2BHFA

3d structure of the reduced form of cota
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
510
structure length
504
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords SPORE COAT PROTEIN A
publication title Dioxygen Reduction by Multi-Copper Oxidases; a Structural Perspective.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 146
structure length 504
sequence length 510
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bhfA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bhfA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bhfA02
5D4HA 3KW8A 1CURA 5I5IA 1PCSA 3NSDA 3PAUA 4YSPA 2JXMA 3ASOB 4N8UA 5I26A 3OQRA 4PAZA 2CBPA 4DPCX 2J57A 1NTDA 3WKPA 4F7KA 4YSSA 3AG4B 2EIKB 1OE1A 1ILSA 2VN3A 1PZCA 4ZK8A 1OF0A 3HEIB 4M3HA 1OCZB 2XVBA 3OMAB 4YL4A 2YAFA 1ILUA 2IDTA 4G70B 1NIDA 5I6KA 8PAZA 2XXFA 3WKQA 4AZUA 2HXAA 4GXFA 2P80D 2BZ7A 3FT0A 3QJRB 3FPYA 1ZDQA 4BWWA 2DWSA 4BXVA 4DPAX 2J56A 1AZBA 2IH9A 1RZQA 3AG1B 4GYBA 1SF5A 2UX7A 1AANA 3T9WA 3FU7A 4NERA 3QJUB 2CAKA 3CVCA 3UABA 1NPJA 3IBOA 1GY1A 2YAMA 1XB6A 4AKQA 4A2GA 3X1GA 3NYKA 2HLEB 3FYEB 2QDVA 5B1AB 2VM4A 3DIVA 1OV8A 1KCWA 2XYBA 3FSVA 3UAEA 2BW4A 2J55A 2PP7A 2UXFA 2BW5A 2XV2A 2IDQA 3FSZA 2UXTA 3JT2A 5B1JC 4G7SB 1A65A 1FWXA 1WA2X 4KOCA 2HX7A 4Q8BA 2LLNA 3TU6A 4E9QA 4F2FA 3T6VA 5I28A 1ADWA 4JHUA 3TBCA 3QJVB 1DZ0A 1W6LA 2FWLB 1J9TA 1AG0A 1W6WA 2FT6A 4GP4B 2IDUA 4KO6A 3PLYA 2BHFA 2AANA 1TKWA 1KYAA 4DP2X 2YARA 3AG2B 2PLTA 5F7AA 4HHGA 1AACA 1J5CA 2YXVA 1QNIA 1FA4A 2FQEA 2IDFA 2DWTA 1BXAA 3EHBB 2Y69B 4HAKA 1GR7A 2VSMB 3CG8A 5B7MA 5TK4A 4QKTA 1IUZA 1ET5A 1KV7A 1MZZA 2HRGA 1EZLA 4AKOA 1A4AA 3NT0A 1SJMA 2HX9A 4GP5B 2ZXWB 3FQYA 1AOZA 1M57B 1PNDA 2NRDA 5B7FA 2X88A 4KO5A 3T6XA 1T5KA 3V9EA 1CUOA 4P5SA 1GYCA 3BVDB 2BP0B 4DP5X 1L9PA 2IWFA 3ASNB 1AZCA 1J9SA 2VMJA 4JKNA 1XMEB 1I53A 2XLLA 3MX0B 2GSMB 2YAQA 3FU8A 3N2JA 4A2DA 3PAZA 2XX1A 3SQRA 2XXGA 4GY4A 2AVFA 1V55B 2UXVA 3GXUB 1X9UA 1NDTA 1E5ZA 4CSZA 1GS6X 1PLAA 1IBZA 3CDZB 1V10A 2EINB 3AW5A 3FPXA 2QDWA 2AFNA 9PCYA 2YAEA 2PPCA 4DP6X 1M9WA 4F2EA 2MRYA 1NWPA 3OM3B 1JZHA 2EILB 1TU2A 4N4YB 1EHKB 3D12B 2H3XC 3NSFA 4UANA 4NB7A 3ZX1A 2B08A 1JXFA 1NZRA 5I6PA 2CJ3A 2R7EB 2BP0A 3T71A 1PLBA 1URIA 3QPKA 2N0MA 1JVLA 3CVDA 1MG2C 5AZUA 2DY2A 4ENZA 3AG3B 1TEGA 1YLBB 2ZWNA 3H4HA 3DKHA 4BDVB 1JXGA 3X1NA 1AQ8A 3PAVA 2PP8A 2VW6A 1QHQA 4E9XA 1GS7A 1ZV2A 1AIZA 2PCYA 1AR1B 4YSTA 3CDZA 1GS8A 1ETJA 3WNJA 4WTQA 1AS7A 2FQGA 1PF3A 2VW4A 1A3ZA 2HRHA 3NJJA 6PCYA 3UGEA 3CVBA 1HAUA 1SDDB 1ZDSA 2BP8B 2PPDA 2HZHA 4TXVB 1PAZA 4DP9X 1L9SA 1ET8A 1XB8A 2PPAA 2Q5BA 2JFCA 2R7EA 3QJTB 5D4IA 1NPNA 1AZUA 5FC9A 4MFHA 2BZCA 1MDAA 3QJQB 1WA1X 2I7SA 3G5WA 3TASA 4RH4A 1L9OA 2H5UA 2I85A 3UADA 1RKRA 2PCFA 2XV0A 2YAHA 4FA7B 1FFTB 3V9CA 4EF3A 4BDVA 3WNIA 1NIAA 1IBYA 1WA0X 2DV6A 1E65A 1KDJA 3UAAA 4E9TA 3RYMA 4CSPA 1SHXA 3IE9A 1SNRA 3NJFA 1OOWA 3PPSA 4BK5C 2FJSA 7PAZA 4E9SA 5B3SB 3X1EA 3PCYA 1MZYA 1V54B 3QQXA 4A68A 1AAJA 4JHVA 2WO2B 4YSOA 1SDDA 2OV0A 2BP8A 1GW0A 3NSYA 4K9JA 1IKOP 2ZOOA 2BWIA 1KBVA 4HIPA 4G7RB 2WO3B 1ASQA 1E5YA 1N68A 3TA4D 1SFHA 4DP4X 2W88A 1E67A 3EF4A 3OD3A 2TSBA 3S3DB 4FAAB 1SFDA 4HHWA 4A2HA 1VLXA 4A66A 1PMYA 5F7BA 4AX3A 1SHWA 2I7OA 2EIMB 2QT6A 3SBRA 3U25A 3BQVA 4NAJA 4KNSA 1AG6A 5B7EA 2YAOA 4HCFA 5B1JA 2GC7C 1A4BA 2XWZA 2CALA 1BXUA 2VW7A 3SBQA 2XV3A 1OCOB 1PNCA 1PY0A 3ERXA 1OE3A 2IWEA 5TK2A 1ASOA 3HB3B 4GP8B 3AZUA 4UAHA 2XX0A 3EH3B 1AZNA 3IN0A 3NP3A 2FNWA 3T6WA 2B3IA 1L9RA 3FYIB 5A7EA 3NJHA 3NJLA 4DP1X 3NP4A 5ANHA 3FSWA 2QPEB 1JOIA 4YSEA 4KNTA 2FQDA 4M4RB 3NJNA 3WIAA 2VM3A 2JKWA 3OMNB 1ID2A 4HCIA 3C75A 4P5RA 3SBPA 5I6LA 1JXDA 2BO0A 2GC4C 3ZBMA 2CCWA 4HZ1A 3WG7B 4AKPA 2H47C 3JTBA 3MBWB 2XUWA 2VSKB 4PCYA 2IAAC 4DP7X 1RCYA 4G71B 1IC0A 1PLCA 2CUAA 2PPFA 5D4JA 5PAZA 4Q89A 5I5MA 1F56A 2RACA 4L0PB 3ABGA 1TEFA 2W8CA 1KCBA 1PZBA 2X87A 1NIFA 1NIEA 1RZPA 2Q9OA 1ZPUA 2E86A 2IWKA 1N70A 1PZAA 1J9RA 1NWOA 1NICA 4E9WA 1ASPA 2AZAA 4DP8X 2FT7A 1AS8A 3EH5B 3PXLA 1JZGA 3S8GB 3NJGA 4UF7C 2GBAA 4A2EA 1BXVA 3OMIB 1J5DA 1B3IA 3S3CB 3X1FA 2HX8A 1CC3A 2PPEA 4AI7A 1NINA 1KBWA 4DPBX 3QJSB 4W1TA 2IDSA 1NIBA 1M56B 4G72B 3ABMB 2YQBA 2YXWA 3FU9A 4BWUA 3S3BB 4KO7A 1ZIAA 4YSUA 2GB2A 2J5WA 3T6ZA 4YSAA 5EHFA 1AS6A 1WS8A 3NJMA 1E30A 3DTUB 1JVOA 3S8FB 1SF3A 4YSDA 3CZUB 4YSQA 3H4FA 1GY2A 2QPDB 1OE2A 5AFAA 4E9YA 1KGYE 6PAZA 1J9QA 4KNUA 3ABKB 4YSCA 1ZIBA 1BYOA 1JZJA 4WKXA 2GIMA 3NSCA 1GSKA 3ABLB 5LDUA 3GYRA 4YVUA 2UX6A 1X9RA 1A4CA 3AY2A 4W9ZA 3N55A 2GHZA 1JERA 1W8EA 3GDCA 1KDIA 4KOBA 2WSDA 4KO9A 3EH4B 2AZUA 2GI0A 5B1KA 2MTAA 1A8ZA 1OCRB 2BWDA 1BAWA 4QLWA 1JZFA 5I6OA 3L45A 3UACA 3IN2A 4X4KA 3X2QB 2Y1AA 3FQ1A 1AZRA 1UATA 5E9NA 2EIJB 4A67A 2OJ1A 1BQRA 5AKRA 1HAWA 2UXGA 1L9TA 3FS9A 5B1BB 3KW7A 4HCGA 3FSAA 5I5JA 1QLEB 2ZONA 2XU9A 1OCCB 1R1CA 1BYPA 3ZIYA 2TSAA 2FQFA 2P80A 3TBBA 4E9RA 1MG3C 1ET7A 1WAEA 1XB3A 2PP9A 3IEAA 5PCYA 4E9VA 3NJKA 4YSRA 2A3TA 2FTAA 4HALA 1BEXA 4DP0X 2OCCB 4A2FA 5I6MA 4G7QB 5IY5B 1L9QA 1WS7A 1CYWA 1JZIA 3X1BA 1JZEA 1BQKA 2IH8A 4YVNA 4BXSV 2DYSB 5I6NA 3WI9A 3FU7B 3ZDWA 3FQ2A 3NJIA 1BQ5A 2DYRB 2YAPA 2FT8A 1DYZA 1HFUA 3H56A 4BWTA 1CYXA 7PCYA
chains in the Genus database with same CATH superfamily
1HU8A 4O5LH 4R5TA 2JNZA 2UUDK 3AREC 2A9NH 5AOKA 4Q6IA 4P4KA 1CICB 1GYVA 4WW2C 4QGTA 3QEHA 3KBPA 4N8UA 4C56D 1GVIA 2DKMA 2LAGB 3HE7D 4QRFA 5CJXC 2BOCB 3TBVA 3G5VA 5I75B 1O0VA 3X14A 1A0QH 2JIXA 1I1FB 4B50A 4Y8DC 1ILSA 2C1OA 1QHOA 5CJQL 1BIIB 1EFXA 1L0PA 2A4CA 3OPZL 3QP3A 3NCCB 2AJVL 4HSCX 1JK8B 2OZ4L 3DMMD 1II4E 1IGIL 3KZ8A 2ADFH 4JDVB 1INQB 4JRXA 1KCKA 3QUZB 4NSKB 4XP4L 3QUXD 5BS0D 2EVHA 1CU4L 2APWA 5CBEB 3LEXB 1X5XA 3L4WA 4PREB 5F1OB 5D7JD 3MBEA 1JGVH 5DUBB 3PWNA 2UX7A 1QFWL 4PJGA 3U4AA 3QEUA 1YUHA 2DQGL 4EIGB 5F1IA 3E7JA 1GY1A 4UBDD 3OHXA 3S48A 1MWAL 4Y5YA 2B0SL 2EDJA 2VMEA 3V7MA 5F1NB 3ZE0F 4AKQA 1WVZA 3C87A 3OX8A 5C6TL 4AW4A 1A6WL 3B2VH 3GMRA 3QNZB 5HHXH 3FSOA 3NCYS 4GW5B 1VFBB 4N26A 3CMOL 3R4RA 5E4EC 3GMQB 3HUJB 3I6KB 1WBZA 2WGXA 3S5LA 1LP9E 4OFYA 5B3JE 1D5ZA 3ORJA 5FO8A 4LCIL 4QI3A 5C0RH 2BMKA 4R2GC 5AKTA 3BEVA 1I1YA 1KJMB 3VXSA 5AKVA 3WOVA 2BH0A 3QJHB 3D0LA 5IQ7L 3SDYH 4HDIA 1RZIB 1Y07A 3CIQA 4QRQB 3KWVA 2AQ2A 5D5MB 3QFDB 5GGTA 3GRGA 4BQ6A 4MSWA 5EZPA 1FLRH 3QDAA 3B9KB 2B5IB 3RJOA 3RWCB 4OKVB 2FLRT 4ODBD 2NOYA 1ZGLP 4RAUA 5KEZA 1TTUA 2LABA 4KHTH 1NGWA 3ULVC 5BV7H 4HHGA 2XTLA 4B9KC 3S8WA 2E7LC 4HAGA 1JNHA 4NZUL 3MXVL 2ICEB 5AZEH 2OXGA 3HAEG 3EHBB 3J27A 1XGTB 1TYJA 3W0WA 1QVOB 3ARBA 4KKLC 5E6YA 2F0CA 5I71B 3P3YA 4LPVA 5DJ8B 2GIXA 3MRQA 2IAMC 1D7DA 2OW7A 3QO1A 1EZLA 4ZUUB 3U2SA 4AL8C 3NT0A 1QBAA 1U2YA 1HHHB 3BO8A 5I1JL 3FQYA 3MLYH 4NQEB 1SHMA 3GSUB 2NRDA 4Y4HC 2ID5A 3UZQB 3AACA 2QZQA 1G7LA 3RNQB 4EQ3A 3HB3C 2IMNA 1WCQA 3E2HB 1ZLUH 1GYCA 4EKJA 4I88A 2B4CH 3OG6B 3PDDA 5FGCE 1JGEB 4O9HH 2W81C 1CFMA 2NUTB 4WI0B 3STLB 5HI3D 3FO2A 1DSFL 3I6GB 2QGDA 3VXQB 5B21A 3U9UB 4PJBE 4D8PA 1I53A 2B8OT 3MLWL 3PRZA 2YD2A 3QULA 4LMQI 4FTVD 3ZTEA 3MFGB 3RWGB 1SJVA 5FA3B 2NW2B 1BBJA 3DTXB 3I6LD 4PGJA 3S98A 4YDJB 4DKEL 4QNPE 4E0RA 2Y2TA 5T3XD 5DUJA 4NQDA 3EOTH 1RUQH 4X98A 2V9TA 4L3EA 4PJEA 1SJXA 5FGBC 3I6SA 2PYFA 2QKIC 4L1TA 3GO1L 4N2NA 2EILB 1S7TB 4N4YB 4N24A 3AUWB 1B2YA 3T3MF 1XSIA 3MV8B 4GUOA 4BZ2L 4N1HB 4JFYB 3RNKA 5FDYA 5KVFL 3E8VA 2ZWYA 3T71A 1FL6A 5CHNA 4HFWB 1I9EA 1XBRA 1I8LA 3OV6A 4B9GA 3CZLA 5JHAA 1UHVA 2WB7A 3HG4A 1RZ8B 4N22A 4Q74A 1I7TB 3AC0A 1D6VH 4WEUD 2R2EA 4PVMA 5FFOA 5KBPA 2Q7NA 5FCUL 3L4ZA 4AXWA 2BS9A 4XMVA 1FO0A 2A9DA 2QADD 3TYGL 3HJ0A 1AQ8A 1BECA 2N56A 3KYKL 5F70A 1N7MH 5EOQH 3O9WC 2UY7B 3FU3A 1AIZA 4RMVA 2CO6A 4C4KT 2X28A 3T3PF 5KJRH 2HSIA 5ETUA 2AEIT 2VZVA 1A3ZA 1R3KB 2EZ0D 2HRHA 4N85A 1OANA 1ORSB 1UA3A 4XCFH 5ANMA 5C8JB 4TVPD 4MD4A 5TF1H 15C8L 1J8SA 1UUNA 4GQ9H 4PLKC 5FO9A 3LHAA 1Q0YH 5DHVB 3WE6A 1LL1A 2XN9E 2YMXH 1PAZA 1RZGB 3MJ9H 4XRCB 5D1QB 4PGZA 5AUMB 3UJJH 1RZJL 3MLZL 3BH9B 3QG7L 4RZKA 4M8VA 4MA7H 1T1YB 2JFCA 3QJTB 5D4IA 4PJAA 2CJSA 3RUGA 4F5CA 1UZ8B 3JZYA 1T1XA 1T3FA 1T66C 4HULB 5E6SB 5I8OL 2WVSA 1D5MA 4PJIB 3ULAB 1WZ1L 4U1GB 3WTSA 4JRFA 4JFOB 4RCAA 1SMDA 2YAHA 3O8XD 1MHEA 3E3QE 2AXFA 3MROB 1KPUA 5HGAA 3FQNB 4BDVA 2LVCA 2HUEA 2MH4A 1P84K 1IL1B 3PFQA 4FZ8H 3DUUB 3MRFB 1DBKH 4DK5A 3QZWG 4B9CA 1QW8A 1E4KC 1DVQA 2QGEA 4MBOA 3FUHA 1PDKB 2EAEA 1YAIA 3WN5B 3DX3A 4Q6KA 2FJUB 1YNTF 3TLRA 4HJGB 5E00B 1R47A 2WCSA 5IEHA 4A2LA 3MVSA 1L0XA 2I26N 4NKIH 2IFGA 2OV0A 5D7IB 5IVXB 4PJ5E 2B9BA 4K9JA 3DARA 5F0MB 5IMKB 1OHZA 4S1RH 2UWEF 4HJ1A 4N8VA 4KUCF 4KAQH 1A6ZA 4FQ2L 1BVNP 3V6OA 1QKZL 1E50A 5JIQA 4I2XE 3OD3A 3DDFA 5EA0L 4LP4A 4K5PA 2O30A 2YRZA 3VFSA 5E56A 5C0GB 2PUQT 2D31B 4DGVH 2RQ8A 3QXDB 3S35L 4A66A 4Z5RB 3SDAD 1NBZB 4M1GL 1P53A 2JMRA 1NBVH 3QEQD 3G5ZA 4JKPL 5DCCA 1J86A 1NUGA 3MRCB 4XCCH 4XPTH 3F7VB 5DJDA 5EUKB 2Z3FA 4LOFA 4D0BB 5ENWB 3QFJD 4HCRH 4IOFD 5E9DA 4X9YA 2CALA 2YEZB 1GZHC 4MLIA 3KDMA 1I3RA 4K73A 3GMPA 4ZFQA 2COQA 3EH3B 5DMKA 5I17A 3CFMA 4M6MH 3STBA 1E4WL 2Z8SA 2AEOA 1CICC 1X5YA 2EVIA 1RI8A 1Y7VA 3B9DA 2OMWA 1L9RA 2PO6A 1YZZA 4WFED 5D7LA 4FG0A 4AUYA 1FG2A 4YDKH 5I75C 35C8L 3GGWB 2BOBA 2JLPA 4K94C 2DBLL 1JVKA 4HV8A 3V4UH 4HS6A 1I3UA 4JQVC 5HHMD 3H85A 2BHUA 2VM3A 3QHFL 4F37K 1XXDC 4ZMAT 3U6XS 4X5LA 1BZOA 4BA0A 1PQZA 4E5XB 3QUZC 2C4XA 5FECA 2XUWA 4P4RB 1C5DA 2B77A 4M43H 3WIHA 4F7TA 1J8HD 4DPRA 5DVPA 1IKFL 1Q9OB 2KI6A 2ZWLT 5FFGA 2WBJA 2AQ3A 4N2AA 3KEDA 3CPLB 3PUUA 2P8LA 4TVPH 5DJ0A 5FDWB 2W8CA 4FFWC 3QIWB 3VI4B 5ICZA 3EJRA 4PJ7B 3VNYA 4J6RL 4UOJA 1J9RA 4PWEA 2X4UA 4DP8X 4BFIB 3VXNA 3TV3H 1UZ6E 5F7HA 4GXUN 5TE6H 4G1EB 2JB6A 3QG6B 4V1DB 5IV2A 1VFUA 4R97C 1CR9H 2A6JB 2X4SB 3DOSB 4LDLB 4NWTH 1NINA 4M4RA 4JQXA 2DOCA 1BQHA 3IKKA 4XO3A 2GBVA 5LGYA 1T6VN 2IDSA 1U8IA 1LDPH 3V8OA 4WWPA 4O02H 1CZ8H 4UT6H 3P2DA 4WU7B 5CLWA 1EEYA 5M94B 3RKDC 5E8OA 3IXAB 3QEQA 4QTHB 4M7JL 4AQ1B 4XNMB 5FFLA 5BOJA 1E4HA 2B5IC 4Y9GA 3K46A 3L7EA 4IOIA 3T6ZA 3QFJA 4F37F 4IK7A 2HKHL 32C2B 1J10A 3GSNL 3QDME 3PP4H 4X6CA 2ALAA 3CFJB 1RZFL 3LNDA 4W9IC 4YBHA 4HK3N 2DIAA 3QAZB 4N68A 4W9DC 2JKTM 1K6QL 1LDSA 2ICEC 4JHZA 2XN1A 5IGXH 4IDLA 1P5UB 4YSCA 2PTUA 1A6UL 3ZQXA 5F89A 3ZRFC 5I71C 3T0EA 3L4TA 4LLWA 5JNYA 2UX6A 4J3BA 4ZPVA 2ZG1A 3U7WL 3HG5A 2FVNA 5T8IA 3K4AA 4P5TD 1P4IL 3HS9A 1G7JA 4NKQB 2GI0A 2G3ZA 5B1KA 5ABAA 4OLXH 5T1DH 4WHYH 3V6ZB 5BO0D 5I6OA 3T09A 3L3DA 4MZIA 5TGBA 3E2HC 1UTDA 1I85A 3X3FH 3L3HA 2WKOF 1HHIB 4R7LA 1LO0L 2K6ZA 4PWJA 4JDTL 1X5LA 3NFPA 1JF1A 3HKFA 5CSZB 2DLTA 1UD3A 2HFTA 5JHDA 4LAQH 2AQSA 3PYCA 2UVFA 4MCYB 1EXUB 3ZY7A 3D25B 4J8RA 2GSIB 2D03L 2HFGH 4I18A 4XP1L 4GRWE 3ESPA 4Q14A 3V6FB 4LPWA 3L3JB 4HIHA 3ZIYA 2CRMA 1NUFA 3KJ4B 1M3IA 4E9RA 1J9CT 1XEUA 4E9VA 1U8QA 2ZD0A 4JZNA 4YSRA 1Z5LB 2G2PA 4S0SD 4WWNA 4U49A 3LNFA 2I9TB 3MCKA 5ALBH 2VDPL 5AW3B 1P9MC 2DIJA 1WS7A 3ETTA 4A7QA 3GSVA 2F8VA 1FGVL 1JZEA 5E2JA 3E6FA 3WEXB 4ESKA 3U4EB 1H3WM 2Y6TE 4CVZA 2AP2A 1BF2A 1JUFB 3QIBB 4LLQB 2AGJH 2ADGA 4GKNA 4NUGL 2IDCA 3TA3A 3FU7B 1A7NL 5E8DH 4GEJA 1KBKA 3MREB 4MGXA 3TH2T 2FT8A 5ID0B 3FFOA 2BIOA 4Z7UE 3RX5A 4HOWA 4LSTL 2DQJL 4WW1B 4L37A 4W9JC 1PCSA 5IOKA 5MEND 3VB9A 1C5BL 2AXWA 3ARFC 3LRSA 4YSPA 3S3PA 4HXBH 4N0FB 3AROA 2YPLD 1EHLL 4LBEB 5CJ5A 2VN4A 3OAYH 4LNRA 2EECA 3GBML 4P9ML 5C7XH 2VTFA 3ILQC 3CLWA 3NGBB 1NMCB 3MJ7B 4K7PX 3EYVA 1G9HA 2VLRE 4JY5H 4F8PA 5F6IB 1IVLA 2C7FA 4ONGL 1BVLB 4JHAL 1OTUC 1YJDH 4AYFA 5C3IA 4DERA 5KYNA 1BOYA 3Q2VA 3S36H 3WKQA 4QCIB 1B0WA 1B0GA 3IJEB 4HIEA 2X6MA 4OFDA 2PXYB 2E4TA 2X4TA 4LRNH 3RILA 3QZOA 3R0NA 4IMLA 1T0PB 3CMGA 3H55A 5F3HB 5KS9A 1FZOB 5D1QC 1QNZL 2VLJD 3QW9A 2JJWA 5MP6H 1M7IB 5I8CB 3LB6D 2V5TA 2WXIA 2A1WL 2E9IA 3JV0A 2XQBH 3UG5A 1VPOH 1F2XK 1PJ9A 2Z35B 1PSKL 4A2GA 1V3MA 2XFGB 3O3DB 1HVXA 3X1GA 4U1GC 3VDAA 3KXFE 4YEFA 2V2TB 5EEWA 3L3GA 3CVHL 5F0PB 5B1AB 1ZT1A 3CGTA 1XIWD 2DBJA 4XC1H 5DVOA 2NLJB 3WUWA 4P2CG 5F7NC 2BINA 3O45A 4QT5A 3Q05A 2W07A 3G5YB 4L4TA 3MQIA 3WN5C 1FWXA 4KC3B 4OVUA 1KV3A 5IJBC 5IHLB 1MJJB 5JW4M 4ZRGA 3QJVB 4K3HA 3GHBL 3RPIA 2DD8L 2QR0B 2IXQA 1UM4H 3EAKA 3LKRB 3B34A 2BSED 4UOW0 2DQTH 5F3FA 4TULH 4NC0B 4JRYE 2W1NA 4H26B 3ZL4H 3GXNA 2AANA 2F18A 1PW3A 3MNMA 2YQ2A 1MNNA 1QNIA 1KIPB 2LHAA 1MY7A 2K3HA 4I48A 5TQ0L 4JM4H 1JD9A 1O75A 2D3VA 4MAYD 2XRAH 5DJAA 5I0DA 2W38A 3PREA 2C4FU 4YHKH 2ARJB 1AVAA 1BFVH 3P30H 3KR3L 5CR8A 3ABZA 2OK0H 2X4QB 4H0LC 3SGKA 3ZKMC 2DH2A 4N2FA 4A38A 1T03L 4AKOA 1A4AA 3FQWB 4MB1A 1S5IH 4AG4H 1TU2B 3P9LB 1QFHA 1MLBB 4OU3A 3WEOA 5JPNA 4O2FB 2ZOWA 1MRCH 3M6DA 5SWZB 5D6DC 1OM3H 3EGDA 4J12A 3NCEB 3U1PA 3WAJA 3IFNH 4HIXH 4ZBJA 4MQXC 5K93A 4B95C 4PV8B 3E1ZA 4OCWL 1DE4B 4LCYA 4UV4H 2L3BA 2XLLA 3VRLF 3U4KA 1U41A 4KH9A 3SQRA 4JHWH 3MKGA 3BE1H 2HT4C 1GH7A 4M29A 3C8KA 4R0LA 3MLTA 5DDHA 4DUWA 4N86A 3H2QA 2O5XL 2AEQH 3OC8A 5D1ZD 1PLAA 3V4VL 5L7XL 4TNWK 3FQTA 5GRWA 4MJ6B 1G4MA 2Y5EA 3WJJC 4MCZB 4BV1A 5ITBH 2PWFA 2WYHA 4DP6X 1PIGA 4EZJA 3O2DH 4YHNA 4M3KB 3PHOB 5FGCB 3W37A 3MNVB 3LV3A 1U3JA 4WJ5B 1FP5A 5HVFB 1T22A 2JF1A 3FZUD 1CFNB 5HI5D 1YHPA 3QIWC 1JGLH 4PJBB 3KGSA 1BCIA 1JXFA 3UTQA 3NFSL 1MFCL 5EBGA 5DD5H 2OYPA 4RA3A 4P3CL 5BV7B 3QPKA 5I1EL 2JKRM 5CS7A 2GUYA 3DRTB 1JVLA 1NLBL 4HQQL 2R2BA 3KYOA 3HC4L 4G8GA 3W82A 5KYWA 2HA1A 3AXHA 3VXPA 1GGUA 4I0PD 1TJGH 2FO4B 4NIYE 1HN1A 4PY8I 2ZOLA 3NPSB 4Y2OA 3R7RA 1I7UA 4NLHA 4U6TA 4PLJC 4IJTA 3MRDA 1U3HB 1A7OH 4F57L 2ZSWB 3AM8A 4NNPL 2H1LM 4M5TA 3EOAB 1U21A 3MLXL 2FWOB 4JUSA 1KGJA 1RSFA 2ICES 3P40A 4Y19D 6FABH 3LXCA 2XKUA 2CJUL 1YEJL 5D6CA 4K8RD 2ZUYA 1GXEA 3WGUB 4DN4L 2EXYC 1UXLA 4TNWF 4HS3A 5LAXA 5CD3B 2DF3A 3HN5A 3QAZC 4TUOB 4BFRA 3HAEH 1XGUA 3STZA 4Y9CA 5IKCA 1P5UC 3BPOB 2BOLA 5I1LB 2DKUA 4NPJA 5I16B 5KTEL 3O3BA 3FU6A 1XCQA 3G5WA 4XP5H 1K8IB 1L9OA 2VR4A 5DJZA 1E6JL 5J4MA 3P4LA 2ICWA 3HIZA 2JKIS 2CHDA 3UTSD 1IAIH 2IGFH 3GEFA 3VM5A 1KDJA 4O2EA 3W2DL 3VWKB 2W91A 4E9TA 3IE9A 4XPAL 3K8KA 3QZPA 4PUBH 3PPSA 2E9JA 1NBYA 1VGEL 2FJSA 3ZZLA 3CHRA 3LHPL 3VFRA 2C34A 1UA7A 5CUSL 1DN0A 2XN9B 4YGVB 3HG1A 5F7EL 3QQXA 3IJ9A 1LE5A 1AAJA 3CFBB 4NZJA 1KCUH 3LKQB 1SDDA 4XAWH 2O61B 5AVSB 2BWIA 5AW7B 4BFEA 5E08H 4A2MA 2G3XA 5GGRY 2ZUTA 4Z7WF 43CAB 3K3QA 4OZHF 4XPGH 2FK9A 1CL7I 1BP3B 2R29L 3VX0A 2ATAA 3CQQA 3FTYA 4ICWA 1CL7L 2V17H 2NY3B 3KJ4C 1YY8B 3Q01A 1PZ3A 4TQEH 1ZV5A 4RESB 4QXGL 3S3DB 2K6YA 2E4FA 1YUKB 3DVNB 4DVRL 4JFZH 1HEZA 4WI5A 4EIBA 1VEPA 3P2TA 3UROR 2GK2A 4AIZA 2G2RA 4LLUA 4NNXB 1XF4A 3HLAB 4GQRA 3U25A 3QIBC 5T1LA 4HD5A 4PJ5B 1A7QL 1J0HA 2ADJB 5LQBH 3N42B 4U6HA 5I1KL 3WIIH 1YMMA 2EE2A 4QHKI 4RZCA 1XVSA 2CPUA 3FK3A 3DO7A 1BAGA 1NBQA 4ZNEE 2DLFH 4XVUD 1AZNA 4PBVC 3KPLB 4L29B 2FJGA 5EIIB 4JG0L 3NRFA 4IIZA 1TT6A 2H1PL 1CCZA 3NP3A 4I2XB 4JFED 5H94A 3SKOA 4XNYH 5HPMA 1CIUA 2M2DA 4GINA 4APQD 1W0WA 4ZMVA 3QZNA 4YBLB 1FNGA 2EIBA 1FJ1B 1BAFL 1NMCC 3NGBC 4OCSL 5CKAA 5KSAA 1R3LA 2P8PB 2NZ9C 4HWBH 4YHPB 5F6IC 1K4DB 2EKSA 3TN0A 3WIAA 3R06B 5SWSA 4BE6A 4P5RA 4IDJH 3SBPA 4AL8L 5EC1B 2WXOA 1R3HB 2WC7A 2ZSVA 4OM0L 5EDXA 3X13A 4BKLB 1S78D 3BGMA 1KCVH 2PXYC 2NSQA 4AENA 2VSKB 4QOKD 1S9KC 5AB0A 1H3PL 1PCXA 4G71B 2XZQH 4PY7B 2IFFH 2Z31A 4LSQH 3WHE1 7TAAA 4L8DB 3VSUA 1OPGH 2VLKA 4ZFGL 2A6DA 3HHSB 5BRPA 1ZA3A 3L9RA 1N70A 1U93A 3LPPA 3KWTA 4RDBA 1XH2A 3AUVA 5I19L 5L8JB 4QHMB 4FYSA 2P5EE 3BVVA 4ZD3H 3T65A 1T7WA 4UF7C 3MNZB 1LO3L 5FF6B 1SUHA 1DVYA 2A74B 5BW7C 1HSAA 3LKPB 4FQXB 1J18A 1RP9A 1W0VA 4MNHB 5I76A 1IM9D 1ZLSH 4CDHA 1N6QL 3DYPA 3HRZA 1RULH 4W1TA 3DURA 1R5IA 2VN7A 1CFQB 4PHXA 5BVPL 4NOFA 1X3DA 2VDLB 4G72B 5DHEA 4L5FL 4YX2L 4Q52A 1HHGA 3EBHA 2A73B 1JRHI 4DGYL 2MSPA 5CINH 4JDEA 2H0PA 5EHFA 3T8XA 1FIGH 3IAPA 3GSQB 4QRBA 3FB7B 3DTUB 5ILTL 4KFZC 4F20A 1RJLB 1H5BA 3H6AA 3ZQ9A 2VQTA 4R8WH 1N0XH 1KFAL 2BC4A 5ESVB 1GY2A 4MASA 3WLWC 1CQKA 4Z76B 1JWUB 12E8H 1Q9LB 1MFAL 4EI5B 5DS2A 3VA2C 3K6SA 4APQA 1A6VH 5C2BH 1S6NA 1KLFB 2Y5TA 4ELDA 1G9NH 1DQQA 1X9RA 4UZGA 4W9ZA 5EULV 1W8EA 4L4VE 5ACMA 4Q97A 2AZUA 1UOWA 5HDLA 2QFRA 3EJYD 3L4YA 4XI5C 1QOKA 2D3LA 1K8DB 1HT6A 4AUJA 3BT2H 3ECBA 3O6FA 2RFXA 4OLZL 4B53A 4HHAB 4BFJA 2F7PA 3QDMB 4KZEL 2NPLX 4AQAB 4DF9A 3FQ1A 1UATA 4WWKA 4BM7A 1JPTL 3N04A 4NZTL 1EAOA 3HC0B 3L4VA 1KTLB 4JG1H 3D85D 4Y9BA 3ZHNA 5GPRA 4IRZL 3TZVD 2V2WB 5L0QB 2ITFA 2HH0L 2CHNA 1CD8A 3DHJA 4Z78A 1LWHA 3RGVD 2XTJE 1ZWIB 3WGVB 5FK9A 2VC2B 4CC4A 1WLHA 2CDEB 2XPGA 4YXKH 3GHPA 4XX1G 1IJNA 3NJKA 3QJFA 4LP8A 1CDYA 2OCCB 1ACYH 5C1MB 3EYQC 3D34A 4O02B 1U3ZA 2LAAA 4Z7NF 4PRAB 1HHKB 5C07B 3VRJB 3TIDA 1X5HA 3NCJH 2CLVA 2DYSB 4Z8FH 3VXMA 4BZ1L 2DM4A 4G6JH 2WXMA 2QSQA 4P2QB 2GJZA 5H37A 1B0RA 3SYPA 1NANH 4P23A 5BV7C 4GRWB 4WHDA 2F74A 1QBLH 4HPYH 5FGSA 4K7PY 5DRXB 3NSDA 5EZJB 4FLHA 4R4ND 4Q9QH 1OP9A 5E2VL 3TH3T 3MA7B 3V4VA 1HWHB 2OTUB 1U8NB 3GZPA 4FCHA 3NPSC 1SXZA 2A9ML 4WFFE 4L0ZA 4WDIA 1K4CA 2BRRH 5IB4A 4XBPB 1GOFA 1MUJA 3FFCA 2G0KA 1UJ3A 2JJTC 5ITFA 1IIIA 5D1XD 1U3HC 3LQZA 3D0AA 1NAMH 1OCZB 2ZXDA 5FHBH 2NDFA 1LO4L 3NIDB 4ISVA 2HXAA 4HOXA 1B90A 4IK6A 2MTPA 2VERA 3TM6A 5I9QB 1FFOA 2IO5A 4Z7UB 3OWRA 3FT4B 5F9WB 2QSCL 1WGOA 2Z1KA 4PSRA 2UYLB 2VIRB 1AHWB 2ATKA 4NQVB 4KJQD 5FV1L 3SGEH 4AQ8C 2G9HA 1TKWB 5IW6B 3HZMB 3BPOC 4TPRL 1GIGL 2O5ZH 2PR9A 4OT1H 4QHUB 3HPJA 3RTLA 2R4RH 3EDJA 2I5YL 3IYLW 3VGGA 1TYEB 1M7XA 1KWGA 2VOTA 3LRKA 4H13C 1DTUA 1MIMH 2GITA 2NY5L 5EF3A 2IQ9H 2ZUVA 5CKGA 1KGCD 3T6QC 5BO1L 2JKSA 4WAFA 3RTQA 1E42A 1N18A 3DIVA 4L1DA 1A9EB 3I3EA 5HYQB 1LO5A 3CX5J 3VWKC 3GS7A 4AGMA 2ISDA 1VFAA 2XV2A 3O4OB 4WIQA 4PVBA 2A83B 3FSZA 3ILDA 3N44B 3ZHFA 1GZPA 4POUB 5IHUL 2KKQA 1A65A 1WA2X 4JRWA 1PZ2A 3UP6A 5GISH 4K7FA 1XH3B 1A14L 4TTGA 2KHAA 3LPOA 3OGOE 1ADWA 2GVYA 3Q13A 3RVXD 4ZQTA 1GCFA 4XAKD 3FO0L 1YEEH 4JEGB 1MN4A 2WZ5A 3BVNB 1JL8A 3GXDA 3ZZ1A 3FUDA 4XBGB 3KXFB 2KQNA 2UZPA 3FRPB 1J12A 3WUZA 1HDMA 3E3QC 1ZANL 2BSCA 3LY6A 4UMSA 1CLYL 3EZJB 2VERN 2NY3C 3WLBA 1S7QB 1GSMA 4XZ4A 4FC3E 3GUTB 1Q94B 3G08B 2F2HA 3BXNA 1L0QA 3HS0A 3SBWA 3IDGA 2L4OA 3JTTA 1R3IL 1JHKH 1ACCA 3UJTH 1KTDB 5HHQA 3L4XA 2E7BA 1TQUA 4YDIL 3RIFK 3LKNA 5EN2A 1KTRL 5C0FA 3KYMA 4NJ9L 5CR1A 1KC5L 3Q3GB 1F5WA 1SN0A 4GG6F 2IV8A 4KJPD 5C2UB 1M57B 1MHCA 1RHFA 2P3YA 3CSBA 1E3XA 1MAJA 4P5SA 2DMHA 4J3OC 5GRYA 3R0MA 5EOCH 4JDZB 1L9PA 1HIML 3B2XA 4MX7A 4KI5D 2LQRA 4X8GA 2RGSA 5AOZA 1MCWM 2BNQA 2ZF8A 2P7TA 4HGKC 4AW7A 4YBLC 2WINA 4WK2B 4DTGH 1TJIH 1RUMH 2BVEA 1JV5B 3OR7A 1ES0B 1R46A 4GY4A 5H35B 4ODXA 5GJTL 5FHAL 3GXUB 1MJUL 4KQ3L 4KY2A 5L2JA 2CIIB 5C9KA 4M8UA 3CDZB 3KLAB 1WP6A 1JPFB 2MHAB 4UIKH 5DEGA 3ZT6A 2JCCA 5B8CA 3LH9A 4L3CB 4FKEA 5C0AA 2MCAA 1M9WA 2MRYA 3QQ3B 4QHKJ 1S3RA 3Q2CA 2VM9A 1CFTB 3UJIH 4WFHD 4N25A 5C3TA 4MDIA 4UM9D 1LD9A 2B08A 4CADB 3RIFF 4W9KC 4LKXA 4PJHA 5E03A 1U9KA 3WJLA 1NUDA 1XH1A 1DVUA 4NO0D 1LO2L 2NY6D 2V8MA 4B5EA 1YG9A 2CGRH 3B7YA 4ODUA 1E40A 4TL4A 2A74C 4FQXC 4QHPA 5C0IB 4PJFF 5IT2L 1IU1A 1G7MA 3O6ML 3QUMA 1NMBH 4CL7A 3IJSA 4LCWE 2J8UA 3WHE0 2PCYA 3OJDA 3LN5B 3D52A 3SCMD 3WNJA 5LHDA 4CC1A 1UCTA 3EO1B 3OBAA 1CGYA 2OMZB 1TVHA 2Z91B 3ECQA 4PSPA 5MI0B 3WSQL 5KN5A 3U7AA 4DZBA 3NZ8B 1JN6B 3RTQC 1N59A 1UH2A 3LXUX 5IWLC 3VD3A 3PJLA 2AV7A 3AU1B 3L5XH 1MDAA 4G8FB 2WBWB 4E41E 2HFFA 1ZHNB 3FB8A 2I7SA 3T0VA 3O6LL 1FH5L 1TZAA 1PD0A 1WT5A 1T2QH 3MRGB 3HR6A 3KGUA 2NUPB 3MACH 3NCYP 4RISL 4RVBA 1MF2L 2DV6A 2X38A 4OCLC 5L4MA 5GSVA 3MRKB 2E76C 2VISB 4OTXH 2MOQA 4QTFA 5HD8D 1ACZA 4PRPA 3ECWA 4JFDD 4FXKB 1T80A 4H8WC 4CN4A 4R96B 2E8YA 4YPGA 3O6KL 4HIQA 4FEMA 4GIOA 1HI6B 2DYPB 2ITDA 4OGZA 2Z93B 1UT2A 3QWRD 1XO8A 5L0QC 4CGUB 2D0FA 2AS5M 4HIPA 4PJ8B 2O5YH 5JZ7D 3WTWA 5AB1A 3SDCB 3L5WA 4ZI8A 1WO2A 2VXSH 2G4EA 4F8LA 3R1GL 2X2UA 1S9WB 3D2TA 4GSUA 5ALCL 3RBSA 4XNXH 5IQLA 1DVFB 2WXFA 4X7EC 3HZVA 4JW3A 4X6EB 1X6LA 5F2FA 4DWHA 1A3RH 3QS2A 5DD1L 5JO5A 1A6AB 1RZKL 4M61B 5KVGH 1I3GL 4GBXA 1WWBX 4UQIM 4KK6D 2ZG3A 1TTCA 1KGUA 4RAHA 2ATPA 1AD0B 4YBQD 4V33A 4WENB 4OSUL 4YL9A 1IC7H 4RFEB 2NCMA 3C12A 1BXUA 4IRZA 4NZRL 1FDLH 5TK2A 4Q58C 1WFJA 1V8HA 2RB8A 3D4ZA 2GJ6E 4W4OA 1E5AA 2AQRA 3BZ5A 1F3DH 3CH8A 2DI8A 1DANU 1IEBB 2K7QA 3HZ3A 4GAYB 3TWYA 3UTZB 1NGXA 5D72H 5FO7B 3VFPA 2W9EH 3FTZA 3F62A 4FFZH 1T4KB 2EH8L 1WC7B 3BWZA 1IGTB 5FOBB 3DJTA 4YLCA 2BVPA 2BO0A 2GC4C 3MRBA 1UACH 3MI6A 4M5SA 4DFHA 2HT2C 4HZ1A 2PW2B 4I3SL 1KXVC 5I9QC 3SDXA 3BP5B 4FQLH 4BZ1A 1U8HB 2VO5A 1CLZL 2C9RA 4J3UA 5F9WC 2CKBH 4OF6A 3P9WB 5GS0C 5MEOB 1AI1H 4PG9A 4HEPG 2LE9A 1JIBA 4MD0B 1AHWC 4KKAC 2R0ZL 4FQIL 5J1SC 3VD2A 2RACA 2YHGA 4OJEH 5I74B 3DHPA 1BZ9B 3QJOA 1UWEH 2BNRE 1E9QA 4RX4D 3B56A 1NICA 2ITCB 3JV4B 1ZE3C 3D5OF 4NXKA 5IBTH 4YMPA 1H15B 4P0DA 3QORA 4OZGA 4P46A 4AGQA 1AGDB 5TE4L 5INCB 4TLUA 1PGRB 1WAAE 1KB5B 1AZZC 1KEMH 3O4OC 3KBFA 4U6VL 1HE7A 3X3GL 1S7SB 2VXUL 4Z7WE 1MXGA 2J44A 4MZRA 1A2YA 1KCRH 3U7YL 3MRMA 4PWGA 2YQ3A 1R3JB 1E4XH 4WGKA 3P4NB 4RRPM 1N6UA 1KJVB 2YD5A 4KMTL 2BPBA 4QXVA 2EDYA 3C5XA 3NQIA 3S3BB 1IM3B 4RBPH 1SEQL 2G5BB 5K9QI 1FZKA 2FBOJ 3DBXB 3G6JE 4AEEA 2FATL 3QUYD 1WS8A 1G5AA 4U1LB 1OGAA 5AB2A 1XR8B 4K23H 1PZSA 3H7BA 4YSDA 2P5EB 4YSQA 2CR0A 1OVZA 5BJTA 4M7LT 1RIUH 3S3JA 3VI3A 5KUKA 2BLFA 4NSKA 3SD5A 5ADPH 3AS2A 1UXMA 3ABLB 2XETA 3DDGA 4KUZH 1UZGA 3C8DA 5FW7A 5K39B 2X1QA 5AKSA 2XZZA 3VFTA 2NTSP 2DQIL 4PD4K 5FYKE 2B1AL 1CPUA 3EH4B 1EVUA 4HUWA 2B14A 4N2EA 3V4PL 1DR9A 2BWDA 5GS3A 3ZSTA 4FNUA 1JZFA 5GGTH 4JRXE 4NPKA 5DFTA 4CUCA 2Y1AA 2GUOB 4OY9A 2JQZA 5D7SH 3DUSB 4PRHA 3L6FA 4A67A 5HYSA 3GMQA 1BQRA 3UG4A 5CP7B 3W9DA 4PJGE 1XSOA 3K71A 2M8XA 4U7MA 5B1BB 1HCYA 3RVWC 1IC4L 5E8EA 1NL0L 1IFHH 3GEWB 2G3NA 3L08A 1D5IL 5F88A 3UAFA 2YLHA 5DD6B 3MLRL 1RZIA 4L4VB 5BRZD 4PJCA 2X4NB 3U46A 4EIZC 2FGZA 2VXVL 3QFDA 4UT9L 4PRBB 1WAEA 4WFGE 2EH7H 1N6VA 3RRQA 3EYUL 3B9KA 4R7NB 5DUPH 3S6CA 3CNKA 5B39A 3D39D 4FL4B 5ERWB 2EDMA 4KRMB 2NY7H 5MHSE 5KAQG 4JFXA 3VXSE 2IWGA 1EZVX 3D3VD 4YVNA 4YO0B 3VH8B 1ZTXH 3PY9A 1KIRB 5IREA 2FJFB 2ICEA 5JHMA 3ESNA 3MRNA 4D3CL 3W1ZA 3GK8L 4OZ4A 1QVOA 3QO0B 5IW1B 1KTCA 4B0MB 5DJ8A 4KKPA 3EO0B 3UO1L 3ASOB 4X5XB 5H2BA 4UILL 4H0HB 1UUSA 5KYUB 2VZ3A 2Z34A 5IMLA 3FCSB 5CEZH 3IJHB 3PFUA 1FFRA 4N9GA 3D0VB 4XC3H 3W0WE 1NCDL 1NDMA 5AVYB 1Z9SA 4IKKA 2XVBA 4X7TA 1FZMA 4IBLT 1N3NA 3CU7A 1CE1H 4XCEB 5DUMH 1AGEA 2KDGA 1USZA 1XF3A 5MI0C 3FT0A 2ZX7A 1SPDA 4BWWA 1X7TA 5HHVL 1H8NA 1JV2B 5GRUL 3KPQB 3RWDB 4JPVL 1AO7D 1RV6X 4ZFOB 1CXHA 4YEEA 5HHNA 3W5NA 1Q4NX 2ORBH 5KJ4A 1XX9C 3HPLB 4Z0BL 4HGWB 3I85A 2XG5B 4J3WA 4AK2A 4ABQA 5JA9A 3D4CA 4AE1A 5HJ3A 3NIFF 4OVVA 3OJ2C 1MCPL 1J1PL 2Y22A 4RDQG 3ZYIA 2OA9A 4JAMB 1ORQA 1ZVSB 5T5FH 3OSKA 4FXGA 4U1JA 3VQ1C 3IDMB 1JF5A 2K1MA 1WWWX 2HWZL 2J55A 5C0EB 1RZ7L 4H1LB 1I9JH 2BW5A 1I7RA 4PTUB 1WWAX 2IPTL 4QXUL 4XVTL 3VFUA 3AT0A 3SE4A 3THMH 4APXB 5CEZE 1AQHA 4U6YB 1FVCA 3BYTA 4FXKC 3OKDA 1YQVL 4FFTA 4NQDE 4OLUL 4YHML 5CWSA 1MDTA 5K59E 2FIKA 4D0DB 3LNGA 4L3EE 1DQJB 3EZ8A 3B2UD 1XGRB 4PJEE 4TF4A 1YNLL 2F5AH 1DJSA 4OZFG 2PYED 4GAAA 3VXUD 3VG9B 3OSVA 4XNDA 3WNNA 4PJ8C 2F54A 1QWNA 4PH8A 2QGBA 2WQVA 2YARA 1IQWH 2B2XL 3QDGD 5F7AA 2YXVA 3MNWA 3O41A 4LLAA 1RIHH 2GHWB 3PNRB 3AQXA 5ELIA 5DZJA 1DVFC 3ZYJA 3CDCA 5E94B 4R3SB 1ORSA 2VSMB 5F96H 4TSBL 1W91A 3LPGA 3MGOA 3GMNA 4W6YB 4Y1AD 4Y5XB 5AUMA 1RFDH 3BSHA 4W81A 1BQLL 3HI5L 5DWPA 1LQSR 3BQUD 1B9ZA 2F19H 2QPFA 2WWKO 5I0VA 2FZ3B 1O6TA 2X88A 2NXYD 3FL7A 4ZW5A 5ANME 4LKCB 5I18L 1CUOA 5JTWA 4PJIA 2EC9T 1G0XA 4URKA 3BVDB 3N41F 2BP0B 4M93B 5FUZH 1O5PA 3DGCR 1EJOH 5EUOF 3CZNA 2XNAA 2XICA 4NUJA 2ZCLH 1AGBB 2YAQA 1KYOJ 3MRFA 3MU3A 1CDGA 4QXTA 4F33B 1CT8B 3RUGE 4PJAE 4A2DA 3CCHB 4F5CE 9CGTA 3IVKB 4GSDL 3NSJA 3GT6A 3REVA 2DLGA 4P48A 1H9DA 4U1KB 1R5WB 2I60H 4CVXB 1ETA1 5FUCE 3R7QA 4J4PA 2UXVA 3BH8B 3QBTB 4WY7L 4MXVF 1E5ZA 2BSRA 4YHOL 4XGZB 1AGFA 3GPEA 3QWQB 3CHXA 1QYGH 2CZNA 3I6LE 4OB5L 5B4MD 4PU2A 1IGYB 1LWJA 3A21A 1QG3A 2K9UA 3SY0B 3UYPB 5J12B 3LS4L 4XOBA 5CZXC 5EZOL 4WUKL 2Q8AL 1NSNL 4QDGA 1NPUA 1S9XB 1L0YA 4AH2B 1EHKB 3ZRCC 1E9PA 2WMPA 1ZLWK 3V0EA 5IFHL 5I74C 2QQKL 3FOMB 3MRHA 4JS7A 1S7WA 2YRLA 1FBIL 4CW1B 3NA9L 5HGDA 5C0JB 1OSZA 1JK9B 4N20A 3RFZC 4AE0A 4RFOL 4ZS6D 5IQNA 2OAAA 2D31A 5INDB 3IU3B 5DVKA 4XMKL 2ZZUT 4LRIA 1EH9A 3KHOA 2CO7A 1NMAH 2C3HA 2XWXA 3U0PA 5LGJA 1E3FA 3W5MA 4NDMA 1YLBB 5ESQB 1WE5A 3V6OE 4EI6A 3DKHA 3SJVD 3X1NA 3OKMB 2KBGA 1EZSA 2X2JA 4RGND 2V3FA 3L1FA 3K2IA 2JE8A 3FO1B 4ZTPL 1KYFA 1K2DB 1EPFA 1K9TA 2IG2H 3WIHH 2OJEA 1KMGA 4A7TA 1CDCA 1HZHH 2YGPA 4XO4A 3S0PA 2W9LA 5DZAA 5IEKB 4EPSA 2YPVL 3OJVC 1YC7A 5E9DE 5F9OL 4OD2B 2EKJA 4YR6B 1EXGA 4XZUB 4F7EA 5GSRB 2Y3AA 1AKJD 3WEAA 3ZDYE 4NQCD 4IRSD 5E99L 3UC2A 1BZ7B 4TOYH 1CXFA 4ZFZA 5FC9A 5LXGH 1J1XH 5IFAL 5ISZD 4E5XA 3NEEA 2QHLA 3OPZH 5C08D 1CDJA 2AJVH 4M9OA 2OZ4H 4LCWB 4N0CC 5D7LE 5E6IB 3QI9D 4N87A 1B4JL 2I27N 4XP4H 4MA3B 2H0JA 1FYHB 2LTQB 3MOAL 4GIAA 4OGAD 4FA7B 5ABDE 3MV7D 3MRLB 3CC5B 4EVNB 1V7MH 4HWZA 2OTWB 4U1SA 1H3TA 5DYFA 1EO5A 4ZNCD 2FEDC 5F0LB 1QUPA 4KU1A 1DLFH 1NC2B 4IMKC 2DQGH 3A67L 2CGYA 1NM4A 4CSSA 4X5WA 1MWAH 3FF7A 2B0SH 4MTMA 1P2CB 1DSYA 3AQZA 3KEHA 5J3HC 3W57A 1GRWA 1JPEA 4OF7A 3TTSA 2F1EA 4YSOA 4GUPB 4LLYA 2X5PA 2R15A 4I0CC 4JO1L 1IKOP 1XD0A 3CMOH 4QRRA 3FN0L 3TO2A 5I1DB 3C6SA 4M1CD 1JNJA 3TVMB 5DZPA 4LCIH 2H45A 3QXVA 5J06A 1XGZA 4GUQA 3EF4A 2HVBA 4MDJB 3WS3B 4KK9D 3V4PA 4AQ1A 4DOHE 1MJ8H 2D2OA 2YWYA 4X4MA 4FF9A 4R5VA 4FL4C 3SJVA 2HMIC 1X4XA 2ILLA 3IMWA 2ZYRA 2QQNL 1ZHLA 4TKWA 3EJQA 3A23A 1BG9A 1IGJA 4ELMA 1DBMH 2W92A 3CX2A 5T1KA 2AQPA 2A77L 2A9CA 3U4BL 3ARRA 3UDWA 2YLKA 1NGQL 3BP6B 1IBHA 2VQ4A 2BY0A 3QEQE 4NUMA 5F0JB 1ZY9A 2VMDA 3ARWA 1DLHB 1MFDH 1T20B 2VDMB 2HN7A 3MXVH 4GKZA 3MDJA 3QFJE 5HYJD 2HLFC 3KL3A 5HGHB 1IT9H 2ZYIA 4X6CE 1R75A 3BCFA 3ZHKA 4IRSA 1KN2L 1VGKA 1M05B 3NJLA 1A9BA 4ZUTA 3PDGA 1IKNA 1N9PA 3LTVA 2FX8H 4JRLA 4QD2E 3V6ZA 3BN9C 4UQAA 5ISZA 5DHYB 2HJFB 3D7PA 2A0LC 3O2WL 3AB0B 3MYJA 3L7FA 3QI9A 3T0EE 3ZE1F 4JN2B 5AWNL 4HH8A 2ZUWA 4ZUWB 4J39A 1U2CA 3FQUB 2XIDA 4LAJH 5J57B 1NOLA 2H47C 4HUNB 4U1NA 3D25A 3DV6B 5HYEA 1DSFH 3SO5A 1QWHA 3ZSSA 1J0YA 2HT3D 2ESVE 2UVEA 4KQ0A 2OP4L 3WNOA 4F91B 1HKLL 1NEZA 2NX5B 1F02I 2OW6A 3OLGA 4F58L 1VCAA 3DYMA 1MRFH 3VSTA 4MJ2A 5JHDE 3G04A 4JKMA 4YWGH 4D94A 1TZGL 1B4LA 1AIFB 2XFXB 3FAXA 4P57A 3ULUL 5IJKC 1OALA 3WFCL 3A6OA 2BCMA 2DIEA 3JTSB 1BXVA 4GS7B 4NPYA 1T04A 3BC9A 3GO1H 3KPSD 1P1ZA 2D0GA 4LHUA 2HRPL 3NCXA 3QJSB 4YFLI 3MJ8A 1RMFL 3LEYH 4BZ2H 4C57C 2KZBA 3K6OA 1X5ZA 5IUCA 1KB9J 5KVFH 3H3BC 1INDL 2XVLA 5JYLA 4QRUB 5LBSH 2B9AA 3NCWA 5IBLD 3VG9C 3GC3A 2BNRB 2L7QA 1N2RA 4PTTA 4B6ZA 1CBVL 1FFNA 4X0NA 1U8PA 5FCUH 3GXTA 2Y25A 4U7KA 3LMJL 2OSLB 4ZX3A 4KJYA 5HYJA 2CK0H 4ONFL 4W9FC 1RJZA 1FNAA 4ZAKD 3C5ZC 4WSJA 4EUPA 1SYVB 4Z7WB 1FPTL 1XZ0B 2D7TH 3SKMA 5DLML 1EJ8A 3N55A 2GHZA 1FYTD 1PZ5B 1ZHBB 2DJSA 2VDLL 3GDCA 4Y5XC 4JGUA 3D06A 15C8H 3V5DB 5AW5B 3H3PH 1OCRB 5EPMB 1MCSA 3B83A 1YEGL 3G6JB 4LF3A 1AXSA 2CRIA 3BP7A 5MEPA 3MLZH 4LDEB 1CMOA 3QUKA 2WQSA 1YYCA 2EYTB 3CDGB 3KH3A 4U0RB 4ZQKA 4E9LA 2XQYA 1AZRA 4M93C 5KVFE 3TIEB 5KS9E 4EN3B 2OL3L 4HSQA 1FNFA 5I8OH 1JGUL 1UD5A 1WZ1H 4IQHA 5FYJD 3DX7A 1CF1A 4P4KB 4Q6IB 3OZLA 3TT1H 1KTBA 3QEHB 3KW7A 3N1MC 3QRGL 5DWUH 4L1LA 3BHBA 4NRZA 3TBVB 2R59A 3G5VB 3W81A 3X14B 3H0TA 1NCWL 5B38G 2JCCF 2JIXB 1FAIL 4MAZA 3K80A 2X6VA 1RPQA 2C1OB 3RX7A 4HYTB 1EFXB 4IGBA 5AL0A 1CF8L 4CA4A 2AKRA 4KVPA 4OLYH 3CSTA 4DO5A 3FBQA 1C7TA 4A7GA 3E8UH 1INEL 4GAJL 2GTQA 4KVCL 4JRXB 5IY5B 1L9QA 4M1DL 5J12C 3VFNA 2O5NA 2W9DH 4L4TE 1JPST 5L88H 3MBEB 1KJ2A 3PWNB 1KIPA 3ESOA 1SQ2N 3L13A 3QEUB 3KJ6L 1E4JA 3CN4A 3FQ2A 5DVLA 5AYQA 5F1IB 1BQ5A 3OHXB 4TS6A 1QKZH 5HHOD 4Y5YB 1DYZA 4E2OA 2E75C 5E2UL 3L4UA 3OX8B 3GMRB 2H2PD 4B3VA 5MERA 3BKCH 1KN4L 3F12A 3QH3A 2OMYA 2VC2L 2JXMA 1GGTA 4W9LC 5IJDC 3L4CA 5JQIB 4GXUM 3S35H 4NT6A 1RVFL 3MODH 3OQRA 4KXZI 1CYGA 1WBZB 4JO8A 3S5LB 4JKPH 1D5ZB 4ZTEA 4R90H 2BMKB 3IDIB 3BEVB 2WP3O 5SWZA 1I1YB 3HEIB 3VXSB 5DJYA 4PP1D 3F85A 3D0LB 1OW0C 2DQCL 4RFNB 4HDIB 4QRSA 3ZOAA 4IRJA 1KEGL 1AFVH 1IBBA 4MSWB 2WVVA 1E4WH 1OTSD 4IEFA 2OR7A 1GMIA 4KI5F 1HK6A 4BBWA 4RAUB 2BY1A 3VQLA 1NGWB 4D7PA 2VITA 3BDYL 4QIRA 3VFWA 3BWUF 4UQ2A 4Y16C 4PGEA 4A55A 1JNHB 3QHFH 4ETQA 2OR9L 1JGIA 2OXGB 3EH2A 3NJVA 4G7VH 5E6IC 1UGNA 2OJZL 2EDLA 3W0WB 3ARBB 2UZIL 2LTQC 3BDBA 8FABA 5JDJA 5DQDL 4KH2A 2BVUA 3MRQB 5CEXA 3QO1B 4K9EL 3SE3A 3U2SB 3BO8B 1HQRB 2FBRA 3EO9L 4TNFA 5GS0L 3DSFL 3O3AA 4E9QA 1G7LB 4QTIL 3OC5A 4YK4B 1RU9L 4NN7B 1NM9A 1KG0A 5C09D 5CXPA 3WD5L 5K1NA 4J23A 5EU6E 2FT6A 3FO2B 2VGLM 4PG2A 4D8PB 5CN2A 4RBPK 2WOBA 1FNSH 4QAMB 1J5OH 4KJWD 5T3ZL 3TVMC 2NR6D 5FYJH 4BFGA 4GAGL 1BBJB 2BVOA 4GSQA 2Y0SA 1PX3A 1QRND 2Y69B 3BKYH 3ZO0A 4X2UA 4G8GE 3CG8A 2VCOA 1TEYA 4HGMA 4NQDB 1DVXA 4X98B 3H9HA 2J25A 4OJFH 4L3EB 4PJEB 4ZPTA 5EU5A 3ENEA 2PYFB 3HR5A 5DO8A 3NN8A 2HKHH 2WLHA 4TUOA 1OAXL 3GSNH 4XTRC 5HDQH 4ICXA 5AAWC 1RZFH 4JM2D 2JSFA 3A4FA 5I1LA 2F53D 2RHEA 3RNKB 1FL5B 4X50A 1CFVL 4Y9EA 1BBDL 2E6QA 3CHQA 3Q2NA 1FL6B 2ZYSA 1YEDA 5HJBA 4WEBL 4I89A 3ZVVA 1HH9A 3AVEA 1C12B 2R2EB 3TGXA 1MVUA 3QCVH 4MMZA 4TSCL 3FUJA 1ZT4B 5E5MA 3P3TA 1FO0B 3K2MC 3OG4B 5T1MA 3AB0C 1R34A 2PR4L 3ARUA 4X7SL 3SDXF 1OP5H 4OM1H 43C9A 3EDEA 3FUKA 2DM7A 3J2PA 5DVMA 1YCSA 1YN6A 5A43C 4JDTH 4UU9A 5DRWA 43CAA 4MD4B 3QQ9C 5FO9B 2WZPA 5EIQA 3D12B 3WE6B 1HINH 1UWYA 3HW7A 3NSFA 3UTOA 1FFQA 2AJ3A 3HG1E 2KC0A 2WXHA 5L4IA 4XP1H 1R4XA 5AW8B 1PKOA 5GJSL 3RUGB 2QVIA 4PJAB 2VRAA 5GZOA 1T1XB 1T3FB 3ESMA 5HVHB 4HLJA 5DC9B 2VL4A 1D5MB 4LU5L 5E4AA 3CVDA 5BZDA 2IANA 5KSBF 4WTWA 1MHEB 4J3SA 2AXFB 1SVBA 1KPUB 5HGAB 2K7PA 4ZTOL 4BDVB 1FGVH 2WM0A 1PY9A 5JIHA 3FRUA 4J2XA 1D7BA 2LFEA 1OGTA 2YD3A 1G1YA 4GI9A 4NUGH 5AAMC 1Z5HA 4M03A 4LT7A 1LVEA 1PAMA 3B37A 4OZFH 1ETJA 1SY6L 1T1ZA 2FQGA 2H8PA 1MELA 1A1NA 4KBPA 2HPTA 4LSTH 5IEHB 4ZZFA 4LEEA 1E5UI 1UCBL 3UGEA 1N4XH 3W39A 1C5BH 3RE0A 4S1DD 1M2VA 1YMME 2P8PA 1EHLH 4YLQT 1NA8A 2DWDA 4NOBA 4P9MH 4JO2L 3GBMH 5F7FA 4N8VB 1QSFA 1QX1A 2IOIA 2PETA 4WO4A 1A6ZB 4JQIH 4ZUSA 1YA5A 2CUHA 5KANI 3PWPD 3IDXL 2ZKYA 3RB5A 4JHAH 1TR7A 3KPNA 4X7FC 2EVGA 4P2RD 1VJSA 3MLUL 2JQAA 4G8IA 2N0KA 3VFSB 3IF1A 5CLXA 3V9CA 2Q8BL 2CIKA 3CXDL 3G5ZB 5SWSE 5DJDB 3NTCL 2CD0A 3KPTA 4IOSA 3IMTA 3TEZA 1DQML 3QARA 4QWWD 1TLKA 4TSAL 2Z8WC 2WWNA 5E9DB 1OB1B 3RVTC 2XJLA 2VJ8A 2WUCL 3Q43A 3BAEL 4U0RC 3VD5A 4EZMA 5B3SB 2A1WH 4HU8A 4BHUI 3ZDYB 3KDMB 1AQKH 1I3RB 4OF3A 1WEJL 2X12A 4N1EA 3GMPB 1PSKH 1MJ7L 4XP9L 3REWA 4EN3C 4QAWA 3MFFA 4LIQE 2X1XR 4UOQA 4JCLA 5DMKB 1T0NA 5FW6A 1BQSA 4HKXA 4IKLA 4P4KC 3CVHH 3I3BA 4Q6IC 1HHJA 2WTRA 4AYGA 1H6EA 3RU8H 2OMWB 2PO6B 2VLKE 5D7LB 5CCKH 1FG2B 1SBSH 2JB5L 3GJFA 2BOBB 3TA4D 4JVPA 3WMPA 5D7KD 1SLUA 2VUYA 1NLDH 4HV8B 4HS6B 5JW4N 2OTPA 4UQEA 2EUWA 2QV2A 2CQVA 4EDXA 2AK1L 4H5SA 3O8XB 1WIOA 3QS3A 3FTVA 4Y2DA 4ZT1A 1PQZB 4A2HA 1PMYA 4JPKL 5LCVA 5FECB 3DXAA 1GMEA 3CFDA 5I66A 1X5AA 3ARED 1I1RA 2I7OA 1C5DB 1PLGL 1NCUA 3MBEC 1JFQH 4GKSA 2OL3A 5B7EA 4Z76A 2H26B 2WBJB 1NBCA 4BFNA 4EI5A 1ZRUA 2P8LB 5DJ0B 3OHXC 4PB0L 3K7UA 4Y5YC 3ERXA 5ICZB 4FQCL 5EBWA 3V8CA 4N0YH 4BE5A 1TPXB 3CFUA 3G6DH 3D33A 2X4UB 4AQOA 1OEZW 3ZMEA 3O4LA 3VXNB 3DBSA 3IWUA 5FWRA 4YJZL 3KR3H 4I3RL 2JB6B 3MHZA 4DOHB 2EQDA 3VTTA 5IV2B 3RX8A 2GG1A 3NESA 2Q10A 1PG7X 1T03H 3LKOA 3LIZL 3SDDD 4L3FA 1HZKA 4M4RB 1BQHB 1ZS8A 2B16A 3N5AA 4DFIA 1U8IB 3NCMA 4HCIA 4RFNC 4YZFF 5CN1A 3ULSA 5D71L 3FAWA 5C0DA 1KTLA 1EEYB 3BAXA 3TV8A 5E8OB 3QEQB 2CRYA 3SKNA 4FJZA 3JUZA 3EOYG 4BSJA 3EXJA 2MQCA 2A4ZA 3L7EB 4G9DA 4IOIB 3SIKA 3QFJB 5F3BA 1P4BL 3AT8A 3H6JA 4X6CB 1ZWIA 5H37H 1FLTX 1PZBA 2P26A 3VX1A 2P5WD 4R2GD 3WNMA 1XCXA 3KVPA 1KGWA 2O5XH 3V4VH 5L7XH 1IAII 2YN5A 3PXLA 3ARBC 5F89B 3NJGA 3S8GB 3T0EB 4LLWB 1CG9A 5JNYB 3A4DA 1NFDA 4IU3A 4MD5A 4ZPVB 4QO1A 4ZW8A 5C07A 3VRJA 3UTTD 4A2EA 2V7HA 3DA0A 5AG8A 4UT7L 2FUTA 3H3KA 1G7JB 5EEVA 3P2BA 5GS2D 2YA1A 4Y4KA 1MRDL 1MFBH 4BA8A 3ULVD 1NCIA 2I9LA 4ZXBD 1Z5YD 2WQXA 3L3DB 5E6RB 3NFSH 1MFCH 2KMWA 2ZX8A 3MKKA 3JWOC 4MMYA 4YK4C 3GMOA 4NN7C 4ZFFA 5EZJA 3MBXH 1ZSHA 3L3HB 1J0IA 1EJFA 5BZZA 4F8QA 1GAFL 5I1EH 2J5WA 3MA7A 3NFPB 2Y7MA 1JF1B 3BOVA 2OTUA 4KXBA 5HVWA 2FNBA 3GLZA 3VXME 2Q3ZA 1OP3K 5JHDB 3L5HA 1CDUA 4J8RB 2Q1EA 2IAMD 4WNSA 5TDOA 1LEGA 2NYZA 2X9ZA 2R0KL 4I18B 3BEWA 1WUNT 2G75A 5AFAA 4HUMB 3QNXB 2IBZX 4XXCA 3U6RA 4XWOC 5C0CD 4HIHB 4Y4HD 3HNTH 1G4RA 1IFRA 1RHHB 2DWEA 2R39A 4F57H 4NM4H 5CGMA 1U8QB 4JZNB 3HB3D 3MLVH 4AOFA 1Q72L 1C8PA 5KSVA 4LSSH 5DK2A 1JERA 2C3VA 3MCKB 4RAVB 3SDDA 3FFCE 3FUFA 2MTAA 3GINA 1MCOL 1YEJH 2XZAL 3E6FB 4BZYA 3AGVA 4JFSA 5IW6A 4DN4H 4CVZB 2JV6A 5EU7E 4GKNB 2ADGB 1L6ZA 1RPKA 5I1HL 3TA3B 3KLDA 3IB4A 4YPJA 4JJOA 3SHSA 1OWWA 3KYNA 4OV5A 1TFPA 2EIJB 1EHAA 1I8LC 4NI3A 5KTEH 4L37B 4RMBA 3BW9A 3FCTA 3LRSB 1E6JH 1SOXA 2R4SL 2N01B 1G0YR 4AEHH 4BQ9A 3BRDA 3PGDA 2CBMA 2PKDA 3D08A 4MJJA 2LU5A 3QEGL 4M9PA 2VAAA 5JIMA 4ABUA 3W2DH 4FX5A 1LTXA 3EYVB 4N5UA 2FQFA 4KY1L 4AGPA 1I82A 1VGEH 2FDBP 1MG3C 1MQKL 5CUSH 2ZCHL 1QBBA 2KLSA 4AYFB 1TTFA 4EXKA 1JI2A 2YBRA 5F7EH 2A38A 2FEEL 1TZ8A 5GGVL 1KFGA 2Y72A 4PB9L 1B0GB 4HC1L 4PGDA 3VSVA 3IJYA 5GS1A 2X4TB 2Y7NA 5KVEH 5JW3L 3EBAA 4IMLB 5KS9B 4ZXBA 1VFOA 2ZX6A 5DZNA 5B3NA 4PM1A 5K9QG 2WANA 2R29H 1MI5A 3N3EA 4Y2LA 5J6GA 1CL7H 1LXMA 3PWJA 2YKKA 1HH6A 5GGRA 5FUCC 4WUUD 4HJJH 3T0XA 5HVHC 5I5IA 1JHLH 3AXLA 1T7VA 3AS3A 1RERA 4QXGH 4JO4H 5E5RB 3L3GB 1SQMA 4P2OA 2WKGA 3Q3GA 4DVRH 1ZT1B 5HYIA 4X83A 4G7YH 4PLKD 2ARJQ 1E8XA 3WUWB 3FOLA 2VLME 1BIHA 4TRPL 1AP2B 1DL7H 4QT5B 4NN6B 1PFOA 2W07B 1OF2A 4L4TB 4R7DA 4V2BA 4BELD 2PABA 5GS2H 2QEJA 3D87B 4CKVX 4ENEC 1FL3A 1T66D 2BZ7A 5AOLA 1GGIL 4G42A 2DQHL 2IXQB 2H1PH 2YUXA 3MUHL 4BCZA 1AKPA 1AANA 1ESOA 5I8EA 4PR5A 3VXTA 3D51A 4JFUA 4OCSH 1X5IA 3UABA 5JYMA 1EQWA 3V6OC 2YEVB 3VVWA 4KDTC 1MCWW 2M83A 4F7PA 3KPRD 4I48B 1ODAA 3ZMRA 3MOBL 2BNQE 2H6UA 5KVDL 1EV2E 1UA6L 4AL8H 4OM0H 5DJAB 1R5VA 5LB1A 3FYEB 2YPLB 1OARL 4L9DA 4OH2A 1MFVA 2Q0ZX 1SY6A 2F58L 3NUKA 1H3PH 2V37A 4Z3IA 4ZG1A 4JN1L 1I75A 1PPIA 5J5EA 2UXTA 2NY2D 2A2QT 1EZUA 1JNLL 5JPNB 2HX7A 2BVYA 4ZFOL 5LNGA 4QY8A 4ZFGH 2F1BA 2OMTA 5C0AE 4D7BA 3EGDB 4FHJA 3ETBF 1K3IA 3S88L 3WTYA 5ICYA 4NO3A 4O4YL 1W6WA 1V5JA 2WJ5A 2VLJB 3Q06A 4ZS7L 2YO3A 5CZKA 2PO6C 4LCYB 5HHPA 4GI8A 4K5OA 1PIFA 1YNKL 4PJHE 4G5ZL 5TDPA 1MAKA 1G7HA 3PNWB 3RDTA 4Q0XH 4XNBA 2Z7UA 3N1QC 3C8KB 4R0LB 5DDHB 5BVPH 1HXYA 2TAAA 2IPUG 2WN2A 4HAKA 1DQLL 4ZW3A 4YX2H 2OMZA 1XIWB 2XIBA 2YMOA 2EIZA 3B8YA 3FQTB 3TO4A 2I32A 4QKTA 4X7DC 3RY5A 1UM6L 1JRHH 1KV7A 3D2UD 4Z7VF 1CICD 1SM3L 4YHNB 2J8UE 3P1VA 3WO4B 3HN3A 2L7UA 2V6HA 2WBJC 3LV3B 5ILTH 5FS5A 1T22B 1NANI 1JHTA 1UB6A 2JJSA 3Q48A 2L04A 2KS0A 4G8FA 1X7SA 3V9EA 4GJTB 3UTQB 2E9GA 1KBBA 1MFAH 1TPXC 5DHDA 3IJ8A 2VXQL 1J9SA 3E0GA 4I87A 4PI0A 5C0BD 2R2BB 3QISA 1ZLVH 3KLHD 4WHTA 3ZJAA 3PAZA 3KYOB 3MRKA 4G8GB 2XX1A 1YQ2A 2D4DA 5KYWB 5EF2A 3VXPB 4JQXC 2ZOLB 3PUCA 4R96A 4Y2OB 3VD9A 3GTVA 1I7UB 2IH3A 2QSTA 3MRDB 4FFWD 3PQYA 3IGKA 1HI6A 4OLZH 4Z7AA 1JNNL 1AGCA 2DYPA 4XN9A 2NZ1A 3AGWA 5D2NA 4KZEH 2Z93A 4X7CC 3GXFA 3HJEA 1D5XA 4L5FE 3CBRA 1JPTH 5FLUA 2QKSA 4NZTH 4WKZA 3U30B 1ND0A 1T21A 3SGEI 2VABA 2JK5A 4LCCA 3RHWK 1E7VA 4PRPE 3SDCA 5D6CB 2WXQA 2BVTA 4IBTA 5HI4C 4HS3B 1PZUB 1M3JA 5C86A 5LAXB 5J1TC 3QIUA 2X1PA 1XGUB 3STZB 5IKCB 1QSED 3CUPA 1G6RL 3APDA 2GCYB 3CXHK 4G6KH 2FLBT 5GRJL 3O3BB 1RUAH 3LIZA 1ZGLM 1XCQB 1BM7A 2FJHA 1MCBA 3F7RA 2C9SA 4GQZA 3T0EC 5EWIL 5DJZB 3RKDD 3FTWA 3BVUA 3GZOA 4ONHA 3QQNA 2OSWA 2ICWB 2GEQA 5E23A 3R4DA 5JR1H 5JPMA 3RKPA 4MYWB 3CHPA 3FTSA 4NWUH 4Q4IA 1NBYB 4BZ1H 4KKBD 3VFRB 4ANWA 5IBUB 1Q8MA 3IBEA 1I85C 1DN0B 1QW9A 1YYML 1FVEA 4MQSB 4U3SA 3R8QA 2A5UA 4F27A 2N59A 4HT1L 4AY0A 1V7NL 1SDDB 3UTZA 1F6AA 1A1OA 2NY0B 5FO7A 3TP4A 5H4ZA 4GFTB 1D9KA 4I18C 5DC2A 2QSVA 4KITB 5JQ6H 2A9MH 1SLWA 3CLFH 3ZL2A 2R0WL 1AZUA 1OAQH 1QQDA 5CF3A 3N43B 2F8IA 4NQED 5JW4Q 2BZCA 2ZCZA 1FH2A 1F1GA 4M7KL 3WY1A 3PV6B 2WIIA 1OO2A 5C0BA 2ZX9A 3TEUA 4AEFA 1LO4H 2PCFA 3UCRA 1TJMA 4HOZA 1MXDA 1WH0A 2ED6A 1L5GA 3AY4A 3F04A 1HEZB 3ZR5A 4UQBA 1W72L 4AIZB 2F6AA 2G2RB 4G2AA 4LLUB 3RYMA 1XF4B 1SHXA 1BM3H 2BRQA 1ZA6A 3F2LA 1OHQA 5DMJB 4KXDA 3HFML 3TA3C 4U6HB 4MMXA 3GBNL 1YMMB 4RZCB 5TDNA 3SDXE 4TPRH 3X1EA 1GIGH 1S7XB 1JP5A 3WTTA 2J43A 3DO7B 2YFNA 5AVVB 5FV2A 2L0DA 2I5YH 2YUZA 2BP8A 1BJ1J 3FB6A 3FTGA 5INCA 2Q3XA 3MXWL 4B9FA 2FJGB 1KBVA 4UTAH 5H94B 3SKOB 4QYOA 3Q1SH 4K7PH 3IXTA 1W0WB 2Y07L 1FORH 1LYQA 3MV8D 2NYYC 3D09A 2VDPB 2VZOA 2EKSB 2XBTA 3TN0B 5IHUH 3WEMA 5SWSB 1KPRA 3UC0L 4OZGE 2WAHA 2BVQB 3V5HA 3X13B 4PHZA 5EBMA 3O11A 3VDCA 5IP4A 3BGMB 1E5BA 1AJ7L 4PRDA 3FO0H 2WSKA 4LPXA 4DZ8A 4AENB 4HK0A 3ARFD 1YNTA 3ZMNA 2X9WA 2Z31B 1I8IB 2R8SH 5K9KA 1ZANH 2KT6A 3SBQA 1CLYH 1X5KA 1PY0A 1OE3A 4LL4A 3Q5OA 2A6DB 1NC4D 2UWEA 1ZA3B 2ZXBA 4KX8A 4UCFA 3L9RB 3RAJL 1ZAGA 4PV9A 1KXQA 1U93B 1V05A 3ISWA 3UIYA 1OGAE 1HSBA 1DP0A 1KBGL 2DQMA 3CDYA 3SQBB 2AJSL 1OLZA 1YY9C 3BD4A 2X70A 3Q5YA 5A7EA 4YDIH 1NCBH 1J11A 4MJ5A 3T65B 1ROCA 2A6KA 2JJUA 1ZXQA 3CZFA 2A6IA 4NJ9H 4M8RA 1KC5H 1HSAB 3BPNB 4NN6C 1W0VB 2FSEA 3VI3E 5I76B 5IJVA 1TF4A 2EYSA 7CGTA 4HC1A 4X6DF 3HRZB 1UOVA 3DURB 1R5IB 3DUSA 5IQOA 3WYRA 2AEPL 3D69A 1RZJC 3QE5A 1PU0A 1OP5K 1HHGB 4JO3L 1AD9A 2G30A 3GKWH 3VG0L 2WNGA 3S37X 2MNWA 1Y18A 4JDEB 3T8XB 2YD9A 3TCLA 4UINH 5D4JA 3IGAA 3DRQA 3HBPA 1H5BB 1KCBA 4JKKA 2BC4B 2IWKA 4PRHE 3L95A 3HI6L 3HUJE 4DO6A 5GJTH 5L9DH 4XMPL 1KCSL 3AMKA 4AJWA 5KAQF 2Y3NA 4E9WA 2ZCKL 5GRZA 5JW5A 3RWHA 3K6SB 3TJEL 3EH5B 1WG3A 4APQB 4XHQA 3LKSA 2Y5TB 2N7SA 1H3XA 1DQQB 3SGKC 4YO0A 1MIEH 3OMIB 5CGTA 3QYMA 3TF7C 3KCPA 5AD0B 2Z64C 4PJCE 4N5EC 4XP6L 5GGSA 3O3EB 1OT2A 2XG4A 4XOCA 5JPNC 5LNDA 3QO0A 1LLAA 3ECBB 2DAVA 1FRGL 4G3YL 3DETC 3QUHA 3N06B 7FABL 5BZWB 1RUPL 3EO0A 3NDZE 4WWKB 4ATTA 5IR1A 3A3YB 2E6PA 4XX5A 4WNJA 4GH7B 1T4WA 1LO2H 4AT6A 1RK0A 2ZAHA 1JVOA 2I07B 3ZKMD 2AQNA 2XOTA 3ATAA 2OMNA 4Z78B 1NC4A 1UD4A 4X80H 1P4LA 5IT2H 2QPDB 5EFIA 1KGYE 1TVBA 4NCDA 4GFXA 3HNSH 4R0LC 3KS0J 2DJMA 5FK9B 4CAGA 2XPGB 4WKXA 2GIMA 3I02A 1MEXL 4PJ9D 5J9PA 3DVGA 3QJFB 3WDHA 3RZCA 3HA0A 3AY2A 4KVNH 2AJYL 1KOAA 1QO3A 4JM0A 4ZFOA 4ES8A 4MQXD 3WSQH 1OAJA 3WO4C 1L7IL 1B4TA 2F61A 4FI7A 2ZE0A 1GGCL 3EF7A 4NUQA 2A9AA 3KHQA 3TIDB 2CLVB 3L3IA 3L45A 2CU9A 4RDQF 1HYSC 4LXFA 4PV1C 4J3OG 3VXMB 1MFNA 2HT4D 5EIIG 1B0RB 2BJMH 4P23B 4IBUA 2EO1A 2P8MA 2Y6SD 2F74B 4OI7A 3E6HA 3O6LH 1S8DA 3U1QA 1FH5H 2DMCA 3QA3A 3OTTA 1ZXKA 3UAJA 3V4VB 1DFBH 4RISH 3IAGC 3F05A 4WDIB 1K4CB 4X4ZA 5IB4B 1IGCL 3FFCB 1MUJB 5B22A 3V79C 2ADFL 3TBBA 1IQDB 1UJ3B 3QIWD 5ITFB 1EK3A 1P7QA 3CZKA 3ECVA 3LQZB 4I9WE 3AM8C 3CXFA 5DHVH 1RD6A 5FYLD 3BAIA 3TPUA 1I4FB 4RNRA 3O6KH 3U30C 2H7WA 4ISVB 1O9WA 3WKML 3GB7A 4OBSA 1FFOB 1JZIA 4FNRA 1U8JA 4TQ8A 5KUMA 4V1DD 3V7AE 2DS4A 1C16A 2WKOA 1JCVA 4PMFA 4EAEA 4NFCA 2O4EA 4ZJ9A 2MKLC 3II1A 4BK5A 2VXQA 4GIPD 5LBGA 2ATKB 2ODHA 4BD4A 2D0HA 1NCAL 4MXQC 2G9HB 3L2MA 1UWXK 1TQCB 1WICA 2GBUA 4JVWA 3VFOA 1OPOA 1I1AA 1GYAA 3FMGL 2X44D 4PLJD 4CBZA 3HPJB 1O9VA 1TFHA 1GHFH 2CWRA 2OS7A 3KM2A 4WTZG 4A6YA 1MCHA 2F54E 3PAUA 2EXTA 2GITB 4JLRA 1RZKH 4WTXA 5AAPA 4M6NL 1I3GH 1BFOA 1I8AA 3RTQB 2ZWZA 4XOEA 5JIPA 4F7CB 4WNQA 1CD1A 4YSSA 2COVD 4G9FA 1LO5B 5AENA 3LS5L 5I6XB 3SDYL 2EXYD 2I24N 4QF1A 4OSUH 4YS4A 2ROXA 4Y9FA 4PJ9A 1GZPB 2YAFA 4JM2F 1YPZA 4NZRH 3EG9A 3SE6A 4DGWC 3FCBA 3MC0A 3OLDA 2EUXA 2PCPB 4RRPA 5JOEA 4KHTL 3VE0B 2NY0C 5D4QA 1G6RA 4PWHA 2EVJA 2GBTA 4GW1A 2YOAA 4PJIE 2Y2YA 3CVCA 5DT1L 5AZEL 4U31A 3BP4A 1HDMB 3IDYB 4E42B 1KSRA 1FE8H 5BUAA 3WLBB 2WLZA 2EH8H 1GOHA 3EBGA 3GKZA 3N9GH 3OAWA 4JFHD 3BXNB 2J88H 3HS0B 1VADA 3IDGB 2PWHA 5DA4A 3JTTB 3KWWA 4UZUA 1W8OA 3P11L 3VFMA 3EFDL 2QDVA 1UWGL 4I3SH 5HHQB 1CDBA 1CLZH 1S2EA 2XKSA 3ELQA 3UBXA 3MLYL 5EN2B 5C0FB 3KYMB 1YEFL 3WY2A 3KM1A 2R0ZH 4BJLA 3WXWL 4BINA 1EBAA 1JK9A 4R6UA 5M95B 1Q38A 4UDUA 4O9HL 1OAYL 4BCXA 1ETZA 5EZIL 1OAZL 5J11B 3MGTA 4G43A 2D4FA 3INOA 2FWLB 2Y7SA 4IU2A 4YDZA 4MX7B 2IGTA 1A64A 1J9TA 3IKCB 5LJYH 4H88H 2BNQB 5D2LF 2P7TB 1UKSA 3I9IA 5TE4H 4RQQA 1DQIA 2WINB 3PWLA 5KSAC 2P45B 3UXFA 3OR7B 4U6VH 1U91B 1XF1A 5L8KB 4PVLA 5FOJA 3TN0C 4ODXB 3U82B 1RUQL 1W72A 3U7YH 1RP8A 1YN7A 2ZPKL 5F72S 5L2JB 1F42A 1RY7B 3MPCA 1XFPA 5I1IL 5DEGB 2JCCB 4Z7QF 3TBWA 4CILA 5GSRA 3H54A 2MJWA 4DJMA 5C0AB 5FYLH 5BOZG 5AOMA 2M26A 3BZFA 5AL8A 4ODTL 2Z31C 3CX5K 4GP5B 2DI9A 1SUJA 4U1IA 2AXGA 3BPLB 3FJTA 5B7FA 3MUJA 4MDIB 5DD3L 2VDKB 3DGGA 3T6XA 3ZDXE 1LD9B 2NZ9D 4PJHB 1E2WA 1VDGA 3I75A 1AC6A 1OD9A 4GKLA 1SOSA 5FM4A 3X11A 5J8OA 4PYGA 2XY1A 5D93B 3UTPE 2K0RA 2PXYD 4GRLD 4ODUB 2DQIH 3N2JA 4AITA 2B1AH 1A5FH 3CWGA 5EOQL 3BPNC 3JZ7A 2DQFA 1G7MB 3QUMB 3HRZC 3JWNH 2X89D 3IJSB 4L48A 1F1DA 1BX2A 2J8UB 4XCFL 4X8XA 4GQ9L 2GW5A 4ODVL 5IVZA 1Q0YL 2WQUA 3L3KA 1U6AL 1T6WA 2LR4A 3MJ9L 4HLEA 1TVHB 5KN5B 1HNFA 3NOIA 4DZBB 1EANA 4J8QA 1H5BC 4HW6A 5FO2A 1N59B 3OF6D 4NKDA 4NP9A 1NZRA 2FSDA 1MCQA 3WS3A 2AV7B 4XVUC 3MLRH 5J7CC 2XBZA 1Z9LA 3IMUA 2XWEA 4UT9H 2VXVH 4UDTB 4FQQA 4FG6D 2HFFB 3FB8B 4QRRE 1UQSA 4U6XA 4APQC 4PP2A 3E38A 2AMUA 1QMUA 2NNAA 2XCMC 1WPCA 4ENZA 1W80A 3AG3B 1DBKL 3BIAX 3FT1A 1DBBH 1WBXA 4LFHD 3IGFA 1XR9A 2BIIA 3MNDA 5GSVB 4WW2F 1I7ZA 4X4ME 2EACA 3RL2A 3JWNE 3U0WL 1AR1B 3BAWA 4HJTA 4PRPB 1S78C 3O6FC 2GKIA 3SJVE 4D3CH 2NY1D 3KDPB 3GK8H 2VW4A 4WWKC 3PG2A 4YPGB 4Z1PA 1TITA 1L6PA 1E5CA 4ELME 2X4PA 1HAUA 2ITDB 3FRPG 5JW4R 2LU4A 3K5RA 2DQDH