3MLVH

Crystal structure of anti-hiv-1 v3 fab 2557 in complex with an nof v3 peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
221
Chain Sequence
EVQLVESGGEVKQPGQSLKISCKSSGYNFLDSWIGWVRQIPGKGLEWIGIIYPDDSDAHYSPSFEGQVTMSVDKSISTAYLQWTTLQASDTGKYFCTRLYLFEGAQSSNAFDLWGQGTMILVSSGTTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 221
sequence length 226
chains with identical sequence N
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlvH01
5J13B 3BFOA 3S36H 5I1AA 3WMSA 4HS3A 4NKMB 1CFQB 3VE0A 1TJIH 1MWAB 1KIUA 3IDJB 5FDWA 3BH8B 5F1IB 5IW6B 4CMMA 5ISZA 2HFFA 3SQOL 1CE1L 1UM5H 1LO5A 1P4BH 5IW1A 5J1SC 1FYTD 2P8PB 4HKJB 1KTKE 4WV1A 3QEGL 4N8CH 4M02A 3KPQB 3QULB 2ARWA 4NO3A 4X4ME 3GSNH 3HNSL 3RWIB 2N7AA 3NFSH 3VXOA 2DLIA 5F1SA 3QNYA 5EU6D 3G5YA 3U2SB 1VCAA 3VFOA 1FCGA 3QPQD 4JPKH 1JHTA 5EOCJ 3ULVE 1I7ZB 5DD0L 3MREB 3IAQA 1KC5H 5EBMA 5IP4A 4MDJA 4CU8A 4ZO9A 5HSFA 1NBZB 5DUBB 2G60H 4L1DA 5J7CC 4JFDD 1A6VH 5L8KB 1NCDL 1S78C 4KK6D 1OM3H 1I85C 5DD5L 4HW6A 4ZTPL 3B8SA 3P9WB 2BRRL 5BJTB 1WC7B 4XNUL 3Q5OA 3CX5J 4HKZB 4HF5L 2QSCL 2GTZB 4X7EC 3S5LB 1ZHKA 3UTTE 4OZGE 1OGAE 3IS1X 4KXZH 4JVPA 4XPTH 4YXLH 5C9KA 3T3ME 5DQJA 1WIUA 3GSNA 3VWKB 3KYMB 4N90E 1CR9L 4PRIA 2AERT 4Y19B 1HEZA 1L7TL 3OJMB 5D7LA 2WQRA 1LD9B 4W4OC 4HBCH 3NOIA 3SY0A 1ZLUK 4Z7UB 1UJTA 3UBXG 4TQEL 1K8IB 2UVEA 3RJQB 5JHDA 2X4NB 3WS6C 3CH8A 1TXKA 1INQB 4P5TA 2FO1A 2VERN 2YBRB 4NZRH 4PGJA 3QZWB 4LBEB 1U42A 1T6WA 5AYQA 1JCKA 4X4XB 4HK3N 3LRHA 4JM4L 2DYPA 4RMUA 1KB5H 3QUXD 4U1KA 1NQBA 4S2SB 9CGTA 1F4HA 4MQXC 1TVHB 2R2HA 4F7TA 1UT9A 1JWUA 3GHEH 3OKYA 1IAIL 4H8WL 1RK1A 4RNRB 3OGOE 3MRHA 2EYSB 1KJ3L 3O4LD 5BV7L 5HHOD 1LEKB 4JFYA 2J8UF 2R1XA 3UBXI 3AREA 4OIIL 3HLAA 1I9IL 4MZ2A 3UEZA 4LLQA 4AEHL 3SE9L 4I13B 4O9HL 3PXJA 1EV2E 1T1WB 5E4EC 3VGGA 2EDDA 3S3PA 1HKFA 3MRNB 2E9BA 3NA9L 2ATKB 4IHOA 2HKHH 5MEPB 3L3GA 4QRRB 1ES0B 4MCYA 4KI5F 1HIMH 2V7NB 1CTOA 5E08L 2Q76B 5F7EL 5HI5D 1E4XL 1R24B 3QO1B 1F4WH 1J1XH 2QSVA 2XACC 4F8QA 1QD0A 3RZCD 1KB5A 5IVNA 5KTEH 3KDMA 3VGAC 3KYNB 3IAGC 4KROC 3UPCA 1AGEB 3DVIA 3CFKA 5E6YA 3VXME 3VGAB 1HHKA 2O5XH 2FIRT 4K55A 4KROB 5DVLA 3AROA 4M48L 1S7UB 4GW4B 2DQJH 1BGXH 4MB3A 4JGJA 1JGEB 5JA9A 5KVDH 3MBED 3PGDA 3ARGA 5KANG 2CUIA 5GGSA 2VUOA 3SHSA 5B38A 2FYYA 5K9KA 4F2MA 4AENA 3THML 4M5ZL 3UTQB 4YEFA 2P5EA 3C09C 4HAGA 2VAJA 3FO2B 2UZIH 2PCPB 2YD4A 5IK3B 5FB8B 2VIRA 5HYQB 4X7CC 1BWWA 2ZP0T 4LDLB 1T0NB 2E9IA 4PD4K 1U3HC 4RMWA 5DA4A 5KAQG 4BH7B 1NUNB 3VXSA 5DDHA 3VG0H 5GS0H 3V5KA 1U3HB 2QKIB 3DWTA 3FB5A 3PDDA 1HWHB 2EXYC 4JJ5A 1NMAL 1QFWI 2YR3A 3S35H 1LO2H 3TH3T 5FYJD 1ZEAL 5KANI 1BEYL 2GJ6B 2YEZB 3QQNA 3DVNA 3TA3C 4QTIL 1QG3A 4U6VL 1FLRL 4FZ8L 3V6FB 3VCLA 3QUZD 4NNPL 3QXAA 4HT1H 1FL3A 1AHWC 3D3VD 3TA3B 3GMRB 1CBVH 1RU9H 4ZNCD 1KEMH 4H0GA 4Y16A 3NFPA 2RFXB 3BP4B 1AHWB 2AABL 3C5SA 1I7RB 2XZQH 4F7EB 2HTLD 3D25B 3ZYJA 1Q38A 1WIOA 2XNAA 2B1AL 3LKQA 1KELL 4TVPD 3MRFB 1U8OA 3BYYA 5T3XH 3CDCA 4LSTL 4AMKL 1ZTXL 3MNVA 5GRUH 2DI7A 4L4TB 4ORZC 4FOMA 4PBVC 2I5YH 4QT5A 3KPSA 2RBLA 1BVKA 1XIWD 4MSWB 1EO8L 3QIUC 3CSGA 2HP4A 2X4OA 3O3UN 2M26A 5DI8A 2FJGA 4NQXB 4N0FA 3K4ZA 1UACH 4JJHA 4PJAB 1U95B 1E4WL 4PJHB 1T5WB 1RZGB 4JDTL 1A4JB 3QIUB 1IM3B 2RB8A 1CDBA 3MUGA 3WHE1 3DROA 4Q7DA 3F7QA 2DQCH 4OLYH 3UJTL 5JMRA 4BK4A 3HE7A 2VLMD 4YNYB 2CH8A 3VFSB 3JZ7A 3MJ8B 5T5FL 2YRZA 4ZXBA 2J8OA 4XPBL 3TFKC 5F44A 3Q6GL 5F8RC 3WNLA 4XPHH 4YXKL 3S3SA 2XTJD 4HUVB 1DN0A 3QUYA 4R2GD 2J1KA 3QUMH 4HWEH 1YEFL 4FTVB 1MCPL 1E6JH 1KG0B 4W6WB 4DFIA 1DQLH 1R5WA 1P1ZB 2IBBA 3MGTA 1WBZA 3GSOA 3MCLH 1P7QB 4YHLH 3P73A 1RZKH 1CVRA 1NCWH 1JMZA 1R3JA 3I75A 1GL4B 1BFSA 4X98B 4FABH 3AM8C 3OPZH 2R8SL 2IQ9L 1UEMA 2CKBB 3GBLA 5E4IA 5KSAC 3ULUD 4H26B 3H2WA 5T1KD 3HS0B 1OAYL 3UMTA 1NFIB 3RNKA 4NWUH 3MSPA 2DWEB 5KSAB 1A1OB 4KXZI 4N8VB 1MJJA 5EC2B 2A6DB 3SDXA 3QJFA 5EUOB 3G5VA 3TO2A 3HRPA 1FFNB 2X1WL 1AR1D 4ZDHA 1R5VB 4IRZH 2RHEA 4X9HA 1L7IL 3LSOB 4RFEB 3P9LA 1QACA 3PDOA 6FABH 1TJHH 4K7PX 3RUGB 4V1DD 3QQ3B 5IB3A 3KXFA 3VFVA 1F11A 1TVDA 2DN7A 3QUMA 5CUSL 3V4VL 3PIQB 1CE6B 4JAMB 5B38G 3IVKB 1JK8B 4OJFH 3VJ6B 1KXVC 1UA6L 2V5TA 1MRCL 2LTQB 4QWWD 3HPJB 3OGCA 1SBBA 5E8DL 1NLBL 4XP9H 3WL9A 5L2KD 3WFDH 4G6JH 5IB5B 2R2BA 5EN2A 1XR9A 4K3HA 3RDTB 3PWVA 1T5XA 3P0VL 3CFCH 3Q3GB 3T0VA 4P3DB 1OGAB 5E95B 4WU5B 4KH2A 2EH8H 3T77A 2BK8A 5KZCB 4P9HH 1EK3A 3O2DH 3QH3B 4G6AD 4UT7L 1NCAH 4OV5B 1YPZB 3MGOA 5CEYB 4I77L 2J8UE 5BW7A 3SGDH 5JUEH 3L7FA 4ZQKA 1NMCC 2GFBA 4GAYB 1FN4B 1U8JA 1N7MH 4X6EB 4JKPL 3MV8D 5DJ6A 5JDSA 1J0ZA 3SDDA 4RGOL 1NMCB 2MJWA 2VISA 3LQAL 3JV6B 1GIGL 1NH6A 3DX8A 4Z76B 1G9MH 4O51A 4PTTB 4ODUB 5C07D 1A6AA 2K7QA 3MRRB 5C2UB 3LS4L 2EDEA 1I8MA 2R4SL 4EEEA 1SVZA 4QCIB 4YHKH 2EKJA 3MJGX 2R1WA 2B8OT 1F6FB 4X6DB 5D5MF 4TUJA 4LLMA 1G0YR 2WWKT 2VB5A 1QSEE 3SDYH 5ALCH 3GBML 5EOTB 1NAML 4N68A 3QRGL 4J6RL 2I60H 1OCWL 2YOCA 2VR9A 4HH8A 5EPMA 2DIJA 3V0WL 4NM8H 1AQDA 3RWEA 5GGUA 1W0YT 1DE4B 2F8VA 5T1MA 4TULL 4RA0C 3BXNB 2DLFL 2EH7H 4M6AA 1DTUA 2X70A 4UTBH 5ICZB 1D6EA 3L6FB 1T22B 2ADJB 5JMOC 3NTCH 1JNNH 1EMTH 1TZGH 1HCVA 1IGYB 3N1MC 4UB0L 2Z0BA 3JTTB 3O6LH 4CNIA 5T1LB 2PTTA 2ZKHL 4F7CA 5KS9F 3FO0L 5F9WC 3U7WL 5DHVB 1JUFB 2LQRA 1A6UH 2DD8H 1RZFH 1VPOH 1CS6A 5F9WB 4NO2B 5F8QC 5DQDL 4HUNB 2AV7B 4HZAA 3TIEB 5E8OA 1HSAB 1UZ6F 1FFOA 3SCMA 4U1GC 1KEGH 4XC1L 3NCYS 3MRCA 2DQUL 2I9TB 1Q94A 4GT7A 1D5XA 4CVZB 5DJCA 1O0VA 3DX7B 4JO3L 4JFEA 4U1GB 5FK9B 3UROR 4B7LA 5JHLH 3LKPA 5D1ZC 4MXWH 1FZKB 3VXMB 3P9MB 4IS6B 1AXTL 4Q9QH 2B1HL 1EEUA 4OCSL 2ORBL 1HI6B 2L7UA 1KBGL 2MOVA 4J3VA 5TDPA 2IMNA 2K1MA 5KSBA 3O8XC 2XKSA 5DRXA 1FGVH 3F58H 4HIEA 3BAEH 3DUUB 1BFTA 4U1LB 4GW5B 1PVHA 4U1JA 1VFUA 5HYIA 3HI5L 3RNQA 4U2YA 1FYTE 1KJMA 3O3AA 1NGYA 3L7EA 3AMKA 2AAVA 1NCNA 1MF2H 5GS1C 2ZUTA 4R96A 4OLZH 4OQTL 4A2MA 3F7PC 4HH9A 4WFHD 2YA0A 4MJ5A 5DUPL 3VFTA 5D1XC 2JIXA 5I8EB 4YWGL 5GS1B 3DOSA 5KN5A 3OHXB 2PTUA 4X7SL 1KIRA 4HHAB 4PB9L 5IT2H 1KNOA 5GRVL 5EU6E 2GEEA 1B4RA 5IF0A 1N4XL 2VC2H 5B4MD 3RL1B 1D6VH 5D1XB 1FH5H 1TJGL 4QY8B 1R5IB 1G7PB 4RMVA 5C0CD 3CJJA 1SY6L 43C9B 4PFEA 3JXAA 2EE9A 4OLUL 3HUJA 4P5MA 3TN0C 1QPXA 1U58B 1KCVH 1ZK9A 4BSWA 3TZVC 3ARDD 3VA6A 1DVFC 4Z0XB 4GSDL 2DKMA 3G04A 1Q9KA 3TN0B 3MLWL 5SWQB 2P7TB 2AGJH 3TZVB 5HJ3A 3WHXA 1DVFB 2GT9B 1N64H 3OR6A 1CT8B 4EDWH 3FN0H 4DCQB 5IJVB 2FEEL 3RA7H 4QLRA 3PWLA 5LG1A 3D9AH 1I8KB 5EFIA 1AQKH 5AWNL 1OARH 2OXHA 3EZ8A 2EO1A 3JV4A 2ESVB 3O2VH 2HN7B 1NGQL 3U46A 2ITCB 2VDMH 2XPGB 2IANB 3EYQC 2AP2A 1DQQA 4ETYA 2R9HC 3P4NA 4U1MA 5J4MA 3X11A 4NSKB 1JTPA 5ID1A 1XR8B 3PHOB 3BO8B 4MCZA 2CKBL 3BGMB 3H3BC 3BDXA 4F3FB 2H26B 5GGRB 4LLVA 4OF5A 3KYAA 1Z2KA 4YZFF 3VGDA 4NFBA 4OKVA 4JN1L 3EFDH 4K71C 4OLEA 1T3FA 4O00A 1OAZH 2YK1L 2PO6A 3BN9C 1EHXA 5LVEA 4PJFA 1FVDA 4XWOC 1A6TB 2WWMC 2A9MH 4K71B 2AJUH 4Q6IA 4OD2B 1KJVB 4ZNEA 2H3NB 5IMKA 3ULVL 5IFJA 5DC9B 2DMKA 3ARXA 1I1YA 2QBWA 3Q6FA 5CSGA 5CJ8A 4G8IA 4NHCL 1MUJB 3O4LE 4QEGA 5IBUB 3PGCB 1IRAY 1KIQB 5HHOE 1TTFA 5GGVH 3L9RA 3DRTB 2WZPD 4LCYB 4XBPA 3O9WC 1NSNL 4DAGL 1J1PL 3RL2A 2FJHA 2MSPA 3GMMA 1NFDF 4D3CH 1X6NA 3O9WB 1FZOA 3MCG1 5IKCA 4PG9A 4H1LH 5E5MA 1MLBA 2Y4SA 3N0PB 4IIQC 1WF5A 2HYMA 5IESL 4TUOA 3H6JA 4PJDB 4FNLL 3RWGA 4IIQB 2DJSA 1EA9C 3V0VB 5DK2A 1CDCA 3UAJD 3DSFL 1EEYB 4ORGB 4DKEL 4FQJL 2ICES 3P4LA 4OM1H 3OB0H 5GRJH 1B2WL 4UAOC 1P7HL 2HFTA 4WI2A 1PLGL 1FO0B 2NY6C 2FO4B 1FFQA 2GY7B 1IM9A 3H7LA 3BUTA 5KVFL 4LK4A 5FUCE 2NY2D 4UAOB 4POZC 3BKML 1VFOA 2NY6B 4XGZB 4V2BA 5BZWA 2MFNA 4P2OD 4Q2ZB 3ROOA 1WFTA 4RGNC 3QNXA 1PYWB 4XWGL 1QSFB 5IWLA 2EEDA 2N4IA 2IG2L 4YEEA 4K7FB 5D5ME 2Q6WA 2VSDA 3RQ3A 4H1LA 1EEQA 2G75A 2FGWH 4RGNB 4M7LL 2YWYA 2APVA 5SWZD 2PYFB 1T1ZA 4HPOH 5GS2H 4PJ7B 5IB2B 1KN4L 1XAUA 3RTQA 1MJUH 2IQAA 3OKNB 2NLJA 5DLMH 4LCWB 2YC1B 1E0OB 3EFFA 3OX8B 1CDUA 4O02L 2FSEA 4M7KL 3DLQR 3BGFB 1INEL 2AEIT 1MCHA 4NQCD 3BMVA 3VD3A 3TVMD 3UYRH 4KTDH 2XQYK 3DBXB 5KS9E 3ZT5A 4YFLF 1T2JA 2CD0A 3SKOA 2EDJA 2LE9A 5FYJE 3PV6B 1B90A 2DM4A 5BXFB 1MY7A 1S7RB 2BHZA 3IFNL 5C0EA 1YEJL 4YXHH 4I0PA 3IU3B 5K59F 1RY7B 3U30C 4XXDB 4PIRF 4UDTB 3UZVB 3D3VE 4X5WA 3B9KD 1OQOA 5I76B 5LCVL 1WT5A 1HHIA 3U30B 4D8PA 3VXUD 1JYVA 4L8BB 4PJBA 3VFNB 2BNQB 5C0DB 5LQBL 1HXYB 4BZ2L 1ZA3A 2FEDD 5JIPA 5BZDA 5ACZA 1DANU 4MLIA 1XF5B 1G7IA 1CLYL 1EH9A 2O5YL 3HG1B 2VO5A 4QXWA 1CE1H 4YHML 2A6IA 4TVPE 1I9EA 2CRIA 4GOSA 3GJEB 4YC2C 1OTTC 4D0BA 2VLRD 3TIDB 4PJEA 5BRZD 4UNTA 2W9EH 3QEGH 4MA8L 4MNGE 1WQVT 2WBJC 1KF9B 4HXAH 4YC2B 3KLAA 4E41D 4QHUB 3FFCA 4WUKH 5CGMA 4UU9A 3I02A 2WBJB 5HDLA 1LK3L 3BDYL 3TWCH 2BOBA 3JWOH 4XPAL 4K07A 4HWZB 4S1RL 3KPOA 3BRFA 4U49A 5E6IA 3QWRD 2VABB 3L5JA 1HHJA 3V52L 3ARQA 2HFGL 4PP1D 2ENYA 3CPLB 2D31B 3IGAA 4PTUB 2XTJE 4ONHB 4L8CA 5FKPB 3W5MA 1NCDH 1IGJA 2Q86A 3VRIA 5DHYA 1MHPL 3FT3B 4I0KA 2ATPA 3LIZH 3QQ4A 3EJYD 4GLRH 2W60B 1BLNB 2MMXA 4PG2C 4IEFB 3T4AB 4YR6B 3FHQA 3BHBB 3HE6D 3ILPA 4XNUH 4HF5H 4Z7WA 2VDOH 3SKMB 2QJDA 5I9QC 2DTML 2OX5A 2YPVH 5D7IF 2ZUUA 5EA0L 1M05B 1PG7W 1SMAA 4L3EA 3HZVB 1H8SA 5EU4B 4TSCL 5IOPA 1QOKA 1MCJA 1L7TH 15C8L 1DUYA 2W0FB 1FVEA 1G7JA 2C1PB 1BBJB 3R0MA 5E8EB 1KPVB 2P42B 2KQMA 5C8JA 1GGIH 2BY2A 3PGFL 3ALXA 4QHLB 3VGBA 4TQEH 1LO4H 3STBA 4MA7H 2UUDK 1MRDL 4DQOL 4QOKA 4X6FA 1T1XB 4K2UL 1ZT7B 1A14L 4V1DE 3NABL 1HYSD 5IB4B 5FYJU 2WAHA 2A6KB 2M2DA 3LQZA 3LKSB 4YZFE 5EZIL 3U9PH 3EYFB 1CGXA 3FQTB 3LB6C 4JFDB 4B41A 3KNBB 3LKNB 1IC4L 3ZKMC 1ORSA 4H1LG 1GOHA 2NX5A 1OAQH 3E6FA 3QEUA 5SWSB 3QJHB 1JTOA 3WXWL 1PSKL 4NQEB 2H2PC 1C08B 3O6ML 3WIFB 5L2KE 4XNZB 2D7OA 3GMOA 3PXHA 3FQXA 3S98A 3C60A 5TQ0L 1I9IH 1NCCL 3CLEH 4L4VB 3EHBC 4PJIB 5T3ZD 5GISL 3MLTB 3G6AA 2EIEA 3WLWD 1QYGL 5C0AD 5F3BB 4O9HH 3HN3A 1P4LA 3OXRA 3UTOA 3V6OA 3RWFB 4Z7VF 3BW9A 3MV8E 2ZCLL 4X0KA 1M6OB 3GSUB 5D2LA 1NFDE 5FA4B 4MLSA 3BWAB 2ARJA 2K7PA 5E08H 2AK4B 1WLHA 3Q5YA 5C07E 3QUXC 2P24B 2F8XC 1BZ7A 4AK1A 5AD0A 1GC1C 3VMPA 3QUXB 1URLA 3IDIB 1SM3L 2VDQL 3CFEA 4GG6A 4U4BA 4K8RH 1U8NB 1YNTB 5F1OB 1AKJB 2H6PB 4I5BA 1X7QA 4MJ4A 2ZSVA 4M48H 4YLQT 4F9PA 3OG6B 4AG4L 4NQDB 3O4LB 4HIXL 4RMSA 3L3IA 1JGUL 1DL7L 2BSED 3JWDH 1FO0L 4HGWA 4UDUB 1Q9WB 4D9LL 1OAUH 5HVGB 4M5ZH 4ZG1A 1D5MA 1TDQA 3RWCA 4C56B 1ZHBA 3LV3B 4ZUTA 3DXAB 2BY1A 3ULSB 4AH2B 1QSVA 3VFUB 2UUDH 2HJFB 1DQMH 2DM3A 2GUOA 2C3HA 1JTTA 1KENL 2A83A 4BQBA 2H9GA 4X9GA 4RMQA 2IALA 1LE9B 3WSQL 3GKZA 4LEXH 2XWTA 4C4KT 1MJ7L 4GAFB 4LKXA 4ZPVA 4Z78A 5CGTA 5GJSH 2FR4B 3LKRB 1NMAH 3GZKA 4P2RB 3RZCB 2PXYD 4R0LB 2J4WH 5IMOB 3PWPA 1ZEAH 4X80L 4MXQD 1TPXC 3MA7B 4QTIH 4HUKB 1FLRH 5JQHC 4NNPH 3QAZB 2EDHA 2H8PA 4DWHA 3REWA 1AJ7H 5ECJE 1MAML 5FUZL 3TBWA 1TPXB 1OF2A 1HILB 1RZ7H 4KKAC 4XHJD 4IRSA 2IMMA 1QHOA 2YPLA 1IKNA 2X4RB 4M6NH 3BH9A 1GHFL 4XC3L 2AABH 3ZMRA 3CVHA 5K59E 4P2QA 2D7PA 1D5ZB 3AXLA 4XVSL 3HNTL 2C7UB 2HRPL 4X99A 3C08H 4DUWA 2PYEA 4GFTB 2B1AH 3LPWA 3B43A 2IGFH 4H5SA 1FNAA 4FQLL 3TT3L 1KELH 4AMKH 3KAAA 4M62H 1F4YL 3N1FC 4NPYA 4WHDA 1EO5A 4WFHE 1MWAH 5C71A 2PW1B 5EIQA 1N5YH 1GGBH 3VFPA 1EO8H 2N56A 3VDBA 5HVWA 3SKNA 2ZCKL 4MNQD 2HMID 1H15B 2DQFB 1E4WH 4DGIL 4JDTH 1CFNB 3QEQD 4M8VA 3EIFA 4F8TA 5F7LB 4YHIA 3NCBB 4BQCA 5CWSB 1BX2B 4W68A 1KOAA 5C0CE 5I2IB 3KHOA 2UWEF 3L3DB 1UQSA 1Y18B 2FX7L 4WWKD 3KWWB 4PGBB 5T5FH 3QUZB 4KFZC 3DMMA 4R90L 3WNKA 2P8MA 3K2MC 4XPBH 2EDKA 3Q6GH 1X5YA 3S37X 2LU4A 5MEQB 3NPSC 4K3GA 5C09D 4YXKH 1U6AH 4AIZB 3T8XB 3LRSA 4LRNL 1YEFH 5FECB 4P4RA 1N26A 1VACA 7FABL 2WINB 3K4DA 3NPSB 1KIPA 2A6JB 4CBPA 2XY1A 1CL7H 3IFLH 1RMFH 1BD2D 2R0LL 5LXGH 1TENA 1KPUB 3SJVD 4NKMA 3UZQA 5I6XC 5F21B 1JGLH 1MWAA 5E7FA 5TF1H 3IDJA 4D0DB 5AAMA 5F1IA 5IW6A 2R8SH 1TMCB 5D1QD 4GLRI 1MPAH 1EGJA 1S5IH 2P43B 4XCNB 1EBPA 5I6XB 7CGTA 2AJ3A 4MNGB 3FRUA 1X5LA 4PGZA 2J5LC 4ODXB 1QKZL 5D7IE 1CGYA 2V5MA 1IFHL 5ALBL 2DLTA 3RWIA 1CLCA 2YD2A 3LH2L 3G9AB 4NKOB 4WHYG 1L7IH 1WFUA 5FV2A 3AS0A 3KPRA 1IC7H 4OBSA 4LLYA 4OZFB 4XMLL 4ZFOA 4OGAC 3CVIL 1LEGB 5KW9L 5TPWH 2NZIA 1MI5A 1D5BB 1I7ZA 5CUSH 3PWUB 3V4VH 5CD3A 1OTSD 1BIIB 2VYRE 1TIUA 2BFVH 4HCRL 3REVA 5DUBA 5E8DH 3ARZA 1LHZA 1NLBH 2MWCA 2C26A 2FECI 2ZOKB 4JDVB 5I66B 5FUOL 5HD8D 5L88L 4MD4B 2NY1D 2BJML 3B5GA 1AC6A 2OTUB 3ULUC 4FFWD 1QUNA 3P0VH 5ENWB 4R4FH 1WC7A 1T80A 3F8UB 1I85A 1AIFB 1FBIL 2V5YA 2XKNB 3IDGA 3WXVH 4QRUB 4JLRB 5T1KB 3S5LA 4HWBA 3H3KA 4G8EB 5IJKC 4I77H 1W0VB 3KYMA 4JKPH 3RKDD 4N0UA 1LD9A 2VKXA 3TH4T 4M1CD 4ZOBA 3BJ91 4R9HA 4Z7UA 5FM5O 1GIGH 2R69H 4Q9RL 2WV3A 4IBLT 4W4OA 4Z7VE 3U7YL 3VXRB 2X4NA 3GMLB 4QWWC 1INQA 5GRVK 3WFBL 3LS4H 2YBRA 3VWJD 1M1SA 1JL8A 5C08D 3DGGA 3QZWA 2R4SH 4Q97A 1CXHA 4U1IB 5L8JB 3WS6A 4FG6D 2L0DA 4X4XA 5IMLB 1F58L 1A3QA 2X2YA 3IJHB 5CJOH 4S2SA 2YUVA 5L2KB 3GBMH 1TVHA 4JHAH 3X3GL 3QRGH 2VXQL 2NY5L 2C3WA 1OCWH 3QXWA 3QIBC 4RNRA 1YEDB 1LEKA 4MWFB 2G9HB 1ZLWK 2ED8A 4LSQH 5SWZE 1MY5A 2DLFH 3RRQA 4GRLD 4PJXF 5LGHL 2YD7A 3TCLB 4PJ9D 1AXSB 1FORL 3B3IB 4HS8H 1MCDA 3MV8B 4OI8A 3IJSA 1OD7A 3WYRA 1P7KB 3MRNA 2CMRL 3NZ8B 3JUZA 3CH1B 4P46C 3V7AE 1A22B 1MAKA 4NQCE 5AZEH 4WO4D 2BY3A 3WHE0 3T65A 5MEPA 3SGJC 1K9TA 1U8LA 2X7LB 4FFYL 4P46B 5J06A 2Y5EA 1MH5A 4Q0XL 1UYWL 4M00A 4GRMB 2R0WL 1R24A 1RZIB 4JO3H 3HRZA 4LCUB 1Q0XL 3PQYE 2X4UB 1XF3A 2F5BH 1AGEA 2V9QA 1BFOB 5F3HA 2ORBH 4L9DA 3QIWD 3VXUE 3VFMB 3FB6A 4I3RL 4WEBH 2FJFA 5TQ2L 4XVJH 3SBWC 4GW4A 1J5OL 4WDIB 3F62A 2F19L 1JGEA 4WJ5A 2Z4QA 3WBDA 1T03H 1V3MA 3CFBB 4UOW1 4LSRH 3W39A 2VLRE 3BPOB 4PRHD 5BRZE 3WCYA 2E6PA 3TEUA 3C6SA 1G7LB 4XMKL 4ONGL 2NY0C 2X9WA 4OQTH 3L3KA 3BDBA 5FO9B 2PCPA 4E41E 1TCRB 1MAJA 2IAMC 1D9KC 5IK3A 5DUPH 2Y23A 5HYQA 2GY5A 2NY0B 4PB9H 1ZHLB 5C0ND 2QADC 2IAMB 3IRPX 3MZGB 1AD9B 5FEBA 4OB5L 4WGVB 4FQ1L 5ITBL 3MRGB 1K4DB 2QKIA 2QADB 1A4KB 5KOVC 1KGCD 1C1EL 2MQCA 1H3XA 4OCYL 2LAGB 4IDJH 3RVVC 2RCSH 3SE8H 5SX5K 5FYJL 4LSSH 1EDQA 2XN9A 3MFGB 2IFFL 3MLWH 2UWEE 5CLTA 5HYSB 4PJ5D 3L5HA 5DURB 4JHWL 2I27N 3S5LG 2Z93A 3TA3A 4IRJD 3GMRA 1QFPA 1JHKL 4ZYKB 5GHWL 1FFPB 1OLZA 4D9QD 1UWGL 4FQCL 3T2PA 4HFWB 3MLVL 5FOJA 2RFXA 1AHWA 1I7RA 4F7EA 3D25A 2EIZB 1B6UA 1AO7A 1Q9OB 1BQLL 5AWNH 5D7KE 1ADQL 3F12B 1CL7I 1S9WB 2P1YA 2JK5B 3MRFA 1FIGL 3T4YB 1Q72L 3EGSA 3GMPA 2YD3A 4HC1H 5FF6B 4L4TA 5B4MC 4LRIC 4TVPL 1C5CL 2ADGA 5I1HL 1EX0A 2JKXA 3TBVA 4MSWA 3GMQB 4NJAL 1S3KL 2DQIL 3B5TA 2CKBH 3MLZH 3QZWG 4JFXB 5FGBA 4NQXA 3O45A 3RIFK 4PJAA 4GBXD 3EDEA 3D85D 1RZGA 4PJHA 1A4JA 1IM3A 4OTXL 1B9ZA 3ZTJH 4L1HA 3DYOA 4R26L 4OZHF 2EDBA 4NO0D 3AAZA 2Y07L 1QO3B 3GO1H 2A1WL 2G2RA 1JF1B 3ARDB 4MQ7B 2VOTA 5J12C 4YNYA 4BUHA 4XP5H 1RJZA 5C7XH 4KMTL 3MJ8A 1BBDL 5GS3A 2DDQL 1ONQA 2YXMA 1UXWB 4KVCL 3ULVH 1P9MC 1DLFH 1OT1A 4P57B 1NC2A 2AJZB 2QQKH 1T21A 4NM4L 5GSRB 1MIEL 3BKCH 4BH8B 1U2HA 3NFNB 2Y9RT 4FTVA 5DSCB 3HC3H 1CK0L 2LABA 5A16A 4LOUD 3JTSB 3G5XB 4JKLA 4OF3A 1P1ZA 5T3ZE 4LL9A 1JWSB 4PRNB 4DAGH 4J3UA 4GO6B 4O2CB 4HC1A 4FFVD 5C0AE 1RI8A 3ESVF 4X98A 5DR5H 4UBDC 3D48R 4YBQD 3R06B 4PB0L 3DO7A 5IESH 5FHAL 2J6EH 2OSLB 3HS0A 2D9CA 1XGQA 2DBJA 2IWGA 3G5ZB 3AM8A 1MCSA 3ULUL 4V2CB 1MQKL 3O2WL 2DWEA 4XXCC 1DDHB 3HCVB 4NBYB 4N8VA 4KUZL 2A6DA 4FA8A 4KJPD 4HGKC 5EUOA 2DL2A 1FFNA 2CPCA 1R5VA 2BNRB 1B2WH 4PLKC 3RVUD 3LSOA 5H35A 2X6MA 1JHLL 3CZJA 1BJ8A 1HDMB 3QQ9C 3RUGA 1T0MB 1HQRA 1QNZL 3GHBH 5KVFH 1MHCB 3AFLA 1YYMH 3PIQA 1CE6A 3EUUA 4JAMA 4M43L 1T7XA 4HK0B 5TF0A 4MZ3A 3IVKA 3VJ6A 2AK1L 3CXHJ 2X4QA 3F7VA 2P5WD 3HPJA 4KMLB 3LDBC 5L2JB 3U0PA 4JQXC 2VQ1B 1H3UA 4GMSL 2IG2H 2E7MA 4KGJA 2AXJA 1X4XA 5F1KC 2HJKB 3K46A 4WUUD 4JZJB 4UT6L 3VFWA 5E2UH 3LDBB 2XYCA 1ZS8A 2J6EA 3B6SB 4S0SD 4P3DA 4G7YL 4J7RA 5I1DB 4BQ8A 4NZJA 2J8HA 4ZAKC 3DTXA 4OV5A 1UM4H 5D71L 1YPZA 4O02H 2UZYB 3BWUC 4XPGL 4LHJB 4JB9L 4JRYD 3SDAD 5B8CC 4LPUA 1O5DT 1FN4A 4PJXE 3LMJL 4ZAKB 1IZJA 2GJJA 3HZYA 1CICD 1J86A 4X6EA 3MJ6A 2YN3A 3GGWB 4M61B 5CSBA 5B8CB 1UADC 1AGDB 4XP1L 4Z7VB 4Z6AT 5DHVH 4RIRA 3PP4L 2DS4A 4WNQB 5JR1H 2IPKA 3VRJB 2BOCB 1KTRL 3ARFC 1AY1L 4L5FL 4PPTA 3L5IA 1MSPA 3MTRA 1YMMB 4NC0B 2GSIA 3IFNH 4P3CL 3C5JB 1YEJH 4ODUA 4PTTA 4DN4L 4F9LC 3KYKH 5JW3H 3ZL4H 3MRRA 3VGEA 2YZ8A 1S9YB 2F53D 5EZLB 3W11D 1RHHA 5F88B 3GMNB 4EI6B 4B53A 4X6DA 2OJZL 2GTWA 2E27L 3H8NA 2NY3C 5EDXA 4BZ2H 5EOTA 1CQKA 1PQZB 1CLYH 3S7GA 4Y5VC 5SWZB 4MJ6A 4C83B 2FH6A 2NY3B 3GSQB 5JZ7D 2DIAA 1ZAGA 1LO3L 2FLBT 1DE4A 4ZOCA 1W2KT 4Y5VB 2NXYD 3WJLC 3BXNA 4MA8H 1LILA 3SKJL 1JNLH 3BYTA 2X5PA 1U2CA 5I8KL 3CSYB 3MYZA 5DHXB 3L1OH 4MNQE 1HHGB 4P5KB 3JTTA 5T1LA 1IBGL 1UH2A 1RJYB 4YDLC 5DHVA 1JUFA 2JF1A 3QEQE 2LAAA 3A6CH 1AFVH 1T2QL 4FN0A 4ERSL 1OAXH 3MRLB 4G3YL 1DBBL 4NO2A 4MAYD 4AEIL 2AV7A 4S1RH 4Y4KC 1HSAA 4GG8B 4MJIA 4G7VH 4D94A 4FXKB 1RVFL 1MEXL 2AXFA 3V52H 2HFGH 3PWNA 5GGTL 3B9KB 1E28B 5C09E 8FABB 5DUML 5FK9A 4XX1G 3BQUC 4KJWD 3EJZD 3P9MA 4IS6A 2YD9A 3VXUB 1I3RB 4JFFD 4A6YB 3SEPA 3U1SH 5EU7C 1MHPH 1S7VB 1HI6A 1MFDL 1YECL 5D1ZA 3BQUB 1BD2E 5ESQB 3LKOB 3BPNC 3V6ZB 3OBAA 5ACLA 3ZTJG 5BRZB 3O8XA 4GW5A 5DVKA 3BPNB 3IU4H 4N8VG 1EXUB 3W9DA 3KR3L 3FQUB 1H8OA 1IGMH 5DC0A 1QPPA 1OP3H 4N1HB 2ICWA 1Z9MA 2P8LA 4ODBD 2ERJC 3PGFH 2Q8AL 1LO0H 4YHZH 1T04A 2NNAB 4J3TA 4KKLC 3OKEB 5GS1A 5I8EA 1MRDH 3U6RB 4OM0L 4S1DC 3OHXA 3IJYB 4PV9B 2EDQA 5D7SH 2ERJB 3HHRB 4BA8A 1LE5A 4K2UH 1QRNA 3RL1A 5D1XA 5JXEC 3NABH 1R5IA 1G7PA 4B50A 4HQQH 5J1AA 5MP6H 3KJ4C 43C9A 1M7IB 4ZO8A 1N5AB 1IC4H 1U58A 4OZHE 2UWEB 2OR9L 3I6LD 1V7NL 4NC1C 1SYSB 3GIVB 1U91B 3RFZC 4Z0XA 3KJ4B 3H7BB 3MO1A 5JQ6H 2KQNA 3O6MH 1MELA 4KUCD 1TQBC 2EZ0D 2H41A 5SWQA 2P7TA 3CK0H 3HE6B 3TZVA 2Z35A 4GW1B 1Q1JL 4DCQA 1LP9B 3BSZL 3BZ4B 1TQBB 1PG7H 3STLB 5ILTL 3I84A 4CRPA 3NN8B 5ADOL 5D93C 1HHHB 1OY3B 3ARSA 5TH2B 4GQ9H 1I8KA 1AI1L 3HC4L 2ESVA 4QHNB 5DMJB 4M4PA 4CU7A 1JFQL 5GRYA 3PL6D 2AV1A 2XPGA 2IANA 1FJ1A 1K8DA 1P6AB 3QDMD 3C8KA 4NSKA 1WCBB 3BO8A 2VXUL 3INUL 3BIKA 4KHXL 4F3FA 2B4CC 5LKNA 1X4ZA 5CD5D 4NYLB 3RIAF 2V2XA 1UWXH 4BJLA 3EOAB 3W0WD 4XRCB 5FCUH 5C08E 3S97C 1CI5A 1HWGB 1SM3H 2VDQH 1FNEB 2DQHL 1IL1B 4M6OL 5JOFB 2EC8A 2YHGA 4JG1L 1KJVA 4GXUM 4QRSB 2H3NA 3AU1A 4AG4H 3ZZ1A 1KPRB 5ISZD 1JGUH 5DMKA 2OK0H 4U7KA 4ELKA 1FO0H 4FQIL 4JANB 4HKXB 5L9DH 1MUJA 3CLFL 1R3HB 1KIQA 4IM8A 3DRTA 4HX1B 5J6HB 4M7LT 4LCYA 2YN5A 5BMFL 1CFTB 1N6VA 2RIKA 4JN2A 4RRPA 5A43C 5BCAA 5K9OB 5IMMA 5ESAB 4QXUL 1KENH 2NTFA 2E9JA 3U0WL 5J1TC 3ORJA 1MCWW 3WSQH 2CLVB 3FZUC 3I6GB 2R0KH 5D2NE 4PJDA 4JY4B 2XXCB 4IIQA 1OAKL 3BGAA 4UUJA 4ZFZB 4S1SL 2EEAA 4WI5A 3S35X 1FE8H 4X80H 2VLJB 3RBGA 4QRTB 2HKFH 2EDYA 4EQ3A 2DOCA 3FT4B 3K7UA 5DJAA 2W91A 3DV4B 5D8JH 3QT2A 5D70H 3D39B 5C2BH 5HI4D 2FO4A 1WAAA 4MA1B 2OI9C 4Y2DC 4YHYC 5GS0C 1OL0A 3N9GL 4KVNL 3HNTH 5GQBA 4XGZA 4RDQF 1YEIL 4Q2ZA 4UIKL 4K23H 2KH2B 3ECBB 2OI9B 3H9SA 4GRWH 3Q1SH 4YAQB 4YDVA 4YHYB 3BI9X 5T1DL 3S88L 1PYWA 1YNKL 4PRHE 4PRID 1QSFA 4K7FA 4Y4HC 5D7LD 5JXAH 1ZVHA 2X10A 1F4YH 3PWJA 3QXVA 4OCNC 3T1FB 2PYFA 1G9NL 4PJ7A 4Y4HB 1NJ9B 4MJ2A 4LCWA 1I1AC 5JHDD 2ZCKH 4PJXB 1GXEA 5FO8B 5CEZD 2ADIA 4O5LH 3OR7A 4P5TD 1DQDH 4JM2C 4NKIL 1I1AB 3UTSB 1E27B 3WNPA 2UV3A 4DW2H 2J12B 1XGRB 2DMBA 2UZXB 1KGCE 2DYPD 5A3IC 4ZUUB 2FX7H 3ZKNC 3B2UD 4JM2B 1TLKA 2F5AH 3HR5B 2R15A 3TT1H 3HAEA 2ICWI 3SQBA 4NZTH 1NAKH 4MQTB 1S7RA 1F3DJ 2OL3H 3P30H 5E8PB 3U79A 3WS3B 1T6VN 4E42B 4PJ5E 1DLHB 4P3WA 1JNJA 4XXDA 5KJRL 4PJGB 1CD1B 2DBLL 4PUBL 1FYHB 1JE6A 2YD8A 3ZYIA 7FABH 3SGKA 3ZT7A 3ARED 4D9QE 3GSWB 2DJUA 4L8BA 4LSVL 2GI7A 4KDWA 2Q3ZA 2IH1B 4KK5D 5IHZA 2BNQA 3OKDB 1HXYA 3O6FC 5DJXB 1HKLL 3DRQB 4BSVB 1XF5A 4OF6A 5HYJB 4MGXA 3HI1A 3HG1A 3HMXL 4G9DB 4Q74A 2R2CA 3GJEA 2A74B 4MB5A 3TIDA 4QRPA 2BHYA 2EDWA 3GNMH 4OAWB 2DM2A 4P2CG 1KCUL 1QKZH 4NWTH 1FNHA 2EKSA 1U8MB 2EYRB 4QHUA 5DWUL 1S8DB 3D0LB 1F6AB 3E3QE 1N6UA 1H5BC 3LY6A 4DJMA 4WWKB 4PJCB 2VZUA 5JW4N 2OL3A 1S9KC 5FGCE 1EEZA 4XMLH 4KUCF 2C9AA 5KW9H 1H5BB 4HLZH 1RJLB 1VGEL 4HWZA 4HIHB 2JCCF 4ONOA 2VABA 5IBUG 2UYLB 4N5UA 4HCRH 4J4PC 3ARGD 1KLFA 2BXYA 5K9JL 5EG6C 4PTUA 3V7MA 3G6JF 3OSKA 1UVQB 4RRPG 5IQ7L 3RI5F 5FUOH 5L88H 5D1QC 2P5ED 3NA4A 3SJVB 5FYKE 5DMIL 5JO5B 3VXNB 3ZDZF 5FKAB 3QXDB 1TTGA 1YJDL 5DGRA 1BLNA 4MYWB 1FAIH 1T83C 4KRMB 5D1QB 1UM6L 2PKDA 3BHBA 1BFVL 1DQTA 1MFCH 3MV9D 4LLDB 4YX2L 5DD1L 5TE7L 3LPFA 3WFCL 3UPAA 4NKDB 3U0TB 1AGFB 3NCCB 5I1KH 2Z8WC 4PG2A 1D7FA 1M05A 3WD5L 1HH6B 1XEDA 4YH6A 3VXSD 3HZVA 5EU4A 4A2LA 4JQIL 4XAWL 3SPVA 2W0FA 1BBJA 5E8EA 2A73B 3RX8A 1KPVA 3EO9L 1K2DB 2HT2C 1TTUA 3KPPB 4QHLA 2R4RH 5ESVB 3O41B 3U7YH 3B4NA 2AXGA 3OF6A 3WFBH 4HCRA 5IM7B 4EOWL 1BWMA 3X12B 4LLAA 3FFDA 2OTWB 4Y16D 5IB4A 3KLHC 3WIIH 1WZMA 4Z8FH 1F58H 3LKSA 3EYFA 4FFWC 4JFDA 3W81A 3KNBA 4I48A 2P5WE 2NY1B 5SWSA 3QJHA 3X3GH 1ACYL 5TE4L 1G9MC 4NQEA 1C08A 4LMQI 1S9XA 3RAJL 3WIFA 1A3LL 2V2TB 2VWEE 2X4SB 3T0EA 5HYFA 4MA3B 3KPSD 4KY1L 4TSBH 5LGHH 4L4VA 5FCSH 4PJIA 1FP5A 2OQJB 3MJ9H 3HR6A 2MNUA 3MRQB 1F00I 4PYGA 5T3ZL 1F4AA 2VQUA 4AQOA 4JRYE 3SDCC 3NPZB 2DTSA 1NLDL 3QI9C 3HAEG 5IROC 1UJ3A 3RWFA 2AW2A 4ODWB 2Z92A 3HE7D 1JVKA 1CLOH 3SDCB 4CGTA 3GSUA 4FFYH 5FA4A 2ZUXA 3OKKB 1H3PL 3RVWD 4MD0A 4ZXBD 3ARBC 4KTEL 2XWJB 3BWAA 1UB5A 2AK4A 1UYWH 3N85H 1QR1B 3O11B 1T4KA 4PLJD 2P24A 5J0BA 1KTDA 4G8GE 3QUYD 3ARBB 2Y7QB 4YK4C 5M7QA 4BUGA 1FIEA 4LSDA 1NEZB 2F53E 3AS1A 3DETD 3HPLB 3IDIA 5FYLD 2IPUK 4YK4B 5T3XD 3IFOB 1YNTA 1AKJA 2H6PA 1F4XH 4IMLB 3IF1B 4X7DC 1PW3A 3K81A 5TQ2H 1XCQB 4OKDA 2ED7A 2F19H 4NQDA 5H94B 5KSUB 1V3KA 2D7TH 1PEZA 4UDUA 3NAAH 5IVXF 3MJ9A 2CIIB 4Z95L 2P49B 5FYKU 2APFA 4R7NB 3MV01 3BMWA 1IARB 3U9UB 5F71A 4PJ9B 3VA2C 3Q2CA 2Z31C 1A7BA 4ACPA 4C56A 3RP1A 5ICYB 2OTPA 1I1RA 3LV3A 3DXAA 1EPFA 1WCQA 2LVCA 4JCLA 4AH2A 3M1BB 3CFIC 2Z31B 2HJFA 1P2CB 1CG9B 2HT3D 1JPSH 4WFFD 4I9WD 1DQJB 2DLEA 5IBTH 2XRAL 3IDYC 3GFUA 4RA3A 1F90L 4FQ1H 5EO1B 5ITBH 3IRZA 2R29H 3NCMA 3BJLA 3KXFD 4DFHA 3ARPA 4K3EH 1EIBA 3WLBB 2FR4A 3UPRA 5E1AA 1DEEB 1MNUL 1MCOL 4P2RA 3MLRL 3GSVA 4OCYH 2FHCA 5DD3L 3EYUL 3LS5H 3FAXA 4ZD3H 5IR1B 5GRZA 3ZKQD 5I18L 1MFAH 3QIWB 2IFFH 4JFFE 5TDOB 3O81A 5CKGA 4JHWH 5IVZB 4EUPA 1HILA 4N8PA 1JYXA 2C3VB 4U1SB 4WW1A 5GHWH 3FO9B 4YIQB 3UX9B 2X4RA 3FOLB 1INDH 3MV11 1D5ZA 4DZ8A 3GKWL 5DRZA 3VFRB 2C7UA 4YDKL 4R3SB 1NKOA 4YUEL 1ADQH 2MKLC 2HWZL 1OVZA 3TC9A 3KPNB 2BMKB 4P23D 2QR0B 3UDWC 1XCTA 4HLZG 1WZ1L 2NR6C 1Q72H 1RZ8B 3MR9B 3SDDD 5HGDB 4TVPH 1A9EA 4HAFA 2R39A 1PGRB 4ZUWA 2MHAA 5CJXC 2EO9A 1S3KH 2DQIH 2HAZA 3BPCA 3A67H 3MUZ1 3HC0B 2ZUSA 2DQFA 4GKOA 4NQVB 2BZDA 1W72B 3S37H 4PRAA 1E4JA 4JO1L 4MVBD 4S11A 2V6HA 2Y07H 5CWSA 1SVCP 5FOBB 1JI2A 5I2IA 5H37H 1CXEA 2Z8RA 1CDHA 3KWWA 4PGBA 1SQ2N 1T89C 4X8JA 3I6LE 4PJ5B 4ZFFA 2XFXB 1MFEL 1RURH 3NIFF 3H0TB 5MEQA 1MJ8H 4OZFH 5JA8B 2LFGA 1MIEH 4AIZA 3CXHK 3QA3B 4FQ2H 3X3FH 1NDMB 1QEWB 5C0RL 3TPKA 1CK0H 4OD1L 1IGCL 4RAVB 3E6HB 2E3VA 4F37F 4JO2H 4HUXB 1DR9A 4U1NB 4EIZC 3MNWA 4RAUB 1X5HA 3G6JE 5BVPL 1DBAH 3EO0B 2XZCH 3RWJB 4D0DA 3TYFB 1QQDB 3ZDZE 5FHAH 4GBXC 5DK0A 3OMZA 2VITA 3UYPA 3SCMD 3ULUH 1MQKH 3O2WH 3QDME 5MENA 4E9LA 2I07B 4CMHB 3K2UL 3MBXL 4GBXB 4HPYL 2DQDL 4JFED 4NO0B 1NBYB 3FCTA 4L29B 3V5DB 2CLZB 3V4PH 3W0WE 3ALWA 4JRXB 4Z5RB 1N3NB 1FQ9C 1AD0B 1X5GA 1C8PA 4KZDH 1FC1A 4ZTOL 5IQ9B 4LASL 5C0JA 1D5BA 3MFFB 3PWUA 4M43H 4R4BB 1BIIA 2MTPA 1FHGA 2AK1H 5ISZE 2D4DA 5DC4B 4DVBA 5AZ2L 5HBBA 1A3RH 3WO3B 4PS4L 5KSVB 2ZOKA 1T66D 4JDVA 4WU7B 4UOW0 5I66A 2E7LC 1RQ5A 4XCYB 4MD4A 1QFWM 5E9DB 1B0GB 1UB6B 3GK8L 4JR9H 3KPLB 1DANT 1RSFA 1JPTH 4UT6H 4F57H 5DD6B 1HQ4B 4GKZB 3JV5A 4G7YH 3AVEA 4W70A 1AIFA 3MROB 4G42A 1SBSL 2JIXD 3MOQA 4JLRA 1GAFL 2CJUL 4J3WA 4OGZA 5D71H 2P46B 4OV6F 4OCWL 4ETQA 3L5WA 2FATL 2VXTL 1KTLB 4PRBB 4LDOB 2ZG2A 4NZUL 2CKNA 1W0VA 3HTLX 4EVNB 1CXKA 3RVUC 5DVOA 2GSGB 5IJKA 5EBGA 2PUQT 4OLXH 1MCCA 3FQWB 3GI8L 5IGXL 4P48A 1U9KA 5GSVB 4KRPD 2GITB 4XCCL 4EUPG 3TBSB 4XBGA 1LNUB 1IEBB 3VXRA 5GXBB 1CVSC 3R8BB 4BSJA 4X6CB 4DK3A 5E94A 4JFZL 3OKMB 4PR5B 5J3HD 5IBLD 3WO4C 2N1KA 1ODAA 2P5WB 2QEJA 4C55A 5IMLA 3LEYL 1YMHA 1X44A 3IJHA 2E27H 4NRYB 2GK0B 2G5RA 3OJDA 3SDXF 1LEIA 5BS0B 4WUUB 1YN6A 3PNWA 2Y72A 4PRIE 4LVHC 3CD4A 5DYOB 1NGZB 5CMAA 5D7LE 2VZVA 1LO3H 2ZJSL 3FMGH 2CUMA 4MWFA 4F58L 4XP4L 1WIPA 2ID5A 3D18A 2B7DT 4LVHB 3QIBA 3SKJH 4UTAH 5JHDE 3MRDB 3VXQB 5CEZE 1CICB 3I50H 1KT2B 4ZSOB 4JZOB 1V05A 1P7KA 2B0SL 3NZ8A 1YEGL 2Y5TA 3CH1A 1QBMH 3TCXA 2PO6D 4G3YH 2BRQA 4JKWA 5AUMB 5TDNB 4AEIH 5FHBH 2X7LA 1KCSH 4P46A 3W11C 4FQXD 1DJSA 1MEXH 1MLCB 3ZDXE 1V7ML 3A6BH 4GRMA 5F7NC 4TRPL 5GGTH 1VKXA 1XT5A 1RZIA 4XT1C 3B2VH 4LGSB 3N50A 1DBMH 4RCAA 3K4AA 3MX0A 1TQCC 5J57B 5CIPA 1QZ1A 5F7YC 4WDIA 3QFJB 2RR3A 4IOFD 3CFBA 5EC1B 2NXYB 3SBWA 4G8FA 5B3JF 3KR3H 4OI7A 3D2UA 3P11L 5H37G 5HYEA 3OZ9H 4EJ1C 1G7LA 4QHKI 1ETZB 2SEBB 3TV3H 1MHEA 3RGVA 4MD5B 4LAQL 1SYVB 2FX9L 1IAOA 1CGVA 3VW3H 3E2HC 4OM0H 2QLVB 1HSBA 2VZSA 4XVUD 4MAYB 4B5EA 1ZHLA 3T08A 2IAMA 3UZEA 1D9KA 5TFSL 1A9BB 1AD9A 2YD5A 5JW4Q 3VFGH 3E2HB 4EN3A 3MRGA 4C57C 1IM9D 4L9LC 2VAAB 4HDIB 1FLTX 1A4KA 3TBTA 2IEPA 4N0YL 1N0LA 4PRPA 2B20A 4K94L 4XH2B 5E2WL 1W72L 4D9RD 1MCLA 1HZHL 2OR9H 1V7NH 3QDGA 4JFFB 1ZLSL 1NC4B 3QPXH 2BSRB 5LBSL 5EOQL 1T0PB 1ZVSB 4XI5C 1LK2B 2P5EE 2XOTA 3DURA 4GUPA 4ZYKA 1S7TA 4G6ML 3BSZH 4HXBL 3NIFE 5HHMD 3RTQD 5C3TA 4LSUH 1R6VA 2A9NL 1KJ2L 3MRBA 5CILL 2EIZA 4K3DL 1R3IL 1Q9OA 3F12A 3GRWL 4YGVA 3VXSE 4UINL 1BOGB 3R1GH 2ADFL 3T09A 5T5NG 1S9WA 1CF8L 4HD9A 3CFJB 4H8WC 2FHFA 5F96L 1S7QB 3T4YA 1FL5A 2HTKC 1MCFA 3ZHKA 5BV7C 1I8IB 5JIKA 1EJOH 3PP3K 1FNFA 1GZPB 3GMQA 5KSBF 3UBXB 3P40A 4JFXA 3V4UL 4LRIA 1NMBL 4JO4H 4I0PD 5BV7B 4KZEL 4ZS6D 3SO3B 1B6DA 1LDPL 5EB9A 1H0DB 3AGVA 4LP4A 1JPGB 1J7VR 4TTDC 3DO3A 1NCUA 5DA0B 2Y06H 1QO3A 1HK6A 1JF1A 4FFZH 4HSQA 1QHPA 2VLLA 3BESR 1B0RB 4XMPL 4TNWF 3RKPA 1CWVA 1EZVY 4JG1H 1UXWA 2AJXL 2AJZA 1W0WB 1J1OL 4MHHG 5GGQL 1J11A 4X6BB 3UJJL 4BH8A 3NFNA 4PGEA 1P9MA 4AQ1B 5DSCA 2ZPKL 3JTSA 5I75B 3KPSE 2UY7A 1HCFX 5BMFH 3CCHB 3G5XA 1A6ZB 1H9VA 4PRNA 1JWSA 3FFCD 3RY4A 4O2CA 1QBAA 3D0VA 4JDZA 2YXFA 3HUJF 2BNUB 2GCYB 2DKSA 3ES6B 4QXUH 1JGVH 3U0WH 2ITDB 4RBPH 3QDMB 3G6DL 1KXQE 1YYLH 5ICXB 3VI3F 2OSLA 1YNLL 3T0DA 4ELMB 1UGNA 3BP7B 2E6JA 3I2CL 5GJTH 4KI5D 5E6ID 2HLFD 5DO2C 2HJLB 1DDHA 3HCVA 1RUKH 1R3KB 1XF4B 4LCIH 1IQDB 2WANA 4RMRA 2BVQA 1NGWB 1G6RB 4K9EL 1DUZA 3OKOB 3F5WA 4MHHI 2XZAL 3EYSL 4OGYL 2OZ4L 1GGTA 3QG7H 2BNRA 2YMXL 4M93C 4NUJA 5I1AB 3U48A 4JQVC 12E8L 2A77L 3H9HB 3RWDA 3VE0B 1HDMA 1FRGL 3CUPB 5T3XE 5FDWB 3OAYK 3CZFA 4CMMB 2OMBA 3MLUL 4M93B 1MHCA 3FOMA 4HK0A 2JCCA 5JDJA 1KUMA 4NUGL 4S1QL 4WV1B 1CU4H 4LF3B 4JG0H 2B5IC 4L3ED 5A2LH 3MACL 5T1DH 3S88H 5L2JA 1ZGLA 3RVXD 4NO3B 5FFLA 2B5IB 4DN3L 1CZ8L 1F6LL 4OCRL 1H3GA 3SDXE 5HXMA 4JQXA 3VXOB 3PP3H 2H32A 1G9NH 1ZA6A 3B6SA 4DGYH 4FP8L 5I1DA 1X5AA 3HMWL 4PJFF 1U92A 3C9NB 4WHTA 3VFOB 2QQNH 5EZOL 4WFFE 4QOKD 4XTRD 5C0FB 5C0BB 1SHMA 1A7QL 2JJUA 1WWCA 4H25A 5EBMB 3UO1L 4MDJB 4ZAKA 1JRHH 4OFYA 3KXFE 3GGWA 1II4E 1NKRA 1G7HA 1R3LA 5DFVD 5B8CA 2Z8VC 5HDBF 1NPUA 4G5ZL 4TOYH 5FXCH 2NX5D 4WNQA 3VRJA 2BOCA 3QHZL 1KLGB 1YMMA 1RJCA 3C5JA 2LVEA 1CYGA 4X4YA 3V79C 5KJRH 3ARFA 4MAUL 2PTVA 2VXVL 1S9YA 2DBLH 2WP3O 5EO0B 4RDQG 4F9LA 4RAHA 1CLZL 3C60D 3GMNA 3RPKA 2D3VA 1XZ0A 4H88L 5KVMC 3EDDA 4NCC2 1KN2L 4OF7A 3TJHD 2QV2A 1HKLH 5D7LB 4A6YH 1NBQA 1PQZA 3VGHA 3NIGF 3SY0B 3SGEI 8CGTA 1MFBL 4C83A 4QF1A 3GSQA 4PBXA 5CP7B 1WZKA 4Y5VA 5CJQL 1KCUH 2NY7L 5IEHB 2N7BA 3CSYA 5B3JE 4P5KA 1YC7A 3WJLA 3O3DA 1YN7A 2Q1EA 2Y6SD 4KJQC 5HGGS 3JV0A 3M17B 1Z3GL 4FXGB 4U1KB 2HT4C 5E7BA 3P2TA 2GJZB 2Q87A 1CN4A 1F2XK 4F7TB 1VGEH 4KPHH 2IC2A 4GG8A 1IQWL 3MNZA 4FXKA 1QBLH 3QRFM 3EYOB 2VDNL 4Y4KA 4JFYB 5K9JH 1E28A 3BZFB 3U7AA 3SOBH 3VWKC 4U6TA 3BE1L 1I3RA 2NCMA 5IQ7H 4A6YA 5CZXC 1J0HA 2R1YB 1TZIB 2V17L 3CMOH 3IDMB 1NGPL 5DMIH 4F7MA 3FQRB 4I2XA 3BQUA 1YJDH 2F54A 3HI6L 4ODHL 5ESQA 2GK2A 3V6ZA 5JNYB 4YX2H 1BFVH 1BVZA 1ORQB 4IHOB 4J1UB 4LKCA 2OP4H 5IB1A 4XP6H 5F89A 1EXUA 5EOCL 1PEWA 5IVXA 4Y5XC 1X5XA 4JQIH 4AL8H 5I1GL 4XBEL 5HHQB 1PBYA 3HB3C 1UWEL 4I1NB 3LEVH 4G6KL 4QRQA 4Y5XB 3KDMB 2OM5A 3PWPD 4QYOB 4K8RD 4HBQA 4JFEE 4OUUA 4PJBF 3GSRB 3OKEA 3QDHA 3MA9L 3U6RA 4MMXC 2DQEL 3LN9A 1HHKB 3HFML 4PV9A 1EVUA 4TUKL 2NY4D 2APWA 1DBKH 4IRSD 1NCBL 5KSBE 2YPLD 4KAQH 1NGXA 3ARGB 3PGDB 4PJEF 5GGSB 4P2QD 5B38B 4TSAL 2QSTA 2XA8L 5K9KB 1FVCA 1PKQB 1XGYL 3QCVH 4ZPTA 4AENB 2PYED 5JXEA 1FG2A 3GIVA 1SYSA 2P5EB 3LQAC 2B4CH 1U91A 5HI3C 4XNXH 4XNYL 1A3LH 2E5EA 2Q20A 4KV5F 3MV9B 1CIUA 1PFCA 1LP9A 3BZ4A 2FCBA 3STLA 3GM8A 5DDHB 5TH2A 2J3SA 3MLYH 5E1HB 2YA1A 4JPWH 1GPOL 5EIIB 1UG9A 1MHHB 3HUJE 1NAMB 2ZUWA 1H3PH 1Y6MR 5LWYL 1P84K 3VCLB 4KTEH 1WCBA 3DMMD 3RJDA 1FL3B 5KVEH 1A7OL 1A7NL 4Z7WF 4MDIB 4NYLA 1BZQK 3P4OB 4UILL 4Y16B 1ZMYA 1I1FB 3KLSA 3C5SB 1TZHB 1C5DA 4XRCA 5ACMA 1JN6B 3TESA 2GYSA 3BVNA 2VXSL 1DFBL 4IOIA 1G6RL 4HS6A 5DMGD 2D0FA 3MRJB 1CGSL 4YQXL 1KFAL 5JOFA 2VQTA 2FZ3A 3K1KC 2HA1A 1ZLUH 3OAUH 4Z95H 4JANA 3U36A 1JJUA 1BVLB 2R56L 2X4OB 3EOBA 4Y1AA 2R0ZL 4YE4L 2AVGA 5F7MC 4HX1A 1AE6L 4UQ2A 1QFWL 5D9SB 2XG5A 3DROB 3O0RH 5HHVL 5ESAA 3L5XH 3LZFL 2W59A 2CXKA 3IXTB 3NCYP 3KPRD 1ROWA 1F90H 3NCJH 4UT9H 4U31A 4K7PY 2CLVA 1GH7A 4PJFE 3I6GA 1G0XA 1IC1A 1RIVH 1MI5D 4JY4A 1VADB 4LLWB 3QUYB 1MNUH 1G7QA 4ZFZA 3MLRH 3W2DL 4ZNEE 5DD3H 1JWMB 2VLJA 3C8DA 1JRHI 4HJJL 4QRTA 4N0CC 4YDIL 4EBQL 1A0QL 5F72S 3LQMA 2B2XL 1X5ZA 5HPOA 5AYUH 2UVFA 3DV4A 3E0GA 5HDBE 3S36L 2DMCA 3ZHDA 1Z5LA 3D39A 4ONFH 1S78D 3FQNB 3L3JA 4Y89A 1K4CB 1UM5L 5D2LF 3PHQA 4I0CC 3S3JA 3NBNA 4FRWA 5DEZA 4EZMA 1BM3L 1MVFA 4LGRB 2D0GA 4YDKH 1NDGA 4KHTH 4U1HB 2XQBH 3VD5A 3ECBA 2HWZH 4I4WA 4F33A 1XF2B 3LEXB 4Y2DA 4N8CL 4YAQA 3VXPA 3FTGB 1MJJB 3P0YL 1OTUD 2P4AB 1T7ZA 2FH8A 4XNQA 3TJEH 5GZOC 5E5UB 3GSNL 4K3JH 3NFSL 2MQ3A 3T1FA 1J0YA 2WSKA 3NIGE 4GG6F 2A0LC 4Y4HA 1NJ9A 3P9LB 4OZIF 1IC5H 3PDOB 5IB3B 4WI7A 4PY7B 2OS7A 1A7RH 1KC5L 5CEZL 1Q9LA 1S7XA 1I1AA 3UTSA 3KS0H 1E27A 1QFHA 5EWIH 1XGRA 3S96A 5I1LB 3VXTA 2DQGH 4DOHB 5C9JA 1OSPH 2G60L 4N5EC 4JM2A 4M6MH 3VMOA 3WL9B 4D9RE 1OM3L 4HWNA 5EN2B 5HVFB 3RU8H 4CVXB 1IEAB 3DGCR 3PABB 2ZG3A 3PWVB 3MLXH 1T5XB 4RQQB 4E42A 3FONB 3T77B 5BW7C 1ZV5A 1CD1A 5C0RH 2AQ3A 4AIXA 3U4BH 2MQ0A 4P23C 2BC4A 5CHNA 5JPMB 5HHME 3MGOB 5EIVA 4XPTL 4YXLL 3SDDC 2CQVA 1BHGA 1Y0LA 1U36A 2GFBB 1U8JB 2IH1A 4G9FA 4P23B 3OKDA 4O2FA 3DRQA 3SDDB 1DSFH 5HYJA 3BP6B 4HBCL 3E8UL 5L6YH 3ULVC 2VISB 4L8SA 1F97A 3O6FA 4O51B 2A74A 3D87B 2ZSWB 1JGDB 4M1GH 1IAKB 5CLWA 1JZ8A 2GHWB 3LN4B 5MI0C 2LU7A 2X09A 4QXGL 3K2UH 3MBXH 4EI5C 4HPYH 5E99H 2LTQC 4O2EB 2VDLL 4YDJB 1VHPA 5MI0B 5HGHA 1S8DA 3M45A 2NZ9C 1F6AA 5F1NA 5BQ7B 4EI5B 4HFUH 5DZNA 3O3EB 2BVTA 3TM6A 2DIBA 1KB5L 4PJCA 1CD9B 3RDTC 1ZXQA 3ZDYF 4WW2C 1H5BA 4PJBE 1RJLA 3GHEL 1Y6KR 4LASH 4BZYA 5CZVL 3K3QA 4NBXB 2CO6B 2IPTH 1NL0L 5EH1A 1I9RL 1C12A 5GGUB 3UTTB 4WW2B 4OZGB 2YKLL 3QXUA 2X70B 4X9IA 3BZEA 4PJEE 1UVQA 4J4PA 5E00A 3SJVA 2E7BA 4N1CA 2IBZX 4G80B 3VXNA 4HV8B 5EU5A 3QXDA 4IMKC 5CBAB 4CADA 3FFCE 3NACL 2NW2B 1OP5K 4KV5E 1L9MA 4M7JL 3U0TA 3ZE2F 5IHUH 2VXTH 3WN5A 4NZUH 1UH3A 1D5XB 5CGYC 4WI8A 1N8ZB 4KI5E 4OT1L 1F4WL 1J1XL 2APXA 2A73A 5KTEL 3GI8H 1IGFL 2CRZA 3QHTC 5ESVA 2EXYD 3O41A 4MX7A 2XN9D 2XY2A 5KSBB 1F3JA 2O5XL 5E03A 3TA3D 3X12A 3OAZK 4KJYA 1A7PL 1ZSDA 4RFOH 3O2DA 2OTWA 5KVDL 4Z7WE 1GZQA 2HVKB 5FIEA 3RNQB 1L6XA 1AO7D 1AH1A 4L3EE 3NGBC 4RWYH 2UZIL 1OLLA 4P59H 5J56B 5I8CB 4L4TD 2VUYA 2V2TA 2ZJSH 3NGBB 4XP4H 1FZJB 4IOSD 2X4SA 5KN5B 4MA3A 3C6LC 2EEBA 3BKYH 1F02I 2P44B 5I17A 4LLUB 4QOKE 3VG0L 3EJJX 3C6LB 1QP1A 5DEFB 4OF0A 1A6WL 4ODWA 4KRPB 4BSWB 1VERA 1A1NB 3SDCA 1ND0B 3QI9A 5IROA 5IV2A 3OKKA 3G04B 2NX5E 4KKCC 1NC2D 3PE9A 1CQYA 4GKSB 1L0QA 2E7CA 3O11A 5CJ5A 4NNYB 4Y7MA 2JLLA 1IAMA 5D72L 3ARBA 2Y7QA 4W6XB 2R23B 3EW3B 3T2NH 3PWLB 4FTVD 3TFKD 1NEZA 3P77B 2XZQL 2VZ1A 4U3CA 5HPMB 4I18C 3RZWA 3F6IA 4DGVL 3IF1A 4OLWH 3U46B 5FYLL 1OP5H 3FO1A 1U0QA 5T3XL 1VFBB 5I30L 4WENB 4Z7UF 3IKCB 4I18B 4U1MB 3VI4F 3V6OE 1C5BL 1A2YA 3X11B 2I24N 2CIIA 4LNRB 2BCKB 5D2LE 3U9UA 3P11H 1UACL 5ICYA 1SJEB 4JHZA 3RVTC 5CCKL 4LAQH 3IDXH 3M1BA 2Z31A 4FQXC 1P2CA 2DQCL 1CG9A 3MOAH 4LIQH 4AM0B 4P4KC 3X13A 1FVDB 4GS7C 4FQHB 1WEJL 1S7SB 4FQXB 4GXVL 4Q6IB 2YPKB 3RHWF 4GG6E 4P4KB 4H20H 5IFJB 5ANME 4GS7B 4KWUA 5CP3H 3MRKB 5EORL 2F9BT 3U4EB 4NN6C 5K9QG 1DEEA 3QUML 4HWEL 3MLSL 2H45A 5D6CA 1HZHH 4GAJH 1E6JL 3L9RB 5IR1A 5L0QC 1ZLSH 4R8WH 1DQLL 4NN6B 5LBSH 5EOQH 5HHPB 2XWBA 1GCFA 1W8OA 4IOFC 5E5RB 4YHLL 1RZKL 5L0QB 3QB7C 3GMMB 1NCWL 3EDKA 2C3VA 5IKCB 1MLBB 3FO9A 3ZO0A 5IEKA 4PREA 1ZGLP 1PG7X 2A9NH 4TUOB 3MXVL 5CILH 3JVGC 4OBRA 1R3IH 1GGCH 1AP2A 4NWUL 1JNHB 3GRWH 2BSSA 4HJ0C 5IHBA 2BMKA 5DK2B 2QR0A 4NQTA 2W65A 4AJ0A 1RZ8A 3MR9A 5DJYA 3WFZA 5K9QI 4HULB 3CU1A 2LU3A 3CMGA 3PWPE 4IRZL 4ZUSA 3UDWA 2AJSL 2E8YA 3X14A 3WIHH 6FABL 1TJHL 5CP3A 5E0QA 3MYJA 1IM9B 4CVUA 2RAMA 1LDPH 1J05A 4KQ3L 5I73C 2BX5A 3D69A 3QNZA 2YPLE 2X4TB 4LCCC 4NJ9L 3ROOB 5I0DA 1R0AH 4P2QE 5I73B 4XP9L 2WBKA 1UEYA 4FHBD 2PYEE 3WFDL 4LCCB 4G6JL 2XFXA 4APQA 2G75B 2AEQH 3H0TA 1J1OH 1T1ZB 2CGRH 1T89A 5GGQH 5HHMB 2CRMA 2EH8L 4BFIA 2IQAB 3QA3A 3TO4C 4NT6A 1NDMA 1QEWA 4UV7L 3EFFB 2ZPKH 2ZUQC 1NCAL 3GRWA 5INCA 4RAVA 3HNVL 1IVLA 4HUXA 3TO4B 4BKLB 3RWHB 4RAUA 4Y8DC 5T1LD 2AEPL 2ZUQB 1N7ML 3WV0A 4J12A 3MXWH 3SGDI 2W92A 2OJEB 1CXIA 1MCEA 3FAWA 1G9EA 3WIHA 2H1PL 3G6DH 2PW2B 1GGYA 4HMCA 3CDFA 5DZLA 2JELL 4MJID 3VGFA 1U8KB 2X1QA 4Y5YA 1A47A 3ZE2E 3QO0A 2I07A 3LCYA 4GBXA 1NEZG 2JJSC 1YEHL 2ZOLB 4X5WB 1U41A 1M71B 1RIUL 1VESA 4BFGA 2FHBA 3ARWA 2XZAH 1YY8B 4UIMB 2QTEA 3F7RA 4L29A 2OZ4H 5IW3A 4D8PB 4JRXA 4Z5RA 1N3NA 1AD0A 1EVTC 2A77H 3MRIB 5ALCL 5D1ZD 5BZDB 3IDUA 2FL5B 4PJ8C 1MRFH 4LNVA 2A6IB 4YHOL 4R4BA 4NM8L 4D0BB 3O8XD 4PJ8B 4M8QA 4URTB 4NCDA 1KB9J 2J8UB 2EH7L 2FBOJ 3BGFC 4FQQB 4UTBL 1OSZB 5KSVA 4IJ3C 3LN5A 3NTCL 1JNNL 1WGOA 4PJAF 1TZGL 4XCYA 4PJHF 5E9DA 1B0GA 1UB6A 3FFCB 4L8DB 4Q9CA 4DN3H 1RUQL 1CZ8H 3F7YB 3UC0H 3I02B 4OCRH 1HQ4A 2ZUYA 4IJ3B 5HDQL 1A6UL 2E7LA 4KI5C 1VPOL 2BOBB 3HMWH 2HVJB 4ISVB 1ZWIA 4LPCA 4FMFA 1A1MB 3ET9F 1JI1A 5ID0A 3TLRA 1A7QH 3KPRE 1QRND 1JPST 5D1XD 3UO1H 4PRBA 3GJFK 1HHJB 2NQCA 2OZ4A 5JPNA 1MI5E 5C6WH 3QDJA 3EO1A 3PQYD 3PUCA 3IGAB 1UZ6E 3SE4C 2OR7A 5DJ8B 4HMEA 3IS0X 4G5ZH 5GSVA 2EIBA 2Q86B 1QSEB 3VRIB 4Q9QL 1HINH 4LHUA 1IEBA 5F9JA 3QQ4B 1P69B 1BP3B 1S5HA 5SV4A 1FGVL 5F7UA 5DMYA 3TZVD 3ILPB 3OKMA 4MAUH 5CEXA 3SQOH 1AC0A 3CX5K 4JCMA 1CLZH 5HDOA 3MJ7B 5DJ2B 4L3EB 4U6XB 1XGUB 3GIZL 4NRYA 1KN2H 3P3YA 2GK0A 2WBWB 4OCMC 4KRLB 3P0GB 1DUYB 4R4ND 1FVEB 1VGKA 1MF2L 4ZOEA 5BS0A 5HVHC 4L3CB 1JF6A 35C8L 5EUOF 4OLZL 4WUUA 1E6OL 4XTRC 3G08B 4GKNB 2IAND 5DYOA 3HNSH 1NGZA 4N0UE 5EO9A 2VDRL 4XCEB 5HVHB 2DF3A 3O6KL 3ULVF 2HLAB 3LD8C 4Z7UE 4X6FB 4HZLB 5IT2L 2NY7H 3DECA 3RUGF 1GSMA 3DX6A 5D7JC 3OG4B 1D6VL 1WWBX 4KK8C 3LD8B 5DD0H 5DGQA 1WV7T 1KT2A 4ZSOA 3BP5A 3LQZB 4JZOA 5D7JB 3MCKB 1Z3GH 3RI5K 4N9GA 2BERA 3FB8A 2NX5B 5AUMA 5TDNA 4X83A 4Z0BL 2EE6A 5DD5H 1WK0A 3UTZB 4ZTPH 1JV5A 2BRRH 3BN9D 1MLCA 1QBBA 2VDNH 4XWOD 1U3JA 2WWMD 1N64L 5M94B 1S9VB 2QSCH 2BVYA 3C60B 3T3MF 4U0RB 3RA7L 1YPZF 2VLKA 3LPGA 1FYTB 3D9AL 5D7KD 5B3NA 3E1F1 2V17H 1AQKL 4OF8A 5TGBA 1P4LB 3O2VL 4ODTL 4QHMB 3HI6H 4ODHH 4PGCA 1CR9H 3M07A 1Z0MA 2AKRA 1IEHA 3BW9B 3VDCA 1X5JA 3QPQC 3QFJA 5D2LB 2V7HA 1PY9A 5EU6B 5EC1A 5EOCH 2ARJB 1V8HA 1H3VA 4RZCB 4ZOAA 4KKBD 3KJ6L 4UQ3B 1TFHA 1UCTA 2SEBA 1RK0B 1A8JH 4MD5A 3EFDL 1BZ7B 3ESUF 4KK6C 1SYVA 5AD0B 1FSKC 1OAZL 4X6DF 4JM4H 3MA9H 3MV7A 3HFMH 2XA3A 4XNZC 4ALAL 2A9ML 4I5BB 1FSKB 2W9LA 2AJUL 2ZSVB 1IAIH 4H8WH 2HRLA 5F7FA 2CDEB 3L3IB 4WEUD 1KJ3H 5BV7H 4POUB 2NY6D 4XH2A 2OR8A 4L9LA 2EDXA 4OIIH 3H9SD 1SEBA 4POZD 1NC4A 4AEHH 2BSRA 4ZUTB 1VENA 4XNYH 1ZVSA 1QSFD 3PJSA 3SE9H 4U2ZA 2W9DL 4RGND 5DVNA 5DJDA 4OFPA 2GUOB 3MZTA 3NA9H 2DM7A 4LCWD 5ITFB 5CZKA 5ETUB 1OD9A 4Z78B 5F7EH 1E4XH 1T7VA 3PHSA 1OT2A 4OIAA 3CFJA 2NY5C 4LHUG 1S7QA 5H2BA 4E5XB 4OM1L 1GZPA 2H8PB 4U7SA 1A6PA 3REWB 3EOTL 4HIJB 1MVUA 4XCFL 1OF2B 3UJIL 4OZIA 2NY4B 5ANMA 1A7NH 2XN9E 3H9YA 1OGTA 5J9PA 2YPLB 1ZVYA 2I25N 1H0DA 4UILH 1WBXB 4Z9KB 3CVHB 1JPGA 5C0GB 5HHOB 4X99B 2FD6L 2PYEB 3FJTA 1DFBH 1G6RH 3S8WA 2K3TA 1CGSH 4NRXA 4QXTB 3THMH 5EU3A 2BNQD 4HIIB 2BVPB 1AO7E 3BEWB 4HEPG 4NN5B 4KKNA 3MRMA 2FGWL 4NPYB 3HG1D 1UKQA 1W0WA 2MKWA 3ZTNL 2R56H 4X6BA 1MJUL 4QRPD 4L4TE 4YE4H 5HI5C 4X7TB 4S10A 1AE6H 2LV4A 3CCHA 3RZCC 1OTTD 1A6ZA 5J6GA 4R0LC 1JPFA 4XNMB 2NYYD 32C2A 3LVEA 4PJAE 2MCPL 5HHVH 3DMMC 2VZOA 4PJHE 2GCYA 4KTDL 3QFDB 3S9DB 1UQSB 3QAZC 2ITDA 5FUCC 1BEYH 5EUKB 1Q0YL 2APBA 2C1OA 3DMMB 2BVOB 4U6VH 5HHNA 4ELMA 4FZ8H 1EHNA 4FZEL 1L0YA 3MBEC 4PP2B 1RZJC 4YXHL 5EBLA 1R3KA 25C8L 1NGWA 4P4RB 1VACB 1KIPB 3MBEB 1TNMA 2BXZA 1WZLA 4AEEA 4FTVE 4R6UA 1YDPB 5D5MB 3QYCA 2D7MA 4E0RB 3H9HA 1EZVX 1OW0C 2VRAA 4Z7NF 3IETB 1P53A 2W07A 3CUPA 4XX1E 1RIHL 2WW8A 1BF8A 4C54A 1J8HA 4LSTH 1ZTXH 3OJVC 4JQVA 2AJ3B 1BM3H 3FRUB 2W9EL 1IGTA 4Y0GA 4LF3A 3WKML 4HXAL 1YUHA 3P0YH 3W9EB 2F74B 4BQ6A 3BEVB 1K3ZA 4AT6A 4WUKL 4U6YA 5KS9B 4ZFGL 4LU5L 2DKUA 3UJTH 4ZUVA 3QUZC 5EUOE 1EFXD 3TWCL 1QLFB 3JWOL 3KPRB 3C9NA 4LLYB 3QEHA 4ZFOB 3CXDL 5C0FA 5C0BA 5E8NB 1MI5B 3OF6D 5JORA 5CD3B 3ROLB 3CDGA 3RUGE 3D3VB 5CEZH 2HTLC 1L4IA 1QSZA 1U8IA 3REVB 3A0OA 2XQYG 1MCQA 2PF6A 3QWQB 4F37K 1MCPH 2E7HA 5SWSD 1EAPB 4NNXA 3TBYA 3BUYB 1KLGA 2VL5A 3LIZL 4NQED 3LB6D 1WTGT 2NXZD 4HUUB 1CFQA 3K8KA 3ZKMD 1XIWC 4GAGL 1HNGA 2I26N 2VDOL 3IDGB 3BH8A 3RGHA 5JOPD 2H2PD 5EO0A 2IQ9H 3T0ED 1OTUC 2YPVL 4L4VD 1XIWB 5AG9A 1OAYH 4PJDF 2P8PA 4HKJA 3ZE1F 1U93B 5KVGL 1YPZE 4X8XA 5MHSD 4JE4B 2CRYA 3KPQA 4N0UB 3EHBD 4RX4A 3QULA 3E8UH 2DWDB 5KBNC 1GGIL 1U8QB 4I8DA 1LO4L 5CP7A 4MA7L 5HTSA 2FB4L 1IT9L 4LQ1A 1K3IA 1UKTA 3U2SA 3TNNB 2QL1A 2V2WB 4QXGH 4R7DB 2XTJC 2AK4D 5IEHA 2DAVA 1WAAF 2Y1VA 4R2GC 4OFVA 4NQUA 2VDLH 3DGGB 3MREA 2XTJB 2FECL 3M17A 1UA6H 4R2GB 1MRCH 3C5ZD 3U9PL 5I1IL 1NBZA 4FXGA 4U3XA 2GJZA 2DLHA 1OAQL 4JHBA 1AKJD 4X6DE 1KLUB 5CZVH 5EBWB 1NL0H 1ZE3C 1I9RH 4NQDD 3EYOA 1LQSR 4PJ7F 4HGMA 5BJTA 1IAII 2YKLH 3BZFA 4HKZA 2GTZA 3GUTB 1DBJL 1OP9A 4QGTA 3CLEL 1EUTA 4H0IA 4UT7H 5DT1L 4M1DL 2FDBP 4C56D 2R1YA 1TZIA 3IDMA 2VZTA 4Y4FD 4M7ZC 1AR1C 3DXAD 3FQRA 3IJSB 4Q6YA 3VWKA 1ERNA 3NCEB 4Y19A 3NACH 5JNYA 4X9FA 1ORQA 4J1UA 4M7ZB 4RGOH 3B8YA 5E4EB 3T65B 2YS4A 4M7JH 3LQAH 1U8LB 4KGLA 1K8IA 3U83A 4MS8D 5J8OA 1MH5B 3ETBF 1MCIA 4V1DB 4MJIE 5HHQA 1JP5A 1BAFL 1IILE 3HRZB 4OFDA 4OT1H 4QTHB 4P2RD 4WI3A 4GRWF 4Y5XA 1XF3B 4LBEA 4QYOA 1E4XI 1IGFH 3CNKA 1I7TB 5F3HB 3GSRA 2WUCL 1BZ9B 1P5UA 2AEWA 4K8RL 4DKDC 3FB6B 3N1QC 2FJFB 1NAMH 2OMNA 1NBVL 4J6RH 4EDXB 1UXSB 4HJGB 3T0AA 4G6AC 1A7PH 3V0WH 5L7XL 4WJ5B 2Z4QB 1FPTL 3JWDL 2EYSA 1ZANL 4KKAD 3W39B 4TULH 1PKQA 3T2OA 1OAUL 3CVHL 4J3OC 3C6SB 4HUWB 4LHQB 3L3KB 2GKIA 1G6VK 4UB0H 2ZKHH 1T1WA 3FO0H 3U7WH 2IADB 3MV9A 5DZOA 3C09B 1DQML 3T0WA 1NFDB 1MIML 1IMHC 2ATKA 2XI9A 2GW5A 2JJWA 3H9ZA 5GIRB 5DQDH 4QRRA 1ES0A 4LEXL 5C07B 4XC1H 2V7NA 5GJSL 1QRNE 2DQUH 4XVTL 3ZLQC 2Q76A 4NDMB 1CIDA 3QO1A 2J4WL 1A6WH 5EIIA 1N6QL 5KOMC 3KYNA 1MHHA 1NAMA 2XN9B 1AXTH 4DVRL 2B1HH 4OCSH 1FNGB 1KBGH 1AJ7L 3ZE0F 2DRUA 4U05A 1AGCB 5CKAA 2Z93B 1RZ7L 1VSCA 4MDIA 5D72H 3P4OA 1S7UA 1I1FA 3BPOC 4M6NL 3QBTB 5B39B 1TZHA 1F13A 1JN6A 4DKAA 3HI5H 3O4OC 3C08L 1AO7B 4UMGA 1B4JL 2IGFL 4P9ML 3MRJA 1RZJL 4DGVH 1N2RB 3UTQA 5FYLH 3O4OB 5I30H 3FO2A 3EGSB 2ESVE 3GMPB 4M62L 5FGBC 2ADGB 4YO0B 4Z7NE 3PDGA 5FB8A 1C5BH 1MWAL 2BSTB 1N5YL 3TBVB 1GGBL 2IANE 2L7JA 1BVLA 4YWGH 1BQHB 1T0NA 1EGJL 4X7SH 3HKFA 1J88A 3O45B 4BH7A 1N4XH 5MEND 2L4OA 2OBGA 5D9SA 1N0XL 4J2XA 1TJGH 5CCKH 1U3HA 3AAZB 3L95B 3RPIB 1CXFA 2G2RB 1SY6H 2FNBA 1UH4A 4OLUH 3T0BA 3IXTA 4JFPB 3VG9C 4CU6A 1WEJH 1RJZB 2GJ6A 4GXVH 2YEZA 5JIIA 5J11C 4GSDH 1ONQB 4PBWD 2CSPA 4M5YL 5GRWA 3V6FA 1NC2B 1T21B 5L8LB 1VADA 3VG9B 4ZFOL 1M7XA 4LLWA 5E2JA 5EORH 1ZLWH 3HZKB 1U6AL 5J11B 4OGAD 2BVEA 1JWMA 3MLSH 5F7WC 5DRNB 2E9WA 4PJIF 5A16B 1WSST 3BP4A 1CL7L 2VSCA 3IFLL 1RMFL 5LXGL 4OQTA 1S7WB 1JGLL 4YPGB 5TF1L 1NGQH 2DJ4A 1CFVL 5F70A 1MPAL 3FQNA 1S5IL 1K4CA 3DO7B 3WE6B 3MXVH 1XGQB 1GVIA 4U1HA 1XF2A 3LEXA 5IFAL 4HWBL 1FGNL 3FTGA 1SY6A 3QUKB 4PJDE 1U95A 1UKSA 3OKLB 3ZE1E 1T5WA 1MCKA 2VZ3A 3ARDC 3QIUA 4YHPB 5C0CB 4WY7L 3R0NA 4JN1H 5MEOB 4LMQE 4TNWK 5H35B 2AJSH 5DJ0B 2YK1H 3V0AC 1IC7L 1IZKA 3VXRD 4LPXA 4YGAB 2Q7YB 3VFSA 5TPWL 1HQRB 1FNLA 3LRGA 4PY7A 4KQ3H 2I9LB 2FBJL 1WAAE 2BFVL 2X4QB 3F7VB 3QWOB 4NJ9H 5I1LA 4HUVA 4NHCH 3BT2L 5INDB 3U0PB 3K74B 1KG0A 2DB8A 5FYKD 4KC3B 4KK9D 1BJ1J 3H9SE 2BDNL 3DVGB 4CVXA 1IEAA 1NSNH 1RUML 2HG5B 3PABA 3VFWB 1J1PH 5HGAB 1P7QA 1QSFE 4RQQA 1ZS8B 4R4FL 3FONA 5FAAA 1VFAB 4RGNE 5IG7B 3WXVL 4UV7H 3DTXB 1KB9K 4CDGC 4YBHA 1T20B 2CKBA 3QIBD 4PJ7E 3HNVH 5JPMA 1PZUB 5D7IB 4H26A 4LCWE 4KMQA 4U3HA 4OI9A 4FNLH 1NFIA 3HZYB 4GXUN 2AEPH 4P23A 4X4MA 4OLVL 2Q3AA 5KSAA 1A1OA 5EC2A 3BP6A 3DSFH 4RIRB 2H1PH 5SX5H 4DKEH 2R69L 2IPKB 4FQJH 2D7NA 2QQLL 2ZSWA 1JGDA 2JELH 2GSIB 1IAKA 4P46D 1KCRL 4RFEA 3LN4A 1EUUA 5FA3B 2P47B 1PLGH 3AS3A 1YEHH 5FM5M 3QQ3A 4O2EA 1RV6X 1RHHB 1GOGA 1RIUH 4YDJA 3BKMH 1JK8A 3ARYA 3ZT6A 5BQ7A 4EI5A 3O3EA 2GTWB 4GRWE 5CJOL 1I3VA 1TNNA 4JZJC 4XWGH 4JHAL 3WUWB 2AQ2A 3OXSB 5IB5A 2BNQE 4MJ6B 1CFSB 3EYVB 4YHOH 4M7LH 3RDTA 4JKKA 1VEMA 3HG1E 3Q3GA 4OZGA 4WW2A</