4A68A

Mutations in the neighbourhood of cota-laccase trinuclear site: d116n mutant
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSNGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Role of Asp116 in the Reductive Cleavage of Dioxygen to Water in Cota Laccase: Assistance During the Proton Transfer Mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords SPORE COAT PROTEIN A
total genus 147
structure length 502
sequence length 509
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A02
1J9TA 1XB6A 4G71B 2VW6A 3NJIA 3NJFA 2BW4A 4KO7A 4A2FA 5AFAA 2NRDA 2PPDA 1RZPA 2H3XC 4TXVB 4DP8X 4W1TA 3ASNB 2YXVA 1KCWA 2FWLB 1W6LA 1AZUA 1PCSA 4QKTA 5PCYA 2HX7A 3FU9A 6PAZA 1IKOP 3S3CB 2HZHA 3NSDA 1GY2A 1JZEA 4GP4B 4BDVB 5B7EA 3QQXA 3FU7B 5I5JA 3FU7A 4E9WA 3X1GA 4AKPA 2IDUA 3S3BB 3EF4A 3FQ1A 2XV0A 2VSKB 1TEFA 2XVBA 4E9YA 1NTDA 1WA2X 3AZUA 5I5IA 1GS8A 3H4HA 2IH8A 1NIAA 3NJLA 3BQVA 4A68A 4DPCX 3ZIYA 3QPKA 5B7MA 3NJHA 1ET5A 3UAEA 1M56B 6PCYA 3WNJA 3WNIA 4E9TA 1OE1A 2QDWA 1SHXA 2HLEB 3SBRA 2EILB 1PZAA 2UXFA 3TASA 4A2DA 3G5WA 4JHUA 3NJMA 1WA0X 1B3IA 3PCYA 1NIEA 4YSTA 2GC4C 4BWUA 1PZCA 1MG3C 1JXDA 1PNCA 2HRGA 1SFHA 3FT0A 3ZDWA 1AS8A 5AZUA 1BQ5A 1MDAA 1NWOA 5I28A 3PAZA 2YAFA 1SHWA 1TEGA 2B3IA 1NIBA 3FPXA 1KBWA 1GY1A 2BZCA 4NB7A 1I53A 2EIKB 3UABA 2UX7A 1CC3A 2TSBA 2VW7A 1N70A 2FNWA 1AS6A 4DP7X 3DKHA 1ZPUA 1A4BA 4YSAA 3V9CA 2GI0A 3PXLA 1ET7A 1R1CA 3N2JA 4FA7B 2WO3B 3AG1B 2LLNA 4UANA 2CJ3A 1KGYE 2QPEB 2N0MA 2J55A 4HZ1A 3FSAA 1X9UA 5D4IA 1JZGA 5I6MA 1KDJA 2PP9A 5I6OA 1HAWA 3FSVA 2GC7C 2XV2A 3OM3B 2BP8A 3AG3B 4PCYA 2QPDB 1E5YA 2IWFA 1CURA 2XX1A 2VMJA 3T71A 3TBBA 1TU2A 3H4FA 3T9WA 7PAZA 2IDFA 3FQYA 3NSYA 3QJRB 3CVCA 3EH3B 4HCFA 1ILSA 2CALA 5B1JC 1ZDQA 2QDVA 3FQ2A 4GXFA 4JKNA 2VN3A 4YVUA 3X1NA 5EHFA 2Y69B 3ASOB 3IN2A 1WS8A 1GR7A 3UADA 1L9SA 3FS9A 8PAZA 3HEIB 1NZRA 1IBZA 2J57A 1JVOA 1NDTA 5D4HA 2XUWA 2AVFA 1NPNA 5B7FA 3TBCA 1OF0A 2DWSA 4E9SA 2Q9OA 9PCYA 2PPEA 1ET8A 1PZBA 1XMEB 1SNRA 1OCOB 4E9RA 2FT6A 2ZWNA 3FYIB 1OV8A 3IN0A 1AZRA 2YAHA 3FPYA 1M57B 2PPAA 1NICA 2HX8A 2R7EB 4BWWA 1CYXA 3PAVA 5ANHA 3TU6A 5B1BB 3EH4B 5E9NA 3QJUB 1W6WA 5I6NA 2XU9A 2UXGA 3CVBA 2I7SA 4HHGA 3NJGA 2HX9A 2AZAA 2BZ7A 2PCYA 3JTBA 2YAMA 1ZDSA 1VLXA 1AAJA 4HALA 4NAJA 3X2QB 3WIAA 2FT8A 2DYRB 1MG2C 3EH5B 4YSQA 1BQRA 2IDTA 1SDDB 1SDDA 2BW5A 1PF3A 3UGEA 2FJSA 1JERA 3BVDB 1AG6A 2X87A 2BP0A 3FU8A 3NJJA 4E9XA 3T6WA 4F2FA 1AQ8A 2J5WA 2MTAA 4BWTA 2HXAA 1X9RA 4CSPA 1OCRB 2BWDA 5I6KA 3X1EA 4HCGA 4DP0X 3CVDA 2PLTA 1CUOA 1GS6X 1E65A 1BXAA 3KW7A 1JZFA 1BAWA 2OCCB 2CAKA 1AR1B 1IBYA 4BK5C 2VSMB 2YAEA 1EHKB 2GSMB 2X88A 1JXFA 4AI7A 4KO9A 2IDQA 1PLCA 1NIFA 2ZXWB 1JZJA 4YSRA 4YSSA 3S8GB 1RCYA 4DP2X 1QHQA 3FSZA 3IEAA 2I85A 1URIA 4M3HA 5B1KA 1J9SA 4MFHA 3ABMB 5I26A 4JHVA 3AG2B 2XWZA 5A7EA 1AACA 2UXTA 4BXSV 4Q89A 1E5ZA 1PMYA 1AIZA 2PCFA 2FQFA 2EINB 4A66A 3ABGA 4PAZA 3MBWB 4GP5B 2BWIA 5FC9A 1JZHA 3PAUA 4KO5A 2PPFA 4E9QA 1KYAA 4DPAX 2H5UA 5IY5B 1HFUA 4HHWA 4L0PB 1TKWA 4QLWA 1PLBA 3U25A 1JXGA 1J5DA 2DV6A 1A3ZA 4ZK8A 5PAZA 1BXUA 1J9RA 3NYKA 1IUZA 3GXUB 2UX6A 1AG0A 1SFDA 2FQDA 4WTQA 1WA1X 4DPBX 2EIMB 4M4RB 2FTAA 1GW0A 4YSCA 2JFCA 1GYCA 2PP7A 4GY4A 4HCIA 4UF7C 2ZOOA 2DWTA 2PP8A 5F7AA 4AX3A 5I6PA 4YSEA 2DY2A 1L9QA 3CG8A 4CSZA 1E67A 2CUAA 1JZIA 3ABLB 4KNSA 2JKWA 2IAAC 5F7BA 5I5MA 1OE2A 1PLAA 2Q5BA 2W88A 2GB2A 3ABKB 3TA4D 3T6XA 1L9RA 2VM3A 1BYOA 1FWXA 2I7OA 2XXGA 4AKQA 1J5CA 3IBOA 4KNTA 2VW4A 4A2EA 2GIMA 2BHFA 1DYZA 1DZ0A 3S3DB 3OMIB 2XV3A 1L9OA 1XB3A 4BDVA 4N4YB 3T6ZA 2W8CA 4X4KA 4DP9X 3OMAB 1ZIAA 1OOWA 2GBAA 7PCYA 2YQBA 3WG7B 1NINA 3PLYA 3QJSB 1A4AA 5B3SB 4P5SA 4YSPA 3UAAA 4G7QB 4F2EA 2BP8B 4WKXA 1ADWA 1A8ZA 2GHZA 3H56A 5TK4A 2QT6A 1V10A 3WKPA 4DP5X 1OCCB 1W8EA 4KNUA 4NERA 5B1AB 3OQRA 2P80D 5D4JA 3IE9A 2IWKA 4K9JA 1F56A 1NPJA 5AKRA 3WI9A 2DYSB 3SBQA 4G7RB 3ZBMA 2YAPA 1ASQA 4YSUA 3CDZA 1MZZA 4KOBA 4DP4X 5I6LA 1GSKA 2P80A 1M9WA 2PPCA 1KBVA 2H47C 3DIVA 3NP3A 2E86A 1V54B 1ASOA 3RYMA 3X1BA 3QJQB 3C75A 4W9ZA 2ZONA 2FQGA 1PY0A 1T5KA 1FFTB 3NJKA 5TK2A 1ID2A 1OCZB 3ZX1A 3V9EA 3X1FA 4YL4A 1ZIBA 4FAAB 1ILUA 4ENZA 1AOZA 1KCBA 3D12B 2FQEA 1MZYA 3N55A 3T6VA 2UXVA 1QLEB 4P5RA 2IWEA 4AKOA 1BYPA 1PAZA 4F7KA 1KV7A 3GYRA 3S8FB 1EZLA 2IDSA 2WO2B 1KDIA 4AZUA 3MX0B 3GDCA 1JOIA 1ETJA 1L9TA 1SF3A 2TSAA 1SF5A 4G7SB 4N8UA 2B08A 3WKQA 3NP4A 3CZUB 2XLLA 1NWPA 2HRHA 4YSOA 1V55B 2AZUA 4HIPA 1ASPA 1OE3A 2XYBA 4A2GA 1XB8A 1WAEA 1A4CA 4Q8BA 3NSFA 2CCWA 3AG4B 3PPSA 2JXMA 3NT0A 1AZBA 2BP0B 2A3TA 3OD3A 4EF3A 1AZNA 2AANA 1AZCA 2AFNA 4BXVA 3NJNA 3FYEB 3JT2A 1AS7A 1AANA 4DP1X 1NIDA 2MRYA 2YAOA 3QJTB 1RZQA 1UATA 3ERXA 1SJMA 2YAQA 1BXVA 1FA4A 1N68A 2OJ1A 1IC0A 2WSDA 2J56A 1BEXA 1PNDA 2EIJB 3L45A 4YSDA 5B1JA 4GYBA 2RACA 3NSCA 1A65A 1BQKA 2XX0A 2FT7A 2BO0A 5LDUA 3AY2A 3CDZB 2YXWA 4G70B 1J9QA 4YVNA 1YLBB 4G72B 4KOCA 1HAUA 3OMNB 3SBPA 4E9VA 4HAKA 2XXFA 3AW5A 4A67A 2R7EA 1E30A 1WS7A 2VM4A 1RKRA 4KO6A 4A2HA 3UACA 3QJVB 4UAHA 1CYWA 1JVLA 4DP6X 1QNIA 1ZV2A 4RH4A 3HB3B 2OV0A 2Y1AA 4GP8B 2IH9A 3FSWA 3KW8A 1GS7A 1L9PA 3SQRA 2YARA 2CBPA 3EHBB 3DTUB
chains in the Genus database with same CATH superfamily
4IBQA 2OYPA 3LV3A 2VW6A 4HJJH 3EJPA 4S1DD 3RY4A 4PFEA 2WWMC 2WVTA 2FJHA 4KO7A 2NRDA 3V5DB 2YEZA 4F93B 5I0ZA 4W68A 3FFCA 2VUOA 1CL7L 5IFJB 4AH2B 1E8WA 1FFRA 2VABB 3PFQA 4NO2A 4OCMC 2ZCHH 5TGBB 1W15A 2NT0A 3KR3L 4NQEE 1PCSA 2KDGA 3O11A 5EU7C 1DBMH 1I7RB 3GMRB 3QARA 1KUMA 2ARJB 4GOSA 1YEIH 1TSHA 4K73A 4WUUE 2D2CC 3Q8EA 4NNPH 3QFJB 2NYZA 5IQ7L 2O61B 2WXKA 4CVXA 1ZT4A 1I9JH 4LQFL 4XWOD 3NRQA 5DR5L 4P2YA 5I0VA 4XPFL 1XF5B 4WUUD 2N7BA 3IBEA 4XH2A 3U9UB 5E6SB 3AZUA 2ZQKA 4QT5A 4WU5A 1JWSA 3TJPA 3U0TB 5TJWK 3NJLA 1T83A 1D9KC 4AQAB 5B7MA 3RWCA 2QTVA 4OZGB 3ES6B 4ZS6C 3VI3A 1G94A 2B77A 1QZNA 3QXDB 4WUUA 1NMCB 2ROXA 3EIFA 4IOIA 4OAWA 4W9DC 4GS7B 1AVAA 5I8EB 1TZIB 4XNMA 5GGSB 3LPFA 1IGML 1R5IB 1QEXA 3N40P 1NGYA 2K45A 4OZFH 5BZWA 4QDGA 3CU7A 2OTUB 5HVHC 5T8IA 2ZF8A 2NYYD 4ICXA 1WIOA 4UTCA 4OZHE 1V5JA 3CHXA 1A9EB 4MWFA 4G1EB 1BPVA 3C6SB 4OCSL 1ACYL 4YSTA 4R90H 4GW1B 4NZFA 3RX7A 1PZCA 5CBAA 1JXDA 1ZLWK 4QPEA 5K1NA 3SBWC 1YJDH 5ANMB 3IKCA 4LOFA 4OF5A 1DFXA 4OJFL 2YKKA 3NCBB 4JRLA 3MKGA 2AXHA 5FECB 1KMGA 3K4DA 2EUWA 3LAFA 3WD5L 1I8LA 1JK9B 3QDGB 4UT6L 1FI8C 1FV1A 1IEAA 4NZTH 1QTYT 5C2BL 4ZS7H 4FFWC 4G6FD 3NZ8B 1UUNA 5FO8B 5DDHA 3QE5A 2C1OB 1FYTD 3DDFA 5F6IC 4GW5B 3V4LA 3MFFA 5I71C 3MRHA 2Z93B 4K7FA 1M7DA 5D1XE 4XBPB 1IJ9A 1CFTB 3VA2C 3D50A 2EDBA 3EG9A 3FUNA 4MJ6A 1AO7D 2CDGB 3MXWH 4N9GB 3GRWL 4JFED 4ABWA 5CJOH 1HAWA 2AQTA 2EUXA 1WIUA 3QUXD 1JPTH 4I48B 1SXBA 1BREA 1M7IB 3EYFA 2VMJA 5D7KD 4C4KT 1JK8A 3B2VH 2NY1B 4PY8J 5HPMB 1JJUA 1O6VA 3GSRA 3T65B 4XNDA 3W56A 1CT8A 4V1DE 4HJGA 2QQQA 5D7LA 1ILSA 5HDWA 3V5KB 2OMYA 2V5SA 3VXMD 4E0RA 4F2MB 4XPAH 2A1WL 2Y2YA 2LU7A 4JM2D 2DQEH 3KLAA 4PRPB 1ZV5A 3C2SA 4KKNA 2VAAB 4FLQA 4RGMC 3QUKB 4K3EH 4GUPB 3AQYA 4F7PA 1MRFL 1FHGA 4NC1C 3CXDL 4U2YA 1HJCA 2X53A 3VFVB 4N25A 5IFAH 3LEXA 3RY5A 1DLHB 4IDLA 4F8QA 5J3HC 2JE8A 4Y2DA 4UQ2B 1UM4L 5JW4R 1W0VB 4O2CB 1DQLH 3TBCA 2AJ3A 3DVNA 4E9RA 1SNRA 5H4YA 1P4IH 4FA8A 5IV2B 12E8L 4FOMA 1P1VA 1AZRA 3RL1A 3SZKC 3VWJD 3ECUA 4YH6A 4XO3A 4BFBD 3AU1A 2PPAA 4H1LG 3ULVE 1FVDB 1VPOL 2AK4E 4PRAB 3TIEA 2O5YH 2ISDA 2GSGB 3CCHA 2R0ZL 3TVMA 3IK2A 4ZMTA 1W6WA 2WNXA 3OX8A 2B9AA 4J3OH 2DMGA 4PJ9A 3GM8A 5MEQA 4ZSOA 3HW7A 4NWTH 1JV5A 4ZTEA 3EFOB 3P3TA 4FLSA 2GJJA 2WZ0A 3FRPG 2CMRH 1TJXA 1RUMH 3K2UL 4L2YA 3OJMB 3MLPA 1T0MB 3MV9E 4M9OA 3MR9A 3CFEB 3TESA 1ZA6A 2A83A 4ALAL 5JPMC 1CFVH 1TO5A 1NEPA 2NDFA 1SBBA 3B2XA 3QCUH 3KXFA 4UM8A 1S9WA 1S7UB 1KELH 4FG0A 1ZK9A 1VA9A 3O45B 1CTNA 5EBWA 4BA8A 4M93C 1XCTA 3T6WA 3QFDB 1XZ0B 3QDMA 4KX7A 3GSXA 1GC1L 1F11A 2QFPA 4XO5A 5E8NB 2P9RA 4U4IA 5GGTA 5AEAA 2HXAA 4FNLL 4HGMA 1ZS2A 1YMME 5GGVY 4GNKB 1FNSH 2HRPH 1MAML 1OY3B 2L0DA 4FYTA 2EC9T 1G7HA 1BXAA 2FO4B 3VQMA 3H3PL 2BSCA 3L3KB 4PW9A 4LFHD 4B41A 3HLAA 2VSMB 2AV7B 3OBAA 3QJHB 2V6HA 1KELL 2X88A 4XPBL 3E3QC 5KS9E 3AMLA 1EVUA 3D05A 5E00B 2Z92B 3OTTA 2EE2A 2IDQA 3HAEB 4KKCC 1M1XB 5T3XL 2PABA 3PWPB 3FH5A 1M05A 2OXHB 2CLZA 4YC2B 3OB0H 2AV1B 1CLZH 2XN9E 3QCTH 4JG1H 3T77B 5IB2A 1WO2A 4X83A 5GGRA 3VSTA 2NNFA 3LN9A 5BZDA 3CN2A 2XVKA 1E5ZA 4L37A 2IFFH 4FLRA 4Y4FA 1I31A 4F91B 4NNXA 5A2AA 4PV8B 1RUKL 1IAIL 3KPOB 4WUKL 2HG0A 3C60C 4IDJL 5DEZA 3IJYA 3U7WH 4B9IA 5L2JA 3CLEL 5F0MB 3R0NA 4FKHA 3FT9A 2ED6A 4QRPE 1PLBA 3B2MA 2OYMA 1J1PL 4FXKB 1CDHA 3VTAA 3MA7B 4WIQA 3QIBB 4XO9A 1I8LC 4GIPD 2DL9A 3IAGC 1X7SA 4GY4A 2WLKA 4LIQH 2ZOOA 4HEME 2W65A 5HI3C 2YPKA 1UURA 1WQVT 2HT4D 5EO9A 4PCKA 2FGZA 2UZIH 5DJCB 3WS6A 1NBYB 1TQBC 1SMAA 2C4XA 3MTXA 1E67A 1H5BA 4XVTL 4R3SB 1TNMA 5KBMA 1CLOL 1PLAA 3V4UH 5C6PB 3OPZL 1NAMH 3UCRA 4L8CB 3BAWA 1Z9SA 4PJXF 1N5YL 5D7LD 4KVCL 2ADFH 2I7OA 4ISVA 3RURA 1GOFA 2YQGA 3Q8FA 4DP4X 3QHFL 1GSMA 3GUTA 4NENA 1U8PB 4Y5YA 1KPUA 4RSYA 2DJSA 1NC4B 3FCBA 1DYZA 2X0UA 4RX4D 4ZUSA 2FWUA 5EC1A 1IAOA 1FIEA 3GJFA 5ESVA 3SGKC 4LPVA 1DANU 4AWJC 4QCIA 3IMSA 1XB3A 3SKUD 1MPAH 3QEQD 1WYJA 4EN3A 1ZGLM 4KZEL 4HIXL 2XPZA 4PG2C 2BIHA 3CZKA 4JO4L 2DQMA 2FGWL 5B4MD 3CZNA 4XVSL 5T33L 1FO0L 1UENA 4LCUB 4C83A 5IBLD 4G7QB 1F3RB 3V0FA 2X2IA 4DW2H 3MRDA 2QT6A 3NA4A 1U8HA 1BF8A 4KXCA 1DE4B 1HL5A 3C08H 3PY9A 5DFWH 1UOWA 4IEFB 1OM3H 1SEBB 2D7TH 1G5AA 4GRLB 5BS0E 4M4PA 3DMMB 3EJTA 5EU6A 2OR7A 3DX7B 4ODHL 4OGYH 5D1ZA 3QZWG 1EAPB 3CDYA 4LDOB 1L0QA 3OSKA 4WHTB 4UV4H 4JJ5A 3VI4B 1JZ3A 3TXAA 4HUUB 1ZHLB 3PGFH 1XF3B 2EO7A 1FVCB 3Q2WA 1USZA 1TCRB 4N6RB 5T3ZL 1ASOA 2HTLD 3KPSA 3PQYE 3C75A 3BJLA 4ZAKB 4HPOL 4IIZA 5LWYL 4WI0A 3DC0A 2Y07L 4G8EA 5F7EL 3PU7A 3Q13A 1P4LA 4NQQA 3TWCH 1QBLL 3TTSA 3QUZA 3X1FA 3S9DB 3MU3A 4ENZA 1KCBA 5GS1B 3QZWB 1QLRB 2JCWA 3OPUA 4JFQA 4P5RA 5E8EB 4J3UA 4EVNA 4JM4H 1TZOA 2X1WL 2AEOA 1VACB 5T3ZD 1A4KA 3OHXA 1GA2A 1CF1A 2ERJC 2ADIA 4N5EC 5CUSH 4QHLA 1KEML 5E2VL 2WKLA 1IKNA 3ARFC 1T0PB 1OGTB 4G6FB 1SF5A 2G30A 4GG6E 1BHGA 2AEPH 1N9PA 3INOA 2VRAA 3D9AH 4JHAL 5CP3A 1DBML 5E6IB 2DM3A 2AQ2A 3TX4A 2ZYIA 1CO1A 2EYSB 1CFNB 2Y3NA 3KYMA 3QXTA 5CR1A 5L7XH 1CXKA 4KRPD 3Q0HA 3B4NA 4UINL 5K9KB 1TZGH 2YUZA 5ADPH 4ZOCA 2R2CA 5J57B 5EBLB 2EKJA 3D2UB 2RA1A 3FFCE 2EXYC 1EGJH 1HS6A 2HTLC 2X6BA 3H3PH 4QJ5B 3ARUA 2VLRD 4BXVA 3NJNA 3K46A 3ESNA 2D7OA 5AVVB 4HJGB 1IC7H 3ARBB 4IIQC 3RPIA 2WVSA 1IKFH 3RTQA 5A2BA 1V7NH 2W0PA 3G6DH 4MHHI 3L3JB 1NGPH 3WEBA 1JL8A 3NCXA 2DH3A 1J8RA 4YL9A 4NEHB 3QIUB 2FX9L 4AYDC 2RACA 4E41A 4OD1H 1YY8B 2R2BB 5IIEB 5DD1L 2KHAA 1LO2L 2W0FB 2VISB 4MA7L 3V52L 1TQBB 4KY2A 1MQKL 4BBWA 5D1QC 1UWGH 3PGCA 1LDSA 4MB4A 3T0EB 3VXPB 2M26A 4APQA 1KPVB 2BDNH 2X4RA 3EO9H 3VG9B 4AM0Q 4PVBA 3WD5H 1JVLA 1NGPL 1PL3A 2ED9A 1GZQB 2J8UB 1DUYA 4FD0A 4BGDA 1RK7A 4YE0A 5HJ3B 5EH1A 4Q6IC 5AUMB 4PJIF 2O6FA 1ZKAA 1Z5YD 1HZKA 3EYOB 2IAMB 2VN5A 5E4AA 3PWLB 3D07A 4QTHB 2R59A 1K3ZA 3NJFA 2R0WL 4MJIA 2EDLA 1HYRC 2Z4TA 2JQAA 3IFLL 1IFGA 3LZLA 4RWYH 4JO1L 1IL1B 4GEJA 1KB5L 3ASNB 3V4PH 3I9GH 4M48L 5GGUA 3FU3A 3T5WA 1KG0A 2K9UA 2WV3A 3DPDA 4HKXB 5T1KB 1AO7E 1D5IH 1XZ0A 5CO1A 1UASA 2GI7A 2NY1C 4L1LA 4RDQG 1CLOH 2VKXA 1JF1A 1S9WB 5KVMC 2IAMC 2VERN 4IOFD 2WM0A 5IKCB 3MV9D 4ZJ9A 4I2XB 4JKWA 5DJZA 1K8IA 3KPLB 5DVMA 5E2WL 1KLGB 4AKPA 3FQ1A 1IV8A 1CFSA 2G9HA 4LU5L 5E2JA 3KYNB 4PRNA 1RZ8A 1WCBA 4CN6A 5I5IA 4PWEA 5IF0B 4J1UA 1I8AA 2PYEB 2CM5A 3SJVB 4MQXC 4PP2A 5CFAA 1TJGL 3NIDE 3QK0A 5CFHA 2YS4A 1OWRM 2E9GA 1J1OL 1OE1A 3G5YB 3TVMB 3MMEB 1BOGB 1QTPA 4N8VA 1SQ2N 4WNQA 4DFIA 3K8KA 4Q58C 3W3BA 1K2DA 2XA3A 4XMTA 3IJ7A 3L5WB 2GBUA 1UXSB 1KULA 1JMZA 4R4BB 1RVFL 1YC7A 3MRHB 1K5NB 2XTJE 4K7FB 4PTUA 4Y9FA 4KV5E 5E8DL 5BVJA 3ARBC 4GRMA 1A66A 3QEQE 1UZ8A 2JELL 3NTCL 1GKOA 3GMMB 4MB5A 2XIBA 5BW7C 4GKSA 3EDEA 3RIAF 1V8HA 2WQRA 2HJKA 3MHZA 3SY6A 3SYPA 4HUCA 1B2WH 3QQ9C 2HUHA 4XRCB 4N2FA 5EC2B 4NJAL 1XH1A 4G7VL 5CCKH 4Q74A 1CC3A 3WHXA 1N70A 1OTTC 1PG7W 4HT1L 4C55A 2ZKHL 5C0FB 5CD3B 4Y2DC 1YEKL 3WJLC 5GZOD 5I2IB 1CXLA 5ANME 4NQDD 3HNSH 1FH2A 3U46B 4OCNC 2PXYD 3D3VD 4M7LL 3SPJA 2QPEB 3V0GA 5TFSH 3IRCA 3T6QC 2E6JA 2NCEA 5CZXD 2V9UA 2WLLA 4PRIB 4AYGA 5EOTB 4ZUVB 3QPXL 2FB4H 2VDPL 4YDIH 4JFWA 2OMVA 2EEDA 2XXCB 4JO3H 3RDTB 4GXUN 4ISVB 3WO4C 5C08E 1ZTMA 3DX4A 5CXPA 4QRBA 3BZ4B 4UIKH 1Z9PA 3A21A 3V4VH 2IXQB 3VFOB 3ELQA 5BS0B 5FKPB 5EZJA 3EJQA 5A16A 1A47A 4AM0A 2X2HA 2W60A 1PBYA 1QUPA 4MA7H 2P3YA 4DKEH 5EV7A 5E8PA 5JORA 1BBDH 3CQPA 4I7ZC 1KY6A 1VF5C 1OT1A 4M6OH 1TQVA 3QAZB 2YZ8A 3QI9A 2UZIL 2WYTA 1ZE3C 3T0AA 4QCIB 1D7CA 5DK0A 5AW8B 3S5LB 5FYJL 4HP5A 3FS9A 4Q4IA 3C5XA 3HEIB 1U8IB 4U1NA 1J18A 1JVOA 2XQ0A 2G60L 2DQCL 2V3DA 3HBGA 5SWSB 4IEFA 4YZFE 1NFDF 2ATPA 3GSNL 2WB7A 3RNKA 2PPEA 3MV8A 1M6UA 4FFZH 3NIGB 1E3FA 1WBZB 3DRQB 3QVAA 2F54E 3MUZ1 5FKAA 2XWTA 1TF4A 4Z95H 1F86A 1PD6A 3FT3B 5CD5D 3VX0A 3PAVA 4PBDA 1MW0A 5TE4H 5C0IB 4MZ2A 3STLA 4CN1A 2W0KA 2RB8A 2CQVA 5AWNH 2J12B 4WJG3 4O5LL 5KVGE 4UOJA 3UZEC 2BNUB 3MA9L 3RWGA 3P77A 4FP8L 5KBLA 3KVPA 1ZDSA 4HCRA 5AZ2L 1HILB 4HEMA 1Y0LB 1YZZA 3SGJA 4PJ8B 1L7IL 2E5EA 3ULUC 5DYOA 4L5FL 1KPUB 3IGKA 3EH5B 4ELMA 1AD9A 3D0LB 3QAQA 3F65A 4L1SA 3HVNA 2BWQA 5DUBB 4F37K 1NL0H 3JWOC 1NCBL 3UGEA 4FCAA 4B9CA 3KBPA 4KJWC 5AENA 3HG4A 4OBSA 1AY1L 4NM8H 1MEXH 4FNSA 4XN4A 4E9XA 1S2EA 2WLMA 2Y7QA 4OTXL 4XNBA 5IHUL 3NCWA 1W8OA 2F68X 3N44B 4I4WB 5C0ND 2QADB 4WK0B 4X8GA 5F2FA 2R69A 1OGPA 1OHZA 3IJ8A 2FEDC 1JGDB 2EXYD 4U6YA 5C0BB 4LVHC 1E65A 4PSPA 1YAIA 2Z7WA 2QKIB 1ZJAA 2OCCB 1MJJB 5CNHA 1KNOB 2BIQA 5IROA 2BSSA 1W72H 2WWKT 2C1PB 1E6JH 3ZT7A 1YEDB 1I75A 2WSKA 3DA0A 4FFYA 1DJIA 3KM2A 4YSRA 5KS9A 3VGAC 3PQYD 4TV3A 1EDYA 3IDXH 4KTEH 1AXTL 4M3HA 1HH9A 1QX1A 1TTFA 2AW2A 3BDBA 4UNTA 4Y19E 4AL8C 4HXBH 5J7CC 3B5TA 5IEHB 2Z7YA 1NFKA 3IMTA 4UB0L 3BQUB 1NFIB 3MLVH 2A9NL 3IGLA 5L8KB 4WW1A 4OCSH 3DTXA 2D03H 2WANA 2MOGA 3HNSL 4FNQA 3UYOD 4HUNB 4HV8A 2E4TA 1YMMA 4BM7A 3GB7B 5IF0A 1IC7L 2EDDA 3MBWB 2BCKB 5C9JB 4MCYA 5CLXA 5IY5B 5GRYA 4ATWA 2XTJD 4JAMB 5IB3A 3HC3L 2O6DA 5HDBF 3RWHB 3KXFE 3TEXA 4D8PB 5JO5B 4NIKB 4QTIL 4Y4KB 5K93A 4ZMWA 3GXUB 3QPQD 1AG0A 2BIPA 2FQDA 3QXUA 4X8XA 5B22A 3B9VA 4PJXB 4DPBX 5IFJA 3TEUA 4OFDA 5FB8B 1H3WM 1ZOXA 5JR1H 1MHHB 4LO9A 3HHMA 3V55A 2NY2D 3W9EB 1G7MA 4E36A 4OQTL 1DBAL 4U6VL 3WNLA 1SHSA 4AX3A 5GS0D 1HEZB 2WQ8A 5I6PA 5EDXA 5AB1A 3CG8A 3CZFA 4HH9B 3TPUA 2FLMA 5CIPH 4DETA 2G2NA 3ABLB 4KNSA 3HJ0A 2AQ1A 1OE2A 1XEUA 3PWLA 4UOW1 4JZJB 2X2YA 3MRFB 3GBNH 4DTGL 3FSOA 3ABKB 5IMOA 1L9RA 3O4OC 4XCYB 5DJYB 5GZND 1FWXA 2OMWB 1ES0B 1MF2L 5IQMA 1JHTB 2C7UB 3P1VA 1S9XA 5T1MB 1GJIA 3B5GA 5EN3A 4MJIB 4TVPE 3T09A 4GSRA 4RNRB 2BK8A 3OMIB 4IU3B 4LNRA 5E51A 3WEMA 3JVGA 3TT3L 4M6MH 2ZG1A 1T66D 2RGSA 1NGYB 4JVUA 2XQYG 5CHNB 5DZOA 5FYKL 2H0JA 5GZOA 1KLGA 1WICA 5J6GA 4NZUL 1FAIL 3EZJB 2WTOA 2A9MH 3KYNA 1NMBL 4MNHA 4PRNB 5HHQA 5MEND 1DTUA 5EUKA 3VXQA 1F5WA 4FI6A 1TQWA 2VJ8A 5FHAH 4Q6YA 1U91A 1QFHA 5D5MB 3VGDA 2D3LA 1K8IB 3KPLA 4JFEB 5TK4A 1OCCB 1IEHA 3F85A 4Y4HD 5H94A 4MJIE 3M1BB 3QQ3A 2MOQA 5DHEA 3SQOH 3VH8G 5KSAD 1CQKA 4ZMNA 4B9GA 3KGUA 2ZXQA 3QQNA 1YEHL 1RJLA 2EEFA 5E95B 4RFOL 5IW6A 1MXDA 3CVIH 4KOBA 3WN5C 3NEOA 4JHBA 4OJAA 3MLZL 3STZA 2KLSA 4ODBD 4WENB 3T0EC 1G6RH 2YGVA 4OFYA 4DPRA 3EHBC 1OP5K 3X1BA 4ODSH 3A4EA 2IADB 5JQIB 5FDYA 5A6IA 3N43B 4UTAH 3BGMA 1DVUA 3UH8A 2FATH 4ZDHA 3VXRD 4P23C 2PNDA 1NBVH 1NCTA 3GD1C 3U36B 1WD9A 5JIMA 1ILUA 1UQSA 2V17H 2WB1A 1HIML 3PF2A 5C6WH 5C71A 2XVLA 1CWVA 2HJFA 3GEWB 2BHZA 3TURA 3F7KA 3ZSTA 4N2GA 4F7KA 4WLCA 2FWSA 1GGBL 1LEGA 5DJ2A 1XGZA 1NGWA 4RGND 4UTAL 4ONHA 4UB0H 1JPFB 3I02A 2WKGA 1S7WA 4XPHL 1ETJA 3DGGA 4FQ2L 4GBXD 2K6WA 3MBXL 4BFNA 4JFDD 5E6YA 4TLKA 2VABA 3JSSA 4Y1AB 2IH1A 4N22A 4G7YH 1T6VN 1QD0A 2HUEA 1E2ZA 1SM3H 3LZQA 3OKLB 4YBQC 4AT6A 2P24A 5EO0B 1NC2A 3S5LG 1HCYA 5AW3B 2AJUH 1D9KB 2FJGB 4YR6B 1W0WA 3UYRH 5FUOH 1RIUL 3HMXH 4QRTB 3B1TA 3JTTA 1PEZA 1DQLL 3Q43A 2ZXBA 3KMDA 2AANA 3GKWL 3RVUC 2WD0A 2FNBA 5IMKB 1N8OE 4QNPE 5LCVA 2WZAA 4NZDA 3D9AL 2DI8A 3QI9C 2DEWX 1XO8A 1EWHA 1SBSL 4NS0A 3GJFH 3AGVA 3ULUH 4YHNA 3DX6A 3QWRA 4FQJL 4MBOA 3RWDB 2XNAA 4MNGA 2YSTA 4AGPA 4QHUB 1QBAA 4HAFA 2YXWA 3NG5A 5DHXB 5E5MB 4NPYB 2CLVB 3Q8AA 4NYLA 1P2CA 1ZXKA 1UWYA 43C9A 1ORSB 2FEEL 3SCMA 5C0EA 1C5DB 1EBAA 2GAZA 1XFPA 5BZXA 2DQHH 3LNDA 4B95C 3QUMH 1MCOH 1F41A 2QZQA 4QHKJ 2NR6C 4MAYB 3RG1C 4IHOB 2EVJA 5ID1B 1XCTB 2XN1A 1ETB1 2OI9C 2VQ1B 2WXQA 4JZNA 3CFJA 3UTPD 1ZEAH 4XP1L 2A74C 4LSRH 4OKVB 3ROLB 5I1AB 1THAA 4M29A 3BKCL 2WCSA 3PDOA 1MCEA 3VWJC 2E8ZA 4R6UA 3C8KB 1AI1L 3VNYA 3BVTA 1EJ6A 3DV6A 4DHLA 4L9DA 2BW4A 3OWRA 1WEJL 5SX4H 1R33A 3WEAA 3V5DA 2Z93A 5C97A 4S0HA 2PYEA 1G9NC 2V9TA 3HE6B 3LQMA 1KB5B 3TYFA 1G6RB 1W16A 2QQNL 2X4TB 3D87B 4GXVH 3KLKA 3S3CB 2A74B 1X5ZA 2P48B 2BM3A 2OJEB 4KHXH 5J1AB 1QSZA 2C9VA 4OKDA 3QIBC 5B7EA 1FO0H 1JXKA 5TPWH 2DLIA 3QW9A 1OVZA 3FC8A 1RP9A 3PL6A 1MLBB 2SODB 4UM9A 4JY4A 3V4VB 4KITB 4JK0D 4LAQL 1RIVH 1BMZA 4KPHL 3IWUA 1GS8A 2XC8A 3UTZA 4P2AA 2IAMD 4IOFC 3OR6A 1M56B 5AKVA 3K6SA 2GSIA 5F7FA 1F4AA 4AIEA 1NL0L 32C2A 1AOHA 3ESMA 2TRYA 4NKOA 1II4E 3QIWD 1DEEB 3A22A 2XN9A 3THMH 4IOIB 4KHTL 3MA7A 2LE9A 4GUQA 1CDIA 3RY6A 4ECNA 5CEZD 1NAML 3FHEA 1AFVL 3I6SA 4B9KC 5ALCL 4OIIL 1MI5A 5J8OA 3HPJA 4AMWA 2OMTB 2MIZA 2NW3B 4LMQI 3RU8H 3BUYB 4L3EA 1X5JA 4G83A 3QIWB 2WAQA 5FYJU 3WNPA 3F00A 5EBMB 5MP6H 4CVWA 3TN0B 2DWXA 2W80C 3S3SA 3IKCB 4JFYB 4ANUA 1N0XL 3RQ3A 1YEHH 5AZUA 5D71L 3F7VA 2CCLA 4JFUA 5F96H 5EU7E 3BVVA 1KJ2L 1SHWA 3T3ME 1OEZW 4GKZB 2DQDH 1I53A 4JFFD 4P23A 5I1HH 3VXMB 4LB8A 3DIFA 3VFMB 3H9SD 2XG4A 2W9DL 4XC3H 1NC4A 1LNUA 3STZB 3SDAC 3DETC 3V9CA 5BO0D 1CF8H 1ZK5A 2AXWA 5CSGA 3B34A 2XWJA 2F8XC 4XAWL 1ZA6B 1HSAA 3RX8A 3T0BA 5JOFA 4OF8A 4IRJC 1YN6A 3ZDZF 3EAKA 3R8QA 2F6AA 1AGCB 1PS3A 2FJFA 4HZLB 1B0GB 4DH2A 3W38A 5DTFB 5JPNB 4LPUA 4C83B 1F11B 1RZIB 4AUYA 1KGWA 2EE3A 4BFFA 2XA8L 5GJSH 1MJUL 3O6FA 4AENB 3HG1A 5MENE 3V4VL 3V0WH 1IJNA 2GJPA 3UYPA 4JRYE 1DBKL 4LSDA 2F53A 2R27A 1F4WH 3SJVE 4MXQD 2DI7A 4G6AC 4W9CC 1EUTA 1QBLH 5BO1L 4WO4B 2RFXA 3T0DA 3FDWA 2NMSA 4GXFA 1LM8V 3I2CL 5EOQL 4JKNA 3IVKB 2HB0A 5KZCD 2IANE 3QDME 1F3DJ 2LHAA 1XF2B 1ETA1 3PHAA 5DO8A 1NZRA 3W5NA 2KZBA 4XP5H 2GK0A 2YK1H 5E6RB 5C0DA 2Q86B 3ATEA 4WHYH 5BZDB 5HGGS 3ZDXE 2A77H 2AJ3B 3FTZA 4MZIA 3MLRH 4F15B 5M95B 1RJZA 3FUIA 1OCOB 2YFNA 4K9EL 2ZWNA 3QNZA 4TYUA 3ZYOA 1VB9A 4MDRA 3M1BA 4QD2E 5FW7A 1WZLA 5ANHA 4KKAD 3EH4B 1FZOA 5LGJB 2GBVA 5EORL 3CVBA 4XNXL 4HJTA 4MNQD 1VZGA 1W80A 2J8UE 3FRUA 3K7UA 2JI2A 2J2ZB 4ONOA 5EOCL 5HSFA 4CA4A 3N1PC 2YC1A 3O8XA 4P2QA 2APTA 2DQHL 4JMNA 1QHOA 4TUJB 4NZRL 5DURB 3F58L 4MLSA 4MQXD 4ZW3A 2QJDA 2XQBH 4CSSA 1XH3A 4WTZA 4NKDB 2NY0B 3DXAE 4K23L 2ZT9C 3O45A 2BP3A 5HHVL 1AQ8A 3BPLB 4FHJA 5CZVH 1H8NA 1X6LA 4WI8A 4B53A 2YOCA 1HH9B 3VWJA 3SE8L 1AXIB 5BV7B 4L8BB 1P5UB 2LABA 2WQXA 4NSKA 3QWNA 3WEXA 1UOLA 1GS6X 3RZCA 2YD2A 3QA3B 5MP6L 2L8AA 4KJPD 4N85A 5BXFA 5C6TH 3HS0B 4F2MA 1SXZA 1XGRA 4Y19B 3BN9C 1NM9A 3UTPE 1I8KB 4K2UH 3S6CA 4JRWA 5IW6B 3P40A 5IQ9B 1BPLB 5D2NC 5LG1A 3AFLA 5J56B 3FUHA 1J9SA 3L2NA 2VUKA 3AG2B 4UQAA 4LMQE 1OAZH 4FCHA 1XTMA 1Z6JT 4CILA 1Z3GH 5D1XA 5ITFB 1SMOA 5E6IC 5JQHC 3MFGB 2N1TE 2Q7NA 3E8UH 4ETQA 4M6AA 4ODUB 3ABGA 2FECI 2FX8L 1OTSC 3BOVA 3GT6A 1IM3A 1Q9KA 4HSAC 4MA1C 1KEGL 4GFTB 4QLWA 1TKWA 3C5ZD 4Q14A 1JXGA 4XI5D 5CLZA 2BRQA 5FX3A 2XJKA 4NWUH 2ESVE 1BZ8A 1BXUA 1DVFD 3E1F1 4OM0L 3R1GH 1TVHA 4YHLH 3QYCA 2D4FA 1GGTA 3BP4A 3P0YL 1QUNB 3UJJH 2C7UA 4RWYL 4PMEA 3ZQWA 4NPYA 5GS0H 4OZHA 1XAUA 1TXKA 2A0LC 2QFRA 3O6LH 4JFPB 2QADC 2D0HA 4JPKH 3OB8A 3QUZB 3RJDA 1GTFA 1IC5L 4XTRC 2GY5A 2I25N 2XTSA 1SYSA 5HYQB 4HWEL 3RVWC 4ZAKC 3CZLA 4JJOA 1YYML 4YDKH 4ZFZB 2Q5BA 3VI4E 2WVUA 1MHEB 4OKVA 3LPWA 2R8SH 3IBOA 4C8XA 5D7EA 3JWOL 4JFEA 2XN0A 4MHHG 4H88L 3L3GA 4JUTA 5J1TC 4N87A 5BCAA 3GZKA 4JDEB 4HF5L 3DO3A 4PBWD 1X5YA 3BGFB 4YK4C 2A6KA 1ZVYA 4LT7A 5I1EL 1MKFA 1WGVA 4BK5A 1SJVA 1FL3B 4FZ8H 3CZJA 4POYA 1E5CA 1WZ1L 4KGLA 3WNOA 2NY6D 3CLEH 1NBCA 3AB0C 5IB1B 4FTVD 4Z77B 1J12A 2GBAA 4N26A 4UUJB 1J86A 3D4YA 3FB5B 4Y5VB 4YWGH 1MJ7H 2EJ1A 2AJZA 2VDLH 2WLJA 5DJDB 1HKLL 4B5ZA 5JHDD 4Y4HA 3HBPA 3V7AE 1B0RB 4IRZA 1BM3L 5FA4B 3NQKA 2ZAIA 4AV4A 1IGJA 3OR6B 4MRCA 3SKOB 2CIKB 5D6DA 5B39B 2HVJB 5JPMA 2Q8BL 2YPLB 5TE6H 1NPJA 1GAFL 1TJMA 3U0WL 3WI9A 2E27H 3GO1L 2RH0A 1ZLVH 4X9FA 1C1EH 4A55A 3MI6A 3ZDXF 3BWAB 3N04A 2P80A 1UZ6E 2DDQL 1OP3H 3WDJA 3WY2A 3CLWA 1V54B 2VXSL 4PREB 5ETUA 1HCFX 4LPXA 4EI5B 4YMPA 1SVZA 1OZTG 1A6ZA 3BMWA 3RU8L 1U8NB 5E8OA 1P5VB 4JY6A 3VB8A 4PIRF 1PD0A 5CEXB 2Z0UA 3II1A 5GZNA 4MS6A 2AJXL 4FFYH 2R29H 4BH8A 1AOZA 1QWNA 3TO4B 3ZL2A 2WQSA 3VTTA 1ZGLB 1S5HB 3EYSH 2XWCA 3L2MA 1R3HB 3L9YA 3ZT6A 2XY1A 3CJJA 3TYGH 3ZDYB 3FU0A 4NC0B 1QFWI 1BD2D 4AEIH 1TETH 4GBXA 2YA2A 2YXFA 2AEWA 4HSQA 3KL3A 1ETZB 3WSQL 4YN3A 1I1RA 2HJLA 1RUML 3K2UH 4N0UA 5F0JB 3EOAA 1DJWA 3LB6C 2TSAA 3C8HA 3UZEA 4KTDL 4PJ9D 1FVEA 5IGXL 2LLGA 3ZK0A 4L4TB 4P5MA 3VFTA 2XN9B 2ENPA 1KFAH 3MGAA 1FL6B 1VADA 3HFMH 2XNAB 1RZ7L 5AB0A 3AG4B 4P4KC 2E7HA 4NUMA 1D3CA 2XA8H 2ZX6A 4NO0D 4OIAA 2PTTA 1O6SA 2R2HB 4ZMYA 5KVEL 4YGVB 1QQDB 2X4PA 4IKLA 3SJVA 4XAWH 5EZIH 1P4BL 1BQSA 4PJFF 2X2UA 4OCLC 4XBGB 4AYEC 1BG9A 4N2KA 1FJ1A 2EIJB 1U3NA 3PDGA 4JM2A 3L4ZA 2JJSA 3IFPB 4JFDB 3NSCA 5DC2A 4NJAH 2DTML 3TEWA 3B7SA 3MV7D 1MJUH 4FFVD 3ECWA 1HZLA 4QF1B 4HS8H 1NUGA 1QRND 4UBDD 3B6SA 5DK2A 4FQHB 4PJAA 4EDWL 1FSKB 4IYKA 1E4WL 4CC4A 4A67A 1T1YA 3UP1A 2OZ4L 4AGOA 4PLKD 5J89A 4JG0H 5H4ZA 3BT2H 4MDJA 3QORA 3ZKXC 4NQVB 1B4RA 2H4EA 1QZ1A 2X4UB 4PYHA 1SPDA 3O0LA 1DQQB 5BJTA 3V6FA 1SOKA 2OV0A 4OI9A 4QUOA 1AKJB 5B39G 1E28B 3K2KA 3EYOA 1JHLL 2IAMA 4X5XA 5JIDA 2YPVA 3L3DA 5D1XD 5H8DA 5AALA 4K7PL 1MCHA 1CLZL 2QPFA 4ZMAT 2V7HB 4NQSA 1CF8L 5ADPL 2AK4B 1SJXA 1P7KB 2PPDA 3EGSA 4UNVA 4XMVA 5T3XE 4ZX3A 5A2KH 4MA3B 2BS9A 3BLPX 4OF6A 4Z3EA 2YXVA 4NKDA 2IPTL 3N3EA 4ZQKB 3I9PA 1KG0B 3SB3A 2V5MA 2N7AA 3EOTL 2HKFH 2EYRB 5BRZE 2ED7A 3QS2A 2C26A 5HJDA 5IJBC 4N8CH 5BZZA 4JPIB 3ZY7A 5KVGH 5DRWB 1HHHB 1MI5E 3LOWA 4ZFOB 1DQMH 3FU6A 4RQQB 3FU7B 4WO4D 2YPLD 3S88L 5LBGA 1QFUH 4N0CD 1EAJA 2JMRA 2NY5H 3BO8B 3S3BB 3M1CA 1BFOA 2VSKB 2WBJD 1WCBB 3AM8A 1VAHA 2TAAA 5AAWC 1Q9OA 2BMKB 4UT9A 4AH2A 2X40A 4FTVE 3DJTA 4J3BA 5IQLA 4V1DA 2LU4A 4OB5L 4M02A 3QIUC 5E2TL 1UB6B 2OW7A 2X1PA 2Y7NA 1UVQB 1A6AB 2EICA 5KVFE 3SBRA 3DUUA 4YBHA 4MQ7B 4PRBA 4IKNA 2ZOLB 4XCEA 1KIRA 1AI1H 2HMID 5F9OL 3G5WA 1IO4C 4P3DB 4MD4B 5FOBB 1WA0X 1XF4B 4R4BA 4NUGH 1BFSA 3RL2A 3WSQH 4L3CB 1NIEA 3BYTA 3MYJB 3TL5A 3V8OA 1A6PA 1CD9B 4X6FB 4Z5RB 3L4TA 3TEYA 2GPZA 2MCPH 5EWIH 4PJCE 3ULVL 2D7QA 1KWGA 1LHZA 3S98A 4EI5D 2HKAA 2JKNA 4G8GB 1KIUA 2DJUA 1MFCH 2QPSA 4JR9L 2M83A 4L9LC 5AUMA 4EZJA 5LXGH 1GY1A 4XXDB 5F6IB 1JPEA 1PY9A 2IEPA 4H20L 4LP5A 1F90H 3CGTA 4WJKB 5DHMC 1XGPB 3M17B 4DGVH 1RZFL 4JFTA 3IGAB 3WAJA 3DKHA 3IETB 4EUPA 1KPRB 4L29B 1Y1DA 4NQXB 4W9HC 3VFRA 3L4UA 2GQHA 2X9ZA 2GI0A 5EN2A 3D52A 3RZCB 2XPGB 3N2JA 5JIIA 3IJHA 3RVXC 5KBDA 3PP4H 2VZ3A 4HK3N 1EZUA 5ANMA 5F70A 4OZHB 1ZVSA 3VFUA 4I3SH 3U7YL 2YMXL 3ZSSA 4PCSA 5E9DD 1BF5A 2XV2A 3PNRB 1B3JA 3FQWA 4Z0BH 2BP8A 1WFMA 1ONQB 3N1GC 1WAAF 1MOEA 4WI5A 5E2UH 2RMNA 1MFDH 2F53D 4I4WA 1CURA 5EF0A 3L3KA 3LS5H 2Q86A 1SY6A 3BZEA 3HLAB 3Q1SL 2QSQA 3B7UX 3QZMA 1WFJA 4EN3B 4H5SA 3S37L 4F1SA 4IIQA 4NIYE 1M2OA 2YWZA 3NAAL 5IP4A 3TC9A 1S7SA 1EO8L 3CXDH 3IDNA 3VXSE 2O6EA 1AC6A 4H0HB 4JN1H 5B1CA 3KYOA 5IVXF 5C7ZA 1KCLA 3UADA 1FLRH 1GPOH 3VXRA 3EGDA 1NGZA 1WC7B 3TP4A 1CDCA 2BSTB 3MV8D 1KN4L 2CIKA 4YXHH 3QCTL 4JG1L 3TBSA 1AGFB 5B39A 5I6XC 1T1WB 5JHLH 2X6VA 4M7ZC 4DWHA 3IJSB 4UT6A 1NUDA 3H9SA 2HPOA 1OF2B 4XXCC 4IKKA 5AYUH 4I0KA 3TBYB 5I82A 2XWTB 2FIRT 4G7YL 5FKAB 3PHOA 3GMQB 4S1QL 1I4FA 1CYXA 2BCKA 4G8AC 3CVHA 5HGBB 3MRIA 4Y2OA 2K1MA 2EADA 5EFIB 4J27A 4PIBA 4PJ7B 3GMPA 4NN7C 4UZGA 3CFUA 1HH6A 1NGQH 4G3YL 4S1SH 2R1YA 1P4LB 1FRGL 2DM7A 2OCJA 3CSYB 1T2XA 3ZDYF 4CNIB 2IH1B 3HG1D 3ISRA 1INQB 1T21B 2OL3H 4GUCA 3WIHH 1BQRA 4CC4C 4QHNB 3UTQA 5ABAA 1DBBH 1IQWL 1Z0MA 1Y07A 5HP5A 3MOBH 2BERA 2LR4A 4XPBH 5C09B 4CDGC 1RI8A 3UPAA 1FC2D 1ZHKB 4YDJA 1N12A 2BP0A 4UT6H 1YEWA 1ADQL 2EZ0C 2MTAA 5F9WB 2PMZA 5ISZD 4XT1C 4OJYA 2A9ML 3VRLE 4P4RB 3OB0K 2QR0A 2BVUA 4LKCB 1DBJH 5CCGE 5CIPA 4OV5A 1CUOA 1ACYH 4XOAA 1G9ML 3UC0H 2FR4B 1JK8B 4GQRA 2WZ6A 5JPMB 3ILEA 4O02A 1J0YA 3WTTA 1S8DB 1ULVA 3R18A 5D7LB 4ZMQA 2HKFL 2P5PA 1QLEH 2GSMB 2C3WA 2JB5L 4EQ3A 1F42A 1SXAA 2J1ZA 3WDHA 2E7DA 2Y1ZA 3MN8A 4F8LA 5EEZA 3H9YA 2ZXWB 1KV3A 4NQDE 5SWZA 1P2CB 3MOAH 3QJFB 3OPZH 1TPXC 5EU4A 3IPEA 4Z7UF 1N26A 3WTVA 2FEJA 1V3MA 2K7PA 5IEHA 5AZ2H 2X38A 3SPVA 2OTUA 3POCA 1S9VA 1JZ5A 1MHPH 2BC4A 4GQQA 4I0PC 3RTQB 1KZQA 3LTVA 3KWVA 1Y6MR 1R24A 1CXEA 5F7NC 1DSFH 3BH8B 3L5XH 2OYLA 5H37G 2DQEL 3WHE0 4X6DF 1VPOH 4K23H 3NCYP 4ZW5A 1VDGA 3Q1EA 1CDYA 2C9PA 5C9JA 1ZANL 3EDKA 2ZUUA 4KBPA 1HFUA 2EO1A 3WFEH 2BLFA 4HHWA 4MMZB 5CZVL 1MWAH 3JVFC 4B3EA 2A6DA 2UZXA 4S1RH 4LCWE 4ETYA 5ALBH 1BYNA 8FABB 4ZK8A 4XN5A 1SUHA 1JXJA 1ETZA 1WA1X 2ICWA 5TD4A 4PJXA 5DYOB 3ECBB 1VENA 3WXVH 4ADIA 1J11A 4YSCA 2CR0A 4GG6A 1JSYA 3M46A 2WIIB 4OD3L 4I5BA 4OLZH 2DJ4A 1LD9A 3DJZA 2F8VA 4HKJA 4FKKA 1NFAA 4X6FA 3N41B 1FPTH 3KAAA 4ABUA 4JJHA 4HHAB 1JZIA 2A9BA 4TPRH 1R0AL 1MAKA 2P28B 4M5YL 3T2OA 3CX5K 3MRFA 4OJCA 4XMKL 3E1ZA 4A2MA 3IDXL 4KTEL 1CQYA 2EH7L 3B2VL 2QV4A 3AROA 4PJFE 4XXDA 4I77H 2X4OB 1MCPL 4L18A 2VW4A 3M8OL 4YXLH 3WNNA 3OKMB 4RFEB 2YRLA 4JO1H 4MJ5A 3VXSD 1A1MB 4M61A 4AXWB 1IM9B 3CFKB 4LSUH 1D5BA 2EEBA 1NAMA 1B4LA 4IU3A 3S3DB 2ENYA 3ZE1B 4TF4A 4QXTB 4R4FH 5I73C 2WXJA 4DP9X 4TPRL 3OMAB 2XICA 2EDKA 3CDCA 4PRHE 4W9IC 4AGLA 2B5IC 1U2CA 3UAAA 5DRWA 2QMKA 3ARXA 4ZFOA 1PKQA 4FG6D 1Z5HA 4TSAL 2VC2B 4IRSC 1Z66A 2BP8B 2ROYA 2GCYB 3WKPA 4PP2B 4MAYC 1A7OH 2KBGA 3ARWA 4NERA 4XP9L 4ES8A 1XSJA 3F5WA 2P1YA 3SOBH 2OXGA 2PCXA 5IV2A 3FQXA 4LOVA 3ZBMA 3DX9B 3EFFB 1SXNA 5GS1C 5I0DA 2VSCA 1E40A 4ENED 3GI8L 5JUEH 1GGYA 3EJRA 3TCXA 3QUZC 4X5XB 1ND0B 3OVUB 3ZR6A 1PD1A 3K6IA 3NIFE 4IBLT 1A9BB 1T7WA 5D7KE 1ORSA 2GUYA 2AC0A 1YQVH 2NSXA 3QZPA 4ZBJA 2XHNA 5T5FH 1X9LA 1IB5A 2ZD0A 3OHXC 3CFCH 4U6HA 3DJRA 1FSKC 5DTFA 5EC2A 3VSVA 3T6VA 3JXAA 5IM7B 3MYZA 5D1ZB 1KGUA 2FZ3B 4AK1A 3S35H 3KXFB 4UM8B 3CTTA 2VDRB 3EYQC 1CPUA 3DPBA 1MW3A 4K94L 2ZP0T 4FABH 1KXTA 2BOLA 6FABH 3HI5H 1KV7A 2L7EA 3MNWA 2R2EA 3MRPB 1U8LA 3UDWC 4DZBA 2C4FU 3IF1B 4F8NA 4FQ1H 5C3TA 3I6GA 2OSLB 3NFSH 3L3OB 4KI5D 3B2DC 3UMTA 3EDDA 4FNPA 4HLZH 4PJEE 2A7BA 3VFRB 1QQDA 4G7SB 4RNRA 3NRPA 3KEDA 4HKBB 1VGKA 5J13C 1V55B 2DMKA 2EDNA 4TL4A 2ZSVB 3C6LA 3P02A 4D0BB 2D7MA 4OF3A 4KVNH 2EH8H 1A4CA 1IGIL 2BOBA 4XNQB 3GI9L 4I9XA 1UKTA 1VACA 2P5WA 4OZGE 2LOEA 3RUGB 1JRHH 3OD3A 5I18L 2R0WH 2BVPA 4B97A 1RLWA 5FOJA 4L05A 3UZQB 1KT2A 1MFEH 2DIEA 4P3CL 2VIRB 2ZKWA 5DGQA 1COBA 1JD7A 1JUFA 1BZOA 1AS7A 2P5EA 5EG6C 3RJQB 5ICYB 1LK3H 1ZLUK 2Y7OA 5GJTH 4EIGB 3JTSB 5ITBH 3ATAA 5E1QA 3E6FA 1LP9F 2XZAH 2BXYA 1V3JA 4HS3B 4XVSH 1MCIA 2WUBH 3O9WD 2W92A 5D8JH 3TV8A 4RGNE 4G70B 2I27N 4X98B 4WQOA 3WYRA 2EH7H 3OMNB 2WLHA 1P7KA 2CXGA 4N1CA 5C8JA 2VLLB 5F0LB 3NQIA 3OXRA 4H44C 1I4FB 3VXNA 5EWIL 4ALAH 4R7DB 5B8CB 1E3ZA 3HC4H 2EO9A 2PCFB 1OF2A 5IGXH 1KJMB 4WNSA 5SWQB 1OLLA 3LVTA 1ZD6A 1EV2E 3QG6B 1QNIA 2OMUB 4GP8B 3QORD 1EO8H 2YD3A 3MUGA 3PWJA 5D2LF 3RWGB 2ZNWA 4WWOA 4PBXA 5CS7A 5EU3B 1S3RA 3CZGA 1EDQA 3HHSB 3TBWB 2UZXB 1NGWB 1A3LH 4OCWL 4TXVB 1S78D 1BD2E 1YUHB 5I0YA 1KBBA 4WI9A 5BQ7A 3E2HC 4KK9D 3MV9A 2IPTH 3ARED 2C9XA 1FN4B 5AD0B 3PP3H 4HDIB 2Q3XA 1QP1A 4ZNCD 4PWHA 4NO0B 4HOWA 2HZHA 4U1MB 1HWGB 4P4RA 4U1IA 4U31A 1Z7JA 3O6KL 4FQJH 4GO6B 5FKPA 4JDZA 5A16B 1N4XH 3P3UA 4IRZH 4XHJD 1JHLH 5EO1A 4AQ8A 1HQRA 4JKPH 2FYVA 5LWYH 1KTKE 2WZPA 5D7JC 1BVKA 1M71A 3TBTB 1WRFA 4M43H 5DA0B 3GJFK 5KVDL 2GJ6A 2OK0H 4XGZB 1H8LA 4XH2B 3JWDL 4G6JH 4X5WA 3KPRD 3MUUA 3UTZB 3BEVA 3G7TA 4KI5F 3CPLB 2E7LC 2VDKL 2RFXB 2YZ1A 3LH8A 4J3OG 4DVRL 1VFBA 4AXWA 2DMHA 1CG9A 4P2OC 1TT6A 2MJWA 2JKXA 4R96A 4M3KB 5DRNA 2QVIA 5KUMA 1AIFA 2FVNA 3MO1B 5FV1L 1E4HA 2EILB 5FGSA 3CSFA 1QBMH 3HPJB 4X9GA 2ZE0A 3HKFA 4NT6B 5LG6A 1OQXA 1OCWL 1KTJA 1XHHA 1QSEA 4S11A 4OFIA 1UEYA 3CSYA 1PZ5B 2DTSA 4FJZA 4K7PX 1GYVA 3VD1A 1INDH 3WMSA 3L8QA 4P5TC 4KXAA 3WBDA 4BKTC 2XY2A 3AT9A 2W9EH 2F1BA 2PO6D 2IBZX 4FZ8L 3WTWA 2Z65C 2EE9A 5M94B 5HYSA 4N0YH 3PAZA 4PH8A 2YAFA 2YWYA 1KPVA 2X4RB 3FOLA 4KI5E 4KUCD 3E38A 2L04A 1RY7B 3H0TB 4YDVB 3BFQG 3L9BA 2PXYB 1IILE 1O0VA 3D3VB 5FGBA 2TSBA 3VFMA 4YX2H 4H20H 4DGVL 1CTOA 5BUPA 4UZUA 1MHHA 1RPKA 3ESUF 3DNKA 3TGXA 2QZ5A 2V3FA 2R8SL 4HPYL 25C8L 4ZPTA 1AJ7H 1CDUA 5I1IH 2C34A 2X4SB 2QBWA 5D1ZD 2YC1B 1BMGA 2EDRA 2XWBA 3A6CH 1JNLL 5F88B 5L4FA 1PSKH 5A2JH 2EIBA 2DH2A 4O02B 3GJEB 1NCUA 4RDQF 5GGVL 4GRMB 1G6RA 3AG1B 1P84J 4M6OL 1KGYE 4OFVA 3ZTJG 2PW2A 1KGJA 5C7XL 1E4XI 4HUKB 3VXTA 3ML8A 5ITBL 1S7SB 1KDJA 3B9DA 1EX0A 5I6OA 4K5MA 5BUGA 3DO7A 3OM3B 3Q2NA 1SOSA 2D3VA 3FB6A 3LKPB 4QYOB 4YIQA 5EU4B 5ACLA 5JOEA 3OKMA 1LXMA 1H9DA 3SKOA 2DWEA 1GYAA 5DMGD 2F7QA 4CBZA 3H4FA 3GSRB 3HUJF 1KIPA 3FU5A 3U0PB 5K9KA 3BCFA 2RQ8A 3QZNA 3EYVA 5B1JC 5IHWA 1KENL 2WQWA 3AC0A 3VH8A 2Z31C 1NCJA 1U8JA 2EC8A 1MREL 3FHAA 5AWNL 1EFXB 4NZUH 3OHMB 1ZE3H 2OLDA 4OGQC 2O4EA 3FT1A 1R5IA 2NSMA 4HLJA 3A67H 1IBZA 5T1DL 3U4BH 3RP1A 4XC3L 2BOBB 3L3OC 5IQOA 1WTLA 3MUJA 3J27A 5CMAA 5I71B 2D7PA 2YJLA 2IG2H 4FI7A 4EDXA 1PKQB 3MGTB 2UYLB 4J8RB 4PP1C 2DEXX 3IN0A 5K39A 1QI5A 1NCBH 1NICA 1WWCA 4I3SL 4YFEA 5I75B 5C0RL 5K9QI 4OLVH 3C6EA 1A4JA 3AITA 3O3BA 4P46A 4ZUUA 2W0LA 2CPCA 3GKZA 4GI9A 5KYWA 3QC6X 3HUJB 3B2PA 4PB9L 4Y19D 2AZAA 3DMMD 4DGYH 3IT8D 1DVYA 3JTBA 1P7QB 5FDWA 5LN8A 4XNYL 1AAJA 1MAMH 4WEBH 3WIAA 1UXLA 1SJEB 3DLQR 2WN3A 5TF1H 3UX9B 3MR9B 3BHBA 2EAEA 3QUXC 3PDDA 1IGTB 4YHYC 1S9YB 1P7QD 3U83A 1GJUA 2IPKA 3KPSE 4WAFA 1HIMH 3D69B 3VCLA 3BWSA 4R4ND 1Q4NX 3NJJA 3A6BH 3VXUA 2AI0L 3FN9A 2PWHA 4AVKA 3FMGL 2WLLB 4JO3L 3RB5A 1IM9D 4BWTA 1M7IA 2X4NA 5CEYA 3MX0A 5DFVC 1NLBL 3Q8BA 3SD2A 3Q9QA 3K5RA 1O5DT 3SPVB 2J71A 5IOPB 3QDGD 4PJ8A 5IW3A 4XC1L 3HHSA 2ZIDA 5F1NA 1OAYL 3KW7A 4PQXA 2D03L 4LNRB 4ZZFA 3NDZE 2NNXA 3HI1B 4PJHB 3KWWA 3PL6D 3CFTA 3MV7B 4FULA 5GQBA 3DUSA 3QULA 4G8IA 2EVIA 4FQLL 4J3OF 3W9DA 4J4PC 5DRZB 3EJCA 3IGUA 4NI3A 4OCXL 5F3FA 2VERA 4YHMH 5MERA 1EZVY 1ND0A 1NH6A 4YSSA 3RGBA 4QXVA 3C2AH 4MS8C 2I85A 1URIA 1C8PA 4QXGH 4JHVA 1VFOA 5GGRB 1F6FB 2Q8AH 4BXSV 4XN2A 5ESAA 2PTVA 4DGIL 5C0BE 1JNLH 1N64L 2I26N 2Z31B 5HHMB 4UAOC 1XZWA 3W0WD 2BOCB 4ELKB 2Y5TA 4IMLA 3RWDA 1EHXA 3WLWD 5LDSA 1ZT1A 3NA9H 3QQDB 4LVNC 4TUKL 5HI5D 4HQQH 4BKLA 1X7QA 1BCIA 3O2WL 2HLFD 5HTSA 3ZDYE 3RVVD 3U25A 3FQRB 1F4XH 2G0LA 5FK9B 1X5AA 3O4LD 2ZKHH 2AQSA 1IGYB 5PAZA 1N5YH 4JHWH 4WTQA 4QR7A 1M53A 2IC2A 1ZA3A 3KWTA 4JCLA 1RV6X 2ARJQ 5T5NF 1AQKL 5C0AE 1NA8A 2ORBL 2G5UA 3APMA 4RISH 1JBJA 4HV8B 1GHFL 1YPZE 1BZ9B 4NQCB 3NEXA 3S96B 1KZYA 1DCLA 3CMOH 3MREB 3UJIH 4LARL 5FWRA 1JDDA 3V6OA 4TQEL 5IMLA 4RFOH 4MVBC 1OAQL 3ZKND 2D4DA 1XR8B 1UA3A 3KLDA 4JAMA 3I6LE 1IEAB 1KTCA 3BRGC 4GG8B 1YUHA 2AF2A 3GBLA 5J6HB 2XBZA 4NO3B 4WV1B 3WEXB 3B2UD 2F7RA 4ZFGH 1KT2B 5KVFL 3MODL 5LGHL 2GIMA 2ZUYA 3DHMA 2XRAH 3RFZC 1CBJA 1ESOA 3WFDH 2XV3A 1KTRL 1DJXA 2GY7B 4PJDE 4YEEA 5IQNA 3VDAA 1I8MB 2W8CA 5C0GA 4PCTA 4UILL 1S9KC 5J12C 2HFEA 2YQBA 3GLDA 1FHNA 2H3NA 3KPTA 3QJSB 2B2XH 5DHYA 3CUPA 4XCFL 5AG8A 4D9LH 3EJZD 2O30A 4Z7WB 2IOIA 1OAXH 1CMOA 2Q3ZA 3R0MA 2FK9A 3Q2CA 2GUOB 4H8VA 2B0SH 2VN6A 1ECYA 1SXCA 1VFBB 1HCZA 5ADOH 4N0FA 3MV01 5FUZH 3ZR5A 3SDXA 1J10A 2X4PB 1F8TH 3U9UA 4YDNA 1WGOA 2IGLA 2QPUA 3BW9A 2IAND 3DTXB 3DSNA 1IC4H 4P2OA 4X50A 4G7RB 1BAGA 1ASQA 3A5VA 5E5LA 4PRPA 2Q6WB 1FZKA 1BF2A 2QQKH 4KKLC 4P99A 5FYLD 1TQCC 1ZHLA 1PZDA 2H47C 4AVIA 4P5TB 2W07B 3RYMA 5L8JB 4P46C 3IDUA 1P5VA 4JY6B 3ZL4L 1SXSA 4UQDA 1U91B 1WHPA 2GBTA 1QSEB 2X4QA 3B9KC 2KPWA 1SDAB 1JFQH 1YNLL 4U4BA 4FAAB 1IC4L 2DS4A 1QOKA 2BNRE 4GKZA 1HSBB 1WG3A 2R4SH 1D7DA 4KQ3L 3TWYA 1RJLB 2UXVA 3QZWA 1AY1H 3H9HB 4NM8L 1QLEB 4YHIB 3AU1B 3DUHA 1ZHBA 2H3KA 2YD7A 3AQZA 3EH2A 2IH3B 2H0PA 4G8GE 1PAZA 3H7BA 3P0GB 1D5ZB 4EN3D 1Q8MA 5I1HL 4W9KC 3GYRA 4PJCB 4X6BA 4HX1A 4IRJA 4XPFH 5KSBE 3H9ZA 5FR3A 4M4RA 4AZUA 3BGAA 3MRKA 4GW5A 3SGJC 5AW7B 4HIIA 5IJCC 1U41A 2X4TA 1REIA 2KZ1B 3EBAA 5G5DB 1UB5B 3IDGB 5TE7H 2GIXA 3VXTB 1IAOB 3PWPD 3BSZH 5DJ0A 3U6RB 4OZIA 1NANH 4XP4L 4YSOA 3GHBL 4IGBB 5HJBA 1GAFH 2WW8A 3BESR 3JZYA 3DWTA 5A1AA 5IHZA 4N20A 1JNHB 1QLFA 4PD4J 5CU9A 5CCKL 3VU2A 2J1YA 1AZBA 3L1GA 4K3DH 4JZOB 4P0DA 5KS9B 1YYLH 2CWRA 4JN2A 1IFHL 4X7DC 1CZ8L 1URZA 1A7NH 1OAUL 3PHOB 3AMKA 2GSIB 2W95A 3X3GL 1NAKH 1HK6A 2EIZB 1AANA 2NZ1A 5HHXH 2BX5A 1U2HA 2ZG3A 4X4XA 3UJIL 5HYSG 5CEZH 2OMZA 2Y36L 4WWID 3NIFF 2Z1PA 3MV7A 4PJ5D 2CLRB 3E80A 4KZDH 5CZKA 3ME0B 2WUCL 1HNGA 4W4NA 5IVZB 2FT7A 1YECH 2BO0A 2JWYA 4MAZA 4C56B 1F90L 1W0WB 5BRZB 4EDXB 5IMMB 2NY4D 5MERB 4ORGA 2WNGA 3B6SB 1M1XA 2EECA 4NN6B 5DK2B 4WWKD 3N50A 1RZGA 1KTDA 4PJ5A 2JLPA 1L7IH 4L3CA 2OMBA 2YBGA 3O2DA 3RI5F 2AEQL 3WIFA 1CIUA 1UZ6F 1BVLA 4KO6A 3QJVB 3CVHL 4V33A 4PJHF 4UQCA 4PWJA 4CGUB 3D08A 2AABH 1UJ3B 3L1OH 4KRMB 5I15H 43CAB 3FO1A 4FYSA 4I48A 4LKCA 1ZVNA 4LHJB 2JH2A 3WFCL 3ZZ1A 3I3DA 5JDSA 1YMMD 3OX8B 4PJ9B 4QY8A 4NUGL 3D39B 3IJEA 3UO1L 3V52H 5AFAA 43C9B 6CGTA 2IQ9L 1TFPA 1ZTXE 4DP8X 3FN0H 2FWLB 2VAJA 1W6LA 2BRRH 4CADB 2HT3D 1W72L 4NN7B 4C56E 4P5MB 3EF7A 3N41F 3MUHL 3DHJA 1IGFH 4OLWH 4KK8D 3E9UA 2R0LL 1YEEH 3NZUA 4GRLD 5BV7L 3QRFM 4OCRH 3X1GA 1B2YA 3IDYC 3QDMB 2B39A 1RUQL 1NLBH 2IDUA 1F6AB 4GRWF 3UAJD 2QSCH 4QHKI 5LNDA 4MXVE 3VI3E 3K0YA 5CBEB 4OLZL 3C5ZB 1UWXK 5I1JL 5JZ7C 4V1DB 5BO1H 1ET5A 3DVFA 3UAEA 3IU3B 1CFVL 1N6VA 4NC2B 4XMPL 4XZUB 3VGAB 4YO0A 4E9TA 5HYSB 1E9QB 1I7RA 3GMRA 4LL1A 4WZ9A 3KWXA 4GXUM 3RI5K 4Q9QL 2E0PA 2OJEA 1MCQA 4QMEA 2ZOLA 2ZUQC 3JZ7A 5AB2A 4MQ7A 1P69B 4B9ZA 1K2DB 1M4KA 2DLEA 3U9PL 4JHUA 4KMQA 4LGSB 1BZ7B 1J05A 4NCC1 4U1HB 3TJEH 1PEWA 3L6FB 3N0PB 3QBTB 1MJ8L 5EZLB 3SSGA 1A21A 4KGJA 4IMLB 3UTTD 4EQ2A 5TE7L 2UWEE 4ERSL 1Q1PA 2EE6A 3HJEA 3LQAH 3MZTA 5LGJA 1AS8A 1MDAA 3PREA 3KCPB 1EO7A 2UY6B 1TEGA 3BH9A 5JA9A 4KU1A 4JZNB 1I8IA 3J07A 2XN2A 3UYRL 3LKPA 4YIQB 4NNYB 2VW7A 4EPSA 4WW2A 1GMEA 1PQZB 2J4WL 3KL0A 2E7LA 2GITA 2NQDA 5EOCH 2J72A 3JWDC 2FO4A 4AMKH 1BZ9A 3H42H 3ETBF 5C1MB 1JYVA 4MX7A 4ZQKA 3H7LA 1N64H 4YOKA 4PTTB 4ERSH 5GGUB 1LEKB 2PR9A 2J55A 2KQNA 1RUKH 3CHOA 4L23A 1JD9A 2K78A 3DJSA 2Z92A 3TVMC 1MCRA 1U95B 3ZLQC 5EIIA 4OZ4B 5GPRA 3BAYA 4IJ3C 1CU4H 1DJSA 3C09B 3V6ZB 2X2JA 1KBGH 3QDJE 3RGVC 4AM0B 4FDWA 5DUPL 1YYCA 2VE6A 5CZRA 5LLIC 2VB5A 1P9MC 1U8CA 1I8KA 4NGHH 3BSZL 1CFTA 3MJ9L 4NO2B 3QWRD 3PWUA 3PIQB 2P46B 4YVUA 5ISZA 3GK8L 1W72B 35C8L 1AGCA 2D73A 2YGOA 2DQ6A 1ADQH 2X44D 4KMTL 1A0QL 2VR8A 5T33H 4HU8A 1L9SA 8PAZA 5L6YL 3QJFA 3A47A 5TPWL 4RMRA 3UPRB 1S5IH 3O6FB 4AENA 1IGJB 3FTUA 4HPYH 2HFFA 1SJHB 4PLJC 4UT9L 4N0FB 3RL2B 4F15C 1RK0B 4FYRA 4PTUB 2H8PB 3P73A 3VFSB 5FYLH 1I1YA 1EA9C 4GW4B 1XDTT 4JN2B 4IS6B 4O2EB 2XRAL 3CFIC 1NDMB 2WMPB 2YAHA 4HD9A 4OJFH 1H3UA 5C07B 1M57B 2CBOA 3RWCB 3VYNA 5TDNA 1OZUA 3RZCD 2Z7UA 3QUYD 4YFLF 4F7PB 1CK0L 1F4YH 2OSYA 4LASH 2G75B 3Q3GA 2ILLA 2ODIA 4Y9GA 1N6UA 3T2NL 3CU1A 4HJ1A 5I1KH 3PAYA 1JGUH 5DVNA 4MQTB 2VDNH 2UVFA 4BEIA 3P0VL 1OSPH 4Z7VF 2VISA 2W0FA 4OGAD 3FH8A 2K3TA 2M8XA 2Y0SA 5F1OB 2IDTA 4QHNA 3UTQB 5A3IC 4G8EB 3EBGA 3GGWA 2XWJB 4LLUA 1KLUA 1AGDB 5F7HA 1JERA 1X4YA 2GEQA 2ZXGA 3LN4A 4OSUH 4WTZG 2P8PB 4APQB 1SMDA 2J5WA 4JHZA 1JPTL 2ZUVA 3MQIA 4WWKA 3JV4A 1WHOA 4DQOH 4LCUA 3QNFA 4TNVK 4ZSOB 1ZAGA 3ZPDA 4EVNB 5I6KA 1X5XA 2A6JA 5IBUG 4OV5B 4X9IA 4A04A 5CR8A 3GKWH 1CD1A 3T0XA 3U4EA 3NCJL 3SE6A 2MMXA 2YUWA 3QDJA 4JPVL 1D5BB 2CO4A 2FYYA 1IBYA 1DHKA 5G5DA 3MJ6A 2OTPA 1LE9A 1D5MA 4UDTB 5DWUL 1XGTA 2BVOA 2CDGA 3PWNA 4FFTA 4HK0B 1X7QB 2YRBA 4IOSD 2DQDL 2Q6WA 5IROD 1T4KA 2P26A 2MFNA 1JZJA 4LEXH 1B0RA 4U1NB 2MCAA 2IV8A 5DS2A 1D5XA 3FXIC 3QXAB 3IWVA 3T1FA 2UXTA 4FQ2H 1WZAA 3K2MC 2VDML 2LAGB 4Q89A 3JUYA 4F57H 5JIPA 3PV7A 4TN9A 2IFFL 1EEZB 5LNEA 3MNDA 4G2AA 1E42A 1FGVL 3EW3B 3BAIA 2GTZA 4G9FA 3LEVL 4JFQB 5AL0A 1NCAH 4JQXC 2K3HA 4CKQA 4EUPG 1G7PB 5AVTB 3H2QA 1M7DB 3RUGF 1HI6A 2YEZB 3VXUD 5DD1H 3CFDA 3DYOA 3JWOH 4V2BA 4M4RB 1A7BA 4Y16C 3WKNA 1A9BA 1E4JA 1LWHA 5DD0L 5JTWA 5JXAH 1LYQA 5HDBB 4GMTH 1J05B 4JREC 4MJ6B 1YNLH 1IQDA 2HVKB 3ZRFC 5IBTL 4L4VA 1XT5A 2YLHA 4NFCA 3LEVH 4TMPA 1A3RL 3L16A 3TFKC 3IS1X 4IMKC 3G5ZA 2AABL 4PUBH 3GRGA 1TJHH 3QFGA 5DHYB 5E4EB 1Q0YH 1QNZL 4KKBC 1JPSL 1ZMYA 3BUPA 4R5TA 3T6XA 3V0DA 3W0WB 3F64A 3HE6C 2AHIA 1IBHA 2BJML 4AKQA 4D3CH 1JGDA 3HC0A 4G1MB 3UJTH 3G6AA 1JZ7A 1MCWW 2MPAL 4GIAA 3SY0B 4NLAA 2H2PD 1G9NL 4NSKB 1RJYA 3MRBB 2F58H 5BVPH 4LLWB 2EYTA 3LY6A 5FYKE 3DOSA 2OL3A 2X3BA 2W81C 3A3YB 4ZD3H 3N5AA 1DSYA 2Y06H 2V5TA 2Y5EA 4FMKA 2WXPA 4CKVX 4L1BA 3NOIA 4JG5A 2X9XA 1NINA 2OR9H 3BD3A 5FLVA 5B3NA 4Y8DC 4L0YA 5G4MA 4F2ME 3DVNB 5JW5B 1EBPA 3WMQA 3C9NA 4QRSA 5D6CB 2COVD 1PYWA 1KLFA 2IVFC 1PFOA 2EIEA 3BQUA 3FZUD 4NHCL 4NDMB 3QHFH 3VFOA 1U30A 1P4IL 1JUFB 1MCFA 2L7QA 2P5EB 3BVXA 3OQRA 1F3DH 5D4JA 5EC1B 1U8OB 3GSNA 5MENB 2ITEA 5JORB 2CH8A 4PJFB 3PFUA 4NP4L 5HGAA 4K2UL 3GPEA 4QGTA 3FTGB 4YO0B 4X7SL 3QI9B 3ARTA 1GSKA 3O3EB 4Z7VB 4G80B 1DFBL 4PJGE 5DFVD 5JO5A 3HG0A 4J5VA 3ZMNA 1OAKH 2AJZB 4OJEH 4TNWK 4WNQB 2XWBB 3QC5X 3VWKC 3IJEB 2PYFA 3OAZK 3PUUA 3EBIA 4Y16D 4OH2A 3UG3A 4Y4FB 1ANUA 1BIIA 1GHFH 4OZIB 1MCDA 1QG3A 4M8VA 1AMXA 1D5IL 4HHAA 3TA3D 2X28A 2X1QA 7FABH 4OM1L 4CMHB 2IWEA 3QEUA 1Q38A 4TUOA 1RULL 1KXTB 2A38A 1QFWL 4ACPA 3H6AA 2ZG2A 4FTVA 1EZLA 1Y6KR 3UO1H 3QDJD 1GGCH 4K8RL 1A7QL 2BNRA 2Z7ZA 2IPUG 2R69L 4APQD 4HSCX 3MLVL 2ZYHA 5KVEH 3KLAB 1DQDH 1XGYH 4PS7A 1ACCA 4N8UA 5F7DB 5JMOC 1E43A 3TFBA 3VUAA 1VGKB 3NZSA 4PS4L 4Y4KD 5CJXA 1HHHA 5BXFB 4X6CE 3GBEA 1LWJA 4W4OC 2OP4H 1MUJB 2IANA 4NQDB 3ZKSD 2CGRL 4Z1PA 1OPGH 5DEGA 2NXZD 5KN5A 1D9KA 2FJGA 4MNHB 4YR6A 2ITDB 1AGBB 2IF7A 2YD6A 1KBGL 1KTDB 4B27A 1UGKA 5INDB 1GCFA 1AZCA 1MWOA 1CD0A 1KC5L 2WTRA 1FVDA 4PRAA 3PIQA 3F5WB 2RALA 1P6WA 3NTCH 3QQ3B 2OZNA 3FQUA 3RX5A 4OUUB 2ZOKA 4LOUC 5LJYH 3CN4A 2WXOA 4IBUA 5E24E 2OJ1A 4F3FA 2BNQA 3U2SB 1BEXA 3HZMB 1UKQA 4IRZL 4K94H 4FG2A 2XX0A 4PD4K 3IJSA 1A7RH 4Z7UB 1G7IA 5T3ZE 4KFMA 1M6OB 5C09E 4MJ2A 1YYLL 4NYLB 2VLKB 4GIOA 2IGFL 4Y5YC 5K5YA 1HHJA 2KZKA 5FFOA 4IBTA 4BQBA 1RKRA 2AITA 3O6ML 2O5NA 3OLDA 4FQCH 4L48A 2HTKC 2ZCLL 3P11L 1CYWA 3GMPB 5B21A 3VXUB 1DN2A 4H4NA 3QG6A 5AW1B 4NCDA 3MXWL 1UT1A 4M9PA 1TNNA 3M17A 3TZVB 2IH9A 3UZVA 3EHBB 1UCBL 1QBML 3M7OA 2Q87A 3U79A 3ZMRA 3FT2B 4ZFOL 5KSVB 2PO6B 4PI0A 4G71B 5IIEA 1JG9A 2JCCB 1DQJB 4WI2A 2F5AH 3V6OE 4Y88A 2V7NA 2R1WA 1QR4A 2VQUA 2F54B 2XFXA 3MJ8A 4UTBL 1WBYA 4KJQD 1OT2A 4OVUA 1GRWA 1PDKA 3F04A 2XT1B 2DEYX 3ARQA 4M8QB 5ESQB 3ABZA 5HHNA 3KZ8A 5IW1B 1IMHC 1HHIA 2D2OA 2HWZH 4XNUL 2DM2A 3VXOA 1MFCL 4K3EL 4WK4B 3P2DA 1NC4D 3NN8A 4OR1A 4OD1L 4PJBB 3HE6D 4ZXBD 3IU4H 2YRPA 5I5JA 3UPRA 4WO0A 4OLYL 4X4YA 2ENQA 3V6OC 5ESAB 5KSAB 1DL7L 1BVKB 1TEFA 1IAIM 1RSYA 4QHPA 1MH5A 1DN0A 3EOBB 2A6JB 2VLME 4A68A 5FYKU 1I7UB 3NJHA 6PCYA 2R2HA 4HUMB 5IK3B 4OZGF 2YGPA 3FQRA 4JR9H 4M56A 5FO2A 2QVMA 1NKGA 1G6VK 3RB7A 1TCRA 1U3HC 4JPWH 1T7YA 4N6RA 4OT1L 1I8IB 4XMWA 4M5YH 1GYWA 4A2DA 1VEOA 4PU2A 1EJFA 3SN6N 1NBQA 2P49B 4WI6A 3SGDH 3NJXA 3D25B 1I7TA 4G82A 3LS4H 5DF0A 1B3IA 2CHWA 2NY5C 4NPKA 5FUCC 5HYFA 4WHCA 5ETUB 2GC4C 3VXQB 4PG9A 5KG9B 1RJCA 1MFMA 3PUCA 1FH5H 2XWRA 4A7UA 2K4WA 5AAMA 4HFUL 4L3AA 1CGTA 1T1YB 3VRLF 4S1QH 3ARFB 2N7SA 4AW4A 1BLNB 1QATA 2ZOWA 1AHMA 4Z0XB 4TTGA 1PLGH 5T1LA 1FZMB 3JV6B 4QRRD 4XBEH 4LHUB 5D8JL 2EIKB 2UX7A 1EMTH 5F7MC 4P2RB 5I0XA 2IMNA 5IB3B 4XXWA 4Z6AT 4Z7VA 1OGTA 4FMFA 2X4SA 4Z76A 2IJ0C 3VGFA 3WUWB 5KVDH 2UWEB 5LBSH 3LD8B 5E8DH 4AUJA 5CCJA 4LLDB 4F57L 4FA7B 4YNYA 4LHUG 3IDYB 4WJ5B 2V2WA 3BHBB 3NIFB 4NQUA 3HPLA 2EYSA 5C0RH 5D9SB 5K9OB 5E5UB 2O72A 3LKRB 3LYRA 3QR0A 1HQ4B 4LLMA 3WFZA 2YSSB 3FSVA 4X6EA 4F7MB 2QR0B 2CUHA 3PGFL 4HJSA 3FB6B 1I9EA 2W9DH 3ARDD 4ONGL 3DGCR 1U8MB 2EIDA 1T1XA 2BSBA 4X9HA 1CCZA 4EDWH 1C08B 2ALAA 4E5XB 5IOPA 2GVYA 4XCYA 3LRMA 3CFMA 3WUWG 1N18A 4FTVB 4B60A 4JFEE 4LSSL 4NPJA 4BZ1A 3JV5A 1O6SB 3CFQA 1S7WB 1Q0XL 2QLVB 3VH8B 4YHZL 4F20A 2VMFA 1VEMA 5E4IA 1QRNB 3QULB 1DVQA 3JWNH 5I19H 1PY4A 1QR1B 4L9LB 4Q6IA 3RFRA 3MRRA 5A40E 3BEWA 4WCYL 4WEUD 3ZMEA 3GBML 4M7JL 5HD8C 5KJ7E 1ZPLA 2ICWJ 2XUWA 1AO7B 4AQOA 1NCNA 5FO7A 5I8CA 4DGUA 4E9SA 4AC4A 5HHQB 3QEHA 1AGBA 4ZX6A 3ARGC 1XMEB 4HF5H 4NZRH 4OF7A 3S5ZA 3RWEA 5ICXB 3UEZA 3WIHL 4PJFA 4NBZB 5IG7A 1L3NA 3V4PA 3DK0A 3QUYA 2WWOA 3AS3A 4ELMF 3IAQA 4NRZA 3D39E 2R56H 5JHLA 1X5KA 4I85A 3D7PA 4A37A 4L5FE 2WYIA 4IU2B 5KANG 1TUPA 4KMTH 1KYUA 2I7SA 4AQ8C 5JOPE 4K8RD 2O1AA 1P7QA 3S4SA 2X0VA 3G04A 1JV2A 2F74A 4KQ0A 4NGHL 1FNEB 3VI4F 1KPRA 4NQXA 4HU2A 2MTPA 2C3GA 2X05A 1RXLA 3AJ7A 1SDDA 3EOTH 1ZRUA 2BW5A 2FUQA 4F7TA 1JYWA 3ARSA 1JFHA 3BVDB 2BVOB 2Z8RA 2HSIA 3PWNB 4HK0A 5CJBA 3TJHD 3D69A 4AV0A 1RIHL 4H40A 1VHPA 2EYRA 4LXFA 3RTQD 5D70L 1F58L 2DI9A 2NZ9C 4MGXA 4DEUA 3LPOA 1RMFH 5FHAL 5IVNA 1X9QA 2RR3A 5HGDA 4ODSL 3DK2A 5T1JA 1WFOA 5FV2A 1E5AA 1UG9A 2D9QB 4KI1A 1BAWA 4K8RC 2F15A 4IRJD 1IX2A 1NOLA 2NX5D 4AQZA 4K94C 1ZSDB 5C0CE 3KR3H 1MUJA 1XEDA