4A68A

Mutations in the neighbourhood of cota-laccase trinuclear site: d116n mutant
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSNGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Role of Asp116 in the Reductive Cleavage of Dioxygen to Water in Cota Laccase: Assistance During the Proton Transfer Mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords SPORE COAT PROTEIN A
total genus 147
structure length 502
sequence length 509
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A02
2JKWA 3UACA 4QKTA 4YSTA 2VM4A 4HIPA 1BQ5A 3FU8A 1NWOA 5TK2A 3FU7B 1KBVA 1SFDA 2H5UA 5B1AB 1AS6A 1JERA 2DYSB 3T6ZA 1BQKA 1WA0X 6PCYA 3AG3B 5F7BA 3FT0A 4A66A 4HAKA 2ZWNA 2QT6A 4DPAX 2YAHA 2WSDA 2YAEA 1E5YA 5I5JA 1PZAA 1I53A 2XX1A 2HXAA 4E9WA 3X1GA 1ZV2A 3FPXA 2PP9A 4JHVA 5B7EA 3X1BA 3CZUB 1PNCA 2VN3A 1JZIA 1CUOA 3H4FA 1AZRA 1KBWA 2JFCA 3HB3B 2FTAA 2QDVA 4BXSV 5D4JA 2VM3A 4P5RA 4BWTA 4BDVA 7PAZA 1MZZA 4BWWA 5D4HA 4WKXA 2DY2A 4L0PB 2J5WA 1NINA 2VSKB 2UX6A 1JOIA 1SDDB 1IBYA 3FPYA 3G5WA 3ZBMA 1SDDA 1X9UA 2CAKA 1A4BA 2BP8A 1PLAA 3DIVA 1WS7A 2I85A 4Q8BA 1SHWA 3S8GB 3SBRA 3FYIB 3QJTB 4YSAA 1OV8A 2FQEA 2HX9A 1QLEB 4GY4A 1L9QA 1OCZB 2H3XC 3EH4B 3MX0B 1WS8A 1BAWA 1L9RA 3X1NA 3ABGA 1W6LA 2ZONA 4E9YA 1IUZA 1NWPA 3PAVA 3UAEA 1J9QA 4JKNA 4HCFA 4UANA 4DP0X 1PCSA 4G72B 2EIMB 5B1BB 1RCYA 3QJVB 3CVCA 2PPDA 1AZCA 2BO0A 2BW5A 4KNUA 3WI9A 1CURA 3FU7A 2XV0A 5D4IA 3BQVA 3S3CB 2Y1AA 3PCYA 2IDSA 3NJJA 5E9NA 4ZK8A 1QHQA 2TSAA 2UX7A 3CVBA 4G7SB 5TK4A 2HZHA 1M57B 4AI7A 3TBBA 1NPNA 2CCWA 4WTQA 4AX3A 3V9EA 2VW7A 2B3IA 3GXUB 1PLCA 2HX8A 3NJMA 1JVOA 2GSMB 1SNRA 1AACA 3KW7A 2EIJB 1FWXA 3N55A 3WNIA 1ASOA 4E9RA 1AR1B 3FYEB 5I26A 2XXFA 1AZBA 4G7RB 2AANA 3NT0A 3IE9A 2EILB 4YSRA 2HRGA 1EHKB 2PLTA 4N8UA 1DYZA 2MTAA 5PCYA 1AZNA 1XB3A 2GBAA 4HHWA 4E9QA 4YSPA 5EHFA 1JZHA 4YL4A 3UADA 4A2FA 3NSDA 1AOZA 1FA4A 1XB6A 4RH4A 4KO9A 1DZ0A 1L9OA 1E5ZA 1NPJA 3CDZA 1E30A 2UXTA 3NP4A 1ZIBA 1ID2A 2J57A 4DPBX 2DWSA 3GYRA 1N68A 1N70A 2FNWA 2FT8A 3X1EA 3H56A 5AKRA 1AQ8A 3JTBA 4KOBA 3ABLB 3C75A 1HFUA 2WO3B 1AANA 4KNSA 3PAUA 1BXUA 1BYPA 3PPSA 2IWKA 4YSOA 2XYBA 3WKPA 1ETJA 3NJNA 1PF3A 1GY2A 3FSZA 1URIA 2W8CA 4YSUA 2GHZA 2X87A 1ILSA 1ZIAA 4KNTA 4CSZA 3S8FB 1ASPA 1OCOB 1NICA 4GXFA 2YXVA 1ZDSA 5I6MA 8PAZA 3NJGA 2FWLB 2GC4C 2W88A 5B1JC 1ASQA 1CC3A 1W8EA 3KW8A 2UXGA 3ABKB 1KCBA 2CBPA 1BYOA 3T71A 2JXMA 2IWFA 1AG0A 1EZLA 1RZQA 3NJFA 4BK5C 1JZJA 4DPCX 1JZGA 3NP3A 2QPEB 3CVDA 3FSWA 3NSCA 4JHUA 1PZCA 4EF3A 3IEAA 1KDJA 2XLLA 1J5CA 4A2EA 2XVBA 2IDFA 1KV7A 5I5IA 1UATA 2XV2A 1J9TA 2J55A 4A2HA 1J9SA 3T6VA 2FQDA 2UXFA 3EHBB 2R7EA 3BVDB 2XUWA 4AKQA 5B7MA 4M3HA 5AFAA 1GR7A 1BEXA 3OM3B 5I6PA 3NJHA 1L9TA 5I5MA 2H47C 2I7OA 3ASOB 1JXFA 3AZUA 4BXVA 4DP5X 1M56B 4YVNA 1JXDA 1JXGA 2BZCA 3QQXA 4NAJA 5PAZA 2Q9OA 1PAZA 1ZDQA 2HX7A 1T5KA 2QPDB 4A2DA 2HLEB 2AVFA 4YSDA 2OJ1A 5FC9A 3SQRA 1W6WA 1MZYA 1RZPA 4HCIA 1KGYE 3WKQA 3AG2B 1AS7A 2UXVA 1OCRB 3OMNB 3TA4D 3OMAB 2B08A 1WA2X 2VW6A 1NIAA 1OOWA 1NTDA 1B3IA 1NIFA 5I6LA 3OMIB 1CYXA 2PPCA 1TEFA 1V10A 2BP0A 1WAEA 3OQRA 3TBCA 1MDAA 1V55B 4E9XA 5IY5B 7PCYA 3DKHA 3SBQA 3OD3A 3L45A 1NDTA 1AIZA 1E65A 1GS7A 4DP2X 2X88A 1A3ZA 2OCCB 4NB7A 2CALA 2GB2A 1NIEA 2J56A 4G71B 4G70B 1SJMA 1L9SA 1X9RA 3QJUB 2YAQA 1SFHA 2VSMB 3AG4B 1MG3C 3X2QB 3TU6A 2PPAA 2IDQA 3FSVA 1GW0A 1F56A 2XV3A 3ZIYA 4DP9X 2ZOOA 1WA1X 2HRHA 3H4HA 1TEGA 3IN0A 2E86A 1MG2C 4YSSA 2IAAC 2BW4A 1FFTB 3QJSB 3U25A 1SHXA 3WG7B 2YAMA 2FQFA 3ERXA 4KO7A 3PAZA 1M9WA 3DTUB 3IN2A 1IBZA 1ADWA 2PPFA 1ET8A 1KDIA 1QNIA 1KYAA 3EH3B 1J9RA 4KOCA 2GIMA 3FQYA 5ANHA 2BP0B 4AKPA 1TKWA 3AY2A 2BZ7A 3AG1B 3ZX1A 3NJLA 1OF0A 4DP8X 2AFNA 5B3SB 1HAWA 2PP8A 2Q5BA 3FU9A 2VMJA 3GDCA 4YVUA 2VW4A 4FAAB 3D12B 1AS8A 2BHFA 3WIAA 3HEIB 3TASA 4AKOA 1GS6X 4F2FA 1XB8A 4CSPA 3QPKA 4KO5A 5I6NA 1ILUA 3MBWB 4PCYA 3T6WA 4DP4X 2YAOA 4YSEA 1V54B 2FJSA 2DWTA 5I6OA 2ZXWB 1OE2A 2PP7A 1JZFA 1YLBB 4BDVB 2XXGA 2BWIA 1AG6A 2LLNA 4ENZA 1RKRA 2Y69B 1BXAA 2XWZA 3EH5B 1ZPUA 2WO2B 3JT2A 9PCYA 3NJKA 2DV6A 2FT6A 3FS9A 4G7QB 1SF5A 5B1KA 2IDTA 1PZBA 3IBOA 2BWDA 2NRDA 3RYMA 4GP4B 2YQBA 1AAJA 2QDWA 1NIBA 1CYWA 4E9TA 1JVLA 3ZDWA 6PAZA 3N2JA 1OE1A 3CDZB 4X4KA 3PLYA 5I6KA 4YSCA 5A7EA 1J5DA 2FQGA 1GY1A 1PLBA 3T9WA 4W1TA 2OV0A 2TSBA 1SF3A 4M4RB 3WNJA 1GS8A 2IH9A 4TXVB 1NZRA 4GP5B 5B7FA 3X1FA 2XU9A 3S3DB 1BQRA 3FQ1A 2R7EB 4P5SA 1KCWA 4UF7C 1E67A 2BP8B 2I7SA 4GYBA 1A4AA 3NSFA 1A8ZA 4GP8B 4NERA 4BWUA 4DP6X 4E9VA 4A2GA 5I28A 1BXVA 5F7AA 3V9CA 1GYCA 2YXWA 3ASNB 1A4CA 3PXLA 1NIDA 5AZUA 2CUAA 3ABMB 3AW5A 1AZUA 1A65A 4UAHA 2N0MA 1OCCB 4QLWA 2IWEA 3SBPA 2YARA 3T6XA 4N4YB 4W9ZA 3NSYA 2FT7A 2AZAA 4K9JA 3QJQB 3NJIA 1OE3A 2A3TA 2GC7C 5B1JA 3UABA 4DP7X 2GI0A 2YAPA 2AZUA 1GSKA 4HALA 4A68A 1L9PA 1IC0A 2MRYA 1VLXA 4F7KA 4E9SA 3CG8A 2CJ3A 2DYRB 4DP1X 2RACA 4PAZA 1XMEB 4MFHA 2EIKB 2P80A 2PCFA 4HZ1A 1ET5A 1PMYA 2IDUA 3NYKA 2EINB 4HCGA 3QJRB 4HHGA 2XX0A 1IKOP 4AZUA 5LDUA 1JZEA 4KO6A 4Q89A 3UAAA 3FQ2A 1PNDA 3S3BB 2P80D 1HAUA 1R1CA 2YAFA 4FA7B 1ET7A 3FSAA 4YSQA 4A67A 2PCYA 1TU2A 2PPEA 4F2EA 3EF4A 3UGEA 1PY0A 2IH8A
chains in the Genus database with same CATH superfamily
4AYEC 1C7SA 1SEQL 1TZGL 3QYCA 2YRBA 1Q0EA 5F88B 3MGTA 4GUPB 1EAJA 4HCRA 5HDQH 5I15L 2P5WA 3FB5A 3N04A 1CF8L 5B8CA 2E27H 3GLZA 3MQIA 1Q0YL 1UVQB 3WJMA 1I53A 4XXDB 1XZWA 4K2UH 4GIPD 5J1AB 3L4XA 3BLKA 4W4OA 3WS3B 3RZCC 1R17A 2CNYA 1R47A 4XNYH 1CLVA 1IGMH 4CGTA 3MNVB 1DSFH 1KB5B 2DH3A 5MERB 2WOYA 5L0QC 4MMXA 4I48B 5JW3L 1DBML 4AUJA 1LXMA 3FTWA 4HIIA 2MKWA 1CN4A 5IVNA 4YXLH 1DP0A 5DC2A 3JV6A 1THCA 3FQUA 1EHAA 3ZDXF 4S1QH 1EIBA 4Z7QB 1RI8A 4EDWH 4YDKL 1HQRA 2RMNA 1T89A 3BHBA 1X9UA 1OWWA 4MJ6A 5FYJU 3CN1A 3V4UH 1JUFA 4JFXB 3FU5A 4H8VA 4NQTA 5HI3C 4Z7UE 4NCDA 4YJZL 3PABA 5AVTB 3V5DA 5KWYC 3TH4T 3LKNB 3AM8A 4LCUA 4CC1A 3EH4B 3N42F 2YUWA 2QMJA 2OSWA 5L2KE 3MRFB 3TBWA 3QZWB 3X1NA 4EXKA 1FYTB 1LD9B 1QFPA 2Z3FA 1S8DB 3STLB 1IGTA 2E7MA 4NCC2 3UCRA 4HCFA 4P9ML 4S10A 4PB9L 4PMEA 2EXWC 2IALB 5E8EA 5I8CA 2L3BA 5DJDA 4PV8B 4HETA 3F65A 3SE6A 1AQDB 1N5AB 3LKQB 2J6EL 2ZAIA 3DWTA 1D9KB 2X4RB 3G6JB 3V4LA 2DMCA 1OP4A 1G6RA 1SLXA 4N6RA 4L0ZA 1YECH 5BXFA 2EEAA 2I9TA 4MA7H 3PABB 3V5DB 3ZTDC 1EXUA 1L6XA 5EEYA 1Z0MA 2XPZA 1QHQA 1N0XL 1TYJA 3MRBA 1QRNE 1G6RL 1KYOJ 1JWMB 2XN1A 2QQLL 4TRPH 2ESVB 1KXQE 4U3CA 1IM9B 2IBBA 3EFOA 4YDJB 1NPNA 2IF7A 5K33A 5EULV 5D7SH 4WTQA 1P4UA 1MF2L 4L4JA 4BK4A 3GJFK 2LQRA 5I0XA 3LQAH 2VUOA 2JJSA 2HX8A 3ELQA 1K2DA 5IWLA 2BRQA 5I1CH 1R3LB 2ZAHA 3LHPH 3DUUA 2GVYA 4IDLA 3DECA 3T2NH 4NNPH 4IKIA 2WUCH 4JN2B 2F8OA 4X99A 1W72L 3DV6B 4U05A 3SD2A 4GRWH 4BYHA 1OGAA 2AANA 3NT0A 3N5AA 2B5IC 3BWSA 4BKTC 4N8UA 3DRTA 4LCWA 1AZNA 3H3PH 4RGOH 3LRLA 1PX3A 3X3FH 3DIFA 3OR7A 5EHFA 4M7LT 1AQKL 1MIML 4GRLB 3KCPA 1CTNA 1E9QA 1FA4A 4M9OA 1FNGB 1K3IA 1L9OA 5C3TA 4FQQB 3E6FA 3WL9A 3WN5A 2FNBA 3B37A 1BD2A 3ROLA 3ZDYE 3M6DA 4ZMWA 3ARTA 1XGUB 2G75B 5EIIA 2DWSA 1E43A 2QVIA 3NH7H 4X9IA 4H26B 5AKRA 3G5VA 3RILA 1PSKH 1Y6NR 2X4PB 2F8VA 5B38A 4TLSA 3CSYA 3P3UA 4HIXH 4OLVH 1NFIB 3WTSA 3PL6D 1BVLA 1G9NH 4FNSA 3V7AE 3WIHA 5DD5L 4G5ZH 4TSCH 1R5WB 4DQAA 5BRZA 2BNRD 4N1CA 5I18H 3GBML 1I1YA 3O8XD 4LPYA 3WJJC 4K3GA 1FL6B 5IJBC 1XGZA 1DUYB 3KYNA 3U1SH 3S8FB 1NAMA 3IJYB 2GEQA 3H85A 1NGWA 2Z7UA 2MHAB 4PJ9C 2G75A 3ULAB 3T3PF 5L4FA 1MF2H 1WAAE 3OXRB 4GRLC 1FNSH 1FLTX 1CFVH 1Y0LA 2QJDA 5KSUB 2FAUA 4PJEF 3TP4A 4OZHB 1IGML 1X5HA 1PZ3A 2DQHH 3Q6FB 5BUPA 3GO1H 4ZMPA 3HE7C 3ZE2E 1MAJA 3TPUB 3U4EB 1A7OL 1MFEH 4PRIB 2IGTA 3HZKA 3K8LA 1W72H 3B8SA 3PGFH 5D1QD 4IRSB 1HHJB 1E4WL 1SMDA 3FBQA 4XBEL 4RFNC 1KXQA 5DU7A 2EDNA 4XMPL 3DV6A 5BOJA 1PZCA 5KJ7E 2DQTH 1KDJA 4BJLA 4HIEB 3SY0B 3MODH 2Y2TA 5EU6D 4MWFB 1TT6A 3L16A 5C07B 3TIEB 3V4VB 1S7SB 1ADQL 5AOLA 1PD1A 4U0RC 4U1JA 1CT8A 4X7SH 1T89C 4XNQB 5E56A 2R69A 4NQED 3CFJB 1F4WH 4ZW7A 2D03H 4AGNA 4GMSL 2DPKA 1W8NA 1L9MA 4BZ2L 4ZUTA 5DHVA 2CJTA 1A1OA 5IQ7L 2N56A 4NQQA 4JZJA 5DZAA 3P9MA 5FW6A 3VXRA 5FM8A 3L13A 2R15A 4X6CB 2WSPA 1A7PL 3HC3H 1FSKC 4JL2A 4TSBH 1E4KC 3BUBA 3NVQA 4V1DE 4ZS7H 4KRMB 3MJ7B 5DZNA 5E5MA 5EIVA 2IO5A 3RG1C 2CH8A 2UZYB 2V8LA 2X6CA 3UAJC 4KHXH 1UWXK 5FHBH 1MPAH 5LBGA 4IRJC 4K94H 3MLWL 4PJXF 2GIXA 3P73B 3RVUC 5IBLD 3OB0H 3ZZSA 1B3IA 3ATBA 3QARA 2V3FA 3MLWH 4XTRC 2R0KL 2JKJA 1INEL 4UQBA 2HJLB 3HG4A 5LXVA 2YUZA 2DWDA 3SYCA 3N43B 3NPSB 3FOMA 2PXYA 1LK3L 2P5WD 4DP2X 2ZOLB 2NZ9C 4HUCA 4R9HA 2DQEH 3RWGA 2DF3A 4MKMA 1XR8A 4LHQB 2O6DA 2CMRH 2H32B 1U95A 2KC0A 4JFEE 1S7TB 1QW8A 3ZKND 1YEKL 3IWUA 3A47A 1QABA 1TJMA 1I3GH 5IOKA 1FRGH 5E0QA 3QEQD 4ADJA 4L8CA 3G6JE 4OFIA 3K71A 3L3JB 4C56E 2F58H 4U1KA 1U8CA 4AUUA 2Q10A 4CNIB 1ESOA 3QJSB 4X7SL 1A7RH 2IIJA 5IFAL 1VGEH 2R27A 2FQFA 3D6GA 4KO7A 4MAYD 4CMMB 1F4WL 3ARFD 4JPWL 4I2XA 4NLAA 5ICYA 3SPVA 1QFHA 3QUKA 1KDIA 4LIQH 4P57A 1CICD 4LHJB 4KBPA 5FHAL 1M3JA 2K0RA 1KT2A 2H3KA 4X9HA 5EOTB 2CO1A 4NUGH 4NYLA 1RZGA 1BQUA 1QFWL 4NO0B 4QY8A 1NC2A 4ABVA 2HT3C 1RIHL 4NSKA 3US1A 4KH9A 1AYRA 2AFNA 3HHSB 4K73A 2WB7A 4R6UA 4WU5A 2APVA 3CCHA 4Y8DC 2QSQA 3A67H 5T5NG 4B53A 2EEDA 1JPST 4ORGB 3RA7H 1G9NL 4XWOD 1C5BL 5DQDL 2NZ9D 5DS8A 5EBMB 2AVGA 2BHFA 1A3QA 4LXFA 4M6OH 3S3PA 1UM4H 4D0DB 4AKOA 4J3BA 1GS6X 3QIBC 4DZ8B 5IVXB 2BS8A 5D5MF 5LKNA 3DUHA 4XMWA 4FHBD 2YWZA 4L1DA 4CAGA 5C92A 2CO7A 1IEHA 3MV7A 1HNYA 1I1FA 5DUBB 4YHML 1WIPA 2IV9A 4R7DB 4M9PA 1JNLH 5B1KA 3IBOA 4XMKL 3T09A 4F92B 5HGGS 3GZKA 3LPPA 4ORGA 5BS0A 3SKOB 4X4ZA 5DHMC 4PJCE 4OFDA 3TBTB 1MSPA 1NGQL 1N3NA 1WFTA 5C0BE 1X7SA 2AERT 2APTA 1AQDA 4EI5A 1TZGH 3K1DA 5IHZB 3ZDWA 1P5VA 3B34A 1CXFA 1TSRA 1KLGA 1N8ZB 2ZUSA 3E38A 5FDYA 5D7JA 4YSCA 1KIRA 1UEYA 3MODL 4J3OD 3WD5L 4XC3L 4WENB 1EMTH 1P84K 2MNWA 5AW2B 5JNYB 1N64L 2HUEA 4I18A 5F7HA 1MQKL 4HPOH 4KZDH 5DMIH 2R4RL 2VR8A 2MIZA 1AGCA 3ZUCA 3WMSA 2DAVA 5D8JH 5TTRA 5BOZG 1YEIL 2XWRA 4P5SA 5DQJB 3OKKB 3SDXF 1OAJA 4PGDB 1QFWH 1XH0A 5JW3H 4XI5C 3FL7A 4P5TA 2DTML 2Q7AA 4C55A 4BWUA 5HPMA 4FTVE 2H2SC 3UGUA 1KMGA 2Q86B 3ZRCC 4ZBJA 4RISH 2YPLA 2V7HA 4DKEL 3MJ8B 3GINA 3HRZA 4YDKH 3CD4A 4S1SL 4RISL 4OKVA 5FHBL 3I85A 4LVOC 1U8IB 4I1NB 3KGSA 1KZYA 4ODXB 2VH5H 5K69A 3N41F 3DO3A 3EIFA 3ZUNC 3QJQB 4HU2A 1WG3A 2X2UA 4UM9A 4DGVL 3AS3A 4MQSB 4BM7A 1BDYA 5BVPH 2A3TA 2CO6A 5B1JA 3HUJA 5J57B 3K4AA 3WS3A 1E42A 5C2UB 3CVHL 1QUNB 4JFZH 3N1GC 1B4JL 1BJ1H 2YIHA 4GXUM 5T5FL 3QG6B 1CDHA 1OTUD 3A0OA 4ZOCA 2VJXA 3H2QA 2OI9C 1TZOA 5BOPA 3FBKA 1QA9A 1BZOA 4HHGA 3FQUB 4YHNB 3PP3K 1CL7I 2D3VA 3D0LA 5I30L 5KW9L 1Z5LB 4WJ5B 1FRGL 3RX9A 4PY7A 4ODXA 1K4CA 2NNFA 5ETUA 1K8IB 2WQWA 2Y22A 2ED6A 3PAYA 5T1KB 2TRHA 3U2JA 1A21A 5IVZA 1TU2B 4ES8A 2WQUA 1KULA 5CMAA 4I0PC 5MI0C 1HOCB 1IQWH 1RZKL 1F4HA 4U1MA 2ZWYA 4Z7WF 2VZ3A 1DVFD 1NFDE 4NZRL 1I1AD 3FT0A 5F7BA 1ZHKA 1TNMA 4M7ZB 1OB0A 1FYTA 1C5DA 4YO0B 4LGPB 3KPPA 4NKIL 4P2RE 4PP2A 1VESA 4LEBA 3SDCA 5FYKH 1PQZB 4AQEB 4FCAA 5INDA 4RMSA 4NFCA 4PRIA 1DCEA 1AZRA 3ARGC 3D06A 1NSNL 1WBYA 1PG7X 4NIKB 2ZKXA 4BFOA 3SDCD 3RWHA 5D4JA 5E6RB 5JQIB 3GNML 1LE5A 5EOQL 3ZE1F 5C0BA 4P3DA 1DJYA 4XNDA 5FYLE 1MVUA 3SN6N 2ODHA 2ZWSA 3BAEL 4WKXA 5EMYA 4CL7A 4XB8A 4NBYB 5IVOA 1TETL 5IUCA 1CG9B 1JOIA 2HTKC 2W0FB 1JXKA 3C87A 1Q9LA 2WWMC 3M45A 4K94C 5DT1L 1G1CA 1FVCB 3FQ4A 1PW3A 3FPYA 3G5WA 3QXAA 4LHUG 3ZBMA 4AQ1B 5EUOA 2KERA 4DERA 5EA0H 1XBRA 2F1AA 1KGJA 3L08A 1J8RA 1G7JA 3WEAA 4NKOA 3FYIB 4OJDH 5KSVB 1CBVH 2WVUA 2QVFB 2NNXA 1QQDB 3IMVA 2RQ8A 2QFPA 3OHXA 3RWHB 3PWLA 3U79A 3RQ3A 3KAAA 1WS8A 1BAWA 1LJMA 2NY5L 3HN3A 4OTXL 2XG5B 4ZMOA 1UB5A 5IGXH 1MCOL 4RLDA 1IUZA 3HMWL 4HKXB 1JXJA 5DJCA 3UAEA 3WEBA 4DGYH 4OBRA 5AVQB 2A1WH 1X5XA 5I74B 4AWJC 1D6VL 3FH8A 1L3WA 2K78A 3GSWB 1CK0L 3UROR 2G5BB 4L3EE 2ENSA 4KRPD 5D7IB 4NRXA 3KCPB 1U58B 3AXIA 3W2DH 4Z3JA 5IW6B 5TD4A 4DHLA 1IAMA 2FH6A 3AWFA 3L7FA 5D7KE 3WY3A 4PB0H 3QUHA 4Z78A 1MQKH 4HPOL 1E9PB 1Q0YH 3BP7A 1U8NA 3MRGA 3UTSE 1QQDA 5DWUH 2WKGA 4F9PC 3B9KD 4TNGA 5HTSA 3ECBB 4N0UA 4NQCB 4PREB 4Y19B 5HHVH 5F3HB 3C2SA 2NYKA 4K5PA 4PP2B 5E9DA 5EU6A 5TK4A 1QRNA 3VFOA 5IV2B 1MCRA 5EOCH 1ZEAL 4FFVD 2EXYC 4M7KL 4N6QA 2R2HA 2GG1A 2R4SH 2C1OB 3V4PH 4MJIB 4OGYL 1C1EH 4TNFA 5JPMB 3LEVH 1U3NA 3K71B 3DYPA 3N55A 1DBAH 1SM3L 1CFQB 1VADB 1F1DA 4OT1H 2B15A 2DZEA 1S7VA 4WZ9A 5IEKA 2QSVA 3IKCB 4TULL 3QIWD 4YNYA 5I26A 5C6TH 5D2NA 3ATFA 4PVBA 4PP1C 3ELAT 3FO2A 1NGXA 3ULVE 3VFTB 4DKAA 1VACA 4N8VB 1GW6A 4NT6A 2Z34A 3HAEA 4ZO7A 3QORA 1GGYA 3GB7A 2DM4A 1VENA 5FUOL 1T22B 1F6AA 5D7LB 5KYWA 1UWEH 5D7JD 4J39A 4C4KT 5AYUH 1BEYH 3Q2CA 2NW2B 1JRHH 4M93B 1E30A 1FNLA 3CXHJ 2FE0A 2OCJA 1CFQA 3MUHL 4PBVC 3PDDA 3ZKQD 3JVFC 4HX1B 4S1RL 4DGYL 5KJRL 1M2OA 3BVXA 4XPBH 3CH1A 5HHNA 1X44A 2IFFH 1I3RA 1MPAL 3MRNB 5LUMA 2X4NA 3H7BB 1E8ZA 5DYOB 1AR1C 3HN8A 4RX4A 4XHQA 1G9EA 3SDDC 1FLRL 3QORB 1BD2D 4JZNB 4TQEL 2GITA 1Z9SA 3ESPA 1TO4A 2OSYA 3TN0D 1F90L 1SZNA 3QIUC 2VDRL 4JJ5B 4E5XB 4MJID 1HCVA 2X87A 1ZIAA 5E4EC 3C5JA 3T0EB 1RUKH 1ASPA 2DQGL 2BY3A 2Y3AA 3TS8A 1QVOB 1ZDSA 3NCXA 4YQXL 1NFDF 4WQOA 1OZUA 2DN7A 3DURB 5EEVA 3EJZC 5HGBA 5FO8B 5IW1B 4IKJA 3EJYC 1ZLSH 3VFUA 4Q2ZA 1OCWH 4LSPL 2YK1L 2OQJB 2IMNA 3SODB 3FOLB 3KLLA 3L5XH 1ES0A 2LVCA 1KIQA 2WUBL 3N44F 3ZKXC 4P2RD 4BK5C 1S4IA 2YKLH 3BQUD 1P53A 4UT6H 1EZUA 3SCMB 5FLVA 3QZBA 1DN0A 1NA8A 2OMXB 4RZKA 1DQTA 1RZIB 2MPVA 1CD1B 1KY7A 2G3ZA 4X8XA 1FV1B 2HT4D 5JUEH 1L7IL 1QBMH 1NUGA 3FCSB 4IHOA 3U46A 4JCLA 2FX8H 1U6AL 4HC1A 3K2IA 1L7IH 4LSDA 2KH2B 5A2KH 2HJFA 4W9CC 1RUQL 3ZRFC 3VTTA 4N24A 4XCFL 3L95B 4WWPA 2E56A 1FNEA 1U41A 1FDLL 1XL6A 2NW3B 3CPLA 3FU0A 4JE4B 4QHMA 4Y5YA 5L4IA 4L8CB 5TE6H 1A3LL 1M56B 1OTTD 1YMHB 2CIIB 1PKQA 1PZDA 3QG7L 4HEPG 4BRVA 4HSCX 3IDYB 3LS4H 5GISH 5H8DA 1KC5H 4A2DA 4YC2C 5FC9A 5H37H 1MZYA 2X0UA 3B7RL 2IEPA 4JFYB 1QI4A 5D5ME 3RTLA 1JGLL 4U3SB 4Z7UF 3I75B 1AS7A 4HSAC 4KQ4H 4RFOL 5ICYB 4JZOA 2B08A 1DJGA 1A9BA 2P5ED 3FK3A 3GTNA 3N1PC 2PCPA 4NUJA 5DGRA 5I82A 4EKXA 1WBXB 1YNKL 3LJ3A 1BQLL 3INUL 3W3BA 1GPOL 2BOBB 3KCWA 4LB8A 3UBFA 2AXHA 5MENA 1N10A 3QRGL 3MVSA 4HUKB 2PCXA 3QEGH 2OX5A 1X5AA 1HWGB 1GS7A 3IDYC 3VG0L 1JHTB 5IQNA 2E6JA 4LRIA 1A3ZA 3AQXA 2FWOB 2DQHL 1CCZA 2GB2A 5KSAD 4WWKC 1LGVA 2F1BA 3BPLB 3O4LE 1CXEA 5J6GB 4NC0B 4CU8A 1CWVA 1EJFA 4PEEA 5JDSB 1NLBL 3FSVA 1F56A 1ZA3A 5GJSH 4HF5L 3OAYH 4KTEL 3SKNA 3ISYA 1NOFA 1NCDH 2XTLA 3KPRE 1TZIA 3P2DA 4HWBL 4NUJB 1NPUA 1UKQA 4DW2L 3U0TA 4NZTH 5D7IF 3ULVD 5I73C 4R8WH 3QDGE 3VFMA 5DLLA 3UYOD 1AHMA 2H26A 3UL4A 4IBZA 4DW2H 2MJWA 2FBOJ 3EFOB 2X1PA 4NNXA 1I7RB 4JKWA 3SCMC 2BNRB 4NBXB 3V0HA 1CXIA 4WNSA 3AFLA 4FQ2L 1LK2B 3OKNB 3QWRA 4BCXA 3BN9D 3X14A 4QRSA 1Z5YD 1ZT4A 5BVJB 1G7IB 3VXMA 2DW5A 4Y5YB 2NW3A 1GCFA 1H3VA 5I17B 2AXWA 4PG9B 5FO9B 3JWDH 1L9NA 1TF4A 1YPZE 3AG1B 2R1XB 4TL4A 1BXXA 3GXDA 1U8LA 2I07A 4RMTA 3EYSL 4DWHA 4O02B 4IMLA 3P69A 1WCBB 1U92A 3E8UH 2V9TA 4P59L 2WY3B 3QZLA 1EZVY 4J3OG 2Q7NA 5G5DB 3EYSH 3BSZL 1OOAA 3HZ3A 3MFFB 1ORQB 3D1MC 4PHXA 3KYOB 2ENYA 5IB5A 4A2LA 3MKKA 4NKQB 4BA0A 5KN5B 4OI7A 4ZTOH 4IIQC 3HE6A 4NQSB 5D7LE 3T6WA 5I6OA 2ADGA 2ZXWB 1F41A 5LCVA 1U8OA 5BRZD 4NPYB 4R83A 1CI5A 2XXGA 4M62H 4UTBH 1NKGA 3FMGH 3ZTJH 1KXTB 2YPLE 1W80A 1NMCC 1QKZH 1TFHA 2CJUH 2VN4A 3C6SB 3L7EA 4HISA 1MREL 5SWZD 9PCYA 2QFRA 2MPAH 3B2UD 2BVPB 4TSAH 4HHAA 2FGWL 3NCCB 2EXYD 4KX8A 3CX5J 4MS8C 1EFXB 1LMKA 1MHHA 1X4YA 2V9QA 1R34A 2YQBA 4C4BA 1C16B 3OHMB 3TA3B 3QFJB 3WIFA 2QDWA 4DTGL 5AW3B 5E6IB 3FCGA 5DRNB 1NCDL 5E08H 2CQVA 4E9TA 3TYFA 4PY8I 2XTJC 1FBIH 3VXUB 4ZZKA 3WDIA 1OE1A 1X4XA 1P4LA 4P9HC 4BK5A 3NTCH 3NIGB 1H5BA 3VSUA 1PY4A 2ZKWA 5IHHA 5KS9B 1EDYA 3MNVA 1J5DA 2DLEA 4LCUB 3T0VA 4UQ2B 3D3VE 2YHGA 4KRLB 2XWJA 1OGAD 1TVHA 3ZE2F 1NZRA 3ZHFA 3ZO0A 4PRAB 3KS0H 2E46A 4L3AA 5E23A 3MZGB 3DSNA 4GSUA 3TVMB 4LPCA 1MCIA 2JTDA 2WWKO 3MA7B 2C1OA 4HLJA 5JPMA 2I7SA 5D1QC 4NUMA 5FECA 4RZCB 3ARFB 3FB7A 1ZTXE 3QXDB 1YYLH 3R7RA 4H5SB 1JNNH 4L4TD 1KWKA 2ZT9C 1S9VA 4JJHA 1UJTA 3PXLA 4X7TA 3EYVB 4FG2A 1S5IL 2IPUG 3F7QA 4OLYL 1QZ1A 5I2IA 3I6KB 5A6IA 4W9ZA 3WGUB 1UFGA 1WFJA 3OKMA 2HTKD 4PVLA 3BZEB 1XR9A 4IKKA 4RAVA 2GC7C 3H9SB 4NGHH 5I9QC 1PQZA 1JZDC 1A6VH 1HIMH 5F2FA 4G6KL 1RZFL 1L9PA 5CBAB 3EOBB 4KKRA 3R19A 2FK9A 1N9PA 2HKAA 3T3MB 1PL3A 3PWPD 4ZOBA 2KLTA 3BP6B 4PRHD 4HBCL 4Z7WE 4O51B 1IL1A 3QO1B 3I6LD 4IU3A 1UA7A 4F8OA 2B0SH 1ETB1 3UZQA 4EZMA 5IK3A 3WNMA 1XIWC 2XVLA 3QEHA 4FXGA 4WWOA 4AVJA 4PBWD 2WOBA 1AIFA 3NQKA 4RRPA 1SXNA 1F2XK 3QEUA 5E6ZA 1MCDA 4AQ8A 2VUKA 5DD1H 1C12A 1CFSA 1O9VA 4Y2DC 1GC1H 5E4OA 3UIZA 2VRAA 3HI1B 4AQAB 4M3KB 4NN7B 5A2LH 4ZX6A 4FKHA 3KHOA 1SEBA 4M5ZH 3ZVVA 5I6XC 5CWSA 5KVGH 5EEZA 1G6VK 3B2XA 4XNXH 2NNAA 1JERA 3X12B 3MBED 3EJUA 2VXVH 4JN2A 1YEDB 3T6ZA 5D7IE 4ZMXA 4M5ZL 4KXBA 4AEHH 2D7NA 4MZ2A 5J1TC 1GGBL 1ZLWH 2Q3XA 3QUXC 4A63A 1E5YA 4XNXL 2VJ0A 2R4SL 3RI5K 3UAJA 5SWZB 1KBBA 4YXKL 4IK7A 5HI4D 1P4BL 3GSRA 4MZIA 1A1NB 3HS0C 5DJXA 4G11A 1DN2A 4PJ5D 1OW0C 1D5IL 3V5HA 4UIMB 3VD2A 4XNBA 5E2UL 4HG4J 4FQLH 2PCFB 4CMMA 4DN4H 2PXYC 1FNAA 3V52L 3LN4B 3PJSB 5KANI 1I8IB 5DZLA 3FSOA 3UTPD 4MLSA 5GRJL 1T1XA 2FEEI 2I27N 3P9LB 4W70A 4LLYA 5ESQB 3GXTA 1FC2D 4GG8A 4PR5A 4D94A 5K9KB 4X98A 2BP8A 1JYNA 3EJRA 2H45A 2IQAB 4S1DC 2XWCA 1J8HE 1LLAA 4NO5A 2JTYA 4OCMC 4WU7B 4BFRA 2IBZY 3KPOB 4OD1L 4D3CH 4IBYA 2E7HA 1EBPA 3HAEH 2DJMA 4U7MA 3KWWA 3ZO9A 1TQCC 4ODBD 2WQXA 4ADGA 3MR9A 5I30H 3MX0B 3ILEA 2DQCL 1K5NB 1M7DA 5FYJL 1QTYT 2WJ7A 2A9NL 4HV8A 4UQ9A 5B8CC 3CN3A 3VFTA 4Y1TA 1IJNA 5KSUA 4Y4HD 4XCNA 4AM0A 2WLJA 4L4VB 4O58L 1X5MA 3WFBH 2VDML 5F9DC 1QLEL 3F00A 2NY6C 5DWUL 5B3JE 1A4JA 2UWEF 3UEQA 2XV0A 5D4IA 4UV7L 5ISZD 4P04A 4HZLB 3F6LA 4PJCF 3P40A 2ZCLH 2AJYH 5T1MB 1KUMA 2BCMA 3VXME 3SQBA 1J0YA 2VISB 1H15B 3ET9F 1EAOA 4N20A 1I3RB 2C4FT 4RRPG 5ITFB 1W0WB 4HWZB 2UUDH 1T03H 2XN9B 1A7QH 4YHZH 1HX0A 5FWQA 3LPGA 4GFXA 1N8ZA 1CICA 2WXQA 3OPZL 4LVEA 4NN5B 5HHMB 4AV4A 3EJTA 1SNRA 2VXUL 1TZIB 2VDOB 3T3PB 4HLEA 2A4EA 2CD0A 3MU3A 5CZXD 3VDAA 5IKCA 1O6SB 5IMOA 1G84A 3BMVA 1YY9C 3MGOA 2RFXA 5GRUL 4OCWL 3HFMH 1KPRB 1MNNA 1DE4A 4JW3A 2ICEA 4NNPL 1F3JB 1U6AH 2F53B 2XN9D 4O2CA 2HRGA 4I3RH 3II1A 4PGBB 4FG0A 3UO8B 1UH3A 3EFFA 3FN3A 2N1KA 5MP6L 4YSPA 3LMJL 5E51A 2P8MA 2YWYA 4P5KB 2LOEA 2ZIDA 1AOZA 2NUPA 4G8AC 2MTPA 5CLYA 4Y4FA 3H0TA 3VDCA 3VQ2C 3QJHB 1YEWA 2I9LB 3SDCC 4B97A 1UUNA 1ZIBA 2HRPL 3EBIA 3P4NB 2H9GB 4NXSA 4PHZA 2E74C 3JTBA 2Y6SC 3LHAA 3PWPA 4XCEB 4RDQF 2R23A 4P06A 3QRFM 2ZCKL 1U2YA 4OGAD 1ZAGA 5HHOD 3Q2WA 2XYBA 3MV8D 5TDPB 4X4YA 1G5AA 4OLZH 1XMWA 4N2HA 3MLSH 4RWHA 5FIEA 5C0IB 1UA6L 1GYUA 3ARWA 2X3AA 4MJ4A 1ILSA 5D1XE 5AAMA 4XX5A 3ILPB 4FFVC 3BUDA 4I3SL 1U8CB 2WN3A 1IT9H 1J88A 3JV0A 4TTDD 3RFZB 5L9DL 4AGLA 5I6MA 1IVLA 3RTQA 4BUQA 3OPZH 5GJSL 3OHXC 5EO1B 3IMRA 4HXBL 4LRNH 1CC3A 3FB8A 1CDYA 2UXGA 3D4ZA 1HNFA 5E2UH 3T71A 1SJHB 1NCCL 1TKWB 2E7DA 1A0QL 1DJSA 5DFVD 3CK0H 1PZSA 5A2AA 1M42A 3CN2A 1AD0B 4MTMA 3NSCA 4LESA 2RFXB 5E2VH 3MLRL 4C54A 2VDPB 4NQDA 1X5LA 3JV4B 3MLVL 5I0WA 3LRSA 3NBNA 2XVBA 4W68A 3VYOA 4NHUB 1BWMA 5H35B 1TR7A 4MA1C 4NQXB 4M00A 3TVMA 2X5PA 2Z4TA 3X11B 1U2CA 4L4VE 4NI6A 5K1VA 1TTAA 4Z76A 4WNQB 1GR7A 4IJ3B 2J3SA 1BWWA 2Y7QB 4ZSOA 2BM3A 3OZ9H 3ISWA 4HH9A 3PFUA 4NKDB 4X6CF 2WXJA 1Z7JA 4HUMB 1JGLH 4IIQB 5DMKA 3T4AA 1BFSA 4MNGE 2OJ1A 4Z7UA 4YHIB 3UBHA 4JS7A 4MQXD 2HT4C 3C6LB 3PGDA 3S5ZA 3AG2B 4TQEH 5MHSD 2B14A 4J6IA 2BNRA 3TF7C 3VD0A 2VR7A 4Z7AA 3L5WA 4OKDA 1N59B 2GSGB 3IFLH 3IS1X 1WA2X 4LSTL 4YFLF 3NIFF 5HYJA 3DX4A 5F97E 4L3FA 3FCTB 1QKZL 5HPMB 5CR8A 5C8JA 1XD0A 3T6QC 3VFWB 3UZVA 3KWTA 3I3DA 2AEPL 1CLYH 2VLLA 1ZOXA 1HH6B 2Z91B 3PFQA 1D5ZA 1QEWA 2R0WL 3LRMA 1XQ4A 2P1YA 3D9AH 4Q9BA 2K45A 4ALAC 5GS2H 3WY1A 2X88A 3TBVB 1MCSA 4NB7A 4PRPB 4I18B 3F3HA 1KN4H 2K6WA 4PCKA 4GW5A 3BXNB 3QJUB 4CBPA 1CR9H 1ORQA 5K39A 3KLHC 2KPNA 1XSOA 2NYYC 3AS0A 3RWEA 2XV3A 3QWRD 4DJMA 1YVLA 1PG7H 2Q8BL 1WICA 1MI5E 4HJSA 1QOKA 1SN5A 3DYOA 4QAMB 3GJFB 4UV4L 1TZAA 1MLBA 3RU8H 3Q8FA 2NNAB 4GS7B 4L2YA 3HLKA 2FBRA 3IGLA 1S7UB 3U25A 2ZKYA 2ED7A 3BP4B 4FQ2H 3PAZA 3ZJAA 2BHYA 1L6PA 4IU2B 3RBSA 1OEZW 5DD3H 1QYGL 5DK2B 3JTSB 3PP4L 4G5AA 4QYOB 3PXHA 4M1DL 3M1OA 2GIMA 3TPKA 4LPUA 4PJIF 1NEZG 4EBQH 4QXUL 3G3LA 4B50A 3KPSA 3TNMA 3HZMB 4J2QA 4NO3B 3N1FC 4JDZA 4EUPA 2VDLH 5EORH 4EOWL 2PP8A 3QO0B 3G5VB 3GDCA 2EEXA 3MROA 3P77B 4IDJL 1EFXD 1A7PH 1NGZA 3C9NA 2IAMB 2R2BB 5BW7C 1HWHB 3A67L 2JB6B 4S1QL 1T04B 2NUTB 4EXPX 4F2FA 4LKCA 4OZ4A 1I8KB 4QRQA 3QVAA 2FJSA 1WBYB 3UG4A 5DCCA 1KIUB 5L4MA 3IDUA 3KVDD 3F7KA 4PRHA 3QQ9D 4A6YL 4YZFE 3TO4C 5GS0C 4H8WH 2AQQA 4ZX5A 4CUCA 5I0ZA 4Q6KA 1DEEB 1LWHA 3NDYE 4BCZA 4MNQD 3FCUB 1FVCA 3VXNA 2NY0C 4ODSL 4K3JH 1E9QB 1KCSL 4K4KA 5TDNB 2AGJH 1N26A 4P9MH 3QI9D 4NS0A 5T3XL 3O45A 4JFEA 5BUAA 3CZKA 1XHHA 5E8DH 5SWQA 3ZKXB 4L4TA 3VXQA 3S6CA 4UTAA 1BLNA 4MJIE 4B7IA 4QXGH 4QTIL 5FDWB 4J3OH 5FO8A 4N1EA 2XU9A 3S3DB 1F58H 4PMFA 4ABWA 1UQSB 2E3VA 1BLIA 3ME0B 3SGEH 4EUPH 4ZUSA 3NSFA 5AKSA 4OBSA 3IDMA 4N28A 3W0WB 3GGWA 4E42B 4I0PA 5CSBA 5GRVL 1BXVA 4QXVA 4ODHH 1IU1A 3IGAA 5FHAH 1UD4A 3EGXB 1BPLB 1TTBA 5T33H 3AW5A 4JFUA 3P4OA 3EYFA 3QWNA 1ECZA 2WWMD 2QL1A 2E8ZA 4HIIB 4LHUD 3SBPA 4D9LH 2DQDL 1TQBC 1CE6B 5EU6B 4AITA 3VXRE 1RHHB 1MWAB 5CEZD 4XMZA 1WD8A 4BZ2A 2WB1A 1J0ZA 1MCPL 2VABB 1HINL 3MLUL 2Y2WA 3B5HA 3KXFE 4A68A 2HKFH 4LCYA 1JUFB 1DFBH 3DX1A 1KTLA 3IPFA 1R3KB 4PS4H 5GGRA 1MFCL 3E3QC 5B8CB 1KN4L 1OM3L 5DR5H 1MN4A 1SOQA 2PCFA 3EH2A 4KKLC 5ECGA 5FYLH 2AQPA 5AALA 4ODSH 1VFBA 4I18C 2PETA 2A0LC 1VSCA 1RMFL 4C4UA 2G3MA 4X5WB 5CF3A 3SJVB 1FAKT 3NCYP 4GRLD 4Z3HA 4J3SA 3VFOB 5DI8A 3KS0J 5GRZA 1E5BA 3RDTC 3S3SA 1KTDB 4TNVK 5DLML 1IAIH 1ZT1A 5D6CB 1KB5A 2LGNA 4X5XA 2DD8H 1DQDH 4FMKA 3P9MB 1NANH 2JIXB 2Q86A 3DJTA 4LL1A 4JHWL 5SWQB 4XP9L 2IH3A 3S34H 3S88L 4PJ8C 1HHGB 1N2RB 1MW2A 2WBKA 3LKPB 5JHBA 3ZKNC 3G5XA 2ZJSL 5JIDA 3IKCA 4DQOH 4M3JA 2KZ1B 2ADJA 3CDYA 2L8AA 3OWEA 4JHWH 1RZJC 3JWOL 2NXYC 1OARL 4ZQTA 1N12A 4EE2A 4OI8A 1TDQA 3ZE0F 5ID0B 5GZOA 4Z3GA 4KY2A 1ZV2A 5ID1A 4P46C 1UOVA 2DMGA 2IG2H 2GJ6B 1SJHA 3BUYB 3O41A 4NQDD 3AY4C 3DJZA 2R29L 4JY6A 5D7SL 1IM3D 2VM3A 2Q6WA 1JV2B 3PQYD 2B1AH 1KBGL 4JRFA 2NYYD 3OJDA 1M1XA 3ZQWA 4HJTA 5B1CA 4Y1AA 4KAQH 5IBUB 1UCTA 1SDDB 4JUTA 3GK8L 5I6XB 3S5LB 3NN8B 2B59A 2UYLB 1G7QB 4KNQA 4JGUA 3HNVL 2WXOA 2K9UA 1TYRA 5CMAB 4J28A 4CC0A 5CFAA 5AOIA 1CLZH 2Z7ZA 3FC8A 1L9QA 3BVTA 2CLRA 2J7LA 2D9CA 3Q13A 1MUJA 4OGXL 2NSXA 2RTTA 3WO4B 1GRWA 1QPKA 4BSVB 4DO6A 5CEZE 5IHUL 2Z4QA 1X3DA 1J0HA 4QUOA 5L7XL 3PAVA 1QSEA 4HIHB 3UDWA 1LP9F 3EH1A 4JQVA 4DP0X 3SKOA 4JFHE 2R0LH 1PCSA 5JPNC 2DEWX 1OAUH 4Z5RB 1TZHA 5JPNA 1XV8A 2YJQA 2WQRA 2O6FA 1R3LA 3T04D 5CCGE 5EC1A 1P69B 1NCAH 4QY8B 4A7QA 4KNUA 4DQOL 1R5WA 2F7OA 3RGVC 3OF6A 2FYYB 4LU5H 1HZHH 3LQZB 3PCYA 3HBQA 4Z7NE 3V0WL 3N50A 1IGCL 2KL6A 5MEQA 3BKMH 3QNZB 3OAWA 3KGTA 2EXWD 2NX5E 4PRPA 3SY6A 4DGIH 2YRZA 3BJ91 1PVHA 1XX9C 2FJGB 2R59A 5D1XB 4QLRA 1IKFH 1AI1L 5DHEA 4JM4H 2B4CC 5HJBA 4O2FA 4KJYA 4OUUB 3TH3T 4AX3A 1ERNA 3MCYA 2NDFA 2VW7A 4HAGA 5DQ9A 3GXUB 5GS0L 1ETZA 3O8XC 3TA3D 3NJMA 5E2VL 1VA9A 2Q1EA 4NUPA 1E9OB 3O8XA 3NSXA 4FQHB 5EUOF 1PKOA 5DFVC 1VB9A 1AR1B 1KWGA 2CLZB 5SX4H 1E4XL 4FKEA 4JFPB 4I3RL 5I75B 3GZOA 3HUJE 4FQIL 1DBAL 1SM3H 4FI7A 2A77L 4OT1L 4TUJB 1C8QA 4XNMA 2JKRM 3GUTA 1I8AA 4YDVA 4QTFA 2NY3C 3DMMB 4ZPVB 2IANA 3LMJH 4BINA 5I1KH 4MWFA 5C07A 3V4VA 4F15C 2Z8SA 4QYOA 1BZDA 5AZEH 1MHEA 5LGJB 4JRYB 4W9HC 5HYQB 4P23A 2MMXA 1NC2D 5DJ2A 5E2TH 1A9VA 3HI6H 1GZPB 3GPSA 4K55A 2AP2A 4TLUA 4XBMA 2XV6B 4LPWA 2AEQH 1F8TL 1XB6A 1I85A 1A6WH 4GRWF 1FE8L 1SY6A 3BPCA 3QHTC 4CMHC 3QB7C 1J0KA 1XF5A 4MNQE 3ZN6A 3BZ5A 5K9QI 2ZOKB 4U4BA 1V7MH 1ZLVH 4WSGA 2H26B 1NCJA 3CV5A 1DSYA 1U3HB 3H9ZA 4L8BB 4FLRA 3ESVF 2WNKA 5C9JB 1LHZA 3NCYS 1HFUA 3RUGE 1HXYA 2WQAA 3PV7A 3U82B 3THMH 3PAUA 5E5MB 3MRDB 4PY7B 4QRSB 4JFTA 3MJ9L 5CILH 1MHEB 5GS3A 1TPXC 2F5BL 5T5FA 4WV1A 1N6QL 3CFCL 1E5UI 3OB8A 5I16B 4OW6A 2HFGL 1JI2A 2ZCLL 3T77A 5F8RC 2FYVA 3U7YH 2RCSL 4PLJC 2X6AA 2X12A 2E9IA 5LWYL 2Z35A 5M7QA 5D2NB 3MDJA 3LIZL 4QRPA 5J56B 3OLIA 1AI1H 4UIKL 5GRYA 2A6IA 3STBA 4YHYC 3H42L 1M71B 1OZTG 3L2MA 3QXTA 1DDHA 5CJXC 2GC4C 3N85H 3VAEA 3ZYJA 3EXJA 2P8LB 3K4DA 1VPOL 3RNKB 3EF7A 4KRPB 1GA2A 8FABB 4ACTA 3H42H 5F6IC 2NY3B 2CBPA 3DMMC 3N44B 3WYRA 3C8KB 2IGFH 3X14B 1U8OB 1ZT4B 4FZEL 5CIPH 3HCVB 4YPJA 5T8IA 1QWNA 3APDA 3RVUD 1BZ9B 1IAOB 2C7FA 4H20H 5JIIA 5SWSE 4QHUB 3DGGB 2CHDA 2R1YB 2NX5A 4AENA 4WEBL 3R8BB 2W0LA 5EBLB 3K81A 4AUYA 4BFBD 3K6NA 1UD6A 2I25N 5I5IA 3IU3A 1S3KL 3S5YA 2VE6A 3PHOB 4M03A 4LLQA 3EHBB 4MSWA 1DQML 1T0NA 1UQSA 3QHFL 4Z18A 4A04A 1VIWA 5AFAA 1BEXA 3OM3B 1LP9A 5AOMA 2OK0L 4F7TA 4QJ4B 4UIMA 3LYRA 5LQBL 2BVUA 5FUOH 3GJFA 2W59A 3KWXA 3QIUA 4K3HA 1KJMA 2V7NB 2X4UA 2WZ6A 4NYLB 2HX7A 2VL4A 1VFAA 1T5KA 2G9KA 2LU5A 4HIXL 4NQEA 2QLYA 5FM4A 3BGFC 5MHSE 4ZW5A 1W6WA 2NX5B 1RZPA 3S35L 4F3FB 1NFIA 1MRFL 2P49B 3CU7A 4XAWH 4PJFE 2JF1A 3CHPA 2CRZA 4TOYH 2GT9A 4I5BB 2BRRL 3ECVA 3MUUA 3G5ZB 4ZO9A 1J1OH 4Q52A 4JBSA 3WHE0 5LGKA 2FLMA 3HS0A 2Y23A 4N25A 2OZ4A 4RZCA 3VCLB 1XGPB 3B7YA 4OZGF 2YBRA 3LIZH 5F9WC 4ZMVA 4JRLA 2GTWA 2UY7A 1FZJB 3HZMA 4NO3A 5LNDA 3U2SB 1NDTA 1AIZA 2WLLB 3ZR6A 1TTFA 4G70B 1M2VB 4ENEC 2UZIL 1JNLL 3FQNB 2R1WB 2YBGA 4CILA 1ZT1B 1D6EB 1T7YA 3A6BL 1KIPA 4YDIH 4BZ1L 2W95A 3JXAA 4JPVH 1NBVL 4PJ7A 4ZFOA 3MLZL 1YEKH 2H3NA 4DT2A 4RWYL 3DPBB 2VLKE 2Y24A 3ARFA 3FB7B 4PJGF 5DHXB 2YA0A 5AAMC 1LEIA 2WLNA 1ODUA 1S3KH 1X5JA 2QVKA 1HCFX 2J1KA 2A6JA 2J72A 4I9WD 5AKTA 3F04A 3PV6B 4MJ2A 4N90D 1IO4C 1H3PL 3PHQA 1BYNA 1SUJA 3O9WB 3LH2H 5D2LE 2XN9A 5E2TL 3SDYH 4Z0XB 3L9RB 5EWIL 4V1DA 2YUXA 1ET8A 4Y16D 1QNIA 4MNGA 4J3XA 2CKBH 4ZZFA 2X1WL 1UCBH 3DVGA 1G9MC 3MCLH 2NXZB 2EDLA 1IBHA 5LGHH 1UOWA 3QJZA 2ZXBA 2LU3A 2NXYB 2YXMA 4M48H 5FKAB 4PCTA 4EN2A 1WP6A 1SDYA 3I6GA 3LKSA 2E9GA 2FO4A 4DP8X 4GUCA 3CSGA 3WFDH 3IM1A 1HEHC 2AF2A 1JHKH 4L1HA 4FYSA 3VFNA 1RIUH 4J8RB 4Q4EA 3BKCL 3NCEB 1OWRM 1IKNC 2EDQA 3KM2A 4BSWA 1CT8B 4GSDH 3P0YH 3FT4A 5CZKA 3MBWB 1ACCA 2VLRD 4KVPA 2YAOA 2GITB 2DWTA 4A7GF 4HS3A 4UILH 4LOEA 4N9GA 4KU1A 5F44A 1KPUA 4ENZA 1RKRA 5L4JA 4W6XB 1BXAA 1M05B 3K0YA 4HJ0D 4QR7A 1LO5A 3TA3C 1FNSL 1YNTA 4HEMA 3GEWB 3U30C 2AQTA 3J2PA 3WJLA 2QHRH 2VIRA 2NRDA 2V2TA 3RNQA 1T1XB 2ROYA 3RGHA 3VFNB 2ENPA 3AT8A 1SRDA 2AW2A 1DVQA 1JI1A 1CYWA 1NC4B 1JVLA 4HBQA 5SWSD 4CJ1A 2XY1A 1Q9WA 3ETSA 1I7ZB 1HKLH 3MUJA 4LKXB 3OZKA 3BRDA 2H32H 3L3IB 2X3BA 2X41A 4FXLA 4W1TA 3MV9E 3T1FB 1F58L 1I31A 4E41A 1YECL 2AV7A 4IKNA 3EKCA 2JKXA 4GPVA 5G5DA 1XIWA 5LVEA 4Z0XA 1ZMYA 4XNYL 4I87A 1A6UH 4M61A 4UU9A 3FB8B 5D71L 2HAZA 2J1XA 2R29H 1XTLA 1CE1H 4JO2L 4WIQA 1NUNB 3UZEC 4EZLA 3S97C 4NRYA 3DV4B 4B41A 3UZEA 1NCUA 1Y6KR 2XWEA 3BAXA 1UD8A 4YIQA 5C7ZA 5IB1A 1ZE3H 4NQDB 3ASNB 32C2B 3V4PL 4ESKA 4K7FA 2CUAA 3RWCB 3GLAA 4TM9A 4UAHA 4TOYL 4QLWA 4L0YA 5FGRA 1IC4L 2F68X 1K9TA 1TJHL 3CSPA 4ZPVA 4QYAA 3IMWA 3D39D 1U30A 4XVTL 4K3DH 1EAQA 1IGJA 1LL1A 1AJ7L 2W81C 1B9KA 2EO1A 3L3GB 4UDTB 4X7DC 4KQ0A 1JPGB 4LQ1A 1INEH 2QELA 2XG4B 5KYUB 4PRNA 5F0JB 1K85A 4M7LH 4IK6A 3DV4A 1J87A 2JIXD 4H1LB 1O6SA 1N7MH 1J7VR 4F7KA 5IMOB 1ZS8B 3POHA 1A6VL 3VMOA 3O0RH 3LPOA 4O00A 4MD5A 1A14L 2EH7H 4M7LL 3II2A 4HZ1A 2F7QA 2K1MA 3OKOA 4JGNA 1RIVL 3K72A 1UTDA 4IHOB 1F4XH 2YZ1A 4LBAA 4TUUA 4YE4L 3DBXA 1OAUL 3RNQB 4Y9EA 3WLBA 2IFGA 4YAQA 4MVBC 3EFFB 1F4YH 2BMKA 2Z31A 4HMDA 3S3BB 4HYTB 5ITFA 4KKNA 1OD9A 2ARJQ 4D9RE 4YFDB 5E8DL 4WFEE 2WBXA 1RK7A 3OGCA 3SE4C 2B8OT 1AP2B 2VDNB 2FL5B 4OCRL 2O5ZH 1NWOA 3QT2A 5DRXA 5IZ7A 4FXTA 4G5ZL 1QEXA 2FX7L 2H5UA 4RIRA 3N40P 3R1GL 3IDJB 4U6HA 5I19H 1MI5A 2R2EB 3OSVA 4JO2H 5JW4N 1D5MA 1UCBL 2OTUA 5LGHL 3B7TA 3QUYA 4NZUL 1R3JB 2X4TA 4I88A 3RWEB 2HMID 3D3VA 1JJUA 3LCYA 2XZCL 1HDMB 4KUCF 3RZCA 3FUMA 5DMGC 3WU1A 3CAFA 4KJPC 1CUOA 2XZZA 3H4FA 4YN3A 4OF0A 2FTAA 3V6ZA 2EYTA 1KBGH 4MXWL 3BC9A 5F3BB 4DETA 1MI5D 4HKZA 1ZSDB 2EYRA 4PWJA 4BDVA 3HC2A 3W0WD 1A7OH 1MFEL 2DQDH 1J8HA 3RDTB 7PAZA 3VTMA 5KYYA 1I8MA 4BWWA 4OVVA 1HSBA 4NHCL 4G42A 4FQJL 4LEXH 4XWGL 3QA3A 3FRPA 5C07D 4FQLL 3ZLQC 1TCRA 1XWVA 2M83A 5KOVC 3R0MA 1P5UB 5ENWA 1TMCB 4Z0BH 3IJ8A 4UILL 1IGYA 4PRBA 3JQOB 5B39B 3UMTA 1ZLVK 1IGIL 2LHAA 3DIVA 4FERA 4EQ3A 2KYIA 2YD4A 5EN2A 5HYJE 5C0RL 2XTJD 3QJTB 3HI1A 4AQAA 4M7JL 5C0NC 2VYRE 4MMXB 5F3BA 1IFHH 2DBLH 4HKZB 4NJAL 2H3XC 4MB1A 3S98A 3L2NA 1X7QA 1QA9B 1I7RA 4PTUA 4WTXA 2CPUA 3KLQA 5HHQB 1QSVA 4JKNA 2NY5C 5FFOA 3MRNA 4E68A 2NY5H 5JR1L 5CP3A 1VZGA 3VWKB 5JLZB 2EIMB 2AQRA 3PYCA 1RCYA 2HFFB 3RPIB 5GGQH 3FFCB 4JQIH 4G83A 2Y2YA 4WJKB 4XCCH 5I1GH 2BW5A 4WW1B 1U4FA 4GKNA 2ALWA 4PI0A 1WK0A 3HUJF 1XEUA 2RBLA 3HHMA 2E7LA 1A6UL 4XVSL 1HZKA 3QPXH 3ZSSA 2KDYA 1OANA 3P30H 3RVXD 4AGOA 5F6HI 3TTSA 1AHWB 2WW8A 5IB5B 2ZOUA 5BJTB 5IF0B 3MV8A 4HJ0C 1IARB 3X11A 1B2WH 5AD0A 3RUGF 5EOQH 4AIXA 2E9BA 2E7BA 3B2VH 5BZZA 1O9WA 3OLEA 3QXDA 2WQSA 1NLDL 2RB8A 5HI4C 2MCAA 5K5YA 3RDTA 4HF5H 4KTEH 3A24A 2OYLA 5KYYB 5HYIA 2ATPA 2WBJC 2XFGB 5HHOE 3SGDI 3TT3L 1XTMA 1TQTA 3QE5A 3IDGB 2C9VA 1BVOA 2CK0L 2IQ9L 3P11H 3O6LH 3RL1B 3OR7B 5C70A 4MCZA 1OPGH 4ZNEE 1BZQK 4ZXBC 4BKLA 4UQIM 1BVZA 1RZKC 1EANA 4BFKA 3B9VA 3NZHH 4RH4A 1YDPA 3MAWA 4FJYA 4HPYH 1HSAB 3ARDA 3NH7L 1NPJA 4GW4B 1DDTA 3NP4A 5G4MA 3ESNA 4PN6A 2BIHA 3X1EA 3H56A 3VW3L 3WE6B 1EAPA 4CN4A 5B3NA 5HGBB 1AR1D 2NY7H 2WO3B 5CILL 3TL5A 3OR6A 3C08L 3E7JA 3P2BA 1NH6A 3AS1A 4K5NA 4NN5C 5IIEB 1PKQE 4B7LA 4ES9A 1ETJA 2H2PC 3LDBB 5MEND 3BRGC 1ZVSA 4M5YH 3DHPA 2XOTA 1GY2A 2ZWKA 4F27A 1F2QA 3MNWB 4H40A 1GXEA 2GHZA 3LZNA 4G9FE 1E7UA 3V6FB 4A55A 2XKNB 4AEEA 1KTJA 1KPRA 3V0IA 3GXFA 1NICA 4Y2OA 2UZIH 2A99A 3FHAA 3CFBA 5MEPB 5IFHL 5EZJA 3D2UD 3DYMA 5KAQG 5AVVB 1IT9L 4Q6IC 4RA3A 1MNUH 4FZEH 2A0LD 2VC2L 5JA8B 3WUWB 1SDAB 4R4BB 3UYRH 3D09A 2YOCA 4XO8A 1IGFH 2BSDA 5CSZA 4OY9A 4Y7MA 3OAZH 4QHLB 2CHNA 5LJYH 4FHKA 1Q90A 2CRYA 3QS3A 4L1LA 5DT1H 3KL0A 2ZXQA 1KSRA 3Q44A 4ZD3H 4KUZL 3O4LD 4UM8B 3T8XA 1WZ1H 1UACL 3IDXH 3HJ0A 4BGLA 1QSFA 5E1GA 3CLFH 4N2GA 5ID0A 4YHLL 1T7XA 3U6RB 3QO0A 5KVDH 4GKOA 1WEJH 4LSQL 4CN6A 3FQWB 2X42A 3IJ7A 2AV1A 4U49A 5DJYB 1CBVL 3FUNA 1KCRL 5TFSH 3WENA 2AEWA 4DK5A 3G6JF 3IXTB 4X5QA 4G8FA 3U9PH 3BN3B 2VDQL 4S0TD 4LFHD 4G1EA 3EDJA 3HB3D 4OD2B 1Z3GH 1D7CA 2H3NB 5TFSL 2VXSL 1DBBL 4B0MB 4D0CB 1JYXA 3VW3H 1EEYA 3B7UX 3Q5YA 2YD2A 4BELD 3JV6B 2Q9OA 1QACA 4HQQH 3BLBA 3QZNA 5L2KA 1WFMA 5IROA 3F5WA 4ZAKD 1USZA 4KDWA 5SWZA 1OCRB 4TMPA 4GSXA 4R26H 5IM7B 1BGXH 4GI9A 4GXVL 2VW6A 3UX9B 2E47A 2VH5L 5F9OH 4DZBA 1I8LC 5FWRA 4A7SA 4LOUD 1GIGH 1XF3B 5DHVB 3MO1B 3EJQA 5F9OL 2DLFH 4JO5A 2D7QA 1UJ3B 1JFQH 2X6MA 2JQAA 3QI9C 1ZTMA 2FO4B 4B9GA 3NZSA 4FLSA 4TVUA 3NFNB 2V37A 4WY7L 4OB5H 2GQHA 2CJUL 4M8QB 3B6SB 3MOAH 4ZW8A 2YK1H 4QO1A 1SJMA 4HFUH 1JGDA 1UGKA 4GO8A 4Y5VC 5BZWA 4QT5A 3ULUE 1EPFA 1SFHA 4R2GD 3TNNB 4GLRH 4ZS6D 3GBNH 5CM1A 4I1RA 3WO4C 3ZHDA 4K9EH 3N0PB 4UT6L 1OSEA 4JFVA 1G0XA 4POYA 4PJ5E 3OF6D 1TEGA 1U8LB 4TVPH 3GGWB 1HN1A 4E42A 1PG7L 2GAZA 4RIRB 2IAAC 4FLQA 5JOFB 1FO0B 4Q6IB 2BW4A 4UBDC 1WEJL 3KYAA 3QBTB 2GBTA 3NACH 3I74A 4FJ6A 3BH8B 4JDEB 1PD0A 1D5XB 1JPTH 1TLKA 3MLRH 3DTXB 5L8JB 1RUAH 1E2VA 3MRPB 5GIRB 3WFHB 2W38A 5BCAA 1HDMA 2QADC 3F85A 4JR9H 2FD6L 3EH3B 4LDLB 3WS6A 2HVKB 3RKDD 3AU1A 2FH8A 4K7PL 3OXSB 1BMWA 3W9EA 3GMNA 5ACZA 2F18A 2PWHA 3HNTL 5BZWB 3DI3B 5FGCE 2DMBA 1KC5L 3N06B 4LCIH 3T2PA 2YGQA 5LG1A 3ZDZB 5JIHA 4F2ME 3D52A 1S9WA 2OL3L 3FUDA 3ARDD 1HYRC 3JWNE 2AQ2A 4S0SD 3VG9B 2VQ1B 3BFWA 3PWNB 4GAYA 1QFUL 3FCSA 1A9BB 4H0LC 1EFQA 4FP8L 1JFHA 3AREA 4YLCA 1XR9B 3QPKA 1A7NH 4RAVB 1FNGA 2R0KH 4CKVX 3RKPA 3BPOB 2CO3A 9CGTA 1OE2A 1AO7D 3SGKC 3SQOH 3VRJB 5CZXC 3L1FA 3T2LA 1IZKA 1AG6A 3K2UL 3MMEA 4F7PB 1UWFA 2X0WA 2XWJB 4YQXH 1RUPH 4M8UA 5CINH 2X4PA 1CYGA 4TUKH 4WVRA 2AS5M 5E1IA 2B4CL 3FS9A 5EU5B 1OAQH 4WU5B 4G80A 3LNEA 2GABA 4LSPH 1FN4A 4PJIE 4HS8L 1L7TH 2OSXA 4NM8H 4MYWB 3GLDA 1IGFL 3MGAA 4KY1H 1GOGA 3CFQA 1I9RL 3FFCA 1ED3A 4Y4FB 5IVXE 2UUDK 1P9MC 3B1TA 5KVDE 1MW1A 1XGYL 3NIGF 1E6OL 4JY6B 1BREA 3RVWC 5B4MC 4DNLA 2DL2A 5FV2A 4KVCL 2SODB 3D4YA 2NY0D 1P1ZB 3QC5X 3RWIB 3BH8A 4JDEA 4X6CA 2YD9A 1B6DA 1FYTE 2CG9X 1HVXA 25C8H 2XNAA 3KPNA 4NC2B 4PH8A 1BG1A 5I76A 2PW2A 3FH5A 1TQBB 2ADFH 3MN8A 3FQRB 5JW5B 5GS0D 1YEGH 4HS6B 1TJXA 4MAYA 4HULB 4WNQA 4MJ6B 5K93A 4DKEH 5E4EB 2BXZA 3DOSA 1A7QL 4YHZL 5KVFH 3LS4L 3K0WA 4G6ML 5GISL 1U3HC 4YXKH 4A2GA 5ABDE 5I28A 5F7AA 5IUSA 3DGGA 1IE5A 2R1XA 4WDIB 3Q5OA 1TJHH 4GG6B 1WCBA 4FNPA 1IAII 4NQVA 3EO0B 4O2EA 5CEYB 4JCWA 3L8QA 2A73B 5H37G 1T5WA 2N7SA 2GBVA 1KACB 2HTLD 3NSYA 3DTDA 3H9HB 3OKDB 1DVFC 4K9JA 4PD4J 2FJFA 5HSFA 2PWEA 3D2UA 1RSYA 2PYEA 3DVNB 4HWEL 3ISRA 1IV8A 5HHPB 4GG8B 1LK2A 1T1ZA 1MCPH 3EXLA 2W0KA 2BSCA 3O45B 3AQZA 3NA9H 2MRYA 1RERA 1EDQA 1VLXA 2K4WA 2VSCA 1NFKA 2YRPA 1T2QH 3DIDA 1B0WA 4X5LA 2P80A 2Q87A 1RY7B 1I8MB 4HFUL 3NZUA 4HHAB 3U7AA 2FLRT 4PB9H 3QJRB 5LDUA 5GHWL 3IT8D 2IAMD 5BQDA 4JVPA 4YDLB 4LDEB 3V9FA 5HYJD 3CFTA 4LIQE 5FYLD 1QASA 1RJCA 3NFSH 4P23B 5DFTA 4PGEA 3SE8H 1A6ZB 4AYFA 1K8DA 4NZTL 3L3OA 2L7JA 3P4MA 4PRDB 3TN0B 1QO3B 4ZG1A 2GTWB 3QDGA 2ZOKA 5I5RA 5B1AB 3VA6A 2VDRH 3RGVB 3QIBB 1BQKA 3WDJA 1EJ8A 5HVWA 1QPXA 3AG3B 1YEIH 3DBSA 5HHME 4XOEA 3K91A 5EZJB 5EUKB 3INOA 4U3HA 5L2JB 3OKLB 3R4DA 4G6JL 1XIWD 3GI8H 3VM7A 5L0QB 5IVXF 2YPVL 1U8PA 5B7EA 1YYLL 1CBJA 2Y0SA 4ZMYA 3U0PB 1JWSB 1JZIA 3KLSA 3WJLC 4OF3A 5ISZE 3ARQA 2GJPA 1ZLSL 1YMMB 3QNXA 1CL7H 3DA0A 3E8UL 3S4SA 5GS1A 4AT6B 2P47B 5GS1C 1XH2A 5HVGB 3OC8A 3HG5A 4PJBE 4PJCA 4KXAA 4F7EB 4XVTH 5GGSB 5JOEA 1TG8A 4XAKD 3B9KC 5EUOB 2Y07L 5EUKA 4NM4H 5TE4L 3GSNL 3C9NB 5ESAA 3JWDC 1DUZB 4U6XA 5C0RH 5J13B 5J7CC 3AWGA 4PJFA 4HP5A 3PIQA 5A2IH 4JANA 3EG9A 4MRBA 3S48A 4PJBA 4GSRA 5TE4H 5EOTA 4IRSC 5ICXB 4IRSA 1RUPL 4YSAA 1E50A 4V2CB 3DNKA 3QQ3A 1Q9OB 1HINH 3I84A 4LPVA 3VI3A 4C83A 5GS1B 3BISA 3IDIB 4IOFD 2AK4D 5IMKB 3QR2A 1X5GA 1H6EA 2M1KA 3BMWA 4IU2A 2WTRB 4QWWC 3AQDA 3OWRA 2EICA 4AG4H 4QOKD 5DS8B 2B1OA 2PR4H 5SX5H 1Q9LB 1TEYA 4UANA 3RZWA 2WXPA 4G7YL 5GJTH 4LMQE 5C0EA 5L7XH 1DUZA 4U6XB 5IFJB 5I1EL 4OU3A 5AW4B 5LBSA 1MWAH 3NA4A 2C1PB 5FPIA 3O6MH 3WMPA 4AK2A 3PWLB 3OAUH 4FMFA 2OYPA 4E0RB 3KYMB 2VTFA 2CGZA 1P2CA 3I3BA 2NUTA 4PJIB 3D18A 2OXGB 3AAZA 3QYNA 2G60L 4M56A 3RFRA 5JMOC 3AABA 4G7VH 1GGIL 2K6YA 1KLFA 2F5AL 1Q94A 2QQLH 3MCG1 4ZDHB 1O9ZA 4L1BA 1VAHA 1BIIB 1RLBA 4FNRA 1IBGH 4CJ0A 2JK5A 2E5EA 4UINH 1JWUA 2R29A 4WHYG 4K7PY 2F5AH 2J73A 4U6VL 1A1OB 1NUDA 4UB0L 4G82A 3TJHC 2OW6A 4IJ3C 5FUCC 4Y7OC 5TDOB 4KDTA 2PYFA 5E95B 1S7XA 4G6AC 3NG5A 1MJ8L 4B60A 4NQCE 5E5LA 3C6EA 5PCYA 1Z9MA 2BS71 1UC6A 1GMEA 4Q6YA 3RIFK 1L3NA 4YL4A 3TV8A 1K4CB 2JKNA 4PJ9A 4MRCA 4Z7NF 1EWHA 4R3SB 1W16A 1X5FA 4QTHB 5CP3H 5IG7B 1WAPA 1U8KB 2W07B 4HUVA 3MJ8A 5IQ9B 2E9WA 4YHOH 1T1WB 2NQCA 4B9YA 1G5GA 3BH9A 1S7VB 2PR9A 1MCOH 4DPBX 1A6TA 4XN8A 3KLDA 3CX5K 2PR4L 1C9SA 4MX7A 4X4ME 4X4MA 3D33A 4MA3B 2YMXL 5IR1A 1JG9A 1QSFB 3ARRA 1G4RA 3MRBB 5T1JA 4KI1A 5C09D 4HOZA 5KG9B 5T1LD 1PEZA 2MOGA 1PSKL 1U95B 4O5LL 4YSOA 1RU9L 4L29B 4UV7H 1OP3H 4OF5A 5IQOA 4RX4D 1A4JB 2IQAA 3REWA 3BKYH 3VRJA 4OD2A 4N2BA 4G59C 4OQ1A 5DD5H 3P4OB 4XX1E 15C8L 1P6AB 4WTZA 2VLLB 3RWFB 3VXOA 4E0RA 3BH9B 4CVWA 5C0JB 1YG9A 4Z3TA 3PNWA 2BOLA 2GY7B 3I9PA 4G9DA 1U8QA 5LWYH 3Q06A 3WOVA 4XP6H 2ZYHA 1OCWL 2JMRA 5HDBB 4HV8B 4RAUB 3NCWA 2H0EA 5KSAC 5C08D 2D0FA 3D25A 4LLDA 4UNTA 4IM8A 2QSCH 1JV5B 4JFDB 4X50A 3MLXL 5EEXA 2FZ3B 1IKFL 4N9GB 4OV5A 1JL8A 1RZQA 3DDFA 4JG1H 3I9AA 3G04B 1ZGLM 1CO1A 5DMKB 5F7MC 1K72A 3MV7B 3GMRB 2J44A 5TPWH 3UAFA 2DDQL 2LU7A 3IEAA 1ECYA 4OFVA 1PFCA 2V2WB 4APQA 3ZGIA 3GMLB 4TV3A 4PW4A 2J55A 4A2HA 1RUQH 2G4GA 2WGNB 1FP5A 3SDAB 3FQRA 5AUMA 3NN8A 3LZOA 1AVAA 1N3NB 2F54A 3Q2LA 2WNWA 4J3OC 5CJBA 3V79C 1ZJAA 5I6PA 1MCJA 3K74B 3E0GA 2BSRA 2I7OA 5BRZE 5KJRH 3MLYL 4DP5X 1I1YB 4ZOEA 1XGTB 3Q3GA 2ZG2A 5CLTA 3DJ9A 4L1TA 2QPDB 1MUJB 1CDGA 4OCYH 1QWHA 3WELA 2O6CA 3UYPA 3WKYA 1BGXL 3PJLA 1DVUA 2VWEE 3FO0H 4NZ8A 1KCUL 5ID1B 4NWTL 4X6EA 2G3XA 4AE1A 4ZW3A 2Y7LA 3A4AA 5CCHE 2F54B 3CZGA 1EEQA 2Z8VC 1J5OL 4Y2DB 3L95A 4P8QA 4P99A 2XTJE 4MQ7B 2HG5A 3OQRA 5HI3D 3CVHA 4UNVA 1FYHB 1YHPA 3UERA 3CWGA 5IY5B 2VITA 4PRHB 7PCYA 2AJSH 3SBQA 1EXHA 3TFBA 5CSGA 3PNWB 3HLAA 4OLUL 2WHVA 5ANMB 4HXBH 1AFVH 5D5MB 4WWKA 4JHAL 1CS6A 3B43A 5H2BB 3TEYA 4OLXL 2BVOA 4EDXA 1JV5A 4AYFB 2JQMA 1WWCA 1NCIA 1E28A 3F05A 4U1HB 3DI2B 5LLIC 2H6PB 4OCWH 1WPCA 1A5FH 5HGHA 3ZIMA 4PWHA 4Y2DA 3F7LA 1X5KA 3WKML 4XN1A 5INCA 2ZX6A 3KPMA 1MG2C 4R5XA 3QIBA 1NM9A 3S2CA 1RD6A 2AAVA 3IE4A 5FGBC 5CR1A 3IVKB 4DO4A 4Y16A 3L17A 4PLKD 1XAUA 4F3FA 5EBWB 2MQGA 3WJJA 3TJEH 3CX2A 4KVNL 1LDSA 1OP5H 2UZYA 4FXKB 2PPFA 3QZOA 3ARBB 3LZFL 3WFCH 5J0BA 1BW8A 4WEMB 4NPJA 3I02B 3T2QA 5DJ2B 3O2DH 4TQHA 1W2KT 3C60A 3O11B 4Q0XL 1WIOA 2D7PA 5AB1A 1S5IH 4OLYH 3QZPA 3FO9B 1TKWA 2ATPB 4HH9B 1JYWA 1AY1L 4MD4A 4ZS6C 1AGEA 3FO2B 2ITDA 2OCFD 1URZA 2VZSA 3SYOA 3V4VL 1B3JA 4JKMA 4WW2C 4B5ZA 4JFWA 5C3IA 4XP4H 4KPHH 4YHKL 4BK8A 1Y1UA 4ALAL 1S7TA 5DQ9B 2FBJH 2ZUWA 4GQ9L 5C0DA 2J4WH 1RULL 3KH3A 4DP4X 4XAKE 2EYTB 3VXMB 3PDOA 4ZTEA 5BQ7B 3FT3A 2KI6A 3FOLA 4Y4KD 4BDVB 1ANUA 2B4CH 4IRJD 3G08B 3KH4A 2LAGB 1ZS2A 2MCG1 3BUIA 1F3RB 4PJAE 1LNUB 2EC9U 5GZND 1FIGL 2C4FU 2V6HA 4BV1A 2A9MH 3MRQA 5D1ZI 5LBVA 2IDTA 3GMPB 4O9HH 3KBHE 4J5VA 3BCDA 3KR3L 2I26N 5E9DD 2VDKB 3ME0A 4LAJH 1IZJA 3BAJA 2DQEL 4LQFH 1HL5A 2WMPB 1WV7T 4R4ND 5FKAA 3GXMA 4X2UA 5IREA 3EFDL 2W9DH 2CXGA 1S78C 3EYQC 4POZC 3A4EA 2NSQA 2VDMH 3O0LA 3ZTJG 3O2WL 4YL9A 2ZWLT 5T3XH 4RNRB 3ZHNA 3WNJA 3OLGA 2M2DA 4PV9A 4LARL 2IH9A 5C09A 4NX0A 2DYPA 2PABA 4P2CG 4R5VA 4GAFB 5FAAA 3WJMB 8CGTA 4QWWD 2G5BA 1FJ1A 2E0PA 1E67A 5D1QA 5KANG 4GKLA 2G2RA 4MB5A 1MEXH 3Q9QA 1FL6A 3BEVB 3HE7D 2XPYA 5CBEA 4NNYB 3MCLL 4J4PD 3E6FB 3WL9B 1NAMB 3IJYA 3F12A 2AJ3A 4PRHE 1LWJA 1YNTF 4XNAA 5D1ZD 4H2AA 1AZUA 1D3CA 1INDL 1J10A 1J18A 3F6IA 2ICEC 4N0UE 4PJ9D 1AHWA 4LCWE 4PRPE 1MFDH 3FHEA 1MH5A 4W4NA 2FWOA 3L1EA 3DO7B 5DK2A 5F89A 4OZ4B 4QRQB 5C86A 5AB2A 4YX2H 4KMLB 3CPLB 1B0GB 3RIAK 4HALA 3A6CH 4PJHB 5AZEL 3ZRSA 4X5PA 3BQUC 1UT1A 1PFOA 4AH2B 5AW5B 2SEBB 3M7OA 3VACA 4PAZA 3BWAB 4MFHA 5D1ZB 1D5BB 2GTZB 1PD6A 2HA1A 4IBSA 3FAWA 4KO6A 3EJCA 5E08L 1CK0H 4WKZA 2FJHB 4YH6A 1A14H 2EH7L 4LVHC 5F8QC 4F57H 4KZEH 4UU9B 3FT2B 5FK9A 1HAUA 2OZ4L 3GRWL 4HUUA 2OPCA 2CLVB 1UHVA 4LKCB 3ARGB 3RVTD 3FN9A 3E9UA 1BX2B 1WLHA 2AQSA 2GHWB 4I0PD 5I1LA 1JNHB 1KELH 1GGBH 1G6RB 2GPZA 2VZVA 2XQBH 4FFZL 3UTSD 3NFNA 3ULUF 1MIEL 4AH2A 1YJDC 3ZDYF 4HDIA 4Y16C 1EZVX 4G9FD 2NY6B 2ADIB 1HZHL 3PG2A 1T7WA 1GCYA 2FIRT 2NY3D 1N18A 3H8NA 4CVXB 3D51A 4E9WA 3LEVL 3X1GA 1FC1A 4MCZB 3T65A 3HUJB 1TQUA 5B22A 4O4YH 4Y4KB 2FO8A 2VN6A 4XMUA 1RFDH 1OW0A 1SVZA 3ARXA 4ONGH 1BFOB 3HFML 1CE1L 3WNOA 1ZSHA 2A4ZA 1J8KA 3OMZA 2XDHA 4UZUA 3VH8G 1NCWL 3F12B 1E4JA 3P02A 4JFFE 3Q1EA 4DO5A 3EYFB 1P9MA 4U7SA 2OULB 5A2JH 4L0PB 5AENA 3TEXA 1FVDA 5F7NC 4FL4B 3RL2B 1EXGA 5HHNB 1PG7W 1I82A 2BOCB 5DZ9A 5D93C 1KPVB 1MHHB 2HTLC 1RZFH 4ZFQA 5JORB 4MMZC 1A4BA 2O30A 4J4PA 1BJ1J 3IYLW 3L3KB 4J4PC 5DS2A 5DZOA 1QP1A 2I85A 4P3CL 1UKTA 1KB9J 3S3JA 4HC1L 3SBRA 4DF9A 5LHDA 3FAXA 4JZNA 2GEEA 4G8EB 4U4IA 4IYKA 3SEPA 1QLEB 2G2PA 3QAZB 3MBXH 1U3HD 3CJJA 2ZUTA 3FUHA 3MX0A 1F8TH 3CC1A 4JX0A 5F1NA 2WQ8A 3BYTA 1BAGA 1H3TA 3GC3A 1KTRL 1VFBB 3HC4H 1SHMA 2W9EL 2EKSB 1ZLWK 3MNMA 3FZUC 1U3HA 1ZRUA 3A3YB 3VGEA 2Q0ZX 4QRFA 4JQIA 1R3JA 2X4TB 4FL4C 3SE3A 1OAYH 1R24B 1SEQH 4PR5B 4PCSA 4JFFD 4J3VA 4UYQA 4H8QA 4YGAB 1YEEL 4PJDF 5CCKH 3LEXA 3QDMD 5SV3A 5E6UB 2JIXA 3OAUL 3ZQ9A 4YBHA 2DIJA 2CBQA 4XHJC 5FCUH 4AMKH 1UADC 3TV3L 3D69B 1FFPA 3BQVA 3SDDB 5BMFH 1KV3A 3QDGD 4KGJA 2GSIB 3GS0A 5AW0B 1ZXQA 5DUML 5CD5D 2RCSH 2G60H 4LU5L 1W91A 2XA8L 2Y6TE 4U3SA 4G7SB 5EU6E 5LBSL 4CVXA 4IS6A 3B2UC 5DJZB 3CN0A 1NCCH 3O3BA 4LSRL 4GJTB 4KWUA 1CL7L 1EO5A 3B3IB 1VDGA 3B2PA 3NMEA 3AC0A 4KI5D 3CFUA 3PQYA 5HYSA 1RJZB 1SOKA 3BPCB 1WBXA 1JPEA 2AJZA 2IJ0C 1AACA 5GRUH 4DN4L 4YWGL 1B2WL 4OZGE 1EERB 5TQ2L 3T5WA 4QD2E 1DANU 2NXZD 4JPIB 4BH7B 4JFDE 4XN9A 2XNAB 4YWGH 4G7RB 3W37A 1ZD6A 2ATKA 2JCCA 1D9KD 1UB5B 2W91A 3QUGA 1R5IA 4NP4H 2GBAA 4XGZA 3WXWL 4EI5C 4KHTL 4GAJL 4NRXB 4A7GA 1OM3H 5D7JC 1R3IL 3PPEA 4X7TB 4H1LA 3KGUA 4BRJA 1BFVH 1ID2A 4ONFL 5CWSB 3QJOA 4JO4H 1F00I 1N68A 2HT2C 1AGCB 4BQ8A 3HS8A 4KOBA 1DDHB 2ZCKH 4XO5A 2O1AA 3ECBA 1QSEB 4HIHA 5D2LF 2ORBL 5IF0A 5TDPA 2WP3O 2J6EH 1FVEA 1PJWA 5DK0A 4MAYC 3BAKA 4KMQA 3BCFA 2I24N 5LO7A 4OZFG 1XCQB 3HCVA 5ACZB 1HHIB 2W8CA 1ACZA 1JCVA 2ZSWB 3DLQR 5I8KH 4EIUA 3CZSA 4O51A 4WI6A 4GSQA 2JCCF 5EPMB 3GM0A 3HRZC 2ICWA 4JFFB 2JJTC 2EADA 3WFEL 3H9SE 4NZFA 2GSIA 1IFGA 3SYPA 3U7YL 3RIKA 4WWKD 4R4FH 3OBAA 3S96A 3L4CA 4ODUB 3GQFA 5AEAA 2EUVA 4F8NA 3MHZA 4UDTA 5B1JC 2HKHL 1CLOH 1YAIA 4BKLB 1IGTB 2NY4B 3TVMD 4HEME 2QZQA 3KW8A 4X6DE 4WF7A 3TN0A 4QRRE 4UZSA 5E8EB 5C08B 4S2SB 1BCIA 3AU1B 4HGKC 1EZLA 4L23A 2F7PA 4PYGA 3UBGA 3NP3A 1IB5A 4I85A 3AB0B 2ZCHL 3LQAL 4K8RH 2BSSA 4N5ED 4Y5XB 5C0BD 2UY6B 4MD0A 1QYGH 4MJJA 5L2JA 4XPTL 4JFQB 4TVSa 4KRNA 2WVSA 3DC0A 4IOIA 4KJQD 4P5TC 5IHWA 1G7LB 3MNZB 1U8HB 1Y18A 3FULA 3GSXB 1GAFL 4FADA 1DQLL 4XN2A 5DRNA 2D3JA 4MCNA 3VD7A 3D7PA 3OZ9L 1ADQH 3GJEB 5J3HC 3NJHA 2X44D 4NZDA 3S4SB 5I5MA 5C9KA 1N5YL 1IILE 4D0BA 4JO4L 4F1ZA 2E6QA 35C8H 4IRSD 4Z95L 1F3DJ