4A68A

Mutations in the neighbourhood of cota-laccase trinuclear site: d116n mutant
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSNGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPORE COAT PROTEIN A
publication title The Role of Asp116 in the Reductive Cleavage of Dioxygen to Water in Cota Laccase: Assistance During the Proton Transfer Mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 147
structure length 502
sequence length 509
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A02
1IBZA 1ID2A 1AACA 5B1JA 1WA0X 3C75A 1L9OA 2FQFA 2JFCA 2UX7A 1WA2X 3PCYA 1CUOA 2XXGA 1JXFA 2QPDB 1OCRB 2W88A 3NJJA 2QDVA 4YSQA 1PAZA 1JVLA 4A67A 1IKOP 2FT8A 2J55A 5I6MA 2BP8B 2PP8A 2DY2A 4GP8B 5I6KA 3EF4A 2HX7A 4YSSA 2XV2A 1RKRA 1NIFA 3NSFA 1RZPA 1EZLA 1SDDA 1NPJA 2TSBA 3CG8A 4DP2X 1A4AA 1BYOA 2GHZA 3N55A 1GSKA 1JXGA 5B1JC 4WKXA 2IH8A 3ASNB 4UANA 3OMAB 3CZUB 1I53A 1XMEB 1IC0A 3DIVA 3NSCA 2GB2A 1J5DA 4HHGA 1NPNA 2NRDA 1GY1A 4KNTA 2YAPA 1NIBA 4G70B 3UABA 4YSPA 1ZDQA 1NZRA 3RYMA 3QQXA 3S3BB 4HCGA 3FSZA 4QLWA 3PPSA 3AW5A 3FU7A 1J5CA 2CCWA 2QPEB 1KYAA 1L9PA 2N0MA 3NJNA 1AR1B 5AKRA 3QJUB 3H56A 3CDZA 3JTBA 2ZOOA 2WO2B 2EIMB 4AX3A 1PCSA 3OQRA 1SHXA 3HB3B 4AKPA 3ASOB 5ANHA 2X87A 2VSKB 2EIJB 4HZ1A 1PZCA 4E9WA 2PP7A 3X2QB 1J9TA 5AZUA 2DYSB 1QLEB 3ZDWA 3DTUB 1CC3A 3OM3B 2IAAC 4YL4A 2BO0A 4A2FA 5I6LA 3NJHA 3TASA 1JZGA 4E9QA 3AG3B 1W8EA 3FQYA 1A4CA 1BQRA 1VLXA 3S8FB 4GP5B 4KOBA 1ZDSA 2A3TA 2HLEB 3WNIA 1FA4A 6PCYA 1X9RA 3WI9A 4BWUA 1ILSA 2Y1AA 5I5MA 2IDUA 1JZJA 3NJLA 4ENZA 3FYEB 4PCYA 3QJRB 1JZHA 1NIAA 3MBWB 5B1KA 3TU6A 2PLTA 5B1BB 1NTDA 2PCFA 1GW0A 3MX0B 1QNIA 4DPCX 5D4JA 4ZK8A 1OCCB 1SNRA 4E9TA 3IN2A 4MFHA 4YSDA 1KBVA 5TK4A 3PAVA 4HCIA 7PAZA 1WA1X 3V9EA 5I28A 1ET5A 5B1AB 3TA4D 1L9QA 4G7RB 1J9SA 1JZEA 1XB6A 2BZ7A 3CVCA 3EHBB 2B3IA 4YSOA 5F7BA 1BQKA 1HFUA 1KGYE 1N70A 2XVBA 3FPYA 4DP7X 2VM4A 1AS6A 4YSUA 3T6WA 2LLNA 3CVBA 1NWOA 4L0PB 3X1BA 2HX8A 3FSAA 3IE9A 4E9XA 2UXGA 1BXUA 2BP0A 3JT2A 4FAAB 8PAZA 2HX9A 2IWFA 4HAKA 2AZUA 3AG4B 2J5WA 3DKHA 3FU9A 4DP4X 1E67A 3FQ2A 3SBQA 4UF7C 2CBPA 3WKQA 2JKWA 2ZXWB 1KDJA 3X1EA 3NJMA 1J9RA 1AAJA 2CJ3A 4KNSA 4A2HA 4QKTA 2GBAA 4F7KA 3FSWA 1A8ZA 5B7EA 1B3IA 4BWTA 2VM3A 4DP6X 1ASPA 3NJFA 2J57A 2BP8A 1PF3A 4M4RB 3S8GB 1IBYA 1UATA 5LDUA 1AG6A 1L9RA 2VW7A 1MZZA 4NERA 2IDSA 1ET8A 1TEFA 2PP9A 1JVOA 1MG3C 5B7FA 3S3CB 1HAWA 3NSYA 3H4HA 2DV6A 3BVDB 3QPKA 2AZAA 4BK5C 2VN3A 3BQVA 2X88A 3TBBA 4JHUA 1V55B 1M57B 1ZIAA 1KBWA 5I26A 3V9CA 9PCYA 1L9SA 4GYBA 3ZBMA 3HEIB 2Y69B 2IH9A 2UXTA 2YARA 4BDVB 5I6NA 2GI0A 2HZHA 5D4HA 2QDWA 1FWXA 1GYCA 2YAFA 2RACA 2JXMA 1OF0A 1V10A 3NJIA 1SDDB 2R7EB 2XWZA 2XLLA 3QJVB 2GSMB 4GY4A 2DYRB 1MDAA 2WSDA 1GY2A 2XU9A 4KO5A 4NAJA 2P80A 5B3SB 2BWIA 3X1FA 2FNWA 1BYPA 1PLAA 3X1NA 1ETJA 1TU2A 1JERA 1EHKB 1GS8A 2P80D 3FT0A 1JZIA 3OMNB 1NICA 3FU7B 3PXLA 1F56A 1AQ8A 2IWKA 1SF5A 2QT6A 4G72B 1MG2C 1OCOB 2YXVA 4HCFA 1X9UA 5D4IA 3KW7A 1AZRA 1URIA 5IY5B 3G5WA 2XV0A 2YAQA 4P5RA 2FTAA 4YSTA 3CVDA 5B7MA 2OJ1A 3X1GA 4KOCA 5F7AA 2GC4C 1BQ5A 2EINB 4M3HA 4Q8BA 1OV8A 2VMJA 4YSCA 3FQ1A 1AIZA 3NT0A 4YSRA 1GS6X 1WS8A 3ZIYA 3T6ZA 2HRGA 4N4YB 1E5YA 2PPFA 2TSAA 4HIPA 3SQRA 1YLBB 3WNJA 2OCCB 3T6VA 1M9WA 1OE2A 2H47C 1MZYA 2IDFA 3OD3A 4YSAA 1AZBA 2CUAA 2BZCA 2IDQA 2FQGA 2PCYA 1N68A 2FQDA 1E65A 3AY2A 3D12B 4DPAX 3AG1B 4P5SA 1BEXA 4DP0X 2FWLB 4A2DA 1SF3A 2H5UA 4GXFA 1W6LA 1NWPA 1AZCA 2XYBA 2CALA 5I6OA 2I7SA 3FS9A 2YAMA 4UAHA 3UAEA 1FFTB 3T9WA 1AG0A 4E9YA 3NP3A 2XX0A 5PAZA 1E30A 4FA7B 2VSMB 1KCBA 2HXAA 3UAAA 3NSDA 1NDTA 2EIKB 3ABLB 4Q89A 3ABKB 1IUZA 1AS7A 2GIMA 1XB8A 4KO6A 4WTQA 1DZ0A 3GDCA 1OE1A 4BXSV 1OOWA 3ERXA 5I5IA 3EH3B 4BWWA 2FT7A 3QJTB 2MTAA 3WG7B 1PZBA 3IN0A 1L9TA 1OE3A 2BWDA 3AZUA 1SHWA 1KDIA 2J56A 1AS8A 2Q9OA 3WIAA 2PPEA 2HRHA 2Q5BA 4KO7A 4BDVA 4W9ZA 3WKPA 3NJGA 4GP4B 2ZWNA 3S3DB 2H3XC 4DP5X 1PY0A 1GR7A 2YAEA 1W6WA 1TEGA 2YQBA 1A65A 1A3ZA 2AFNA 1JOIA 3IBOA 5E9NA 2R7EA 3TBCA 3GXUB 2BW5A 5I5JA 3UGEA 3ZX1A 4CSZA 5EHFA 1AANA 1ILUA 2E86A 4G7SB 4YSEA 2FQEA 3U25A 1ADWA 3FPXA 1XB3A 2XUWA 1A4BA 3ABMB 3QJQB 1R1CA 4AI7A 3NJKA 4EF3A 3T6XA 2DWTA 1WAEA 4DPBX 4YVNA 2GC7C 4BXVA 1T5KA 2VW4A 3FU8A 3PAZA 5PCYA 4F2FA 2WO3B 4F2EA 1GS7A 1SJMA 1CYWA 1J9QA 2B08A 4W1TA 2ZONA 5I6PA 1NIDA 1ZPUA 3FYIB 4PAZA 3QJSB 4E9RA 2PPDA 4DP9X 4YVUA 2UXVA 1PLCA 4G71B 3OMIB 4A2EA 2OV0A 3T71A 1PNDA 2IWEA 1E5ZA 3CDZB 1RZQA 2I85A 3AG2B 5TK2A 4KO9A 1AZNA 1DYZA 4X4KA 1TKWA 1M56B 1HAUA 1PLBA 3PLYA 3EH5B 2UXFA 5A7EA 2YAOA 4AZUA 1V54B 4JKNA 4E9VA 2PPAA 4JHVA 1AOZA 4HHWA 2EILB 1OCZB 2XV3A 1BAWA 3PAUA 1ZV2A 4AKQA 4CSPA 1NIEA 1WS7A 2VW6A 4DP8X 2I7OA 4G7QB 1JZFA 3FSVA 3N2JA 4A68A 1QHQA 4DP1X 1RCYA 3NYKA 7PCYA 1KCWA 4K9JA 4E9SA 2UX6A 1ASQA 4TXVB 2FT6A 1AZUA 3EH4B 3KW8A 2YAHA 2AVFA 2AANA 4RH4A 1ET7A 5FC9A 1PMYA 1SFHA 2FJSA 1ASOA 3NP4A 1SFDA 3ABGA 2DWSA 2W8CA 4HALA 1CYXA 2BHFA 4N8UA 1PNCA 4A66A 2XXFA 2MRYA 3H4FA 3UADA 1JXDA 2XX1A 2YXWA 4AKOA 2BW4A 2PPCA 3SBRA 1ZIBA 1BXVA 3UACA 6PAZA 3GYRA 4A2GA 3IEAA 3L45A 4NB7A 1CURA 1NINA 2CAKA 2IDTA 1KV7A 2BP0B 3SBPA 1BXAA 5AFAA 4KNUA 1PZAA
chains in the Genus database with same CATH superfamily
1J5OL 5D93B 4I0PA 3GMNB 4HG4J 2E6QA 4GKSB 4IU2A 2K6ZA 1MPAL 4X9HA 1NFDB 2D0GA 5CO1A 2UX7A 3HI1B 1QMUA 3DSFH 3ZE2F 1ZS8B 5IROA 1BQHG 3HPJA 4Z7NE 3U0PB 1AO7B 3QDJA 4LLQB 3MZTA 1KIUA 2PR4L 4LLYA 2LU4A 4A67A 4XOEA 3TLRA 2FT8A 4X5RA 3K6NA 3EYVA 1GJUA 5HDBE 1R5IB 1NM9A 3D33A 1RQ5A 3CZKA 1RZPA 2FEEI 2GJPA 2KC0A 1I3VA 4KTEL 2X70A 4L4TD 2V4LA 4PR5A 5L0QC 5D1XB 3LEVH 4G3YL 1HWGB 3SO5A 5I66A 1WICA 3FU3A 2XQYA 2R2BA 4NNPH 4QXUH 5FO7A 4K3EH 3ZYJA 2EE9A 5DMJB 3E6HA 1L6XA 1GY1A 2E7BA 2EEDA 3GGWA 2O72A 5MEOB 1WWBX 4Y5XB 4NLHA 3S3BB 1NGPL 3AT8A 4NC2B 1FH5L 4N68A 4NS0A 4G6AD 4L4TE 5HYFA 5MEPB 4ODHH 3KBPA 3FFCE 2JIXD 1H9VA 4EDWH 5D2NE 2WO2B 4JG5A 4P2RE 4OZ4A 3V6OC 3QJFA 4EZKA 1HZKA 1RUPL 3L16A 3P4LA 1TQVA 4ORGA 4D0BB 3MCKB 1QKZL 5I17B 2CRZA 5GS1C 4XO4A 4GO6B 2DD8L 4L3EB 2X89A 3RUGA 1JMXA 1INDL 4E9QA 1T03H 1W8EA 5K33A 2ESVE 4L9LC 4XO3A 4JO4L 4WI3A 2WP3O 2ITEA 1AE6L 1ZDSA 4NUMA 4POYA 5IJVB 5MI0C 1AZZC 2XBDA 4OUUA 5DWUH 1ED3B 1IFHL 1TMCB 2F0CA 1EXGA 2IANB 1U21A 4PS4H 5AEAA 2GSGA 4JJ5B 3MJ9A 4IDJL 5JQIB 5IVXE 1IZKA 1A47A 1SJEB 2BNRD 2WB7A 3HUJA 4XPGH 4GRWH 3MRBB 4KUZL 3O45A 4IU3B 4X8JA 3VRLF 2MQCA 2L7JA 2Y36H 2PW1B 3NCEB 1SUHA 5L8JB 3BI9X 3IU4H 1OHQA 1T7XA 2A6DA 2XICA 3SEPA 2Q8BL 2ATPA 2E6JA 1M7XA 3VFOB 1KTCA 5LWYL 4FQQA 2L3BA 4GI8A 4WV1A 1UCBL 3FFDA 1ZLUH 1ZA3A 5JIKA 1WT5C 5G55A 4Y0GA 1J9SA 2WXMA 3G7TA 2IPUG 4ZTOL 4ZO7A 4JL2A 4YSOA 3BUPA 1BQKA 1KCKA 1TG8A 3PABA 1CIUA 1L0QA 1QLEH 1U4EA 3V7MA 1EXUA 1CXLA 5F7FA 3RWEA 2WIMA 2AC0A 3LV3B 2FECI 1TVBA 2EEAA 1WG3A 2VCOA 3DETD 3FU9A 5EOQL 1UWFA 3H9SD 5J5EA 2WVVB 1HXYA 4AMWA 5J8OA 1YDPB 3MJWA 2R69A 2FX7H 2OULB 8FABB 3QDMB 4Z7UA 3BEWB 2EVFA 1ZV5A 3HG5A 2CJ3A 5CCKL 2NY5H 1S7SA 2QVFB 3NZ8A 4HJJL 4WDIA 4A2HA 1BG1A 2VH5H 4F7KA 3FO0H 4DO6A 1RL1A 4BZ2A 1RVFL 5DLLA 3EGXA 2BP8A 5C2BH 1Z32X 5ESVA 2YA2A 3H9SE 5FGRA 2KLSA 5HI5C 1J05B 4UIMB 5LQBL 5DK2B 4LGSB 3QR2A 1AG6A 1B4JH 4U1KB 2WBJB 1ET8A 2PXYB 4L4JA 4M9PA 4N24A 3L3IB 5CIPA 1JVOA 5C8JB 4JO2L 4JKPH 3GSXB 3S3CB 3LN4A 5ISZB 3F7YA 4CVZB 3LSOB 3VTTA 5I9QC 2VLKA 1FL3B 2MQ0A 3CHOA 3QNXA 1OSYA 3A47A 4J8RA 4JFDE 3VVVA 2QQLH 1TCRB 3V4VH 1U8OB 1R3JB 4HC1A 4Z77B 3IFPB 1XIWC 2UY7A 4YHZL 3MRHA 4HK0B 2CKNA 4XN2A 5F1OB 4G9FE 4UQ2A 4MNHA 4BDVB 4MZ3A 1BAFH 1OTTD 2YBRA 3SD2A 3EYQD 1PDKB 1UD5A 2BIOA 2F7PA 4H8PA 5CHNB 1A7OL 1A5FL 3OAUL 1SHMA 1G1YA 2VE6B 2FX9L 1JE6A 3FT1A 1HEHC 2R59A 1CFVL 1IIIA 1F00I 1LLAA 2ADFL 4PY7A 2IH1B 4WY7L 1PLGL 4QNPE 3HC4H 5DJ0A 3ULVC 1I9EA 2O26U 3WHXB 4MD5A 4AYMC 3DXAA 2D03L 5MEQA 2RCSH 1A1MB 1USQA 1DSFH 5A2IH 1DE4B 4CL7A 1KEGL 1A7PH 4ZAKC 3FB7B 2G4EA 1QFUL 4UDTB 4XCNB 1ERNA 2ZX9A 4N0UE 1FNSL 3BUDA 1HCFX 3K3QA 4Q97A 2C9QA 3ROLB 3D87B 2BNQD 2CIIA 4LL9A 4WSKA 5HYQA 4YDMA 5EU5B 2EXYD 4LOVA 3TBVA 1DBBH 2DJ4A 4KROC 4HSAC 4YHPB 1B9KA 4RRPM 1ZLDA 2XWRA 3FT3B 4RISL 4QRPD 3GS4A 2OW7A 4WEBL 3C6SA 5AVTB 1Y0LB 1HWWA 3JTTA 2BNQE 3PQYD 3U0WL 5F9JB 1ZHNB 1HL9A 1ODAA 3LKRA 3KNBB 4FCHA 12E8H 4KRPD 4LXFA 4PGEB 3HE6A 2Q2EB 3OKNA 4ORZC 4OFQA 1GC1H 5HHOE 1BFOB 1WGOA 3KE0A 5AVSB 2K8MA 2IDQA 2EUXA 1OAQL 1F90H 1SDYA 3D2UA 4QRPE 3BIBX 1DUYA 4QOKA 1QQDA 2J1ZA 3PWJB 1N68A 5F9AC 5BVPH 4CC4A 1KCRH 2FLMA 3LMJH 2YUWA 4GXUM 3TT3H 1KG0B 3D12B 3LD8C 4P46D 4PJXE 3TBYA 1MRFL 3Q3GA 4ODTL 2AEQH 1B4LA 4BUGA 2FLBT 2XYBA 3HI5L 3FN3A 3JV4A 4RSYA 3ZYOA 2D3LA 3DURA 1IC5L 5LGJB 4KWUA 3BKCH 1U3YA 4P5KB 4UAHA 2HTLC 3S37L 3T9WA 4KTDH 4F80A 3BZEB 1S7TA 5DEGB 3F64A 5CFHA 4X5QA 3UTQA 3W9EB 5AZEH 2CDGA 5BS0A 1J18A 3P30L 3MTXA 3MCLL 4PVNA 3E1ZA 4R7NA 4O2CB 4NQDA 1HT6A 1Q0YL 4X50A 2ZX6A 4KTGA 1MFCH 5HJBA 5C3LD 3P2TA 1Q0EA 4R84A 2EUZA 2BVOA 4LSSL 5EUOE 3UAJA 1YA5A 2XBZA 3FB5B 2E7HA 4MAYD 3F12A 3NRQA 5IEHB 1X5YA 3OAYK 1FI8C 4O51B 4WO4D 3IN0A 4B0MM 2C1OA 3IVKB 3VFUB 4BE5A 4QF1A 3U46B 5DVKA 4YX2H 2J5LC 4G5ZL 3LNEA 3QA3A 4TN9A 5I0ZA 5JPNA 1H3UA 5L2KE 1MCCA 3PWNB 1KY6A 4OLUH 1XCXA 5DHVH 3PJSB 2CKBL 2L0DA 4AGLA 4QRUB 1AD0A 3TBSB 4G6FD 4PVLA 3ZKXC 2AXGB 1E2ZA 1U95A 1WTGT 3PWPD 4FQLL 4L05A 4RFNB 5DJ2A 4NSKB 2KQNA 4ZMPA 1P7QD 5E9NA 4CSZA 3V7AE 2EUVA 3OKDB 2OSXA 4AGPA 4ALAH 4OZIA 2NNCA 3ES6B 4D2NA 3PV6B 5K9OA 2KLRA 1VCAA 4X0NA 3OKEB 4FEIA 5I0YA 4ZUVB 3HNTL 5IJBC 3GSNH 4DKEL 1MVFA 1VFUA 4QLRA 3TN0C 1KY7A 4G42B 1BOGA 4PJFF 3H7BB 3PWPE 3UTZA 3FU8A 2R56L 1J9QA 1I4FA 2VDLB 2COQA 3Q5YA 4PJEA 5JW4R 1Q94A 3LNGA 4AYGA 1IV8A 1NC4A 1E7VA 2VAAB 2BJMH 2AJ3A 1TJHH 2XQBH 3CFNA 2A9ML 4N2EA 3ULSA 3QXTA 3TA3D 3UZEA 4APQC 3WTTA 4P48A 1F2QA 3OMIB 1N59A 3MNZB 4L8BA 5I1IL 1EFXB 2OMUB 1IJ9A 3CDYA 2QTVA 3VG0L 5JW4M 1DLHB 3CDZB 3UEZA 2DM3A 2JXMB 2LFEA 2H6PA 4P59L 5CN3A 2HJFA 4HUUB 5JIMA 1X7SA 2MPAH 3AROA 3IFNL 4I77H 3ZL1A 5I73B 4C4BA 3CHRA 3PHSA 1MW3A 3ZZQA 1TVHB 1YEJH 3FQWA 2PO6D 3LZOA 1RUAL 4MLSA 4Y2DA 2XTJD 5JXEA 2Y07L 4PSPA 4HPYL 1Q1PA 4JPQA 3RFZA 2EUWA 1EEYB 2DL2A 2Q20A 4C8XA 1HOCA 1G5AA 1TZAA 5HYJA 5KBPA 2ZCHL 1UENA 3HBPA 4LL4A 2NOYA 3T0EB 3ESPA 4LVOB 5F88B 4TTDC 3QC6X 4IKKA 3NYKA 4AJWA 2DIJA 4LLUA 2BRQA 3IM1A 2X9ZA 5MERB 2FD6L 1SMOA 3DI2B 5GS0H 1F6AA 1F6LL 3WTXA 3SQBA 1A8JH 1CFNB 3WIHA 4NQCE 5DRWB 2A9BA 2OR9L 1CF1A 1FHNA 4N6RA 4F8NA 1R19A 1Y7VA 3HE7D 3SDAA 4F91B 3H3PL 5E5MB 2VZVA 5EZLB 4X6CB 1KB5H 3BPNB 4QIRA 2WLYA 2Y5TB 2A9DA 1OSEA 2F5AH 1E3FA 4N8UA 4HLJA 4F8PA 3Q5TA 5FM5O 4JM2D 1NCJA 2JK5A 3BAXA 1A6ZB 1JXDA 1CO1A 1QSVA 4QRSB 2IF7A 4PV9A 5KS9F 1SY6H 2A4EA 5DFTA 3K0WA 3CPLB 5DQ9A 3F7QA 3QNFA 4KKZA 1CN4A 1JCVA 4TQPA 4HXAL 4IRJC 5I1KL 4U6YB 3B8YA 5EOCL 1BXAA 5T1KA 5AB2A 1SQ2N 3NA4A 5BNXD 4L1SA 3U83A 1RZFL 3B9KD 3JZYA 3LH2L 1WAAE 4M3KB 3JV6A 3C5ZA 4N2FA 3WMQA 4DZBB 2Z65C 4K3DH 1WA0X 1L9OA 3C5SB 2OYLA 3VXQA 2CMRH 4PRHE 4ZMZA 4K7FB 4M62L 4MXQD 1Q9WA 5A2KH 5JLZB 2W88A 3V8OA 3GB7B 4J27A 3UO1L 2DEXX 1K6QL 1S8DB 3HKFA 3W2DH 1P0SE 4PJBE 3T4AA 5I6MA 5TFSH 5E1IA 3RKPA 4JN2A 5I2IB 2G75B 2IFFH 3NG5A 2X9YA 4Q6IA 5D2LE 4G11A 1BM3H 2XV2A 2DIEA 2C1PA 5IBUB 2FBRA 3NCJH 3P11L 4TVPL 5EIIA 1JHTB 3SDYL 2OJZL 4MNQD 4LLMB 4LLAA 2F18A 3WS6C 1GSKA 3FRUB 2BIHA 3LKPA 4M1GL 4X9IA 3VMNA 4LF3B 2IPTL 3CZUB 1SZNA 1EHNA 2P47B 4S1QH 5AW3B 3RWGA 4AIZA 5D1QE 5EB9A 4ERSH 5KYUB 3EGSA 4JREC 2XHNA 4IKLA 4JR9L 5KN5B 3V95A 1I3RB 3V9FA 3CFKA 5DZNA 3RVTD 3SQOH 3B9AA 3FBKA 4KUCF 3WJMB 2QPEB 3BYYA 3GLAA 3CFBB 1QFWI 2N0MA 4QTIL 5I1LA 3QIBC 2P5WA 1E27A 3LKSA 4IGBC 2X4QA 4YDVB 4DAGH 3F7VA 1NKRA 3NAAH 5GJSL 3Q48A 5C2UB 3DI3B 3UPRA 4XAKD 3LEYL 5T5FA 3OL2A 3TT1L 1T4WA 3MBXH 5CD5C 3CBRA 5KYXB 3NJHA 2YD0A 2JB6A 1N3NA 5KVFL 3MNWB 2EDNA 1NAML 4YN3A 3WOVA 5JUEH 1T1XA 5AW0B 2CXKA 1J1OL 3NESA 1RIHL 2QSTA 4HIIB 4ZXBC 3Q6FA 1QFOA 2E9WA 3CFMA 1I85A 4L8DB 4OB5L 3VACA 1HOEA 1JZJA 5SWZA 3IDXH 5HHMB 3ZHFA 3WIFA 3DX9B 1V3MA 4L48A 4PBXA 4P2OC 3D3VB 1KPUA 4UT9A 1S7QB 5TH2B 4PYGA 2PCFA 1CD1B 1JF5A 1GW0A 1MHEB 2NQ3A 3BGFC 3P54A 2NY6C 3UJTH 3QUYA 3QJHB 4E36A 2B59B 1SNRA 3LDBC 1DBKL 1DQDL 2CR3A 1NCTA 4TVSa 5FKAA 3P4NB 3PAVA 4LVNB 3EJPA 3PUUA 5GSRA 3V9EA 5K1JA 1N5AA 5HJGA 4HH9B 2TRYA 1OP3K 1OB0A 2JQAA 1CQKA 4XXDB 1CICC 2K3TA 2ID5A 1Z9NA 4Y9CA 2F54B 3T6WA 4Y4KB 4YO0B 3T0DA 4WSJA 3CVBA 3LIZA 1WHPA 4OBRA 3IFLL 2MKWA 4XXWA 4G6JL 3WMPA 1DDHB 5BZWB 4OJAA 4BINA 1CCZA 1ETZA 1YEGH 1IGTB 2NLJB 5GZOA 1R3KB 1E67A 1FVDB 5T33H 2VR9A 2R0LH 3HCVA 2K7QA 3VFTA 3X1EA 3S34H 1KTRL 2XYCA 4XVUC 2EDJA 1P5UA 1VADA 2ZG2A 3MUY1 2K9FB 4XCCL 3S4SG 4YLCA 3MVSA 3THMH 3QHZL 1GA2A 5C0BB 4ZMQA 1YEFL 2BVPB 3IJ8A 3DUUA 1B3IA 1P7KA 2C34A 4F20A 4JPVH 3SKNB 2WUBH 2WXQA 4AITA 1KYUA 4PJIB 2Y7SA 3F00A 4YHML 5FW7A 2RQ8A 2OK0H 4N8VA 2FRGP 1JWUA 1IEAB 3ROOA 2EDDA 1KTBA 1PSKL 2V0AA 1DFBL 1L9RA 2Y6SC 2GK0A 4N2OA 3A4FA 2PP9A 2X53A 1KNOA 2B0SH 3IYLW 4L29A 3GRBA 1F4YL 2C7FA 4LSPL 1EJ6A 3M1CA 5H4YA 5D9SB 3WU1A 5F3FA 4GSUA 1CFSA 1E9PA 3VI4A 1HDMA 2AEPH 3UYPB 1XCQB 1I7TB 1EDHA 4N6QA 5IQ9B 2EICA 3QDGE 5KJRL 4PGCA 3O2DL 2RJMA 1MJ8L 4MAZA 3FAWA 3SYQA 1LEIA 4LQ1A 5CXPA 3QIWB 1YQVL 4K2UL 3V5DB 4QRRD 2HKAA 3L08A 1JNNH 2KKQA 3WIIL 4H13C 3KVPA 3IGFA 2Q6WB 4DFHA 4M6OH 3NMEA 3KH3A 2FX8L 3UH8A 3PWLB 1KTJA 1DJXA 3ARBB 5K9KB 3FRPB 5I24A 2RACA 5BZZA 1IEBB 1CD8A 2BY3A 3O6KL 1H8OA 5D8JL 3V6OE 5LHDA 2IGFH 3QZPA 2BDNH 4JZNA 4ZFOA 4IBLT 1LE9B 1QRNA 4I9WD 4NBZB 3BN3B 1YYCA 4G8GD 3VX0A 4AQEB 4LPXA 4M5ZH 1CXEA 2HP4A 1B90A 1AR1C 1PLAA 1NDGB 3TO4A 1J1PH 3PHQB 3V4UH 4A7VA 5J1AB 2QVTA 3PJNA 4M48H 3SE4A 2P80D 3FT0A 4RFEA 2VDMB 1JZIA 4FQ1H 3CFJA 1EJOH 1EAPA 1MQ8A 1JUFB 5KSBF 1TQBC 5INDB 4I9WE 5TE6L 1P2CA 2FE0A 1AGEA 1URIA 3DK2A 3N1MC 5FV1L 1KJVB 5FO9A 3JSSA 2ICEB 3MOBH 3VM7A 1I1AB 2JKTM 2Q76B 4N0YH 4J4PC 4LE8A 4Q8BA 4E41E 3FQ1A 3WUWB 3RIFK 1CS6A 3NT0A 4MA7L 5DQDL 2J73A 4F24A 2WTPA 4L8CB 4I0KA 1TITA 4PS8A 2P43B 1M3IA 3F84A 5F3HB 3SE8L 4CU6A 4WZ9A 3TV3L 3TYFA 1QSED 1H6TA 2MWCA 5FHBH 1JIBA 5LXVA 1I9RL 4PJDE 1SVZA 4FQXC 4W9IC 1CF8H 3RY6C 4PRIE 1RULH 5KSAB 3QXWA 4F57H 3WNJA 4J3WA 4MVBC 1AGFB 1RJLA 3P73A 4NKOB 4EI5D 3EHBD 3KBEA 5I1HL 5HGHB 5CLWA 2WSKA 3MODH 4J23A 3QI9C 3U6RA 1KTLB 3S36X 3MLTA 3B8SA 4XN5A 1KBGL 3VB8A 1IAIM 2Z4QB 3LB6C 3ZDZB 1E65A 3QEUA 4NKDB 4ODXA 1Q1JH 2DLGA 2VABB 1M7UA 1U8PA 2IXQA 3N50A 1LD9B 1TXKA 3Q5OA 5H8DA 4EN3A 5I71C 5IF0A 4U0QB 1E9OB 5J12B 4K15A 3T2NH 2YIHA 4PTUA 5HVWA 2GJ6A 3MNVB 2O5XL 2AJUL 1TVDA 5TE4L 3X3GL 5PAZA 2NY1B 1VRSA 1OGAE 4YE4H 3QWRA 4WEMB 2AQ3A 3ABLB 3EO9L 5M94B 4LIQE 3HIZA 3O6FA 4X5XA 3MRQA 1R0AL 1MFBH 1H0DB 1GGIH 1NCAL 5DUJA 1XF1A 2ED9A 4NBYB 1O7VA 3UBXB 4AE0A 1H9DA 1DBJH 2D4FA 2VDOL 1I75A 2BMKA 4LMQE 3IJEA 1FVCA 3WG7B 5AVZB 4EN2A 1IGMH 1L9TA 1OE3A 2EDLA 3KPSA 4FX5A 4GQ9L 4J3OC 4FG6C 4PRPB 4X4YA 1MLCA 3SOBH 5T3XL 1PS3A 4YDJA 5B21A 5E24E 2W9LA 2Q5BA 4FCAA 1QEWA 2MKLC 4HIEA 4LSVL 3QG7L 4ZNEA 3GHPA 3LQZA 3ZLQC 2A6IB 3NZHH 1UQSA 3LVTA 1MI5B 3CHSA 3LHAA 4XWOC 5BOJA 5EBMB 1A65A 1A3ZA 3GRWL 4YOKA 5B4MC 5EWIH 4U1HB 3UZVA 3QDAA 5BCAA 4HIJA 4WUKH 4H7VA 3AB0B 5AKSA 4MJ5B 5CEZE 3CX5K 3RY4A 1C5BH 1KIPB 3CAFA 3QJQB 1JSYA 5F1SA 4KC3B 4EF3A 2VDNB 4HKXB 4PRDA 3IJYB 5F7EL 1ND0A 5KSUA 3ULVE 1BQHB 3MA9H 1I8MB 5KAQG 1LO2H 3N9GH 2NXYD 5FHAH 5MHSD 5BV7L 4FXGA 5AUMA 4KROD 1A6UL 4MRCA 3RL2A 3MLVL 1N67A 1X5HA 2ZUUA 1OPOA 1ZPUA 4FHKA 4HLEA 2AK4E 2PPDA 3ZDYE 4DP9X 2OZ4H 1WAPA 3QQ4A 3E6FB 1U92B 1DQLH 4YDIH 2ZPKL 5ITBL 2WXKA 4YHNB 3RGHA 1E3ZA 3QNZA 5I1AA 3LKOA 2ZUQC 3QH3B 5SX5H 1DEEB 4OGYH 1DYZA 3VXPA 2AJZA 1TKWA 1E42A 2PCPA 3NCCB 4GRMA 1ZLWK 1PLBA 4NFBA 4P8QA 1K5NA 4JRYA 4GXVH 4JZJB 4NYLB 4U6TA 1A9EA 4E0RB 4JHZA 1CJYA 4P3CL 4F7TB 1MCNA 2Y2YA 5IB5A 1RZ7H 3UX9B 4PI2A 3NGBB 1XEDA 2ZCLL 5K39A 1PKQE 5CSZA 1U33A 3OX8B 1U6AL 3ZZLA 5IHBA 3PE9A 4YNYB 2LVEA 3QISA 4DEPC 3S5LB 1HHIB 1A64A 3HHRB 4G7QB 4M7KH 4PV1C 3ZR5A 4F9PA 3HZKB 1C8PA 3CSYA 1G7MB 3LCYA 3TZVA 1HHGB 3DIFB 5F9OH 3WLBB 3VGHA 3ESVF 3WE6A 4GG6E 1UB5A 4H2CA 4BQ9A 2DYPB 3V6ZB 3QC5X 3QORB 1JPTH 2FGWL 2BFGA 3ISYA 2OXHA 5E2JA 4EVNB 4UTBL 1LE5B 4ISVB 4HUWA 3MRGB 1R3LA 4YEFA 3MRCA 2HT2C 2XT1B 5E00B 3QQ3B 1FNHA 2GW5A 2ZYIA 1OP5H 4U6HB 2ZOKB 4AKOA 4FQHA 1NC2D 3L3JB 4AEHH 3N0PB 4H0GA 4PV8A 5DMIH 1XMWA 1BXVA 3WFBH 4B3VA 3GD1C 4F2MB 5C6TL 6PAZA 2I26N 4MJID 3L45A 3L5IA 3O8XB 1EAQA 1CGSH 1P4LB 3MLZL 4XNQB 5IB3B 3S88H 4JGNA 3C6LD 2Z34A 1KJ2B 1JHKL 1UB6B 4OKVB 3GTNA 43CAA 2FWSA 4JPIB 4Z76B 1C5CL 3NK4A 3S3SA 4KNUA 3T09A 1B0RB 3G6DL 4OLEA 2Q3AA 5D71H 5FB8B 2FATL 2ZKXA 1FFOA 1WRFA 4NQTA 3N1FC 4YWGH 5C0GB 4FYSA 5E6IB 5G2NA 3W9DA 2AEOA 4TLKA 3U6XS 1PAZA 2FYVA 5HYSA 1IKOP 1OARH 3QUXC 1KXVC 2J1XA 4XN4A 3VI3B 5L4JA 4L4TA 4KGLA 4XVOA 1JTOA 3WFEL 4H20L 2OTUA 5IQLA 1OAXL 1EZLA 2OJEA 2EYRB 3MGTB 3BAYA 5F7DB 4UQ9A 2OL3H 3IT8D 5IB2A 4ZUTA 3KPPB 4Y4HC 1OGTA 4M7JL 4BYHA 1EUUA 5D1ZC 5BJTA 2LHAA 4APQD 5C9KA 2AK1L 4KV5E 3SYCA 7FABH 3KG5A 4NAQA 5I19H 2WSPA 1XBRA 4M4PA 1ITBB 1IC0A 4WU7A 4HUKB 1IM3B 2J12B 4POZC 5AAWC 4EBQH 2EYTA 5E4IA 1S3RA 4I9XA 3QS2A 1BFVH 2WCSA 3F6JA 1BGXH 3NABH 4JFHE 1LEGB 3ZRSA 1ETA1 5DYOB 1AXSB 2YD6A 4WWKD 5C0CE 3DO7B 3KVQA 4HMCA 2AJSL 1YSOA 5IMLA 4GBXC 1BD2E 3MRRB 3AMKA 3CMOH 2M2DA 4FQJL 2R29H 1YNKH 2SEBB 2PN5A 2VDQL 3TXAA 4U31A 2BXZA 3HTLX 1G7PB 3VW3H 2K4WA 2O5YL 5FECA 4BFOA 4LRIC 4E9WA 3S48A 1RLBA 3D39D 3AJ7A 2DYSB 2E0PA 3AM8C 1BZ8A 3MBEC 4NDMA 4BH8A 3RDJA 3KLDA 3V79C 2DMKA 4YL4A 4A2FA 1NEZA 1Q0XH 1AFVH 4Y1AE 4ZOBA 1BIIB 1QFWH 1T2JA 4IBTA 2LQRA 3S8FB 1FGNH 1R47A 3HNVH 1WBZB 3A6BL 2BNRA 2NR6C 5HPMB 3Q1SL 5DHYB 1X9RA 4Z3TA 4BWUA 5J57B 1AMXA 4Y2NA 3QFJE 3Q05A 2NY2D 2EIDA 1CGUA 3UFIA 2L7EA 3BEVB 3CVIL 5DHVA 4QXVA 3SJVB 2XG5B 1T0MB 2HSIA 1BBJB 3H54A 2NQCA 1PPIA 1FBIH 3IDMB 3SKMA 5CUSL 1ZLEA 3QXVA 4PLJC 2Z31B 5IM7B 3GMRB 43C9B 4B9CA 5TK4A 1RUMH 1LO5B 2ZSWB 1UM5L 2Y06L 3VG9B 1E9QA 3JVGA 2W59A 1BMWA 3GSNA 1W8NA 5DJZA 2NT1A 1X7QB 4YFDB 3RE0A 2PUQT 3OKLB 2Y3AA 2V5SA 4N8PA 1F4XH 1H3PL 4PJ5D 1OVZA 3GSVB 4X7CC 4P2QB 1BVKA 4QHUB 3OVUB 3P9MB 3H9SA 1L5GB 5JR1H 3FSAA 5I30H 1XH0A 5ADPH 1BXUA 1JYWA 3JT2A 5KBKA 4WK4B 5KW9L 2IWFA 3FDWA 4HAKA 3GIVB 5IWLA 2J5WA 3IMBA 2MTPA 2A74A 4LVHC 3J27A 1RP8A 2MPVA 1UJ3C 2TAAA 4NM4H 3FULA 5FK9B 1U93A 4RBPH 4PJ5E 4YXLL 1VPOL 4KK5C 5AOKA 4MAUL 2OZNA 5F1IB 3RIKA 5DA0B 4FNLH 5I8OH 1DQIA 2ZOLA 1PZDA 2EVJA 4JK0D 1GKOA 4BWTA 4IJ3B 1RK0B 3B56A 1MIML 3DGGA 5AKTA 4K5PA 2VAJA 1AO7D 4NPYB 1UA6H 2DH3A 4HVBA 1EGJH 2ZXDA 3TURA 1GPOL 4XNBA 4ZX5A 2F8IA 2GSIA 2CDEB 2D7OA 5AL0A 1P1ZA 2H1XA 3QUMB 3H4HA 4LNVA 5D1XD 4RGNC 3QPKA 4K23H 5JHDB 2AZAA 3EFFB 3Q2NA 2CR6A 2D0FA 2DICA 1TQCC 4KVCL 4XP9H 4L37A 3WFDH 4I0PB 1JZ8A 3SGKA 2A4CA 4IU2B 2YOCA 1WBXB 1ZIAA 1HX0A 1A6VH 3PHAA 4IGBD 3WMSA 4Y5YA 4U0RB 5KG9A 3QDJB 3H7LA 4LLYB 2HVKA 1GGCH 1U8MA 4N2BA 5I74C 4N0UA 2N1TE 3EYVB 2DQTH 4QY8A 3DDFA 4O2EA 4TULH 3KDMA 1L6ZA 2QVMA 1O7DC 3NFPB 3K2UH 3B7UX 3QSKB 3UXFA 5IW6A 3K6FA 4PR5B 5BVJB 5JW4Q 2FYYB 4XP1L 4K3HA 5H37A 2F08A 1MCSA 4GY4A 4ZXBD 2MCPH 4L4VB 2XU9A 1GAFH 1GOGA 3DSNA 4CKQA 4L3ED 4FZEL 4YHKH 2W9DH 4XGZA 4R5TA 4P2OD 5IW3A 3MYJB 3GGWB 3SE3A 2BNQA 1I8LC 4QJ5B 3ZKMC 4N9OB 1F1DA 4XN1A 5C0IB 3RLSA 1SOKA 2DTSA 3KL3A 5C0RL 2RGSA 3CV5A 1T3FB 3BUQA 3NA9H 3HG1B 1F86A 4OZ4B 2QZ5A 1A7BA 4QRPA 1DVFC 4BCXA 4L23A 1A21A 4TLTA 2VKXA 1H8LA 1YYLH 1NEUA 3KJ4B 3PQYA 4J12A 1N2RA 3ETBJ 1GS6X 1KPRA 2H7WA 2KZ1B 2WXNA 5AYUL 4PJXA 3FZUC 3T6ZA 1T22A 4PJHF 1BFTA 3ECBB 1OEZW 3GK8L 5HHQA 3RUGB 3EJRA 4G9DB 4YXKH 2DQHH 3PL6C 4HPOL 4U2YA 2VJ0A 4DZ8B 3T6QC 3W5NA 2UZYB 5IHZB 5ESAB 2OTWA 3V5KB 2QLYA 2DS4A 3I50L 4GMSH 1HH9A 3EDEA 4OUUB 5B8CC 4UINL 5HI4C 4LRNL 3P9WB 1IBGL 4P46A 4TUJB 1HU8A 3BGMB 3ZO0A 3E9UA 3DJTA 4JO3L 3O45B 5T1DH 5LXGH 2NNXA 4RZKA 1FJ1B 3QW9A 4NWUH 3OB0K 3KYMA 2ICCA 4JPSA 1SOSA 3IU3A 5E2TL 4CADA 2DWYA 1W6LA 2ADIA 1DANU 4FQQB 4WV1B 3QDMD 4MXVF 4P5TB 5GGSY 2Y6SD 3X3FL 4GQRA 1ZA3B 4Y9FA 4AIOA 1LGVA 5EC2B 3P02A 3HZYA 2ZQKA 3NSDA 5L2KA 2Z7UA 4BCYA 3PABB 4A6YH 3MMEA 1K2DB 4ZSOE 3MGOA 3O3BA 1M2VA 3KPMB 3CQPA 4XP4L 2VZSA 4MAYA 3KJ6H 2WBJD 4IBQA 2EH7H 1WZ1H 2PXYD 1U8CA 3U0TA 3HBQA 4Z7IA 2DBLL 4NKIH 1D7CA 4GQZA 3QJTB 5ISZD 1TYEB 4LVEA 1RXLA 4C55A 1ZHKB 3GMOB 2WPGA 1YEKH 3L2LA 3SKJH 2AI0H 4Z7UB 5TQ0H 1F11A 1K8DA 4WDIB 1S7SB 4BRJA 3NZ8B 4TOYH 1IX2A 4KFZC 3NTCH 3IDIB 2HRHA 4YBLC 3SE6A 1WQVT 3PWPA 4KO7A 3ZE2E 2YQGA 2YSTA 2WC7A 1P7QA 3HMXA 5EOCJ 1Z9PA 1FORH 2EEFA 5GRUH 2R39A 4Z5RB 3UP6A 1GR7A 4BUQA 3K0YA 1XGQA 2R7EA 4N8CH 1IJNA 3QCTH 1AR1D 1T89C 3I02A 4WI0A 4QWWD 1LO3L 2ENPA 4H8WL 4XOAA 3LN4B 4JQIL 5JDSA 3U25A 1XB3A 3F7YB 4MLIA 4MNGB 3OLGA 4DH2A 3QEGL 3QNXB 1L7IH 2R51A 1BMGA 1TJIL 3RB5A 2GPZA 3CZSA 2CM5A 2X0UA 4HS8L 4GS7C 3RBGA 3SCMB 3TA3A 4F2EA 3DO3A 4O2FA 4W1TA 3MRHB 4BH7B 2E27L 3W39B 1MUJA 4MD0B 1FP5A 4J4PD 1NIDA 2X0VA 4TTGA 5BW7C 5JIHA 2ZX7A 3DMMC 2DI9A 4QHNA 1QWNA 2WN3A 1OT4A 4BZ1L 4MQ7A 3RWJB 2PO6A 1W0YT 5D7IE 1NCCL 2X4RB 4FFWD 5KBNC 1FN4A 3QQDA 4PY7B 4S11A 1I1FB 2BWQA 2WYHA 5DJ0B 1BJ1H 2YAOA 5FWRA 3QI9D 3NACH 3DXAB 2D3VA 5TD4A 1JPSL 3HR6A 5HGBA 3B1TA 5MEQB 3NIGB 4HHWA 1OCZB 3FK3A 3INUL 5GGRA 2Y2WA 4RRPG 4HK3N 1IAKA 1EZVX 4PJHB 1JF1A 4MDJB 4BHUI 3MRLA 2CIIB 5HYQB 1ADQA 5IV2A 5BV7C 1VFBA 1M71B 3L95A 4MASA 1H6EA 4AH2A 4ZDHB 4Q9BA 4Z7VF 5EULV 5K1VA 1AZUA 3DOHA 3HE7A 4QI3A 1E6OL 4OAWB 1CR9L 1HSBA 2YK1L 4R4FL 3DRTA 1GGTA 5CZXC 2NMSA 3LXBA 1H3XA 5FR3A 1DFXA 1WAAA 2EIZB 3ILEA 2CJUL 4JM2A 4TUKL 5LNDA 2F5BL 2A0LC 1F42A 2WO4A 1FDLL 3E8UL 3UYRH 3ZU8A 5HVFB 3H8NA 3PGFH 2C9SA 1FL5A 5DQJA 4P23C 2BZDA 3P69A 3A6CH 5GRXG 2YMTA 2DKSA 1NGPH 2XG4B 4PJBA 4DEUA 4FLHA 4U1LA 4YMPA 1O6SA 3FTGA 1DUYB 1W72B 4JFUA 5DD5L 5GRVK 5F8RC 3B9KA 4OCWL 5D2LA 2AW2A 1QX1A 4L9DA 3ZZSA 2WINA 4LL1A 4ODWB 2NZ9C 1XBDA 3U7WH 2QSCH 4DW2L 2AV7A 1WJ3A 4BKLB 2E7LA 2BOBB 1IFRA 4EUPB 2Y7OA 5FF6A 1D5MA 4UUJA 1IVLA 4M29A 3G5ZA 2HFFA 3L7FA 3T8MA 4WHYG 4PSRA 4OSUH 5J6GB 3UTQB 2CDGB 3QRGL 5BS0B 1A3LL 5KYYB 1AP2B 1XGTA 3V6FA 1HCVA 5FLUA 3H2WA 4JFEE 4NFDA 4WWNA 3DV6B 3RWFA 5JPMB 3V52L 4NQSA 4MNQA 2XY2A 4PJGA 1RKRA 3CCHA 5FCUH 5IJDC 1Q9OA 1FZOA 3TNNA 4I18C 4JO1L 3HS0B 3L5WA 5CINL 3UMTA 4AV0A 1S7XB 5J6SA 5HDQH 1AGCB 2W80C 3F12B 3OKMA 3ZJAA 4N25A 2ZKHL 3LS4L 1XL6A 3WXWH 2X2HA 2C1OB 1JWMB 3D8MA 2Q8BH 4JKMA 4LBAA 1YMHA 4O9HH 4QF1B 5J4MA 4FQCL 4HUVA 4IIQC 5K9JL 4CW1B 1R24B 1CLZH 4ZOCA 1C9SA 3JWOL 2CCWA 3KVDD 3OG4B 1W16A 1L9PA 5A2BA 2FJFA 3L2MA 1OM3L 1EJ8A 5F70A 5E1GA 2WQAA 1EFXD 3WJLA 2J88H 3BPOC 3S2AA 2PP7A 3B9VA 2OX5A 5KSVA 5T3ZD 3JYCA 4XBPA 2B77A 2Z3FA 3QYMA 1CC3A 4YQXL 2OI9C 1E43A 2EECA 3K2IA 4P9HH 4JS7A 1VKXA 1H5BA 3ME0B 2ROXA 5F0LB 1I4FB 3FN0L 3P0YL 1G7QA 2BVUA 1C7TA 2RQEA 5GGQL 1TF4A 2XJLA 3T0ED 4KKLC 2VQ4A 3RVUD 2RFXA 4L8BB 5KAQF 4CVXA 2AXFB 5EF2A 1JZHA 5LQBH 5GJTH 3MCYA 5CLZA 1G7LA 3GZKA 1N7ML 2HJFB 3D09A 3QXDB 4LCCC 5DZ9A 1U2CA 5SV3A 3U30C 3VFWA 5I0XA 2J2ZA 2Z1PA 2NZIA 3N1QC 3R18A 2DMCA 1JL8A 1T7YA 2G30A 4Y2DB 4Z7VB 5A7BA 2R0KL 5JIPA 1D6VL 4UU9B 4ZFZA 5GRVL 4NOFA 2FB4H 2ZXAA 2WMPB 5HJDA 1AGDA 2ZUYA 4WGKA 2X4PA 4G1MB 2BZ7A 1HOCB 1HFUA 2ERJC 4P4KC 2XVBA 4DP7X 5HYJB 4M7ZB 1AS6A 2HUHA 3HZVA 3HN3A 3NN8A 4M8VA 4R97C 4FADA 3CQFA 3IDGB 5ICXB 4E9XA 2ITDB 4DN4L 2VIRB 2BVYA 4NUGL 4PWFA 3EDDA 2VDKB 1NJ9A 3IGKA 1HC1A 3SQBB 3POHA 2OZ4A 2ILLA 4ECNA 1O5DT 4OR1A 1RURL 4HP5A 3QUXD 1J9RA 4OV5B 1WLHA 1IQWH 3RAJL 3RQ3A 2ADFH 4N6RB 3BKYH 5LGKA 2YEZB 5E4OA 3CZFA 4WJ5B 3Q9QA 1T21A 3ECUA 4G6KL 3DJRA 4PJCE 3WKML 1S9XA 1ASPA 2D03H 5I1DA 4Z7OF 5AW6B 4FDWA 4KQ4L 2JK5B 4X9YA 3AREC 4HCRL 1UATA 1ECZA 5ID0A 1MZZA 1NPUA 5LCVL 1JFQH 1TEFA 1MJ7H 4CC0A 1XH3A 3U4AA 5DQ9B 2D7PA 4OJFH 3NSYA 4Q14A 3GBMH 2I60H 4R7DA 1AMYA 1KGCE 5T1KB 3BD5A 3BPCB 5E8EB 5D96C 3V6OA 2VN3A 1UFUA 3A4DA 4QRRA 4Q0XH 4GBXD 2Y22A 3IMVA 3JV6B 2AVGA 3C5ZB 3CHXA 5JZ7C 5GS1A 1KWGA 2MH4A 5JNYA 1QTPA 2VL4A 4Z7QF 1OAJA 1Q9WB 1A0QL 1R75A 2OCFD 4GYBA 4BFJA 5E8NB 3HEIB 5I0WA 2CJSA 1CDHA 3BMVA 3NK3A 1QBML 1EK3A 1I7UA 3AGWA 2KZBA 4L9LA 4OCRL 4RLDA 1DVTA 4QYAA 2GI0A 5DUML 4TRPH 5GGTH 1DQTA 2QDWA 2X4NB 4HXBH 4JN2B 5GGVL 3K91A 1WIOA 4N5UA 4BK8A 3VCLA 2PR9A 4G8GA 4AYDC 1NCGA 4IS6A 3VTAA 2FEDC 2GSMB 4WSGA 1JNJA 1BVZA 3IDJA 3LKPB 4AQ1C 4C4UA 4E41A 2FO4A 4UMSA 1O0VA 1XDTT 1T5WB 4WI4A 2P80A 4YHLH 2XWTB 5E03A 4AM0Q 1MRFH 5IBTL 3AS1A 4PJFE 4IBUA 4MCNA 2XRAL 1CDJA 1GGBL 4TVPE 4Y19B 3HI5H 4PJDA 4H88H 3FONA 2RALA 3CLFH 3G5XA 5IQ7H 3RWCA 3BE1H 5C0EB 1AQ8A 2P24A 4HWNA 4K8RL 5D4IA 3L4XA 5I1LB 3BH9A 4KKCC 2P5WB 1E27B 5HHMD 2N3JA 2Q3XA 3VFPA 1PVHA 2MQGA 5FYLL 3LKSB 3KL5A 4YAQB 4GAYB 4MS6A 1QSEA 2DEWX 3MRIA 1U58B 1UT9A 4OGQC 4WW2C 5HI3D 4LCIL 1RMFH 3IF1B 1Z9OA 3QCUL 3GMMA 3I6KA 1RZJH 5EIVA 1ZRUA 3FOMA 2DDQL 4X7EC 4F7CA 2HJKB 2BFVH 1NCBH 3DPBA 1XD0A 2JB6B 4EI5A 2OL3A 1N3NB 1G6RB 3WNLA 1YAZA 4YH6A 2E9JA 2KZKA 3QUKA 4XH2A 5DDHA 4M61A 2FDBP 2F54D 4QTHA 1X5ZA 3MV8B 5I18L 1N19A 2DQJL 4Y4KD 2DIBA 3STZB 3GUTA 2VDLH 1FZMA 5I8CA 5KVFE 1FRGL 1ZGLA 3HJ0A 1YUHA 3WS3A 3VWKC 1E4KA 4FQLH 2CO2A 1DJHA 2J8UE 1EZUA 2XWEA 4PG2C 1BVNP 2GABA 2H5UA 4KBPA 1AZCA 5CR8A 4F7EB 4KZEH 1Z7JA 2R29A 3BUYB 1ZSDA 3MJ8A 3UAEA 2A83B 4D9RD 3LPWA 3L1EA 4HAGA 5C71A 1AG0A 5T3ZH 1KSRA 2G2RA 4RA3A 5C0BD 4QMEA 2HFTA 2BCKB 3MLUH 2NX5B 4ENEC 4HBCL 4PJAF 2H8PA 5E95B 1XHHA 1L0PA 4D9LL 5D7LE 3OKKA 1M3JA 4RGND 4J2XA 1Z3GH 1E5AA 2ICWA 4HAFA 2ENJA 3ABKB 4JFXA 3K6SA 5KS9E 1FG2B 3U4KA 3UAFA 3D4YA 4OCNC 1ACXA 4A63A 2V8MA 3GDCA 4PS7A 2AJYL 2O6CA 4Z7OB 4CN1A 5L4FA 3ERXA 4D9RE 1ETZB 4M02A 1NCDL 3KD4A 2V5YA 3VFTB 5TDPA 3BUIA 4LASH 4RGNE 2BWDA 2CBOA 5EOTB 1VADB 1KGIA 4XPHL 4XPBL 4HV8A 1OAUH 3JWNG 2ZYRA 1MHPL 2Y7QA 6FABH 1JWSA 5INCA 1RJYA 4FFVC 5TE7L 3S3DB 2HRPL 4ZMVA 4M5YL 2XWDA 2IBZX 3R06A 1A7NL 1JWUB 1JOIA 1J1XH 1U3HB 2ZNXA 4Z7QB 2GK0B 4ZX6A 5CF3A 3FQRA 2BSED 5F96L 3P0GB 3FB8B 1KNOB 4L29B 2P7TA 2FQEA 2H32A 3FTVA 3SDDC 3ZKMD 4HISA 5C0AE 5EO1A 2G3MA 2C4FU 1E9PB 3APNA 4YXHH 3AGVA 1O7DE 1HXKA 5J9PA 1GH7A 3WY3A 2JELL 4R7VA 5CNHA 5D70L 2DQ6A 4MD4A 3MFGB 3S96A 4DIXA 3AS3A 4NJ9H 2IPKA 1CYWA 2ZWKA 4ZZFA 2ZONA 3CXDL 5TQ2H 4RFOL 2CIKA 4BGLA 4Q7DA 3FYIB 2EH8L 2YD7A 1EV2E 4IOFC 4D8OA 2C9PA 4G7VL 1CE6A 4EIZC 4NO3A 3UIZA 1GJIA 1PNDA 3BAEL 4MXWH 5EO9A 5KTEL 3US1A 5KVEH 5H4ZA 4KKQA 4RQQB 3EF7A 4ANUA 4WJKB 1I1AD 1TTBA 1NBVH 4JANA 4JFQA 1EGJA 2VC2L 4KK8C 4NRZA 5FDWB 1AVAA 1QRNB 3EH5B 1UD6A 3LQMA 2XFXA 3FUKA 3ZTJH 3EOTH 4B9FA 4W68A 5C97A 4JRXB 3ATDA 5D5MA 3TP4A 3T2OA 4Q56A 3QE5A 4AG4H 1EAOA 3DC0A 4H8WC 5IHUL 3ECQA 3C08L 4HS3A 5IIEA 2XNAA 4WI8A 1IGFL 4TSBH 1NBZA 3LPGA 5HJ3A 1HKLL 3EG9B 2YD4A 3C8DA 5KSAD 4JE4B 3UG4A 1NIEA 4G43A 5DMKA 5CBEA 5E5UB 3QO0B 4ZO8A 5DURD 1EAPB 3GNMH 2FIRT 4L3AA 4HU8A 3UMNA 4NXSA 2PTTA 3X14B 1KUMA 2LU5A 3DVGB 3ECVA 4HKJA 4WQOA 5I75B 4MDRA 2WKOA 2YPLE 5FO9B 2QADB 2X0WA 5GSVA 5C7ZA 4G5AA 4O4YL 4WFFE 4YLBA 3GIZH 3Q2VA 4G7YL 1II4E 2OPCA 5KZCD 4WHCA 5I1JL 2UZXA 3MJ7A 2IH3B 3KWVA 3OLEA 2E5EA 4LAJH 1O6VA 1U8NA 3P11H 4PRNA 1AQKH 2VITA 3P4MB 4QHKI 4V33A 2B5IB 1U8IB 4W6WB 2DJUA 4PJ8C 2EDFA 1YN7A 3NFNB 2GUOA 2XA8L 2NDGA 5C1MB 1V3LA 1QLRA 4YDZA 2VMFA 3GC3A 4XNXL 2XVGA 4HALA 3S36H 1NC2A 4M6NL 4DPRA 1JP5A 1KIRA 4I3RL 5C6PB 3M46A 3O3DB 4A66A 4MJIA 3ZDXF 3ARRA 3P73B 1G1OA 3V5HA 2EO1A 3WYRA 4X6DB 3C6LA 2C4XA 2PPCA 4GKLA 1U8JA 1OTUC 2A9CA 3D7PA 4WTWA 2WKLA 3O4OC 3UACA 5C70A 3WXVH 3U6RB 4LLDB 1AOHA 2Z8SA 3IDYC 5E2UL 2D8KA 4R3SB 1JXJA 4QTIH 4LDEB 3QFGA 4KJWC 2HVJB 5JYMA 4WK0B 2ORBL 3U82B 2QPFA 1S7WA 1U8PB 3OPZH 2Y5QA 3WN6A 3BIKB 3DX7A 4P57A 4PD4K 1P4BH 1RSFA 3J8F7 3O3EA 4YIQB 1JI2A 1ID2A 4PW3A 5A43C 1T1ZB 4PTUB 2E47A 1Q9KB 2WHVA 1CLYH 1CI5A 4PRPD 1WA2X 4XP6L 1SEQL 4ELKA 3PP4L 4URKA 3L54A 3VFGH 4Z3JA 4HEPA 3M45A 2MIZA 1I1YA 3FCUB 4IRZH 4X5XB 5BMFL 5C07B 3QNYA 1MI5D 3DHPA 4OD1H 5CD3A 4ZUWB 1AC6A 2F7IA 3T0EC 4APQA 4PUBL 4KDVA 2Q2LA 5ELIA 4XNMA 3V0GA 1VGKA 1ZLVK 3LRHA 4M6AA 1B88A 2VXUH 3P3TA 4R7LA 4UT6L 1BBDH 3E80A 3QPQC 1D6EA 5BRZB 5FYKL 2BMKB 1E6JL 3OJDA 4FQ2L 5SV4A 4KJPC 4WWKA 3DMMD 3SPJA 4NJAL 1E5CA 4G70B 4NOBA 3IPEA 4X4YB 4RAVA 1ZDQA 1MLCB 3FMGH 1D7FA 4B60A 1F6FB 5LNGA 3K4ZA 3CFCL 1QEWB 2DQMA 5FUZL 4HIEB 5AQ0A 3PPSA 4I8DA 5FV2A 1FZJA 3LQZB 2X2IA 5ILTH 3V4PB 2Y3NA 3GKWL 4AUJA 5AKRA 2AKRA 2EKSA 5GGUA 1TNNA 1MW1A 4JCWA 3D39A 3ZQWA 4ANVA 4Y7OC 4KXCA 4HWZB 5T3XE 2GEEA 5IUCA 3L7EB 3VJ6A 3UEQA 1G9NL 3BWAA 5HVHC 4A6YA 4ACTA 2QMKA 1QLEB 3M88A 3RJQB 3HPLA 1JI1A 1G7JB 1VIWA 4UZSA 4N5ED 5AVRB 5AAMC 1QSFE 3GSRA 4PRDB 3L6FA 1X5FA 4JDTH 1ZVYA 4BELD 4XNUL 4ZPVB 1VLXA 2YQ3A 2UVEA 3SPIA 1AGBA 2Y1VA 3BSZL 4FMVA 1ZXKA 4FXGB 4Z0BL 3VH8B 3WNIA 1M6UA 3RL2B 5C08E 4Z7WF 1WK0A 1NL0H 3QHZH 2YXMA 3NDYE 5CGYD 1I3GL 2YSSB 3L13A 4GOSA 1WFIA 1L3NA 5KSBE 2VDPB 1QI3A 3TJPA 4KAQH 1UOKA 2XPYA 4OZGE 2DW5A 4AIXA 1ZLSH 3QNZB 3JWOC 3KGRA 3LKOB 5I1AB 2BSRA 4AJVA 1K8IB 1KOAA 4W9FC 1K5WA 1IKFH 2WZAA 4D8PA 4HWEH 5BOPA 4W9HC 1TKWB 4WKZB 4P23D 3IN2A 5F0MB 2DYPD 3QORD 4JRYB 4P5MA 1FQ9C 1A9EB 2P5EB 4HCIA 4NUPA 3VYPA 3W0WB 1Y6NR 4PJ5A 5IB5B 3TA4D 2SODB 4FNUA 1GYVA 2B1AL 2APVA 4I3SL 5K39B 5CP7A 2H1PL 1ICTA 1R6VA 4XHJC 5CSZB 5F7BA 3STLB 5EDSA 2NZ9D 2DM4A 5IJKC 5AB0A 1F3JB 4TPRL 3QIUB 2DQGH 2ATKA 4KI5F 2O30A 1H3VA 1QHPA 3IE9A 4QO1B 2NTSP 3O0RH 5ECJE 3US9A 2BP0A 3VD2A 3IK2A 3MRNB 4LP4A 4HH8A 4JPWH 5E8PA 3O8XD 2VDMH 1THAA 3TZVB 4PEEA 4B97A 1EO8L 3GMNA 1NM4A 3VNZA 1WO2A 4GKSA 4MBOA 1LHZA 1UB5B 3NJMA 1QNZH 4Y2LA 3HI1A 3BQUC 4XB8A 1ZS8A 5M95B 3WS6A 3U0PA 4YR6B 1AO7A 4Q9CA 4LLQA 5EIIG 4PLOB 2D4DA 2V9RA 3QEHA 1R3LB 2YKLL 3MRCB 3GEFA 3MLWL 1M7IA 1PF3A 4JG0H 2CHZA 3RZCB 1QAWA 4XVSL 5E9DD 1MW2A 3GHEL 1BJ1J 4Z7NB 2QKIB 4FQHB 4HIQA 4HIXL 1MSPA 4N85A 3HNSL 4PV8B 5J11B 4L8SB 3UTSD 2MHAB 1BVLB 3PP3K 5D1XA 1QD0A 2HMIC 2BIMA 5HDBB 2EDEA 5HY9B 2N7BA 3CVHL 4OFIA 1NGXB 1ZT1A 2ROYA 2Z1KA 1MW0A 1I31A 3BQVA 4HZAA 4HWBL 4IGBA 5CS7A 3JQOB 4NQED 5MEOA 2QJDA 1JDDA 5E9DE 5ABAA 4BFGA 2CGRH 1H19A 4WEEA 4HOMA 1CGWA 4LPUA 1NGWA 4XMLH 4LGPB 4LEOA 3UTSE 5MEPA 3L4UA 2V9QA 3W9DB 3ARYA 4CC1A 4JDVA 3L9EA 1SGKA 3P9LA 2HT3D 5C0JB 1SLVA 4AGNA 2FH6A 3BSGA 1A3RH 2F6AA 3IJHA 4YK4B 3WO3B 5FYJD 1NUDA 3GHBL 4L4TB 4D0BA 4JZOB 1U2HA 2D31B 3FFCB 1XGRB 4NQEE 1CU4H 1KCSL 4JHAL 4ZXBA 3CIQA 5D2NB 4I2XE 4P2RB 1TJGH 1D7DA 4R8WL 4L3EA 2VDRL 3QJVB 1T04A 3CSPA 3QZWA 4ZUTB 3TWYA 1OGTB 3B2VH 4FXTA 4URTB 3VXSE 3O6LH 4ZMNA 2LE9A 4P2OA 2ZYSA 1XF5B 3JXAA 5B3SB 1C1EH 4D9QE 2I5YL 1KC5H 1ED3A 4ONFL 3UJIH 4XMPL 5CJOL 5LGHH 4CMHB 1QZNA 2ESVB 1KN2H 3VWJC 1SJEA 4FNTA 2AJUH 1F56A 1L7TL 3MRBA 2NZ1A 2OFQA 1QASA 4IU3A 3X3GH 5IMLB 1LWRA 4OCLC 5CN2A 3WN5C 5BUAA 3O2WH 1DQVA 3WFHA 3OHXC 4YSTA 5EZOL 1IGCL 5IVXB 2C3GA 3NQIA 2XC8A 2YRLA 2GC4C 1MF2L 1OV8A 1U2YA 4MX7B 3RTQC 1MIEH 4PB0H 3VTMA 5CJXA 5FS5A 3C60C 1MWAL 4UOQA 4NDMB 1AIFB 4JQXC 4K71B 2VR7A 2Z31D 1NEZB 4TL5A 2WNWA 2CUHA 2QSQA 4ZTPH 1I9JH 3L9RA 4ICXA 2Q7AA 2YMXH 3BT0A 2OP4L 1HILB 2WAQA 1DBAL 2VDNH 2IDFA 3TH4T 3ZR6A 3LV3A 3ILQC 3N91A 5DC0A 1AZBA 2EDYA 1QFWM 3B7TA 4WO0A 2XTSA 1MHHA 4OGXL 2WVVA 4ONHB 3WD5L 1YDPA 25C8H 4KTYA 5EORH 1OQXA 1Z6JT 8FABA 3BEWA 3CLEH 4NKMB 4K8RC 2A9AA 4N8VG 3SKMB 4GXFA 5FM5M 5H2BB 4LK4A 3ARED 1LO4L 3U1SL 3MUZ1 3CH8A 3F01A 3VRIA 1MFEH 1EWHA 1FIGH 2YN3A 4OLWL 3GSNB 4UIMA 5DJZB 3GJEB 3C5JB 3DLQR 3PXHA 3ARXA 2WBJA 4ODSL 3C09C 3L3IA 1BVKB 3OZKA 2A1WH 5EUOF 2WLKA 3JV5A 3H9SB 4WTQA 2HWZH 3BKML 1I8KB 1XVSA 3HHSA 2IMMA 5L88H 1FSKB 4N0CD 1JZDC 2CO6A 3QUZC 2ZAGA 4HG4K 1F4AA 2JJVA 1U8OA 2C9VA 1PCXA 1R3JA 2DWDA 5IT2L 1U93B 4N3UA 1FO0L 3AZUA 3BZ5A 4LLWB 4F1SA 1FH2A 4I0PD 4X7SL 4MMXC 3QBTB 2NTFA 2ZOLB 1UFGA 4JFDB 5D6DC 3WIAA 2XIIA 4NBXB 4BDVA 1J5HA 4KQ3H 4QHLB 5DS8B 4MWFB 4K3JL 4ILDA 1DBMH 1U0QA 2BY2A 2ZWNA 5IROD 1XF2B 3QDJD 3IETA 4KHTL 5AW5B 1TEGA 3SPGA 2V7HB 2D9CA 4JFFD 4L18A 1G0YR 4G9FB 3TBCA 2Z64C 3I9AA 3ZX1A 4DK6A 1RU9L 2OSLB 3IS1X 2IH1A 1TO5A 4PLKD 1UXSB 1XO8A 1JTPA 1Q72L 1P1ZB 3Q9PA 5MP6H 1XD1A 1MCDA 2DQFA 1A1MA 3NJKA 2EXWC 1DE4A 1AHWB 4L4VD 1NLBL 3KS0H 3FQNB 5IR1A 5C9JB 3FB7A 3KLAB 4XMKH 2KT6A 3TEWA 1EMTH 3MAWA 4J4PA 4O5LL 4XCNA 2WKGA 2DLFL 1KJ2H 3IDUA 4JFFE 1XAUA 2WVTA 1NBQA 4KMTH 4P3WA 3X17A 3AAZA 5EG6C 4B0MB 3ROLA 3RKDD 4UQAA 1H8NA 3IJ7A 1NLDL 4Y5YB 2D7TH 2BLFA 2XZAL 4NNXA 5EU5A 5KG9B 4G71B 2N7AA 3RY6A 1UM4L 4N0UB 4HW6A 6CGTA 5T1LD 4QY8B 3DUSB 1X3DA 3F62A 4M03A 1AXIB 3HG1D 1D5IH 3HVNA 3REVA 5AG9A 3VXTA 4V1DD 1NCOA 5E8OB 3QI9A 1CTOA 1OCWL 4HHAB 2KBGA 1TETL 5IW6B 4YGAB 1HAUA 1CFQB 2J6EL 1JHKH 1KYFA 4XI5C 3DSNB 3WEOA 4UZGA 1HZHH 2QGBA 3KNBA 4PGEA 1GKEA 1EANA 4PWIA 2KYIA 3VWKD 2BNQB 3JV0A 4YDKH 1BFOA 4UNVA 5D7SL 3PG2A 4V1DE 1A6WH 1IBHA 4G83A 1O6TA 3D06A 2FWOB 3PWJA 3HUJF 5K9QI 1QHQA 3EUDA 3T4YB 4TNEA 3KPRE 3LQAL 4K5NA 5LN4A 3TCLA 3FB6A 5HHOB 3PS6A 3VGBA 2VXTL 4N90D 4NGHH 4QRPB 4U6VL 2BY1A 4Q74A 4ENED 4X5LA 1EUTA 2WWKO 4LSDA 3NCXA 3KXFD 1WWWX 2F1AA 5FYJH 5GGTA 5JHBA 3A22A 3BZEA 4PJXB 1YY8A 3BP7B 1T22B 1E8WA 2ZUTA 4P5TD 1SFDA 3EYUL 5HHQB 5JW3H 1VDGA 4NO2A 4Q9RH 1YC7A 1CYXA 1CZ8H 2E6PA 2GBUA 3EDFA 4DOHE 5T1MA 2MOGA 2OTWB 3RGVC 2LAGB 1X4XA 4BA0A 3Q43A 1J86A 2ENYA 1HH9B 2WCPA 5C0DB 4B9GA 2EEBA 1CBVL 3NPSB 3KXFE 4JFEA 3BKJH 3PWUA 1PYWA 3FB5A 1JGUH 1SYVB 4QHMB 2G3ZA 2CAKA 3VGDA 1A2YB 5IEHA 3HA0A 1OP9A 2N56A 2NY4C 4I4WB 5AFAA 3ZKNC 2VDQH 4FFVD 3IVKA 3VFUA 2K78A 5EUOB 3S3JA 1OAYH 4WTZG 5FDYA 1YMME 4CADB 3QYCA 2ADIB 1RH8A 3PWNA 4OCXL 4J6RH 3RL1A 3OGCA 4PM1A 5I1CH 4QRUA 4NN7B 2FBJL 2W38A 4LARH 2NUPB 3PCYA 3TBSA 2QPDB 1DQMH 3DX8A 3DX6B 1XR9A 1UH3A 1KCVH 4YBQC 4G8FB 4NSKA 4RZCA 2YUXA 1J7VR 4NP4H 5L2KB 4C83B 3OKDA 3B7RL 3HMWH 5DO2C 2J55A 1YYMH 3HRZC 3ES6A 1DL7L 2G9KA 1JD7A 3MGOB 1COBA 5I6KA 3FQTB 2HX7A 3T65B 4BCZA 4GO8A 2HFGL 1FVEB 3W81A 4X8XA 4EOWL 4JY5H 3U0TB 4UILL 1LTXA 4GIAA 4G42A 1P9MC 2F1BA 4IOFD 3H7BA 5LUMA 3BFWA 5I82A 4S1RH 4TQ8A 1SJHB 3MO1B 4QXTB 3KYAA 4KNTA 1F11B 1SXAA 4IK7A 2FLRT 2F61A 3SCMD 3P77A 3BDYL 3IFOB 3PWPB 2Z93A 3AW5A 5ADOH 3M8OL 1P7QB 4KITB 1EFXA 2OMUA 5JIDA 4KK8D 1IAMA 2VJ8A 3RPKA 3W1ZA 4P06A 4DESA 1DLHA 2Y6TE 3CDZA 3LZFL 3OQRA 4N2HA 1DVQA 1BZ9B 5E1HB 1S3KH 3RURA 1H3PH 4CBZA 5F6HI 3FCBA 4KPHH 1Z66A 4A7TA 3I02B 4WI0B 2WYZA 3AT0A 1OAZL 1TVHA 5DHEA 1NGQL 5EU6E 3X2QB 1J9TA 1N9PA 3MJ9L 4OGAC 4YFLF 5GHWL 1EEYA 4PU2A 5IESL 4U4BA 2LVCA 1KZYA 2WANA 4G8EB 1NMBL 1HYSC 1OD7A 1KGJA 3BVUA 2L8AA 3QUMH 4R26H 4MHHI 1LNUB 3T0EA 1ZY9A 3GO1L 2IGTA 4FNRA 5F88A 2OM5A 4JHWH 3PPEA 1RY7B 3HC0B 1AI1L 4Z9KB 1XF4A 3Q1EA 2UZIL 1T1YB 1YCSA 4QXWA 5IVZB 5DRWA 3MBWB 4QHNB 1EDQA 5E4EC 1CIDA 4XVJH 2EVIA 2YGNA 3GJFB 4G80B 1FN4B 3EYOB 3WLWD 4LBEB 5E5MA 3TIEB 4AYBA 4NQCB 2Y5TA 3LN9A 1OTUD 3SY0B 4JFWA 4AEIL 1HJBC 2AEWA 1G9NC 1M1SA 1B2WL 4G7RB 3KEHA 4JFZH 3V0WH 1MNUH 4KJWD 4QRSA 1RK1A 2J8HA 4GQPH 1NBYB 3ZYZA 2R69L 3L1OH 1KGYE 1N70A 1IAKB 1UWEL 3CPLA 4XXCA 3GI9H 3SE9H 1JFHA 2F1EA 3MRLB 1RUKH 2WUCL 2X4OA 3O4LE 4X6BB 4KX7A 4L1TA 4KZ0A 1LDPH 1VFBB 5IV2B 3I6LD 3L95B 4QYOA 4BZ2L 3SODB 1U91B 2E9BA 3DKHA 3QUXA 1KXVA 3EOYG 3GMLA 3MV9E 5E2WH 5EC1A 1LO0H 4M1CC 1KDJA 1K3IA 1SM3H 3N43F 1ANUA 4J3VA 4EZMA 2LV4A 3C5SA 4B5ZA 4NWTH 3KBHE 2NW2A 4MXVE 4OQ1A 3TX4A 5JLZA 1HH6B 4LSRH 3M1OA 1G9ML 1WFOA 4OV6F 4JQVC 5DR5L 3VXRD 3CZGA 4JM2B 2OS7A 5L6YH 4JCMA 3PGCB 1UVQB 2QR0B 4ABVA 3I6LE 4DTGH 1OIOA 4JN1L 5AAWA 5AVQB 2R4RH 5I2IA 1FL5B 3O41A 4PRHB 5HHXH 3PU7A 3OWRA 2HUEA 4RA0C 5DVNA 2BK8A 4HC1L 4NERA 1QBLL 2IGLA 4PJBB 1J5IA 1M6OB 4U1LB 3FRUA 1O6SB 1J8SA 4S1SL 3WNOA 4DO4A 3APFA 2FO8A 3VXRE 4PN6A 4GBXA 5D2LB 2A77L 1CG9B 5JQ6L 5KYUA 5JHLH 4U1JA 3TM6A 2FEJA 2UUDH 1KFAH 4FFYL 5GRZA 4EKJA 1I3RA 2X3CA 5DHMC 2J8OA 5SWQB 2WB1A 1N64L 4GRLB 1WFUA 1EH9A 2DQUH 2VNCA 5E6ZA 3FUDA 5AYUH 5TF1H 3WJMA 3MBEA 5D1QB 4R4BB 4UUJB 3K8KA 1G9HA 3G5ZB 2HFFB 4K7PX 2V5MA 4M1DH 3V9CA 3CFBA 4PJFA 4PG9B 1KJMA 2Y69B 3Q6GL 4KDTC 5DZPA 2UXTA 3V6FB 4KVNH 3U9PL 4IEFB 1G7HB 4BHUA 4FQPA 4NQSB 4IRSC 3BZ4B 2JLLA 4GAAA 1P4IH 4JGMA 4LRNH 1KELL 1FZOB 3TNNB 1IBGH 1INEL 5DSCA 3SZ6A 4ABUA 2W1NA 3MOAL 5LG1A 3L5WB 1RJZA 4OLXH 3VDBA 3MNWA 1GTNA 1WWAX 1DJWA 2OMZA 2BWIA 3X1FA 3CLWA 2V6HA 1KTDA 4PJEF 4BFRA 3UCQA 4ANKA 2GY7B 3U1QA 4HUVB 3HB3C 3F6LA 4L8DA 3I85A 3MXWH 1WC7B 4KXDA 2HT4C 1Z3RA 1EA9C 2IWKA 3QRFM 4DKFH 4HF5L 2YEQA 4KX9A 3GBDA 1S7QA 5F72S 2Z4TA 4MDIA 5TH2A 1MHEA 3IMSA 2ISDA 1TFPA 3CDCA 2B59A 2Q8AL 1PZUB 5DTFA 3DVIA 2JSFA 4M3HA 5GISL 1NAMA 4P2YA 2ZKMX 3BHBB 3P2BA 4XBPB 1ZKAA 5I6XB 2DI7A 3M07A 2HKFL 3FAXA 5ACLA 4HH9A 2VLJE 4EE2A 3MUGA 2CGZA 3VX1A 2QV2A 1OW0C 3ARDC 4PJ7F 1PFOA 3OSVA 1UJ3A 4XXDA 2G2PA 3SGJC 2F54A 1VKXB 1CE1H 3QR0A 1YEIH 3H2PA 1KN4H 1O9WA 4PMEA 4Y4KA 4YO0A 1NUGA 4OIFA 4Y7MA 3WSQL 3RWHA 2ZAHA 4AMKH 5I15L 4H1LG 5HYJD 2ARJQ 2BZCA 3QUHA 2AJVH 3VD1A 5BZWA 5ANME 5D7JC 3BQUD 4A7UA 1IGTA 4J3OG 1R3KA 35C8H 5KS9A 1FVDA 2FSDA 1VFMA 3ARPA 2A9NL 4U33A 2B9BA 4P5SA 4DP0X 5ALBH 3VFWB 1RZKH 2WLZA 5I8KH 3BZFA 4Y5VB 2J2ZB 5C0BA 2W92A 4ZQKB 1MCOL 4KKBD 3FS9A 1HHHB 4PJ9B 1XF3A 1IT9H 3SKNA 1N0LB 2HMID 3NP3A 4ZFZB 2XN2A 1P84J 3KGTA 3QXAB 2CCLA 3LNDA 4RDQG 2X4PB 2ZF8A 4F7MA 3KZ8A 4KI5C 3QP3A 4JY6A 3HZVB 2ARJA 3NN8B 3LN5B 1JAEA 2VQ1A 4LSUL 5D9SA 4BBWA 4WJG3 2VR5A 2JI2A 3UYPA 1XCQA 1I7TA 1OOWA 3ZY7A 1ZTXL 4AL8H 1J10A 4FTVE 5T1KD 3RDTC 1V7MH 4ONGL 2W5PA 5C0AA 3V5DA 4N87A 1NCCH 3S3PA 4F9LC 3O6ML 5IEKB 2FAUA 1SMAA 3C5ZD 5L0QB 3QDGB 2Z0UA 4FP8L 3IAPA 2PPEA 4LAQL 1VGEL 4OIIH 1TZ8A 2BS8A 3PWLA 2QQKL 5E1QA 4UQCA 5DA4A 4FLQA 2XPGA 1MEXL 3FRPA 1IEBA 2BSEA 4QRAA 4XP5L 4O02L 1TQTA 3K8MA 1I8LA 4PP1C 1A9BB 4CJ1A 2WZ0A 5ID0B 3UGEA 4XRCB 2K8QA 5EHFA 4BSJA 5AVVB 4HGKC 5KVDH 2E86A 1FCCA 2IOIA 5DLML 1BPLB 4FMFA 3VWJD 1ONQA 1GGUA 5ID1B 3ULVF 1NUFA 4H26B 3T6XA 1JRHI 4UOW1 2OCJA 1BFSA 1YEEL 3BSHA 4KHXH 1W72H 4BK4A 3GPSA 3MDJA 4X6FA 4BXVA 1JZ4A 1IBDA 4NN6C 3PAZA 3IPBA 1MFDH 2L7UA 4XBMA 5GS1B 5LBSH 1F58L 2B8OT 2IBBA 1T7VA 4Y19D 1JUFA 2CHNA 4GW4A 5INDA 1NCWH 3QJSB 4OI7A 4IIZA 4EUPH 2B2XL 5B1CA 3PL6A 1FDLH 1I7UB 1WFMA 1HTYA 4FXKC 4L9LB 4ZZKA 1DEDA 4AVIA 3TEZA 3MU3A 1I1AA 4ANWA 2K6WA 2Q76A 1NAKH 3LRLA 5EZPA 5MI0B 2X1XR 4KMQA 4H0LC 2HKHH 1MFAH 3VCLB 4PHXA 2VXQH 4L8CA 3MX0A 4IDLA 1EXHA 3A3YB 3MSPA 3QXUA 3AABA 5DD5H 1O9ZA 1PG7H 3ILQD 3GM8A 2J72A 4RWHA 3ZO9A 1THCA 4E41B 3OXRA 2HN7B 5KSAA 5DFVC 3R8BB 4LNRB 2VXVH 2EILB 1AGFA 2I07B 5KANI 4NKOA 1GIGL 4B41A 2EXTA 2O5NA 4ZD3H 3WIHL 4PJDB 4JFTA 4PW4A 4PRIB 3VFSB 3KBFA 4KJYB 2WTOA 1HQ4B 5EO0A 3MV8D 4NKDA 1ETB1 4R5VA 3QRGH 3TIDA 1A3LH 2VABA 1FGVH 4M7LH 1UZGA 3BP6A 1LD9A 3BH9B 5D7KE 4GG6F 4LU5L 3VFPB 1CGVA 3LAFA 3AITA 3RVVD 2QBWA 1KCUL 4IMLA 5DUBA 2YAHA 4LDCA 5BQ7B 3TESA 1RK7A 1XZWA 3MNVA 5EUKA 1ESOA 2DKMA 2R2HB 3I6KB 5FC9A 1PMYA 1PEZA 2FJSA 4RGOH 2QLVB 2CHDA 4KY1L 4ZYKB 1Z0NA 1QO3B 3ABGA 3GBEA 4KJQD 4AM0B 4F7CB 1XGYH 3DPBB 4O58L 2MOVA 3H42H 3OAZK 1Y6MR 3AXHA 1KPVA 3QUKB 3QUZD 1ZXQA 2NX5D 4WFGD 4XH2B 4YS4A 2ZOTA 4AVJA 4UM8B 5E8DL 1QWUA 2CBQA 1OGAB 5K9JH 5CKGA 4GNKB 2R4SH 4TSCH 4EO5A 1OLZA 5DD1L 3JWOH 4LOFA 1UOVA 1ZGLB 1FZMB 3UBXA 1DQJB 3KM2A 2MQ3A 3HC2A 3WS3B 4FFZH 3UDWC 5IMMA 2HB0A 4X83A 4ZUUB 4NZDA 4PRPA 2FHFA 3LQAC 1JGVL 4XMWA 5FEBA 5AZ2L 4FABH 3SY6A 3MJ8B 4ZUSB 1EZVY 1PJ9A 1Q9LB 3L3OC 4N2AA 5I9QB 3NJJA 4L1BA 1MI5A 3JT0A 3UCRA 8CGTA 5JOPE 5ICYB 2J4WH 1JVLA 4NQUA 3T0VA 4N0FA 1OPGH 3JZ7A 4AYID 2ICWB 1XIWB 4JFXB 3O11A 1A1OB 5CMAB 3K6SB 3QJXA 1N6QL 3WDHA 4MJ5A 1U3HD 4F27A 1KIPA 3D34A 3BRGC 4XNYL 5GGQH 3X12B 3VI4F 5BW7A 1OHZA 1BYOA 4HKXA 3J07A 2XXMB 3DMMA 3PJLA 3IJYA 2ZT9C 1T1WB 2Q1EA 1KENL 1I53A 1BQHA 4OFKA 5FOJA 1I8MA 3ULUF 4R5XA 1ML0A 3WFCL 5TDPB 1CPUA 4V2CB 1HXMA 2YAPA 3H6JA 2VDKH 4TQHA 1HSAA 4ELMF 4I89A 1RPKA 2Y7QB 3E6FA 2KDYA 1U92A 3FU7A 4E42B 5T5FL 4F37K 3PV7A 5C08A 2NYYC 1UT1A 2I24N 2ZXEB 3H56A 3R06B 3QH3A 4ZAKB 2AK4B 2ZAIA 1YY9C 2FNBA 3LZQA 3ZDYB 5HPOA 2QELA 5KSBA 3S5YA 2DQEH 2H32B 1HIMH 2JCCE 5CBAB 4JZJA 2F58L 2ZCKL 2IOOA 4E0RA 4XN7A 1HNFA 1P7HL 4F7TA 3OM3B 5J9PB 2IAAC 2BO0A 1QRND 4DERA 3BJ91 3ARFC 4FLRA 3AG3B 2JB5L 3G6JF 4KROB 4JRXD 4AK1A 4GMTL 4FZ8L 1KLGA 3OX8A 1FFRA 1MRCH 1SUJA 4YNYA 1OTSD 1HHIA 3MUHL 2AITA 1IC4L 3WI9A 1FFQA 3QPXL 4G6KH 1PKQB 2G4GA 2Q3ZA 6TAAA 1G7MA 3VU1A 4GUPB 2JKRM 3E0GA 3DIFA 4NO3B 5EIQA 4UTAL 5AD0B 3WLBA 1DSYA 1JBJA 4PBDA 1MJUL 3QJRB 4QAMB 3ZQ9A 1NIAA 5AOMA 4P23A 5EO9B 3CUPA 4HCRH 5BUGA 4JM0A 1EFQA 2AQNA 3LH8A 3QORA 3AQXA 4OF6A 4JANB 5JO5B 4EVNA 1LE5A 3LIZL 4ISVA 4GG6B 1BWWA 3MRGA 3B2DC 3ISRA 5DEJA 3LD8B 1BV8A 4JUTA 5I28A 3QQ3A 4MB5A 3BN9D 4HS3B 1VEMA 1A7QH 2XNAB 2ZOKA 3F8UB 3N0AA 4U6HA 1UKQA 2W95A 4XAWH 2GJJA 4JDEB 4WK2B 4YDLC 4F2MA 4G43B 2EO9A 3UTTE 4XZ4A 3E3QC 3CDGA 3O8XA 4XNQA 1P4LA 3X1BA 3O2VL 5IB3A 1BQLH 3J2PA 4OTXL 5FFGA 2R8SL 1UB6A 3EOAB 15C8H 4JPIA 4Z76A 5B38G 4K4KA 4HKJB 2BC4B 4MCZA 4RWYL 1B0RA 2CE6A 3U2SA 3GQFA 2X4TA 4LPTA 5FB8A 4N1CA 2UZXB 3MJ7B 3WEXB 1M53A 2CQVA 1IIKA 2IC2A 1QBAA 3VXOA 1YN7B 4M6ML 3GBNL 1HS6A 5GZNC 1I7ZB 1MH5B 5E9DA 1MQKL 2ATAA 2X6CA 2YFNA 2W0PA 3VI3A 4PJAE 5IJCC 4GAGL 3UTSA 1CDIA 5IHHA 3QJOA 4OU3A 4WLCA 1IB5A 2J5LB 3V4LA 2EE0A 5CILH 4DHLA 2PW2A 2VW7A 3MGTA 5F7DA 2IG2L 1U8JB 3FTSA 5C07D 5IMKA 1G6RH 1P6WA 1XSKA 3RG1C 1I9IH 4OGZA 2BSBA 1HAWA 2BRRL 4YZWA 3N41F 1F5WA 4NQEA 5DD0H 5HHVH 3UBGA 3ZKXB 1JYXA 1HJCA 3OBAA 3L4ZA 3PRZA 4OLVH 3FUJA 1S7WB 4GRWF 4OZHE 3D4ZA 5BRZD 2YO3A 4PB9H 3O3EB 3M6DA 3VXNA 3QAZC 2APFA 3CHQA 1AXSA 2KUTA 2EAEA 3BVNB 1SN5A 4UT9H 1BF8A 2GITA 2W65A 4U6XA 4Q4IA 3N6YA 1JV5B 1X5IA 3ZBMA