4A68A

Mutations in the neighbourhood of cota-laccase trinuclear site: d116n mutant
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSNGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords SPORE COAT PROTEIN A
publication title The Role of Asp116 in the Reductive Cleavage of Dioxygen to Water in Cota Laccase: Assistance During the Proton Transfer Mechanism
pubmed doi rcsb
source organism Bacillus subtilis
total genus 147
structure length 502
sequence length 509
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A02
3QJSB 2PLTA 1M56B 2P80A 2XUWA 3SBQA 4E9YA 4DPBX 4FA7B 2VN3A 3FU9A 1OE3A 2WO2B 1A4AA 2CALA 1KV7A 2YAEA 2GHZA 1CURA 3SBPA 2J5WA 4JKNA 1J9SA 1SF5A 1CYWA 1NIAA 3FQ1A 3QJVB 4A66A 1GYCA 1JXFA 3DTUB 3NSYA 3D12B 1QLEB 2N0MA 1SHXA 1JVLA 5PCYA 3C75A 3CVCA 4YSDA 1AIZA 1FWXA 4KNTA 1AS8A 3CVDA 2VW4A 1KYAA 1ASOA 1FFTB 1XMEB 1AG6A 1SDDB 3S8GB 4GYBA 3OMNB 2GC4C 3EH3B 2AFNA 2VSMB 4ENZA 4WKXA 2GSMB 3AW5A 5EHFA 1NWPA 2GC7C 2HXAA 1AACA 2BP8A 3X1GA 3NJLA 3EF4A 4BWWA 1N70A 3QJTB 1JZEA 1L9OA 3FPYA 5D4JA 1ETJA 5I5JA 3NJMA 3NSFA 4A2FA 1EZLA 4HALA 4YSCA 1BXAA 2ZXWB 3AG1B 1AOZA 1GS7A 1J9RA 1JERA 3IN2A 5B1JC 1AQ8A 3H4HA 3PAUA 2DYRB 2EIMB 3OD3A 2FNWA 3PPSA 1MG3C 1KDIA 3ABMB 1E67A 1L9PA 2IWEA 2IWKA 3CVBA 4UAHA 4X4KA 4KO9A 3WI9A 2HRGA 2R7EB 1A4CA 1A3ZA 1ADWA 1DZ0A 2JKWA 3X1NA 5I28A 1V55B 2B3IA 8PAZA 1EHKB 2YQBA 2XV3A 4BK5C 2ZOOA 1AR1B 2Q5BA 1RZPA 3NSDA 4M4RB 3TASA 2Y69B 4W9ZA 4YSRA 6PAZA 2UXVA 2DYSB 3OMAB 2XX1A 3PAVA 1KBWA 2J57A 3JT2A 3NJIA 1HFUA 1OOWA 1OCCB 5I6OA 1OE2A 1W8EA 4E9XA 2PPCA 4HIPA 4NB7A 2GB2A 1A8ZA 3NJFA 3ZIYA 3TU6A 1KDJA 3SQRA 1OCOB 3QJRB 1IBYA 4PAZA 3ZX1A 5AFAA 1RZQA 3FQ2A 1F56A 1JZHA 3NJKA 1YLBB 4L0PB 4P5RA 3ASNB 4BDVB 5I6MA 2YAMA 2UX7A 3T6XA 3MBWB 3FU8A 4G70B 4E9TA 3ERXA 4YSTA 3WIAA 5B1KA 1JXDA 1ID2A 1IC0A 1NICA 2XU9A 1MG2C 1AAJA 1ASQA 1TU2A 3CDZB 5B3SB 3UAEA 2H5UA 4GP8B 4K9JA 5LDUA 2BP0B 3FSWA 2XYBA 1NIEA 2FT8A 7PAZA 5B7MA 1E5ZA 4KO7A 4GXFA 5AZUA 2TSBA 3T6VA 2UX6A 2PPEA 2XXFA 4G72B 4HCFA 2WSDA 2CJ3A 4YSQA 2RACA 3FU7A 1IBZA 3GDCA 3T71A 5B1JA 1AZRA 1BQRA 4E9RA 1V10A 4N8UA 1AANA 5I5IA 4E9VA 3X1FA 1NPNA 3EH4B 1L9SA 2EIJB 3NJNA 5A7EA 2GIMA 2I7SA 1WAEA 2H47C 4E9QA 3UGEA 2I85A 1SFDA 4W1TA 1JZGA 2GBAA 5B7FA 4E9WA 1RKRA 3UABA 2ZONA 3NSCA 4DP2X 2IDFA 4G7SB 3NJJA 3FYEB 3WKQA 1M57B 3S3BB 3L45A 3UACA 1WA1X 2AZAA 4DP6X 2P80D 1B3IA 2JFCA 2MRYA 4AKOA 2IDTA 3KW7A 1KGYE 2FT6A 1PCSA 5I6KA 2AANA 3IEAA 2DY2A 2FQDA 2FT7A 1PLBA 1ZIAA 2BHFA 1E5YA 2DWSA 3H56A 3QQXA 6PCYA 3FPXA 1FA4A 1KBVA 3OQRA 4CSPA 2QPEB 4A2EA 3FQYA 3IE9A 5PAZA 2HRHA 2YAHA 3UADA 2FTAA 7PCYA 1IKOP 2AVFA 5TK4A 3BVDB 4YVUA 2X88A 1PMYA 1RCYA 4NAJA 4DP8X 3PCYA 5TK2A 3ABLB 1ZPUA 3WG7B 1CUOA 1TEGA 1OCZB 1PLAA 2VM4A 2BWDA 5D4HA 3TA4D 3KW8A 2IDSA 2BZCA 2YARA 3V9EA 4NERA 3N55A 1ET8A 4WTQA 1XB8A 1NIBA 2PP7A 1PZAA 3ASOB 2Y1AA 4DP0X 1VLXA 2PPAA 4ZK8A 4AKQA 3IBOA 4DP4X 2BWIA 3CG8A 1W6WA 1GR7A 4HAKA 3NYKA 4YSEA 1AZNA 5I6NA 2VSKB 3S3DB 3PLYA 1AZCA 4YSPA 3ABGA 2IH9A 4BWTA 4YSAA 1R1CA 4N4YB 3CZUB 1I53A 2QT6A 1KCBA 2IWFA 3RYMA 2YXVA 2PCFA 3S8FB 1OF0A 1SDDA 1AG0A 1ET5A 3T6ZA 4AX3A 1BQ5A 1XB6A 3QJUB 3ZBMA 1A4BA 2W88A 1BQKA 2OCCB 2CBPA 4KOBA 4A2GA 2QPDB 4GP4B 2LLNA 3DIVA 2X87A 1J5DA 3GYRA 1NWOA 1AS7A 1TKWA 1URIA 2XXGA 5D4IA 1L9QA 1A65A 1CYXA 2YXWA 2J56A 3AG4B 4UANA 3TBCA 2MTAA 1MZYA 2VW7A 2TSAA 1M9WA 2XVBA 5B7EA 4GP5B 3X1BA 2R7EA 3NP3A 1CC3A 1SHWA 1T5KA 1ZDSA 2EINB 4KNUA 2BP8B 4AI7A 3DKHA 2UXTA 2J55A 1GSKA 3FSVA 1OCRB 3HB3B 3PXLA 3GXUB 3UAAA 4A2HA 5I6PA 1KCWA 1DYZA 3NP4A 4Q8BA 3FYIB 3MX0B 1QNIA 2E86A 1E30A 4E9SA 4G7QB 4KOCA 2UXGA 4CSZA 1MDAA 2YAFA 4UF7C 1BXVA 1GY1A 1NTDA 2VMJA 1TEFA 1NDTA 5AKRA 4YSOA 2GI0A 4A68A 3WNJA 3QJQB 4A67A 1X9UA 2FWLB 2CUAA 1PNDA 2ZWNA 1SFHA 4BDVA 4HHGA 4KNSA 4G71B 4TXVB 1AZBA 1JZJA 4PCYA 2FQGA 3QPKA 1ILSA 1JOIA 4DP9X 2QDWA 4F7KA 1ZDQA 3X1EA 3IN0A 4HCIA 3NJGA 4BXVA 1NIFA 2XV2A 5I26A 2YAOA 3CDZA 5I5MA 1NZRA 2DV6A 5F7AA 4EF3A 2BO0A 1J9QA 2BP0A 4RH4A 1OE1A 1SJMA 3NT0A 4F2EA 3FSZA 2XX0A 2HX8A 2YAQA 4F2FA 1N68A 1JXGA 1WA2X 2I7OA 3EHBB 3H4FA 1AZUA 2HX7A 3NJHA 1MZZA 2FJSA 1ZIBA 3AG3B 1JVOA 1W6LA 4HCGA 1WS8A 2BZ7A 3OMIB 1SF3A 2DWTA 1PAZA 2XV0A 1PZCA 1HAWA 3U25A 2PP8A 2FQEA 3TBBA 1UATA 2B08A 2EIKB 1L9TA 2AZUA 4KO5A 3AZUA 5FC9A 5E9NA 5B1BB 3WKPA 1NIDA 2VM3A 2W8CA 1E65A 1PY0A 3BQVA 4Q89A 4DP7X 1X9RA 4KO6A 3FU7B 3EH5B 3FS9A 1BAWA 3SBRA 3T6WA 1J5CA 1V54B 2VW6A 3T9WA 4YSSA 1IUZA 1OV8A 1GS8A 1BYPA 4BXSV 4G7RB 2XLLA 2HX9A 4QKTA 1PZBA 2BW5A 2NRDA 4GY4A 3WNIA 4DP1X 1SNRA 1ET7A 2QDVA 2PPDA 1J9TA 2OV0A 4YVNA 2YAPA 2OJ1A 1ASPA 2A3TA 1GW0A 1GY2A 2IDQA 2XWZA 1PNCA 1NINA 4JHVA 4M3HA 2HLEB 3S3CB 2HZHA 4QLWA 1BYOA 2IDUA 1L9RA 2IH8A 3FSAA 2H3XC 1GS6X 2BW4A 2EILB 2IAAC 1BEXA 1PF3A 1XB3A 2Q9OA 3G5WA 3JTBA 1NPJA 3ABKB 4BWUA 1ZV2A 5B1AB 5ANHA 4DPAX 4YL4A 2WO3B 4HHWA 3V9CA 4JHUA 2CAKA 3N2JA 1JZIA 3OM3B 2FQFA 4A2DA 1QHQA 2PCYA 2UXFA 3ZDWA 5IY5B 2CCWA 2PP9A 3AY2A 4AKPA 1PLCA 1JZFA 5I6LA 2PPFA 1AS6A 3HEIB 1ILUA 3AG2B 1HAUA 4P5SA 4MFHA 4DP5X 9PCYA 4FAAB 5F7BA 1WA0X 4AZUA 1WS7A 4HZ1A 2JXMA 3X2QB 4DPCX 4YSUA 3FT0A 3PAZA 1BXUA
chains in the Genus database with same CATH superfamily
1F13A 1ZANH 5TFSH 4RFOL 5E7FA 1P1VA 2XETA 1CURA 1R19A 2YXMA 3ZN6A 2I9TB 1NDMA 4LNRA 4HJJH 4F57L 2H1PH 1NCHA 4P9ML 1GC1L 2K78A 5E6IC 1HDMA 4TSCL 4XI5C 4S0SD 1MVUB 3DX7B 3REWB 3NZHH 5J13C 3GZQA 4WKZB 3D12B 1JVLA 2VR8A 3B4NA 5L9DL 3TXAA 4DEWA 2VL5A 5H94A 1H5BC 3L3HA 4O4YL 3VA2C 3VXOA 4QRSB 1A0QL 1T6BX 2JMRA 4LPTA 4JY6A 1ETA1 2VXQL 4G8EA 4UV7H 5E6IB 2PCFB 1M7UA 3MCYA 3BW9B 3OJ2C 3REVA 1IC1A 3TTYA 1JYWA 4MASA 2ATPB 2GSMB 4FP8H 5C0AD 3QDGD 1DDHA 1HYRC 4IRJD 4KROC 4JPKL 1WSST 4MA8L 1E9PB 3KPSA 4F8QA 2X2JA 3DVFA 2XN9D 4KHTL 5KW9H 4CN1A 3GKZA 4ONOA 3L1OH 4IHBA 4KMLB 1AQMA 4OCLC 4N2OA 5I23A 1TYRA 1WE5A 3VFVB 4A2FA 3K72B 1FFPB 4I48A 4G6MH 3BP7A 1AGDB 4PJ5E 1EZVY 3ZE0E 3B7RL 5CZVL 4LKCB 1J9RA 1EDYA 4O2EA 5JHAA 3LH2H 4QRUA 1MHEB 2F8VA 2EIMB 4KROB 3D7PA 2HFFA 3CN0A 4TVPL 1ZHLB 4A04A 1YN6B 2WJ7A 4JQIH 3X1NA 1V5JA 1H6UA 1A47A 8PAZA 4Z8FL 4NRZB 2YQBA 3ARGD 5H37G 3K0YA 4EAEA 2H3NA 1NGYA 3MLWL 2G3NA 2YUVA 2VDOH 4ZXBA 1KPRB 1RZ8A 1I7UB 2K1MA 3LH9A 4U1HB 5I0WA 2RIKA 4WEBL 2O5NA 3PABA 4BELD 4KK8C 3BUYB 1A9BB 4LPCA 5TGBA 2WLNA 2J6WA 3A47A 2MH4A 5EBMB 3ARZA 4QRRA 4NLAA 4WJ5B 1JTOA 4KQ4L 2GK0B 5SWSD 1HE7A 4ESKA 4KMTH 1RY7B 1ODAA 5DRWA 1W80A 3RL2B 1IAKA 4PJ6A 4PP2A 1EHAA 1OCOB 4B9YA 5F6IB 1QBMH 5CILH 1AQHA 3QUHA 3TBTA 3DSFL 3VX1A 5C8JA 2CBMA 5IQ9A 2AI0H 2HG0A 3Q2LA 2YAMA 4ZTOH 3LV3A 1T20A 1QEXA 1G9NL 1I1YA 4U1NA 3ZJAA 2DQCH 5D7EA 1OT4A 1A6WL 5B1KA 3WIFA 3KPRA 1IEBA 1H0DB 1G7LA 3HKZA 4XMKH 4Y9FA 5A2KH 2ZPKH 1R3LA 1NFDE 2P24A 2XU9A 3KYOA 2DEXX 4XP4H 4V1DB 1EJ8A 2YQGA 4PGDB 1JTTA 4HKJB 4GMTL 4EUPH 1BIIB 1VGKB 4NZRH 4KKCC 4TOYL 1BBJA 1OP3K 3POCA 5T1JA 5I19L 1V7ML 1D5IH 5DFAA 5MP6H 3WJLC 1EO8H 3L81A 4DQOL 3RWGA 2WYIA 3X13A 1IBGH 3VCLB 2DYPD 2NW3A 3VFTB 2H9GA 2VUOA 1CVRA 1DN2A 4JFEB 3GSNL 2FSEB 4OFYA 4PS4H 3WFBH 5IGXH 4FNSA 3RWJB 3MRLB 3GJFH 3IXAB 5DMIL 2P48B 1EEUA 1P69B 4W9CC 2GJ6E 2NUTA 3BPCB 3NIGB 4JPSA 3WY4A 3TIDA 5JXAH 5KVMC 3WIHH 1JGDB 2DQGL 2IGFL 4H4NA 5AW8B 4AL8L 1E4XH 3FQWA 4BEIA 2K6YA 1ZCRA 5KBPA 3ZT7A 1GAFH 1XCTB 2IDTA 1G7MB 4AQ8A 2Z8WC 3MYJA 1BQHB 3PGCB 5KYNA 3WL9A 1PZDA 1GRWA 2G3XA 4Y5YC 2VXQA 3PXHA 1HZHL 1T7VA 3LS4H 5JOFA 1N8ZA 4QHKI 3H9SD 3U2SA 1F6LL 3C6EA 4PP1C 5HDRA 5EIQA 2EE2A 4FMVA 2P7TB 3VXSB 4PJBA 4CMMB 5LJYH 5J1TC 3NACL 1BOGB 4RAHA 2Z8SA 3G7TA 4Y5YB 1ZLSH 4BZ1L 4TNVF 3O3AA 1M53A 4ILDA 2D7MA 1EZVX 2HT2C 4FS0A 4NPYB 2AK4A 4K3DH 5T1KA 5BS0A 4PRDA 2J8OA 3HB3D 4N8PA 2BFVL 2W1NA 4FQHA 4HHAB 5HYEA 3C6LD 4UB0L 3R8QA 4HH9B 2PYEB 4LO9A 3ULUC 4NUQA 4KRPD 1XCWA 2CJTA 3OAZH 2CDGA 3AMKA 4YPGA 3QXAB 3H3BC 2C3HA 1A5FL 3FTVA 3I6LE 1XGTA 1RUML 5EEYA 1E4KA 3PGFL 4QRPA 4ZSOA 1KXQA 2PYFA 3VGDA 3KVQA 1H8NA 4JFFA 4QOKD 1MHCA 2XZZA 3HE6A 2AC0A 1SLXA 1RU9H 1YEKL 1B4LA 5T1LB 3S36X 3V4VL 3TYGL 5FYLD 1IX2A 4QTHB 1W6WA 3BJ91 3WLWD 3P0VH 1IKFH 5LWYL 1VGEL 3UTTA 2VSKB 1XQ4A 3TEZA 3ZE0F 4LF3B 5LG6A 1D9KC 3ABGA 1U8KA 2IH9A 2X0VA 3I75A 5T5NF 4WEUD 3HPLA 2A6JA 3FU5A 4HKXB 2LABA 4X99B 4JGUA 2WBWB 4BFEA 3G6AA 2ZSVA 5D5ME 5EZIL 5F1OB 4MLSA 1A4BA 1EANA 4TSBL 3D2UD 1D9KB 3K4ZA 2X6AA 1RZKL 3W1ZA 2WN2A 2Z6FA 1BGXL 1KOAA 5DVPA 1JZDC 5I8CA 2NNCA 3BKJH 1G5GA 1AS7A 5DJDB 5CMAA 4TMPA 1JGIA 4UINL 4Z5RB 3QQ4A 2Y3NA 2OJZL 1RPQA 2A9NL 2FVNA 5JIQA 2VLKA 3KS0J 2WBJD 2EADA 3FFDA 3RRQA 4B53A 4DJMA 5KUMA 1M9WA 4OZGA 3SEPA 1S9VA 1VESA 3M7FB 4P0DA 4PBXA 2WYHA 4IEFA 4OLWL 4UQDA 4AGMA 1HHJA 3Q01A 4L48A 1QSEB 3KPPB 2XPYA 2KDYA 2ICCA 3GSNA 2Y7OA 1NAMH 3M1CA 2BVPB 3H7BA 4JKWA 4I2XB 4LP5A 4WGKA 5JO5A 3BWAA 1UGNA 1IAIH 1BQSA 4JM2F 3LDBB 1RSYA 2C8NA 3QCTH 4RQQA 3IJSA 3HNVL 5CIPH 3TT1L 2EDYA 2IANE 2IAMA 3ZMEA 1NFDF 3LNHA 3T65A 1BD2B 1C1EH 3OHXC 3DETD 1M42A 4MAUH 5AKRA 5DURB 4FTVA 2R9HD 3OF6D 1XF3A 1UOWA 3G5XA 1SUJA 3RAJL 4HDIA 1H15A 2A6DB 4HIEB 5DD0H 4U1SA 1X5KA 3QIBD 3P40A 2DH2A 3P9MA 3BVTA 3Q44A 2WN3A 1I3RB 3VQMA 1F42A 5DD6B 5IV2B 1DQTA 3OHXB 3DIFA 3SYQA 4JHAL 2LU3A 3DK0A 4H5SA 2QLVB 4UQ3A 4ZPTB 5C09E 4CRPA 3ENEA 2ZT9C 2F54A 4NIKB 1WK0A 1JP5A 3B2VH 5T1DH 3GI8L 2L8AA 3L9RB 1DANU 3FQTB 5D1QE 2FYYA 3DUUA 1NUFA 3DXAD 3A22A 3SE6A 4UNVA 1JJUA 4P4RB 5F9JA 5FYJL 5ACMA 4X4YB 2V17L 4LK4A 1TTUA 3CSFA 3TBVA 3FHEA 1R3JB 3LS5L 2GHWB 3INUH 4GQ9L 4WU5B 4FABH 1ZS2A 5IUCA 5I30L 4JY5L 1ED3B 4FEMA 4GXUN 4S0TD 3JXAA 3TT3L 3BISA 3UEQA 3H4FA 4JFWA 1EAQA 1BIHA 2JF1A 4IIZA 5BZZA 5LKNA 3KLHD 1AZUA 3O6FB 3AQYA 3R7QA 4H0IA 1R5IA 1ZIBA 3LX9A 2IADB 4FF9A 4PJFB 3BIAX 3FUKA 1SF3A 1CK0H 1R9FA 5A6MA 3T1FB 4AYID 1PZCA 2IC2A 2CHWA 1DJHA 3F04A 2X4SA 3GKWH 4FQJL 4OFKA 1UATA 3LNIA 5F8RC 1XGUB 3LZRA 4BUHA 3LRSA 1I8MB 1JMZA 1YO4A 1ZHKA 1MI5D 2E27L 2J2ZA 2WXNA 4R83A 4U1LB 2B1AH 3DGCR 1U8MB 1NBZB 2A9CA 2QSTA 2Q6WB 1F58L 3L6FB 2OSLB 4B9GA 1X9RA 4KO6A 3Q8BA 5I76A 4K3EL 4NO3A 4JJ5B 2Y6SC 3CDGB 2D7OA 3ARQA 3G5YA 3HCVA 2CGRH 3BDXA 3DHPA 1T2JA 2FLRT 4GXUM 5SWQA 3WO4C 4ZS7H 1CFQA 1XZ0B 2FSDA 4MCYA 1LEGA 2EIZA 2FWOA 2Y07L 1M71B 4MTMA 4U7MA 1K6QH 3ARED 2QQLH 5I17A 1HKLH 2P42B 1V8HA 3PWUA 4E68A 1GW0A 2CHNA 1JNLL 5FUCE 2NOYA 2C4XA 4M3HA 3WO4B 1ECZA 1VZIA 5ESAB 3CSYA 3HAEA 4B7IA 3IS0X 2IAAC 3UBGA 2QVFB 5L4FA 3G5WA 2EYSB 4PJAA 2VLME 4L0ZA 3RHWF 4DZ8A 1WUNT 5B1AB 1H3WM 2KPNA 4N20A 3DPBB 4RGMC 4QJ4B 3SPJA 3D0LB 3V9CA 4NQEA 3K8LA 4X8JB 1BBDH 1MW2A 3KBPA 2CAKA 2EXWD 1OSZA 3BCFA 5CD5C 1CF8L 1JF6A 1MUJA 5EZPA 5D5MF 2VE6A 3GSUA 2UXFA 3ZDWA 4DW2H 3MJ9L 3HE7C 2PP9A 1H3GA 4EDWH 2Y22A 3QIUC 2OI9C 3LRGA 4R5TA 3BKCL 3JWOL 4F7TA 1ILUA 3GSVB 1V05A 1TNMA 3WTWA 3QEQA 3ATDA 3WUWA 4FYQA 5E94A 4ODHH 4M7ZC 3SDDD 4YSUA 5E08H 1GXEA 5DJ0B 3W39A 2BSDA 3HE7B 3QUYA 2P80A 4M62H 3QIUB 4AVIA 2OI9B 2VJXA 4GAJL 2VDNB 4JRYB 8FABB 3MLXL 4BUQA 3QULA 5JIDA 3V4LA 3QDJD 2H6PA 3K6OA 3UX9B 5LQBL 2J5WA 4OV5B 2Y9RT 2X4RB 2F7IA 4FHJA 1SF5A 2P52A 2XFXB 5CHNA 3N06B 4ODWA 2J8UB 4M7ZB 2DQMA 3D5OF 1AY1L 1WFIA 4WAFA 2FL5B 4UM9A 3OLDA 5LXGH 2QMJA 4M8UA 1K4CA 1ZT4A 1KSRA 3B7YA 1AXIB 4NNPH 1T83C 4YSDA 4R4FL 5I1KL 4KNTA 3T0XA 1F4YH 5HDOA 1K8IA 4QHNB 2R1XB 1SDDB 4GYBA 2OQJA 3ZW3A 2VR9A 3DDGA 3QUKB 1PLGH 3MV7A 3N1PC 3O6LL 1JXKA 4JGMA 2BSEA 3T0VA 4NZDA 5EU7E 2Z35B 4KX8A 4AIOA 5EFIA 1L9OA 1PG7H 4N0CC 1E3FA 1FLTX 2HAZA 3BXNB 4X6CE 4ODTL 4XVJH 2MCMA 4ELME 5IEHA 5JW5B 2LV4A 1HHKB 4R7NB 4TLKA 4HALA 5C0JB 2EYRA 3TLRA 4GKSA 4M7LT 2E7BA 4CC4A 4OZIB 2ZUYA 1KXTB 2QMKA 4GFXA 2PCPA 3QT2A 3SGKA 2BNUA 2BZDA 3O3BB 4PCSA 1F00I 1I85C 2D7QA 2IWKA 3OKNB 3CVBA 4FQQA 4XP1L 3SO3C 5K59F 3Q05A 4R3SA 4BQ9A 4FULA 3KZ8A 1HSBB 3IWVA 1JPGB 1F4XH 1MWAB 4F37F 4L8CB 4DGVL 2GK2A 3JVFC 1U0QA 4D8PB 2V2TA 4B9JA 4NQSB 5G4MA 4KNQA 3FB6A 5DFWH 3MUJA 4LHJB 3SO3B 3FSOA 1HXYB 3A24A 2JLLA 3QZWG 2VDLB 5J6HB 4OD1H 5T8IA 5AVYB 3ZZQA 1KTBA 2J3SA 3S96B 1SQMA 4UQEA 1JWSA 1KB9K 3IAQA 5BRZD 2RCSL 2OMUA 4LOUC 4EXKA 1J0JA 2ZYHA 3ZRFC 5MEND 2EIBA 4MA3A 1BAGA 4NAQA 2B4CC 3LZFH 3FQUB 1ZVSB 3C8DA 3FQNB 3NCCB 3KPSE 1A7RH 2YSTA 3PHOA 3QUZB 1DEEA 3QR1A 4HUCA 3HW7A 4X6DB 5EU6B 3L2MA 1NM9A 1CI3M 3ECQA 4KXZI 1CFMA 4CMHC 4XVTL 3RPIB 5HVWA 2X9XA 5DHMC 1EEQA 1ID2A 3CZNA 5CJOL 4Z3HA 5BJTB 3B6SA 3L95B 2KZBA 3QBTB 4MCMA 4KMQA 2UVFA 4GQZA 1MG2C 5K39A 4ZW8A 4MB5A 2C3GA 1P7HL 2I27N 2P44B 2Y5QA 3IAPA 4XP5L 1OGAB 3KXFD 3NCEB 3EJUA 3G08A 1WFOA 5DVMA 4HOXA 2Y06H 4HS3B 1SLWA 2ZG1A 4QXGL 1XF2A 4Z77B 1KJ2A 3GFUA 3BH8A 4ANXA 4M7KH 5KSBB 4O00A 1O6SA 2DQDH 4G72B 4DGUA 1RP8A 1X7QA 1GGIH 4YWGH 2XWDA 3O3EB 3UDWA 4TSAL 4Q9QH 5BNXD 1RZFH 5FV1L 4QRRE 5CZXC 1LE5A 3K80A 3AWGA 3LEXB 5AAMC 4ZS6D 2QADD 4BQCA 1YDPA 3EYVB 2Q8AL 2GPZA 5IVXA 5HYJB 5EZLA 1X5XA 2YEZB 1GZPA 4B27A 1C8QA 3LKOB 5HYIA 1U3NA 2NLJA 2Q2EB 3BN3B 4G8FB 4JFHE 2H8PB 1Q4NX 5DJCA 1HX0A 1UXWA 5CWSB 1YMHB 3VG9B 3TH2T 3BUIA 1FYTA 1WHOA 3DX8A 4HPHA 1G1OA 1MHHA 2QQKH 3KPRE 4FFZL 3JTTA 4DHLA 1AOHA 3KVDD 1KF9B 1KGYE 2E74C 1H6TA 4Y1AB 3GRBA 3KLQA 4W9JC 2FX8H 4OLYH 1Z1WA 3MRHB 1T21A 2OP4H 4BQ8A 1S3KL 4KRNA 4W9HC 2R2BB 3AFLA 4CN6A 1D7FA 2C9RA 4WI6A 3SJVD 5DO2D 1YA5A 2CBQA 2D7NA 3EO9L 3FQYA 5EO9A 3A4DA 5GGTH 1IJNA 5FF6B 3H2PA 4RIRB 2W60A 3QDMB 2P8MA 2HUEA 4M29A 1XSOA 3SGJA 1JFHA 4K94H 3QW9A 3QHTC 4J3WA 1RUKL 5DSCA 1XWVA 3WELA 7PCYA 3QJFB 5F7MC 2DWXA 2X88A 3I6KA 4FNUA 4OUOA 3BFOA 4A7GF 5ADOL 1HILB 1UACH 3OKDB 1J18A 2AXWA 3VXNA 2G4GA 3GUTB 2EACA 4FYTA 4LKXB 1S7TB 4PRIB 3VWKD 3SKMB 3RFZA 3DOIA 4GKNB 3SGEH 1ZWIA 4LL9A 5HHOA 1UM5L 4FD0A 4WU7B 1Q9WB 3HS9A 1Z3GH 3TV8A 4M03A 4F9LC 4L29B 4PJDA 5IB2B 5E1AA 3OXSB 1E4HA 3H0TB 1PZAA 1LO0L 5HJDA 3QHZL 2IOIA 1OAJA 3BEVA 2R1WA 2YPKA 4JM4L 2YD7A 3JYCA 5ANMA 5KEZA 3TF7C 5JOPD 3QWQB 1IFGA 4X6CF 4ELMF 4YSEA 1UZ6E 2WV3A 4N2IA 1HL9A 2BSCA 1KZYA 2WUBL 4MDJB 4N4YB 5KSUA 3ARFB 2JI2A 1T0MA 3B2DC 4LPUA 4OLXH 4ZYKB 3VFNB 1GH7A 3ZR5A 3KGSA 3P4MA 1U8OB 3KBEA 1KNOB 3CBRA 3VDAA 1DE4A 4YX2H 1FG2A 1LVEA 2AJ3A 4JCMA 2X3CA 4PJBE 3Q5TA 4FLOA 3HG1A 5FGBC 3T6ZA 1BQ5A 4Z7IA 4G83A 3HG0A 4HSAC 4BH8A 5E8DH 2JB5H 1AVAA 1ZD6A 4FQ1L 4DCQA 1MRCH 1Z9SB 1ZLVK 3RTQD 1LP9E 3IU3A 1M7IA 2VABB 5HDBE 2HJKB 3WFEL 4PRHD 5FYKE 3B5GA 4NWTH 2AK4E 1F90H 1G5AA 4XB8A 1P6FA 5ICXB 3D39A 3MR9B 4LDLB 4WSGA 1BFVL 4TVPE 1J0IA 3UJJL 5EWIL 2ZXCA 2XWCA 3VGAC 4IBUA 1CDJA 4K7FA 2C1PB 2BNQB 2CKBB 3CUPA 3MGTB 4LLUA 2YZ1A 1KXQE 3CFMA 2ARWA 5C0CE 4JFFE 2XQBL 3RGHA 4PD4K 4AI7A 3D0AA 3ESNA 4HIJB 1LK3H 4TUOA 1HCFX 4PV9A 3QEGH 4XOAA 4WWKD 1ND0A 3HR5A 4OCSL 3LIZH 5FGSA 2E7MA 5CGMA 4FXTA 1MRFL 1YN7B 2NY6B 2P5PA 4G6FB 5AKVA 3QZWB 2BOCA 2QGBA 1U42A 2AP2A 4YMPA 4UDTA 4PMEA 2QKIB 5GGVH 4OLUH 1NOFA 4DKAA 2VQ1A 3QXWA 4FGMA 4M93C 3EYFA 2D9QB 3VRJA 4MQTB 3C5SB 3EZJB 1C16A 1BVKB 1U95A 5F7KC 4U6XB 4I0KA 1BZOA 1VHPA 3CLFH 4FFZA 3MBWA 2H0PA 1DFBH 2WWKO 2LOEA 4EVNA 1INDL 1KYOJ 1Y07A 3FQRA 3B2MA 5JPMC 1GZQB 1A02N 4L3FA 4APXB 5D7HA 4JGJA 3MRCA 4M93B 4RFEA 2EDLA 2WLIB 1NAKL 3EO1A 5E6YA 3P73A 5CEZE 2L4OA 3BT2H 1KIRA 4OZGE 1KCLA 2WLKA 2AQRA 3O3DA 1NZRA 4LSVH 3KEHA 4NZFA 3U0PB 2WVUA 2I9LA 4DGYL 1MRDH 1NLDL 5CF3A 4LVNC 4DKDC 1HJBC 5F96H 5JPMB 3VDCA 4J23A 3RL1A 1I8LA 2JKXA 2ZE0A 4MBOA 2AF2A 4GIOA 1NFKA 4NRXB 3D69B 1DDTA 1I3VA 3QDAA 4PB0H 2QQQA 3GMPB 2DQJH 2Y3AA 4M7JH 3V52H 2HX8A 4XN5A 2PWDA 4HWUA 3HI1A 1WA2X 4L5FE 3TVMA 1U2HA 3TFKC 4ALAC 2I69A 5JXAL 1KFAH 3FCTB 3BUBA 3IDYC 2IQ9L 5C07B 1OF2A 3AG3B 1KIPA 5BXFB 1MXGA 3L3KB 3VI3B 4FTVE 5IB4B 1L6XA 1IBDA 2O6FA 3BI9X 2COVD 2Q8BL 3DX9A 3KWXA 3GXDA 4KO5A 4YNYB 3LZNA 2P3YA 2XTSA 1C7TA 3V5DA 2BS71 3QUML 4N0YL 5I1AB 2XKNA 4BFIB 3L4XA 3IDYB 4L1SA 2DPKA 3PWPB 3TBWA 4DUXA 2ORBL 3RX8A 2X41A 4QKXB 4XO9A 3MVSA 4ZO7A 5GRXG 1HH9B 3E8VA 3KG5A 4GQQA 1II4E 2F54E 3L48A 3QYNA 1Y7VA 3N1QC 1Q0EA 4XVUD 3WEOA 5I0VA 1NGQL 2Q87A 3JV4A 4M1GH 25C8H 1GA2A 1SHSA 5KSAB 1ZA6B 3WFCL 2E7LC 4GY4A 4Z1PA 4OW6A 3UTZB 3GQFA 1SNRA 5DFVD 3MACL 1GPOL 4XMPL 4WW2A 4P2YA 5FOJA 4K4KA 1UD2A 2YPVL 3QZBA 5IMMB 3K74B 1SEBA 2EH8H 4KZEH 2XCMC 3QG6B 2V5TA 3V0FA 3GBML 1I7ZA 1GS6X 4HWBH 5DJ6B 1UZ6F 4N1HB 1LJMA 1UFGA 4DETA 5AOZA 1SPDA 3STLB 2MHAB 3Q3GB 4OZ4A 3ULVL 4IRZL 4OD2B 4MJ5B 4F2MA 4B95C 5KVEH 1KEGL 3E1F1 4R0LA 1J0HA 2CJUL 4JHUA 4G7YL 2OMTB 2ZXEB 1RMFL 2A9MH 3DMMA 4PJBF 2EO9A 3ZRSA 4IKLA 2BSTA 5EBWA 1T1YB 1BX2A 3PQYD 4ELDA 5DLLA 4X6FB 2PPFA 2WC7A 1LP9F 2IF7A 2D31B 1ONQB 1DUZA 2SODB 2V5YA 3HEIB 4L05A 3C8KB 4Z0XB 3ARPA 5GS1C 5A3IC 1JNHA 1DVZA 3SDXB 2VN6A 5KS9E 1JG9A 1L3NA 2DAVA 3QE5A 4QGTA 3VFPA 1KYDA 4G9DB 4QCIB 1NUNB 4QTFA 1RIVH 2DJ4A 3W56A 4HUWA 4PJHA 1RIHL 5EV7A 5E2VL 1DQJB 2FDBP 4HK3N 1RIUL 4FZEH 3RGBA 5AWNL 3MLUH 3W9EA 1A1MB 3IKCB 5H37H 4DK3A 4ZX5A 3WKMH 4DGIH 1A9EA 3V0WH 5IQOA 4H0GA 4YS4A 1EFXB 1SBSH 4A6YB 1QFUL 3KM1A 2BMKA 3DTUB 5T5NG 5L8KB 2ZOLB 1QLEB 3P3RA 4PJ8A 3RB7A 3V6ZA 4DFHA 3C75A 4OFVA 1WT5C 4R5VA 4X8XA 2DM3A 2D7PA 1F4WH 4MD4A 3VD0A 4JPWL 3WXVL 2HPTA 1KLGB 4NRYA 2X4UB 4XVSL 2N1KA 1B4TA 5J12C 4P04A 3KMDA 2FX7H 1B0IA 4NQEE 2GC4C 4JDEA 3ZTNH 3BIKA 2F5BL 4GOSA 1P1ZB 5CCJA 2G60H 3X12B 4N87A 4M6OH 3MCG1 4ZUUA 3CGTA 1J8HD 4J3SA 3WTYA 1MFEL 2XXMB 3JV6A 1DQQB 4N2MA 4XNMA 5I5JA 6FABL 2AXJA 2JTYA 3D09A 4M5YH 4Q97A 2EKSA 5J12B 3IGKA 4YPJA 2DDQH 1N6QL 4BSWB 3OX8B 1UTDA 1KLFA 2BOBB 2VLLB 3QQ3A 3KL3A 4LEOA 5BV7C 2YGQA 4MB4A 4HF5L 3X11A 3HTLX 4K8RH 4OZGF 3LXCA 3SBWA 3EDJA 3RWEB 4MAYC 4B9CA 4Y4KD 4IBVA 3QUMA 2HTKC 4L2YA 1SJHB 2CRZA 3K6DA 3QCUH 5KVDL 1CE1L 2ADJA 3WEXA 3PRZA 4YSRA 3N5AA 2PCXA 3SE9L 1QHPA 3OMAB 2W80C 2Z1PA 4FXKC 5TE4L 3TL5A 1JRHH 4MMZB 3DROB 2VDMB 1HTYA 1OOWA 3W3BA 4MAYB 3X3FL 1OP4A 5A6IA 3UZQB 4WSJA 1OE2A 1S7QA 3IFLL 4CKQA 4FQXA 2YLKA 6CGTA 2F18A 5FYJE 4CA4A 1OP5H 3MV7E 3IDMA 5BVJA 4FXKB 1VEOA 3IGAB 4P5RA 2YPVA 3ASNB 1IAIM 4OCXL 4OIIH 5ITBL 5I6MA 1DLFL 4IOFC 1IGMH 2V9UA 4D0DA 5DEFA 3FUHA 1S9WA 4ORZC 1H3PL 1UZ8B 5JUEH 3KYAA 2PW2A 1QW9A 2YQ2A 2RAMA 3LNFA 1CLOL 3KHQA 4IRZA 1HXKA 1F11B 4JAMA 1A7PH 3UAEA 1T22B 2BHUA 4JFXA 4UTBL 4BD4A 3L3GA 4I0PC 2YD8A 4HKBA 4P4KD 5FFOA 1OGTB 5JLZA 1ZT1B 2XWTB 5CP3H 5I2IA 2D7TH 3VFWB 2XYBA 3VFOA 3ET9F 1H8SA 5B7MA 2ZOKA 5IB1B 2A1WL 1NCAL 4XNDA 1OPGL 2CGRL 3UTPE 1CN4A 3GO1H 3MRBA 2F7RA 4AW7A 2CMRH 4YHLH 4UOZA 1CGYA 2WLMA 2X4TA 5B1JA 1BQRA 1ROWA 4I0PB 4LRIA 5L2JB 4MJJA 4B9IA 4N8UA 2J4WL 4YLBA 5ES4B 2P26A 3L3IA 1U6AL 5A7EA 1MF2H 2ZCLH 1D2PA 5DMJB 4AZ8B 1EAJA 4KDTA 4NKDB 4IS6A 5KYUB 1QFWI 3L5IA 3BEWB 1QG3A 1HQ4B 2X4NB 1EPFA 3ABZA 3SDAD 2H41A 2DMHA 2VR7A 2DWYA 2AVGA 3BVNA 3ZKND 1E27B 2HP4A 5IR1B 4HJ1A 5KN5A 5TQ2H 3H3KA 1IKNA 1IGYB 2HKHH 3TYFA 3FK3A 5ISZD 3QFJB 1MCOL 5F44A 1AH1A 2P5WD 3L3DA 1A4JB 1SYSB 3PF2A 3QSKB 3V8CA 3F7VB 2AANA 2DWDB 2CXKA 2V33A 5F72S 5J4MA 3WE1A 2EJ1A 2VDNH 3MLTB 4UQIM 4EDWL 4ZMTA 1FL6A 3MYZA 1AKJA 1FPTL 3QQXA 1FA4A 3RKPA 5IJBC 1QNZL 4H8WL 4A2EA 2E4TA 4KI5E 4HWZA 4YXLH 1J7VR 3KYNB 3E9TA 1S7XB 3UXFA 4Z95L 2Y23A 1CF1A 3IGUA 1YEGH 2FJHA 1KIUA 5E00B 4Y8DC 5E5LA 1YYLL 3ZE2B 4YVUA 4NKIL 2C26A 5FECA 3F8UB 2KPWA 3EIFA 3MDJA 2OMWB 4BFOA 4N2NA 1MJJA 5TK2A 3ML8A 3SE8H 3DV4A 2NR6A 1TEGA 1BZ9B 4WVRA 2AKRA 3IMVA 5CEXB 3LB6D 3PWJA 2IALB 2MPAL 4POZC 5HHPB 2QZ5A 4HGMA 4ZTEA 5IVXE 4AIZA 4WHCA 3CFQA 3G9VA 4ZMPA 4BZ2H 1HI6A 1WFUA 4I4WA 4IHOA 3WS3A 4C4KO 3O2DL 4GUPB 4DSYA 4AUJA 1HEJC 1ACCA 5IOKA 1NIBA 3DJTA 3IRCA 5D8JH 5F1IB 2Z31C 4KKLD 3KCPA 3O8XC 5JQIB 2FZ3B 2G2PA 1I1FA 3GJFK 1JHKL 3F62A 4UV4L 1GR7A 3DGGB 1CS6A 4N8VG 4Q58C 3ZUNC 3SCMD 3VW3L 5H2BB 3U2JA 2OW7A 3HRZA 3ILPB 4PJ5B 3ZE0B 5INDB 3D4GA 1A6ZB 4PJXA 4YHKH 3PLYA 2BIMA 2VGLM 5DJXA 1J8RA 3JVGC 2Z31B 3O8XB 4OM1L 3MV9D 4FE9A 1DBAH 3PL6C 4JFTA 2KHAA 1O9WA 3BKYH 3TPKA 4I5BB 2Z8VC 1WIUA 1DR9A 3NJXA 4S0HA 4G11A 1R75A 4DKFH 4X8GA 2W88A 2VIRA 4JFPA 4HKZB 4DEUA 3L8QA 2E8ZA 4HJGB 3TZVA 2W9EL 3EOBA 3BLPX 5D7JA 1R17A 5I18H 3CE1A 2I5YH 4XH2A 5I0XA 2Z7ZA 2J5LC 5HGHA 5ILTH 2OMZA 1CU4L 3PL6B 4ADGA 1KGCE 4XAWH 5TDOA 2QSCH 4NNYA 4RISL 2WHVA 4IOSA 1YNTF 1U3HB 1A64A 4KPHL 3HLAB 4GO8A 2TSAA 4UTBA 4M3KB 5BVPH 4JM2C 2VDPH 2XVBA 2VTFA 3PDDA 3FMGL 2A6IA 1R33A 1BF5A 2MMXA 4UBDC 3ZQXA 4F58H 2BIPA 4LCIH 2J5LB 3B56A 3LHPH 5EORL 5DMKA 1AQKH 1EMTL 4XCNB 2AXGB 2F7PA 3WHXA 3FSVA 2J55A 4P23A 4V2CB 2AAAA 2ZCKH 4HS8L 2R39A 3QWRD 2J8HA 5ANME 4CDGC 5CGBA 1A1NA 1EGJL 1NBQA 3VJ6B 2RHEA 2B4CH 3GEFA 4QEGA 4HG4K 5TD4A 3RQ3A 43CAA 2QELA 4IBLT 5E7BA 5CKGA 3ATAA 3G5ZA 1NFDB 3VU2A 3K6SB 1W72B 3IPFA 5DUML 4Q4EA 3HFML 2VMJA 2MKLC 4DKTA 1KLUA 3WIIH 2DTSA 4LRNH 1VADB 2PXYD 3FU0A 4OZFG 4RNRB 4F7PA 3VXRA 2FWLB 4WI7A 2QTEA 2CUAA 1S7RA 1MAKA 2EDBA 2CDFB 2A6KB 2FWUA 2IBZY 2R59A 4JE4B 2VDQB 3GHEH 2G5BB 1RJLA 4C56A 3DRQA 4UOQA 4UWQB 2XWXA 3I74A 4WNQA 1VA9A 1IQDB 1JGEB 3EJCA 2WD0A 3Q6FA 1MH5B 5IVZA 4L4TB 4PJ7E 2Y5EA 3AXIA 3DVGB 2R4SH 3ZLQC 2MQCA 4YBQD 4WWPA 4KFZC 1QBLH 1W0WA 2GJ6B 3O9WA 1WWBX 3CC5B 5EC2B 3KR3H 4MQSB 3VXUA 4D9QE 2N59A 5KANG 4MSWB 2KC0A 3RI5K 3MOAH 4V11A 2NYYC 4O5LL 1YEDA 5I1EH 5JW3L 2W65A 4Z18A 1G1YA 1F8TL 3FTGA 15C8L 3EBAA 4IKNA 3GIZH 4PRPD 4OCNC 4NN5C 2YPLD 3V6FB 4MJIA 1X5IA 5B39A 1RUQH 2MCG1 1HL5A 1X4XA 3I9IA 4F1ZA 2DBJA 1KJMB 1JVOA 3N1MC 2R51A 3DX3A 3RGVC 2CCVA 3VXQA 5HYFA 4K07A 1CBVL 1S7WB 3O2DA 4B7LA 2HRPH 3JUZA 2D8KA 3OKLB 3A67H 4PRBA 1MCNA 1IEAA 1HC1A 4KI5F 2A2QT 4S1QL 1LNUA 2VM9A 2F0CA 4OGQC 3WKPA 4XNUL 4PREB 5CJXC 3RP1A 4OGAC 1L0QA 4EI5C 5FW7A 1PY0A 2W9DH 4LL1A 1RJYB 4S1SL 5DQJB 4CU8A 3E7JA 3FQ4A 1J88A 3M1BB 4GW5A 3I50H 2EECA 3U9PL 2Q86A 4X7SL 3U48A 3GMLA 5KVFL 3PNWB 3OSKA 5D1XA 1UQSB 5HHXH 4AGNA 3TV3H 1SVCP 1WIOA 2WVSA 4YHML 3CU7A 1BYPA 5C9JB 1XGQA 4EI5B 4XB7A 5IVXF 3DJSA 1SM3H 2FECL 2BERA 4GKZB 3ZT5A 4MDIA 3S35H 3WEBA 4U1MA 5E6ID 3ZRCC 2YAPA 4C54A 2EAEA 4NUGH 4Y8AA 1J1OH 2BVYA 3MGOA 4XI5D 4HUVB 4UT6H 4G5ZL 2OPCA 1M7DA 1QWUA 1VB9A 4X7TB 4PBVC 4K9EL 4PI0A 5E8OA 3MRGA 2AK1H 3HBGA 4QY8B 5MERA 2XZAH 5A7BA 1MCPL 1DJGA 1IGFH 4LIQH 3QO1A 4TLSA 5GGRA 1SGKA 3EKCA 5GGUB 2CO6B 4KTGA 4BWUA 2HVKA 2SEBA 3P3SA 3U1QA 1T03L 3CXHK 5IEKA 5K9JL 3TCXA 1AZVA 3CFCH 4K0OA 4JB9H 3NZ8A 1RZGB 2FBOJ 3CHXA 3DVNB 1HOCB 1IFHH 1I9JL 1Z0MA 2FO4B 1BJ1H 2Q20A 3M8OL 1QHQA 3VDBA 1KN4L 2PCYA 4EZKA 5EG6C 1EGJA 3SE4A 32C2B 1ZGLP 2M1KA 3F3HA 4QHLA 4WI0B 2F53B 3HHRB 4U4IA 1NEZG 2EVJA 3G9AB 5EN3A 4YX2L 4M9PA 3BO8A 4MNGB 1FGNL 3O41A 4XMLH 4I3RL 4M02A 1FVEA 3AS0A 4N8VB 3IFOA 3HHSA 3MNWB 4IU2B 2CKBH 1SXNA 5F7HA 1JV5A 1N8OE 1XH1A 3QUXA 2CLVA 1UHVA 4Y9CA 4HW6A 4XXCC 2ENQA 2IBZX 5LUMA 4PVLA 5DT1L 3GGWB 2ENYA 3PFUA 5JXEC 4YJZL 3KPOA 2E9JA 5AB2A 4UTAL 3T0BA 1JXFA 5JORA 4K55A 1GTFA 3S2AA 3CPLB 3P0GB 5D7LE 1AXSA 4KQ0A 4N90E 1IGTA 5HDWA 4YH6A 4XNQA 3EJTA 5J6GA 2DWEB 4R6UA 3QC6X 2A74A 3A21A 1KYAA 2IANB 3R1GL 5E2JA 4V2BA 1ASOA 4MMXC 4JFQA 4WCYH 2WXKA 5AOKA 1AGBA 1Q9LA 3V0JA 1MSPA 2D0GA 2EIDA 4LP4A 3QEGL 4CBZA 3EH3B 2K9UA 4ENZA 2IGLA 4M61B 4K3JH 5EHFA 3VSTA 4AMKH 1MCIA 4V1DD 5AVWB 4UOJA 2J1YA 4KZ0A 4NO0A 1FP5A 2X0UA 3V4UH 2K3HA 1O9ZA 2WXHA 3N41F 3T2QA 2VWEE 5AOLA 3FB5A 5D4JA 1PQZA 4MMXB 4XCCL 5D1QC 5TH2A 2ENPA 1CD0A 4U49A 3AG1B 1INQA 1NKOA 1T4KA 4JJHA 3H4HA 4S1RL 5C09B 4XCEA 4HZLA 2FRGP 1OHZA 1E5BA 2JJSC 4JFED 1PJWA 1WBZA 4PJ7F 4YDJA 3VQ1C 2GY7B 4NS0A 1P4UA 2IPKB 2XWEA 1TF4A 2B1HL 3CLFL 2EUWA 4KKCD 5IHUH 5HI5C 2ESVA 5J0BA 1EHNA 1V55B 5D1QB 5E8NB 2CBOA 3L17A 1KBPA 1QFHA 1K8DA 5IP4A 3QZOA 4X2UA 3IJHB 4EIUA 1EUTA 4LVHC 3DTXA 2YGOA 4OZFB 5TF0A 1BAFH 3KNBA 4U6VL 3TASA 3U4BL 1EDHA 3ZKQD 1FRGH 4LSVL 5I1CL 2CLRA 1AHWA 4XODA 5B3JE 1V3JA 3RA7H 1P5VA 4W6XB 2NY1C 3NJIA 5D2LA 3NZUA 4NP4L 5JDJA 1FAKT 2GBUA 1A3RH 1CTOA 3L7FA 4ZUVA 4LVHB 3ZIYA 1D6EB 5EBLA 5MI0B 4M7JL 2B77A 2X6MA 3TO4A 5IMLA 4ALAH 3SDCC 1ZJAA 1CG9A 4IGBC 5DI8A 2AMUA 2DQTH 4JN1L 1IC5H 2NY1B 1UA6H 1YLBB 4ONFH 1QTYT 1MFDL 2WB7A 3B1TA 4EN3C 4LLQB 3VXSD 4U6HA 5HGDB 1DVUA 1VIWA 1H5BA 2X9WA 1A22B 4IGBB 1AIFB 1E4WL 2P1YA 3H3PL 2X4PA 4CNIA 4O9HL 5DDHA 1T1ZA 4PG9A 5FUCC 1E90A 4WUUB 3SPVB 1BVNP 3DECA 4OI8A 1JZ5A 2WXFA 3IWUA 4EN3B 3TIEA 3FN3A 2AQ3A 1N0XL 1NFAA 2PYED 1GYVA 5DS8A 4OJFH 2FJUB 4G3YH 4GT7A 1VACB 4AUYA 4RBPH 3KE0A 2TSBA 1PDKB 4BKTC 2WCSA 2HT2D 3FU7A 3MV11 3FB7A 1MCBA 2ZX5A 1EFQA 1NBVL 3APFA 4U1KB 3SE3C 5IHZB 5T1LD 3LPPA 3O45A 1FO0B 5CSZB 3ULUL 2MNJB 4OTXL 2I85A 1KENL 3QQ9C 4L4VE 4YHIB 3U6RB 5FKPA 1RZJC 3TH4T 2NX5A 4WW1A 1LO4L 3NJJA 1XV8A 3GF8A 2O61A 2FGZA 4MJHA 3ZDZE 2IIJA 3MLPA 4YGVB 1LTXA 4UTAA 4PGEB 3SOBL 2J6EH 4M6AA 5KVEL 3CTTA 4PLNC 4U2ZA 4Z3GA 5T3ZL 2CHXA 3HMXL 1XIWC 1D9KD 4E41B 3ULVE 3AAZB 1LM8V 4TULH 3X14B 5FO8A 4JQVC 2CCLA 1QI5A 1IGJA 5IW3A 1PLBA 1SY6H 3OR6A 1PAMA 1GZHC 4O02B 4KKBD 1MCRA 2Z7UA 2CD0A 3TJHC 2R56H 1XX9C 4P59H 4Z7QB 3Q6GH 1U8JA 3ATEA 3IS1X 3E9UA 4ZMAT 1T5WB 1I82A 2VMCA 1XIWB 1ETZB 4CSTA 3U82B 4WW2F 5DD5H 2EXTA 3TN0C 3K71A 5IFJA 4HS6A 3GNMH 3BVDB 1HN1A 1IC4H 4DAGH 5C6PB 1JZ7A 1BVZA 2K7PA 3I9GL 3U1SH 1QSED 3SQBA 1NCGA 1O6VA 1ZT7B 5EU7C 3W9DB 3ZUCA 1NEZB 3KPLA 3KPQA 4R4NC 5D7KD 5K1NA 5CBAA 1G6VK 5D4HA 3BFQG 1AGFA 1INEH 1J1PL 1MVYA 1F6AA 2NTFB 3PV6B 3TN0B 2R15A 3DHJA 2B16A 2DD8L 1DSYA 3V9EA 3WJLA 1IL1B 1SOSA 5LG1A 1BQUA 3UAFA 1PW3A 4JPVH 4WK2B 2GIYA 1MQKH 1BD2D 4ODSH 3P02A 1F4WL 4O2FB 1VPOL 1T66C 2EIEA 5DEGA 5E6RB 5C3TA 4ZNCD 5DURD 5MEQB 4X6CB 1PY9A 4ELMB 2WLLA 2RJMA 1LK2B 1WYJA 4L9LA 2VJ0A 1QHOA 3IETA 4HC1L 2OMBA 2BCKB 3HC0A 2FUQA 2VQUA 5JHLH 2XQ0A 3N1GC 2ZTBA 3RWHB 4ZW6A 1KCBA 5DK2A 3SDYL 3S8FB 3VE0A 3BUQA 2XSKA 3IK2A 2X0WA 4KZDH 3SKJH 4AX3A 2Y72A 1NDMB 4H8QA 4LNRB 2VLRE 3QJUB 2XN0A 2R0KL 4HEPA 2WIIA 3ARWA 4I3SH 1HDMB 2ITCA 2OCCB 1KCSL 4HPOL 4OH2A 2R2EA 1IIKA 4LSSH 5K33A 4CGTA 2X87A 1J5DA 1X6NA 2VDMH 4JW3A 5KBNC 2A38A 1BM3H 1URIA 5FAAA 4BGDA 5B3JF 1TSRA 1A65A 3QEUA 4KY1L 1YC8A 1CYXA 2VL5B 2B59A 3IRZA 4XTRC 3U4AA 2H4EA 5H94B 3L3HB 1PEZA 2MTAA 5GGQL 1DSFH 4MRBA 3VXOB 2XVGA 2NY5C 4JY6B 4NKMA 4G8EB 1A3LH 3REVB 4EDXA 4DTGL 4CVUA 4LHQB 3CBJB 3O6FD 1DQKA 1DDHB 1JFQH 2B9BA 2EDHA 4A39A 2XQYG 2BJML 3KPSB 1OCRB 4ZMXA 3PHSA 4LCWA 1PYWA 3INOA 4A2HA 1N67A 3LKQA 2CLZA 3ZQWA 4I48B 3BP7B 2ROXA 4PJXE 1ACZA 4O2EB 4ZXBC 3EFOA 4J5VA 4QRUB 2CIIA 3BKML 2EABA 4CSZA 5B4MC 1EVTC 4JFOA 3BRFA 1NTDA 2HFFB 4ZFZA 1KGWA 2Z92A 3UCRA 1UOVA 4TL4A 2ZD0A 2X6VA 2LFEA 3NRQA 1IGML 3PNRB 3BGMA 3S97C 2Y6TE 3E6FA 3GM0A 5HYSA 4PS8A 2OSXA 2NXZC 2H3NB 1CLZH 1NGYB 1F2XK 4ZXBB 1FH5H 1RZ8B 2HB0A 2V5SA 1ES0A 2AGJH 1AZBA 4ENEC 3PABB 4NC2B 3JWDL 3HMXA 1SMAA 1ILSA 1TTCA 4JKPL 4PTUA 5DZNA 5K9KA 3KL5A 5TGBB 1MEXL 4LSRH 2PR9A 2UZPA 1AMXA 1P5UA 1IRAY 2Y6SD 3NJGA 4QRRB 2KBGA 1S78C 2DJMA 2NXZB 3DX0A 3SIKA 5I26A 3VD4A 3NMEA 2XG5A 5DRWB 1EJOH 1XL6A 1IAKB 3DO4A 3LEYH 4I9WE 4PP2B 4WQOA 4Q74A 5EA0H 4YLQT 3TBTB 4OLZH 5IQ7L 5IK3A 3S36H 5C8JB 2MNWA 3GD1C 1MCCA 5IQ9B 4AW4A 3BSZH 4TQEL 4D9LL 3ZDZF 3QYMA 3LV3B 1T20B 1N4XL 1X4ZA 1I1YB 4U1NB 4FG6C 5EEXA 1Q1JL 4D8OA 3BGFC 3S8WA 1JPTH 2I7OA 2FK9A 3WIFB 3KPRB 3RWCA 1IEBB 2VLJE 1G7LB 3UTOA 4BJLA 4ZUSA 4Q56A 1R3LB 5CXPA 4XWOD 3RIAK 2P24B 3KYOB 2HX7A 1T80A 1TTGA 3ME0A 5K9QG 3I85A 2WPGA 3ULVF 3KCWA 3ZIMA 3P4NA 2VN5A 5TQ2L 1OK8A 4B41A 1BBJB 3MXWL 1DHKA 5DLMH 4AXWA 2F74A 3BGFB 3DIDA 5DZAA 5CD5D 2AQSA 5LBSL 5BOPA 1MAMH 1ADQH 2EDNA 4GSRA 3RWGB 3X13B 1I3UA 3HE7D 4G9FA 3OXRA 2NW3B 2W8CA 3QIUD 2H9GB 4JRYD 3ETBF 5C0RL 2HWZH 1LL1A 4G8GE 4BKSC 1B6DA 3QNZA 3TEUA 3GXTA 4GLRI 5I1GH 1JUFA 2JIXA 3D33A 3K2IA 2VW6A 2ZUSA 3NTCH 2XKSA 4JVUA 4F91B 4XNBA 2GBTA 1CFTA 2G4EA 4OFDA 1RUPH 4AQ8C 3ETSA 1OV8A 1MJUL 2NUTB 3FH5A 3NFSL 4QKTA 4GG8A 1ACYL 5GRVL 3BP4A 3VXUE 3TIDB 4MMYA 4H40A 4RZCA 2C9AA 3WNIA 2DMGA 1ET7A 4YDIH 5HHME 5A2IH 1F97A 3FQWB 4PWGA 1LYQA 4LXFA 2XPZA 1N3NA 4AGPA 4ATTA 3BHBA 4JO4H 3U7YH 3WD5L 4XHJC 3IU4L 1VCBC 5BZXA 1K2DA 3MYJB 2HZHA 4QLWA 3EUDA 4WFHD 4R26H 4MJIE 3WL9B 3ZHDA 2QVTA 3PV7A 2E76C 4LPYA 1KBGH 3WFHA 3MRRA 4ONHA 5F7LB 5JOFB 2MCPL 1DBMH 1N8ZB 1QPPA 3U2SB 1OP9A 3L3OA 4OZHA 1BZ8A 1OAXH 4AEHH 5ACLA 2XA8H 4FYSA 1I3GH 3CMGA 3N2JA 4PJBB 5E6ZA 3BQUA 3CLWA 3DI3B 3T4YA 5DEJA 4OT1H 3TBSA 3HI6L 5GZOA 5IY5B 5I6XC 2ENJA 3IJ8A 4OGXH 1PL3A 5T3XE 3DYMA 1JK8A 3O3AB 4N0CD 5C0EA 3II2A 2WZPA 3VFGH 1E4KC 2O6PA 1BJ1J 1UWEH 2AK4B 3L08A 5HI3C 5T1KB 1QRNE 3FRPA 1P4IH 4PRDB 5BS0B 5CLXA 1HEZA 2YD9A 1MWAL 5D1XE 4FQHB 3VA6A 4G1MA 3WTTA 4U3CA 3E38A 3FFCE 4YPGB 2CDGB 1W0YT 2VXUH 2VDLL 3V5KA 5I6XB 2PLTA 1PCXA 1XGTB 1NC4A 1E6OH 2B14A 2GG1A 3DRTA 3NN8A 5E95B 4QRPB 4ZSOB 2PYFB 2AMGA 4YDMA 1BWWA 2BY0A 4JFFB 1MHCB 3EF7A 3HE6B 5F71A 1P7QA 2HVJA 1C8PA 4F80A 2KYIA 4QR7A 1OM3L 1TZGH 2FBJL 3HC4L 2ED6A 3KPNA 3PYCA 3WUWG 1FBIL 3U7AA 1IEHA 1M6OA 2GJPA 4GPVA 4Y5VA 3QUZD 5AQ0A 5EU6D 3UTTB 1BVNT 1W72H 4U7KA 2LTQC 3LHPL 2WJ5A 1G9NC 1U8KB 1FGVH 3GRWL 4PJXF 3I75B 5HY9A 1FAIL 3CVDA 5EF1A 4J2XA 1MFMA 3HPLB 5KBDA 3FUDA 2A6JB 2FAUA 2IO5A 4NO5A 4L1LA 4LASL 1MFAH 4JHWL 3OMNB 2BSBA 3G6AB 1PIFA 2ZSVB 4N22A 3AW5A 3RTLA 1F3RB 2VDQH 2LLLA 4J3OF 1FNAA 2LTQB 1QFPA 3FU3A 1BMZA 1OGAD 5GRJH 4ERSL 4ABQA 2XC8A 5HGAA 5I8CB 1TCRA 4A55A 3MX0A 5E2WH 1CXFA 3M6DA 5CMAB 1F3DH 4IK7A 2WKOA 3M17A 3QQ4B 1YCSA 1AR1C 1TZIA 3B2UC 1WD8A 3QORA 4ZUTA 3ULAB 3VWJC 3TGXA 1HK6A 2VLKB 4KJQD 3FFDB 2Q7AA 2DLFH 4ZRGA 3GHEL 3FCUB 4FQ2H 3IT8D 4OZGB 1S9VB 4UAHA 5CUSL 3G6DL 3KPMA 4IEFB 3FHQA 1HHJB 5DZPA 2XRAH 2IAMC 2XV3A 1ZSDA 2ZOOA 1AR1B 4U05A 3GSNB 4XBEH 5C0AE 2Y69B 3H7BB 1I1AA 3BAJA 4Y9BA 5HYJD 4HXBH 1KXVA 4LP8A 3NAAL 5IQLA 3BWAB 3O6KH 5JO5B 4AL8C 3BH9A 4KX9A 2EO7A 2E6PA 4RQQB 1MCEA 3IJSB 3IKKA 5CZXD 1WLHA 5F9AC 5D70H 2IAMB 1DJWA 5C08A 3AACA 3QNFA 5F9OL 2WQWA 5I0YA 3T65B 4KUZH 4LARL 3SN6N 5BO1L 2DL9A 4Y1AD 4FTVB 1XF3B 3RKDC 3G5XB 2OTUA 3GIZL 4HDIB 1JZHA 1H15B 4IK6A 2KL6A 1JS4A 4L0PB 3MLRL 4U1SB 3ILDA 3P9MB 1JAEA 2OTWA 5LAXA 1TLMA 4JO8A 4J3VA 4A2MA 1KV3A 3DIFB 4O2CA 1P4LA 1NICA 4UQ3B 3QDMD 1PG7W 4H5SB 3SOTA 5HSFA 1OARL 1AAJA 2F54B 1U8NA 1JGLH 2XDHA 5GGRY 4CW1A 2R4RH 2WLJA 4AG4H 1V27A 1CDHA 1FDLH 3CZGA 3F65A 3T6QC 2ESVE 1JDCA 2FYYB 3DUUB 3DWTA 1OAYH 1I8AA 3T2PA 1ZMYA 4RX4D 5F9JB 4PRID 2D0FA 3FSWA 3MRKA 1NIEA 1NJ9A 4A7TA 2ADYA 2V3EA 2B1OA 4LBAA 5AVXB 2FO8A 1OT2A 5ETUA 3TBVB 4NT6A 4F92B 2I60L 4MDRA 1T7XA 2BPBA 2WSDA 4G8IA 4KTEH 3T71A 1SOQA 1OW0C 1AZRA 5D2LE 4LGRB 4E9RA 1BP3B 1D2OA 4OF3A 4GAFB 1A3QA 1P4BH 1CXLA 2W9LA 4JHZA 3OB0H 1NPNA 3EFFA 3GJEA 4Y2DA 2HLFD 2GIMA 1R5IB 1GKOA 4FCHA 1W9XA 1QKZL 3B3IA 2K8MA 3Q2NA 2E75C 3JV0A 4Y4HA 2X4SB 4FTDA 4HA1A 4OGZA 1E3ZA 3ARFD 3LRSB 4X5RA 1ZHKB 2J2ZB 4G6AC 4HBQA 1P7KA 2IFFL 4LEEA 5AAWA 2CGZA 5I76B 3WDJA 5FO9A 1BLNA 4ANVA 4NO3B 3DX4A 1WBXA 2EEDA 1Z9NA 2F15A 5E23A 3W2DH 1AD0A 3G5YB 3HCVB 2CUMA 2F58H 3FO0L 2GTZA 4N8CH 1QPXA 3EDFA 1AI1L 4H7VA 5SWQB 1CFQB 5DJYA 4MCYB 5AW3B 1LEGB 2V4LA 4MB3A 2EIZB 2FWOB 3WOVA 2EC9T 3CFBA 1X5GA 4NFBA 5EOQH 2DKMA 5I1JH 1RJCA 2GY5A 4G7VL 4XMLL 2CO1A 5I17B 3PWUB 4QRBA 2BNQD 4K3GA 1L7TH 1NMCB 5LBVA 3CSYB 3HAEB 1LO2H 2ATKA 4MS8C 1PLAA 4J3BA 4TUJA 4PJAB 3L4CA 4DZ8B 4A7UA 4KJYA 1P2CA 2D3NA 5HHQA 4HLJA 4NQEB 2NY6D 4G6FD 2VDKH 1OSZB 5L0QC 3AC0A 1MUJB 3H9SE 2VE6B 2AEQL 3GSUB 3QUYC 2VKXA 1VLXA 2PPAA 4P48A 4HUXA 4F7TB 4ZW5A 4RAVA 1LQBC 4WTZA 3HUJA 2EH7H 1X5ZA 2FB4L 3QEQB 4FNLL 1OCWL 2R69H 1DVFA 3N0AA 4XN2A 3M7OA 5L0QB 2FLMA 3NABH 1R1CA 3O2WL 3WUWB 4ZFGL 2AS5M 5E94B 3PHAA 3V4UL 4NJ9L 3WE6A 1XCXA 4M6MH 3W39B 4JQIA 3QUYB 1NGPL 4TNFA 1U8PA 4GI8A 3QULB 4QO1A 1URZA 2H6PB 3L7EA 1RK0A 4OZFH 3PGDA 2DQIH 2EDFA 3UYOD 2CPUA 5M95B 3WAKA 1MIMH 4P5TA 3RX7A 5CHNB 3CN1A 3STZA 4ODWB 3F7PC 3CFKA 4UM9B 5DTFA 4QOKE 3IDJA 1K4CB 1ZT4B 3GXNA 1XL4A 1YNTB 4MJ6A 1NCWH 3AG4B 5FYLE 3TBCA 5TPWH 1K8IB 2QHLA 4NWUH 4QXUH 1BAFL 5B7EA 4YXKL 2OQJB 3RVVC 1TJHL 4H1LG 3MV7B 2BVOA 3H9YA 4HQQH 4CC4C 3SGKC 4E9LA 4B5EA 3FQXA 1TYEB 5C07D 4R8WL 2BIQA 1IM3A 3MREA 4XP6H 5EFIB 4L3AA 1MCWM 5IEHB 5LGJA 1DBJH 2EYRB 3TFKD 4E9SA 1X9LA 4GKSB 5I15H 3QR2A 2J72A 2MQ0A 3VTAA 2PCPB 2BNUB 4XOCA 2C1OA 1BXVA 4UOW0 3PWPD 3CBKB 5BO0D 1J12A 4FQQB 5IUSA 2IPTH 4ZOAA 3UGUA 1MIEL 3FL7A 4R3SB 3OC5A 1PKQA 3MI6A 3TA3A 1PKOA 1Q90A 3QJQB 2C9PA 3ZL4H 1D5BA 1FVDA 2V3DA 2V5MA 3A4FA 2V2TB 3MJGX 3R06A 5DVLA 2J1WA 4TXVB 5KSAD 3FB6B 3KYKH 2OXHA 4F7KA 2NQCA 4X4MA 2ZG3A 2K45A 1PD6A 3GJFA 4M7LH 1JZ8A 5D2LF 1JWSB 4G59C 1IC7L 2OMUB 2YMTA 3DJRA 3LQAH 3U46A 5GZNA 3CN4A 2CR3A 4MA3B 1W0VA 3MA9H 1TMQA 2HH0L 2CRYA 4OCWH 1GGCH 4X98A 3FAWA 2R29H 2DLTA 2VR6A 2VRAA 3PHOB 1DEEB 1SYVA 1N6UA 4FX5A 3L4VA 2ZUWA 5C0IA 1E2VA 4LCWE 3B2PA 2CO4A 2JLPA 2EUZA 1TQCC 5BUPA 4JY4A 4L1BA 1C5BH 1W2KT 2R1YA 2WYZA 3KVPA 4KQ3L 1RZJH 2B0SL 2YAQA 3MJ6A 7CGTA 5KBKA 4KI5C 4HMDA 2BH0A 4CN4A 3B6SB 4X5XA 2VR5A 2W07A 4JCLA 4O02H 3WY3A 5IWLC 5K39B 2WLZA 3N1FC 4MKMA 2HRLA 5IESH 3T09A 4RA3A 1TQCB 3VSVA 3UDWC 5EOTA 3G08B 1UH2A 1UWYA 4J12A 5GIRA 4PGBA 5IJVA 4RAUA 2AEPL 5FUOL 1XF2B 1KJ2B 3QI9A 4F7MA 1Q0XH 3BH8B 1LD9A 3T3ME 1U58A 2IG2H 1O6SB 1QZ1A 2VM3A 1A6UH 3DXAE 2APFA 3BQVA 1X7QB 4DP7X 2Y2WA 3MUY1 3AM8A 5A3ID 3SBRA 3O6ML 1S6NA 1FCCA 1LE5B 3BAEL 4HK0A 2VB5A 1EFXD 2DQFA 4YC2B 3MRPA 4A6YL 4OJYA 1H3UA 2A4EA 1YDPB 1MNNA 5IG7A 1QLEL 5KZCB 2DQHL 1TG8A 1UD8A 1EDQA 1HHHA 5EZLB 3U4EA 5IVXB 3GNML 5FHAH 1GZPB 3B34A 1DJZA 1A6AA 4QD2E 2NLJB 1RUAH 1L0XA 3J7HA 1NGZA 2CZNA 2O5ZL 5DJCB 1UXWB 2OJ1A 2A3TA 2EZ0C 1RVFL 3DX8B 1FYTB 4OCRL 5D71H 2ZUTA 1AZZC 1MHHB 3NCBB 3JTTB 3B1UA 4JO3H 1TEYA 4FFYH 4FNTA 4J2QA 4AQAA 5CFAA 5AW7B 2IPUG 1UVQA 4PSRA 4Y7OC 1HZLA 3SGJC 5FCSH 1T21B 2Q9OA 1SVZA 5EIIA 2DBLH 5IW6A 3IFPA 5EC1A 1FIGL 1P0SE 4I18A 5E9DA 3MN8A 3HZKA 2WO3B 5K69A 1UM6L 2ZSWA 1PS3A 3RUGA 2YN3A 3AVEA 2JKNA 5EO9B 1CYGA 4NSKA 2DTML 4G9FE 1EJFA 2W60B 2P8MB 5MEPA 5DSCB 1WWCA 4U1GC 2MQ3A 3K2KA 3UEZA 3I6KB 4GRLC 3VXNB 4NCC1 2VISA 4WNSA 2FD6L 4X83A 4EBQH 3RFZB 5BV7L 3NRPA 1A66A 1ZWIB 3WDHA 2Z65C 3NCYP 5HHOB 1MAJA 1ULVA 1QABA 4YHOL 4KTYA 4U1GB 3S2CA 1UD6A 3MNVA 3VYPA 2CALA 4PJDB 4MAYD 2GHZA 1YY8A 2XPGA 4AOFA 4JKNA 2E46A 5E1AB 2HTKD 1CIDA 2EDRA 2NY5H 1J9SA 2V7NA 1A8JH 2J7LA 3BEVB 2R1WB 2YPKB 5TE6H 2XQYK 1KTKE 4LQFL 2D3JA 5ANMB 1HOEA 3T2NH 3VFSA 3O0RL 2MPVA 2JCCA 4WJG3 4DT2A 3CVCA 3ALXA 5KSUB 1PZUB 1T0MB 3P4MB 1AXTL 3ZL1A 3QRGL 4WO4A 1RURH 1DE4B 1MDTA 1FG2B 5DU7A 2AJ3B 2DW5A 2X6UA 1H9DA 2FATL 3HG1B 2Z3FA 4NZ8A 1B4RA 2NW2A 2R83A 1J05A 5K93A 4BH8B 2QFRA 4OF5A 3N41B 3X1GA 4TRPL 4DCQB 1AO7A 4J8RA 4JVPA 3IU3B 1M7IB 4OD3H 4XP9H 4B6ZA 1AQDA 1JNNH 3CFNA 4IOFD 4AMXA 4G5AA 1QYGH 1TTRA 2VDRH 4RFNC 3WJJA 5CGYC 3D39B 4X42A 4B0MB 1GS7A 2HT4C 4HUUA 2ICWA 4F7EA 2AHIA 5I1HH 2DYRB 4PJGE 3UZEA 1MCHA 1S7VA 5CSGA 4K7FB 2YKLH 2OLDA 4XHQA 1A4CA 2X70A 3N43F 2NT0A 3CUPB 4I0PD 1TJGH 4LLUB 1FIEA 1L6PA 1ZLEA 4RFNB 1MREH 2V7HA 4TUOB 3MAWA 4OGYL 3UMTA 4PV9B 4F15C 4AH2A 2CM6A 5GS1A 1ND0B 3VD5A 3BGAA 3HR5B 2I24N 4UU9A 2FECI 3BVXA 1B4JH 2EDXA 3B9EA 3CJJA 2J57A 3FTXA 5SWZA 3FRUA 1JF5A 2AJYH 3L1EA 5ABDE 2PWHA 5JHDA 1Q0YL 2BOCB 3SGEI 2HT3C 4UDTB 3POHA 1CFVH 4LAQH 1PZ5A 2JCWA 3QFJD 1A8ZA 1E4JA 4XPGH 5L88L 4H25A 1ZHNA 5E2UH 2VQ1B 4F15B 4S11A 2OK0H 2WKLA 4PMFA 3EYFB 4HPYL 4XN8A 5LCVH 1B0RA 1WCQA 3VRJB 4HULB 1MCKA 4N3TA 3RU8H 1C16B 1U95B 4JO1H 3MBWB 3T3MF 4EVNB 5SX5H 1G9HA 3FQRB 4Y16A 1FCGA 1S9XA 3WXWH 1G7HA 1I8LC 1QQDA 3SYCA 3MRCB 4RFOH 4RFEB 3EO1B 4Y9EA 3P73B 1KIRB 3GIVA 1KJ3L 4J1UA 5KYWA 3O3DB 1ZTXL 4F57H 4P9MH 3OZ9L 1GC1H 2I9LB 1OY3B 4TSCH 5LDUA 4QJ3B 5BRZE 3EYSL 4AQEA 2OYMA 3QC5X 5EBGA 2X09A 3NEEA 4M1CC 3RL1B 1RPKA 3NTCL 5L9DH 3N40P 2GABA 5AZUA 5MENE 1MPAL 2XXFA 4NO2A 1UJ3C 3QH3A 1CPUA 1HL4A 1A0QH 2H6OA 1IBZA 2RACA 3ZTJG 3WTXA 3F7QA 2WKGA 3HI1B 1Y6KR 2VXQH 1WRFA 3CLEL 3LNGA 3TVMB 3X3GL 2KLTA 2QTVA 3SSGA 1D5MA 3MRDA 4YDIL 1OF2B 4GW1A 4N25A 1KIPB 4JPKH 4MA8H 4QUOA 1JZGA 2ZP8A 3EYUL 4KHTH 4PJ5D 3U7YL 3GPSA 2GJZA 4M8RA 5ELIA 1E0OB 5C0BA 4RSVA 5AYQA 3DX9B 2R2CA 5CZKA 3SKOA 3GINA 2LW3A 3KLLA 4YHPA 3V5DB 2Z31D 2XKNB 3BUPA 3O8XD 4PWEA 5HP5A 4PWKA 3IJEA 3TBWB 1R46A 2WXOA 4A7SA 1HESA 4FFVC 4TVPH 3BAYA 3AXHA 2BIHA 5C7ZA 4WW2C 1I3GL 2O6DA 4P3DA 3ISYA 3EH1A 5DVKA 5M94B 4Z8FH 2BHFA 2DWSA 3MLWH 5DZVA 3JV4B 1S3RA 2X12A 2P28B 3PL6D 4W68A 3KDMA 3FU6A 3BESR 3U6XA 3O4LA 2QBWA 1KPVA 4PCKA 4J4PA 1U3HD 4WEBH 2NDFA 1JYNA 4QDGA 5LAPA 2D0HA 1NMBL 1VRSA 4WW2B 2EE3A 5IMKA 4XNZC 4R0LC 1SEBB 4NYLA 4KQ4H 1PMYA 3DMMC 1I7ZB 2UZYA 4P99A 1ZPUA 1ZVYA 2APXA 1NCTA 1OCZB 3FT9A 1N10A 4BA0A 3OWRA 2VWEC 2ZCHL 3MROA 3DSFH 4OZ4B 5I74C 4XNZB 3APDA 4F2MB 4Z7OE 2JB6A 4R0LB 4KKPA 4RBPK 4QGYA 1I9IL 3UGXA 4DH2A 5CR1A 1G9NH 4C83A 1QSZA 2G5UA 1ET8A 1OZTG 1A6WH 3DMMB 3K5SA 3MKGA 4WTQA 2BSTB 5EBWB 1D5ZA 1BX2B 3FOMA 4XVOA 4ZK8A 1PD0A 4FL4B 3IBOA 1DUZB 2AJUL 2WVTA 3NYKA 5I74B 1JNHB 2X5PA 4GMTH 3GBNL 3SD2A 4KTDH 3C6SA 3MUHL 2A83A 5BZDA 1KGXA 3VFPB 2E9WA 3WKNA 4TOYH 3CZUB 1AFVL 1CE6A 3MV8A 5I19H 1V7MH 4JFDA 4HUWB 5BQ7A 1VFOA 4PJGF 4PJ8C 5FA3A 4DQOH 4PJHB 3U79A 3FTWA 5KBMA 5CO1A 2XJLA 4L4TD 5KOMC 2VN4A 2BP3A 3GSNH 1Y1UA 3W9EB 2ZAHA 2BXYA 3S4SA 4CBPA 4OU3A 1A9EB 3S88L 3AT0A 3PDOA 1MHPL 1MLCA 2GJ6D 4XBPA 3NCJL 4L5FH 4N0FA 1T6WA 2BMKB 4K71C 4XGZA 5DMIH 5CLWA 1NWOA 4PJ8B 1O75A 3V6ZB 1U92A 2J56A 1J0YA 1T89A 3QZMA 4Z3IA 4MD4B 5AB1A 2DQGH 2QL1A 2IGFH 5I66A 4NRYB 5AUMA 4AL8H 4J3OG 4K5PA 5C6TL 4YZWA 4FOMA 3MUZ1 5AG8A 3GS7A 4JDEB 4XPBL 3BIKB 3O6KL 1EXGA 2EE9A 4K71B 3RWIA 1E7VA 3RVUC 4I77H 5E1HB 1XH2A 1J10A 4ZUUB 4YZFE 1N5YL 5G55A 2F5AL 3D4YA 4ZTPL 3LNDA 5L7XL 4LEXL 4UILL 2LE9A 2NYYD 3IDXL 1NC2A 2V8MA 3JV6B 4X5WA 4XNMB 3GSQA 2EKSB 1HZHH 3AJ7A 2VO5A 2E86A 5HVHC 2WKOF 4P49A 1EZSA 5HGGS 1KLFB 3DUHA 1VERA 3C08L 3QQ3B 4PJCA 1DSWA 2WXPA 4LEOB 3E3QC 4BK5A 4U6YA 1KIQA 3V0IA 1XF4A 2OMYA 2QHRH 4MXWH 3BIBX 3NACH 3X11B 4ETYA 2H1LM 5GS0L 4TTDC 4XWGL 4BZ1H 2GI0A 1JV2A 5ADPL 1YNKL 3SZKC 3QUMB 4F33A 1ODUA 3HC2A 5FFGA 5HVHB 1PNDA 4FQXC 2ZWNA 5C2BL 1H8OA 3FT4A 1EAOA 4F8TA 4KNSA 4OGAD 4EI5D 2ADJB 2BFVH 3WEXB 1EBPA 2UY7A 4FG0A 3I6LD 4UB0H 2APVA 1JZJA 1GCFA 1URLA 5I24A 4QYOA 1UT1A 2XY1A 2FWSA 1A5FH 4KK6C 43C9A 1BYNA 1RUMH 4BXVA 2BIIA 3HPJA 1S7QB 2IMNA 3PGFH 4MAZA 3W37A 1JXJA 1U8LA 2GW5A 2RGSA 1TSHA 2YAOA 4FQXB 3PP4L 4JM0A 4B5ZA 4BHUI 3IDMB 1YEKH 1G7JA 3D6GA 4JHBA 4EF3A 4EPSA 5BVJB 1KB5L 3V4VH 1J9QA 3TYGH 5JIHA 1HNGA 1YMMA 4PU2A 3ULVC 5LWYH 1VGEH 3ZDZB 3WBDA 2YUZA 1LEKA 4D0DB 5DEFB 3UH8A 3WFDL 3QFDA 3OG4B 4G6KL 1S9WB 3KH4A 1G7QA 4GXVL 2PW2B 4NC1E 2MKWA 4JM2A 2X2IA 5EZIH 4ZZFA 2F53D 4JAMB 4YIQA 3WS6A 4JFXB 2YMXL 3BDBA 3L3GB 1PKQE 4HKBB 4LRIC 1RZKH 5IJKA 1BGXH 4L1DA 5JLZB 4NCC2 5I2IB 5HDLA 2AJSL 4MYPA 5KSVA 3VFOB 2WMPA 2ZOKB 4X4XA 4UINH 5BRPA 1TCMA 2OJZH 4KDTC 4ZO6A 2A9NH 2G75A 4PS7A 2F58L 1E65A 3HAEH 2YRBA 3MRBB 2VXTH 5B39G 2DI8A 3MXVH 4KXBA 4X4ME 2Q2LA 4LQ1A 2X4TB 2P8LA 2EEBA 2WP3T 4FXLA 3UTQA 4ODUA 4BFNA 3JTSA 2VSDA 2VQ4A 3L3IB 3FOLA 1IKNC 4OLWH 3P54A 1TTAA 1NKGA 3BE1L 4L3EA 3VM5A 1FSKC 2MWCA 4IS6B 2D9CA 2E9BA 4Z7OF 5F9WC 4AJWA 5JR1L 2F68X 5C0FA 2Q0ZX 3BVNB 2IAND 2PPDA 5ICYA 4QRAA 4DIXA 5KN5B 1C5CL 3HNVH 4QTIL 2Y36L 3TT1H 3TYFB 5C6WH 1UA3A 3S5YA 5H35A 1AD9A 2H6UA 1JRHI 4YFLI 2I07A 1BYOA 3AUVA 3L3DB 5JA8B 1HVXA 4P9HL 5E4AA 4NQDA 4TKWA 4MHHG 5F9WB 1H6EA 1BEXA 4KX7A 1NL0L 4OFPA 4ABVA 4LBEA 4Q7DA 1FL6B 1ZLUH 1AKJB 1REIA 4LVEA 1CL7L 2YUXA 1WO2A 2NR6C 4HWZB 4X9HA 5C09D 2D3VA 3RY6A 4IBSA 1XGYL 4OJAA 1E5AA 2R69L 5HHVL 3OKMA 2FJHB 3AY2A 4JHAH 1KIUB 3U0WL 3VTMA 2VR4A 4DZBA 3MFGB 3Q8CA 4ABWA 5D1QD 5FECB 2WQSA 3I84A 1G87A 4OJDH 4NGHL 4OJCA 5BW7C 3GI8H 1MJJB 4AQZA 3DV4B 3T3PB 5AG9A 3AROA 2AKRB 3RGVA 3FZUD 4IM8A 1GYUA 5FYJH 3MPCA 3N44F 3PWJB 2V17H 4AIZB 3F83A 2ZXQA 4JG0L 4ZMLA 1HI6B 4IHOB 4I4WB 5HI5D 3WS3B 1Z5HA 3BAIA 3LS5H 4GQ9H 3W82A 3US1A 5I30H 2PETA 4JY5H 2XWBA 3RURA 5CJXA 4XRCA 1MJ7L 4FA6A 3KCPB 1JPSL 1CYWA 3BH4A 2YK1L 4YZFF 1I1FB 2ILLA 4YK4C 5IROC 3LIZA 1ZE3C 1BF2A 4U1JA 1LDPL 5DQDL 5E5MA 3P3TA 3WN6A 4J3OC 4LPVA 3HRZB 2NY1D 4XC1L 4PJXB 1BW8A 2HFEA 1JDAA 3MNDA 1UXMA 5DJXB 2DIAA 4FQJH 5D7JC 5E9DE 1S7UA 3CQFA 3EBIA 4JRXA 3WV0A 5B21A 5FO7A 4KKAC 1KB5A 3SPHA 3RUGE 3NFNA 2E27H 3S34L 4MQ7A 4YK4B 3QWNA 1GHFL 3CAFA 3GSRA 1F58H 1DBJL 1DP0A 2HXAA 2UWEA 4IGBD 5IQMA 4NN7B 2BP8A 1U8HA 4PIBA 2CBTA 5DA0B 2X89A 4OIFA 4M4PA 2VIRB 4JFZL 4JFPB 4WUUD 4K3EH 5JIPA 3TZVB 3EOBB 5D7JB 5EO0A 4POUB 1SOXA 5D5MA 4EN3D 2ZNXA 3FUEA 4XH2B 2J20A 5HGHB 2OMZB 5TDOB 4MNHA 3AADB 1QBBA 4NNYB 4WJKB 4P23C 4YUEH 2Y07H 2CPCA 1EHLL 1YQVL 3E2HC 4MA7L 5DJAA 2A6IB 1XSJA 1KTCA 1A7QL 3TX4A 5DMKB 2Q7YA 5F70A 2RH0A 1FO0L 3WHXB 2WNXA 2DRUA 2VLMD 1G6RL 2Q5BA 4P23B 4W9FC 5EOCL 2R0LL 1IZKA 2DQ6A 1JF1A 1A1NB 5CINH 3LKPA 1FYHB 3E2HB 6PAZA 5E99H 1R3IL 1X4YA 2UXVA 4PWHA 3B2XA 4E2OA 4R7XA 43CAB 4NHUA 5KUKA 4BSJA 4OFIA 3P9LA 1YYML 4K7PL 3G5ZB 4A7VA 2VERN 5DVOA 3QB7C 1CF8H 1TQVA 3AABA 3IDNA 3ISWA 4NB7A 3T08A 3QQ9D 3W5NA 4XPHL 1KLUB 1DVYA 3MJ9H 4TUUA 3CVHL 2EDOA 1KDJA 5E4IA 5EB9A 4F7PB 4YFDB 4E41D 1N7ML 3VXRB 4P5MA 1FFQA 3JWOH 5JXEA 3NJKA 1I1CA 1AO7E 1S7RB 2AJXL 1Z5LA 4ODVL 1RJLB 4LE8A 4YBLC 3O9WC 5IESL 4C56B 5AVUB 3DRQB 3TWCL 3WIAA 1Q94A 4WNQB 5ALCL 3LEVL 3SYAA 1IC0A 3ARUA 3Q6FB 3SPCA 1HXMA 1LE9A 1DBBL 4GSDL 1XIWD 5IVZB 4FMKA 2WZ5A 4GAJH 3MHZA 3MLXH 1TVBA 5LQBH 1Q8MA 4XPAL 4DKEL 2IG2L 3FO1A 4TLUA 1W0WB 1RD6A 3O9WB 3P30L 3LD8C 4YBLB 3TJHD 4J39A 3F7RA 1PSKL 3BMWA 3VXUB 1PVHA 1AE6L 1AY1H 1TQUA 4JDZA 5HHMB 4P2RA 3TN0D 2VKWA 4ZD3L 1YEDB 4JDVA 2FX9L 4GS7C 2W65B 4JR9L 4R4FH 3RIFK 4AE1A 5I1KH 5SWZE 3FTGB 3CVIL 4HWBA 3LD8B 5JHDE 4MJIB 5B39B 2QR0A 2JJSA 2FEEL 3HZVA 4GAGH 3O6LH 4R4ND 5EULV 1OPOA 2I7SA 3VXQB 3D3VA 4XCFL 2WXMA 3UGEA 4GT0A 1MFBL