4A68A

Mutations in the neighbourhood of cota-laccase trinuclear site: d116n mutant
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSNGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPORE COAT PROTEIN A
publication title The Role of Asp116 in the Reductive Cleavage of Dioxygen to Water in Cota Laccase: Assistance During the Proton Transfer Mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 147
structure length 502
sequence length 509
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A02
3OMNB 3TU6A 4YSRA 2I7SA 2UX6A 1ET5A 1WA2X 1NIBA 1WA1X 3FQYA 2ZONA 1J9QA 1GYCA 2BZ7A 1OCOB 1NINA 4GXFA 4NERA 4YSPA 3EF4A 1AR1B 4CSPA 2WO2B 3TBCA 4DPAX 5I6KA 5B7EA 1JZEA 2HX7A 4AZUA 1GY2A 5F7BA 2EILB 2QDVA 1PNCA 2YAHA 3AG3B 1ZIAA 1ZV2A 4DP7X 2VM3A 4N4YB 2IH9A 1PZAA 5D4HA 2N0MA 2ZXWB 3ABKB 5B1KA 3PLYA 1NIDA 2BW4A 1JVLA 2PP9A 4BXVA 2HX8A 1ZDQA 2QT6A 3MBWB 1RZQA 4GYBA 3PAVA 3SBPA 4M3HA 3ABGA 2QPEB 4AI7A 2DYSB 3T6WA 2PP8A 2Q5BA 7PAZA 1KV7A 3QJRB 1TKWA 4YSDA 2R7EB 4G71B 4UANA 1ADWA 2WSDA 4A66A 1JZGA 2TSBA 3FSVA 5TK4A 2FT7A 4NAJA 1R1CA 4YSTA 1ASPA 2TSAA 4HZ1A 1ET7A 1L9SA 3NT0A 1SHWA 2YXVA 1JERA 3FU7B 4W1TA 1CURA 5I6PA 1L9OA 2CJ3A 2HZHA 4DPCX 1IKOP 5B3SB 2GBAA 2FJSA 2XV3A 1ASQA 1OE3A 4GP5B 4A2DA 3ASNB 1E5YA 1AZUA 2GIMA 3WKQA 4Q8BA 4AKOA 4YSEA 1CYWA 1FA4A 3H56A 3UAAA 4G7RB 2BO0A 1J5CA 3CZUB 3AW5A 2VW7A 2XV0A 3NSCA 1PMYA 5B1JA 4YSCA 4E9RA 3NSYA 2DV6A 2GB2A 2H3XC 3BQVA 2EIMB 2XXFA 1AS8A 1GY1A 2JXMA 2UXGA 1ID2A 1NWOA 2X88A 2IWKA 1W6LA 2IWEA 2XUWA 4YSUA 3QJQB 1RZPA 5I28A 1GW0A 2BZCA 3NP3A 1J9TA 1JOIA 3HEIB 3QPKA 3AG2B 2FTAA 2VM4A 3NYKA 4HCIA 1RCYA 3QJTB 4KO6A 1I53A 1RKRA 3NSDA 3NJHA 1JZIA 1JVOA 1KCBA 3OMAB 4UAHA 4KOBA 3AY2A 2VSMB 1X9RA 4HHWA 4KNSA 1AZCA 3FYIB 2NRDA 2PPAA 2ZOOA 1J9SA 2XX1A 4BWUA 1UATA 4A2EA 3WIAA 3FQ2A 2IDSA 1IC0A 1NTDA 1WS8A 4G7SB 1WAEA 1AANA 1BXVA 2PPEA 1V54B 1NWPA 2Y1AA 4PAZA 1B3IA 3EH4B 3IN0A 1E30A 4KNUA 1BAWA 2YAQA 5B7MA 1BXUA 1NIFA 3X1BA 1HAWA 3CVCA 3BVDB 2VSKB 4E9VA 9PCYA 3X1NA 1M56B 1KGYE 1E65A 2UXTA 2VN3A 4GP4B 5I6NA 2CCWA 1J5DA 3ASOB 3S8GB 3ERXA 1BYPA 3X1FA 3NJLA 2BHFA 2H47C 3EH3B 3FYEB 4EF3A 3WKPA 1JXDA 2FT8A 1EZLA 1GS7A 3QJVB 1MZZA 5I5MA 2VMJA 1L9QA 3SBQA 3FU9A 3QQXA 3UAEA 1BQKA 2QPDB 3FSAA 4ZK8A 3EH5B 3UABA 3S3BB 1AAJA 2CBPA 1W8EA 1WS7A 2DYRB 2P80A 3NJGA 3AZUA 4WTQA 1ET8A 2FT6A 2PCYA 3DKHA 1PZCA 1M9WA 2PCFA 1ZDSA 5B7FA 3X1EA 1QHQA 2J57A 4P5RA 4MFHA 5E9NA 5FC9A 3DIVA 3UADA 3U25A 2A3TA 4DP8X 1XB6A 3AG4B 3GDCA 1SHXA 3MX0B 3NP4A 2XV2A 3TBBA 3CDZA 3X1GA 4KNTA 2IDUA 3FQ1A 4G70B 3PAZA 2VW6A 2I85A 1KBVA 4DP1X 3GYRA 3N2JA 4KO5A 8PAZA 5I6LA 5AFAA 2MTAA 3QJUB 2GHZA 1SDDA 1TU2A 4AKPA 4A2GA 1GSKA 4E9TA 2BWIA 2BP8A 1V10A 2W8CA 1KBWA 2GI0A 2JKWA 2WO3B 1DZ0A 4KOCA 2HXAA 1ZIBA 3AG1B 1CUOA 1OV8A 5I26A 6PCYA 2AFNA 1OOWA 1L9PA 4WKXA 2X87A 1HAUA 2XXGA 2PPCA 1A65A 1NPJA 2XLLA 4RH4A 4W9ZA 1E5ZA 2Y69B 2AVFA 1W6WA 1PCSA 2OV0A 3V9CA 3FT0A 4YSSA 2DWTA 4N8UA 4ENZA 1JXFA 4JKNA 2UXFA 5TK2A 5A7EA 4YSAA 1A4BA 4F2FA 7PCYA 4DP4X 2GC7C 5AZUA 1QLEB 3NJMA 1KDJA 3KW8A 1SFDA 2YAOA 3IE9A 3ZDWA 2XVBA 4QKTA 2Q9OA 2BWDA 1AG0A 1T5KA 1XMEB 5I6MA 2BW5A 2EINB 4FA7B 2E86A 1KDIA 1KCWA 1TEGA 3CDZB 3NJFA 3JTBA 2HX9A 2J55A 1AG6A 3ABMB 4DP9X 4F2EA 2AANA 5I5IA 4QLWA 1ILUA 3FU8A 1AS7A 4UF7C 2GC4C 3V9EA 1BXAA 1SDDB 4BK5C 2HLEB 2J5WA 4E9SA 2YAPA 1M57B 3TA4D 2BP8B 6PAZA 1ETJA 5I5JA 3L45A 2W88A 1MG2C 2XX0A 1AOZA 5AKRA 3H4HA 1XB3A 1JZJA 4P5SA 2I7OA 3IEAA 5I6OA 1JXGA 1A3ZA 3D12B 4M4RB 3FS9A 1NZRA 2IWFA 3CVBA 1PNDA 3OM3B 3QJSB 1QNIA 2RACA 2UXVA 4E9YA 1WA0X 3NJIA 3NJNA 4E9XA 4YSOA 1BQ5A 5LDUA 1ILSA 4KO7A 2YAMA 4X4KA 4DP5X 1NDTA 3X2QB 1PLBA 1DYZA 1NIAA 1PZBA 3C75A 4Q89A 4HCFA 3SQRA 3WG7B 2FQGA 1EHKB 2YXWA 3T6XA 1AIZA 2XU9A 4GP8B 1FFTB 3HB3B 1BYOA 1IBYA 4TXVB 3ZIYA 2PPFA 3ZX1A 2OCCB 2MRYA 1KYAA 5ANHA 1PY0A 3RYMA 1L9TA 4HHGA 3S3CB 5IY5B 3EHBB 4KO9A 1YLBB 3UACA 1VLXA 1TEFA 1V55B 1GS6X 3T9WA 3JT2A 2YQBA 1ASOA 4CSZA 5EHFA 2UX7A 2YARA 1JZHA 3H4FA 4BWTA 1HFUA 3S3DB 1A8ZA 5PAZA 2CAKA 4YVNA 4DP6X 4F7KA 4A2HA 1FWXA 2HRHA 1OE1A 3PPSA 1GS8A 3ABLB 5D4IA 1J9RA 1E67A 2P80D 4BWWA 1MDAA 2XYBA 4HIPA 2IDFA 2PPDA 5B1BB 3T71A 2BP0A 4AKQA 1SNRA 1CC3A 1MG3C 3FPYA 3DTUB 4HALA 2FQDA 4DP0X 3OD3A 3UGEA 1SJMA 3TASA 2LLNA 2CALA 1OF0A 2FWLB 4YL4A 2AZUA 3T6ZA 4A2FA 4YSQA 3FPXA 4E9WA 1IUZA 4G72B 5D4JA 1AZBA 2EIKB 2GSMB 5F7AA 2PLTA 1OCRB 4A67A 1PF3A 2YAEA 4BDVA 2IAAC 2OJ1A 1MZYA 3CVDA 3WI9A 1OE2A 2FQEA 2DWSA 1OCCB 1A4AA 3S8FB 3GXUB 1SF3A 2QDWA 1SF5A 1F56A 3CG8A 1A4CA 1BEXA 3WNIA 3FSZA 1IBZA 2CUAA 3IN2A 3SBRA 2VW4A 3OMIB 3IBOA 1X9UA 1ZPUA 2B08A 4A68A 2H5UA 4DP2X 3G5WA 1OCZB 2IDTA 1AZRA 3N55A 3NJKA 3NSFA 1JZFA 4K9JA 5B1JC 1PLCA 1AACA 2EIJB 3NJJA 2PP7A 2DY2A 2IH8A 4BXSV 3T6VA 3ZBMA 1BQRA 1L9RA 2ZWNA 4DPBX 2HRGA 2R7EA 2XWZA 4HCGA 4G7QB 3PXLA 1AQ8A 4L0PB 4JHUA 2J56A 4NB7A 4FAAB 4GY4A 4YVUA 1URIA 3FU7A 1SFHA 1NPNA 4AX3A 1AZNA 2FNWA 2BP0B 5PCYA 2B3IA 1N68A 4PCYA 3PAUA 2YAFA 5B1AB 3PCYA 4HAKA 1PLAA 1N70A 1PAZA 4E9QA 2IDQA 3WNJA 1AS6A 3FSWA 4JHVA 1GR7A 3OQRA 1XB8A 1NIEA 2AZAA 2FQFA 2JFCA 1NICA 1CYXA 3KW7A 4BDVB
chains in the Genus database with same CATH superfamily
1S7WB 5I76A 3UAJC 1IKFL 1DANT 1ET5A 1MFMA 3ESMA 4HLJA 3UP1A 2WYHA 5EIVA 3BFWA 1HHGA 1A3LH 2ARJQ 3FQYA 2PWFA 5JPNC 3VO0A 2EXSA 1AR1B 3Q1EA 3MRJA 3WLBB 4U6XB 1UD2A 1A2YB 4OM0L 4S1RH 4PJ9A 5E94A 1OGAA 3QDMD 4PJBA 1BAGA 5KUMA 2Z7ZA 2B1OA 3FQXB 1P53A 1FGNH 3VSTA 2VO5A 5A16A 4BXVA 4JAMB 4LQFH 5LN8A 4AQOA 3PWPA 4LCYA 4AYBA 2A38A 4GYBA 1TJMA 1W80A 3GO1L 1JPEA 3PWVA 2JCCE 5DMIH 3GS0A 5FHAL 3RA7H 3RPIA 1JZGA 5HD8D 3RUGA 4QJ5B 1ZSHA 1R1CA 2QFPA 4TVUA 1WLHA 4S1QH 5E5RB 1IKOP 1G0YR 1EANA 3GB7A 3L95A 4EAEA 4EIGB 4YL9A 4YDKH 1LE5B 1QTYT 1TJHH 2XV3A 3HG1D 5EF0A 1WIOA 5DJXB 4FQPA 5ILTL 3BIKA 4ERSH 3ZE1E 4C58B 3DUUB 1VJSA 1DQVA 2AK4E 2W07A 2NCMA 3FTSA 4UU9A 3FSOA 3U7AA 2QKIA 2VKWA 3KPLA 5C6PB 5JHDA 2IQ9L 3C5ZA 3O6KH 3ZHNA 3ARPA 4L5FH 3D39D 1Q94B 3FQUB 1RMFL 1AOHA 1CDIA 1EDQA 5SV4A 1IZKA 5E8NA 1GZPB 1FZOB 2G9HB 4X4MA 1XD0A 1FN4A 5F0PB 5AG8A 4WSGA 3AITA 1BEYL 4BFEA 1A1NB 4ANWA 4C55A 4LDOB 1JTTA 4XTRD 3AS2A 2Y36H 3HI1B 4KZDL 2WPGA 3J07A 4UT6A 3BD4A 2BZCA 4MZRA 3OZ9H 1HIMH 4L8SA 3MRNA 3BUQA 5C0ND 4OJFL 4MJ2A 4PYHA 4AQAB 1K6QL 2EICA 1U9KA 4ODUA 3DK2A 3UJIL 4HUWB 1H0DA 4ZPTB 4NZRL 4R4ND 3ULUH 2EDYA 3H9HB 4KK6C 3VQLA 2IQAB 3SDAA 1QSFB 3OR6B 2IANA 4GFTB 1LE9A 3NZSA 4NZDA 2PPAA 3OZKA 2RIKA 4AQ8C 3GNML 5HHXH 1HILB 1CFNB 1IFHL 4HPHA 4IBYA 3REVB 2RA1A 3CFCL 1AXSA 3CXHJ 2VERA 2IOOA 1M7DA 5D6CB 1S9YA 5ALCL 1DQJB 4UQ2B 5EU4B 1CXLA 3FF7A 3FO9A 4AZ8B 3AS1A 3APFA 3GRWL 1UXSA 1U8CA 1G9MC 4ZZKA 3HAEH 3LKRA 1Y18A 2PO6C 2OYKA 3I50H 4KPHL 4AJYV 4KVCH 2EE2A 1Y1DA 2GJJA 2PW2B 3ORJA 1MW0A 2CHXA 2NQDA 1E65A 1IAMA 5E4AA 2VL4A 1D5XA 5D1QC 3QISA 2IOIA 3U0TB 5FA4A 3X1FA 4ETQA 3NJLA 5L2KE 2DB8A 4QRUA 2H47C 3EH3B 3IDNA 1YC7A 3MV9E 4HH9B 1JXDA 3OAYK 4WI2A 4F7TA 2I25N 2IG2L 4TLKA 1JHKL 2G5BA 2H0JA 5F21B 3US9A 4EN3A 2F58H 3ME0A 1YCSA 2VMJA 4UYPA 3NCWA 4MQXD 4MKTA 2FYVA 4RX4A 1QRNE 3ECBB 3HMWL 4U1MA 3U7WH 3W57A 4A1RA 5KOMC 3KGRA 4D8PB 3I9AA 4XODA 2JJSC 2IO5A 5BO1L 1L6ZA 3FUKA 4N0YL 4HGWB 3BN9D 2ZXBA 1YEIL 3UYRH 1R5VA 4HCRL 1DBKH 1I8KA 4L4TD 2MCMA 1TJIH 1XGUA 4NUJA 1H8LA 3AZUA 5T5FL 5A2BA 5KYUB 3O81A 2H7WA 3BHBA 4HZLB 4XXDA 1JNJA 5DGRA 5IUCA 4KTEL 2VDPL 1UM4H 1PD1A 4X8GA 1AGFB 3C6LB 5KTEH 5HYIA 1NSNH 1UYWL 1T83C 3D50A 1Y1UA 3MRQB 2GCYB 2BCMA 2YK1L 3IJ9A 1ZHKA 3FQ1A 5BUPA 2X4NA 3KM1A 2F54B 3EBHA 1BD2A 3G6AA 3DMMA 1VPOH 1U8OB 3Q2NA 2QR0B 2VWEE 4Q6IC 3QR1A 3G5ZA 3G5VA 3VGBA 4HVBA 1QP1A 3EGDA 3NUKA 4PG2A 3RQ3A 4LRIC 5D6DA 2ZOLB 2GYSA 1OTUC 2IGTA 5HYQB 2HPTA 3ML9A 4G9DB 1L7IL 2IH3B 4K7PH 3DXAB 3LY6A 1HCZA 1KEMH 2VAAA 5E2UH 4UAOC 3QJXA 1F4HA 4YX2L 3QI9B 2J8HA 2A6JA 3L3DB 3DBXB 1JCVA 3LVTA 2P7TB 5EZOH 2DWYA 1OOWA 3K80A 4KK8D 5KS9A 4JFTA 1A3LL 2D7TL 2DQMA 3L7FB 3GMRA 1ACZA 3FTUA 3LNEA 1CXIA 5JQIB 4BUQA 5EO0B 3MRGA 2VISB 3QDGE 2AXJA 4F2MB 1W6WA 3Q44A 4MQSB 4S1RL 1WBZA 4L8DA 3L1GA 4CADA 1CQKA 3LRSB 1FGNL 5D9SA 4YXKH 4TUJA 1GHFH 5BS0A 2Q86A 4A7GA 3OKDA 1ZEAL 4R2GD 4LQFL 5KBPA 1GW6A 5AZUA 3ARDD 2EVIA 5HHOB 1L9NA 2F53D 4O51A 4L0ZA 4H26A 3BWZA 2BOLA 4B3EA 2XVBA 1L0QA 4QKTA 4OZIF 5DMIL 2KZKA 1XMEB 3C12A 1WO2A 4DERA 4OLEA 4D9QE 4GLRH 1N8ZA 1ACYH 1Y6MR 1MJ8H 4PJEF 1JZ4A 5AZEH 4NS0A 1YY8B 4MS8C 1ROCA 4YDKL 3ECWA 1RU9H 3VXUB 1TJHL 1UZ6E 4LVNB 2BIMA 4WI0B 5DJ2B 2FX9H 5C0EA 3QNFA 4K5PA 3Q5YA 4K2UH 4ERSL 3U4AA 4HSQA 2YQ3A 2YAPA 4K94C 4WF7A 4DT2A 2Y5EA 4WUUD 4OFQA 2K45A 4Y4HC 1GPOL 4QRPA 5A2LH 5IJCC 1CGVA 5LAPA 1D9KA 3ROOA 1DJXA 4XNXH 3N40P 1B2WH 4L5FL 1VCAA 3BIBX 4L9DA 1QR4A 1KCKA 4AGNA 1BOYA 3K5RA 2P24B 2HH0H 5IBUB 4EQ3A 1NEZB 3VG9B 4ZQKA 1RLBA 5C0AD 4AYDC 1SEQH 4BIKA 2HAZA 1KT2A 3FN3A 1DFBL 4HJGA 3TEYA 3DV4A 4G8GA 2Y36L 4JRXA 3V5DA 3VI4A 4PGDA 3DUHA 5FFGA 1BQ5A 1EZSA 3OZ9L 1AXTH 1JGEB 3QEHA 5FYJH 3SSGA 3TL5A 4ANUA 1KEGH 3UOAB 1I3GL 2Q7AA 1IQWH 1NGZB 3QAZC 4LCWD 3IDGB 3S4SB 2ZCZA 2D7QA 4J6RH 1PZBA 4MD5A 4L05A 4UTBH 4KI5C 4W6XB 2CO1A 3LXBA 2V9UA 3ULUL 3RY6A 4UZUA 3QJHB 3BZDA 2AEQL 2ERJB 5DHVB 1FG2B 3BCFA 1IEBA 1YO4A 4XO8A 1AE6L 5DVNA 1FYTD 5HHXL 3K91A 3OKLA 3UGXA 3QWOA 2EH7H 1Z9NA 2NY1B 4L37A 1IKNA 4X8JB 2P5WA 3OGCB 4GSDL 2BY2A 3EYOA 3E3QE 4ABQA 3UXFA 5CD3A 3T0AA 2UX7A 1KULA 3BEVA 3WY3A 5F9OL 5JO5A 3C8HA 3UH8A 3MGOA 3VFGH 5AALA 3LDBC 2J1XA 3ZDYB 5IHUH 2IMMA 2ZKYA 4YFLI 2AQQA 2WWMC 3TN0A 1TTBA 1UOVA 4NHUA 1QSED 2OP4H 4GUOA 1NOLA 4QHNA 1S7UA 5AOJA 3D0VB 4N2FA 1U3HA 4KVCL 3I9PA 5IIEA 4OGAD 5HDQH 4APQC 2IDFA 3ZRSA 3OKMA 4RMVA 3EXLA 3MLZL 4KZEH 5SWSA 4EIUA 4PJHA 5DD1H 1A7QH 3UGEA 2DQDH 4XVUC 2YS4A 4GI6A 5BW7C 5IFAH 4KROC 3MC0A 5HDOA 3MRBB 5FX3A 3U46A 5FDYA 1OLLA 1U8HA 2VDNH 3WUZA 4JDVA 3IGAB 3NABL 3SGEH 3IDYB 4K3GA 2XT1B 2Y6SD 4X6EB 1N64H 2CO3A 4AGLA 4XMPH 3THMH 1OCRB 2FE0A 1QFOA 1F4AA 4OFDA 3W9EA 1S7WA 4QTHB 4X6CE 1AHWC 2B2XL 1TTFA 4S1DC 4U1HB 4QY8B 4WGVB 1ZLDA 5A3IC 2BNUB 3QIUB 2E7MA 4JFFB 1LVEA 2OMVB 3L7EA 4HUCA 5F7EH 5AW1B 4FA8A 2B5IB 4WI9A 3C60B 2B77A 1J8HB 1OCWH 1RJYA 1SF5A 1X5GA 4J3OC 4HLEA 4U6XA 1OT4A 1A2YA 4HJ1A 4PS3A 1X9UA 4A68A 1QLRB 2CZNA 1K4CB 2X6AA 1P7QD 3ATAA 2VR9A 4ZS6D 1TG8A 1E7VA 3FQXA 1DQQB 3KZ8A 3WY2A 2ZT9C 4JAMA 4NC2B 5I1HL 5DHYB 1NSNL 2VSDA 4NAQA 3VW3L 5E6IB 1Q9OB 3ZYZA 2V5RA 4ADGA 5H35A 5E0QA 1IL1B 1VPOL 2CHZA 3PXLA 2VITB 3AXIA 3CLFH 2BVUA 4KX9A 4FAAB 2J56A 3B9VA 1RK1B 1RZKC 2EE6A 3O3DB 5KEZA 3RY5A 3V0DA 1BG1A 3CU1A 1LE5A 4XVSH 2MEJB 4WW2F 5L4FA 3KMDA 4PCYA 5E2UL 1MWAB 1WHPA 2LAAA 5DJXA 3RVTD 4LSVL 4E9QA 2CBQA 3DUUA 2IDQA 5EZOL 1KCRL 4K5LA 4JHVA 1FCCA 2F2HA 1TJGL 1D6VL 4FJYA 2J25A 1JPSH 2H3KA 3PJSB 4X4XB 4Y2OB 4L8CB 4MA1B 3W0WE 5CLYA 1Q94A 3ILPB 2KERA 2UX6A 1GZPA 2KPWA 3COOA 1FZOA 2G9HA 2Y5QA 1C5BL 1EXUB 5TE7H 3DX1A 1EO5A 4HOZA 3PP4H 2APBA 5E1AB 3VUAA 2WWNA 1BWMA 1A1NA 4YXKL 2H41A 3O2DH 3SBWA 1GHFL 3X13A 5DC0A 1Q72H 3F7PC 3HI1A 2WYIA 1JPTH 4BBWA 3VWJD 3M86A 5DQ9B 4KHTL 5I71C 3WLWC 5IUSA 5J8OA 1FFQA 4G9FD 5TH2B 3FCSA 3JVGC 2JELL 4HHAA 4NQCE 4DESA 5IFJB 3EYQD 5D5ME 4AQAA 3IYLW 5JXED 4MB4A 2Y24A 3MFFB 1JK9B 2WN3A 2I60H 3ML8A 4HUWA 4FADA 4ZPTA 5CILH 4H0IA 1ACYL 3MODL 2IQAA 1MJ8L 3SCMD 1SY6A 3OR6A 1T6BX 4PY8I 3ARVA 3BZFB 5F72S 2OL3B 5E6UB 1RU9L 4Y5VB 3H42L 4Y4FB 2FX9L 3JBG7 1BVNT 1S78C 1ASPA 1QFPA 4POYA 5DMYA 1ET7A 4FKKA 2KH2B 5HGAB 5EG6C 2YKKA 2ZYSA 1HILA 1CFNA 3TJHC 1T5XB 2OK0H 4CILA 3REVA 4K3HA 4ZQTA 1ASQA 4K7PX 5D6CA 4U3CA 1DQJA 5EU4A 1IQDB 1B2WL 4AZ8A 3Q43A 1WP6A 1N0LB 3SJVB 1QYGH 1KCVH 4NQUA 3KGUA 4EO5A 4YLBA 3RWFA 4K8RL 1SEQL 2L7JA 3GPEA 2LLLA 2X05A 3ZE2B 1BDYA 1QA9B 2PW2A 4RAUB 1JGIA 3F7YB 4H4NA 3Q9QA 1TOXA 4OCWL 3U0TA 1DVUA 1AXTL 3NSYA 1GSMA 4WEUD 3ETBJ 2G3NA 2ZKMX 1B3JA 4QXUH 2FWSA 2D3VA 1IQWL 4HH9A 5AOIA 1NWOA 2K1MA 4JFXB 1S5IH 1WCBB 4UTBL 2BIOA 3MACL 4MKMA 5FFLA 2EO9A 3ECBA 5DO2D 2J88L 4D8PA 1J12A 1JDDA 2VLRB 4HCIA 4N2NA 3AXHA 4CMHB 5EU7C 1X5FA 4HGWA 5AYQA 4HD5A 2EH7L 1AH1A 1AYRA 1S7XB 1U8KA 3S3PA 1I1CA 3ZL2A 2A1WL 5KYUA 1JZ5A 1OGAE 4PJBE 4HZLA 1KJ3L 3WS3B 5AVUB 1UATA 1UH2A 2QQLH 5L4IA 5DRXB 1B88A 1AGFA 2CRIA 3C6LA 2XVGA 3PWPE 3IDIB 4NC1E 4G7SB 2C7FA 2AK1H 2GCYA 2WXJA 4UOW1 3T2OA 5C97A 2D9CA 4RA3A 1V54B 1QBMH 2Y1AA 2F54A 4AJ0A 2WQXA 5I1EH 4E41D 1U8OA 1S9KC 2QR0A 3S0PA 3RUGE 4KZEL 5DD1L 1XAUA 3WTWA 2L7UA 3P0VL 2C9AA 2VWEC 3CVCA 2ZOLA 4ZX3A 4M29A 2WZAA 3FOMB 2VDNL 1NFDB 2UXTA 1HC1A 1MUJB 4G9DA 3CD4A 2IH3A 1FBIL 2H9GB 3DXAA 5IKCB 4OTXL 4JFED 4XMPL 1IVTA 3QI9A 4N2OA 3L3DA 3DBXA 2P7TA 1R3HB 3BAXA 2AQTA 3P0YL 5HDLA 4URTB 5BV7C 3L7FA 4Z0BH 5JHDE 3SE9L 3FUIA 1HE7A 5I5MA 1JPFB 2Y07H 5F7EL 4ZNEA 4G5ZH 4HC1H 2JMRA 1OCWL 1CXHA 2F8VA 1G5GA 2VISA 4RAVB 5EO0A 4F2MA 3TVMD 2WBJD 1MKFA 3B5HA 4ZOBA 4CVZB 5DMGD 4H0GA 4X4ME 1YUKB 3GRBA 5ITFB 4Z7OF 4AEIL 4LSTL 4NIKB 3IU4H 1O0VA 2DQ6A 4NQQA 2EXWC 1IBHA 3LRSA 4G1MA 4NQTA 1CCZA 1FHNA 1KYOJ 4M8RA 3H53A 3TZVB 5FHBL 2JKIS 4AQEA 2YA0A 2ZTBA 5HHOA 1R4XA 5C0BB 1ZDSA 2ARJB 1RZJH 4NQDB 2WNWA 4P5RA 3DX2A 3FB6B 4DKDC 2Q8AL 2FATL 4PS8A 4JKWA 2WB1A 3X1GA 2WAQA 4JFHD 2IANE 3RL2B 1Z5LB 4PS4L 4M7JH 4ZFOA 1YY8A 3QAQA 3TCTA 3DO3A 4MS6A 4WI0A 4XOEA 3GK8H 2XA8H 1G1OA 3BCDA 3KYKL 2V2WA 2B7DT 1ZGLB 2XG5A 4M5YH 4OKDA 1DHKA 2BWIA 3TH3T 4F93B 5J13C 1W2KT 2QVTA 5F89B 1KBWA 1NDGB 1U0QA 4KOCA 3KVDD 5L6YL 2OCJA 4F20A 3VMPA 3DV6B 5DEZA 3P3SA 1OV8A 3U30C 2P24A 4B9GA 1NEZA 5TE7L 1SN0A 5F7DA 4F9PC 1SXZA 4OCXH 5ICYB 3BQUB 4RGOH 1EQWA 2XLLA 2V2TB 2CCLA 3HNTH 5EV7A 1JPTL 4DF9A 4F58H 3SKNB 3E2HB 2ZWZA 3MRIB 5TDNB 1JGEA 3EBIA 5C09D 3S35H 3RBSA 1NGZA 1P6AB 3BPLC 3GQFA 3O4LB 3IDGA 5CKGA 3S4SA 4YSAA 5BOZG 1CDGA 4DP4X 3HC4L 3KLQA 4LLYB 5H37A 4XVJH 2C4XA 5DJCA 1U2CA 2KHAA 5JMOC 3H9SD 1AQHA 4UNUA 2PXYC 3QJHA 2ILLA 2XA3A 3KPTA 2V5YA 1E4JA 5DHVA 4P46A 3N04A 1FG2A 4AOFA 2ARWA 5FW7A 3C08L 1FFOB 3B7YA 3BAEH 3H85A 4X8JA 3WHE1 2AANA 4NKIL 2HT3D 1IC7L 3D51A 1VGEH 3OGCA 4ELKB 3OWRA 3VU2A 4P2OB 1AS7A 3B3BA 3V9EA 5ACZB 3E1F1 2GTZB 3IWVA 3GIZH 3Q2VA 4N68A 2KQMA 4NNXB 2NY6D 3NACL 2KYIA 2IPKB 3GMMB 1QYGL 1KCVL 2GT9B 3O6ML 5H4ZA 3U0WH 2LVEA 5DSCA 4QJ4B 1IRAY 2OX5B 3D0VA 1HT6A 4LO9A 4OBSA 3BMWA 1EWHA 3LIUA 3QULB 1BD2E 5LNDA 5AEAA 4RWHA 4HU8A 3C6SB 4Z7VF 1MI5B 4QYAA 5F7MC 3NZHH 5LB1A 3VG0H 1EFQA 5C9KA 3MRBA 5C07A 3HLAB 4PJEB 4PVMA 3NEXA 4F9LC 3UTSE 3IGAA 1CFSB 3HI6H 4G6JL 3ARBD 1I9EA 4X6EA 1Z66A 2YMXL 4OF8A 2C9SA 3MKGA 2PR4H 3IJEB 3VSQA 1OAKH 4QTHA 1D7FA 1FZMA 4YGAB 4U1HA 5KS9E 3AUVA 4QY8A 3G08B 5AOLA 1FAIH 5EORL 1E27B 1MAKA 2BNUA 3QIUA 4Q89A 4JFFA 4GIOA 5EUOF 2R23B 1MH5B 2OMVA 5T8IA 1H3XA 3T6XA 1GTFA 1J8HA 1ZHLB 4ZUSA 3D33A 4JO1H 4CVWA 4YC2B 2HJFB 2BM3A 2UZIL 3ZIYA 1QLRA 4YNYA 4GOSA 1UCBH 2J43A 4XAKD 25C8H 3ZX1A 3ARGC 1XR8B 4L2YA 5BS0E 4EN3D 2HFGL 2LTQC 4MB5A 3MRRB 5GGQL 4RX4D 3HN5A 4KK9D 5IBUG 5JXAH 5DHYA 1NEZG 2FD6L 4D94A 4WHTB 4XCNA 5E6IA 4X80H 1Q9OA 2LHAA 2O6CA 3HRZB 4PLNC 2VDPB 3WIFB 4JO3H 1QBML 3QH3B 1IL1A 4JFDB 5I1EL 1WAPA 3Q1SH 5GGTA 4H25B 4JE0A 4M03A 4I4WB 1F02I 2VITA 1DVYA 1NGQH 3S97C 3UFIA 4YXLH 3ABLB 4Q0XL 1QI5A 3S3JA 3OLDA 1RK1A 4IU2B 3O3DA 5DUJA 1EHAA 1WYJA 4R5TA 3S4SG 1AP2B 1CC3A 1MG3C 5H37G 3C87A 3DVIA 1MWAA 1OQOA 1KFGA 3TV3L 2VQUA 1XCQB 4MA7L 2D4FA 1CLZH 3LNIA 1JF6A 5I17A 3VB9A 1XEDA 2KDGA 4QRPE 5ESQB 4Z0BL 1R3JB 3VRJB 4PWJA 4X4XA 4Y2OA 3PJSA 1IUZA 4L8CA 2Y07L 5D4JA 1ZHBB 1TSRA 4NENB 2CPCA 2Q3AA 3WDHA 3QDJD 2X9YA 5FKPB 4DFHA 5L9DH 5MI0C 2DWSA 2WOYA 1EXUA 4F3FB 1ZLVH 3F6IA 2ZX6A 3P3RA 4N1CA 5AQ0A 5E1AA 3ZZSA 2AAVA 3FFCD 2ZUSA 1TZGH 4G8GE 1DVSA 2MIZA 4RAHA 1XXFC 4JRXE 3VI4E 3GSUB 3FSZA 2G4EA 2XWBB 5DQ9A 4AW7A 2X2UA 2AEOA 1C5DB 2MKWA 5IFJA 4LCCB 1PLCA 5F9WC 4CMMB 2VUOA 3MFFA 4Y16C 1FNEB 1NBQA 2J3SA 4K3EH 3RZCB 1HX0A 1OL0A 4D9LL 3VD1A 3R1GL 4J8QA 2X41A 5IB3A 5F6HI 4M7JL 3U0PB 4IK6A 4WGWB 4Y5VA 1HNYA 4Y4FA 3GK8L 1ZK9A 5EZIH 4HK0B 2VMEA 3CXHK 3MRPB 4NB7A 5GS0D 1KWKA 4TSCH 5HGAA 2ICEB 1SFHA 1T5XA 2P5WE 4A38A 4DVBB 2Y5TB 5FO8B 3DSFH 4GSQA 2NY3C 4M5YL 4L18A 4ODSH 2EXTA 4MDRA 4ATTA 4FG6C 1KXVA 3RWCA 1IQDA 4BFOA 2HYMA 2CU9A 2F08A 1YYLH 2FEDC 4X7CC 2H0FA 3SJVA 3D9AH 3UAJD 1OT1A 3EO9H 4PU2A 2NZIA 4OCXL 4PB0H 4QKXB 4D0BA 3DX6B 4NKDB 4RAUA 2QADC 1OB1B 1QFUH 3GSXB 4JQVA 4RISH 3F7YA 5DHXB 3RPBA 4NO5B 4HPYH 3ECUA 3OMNB 5SWSE 4M6ML 4ZO7A 4PJHE 4F58L 4JRFA 3EGXB 4RFOH 1QEWB 4OF6A 2EO7A 2ZJSH 1LJMA 4GAJH 1SM3H 3KR3H 5FEBA 4I0PB 1JZ7A 3AU0A 3DA0A 1OCOB 1NINA 2DQUL 4YAQB 3VGAC 1D9KD 4KKAC 3W39B 3K6FA 1OP3H 3AB0B 1NFKA 3WBDA 4WW2B 3KPMB 4ZBJA 4LHUB 2YD2A 5AB0A 3PJLA 3BH8B 3ABKB 4Q56A 2ADFL 2VIRB 3CQFA 2JKJA 4XP4L 2HX8A 2QT6A 1UACH 1RZQA 2H2SD 1SQMA 2J5LB 3BAEL 1ANUA 1A21A 1AJ7L 2OZNA 1BF8A 3Q8AA 4KVNH 1S7XA 4YLQT 1VGEL 1XGRB 3GS7A 2DEXX 2R7EB 3FO0H 2AQSA 1HS6A 1IGMH 3QEGH 4YFDB 4PJ9C 2OR8A 5IBTH 3GIZL 2J73A 3WS3A 2HT2D 4ELMF 3PAYA 3KEHA 3PUCA 5J5EA 3CDFA 5DRXA 2FBOJ 1CURA 1L9OA 1E5BA 1SJEB 2W9EH 2FJSA 4B97A 4G7YH 3ZDZF 1MCIA 4JLRB 4A2DA 4NC1C 4X98B 2VUKA 1U21A 2HTLC 4UQCA 1AZUA 2GIMA 3DO7B 4TSBH 4XVTH 3QWRA 2OW7A 1IB5A 4XNZB 1OSYA 3VG0L 3BOVA 2XQBH 3TNMA 3DTXB 3FOMA 5CSZB 2ZOKB 1NFDA 1NCDH 1TQCB 4FFWC 4K5NA 1MUJA 1QHPA 4FYTA 2H9GA 3AJ7A 3SHSA 5IKCA 2XWXA 1HYRC 1FZKB 2O72A 3AMLA 3HI6L 3G5XB 2PR4L 1R3HA 4MX7B 3S35X 1FAIL 2IWEA 4JQXC 4YO0B 4UINL 2ED7A 1JPFA 3WTSA 2QKIC 2RH0A 3KPSD 3QS3A 4KK6D 4PRHA 2ZYRA 3DYOA 5IF0B 1F4XH 4RAVA 4XPTL 2EE3A 1XF5B 3WNOA 4CVZA 3EH2A 2QGBA 5FR3A 2WXPA 4FLRA 5D7KD 5ITFA 4GEIA 3NJHA 25C8L 4E42B 1OP5K 2K70A 1IAOB 4XCYB 1SVZA 1VEPA 4KY2A 2A77L 3DC0A 3FO1A 1TKWB 3MOQA 3MRMB 4Y9FA 3SY0B 5JXAL 3KWUA 1SVCP 3ISWA 4X80L 4NWTL 5C0BA 2ARJA 2A83B 3EYUL 4NQDA 3GHBL 3Q1SL 1MQKL 4L8SC 2V5TA 1LK2B 2PO6D 2KDYA 3INOA 1UC6A 1OXYA 1QSFE 4HJUA 1B9KA 1NFAA 1VFOA 3RL2A 1Z5LA 3SDAC 1E30A 4UMSA 2YD3A 3GJFH 5HHPB 4H2AA 5CS7A 1BXUA 1NIFA 3CZEA 4NCDA 3ZYOA 1TTAA 3HCVB 4IDLA 5EMYA 4ZX4A 1ZGLA 3RI5F 2YA2A 3BH9B 3GLEA 1HOEA 2CCWA 2I27N 1YMMA 1OPGH 5F89A 4ILDA 5ADOL 4M7KH 1NDGA 5IMMB 5IBLC 5CIPH 1T03L 3J7HA 2VLKB 1A6VH 43CAB 1T0NB 4CC1A 2LGNA 3L9BA 4QO1B 3DV6A 3MJ8B 3SGJA 3WKPA 4KKBD 5DJZA 1NFIA 4WI3A 3QJVB 5HHMD 3UYOD 5ICYA 3ETBF 3BQUA 1QNZL 1TZGL 4K07A 1E50A 3KPRD 3BISA 2OMUB 2V2TA 4J3XA 2X4UB 3BUTA 4ZK8A 3UBGA 4QXWA 2P1YA 3SKOB 3SKNA 3F64A 4N8VB 3B2DC 5K59F 5TDNA 2NTFA 4GO9A 4GT0A 4JEGB 3GUFA 2NT1A 4FNRA 4LBAA 3O4LA 4RRPA 3CVIL 1OSPL 4AUYA 1WSST 4LLYA 2CWRA 3DKHA 4CC0A 4QHUB 1HH6B 1M1XB 2NXYC 1A0QH 1LLAA 1UGKA 4XN7A 1HOCB 2ZKXA 2Z3FA 2HLFD 1SLVA 3FHEA 3AG4B 4B9YA 3X12B 2JKLA 3TBBA 1FFOA 1JGDB 1GOHA 3DI3B 3N1PC 2HKAA 5HI5C 3FO2A 4G70B 2EEFA 3SKMB 2VC2H 4ELKA 4P2OA 2ATAA 2VRKA 3ENEA 4Y5YC 1T1WB 4QNPE 5ACZA 4Z7OB 1RV6X 2GTZA 4PMFA 5E2WH 1CI3M 4YS4A 3ARRA 4Z7UF 4NNXA 1D5IH 1QRKA 2JI3A 2IPKA 3GMMA 3D9AL 2GT9A 2OQJB 3D2UB 4JZOB 3EO9L 3STLB 2OX5A 4PB0L 4JMXA 3UBFA 2GABA 2MJWA 3GRWA 4WGKA 2F54E 4XPHH 1QFUL 3QULA 4HPYL 1ZIBA 2G60H 4OZIA 5CBAA 6PCYA 2VDLH 3ARED 3QK0A 4RFOL 2IBZY 3C6SA 1MI5A 4X0NA 3DX3A 1JGLL 1H3WM 3KR3L 1OP9A 4E36A 4YHPB 1FFPB 4RH4A 2Y7OA 3CHPA 3HLAA 4PJEA 4KNQA 4HIHB 3DXAE 4W6YB 3V2AR 5KSUB 1CFSA 2ODIA 4OLZH 2Q8BL 5AYUL 3B8YA 1KB9J 1JYXA 4ENZA 3WFBL 3HBQA 3IJEA 4TNWK 4WO4B 5E99H 4X5XB 1T7YA 5DD5L 5BQ7B 2EVGA 2EVJA 4F2FA 3AMKA 4NCC1 1KCUH 1PS3A 3G08A 3ZT5A 1OM3L 3Q6FB 3LB6D 4CN1A 4P3DB 2R23A 1MH5A 4ZNEE 4Q14A 4DAGH 4NJ9L 4KVNL 4F2ME 1ZHLA 2ZUWA 1NANH 2HRPL 3ZZQA 4LOUD 4OV6F 2HJFA 1AG0A 5HGDA 2DDQH 3FO0L 4MS8D 1FCGA 3G6DH 2VRQA 2BIQA 5C9JB 1IGML 3MDJA 3QEGL 4HCRA 5IBTL 3QNZA 5M7QA 2B16A 1RPUA 4LSUH 3S88L 1AG6A 1NUDA 5AKSA 5TDPA 3ZQXA 3MRRA 5T5FA 2W9EL 3HE7D 1MCOL 1WBXB 2GC4C 4G7YL 4WHTA 5HHOE 3HRZA 3WIFA 3N1GC 5FGSA 3QH3A 2IFGA 3LRKA 2DKMA 2MOVA 1T4KB 5GIRA 3TT1L 1Q0XH 4H25A 2WYZA 3ZKXB 5FF6B 4TSBL 4XVTL 2VMCA 3IMTA 4I4WA 3RTQA 3UO8B 6PAZA 3IMRA 1DLHB 4B50A 4H7VA 4WEEA 5T3XH 1BWWA 4IU2A 2G3MA 1NCDL 4RRPG 3S34H 3VXUE 4EBQH 1AP2A 3TO4B 1NCNA 4APXA 2V8MA 2N0KA 4P4RB 3ZKMD 5I6OA 4PP2B 4OFVA 3GXDA 1XCQA 4NPKA 2VDNB 4AH2B 4N9GB 1XWVA 1QNIA 2DZEA 2UXVA 1NKRA 4MHHI 5ESQA 3SGKA 1R3JA 1JG9A 3RP1A 3VRJA 3VXSE 5KANG 4RGND 5ECJE 2HA1A 2MNWA 4GQRA 1F4XL 5IQ9B 4NENA 1JNHB 4NZ8A 2VERN 4KRLB 5FKPA 1A6TA 1OT2A 1ECYA 3O45B 1I3UA 1X4XA 5KVFE 4AQZA 1ITCA 4F3FA 1B4TA 2WCSA 2BNQA 4F33B 5DC4B 2FQGA 3DDGA 2YKLL 3HS0C 2GSGB 4TV3A 4YBHA 3MRFB 2YJLA 1DR9A 4DVRH 2V9QA 3GSUA 5D70L 3QI9D 2XWBA 4TXVB 3H2QA 4JM2F 4Z7VB 1W0WB 1CLYH 3P02A 1C5DA 3K1KC 2C4FU 4K9EC 4LCCA 1EDYA 2WWMD 4CMMA 1HQRA 1CL7H 1TEFA 1AMXA 1FNEA 3IFOB 4PCTA 4XBPB 4Z23A 5ID1B 3RZCA 1QBAA 2LU5A 4IM8A 4H44C 3SGDH 3RVUC 3ZK0A 2MNUA 3V4PH 4TL5A 4APQD 2A74B 4MA3A 2VDOH 4P3CL 3U0PA 4ZOCA 4FNSA 3RY6C 4P5TB 3SDDB 1CYGA 5CZKA 3VCLB 5LLIC 3MCYA 4HK0A 2F8IA 4XVUD 5DC2A 3MRPA 1DJYA 1USZA 2A0LC 5D4IA 5EUOB 3FULA 3WDJA 1E67A 1G6RL 4IOIB 2ICEA 5FO8A 3LN9A 4DVBA 2DQTH 3AT8A 2Q6WB 3C09C 2YOAA 1R3KB 3QRBA 1IKNC 3EJUA 5IHHA 3MZTA 4HALA 1OPGL 1EHLL 3POCA 3RI5K 4HK3N 3RVXD 2BWQA 1Z0MA 1K3IA 3B8SA 3L3GB 3ZDYE 1A6VL 4NAMA 5HYJB 5MHSD 2YEVB 2ALAA 3QRFM 5A3ID 4X5LA 3WUWB 4YSQA 3TN0C 1JF1B 4HKXA 4XXCC 3DX6A 1KELH 3GTNA 3BESR 4NKDA 1MJJB 2XBTA 1OB1A 1U3HC 3GSXA 3Q8BA 3SPHA 4R4BB 3WTYA 4NO5A 1S4IA 1KN2H 3I3BA 3EGXA 3O0LA 3BUPA 4G5AA 2V33A 3O8XB 1FL5B 4I0PA 4YAQA 4JY6B 4JRYD 1WZ1H 2YFOA 1I8LC 4FE9A 1BEXA 3W39A 1HXYB 4ODHH 3SBRA 4M7ZC 3BZ5A 1DSFH 4WW2A 1ZPUA 3FOLB 3KPMA 3D3VB 4LHUA 4Z5RB 1E4XH 2O1AA 3SE8H 4ANVA 3DJRA 1A0QL 3QUZC 3CZJA 3BH8A 3F7QA 4N0UE 2APFA 5B1JC 5IREA 2VIRA 3KM2A 1N6UA 2CMRH 2DBLL 2Z4QB 4AQ1B 2QHLA 4JFFE 1BQLL 4PJ8D 5ANMB 3A3YB 3OXSB 4UTAL 3RIKA 1KPVB 1ZS2A 2E7HA 3GXTA 3OGOE 3TX4A 1J8HE 1L4IA 2DQEH 1I8MA 1XGRA 2VC2L 1IE4A 2GY7B 2NNAB 2R7EA 4GRLB 3WFDH 1OANA 3ZRFC 3CZSA 3IKKA 4IKNA 4KY1L 4OY9A 4KJWD 1BX2B 3VGEA 1SJEA 2BP0B 4L1SA 5CUSL 4W9GC 5EZLB 1S7QB 4LLDB 4L1HA 4JLRA 4P46D 5D7JB 2WBKA 3TBVB 4X98A 4IKLA 5D7LB 1S3KH 1AS6A 2VDLL 3DO7A 4FXKB 1L0PA 1AD0B 1T7WA 5FLUA 5FYKE 3T3MF 3MCLL 3T3PF 1NIEA 2OS7A 4IW4C 4B0MM 1I85A 3DTXA 4H8UA 5CSZA 1WF5A 2WM0A 2ZOKA 1AKJB 2ZP0T 2XI9A 4XCCH 3TU6A 4ODXA 4K7FB 4GXVL 1EZVY 1FZKA 5GGSB 3QCUH 1VEMA 1TVBB 1CE1H 3WLWD 3PUUA 4NERA 4MX7A 1ADQH 3TV8A 5EF2A 4EVNA 3G3LA 4YO0A 4YDNA 1LMIA 3V0GA 2HFEB 2YAHA 5LJYH 2X89A 3C5SB 2JV6A 1NC2B 5GZNA 4YPGB 2CNZA 4OT1H 5AVXB 3RNQB 4B9ZA 5IF0A 1NGYB 5MP6L 1XF5A 2DDQL 1KYOK 2E74C 3WY1A 2AV1B 2FIRT 2QGDA 3QCVL 5C07D 2AQ2A 5CINH 2YD4A 5CBEA 5HP5A 5CP3A 1S78D 1IAOA 1A4JB 2E7BA 1P9MA 2MPAH 3DRTB 4XCYA 3TJHD 1R9FA 5GRUL 1TKWA 3MRMA 2IPUG 4BSJA 3SY0A 2Y7QB 3VMNA 1QWUA 2D7MA 3QPQC 5D8JH 4NRXB 2TSBA 3VFPB 3QUXB 5IVNA 2A83A 3QEQD 1JERA 5I6PA 4MJID 4HF5H 3MREB 2ZKHH 7CGTA 3LZLA 5BZWB 5AOKA 5IJKA 3EDFA 3PIQB 3N3EA 4DN4H 5C0CD 2Z6FA 3D2TA 5I19H 3S34L 4EBQL 1E5YA 4A7SA 5HHPA 3WIHL 2EABA 5IEHA 1FG9C 2A4EA 1WGVA 3EKCA 3OMZA 1BM3L 4LHUG 5J6GB 2O6DA 4QXTB 3HCVA 1RZGB 5AB2A 3L81A 4PCKA 3PFUA 4M5TA 4S0SD 2K9FB 3NSCA 3BH9A 3FQTB 2PYED 3TT3L 5IMMA 1VFMA 1K5NB 1V7MH 3P9WB 2AQRA 2VLKA 2DIAA 2WGNB 43CAA 1T0NA 4ELMB 3SJVE 2ENQA 3W2DH 2XYCA 3MJ8A 3PV6B 4QO1A 2KZWA 1PKQB 2XPZA 3HHMA 3ZE2E 4YSUA 4Q9RH 4I18B 1CB4A 2W0PA 2NY2D 1Q1JH 2OMUA 3QPKA 2DD8H 5LG1A 4EJ1C 4DVRL 2X4UA 3SKJL 2WBWB 4X6DF 3SKOA 3OHXB 5L2JB 2NQCA 1QSZA 4HUNB 1FZJB 3HAEG 2AMUA 5G2NA 3S5YA 1CL7L 1BM7A 1TYEB 1U36A 3PHQB 1AGCB 1NQBA 2APVA 1NLBL 4TF4A 4KVPA 4PYGA 4QHUA 1HH6A 1M1XA 3SD2A 4W9HC 3BKML 4HIJA 1RD6A 2VLRE 4JN1H 2VDOL 4N0CD 4A2EA 1PIGA 1BIHA 1HOCA 3AVEA 4OM1L 3WIAA 4D0DB 5L0QB 5I1GL 5CNHA 3X12A 2W80C 4OZFH 1E3ZA 3AQZA 1JGDA 2BNRB 3Q01A 4C56D 3SKMA 4J12A 4JS7A 1DL7L 4KK5C 5FV1L 1WZAA 1IIKA 2CLRB 1T1WA 3ARSA 4M3KB 4R97B 3JUYA 3MTXA 5IK3B 4FI7A 1DCLA 3SPIA 2H2PC 4PBVC 2E4TA 4U31A 4PGZA 3BVUA 9PCYA 3QUYB 3HB3C 2OQJA 2YN5A 3D2UA 4JZOA 3KCPA 3L3KA 1I75A 4EE2A 1E4KA 2CK0H 3STLA 1UA7A 4BK8A 1K4DB 4R8WH 3ERXA 4FFZH 1VFAB 1KN2L 5DMKB 2VZ3A 5DVLA 3TM6A 4R7NB 4PGJA 4WFEE 5K39B 2DIEA 4QAWA 4EIZC 1U91B 1I1AB 4MJHA 4YHPA 1NFDE 1VFUA 3FB5B 1WZ1L 4XNQB 2XQYA 3FU3A 4HIHA 4NFDA 5IB1B 4ODHL 3UABA 5KSUA 1CXFA 1DSFL 1B0GA 5LN4A 1HHKB 3VRLF 3SE8L 5IQOA 5KYXB 3EJYC 1ZT4B 5BQ7A 2A9BA 5CZVL 1IM3B 4UTBA 4TVPE 1VIWA 2WVUA 3CDGB 2CMRL 3FFDB 1GKEA 5FPIA 3Q6FA 1K85A 1J0JA 4P3DA 1C5CH 4J3UA 2NZ9C 3NIFB 1H6UA 1TT6A 2WUBL 4Z6AT 2NY4B 4NHCL 4XCFH 1MN4A 4IRJB 2GK0B 3O3EB 5FC9A 1ZV5A 4ALAC 3BWUC 4GIPD 3U25A 1BBJB 5C0JB 1SJHB 2DTMH 3I3DA 3ES6B 4ZXBD 4P48A 3SO5A 2IDUA 2AKRB 1VA9A 3TA3C 3AADB 2FWOA 4YUEH 2QVMA 3UMNA 4YHML 5FGRA 2DAVA 4R90L 3O11B 1OB0A 3GYRA 1F42A 5C0BE 4AWJC 5I6LA 4L0YA 4NQDE 1EFXB 5E4EC 1U8QB 2BXYA 2F68X 3K3QA 4UB0L 2X42A 4YK4B 1LWHA 4A2GA 4YHKH 2YD1A 4N8VG 4ANKA 5FUZL 1BA9A 3RX9A 3FFOA 1E4WH 3DGGB 4JVUA 4MAYB 2WO3B 1PY9A 1OARH 2CGRL 3O41B 4XCCL 1RP9A 3V8CA 1FNLA 3GGWB 3TO4A 1YRKA 5JOPD 1MSPA 5E1QA 4P4RA 3QCUL 4OFIA 4LVNC 2BSCA 4PP2A 2X87A 4WWPA 3TEXA 4LSSL 4PGCB 3LKSB 4AH2A 4N9GA 3I6LE 3PXJA 4W9ZA 3FH5A 4PJXB 3VD5A 1PCSA 1TMCB 1BHGA 4N8UA 4OT1L 5HDBB 5TK2A 2YMOA 5IQ9A 1J9CT 1JNHA 3UZEA 3O45A 3ARFB 1WIUA 3AQYA 4F33A 2GSGA 2MPAL 4KMLB 3F6LA 3MRFA 1ZMYA 3P9LA 4JO5A 4I3GA 4GJTB 4F80A 5CJQL 4OGYH 5IVXB 3IDJB 2IWGA 4Z7VA 1UD4A 1W0WA 2C9XA 1KCWA 4PV8B 5DVKA 3T0XA 4DO5A 3O4LE 1FNGB 3HMXH 4YXHL 1KNOB 5L7XL 3DNKA 1KLUB 3ZE0F 3GT6A 4PTUB 4PRHD 3HW7A 4QLWA 1KFAH 3IFOA 2ZKHL 4QDGA 4XBPA 5ID1A 4UF7C 2AXFB 1NBVL 3DSNB 1MCWM 3MLWH 3U9PH 4DN4L 3QRLA 1KGCD 2A74A 1TXKA 5I19L 1YQVH 4KXZI 1M2VB 2XQYG 3HE6B 4P5TA 3SDDA 1IVLA 3L9RB 3TA4D 1ETB1 3VD2A 3Q8CA 4PLJC 4YBQC 5EUOA 3HS8A 3CBJB 4IOIA 1DQIA 3IMSA 3N6YA 4LF3B 2Q6WA 3WL9B 3NQKA 1R3KA 1ZWIA 3HOGA 4GBXD 1JZJA 4P5SA 2AEPH 1V7ML 4FCAA 1ZLUK 3MLVH 5HYJA 3IKCB 1NH6A 3W2DL 1C7TA 2BIIA 3PNRB 4XO5A 2GBUA 5KVGL 1SOSA 3WUWA 4BCZA 4E9XA 1JF1A 3GD1C 2NPLX 4X4KA 1MJJA 1W8NA 3JT0A 1Q1JL 3MUUA 4LZKA 5GJTH 4R4BA 3T2NL 1MCQA 3QORB 1MI5E 5F3FA 1J88A 2BLFA 3DUSA 4B41A 3MUY1 3O8XA 2O61B 3W37A 5EOCH 1FL5A 3O3UN 3QJFB 4PJEE 1A3RH 3ARXA 4PB9H 4JY6A 4WSKA 1YMMD 1EHKB 4X9HA 3X11B 4WWKD 1AIZA 4Y4KB 3MU3A 3SE4A 3NJXA 1RSFA 1HXYA 5CEXB 3QGVA 3QXAB 1UUNA 1MW3A 3IGKA 2FWUA 3FOLA 3IDYC 1CTNA 3D3VA 4Z5RA 4LP5A 2DM7A 2VH5H 3HC3H 4Y9GA 2YPLD 3KHOA 3HBPA 2VXQH 2Z4QA 1NGPH 4AQ1A 2WC7A 2ED6A 4XB7A 4XXWC 3SOBH 3GBNL 2Y7SA 5ANMA 3OXSA 3QIUC 1KPVA 1JZHA 4X5QA 5KSAB 1ZVNA 2B5IC 2NNAA 3D85B 4GRLA 3C60C 4QGTA 3CZKA 5C08D 4TNFA 4PRDB 1MFEL 1LO5B 1X6NA 4MXQC 1NCWL 4JJHA 1CVRA 2XY1A 1BX2A 1RUMH 5JQHC 3FONB 1G4MA 2PPDA 1B6UA 4JPWL 2BP0A 4LU5H 1J0KA 3V4UH 4PJIB 4R8WL 1S7QA 4LLDA 4FXLA 4FFZL 5D7JA 3T4YB 4JFDE 1S5HB 3TBVA 1KBKA 3BXNB 3MV8D 3PJNA 4RNRB 5DJ8B 1MCNA 3I85A 4DUVA 2BVPB 4BJLA 5D7LA 1TENA 1EBPA 2ZUQB 3TONA 4FXKA 1AD0A 2YZ1A 3CXDH 5E9AA 1SGKA 1AZBA 1NCTA 3JV0A 4X9GA 2W0LA 4HKBB 1QBBA 2P8MB 1AKJA 3B56A 1HHIB 3KDMB 5EU6B 4JGJA 4K7FA 4XPBH 3PRZA 4PWEA 3DHUA 2AXHA 1IAII 5GGSA 1GC1L 1TVBA 3TS8A 2BFVH 3HZYB 2F19L 4C59B 2G5RA 3D6GA 4OF3A 1UASA 3RKPA 3EJSA 4Y16D 5IZ7A 5ITBH 1BMZA 1ML0A 2F1BA 3DROA 1C5CL 1GGBH 2A9MH 3T65B 4EIBA 2HFEA 1UOKA 4N8CL 3C5SA 1NC2A 4YPGA 1C7SA 1KTDB 3IBEA 4MA1C 5F9DC 3LXUX 2EE0A 1NGYA 3RNQA 5A2IH 4XCFL 2M8XA 1O7VA 2AV1A 2PP7A 2DY2A 4P2CG 4P23A 5T3ZD 3QP3A 2Q7NA 4PJFF 1L6PA 1A4JA 1MCKA 3DRTA 5J89A 4TQEH 3MR9A 2NY3D 1EAPB 4X7DC 2V2XB 2Y7QA 3S7GA 3VQ1C 3WUWG 4G7QB 4KFZC 4NM4H 4NRXA 3VFPA 3QUXA 1TZHB 2E9GA 3U1PA 4AGQA 4B7IA 3I02B 4N0RA 3BX7C 3KS0H 5D2LF 5E8PB 2VB5A 4GIAA 3MREA 3DWTA 5BZWA 3LNDA 1E4WL 3PIQA 2CDGB 4TTDC 2EYTB 5B1AB 1WD9A 1OARL 5E70A 4LVEA 3VFOB 5CJOL 1KF9B 4P2AA 2Z1KA 1RHFA 5EBWB 4Y5VC 1QFHA 3V6ZB 3B2VL 1X4ZA 2WLIB 5J6GA 1PZ5A 3P73B 3WYRA 4QXTA 1RZGA 3GBMH 4MXVF 2EO1A 1CYXA 4JUTA 5B8CB 4LOFA 5KZCB 4MRBA 5E4IA 3FQTA 2VLME 4HFUL 1K5NA 1KXVC 4ELMA 1ZCRA 3RTQD 1FRGL 3EF4A 3PV6A 2IPUK 2X0VA 1BQHA 3NSXA 4JQIH 2O6PA 4HEMA 4JBSA 4L5FE 1VB9A 4I18A 4KV5F 4GUPB 5AAMC 4QGYA 4ZYKA 2CNYA 2ZXWB 4JQVC 4NP4H 3GIVA 5CU9A 4Z7NF 4OGYL 1U92B 1JVLA 3WMSA 3DVGB 2H4EA 3OHXA 3T3MB 3EG9B 3H7BA 3LS5H 2CM6A 1FZJA 3LHPH 3HMXL 3BH4A 1II4E 2R56H 2Z7UA 3E6FB 2PP8A 3QJRB 3GZQA 1KFAL 2XTJD 1D5MB 4X99B 3PHQA 4OCLC 2NSXA 1AGCA 5EO9B 1P4UA 3FSVA 4J3SA 4MMZC 3U9PL 1DJZA 5EZPA 5I0ZA 2BNQD 4D0DA 3TYGL 2CJ3A 3ULUE 1OAUH 3OXRB 4CMHC 2NX5B 3QNXB 4PRPB 2BNRA 3F12A 3D48R 4U3SB 5SX4I 1A5FH 2NLJB 5TQ0L 3GJFB 3BPNB 4N26A 5KJRH 3O3BA 1TFHA 2EYRB 5IK3A 3T04D 1G6RB 3MLVL 3T1WA 3RZCD 3H3BC 5IGXH 3QUYA 5G55A 4HJ0D 4UNIA 3UO1L 4CVXB 1K4DA 3KJ4B 3O0RH 2CRZA 2E9IA 4XHJD 1VSCA 1VFAA 3QFDB 3PWJB 5CHNB 5DMKA 2F61A 4POZC 5I15H 1CFVL 2IWKA 4R7NA 2XUWA 4FTVB 5GRJH 5K39A 1L9MA 2MCAA 4DZBA 3T0EB 2NXZB 2P46B 4UT6H 1I1AA 1KB9K 3NP3A 1H15A 4PB9L 2DOCA 1QLEL 3HEIB 2J1WA 3FB5A 4XNQA 3DVNB 5IB1A 1VACB 3NYKA 2JLPA 2PYFB 5D1XA 4DGVL 2VOTA 1I53A 3EH1A 1HHKA 4R0LB 3ZOAA 3B7TA 5KYXA 2VH5L 1JZIA 3BDYL 1ZT4A 1HL9A 2Y6TE 1IM3A 5AW4B 1BJ1J 2ZG3A 2K4WA 3CDGA 3FFDA 3VXOB 2Z35B 1LXMA 1X9RA 4PIRF 2EDTA 4HHWA 3SOBL 3DRQB 5DZOA 3FYIB 3LXAA 3ZN6A 3QSKB 2ZOOA 3MUGB 5LXGH 1ICTA 3UTOA 3CN4A 2I26N 3Q2CA 3UC2A 3UZQB 3QO1B 2WY3B 4AVHA 4IRJA 2GK0A 3O3EA 4ANXA 3H8NA 3L5IA 1BBJA 2P4AB 2IDSA 1SJHA 4YGVA 4HKZB 3ES6A 1KIUB 3EYVA 4LL4A 2VC2B 2AKRA 4HJTA 5I16B 5SWZD 4JL1A 1GIGH 1RUML 2OTUB 1T0MB 2CRYA 4PAZA 3EXJA 3EH4B 2IADB 4LU5L 1LO0H 4A2MA 1YYCA 3TZVC 1SPDA 1BAWA 1F6LL 1TZOA 2ZOWA 3O11A 2XWDA 3RX5A 2OSYA 2FNBA 2R0ZH 1EFXA 1U8QA 3MOAL 4KMQA 4KKLD 4OD1H 2CJSA 4AM0Q 4KMTL 2UZYB 2E5EA 3F7LA 5J12C 4B6ZA 2VMFA 3DGGA 3WE1A 3MBEB 3DLQR 2NT0A 4MAYA 1MW2A 3IFPB 4KFMA 2YJQA 2ZYIA 4L4JA 2VDLB 3O41A 2ID5A 1DQDH 3HFML 5CM1A 1JRHL 3GGWA 4OD2B 5I0WA 5JOEA 4A6YA 1X7TA 4PGCA 3NA9H 1OGSA 3LKSA 4N3UA 3EDJA 3FU9A 2VTFA 1USQA 1RERA 2FHCA 5I18H 3ET9F 1JCKA 4KRPD 2VXSL 2VLKE 3WDIA 2EEXA 3HBZA 2WXOA 1KGIA 3S2CA 3ISYA 4C47A 4CBPA 2X4TB 3MYJB 1W8EA 3ARFA 3SGJC 3ZR6A 3CLEH 3VI3F 1DZBA 1MFDH 3CNKA 1ET8A 3NDZE 4OFYA 4WTQA 3VRIA 3PQYB 4FD0A 2D0GA 1U58B 1N10A 4JVPA 3RGBA 3BQUC 3QPXH 1Z9OA 1TZIB 2BOCB 5IVXA 2E7LA 1R19A 3IDJA 2ZXDA 5CJXC 3KVPA 4ZRGA 3E2HC 4U1SB 3RFZB 4JG9A 5AVYB 1KTJA 2FCBA 2VZUA 1BIIB 1FNGA 4CU7A 1KNOA 5AVVB 1KLUA 1J10A 1UB5B 5ES4B 2XTSA 2NY0B 3JWNG 1ES0B 2I85A 4PTUA 5DF0A 2GBTA 2AXFA 3LH2L 2R83A 3DSNA 2WK2A 2QELA 5AFAA 1N26A 4FG4A 3RDTC 3FCTB 2GHZA 5HDRA 1FV1B 5CWSB 4KX8A 1T22B 1M2VA 3F05A 1JAEA 1GA2A 3HE6A 4EKXA 3L9RA 5I5RA 4RDQG 2BSTB 3LQAH 1JUFB 4X5PA 3CMOH 2P3YA 4XH2A 1KPUB 1CQYA 4NP9A 3GBML 2APSA 3U9UB 1SZNA 1YC8A 2CM5A 4LF3A 1KN4H 3QDMB 3WL9A 1BZ9B 4UI2A 3RWJB 4Z7OE 5HXMA 1C8PA 3IKCA 4GKOA 3PHAA 1GOGA 5D55A 5AVZB 1XF3B 4JQIL 1UWYA 2A6KB 2C9VA 5FO2A 5F7LB 5HVWA 3I6GB 1A4KB 2P28B 4Q9BA 3PV7A 3RVWC 3QORA 1IILE 3HPLB 3EUUA 3J27A 3NTCH 5GS0H 1FL3B 1CBJA 5JUEH 4AEEA 5HYSB 1KTBA 2O61A 3QVAA 4BKLB 3CN3A 2JTYA 3QJFA 3LHPL 3UROR 5IESL 3HG1B 1NAKH 2CO2A 3X11A 4Y4KA 4IIQB 2CJUH 4U6TA 1XIWD 3V6FB 4DKTA 5CEXA 1G87A 5GGVH 3QXAA 4Z77B 2XV6B 2P8PA 1A6PA 3KL0A 3JQOB 2IALB 4D3CL 5EU3B 4DUXA 4JM4L 2DJ4A 5I5IA 2WINB 3L5JA 1I1RA 4JGUA 5C3TA 3MAWA 2X53A 3D39B 4N85A 2BRQA 3JWOH 3H2WA 3S9DB 2VDOB 2W81C 5JYMA 1KY6A 2V17L 1HU8A 3F7VA 4CDHA 3QYMA 5KSAA 1FVEB 1YUHB 3D85A 4N25A 4KJYB 2YGQA 1MJ7L 3CSBA 5KBKA 3L45A 1VDGA 2QQNL 4G7VH 3FONA 1YJDH 3KJ6H 4QEGA 2W0KA 1XGZA 4PJIA 3VWKC 4RSVA 1GZHC 1RPQA 3MGAA 4JM2A 3IEAA 2X1OA 3APMA 3N91A 3T4YA 1J7VR 1S5HA 2BVTA 3HRZC 2QPUA 3N1FC 2OR9L 5E7FA 2DQCH 3ZE0B 5KSBF 3QCTH 5GRJL 3MJWA 4NUMA 1PLGL 3VH8B 2W0FB 1KJ2H 1WWCA 2BHZA 4HKBA 3NJVA 4DP5X 2P8MA 1BVLB 5EU6A 1HHIA 3KDMA 1PLBA 3RWDB 1EXHA 5FGCB 2BCKB 3CU7A 3MROB 4F15B 4AL8C 3P11L 3QZNA 3NQIA 4FL4B 5I23A 3HZYA 5A1AA 4L3ED 4G3YH 1OZTG 2BINA 1BPLB 2XU9A 4AYMC 2V3DA 1LL1A 1SDYA 2DM3A 1NL0L 5CZXC 3V0WH 3SGKC 3T65A 3FUMA 2AI0L 3E9TA 4YR6B 1KTDA 3K4AA 1DVZA 4MSWB 2KC0A 3GSVB 4TUOB 3IETA 2CE6A 3B1TA 4RGMC 3V95A 5LWYH 2XZQH 3PDGA 2A0LD 4Z3IA 1GIGL 1Q9LB 1F1GA 2AERT 1M7UA 1EAPA 2V2XA 4XC3H 4DIXA 4Z7VE 3RLSA 2EEBA 2AGJH 5AKTA 1TZHA 3BPOB 2R0ZL 3I02A 4P2YA 1JFHA 5I0DA 1T7XA 4OD1L 1NMCB 3BSZL 2QTVA 3T0VA 5E8PA 3OVUB 3L3OC 1HXKA 3SDXB 3S3SA 3DTUB 4TL4A 2CDGA 2EYTA 1XTLA 1YVLA 3TPKA 1S7SB 3VFOA 5JIDA 1DQDL 5F70A 4LSDA 2B20A 3L2MA 5EBWA 3RG1C 3ZQ9A 5EUOE 4L4TB 3V6ZA 1WFNA 4R4FH 1Z3GH 2WLIA 3GSOB 1WBYB 3NA9L 5F7AA 2P44B 1SHSA 2H8PB 3MLYH 4S0TD 2X4OB 5B8CA 3MXWH 1SQ2N 4M48H 5I18L 3HI5H 1T6WA 4NWUH 2VZOA 1HJCA 1LO3H 2A9DA 4TLUA 1CDCA 4XN5A 4KTYA 2CPUA 4LSPH 5HYJE 1IMHC 4ZMOA 1MOEA 1YAZA 4IMKC 5F1NB 5T1DL 1AR2A 3CFJB 3Q2WA 4WNSA 1EEZB 1F5WA 4BK5A 4F7MB 1A4CA 2YWYA 3P2DA 5IB5B 2WQSA 4DGYH 2DM4A 3F01A 1MFDL 3OB8A 1MNNA 4GUPA 1ERNA 2RQ8A 3O9WD 2ADYA 4TSAL 1A7NL 3CX5J 1AACA 1U92A 3FT9A 4I9XA 4M8UA 3DVGA 3EGSB 3X3GH 2QGEA 3DARA 3QIBC 4FLSA 4BXSV 3EG9A 2B3RA 4N2IA 2ZNXA 1RUKH 4HWBL 5I30L 3LEYH 4I0PC 3E6FA 4L9LB 2D8KA 4IRSC 3MKKA 1D5MA 3GXFA 2M83A 1C16B 3L13A 5DO8A 5EO9A 3CAFA 4F24A 2K6ZA 1CDHA 4OLXH 4Y9EA 4M3JA 4YVUA 2HKHL 3P3YA 3UTQB 4AX3A 3QXDB 2CO4A 3OXRA 1K3ZA 3LQAL 4PLKC 5ANME 3U7YL 4H8WH 1HCFX 1WAAF 3KL3A 3ULUC 2IFFH 2NX5A 1VZIA 3QNXA 4PRPA 4U3SA 1CGSH 1M71B 1YNKL 4BFBD 2J5LC 1F4WH 1KN4L 2NLJA 5JHLL 3GJFA 4Y2DC 4JZJB 3VXTB 1DJHA 2EYRA 4NT6B 1E6OH 4O2FB 3BZEB 3U4BH 2AJ3B 1G6RA 3NCJL 5JMRA 4R2GB 5IHBA 4PJFB 4DEUA 3ARDB 4LSRL 3GI9H 3KW7A 4DTGH 3FJTA 2WQWA 4LESA 1T21B 2F53B 4JCWA 1M7IB 4CVXA 3PWUB 4N9OB 1NC4D 1S9WA 4LLUA 1QKZH 1SN5A 3SYOA 3SDDD 2G3ZA 1A6ZB 5DLMH 3QFDA 5D7LE 3PWJA 4GXFA 2W65B 5CHNA 5D2LB 4C8XA 2JJTA 3EBGA 3SE3A 3W11D 1CICC 5I6KA 4FTVA 5GS0L 5JUEL 3T0EA 2E76C 4QAMB 4FMKA 4P9ML 4XNZC 4PN6A 1OTTD 1OAQH 4JPQA 4OCSL 3DVNA 4AW4A 5T1LD 1RUQH 1VACA 5GGVL 1TQCC 1R3IH 3BW9B 5IR1A 3MSPA 2PYFA 3CPLB 4H5SA 3N9GL 1U4EA 4PJ5D 4XMVA 5T5NF 3VXRD 1ZDQA 4R0LA 1ZVSB 3UTTE 4WUUB 2EZ0C 1JHLH 2WTOA 4XX1G 3RX8A 3F7KA 5D71H 3SBPA 5BCAA 1WT5C 4FN0A 1DBMH 3PHOB 3VXOA 1SY6H 2Z35A 4B9FA 4G71B 4ES9A 2EC9T 3JWOL 2WBXA 3DJZA 2GJ6D 4J4PA 4MLIA 3MUGA 4DGUA 2VZ1A 3HNVL 4AC4A 3L4YA 3UZQA 1BBDL 5GZNC 5C0AB 4DPCX 5GS2D 2VABB 1XVSA 4UTAA 5B3NA 2GBAA 3OL2A 4HKZA 1KIUA 4RZCB 4I7ZC 5I16A 4ZW3A 1T0MA 1UH4A 2OTUA 4G7VL 3A22A 1YJDL 2IADA 2Y7MA 3DETC 4AT6B 3VB8A 4I2XB 4LCWB 2IXQB 3WO4B 1S8DB 3BKCL 1MHPH 2YD6A 3PP3H 2DQCL 2OSXA 1HJBC 5ADPL 2UZYA 4C4KT 1AQMA 1N0XL 2ICWB 5CJ5A 4OLUH 4XBMA 3L3JB 1A02N 4PJCB 1KJ2L 2COVD 1BP3B 1UWXK 3UTPD 4BZYA 1A6WH 2X28A 3NFSH 3IFPA 2GB2A 4OJEH 3BQVA 5F2FA 4AGOA 1QEXA 3EZJB 1DVXA 1F86A 1FYTB 3R19A 4OD2A 3TJPA 1PZ3A 2R8SL 3OBAA 4C57C 5JHMA 1BZEA 1KCSL 1XF2B 1DVTA 2EYSB 3AG2B 5EZJB 5AW0B 2AJXH 3BFQG 1MRDH 1ZJAA 4BRJA 4U2ZA 1ZGLP 4ELME 3IPFA 1QSEB 1NBYB 4ZO6A 4LAQH 4RMWA 1PU0A 4BHUI 1GJUA 3TBSB 3MYJA 3ZTEA 1MDTA 2Q7YB 1PKQE 3BT0A 3IJHB 4HEME 3WGUB 1DDHB 1MIML 5LWYL 2XZQL 4IOSA 5DDHB 2K6WA 3PQYA 1U58A 1P6WA 4ZMYA 1AQKH 1P4BH 2DLTA 4ZUUB 1TZIA 2BOCA 2E47A 1UQSB 1SLUA 1BZDA 1Z0NA 4FZEH 4M1CC 1IT9L 4OLWH 4ZUVB 4U1SA 2H2PD 2P43B 6FABL 1BIIA 5KYNA 3KXFD 4N1HB 2EUXA 1UFGA 1AGDA 1QPPA 1UB5A 1G7JB 1GXEA 1ES0A 4OF0A 2BRRH 1LQSR 3CFNA 3CZNA 1F41A 2J1ZA 3FCTA 3OKYA 3FUHA 5F0JB 4XMKH 4P23D 5CWSA 3FTVA 5FYLD 3BC9A 1M56B 3BRDA 2BSTA 1JUFA 1HNGA 1Z3GL 5A7BA 1THAA 2BNRE 1KPUA 1XCTB 1U2HA 1ZVYA 4JDTH 3U9UA 1CIUA 5BRPA 2F8OA 4ZFZB 1BZOA 2YD0A 1BZ9A 3MXWL 1BQSA 1CT8B 1P7QB 2JXMB 3WIHA 3CSPA 2ZCHL 4OLVH 3RWJA 4MCMA 4KH9A 4LCUB 2OAAA 4N2GA 4LSPL 3CFIC 3VFVB 1W0VB 3NGBC 3QT2A 2ITCA 1RJLB 3CH1B 2AMGA 5LGHL 1XF3A 2KKQA 4LDLB 5DUBB 2A6KA 1QI4A 5ESVB 2R0WL 3OF6A 1WEJH 3EH5B 3DTDA 1T2JA 4LEBA 3I6GA 4PJGF 1A4KA 4LP4A 1UH3A 2NZ9D 5LCVL 4M8VA 2EP6A 4FQXD 2J12B 1Z9PA 3EUDA 3JWNE 4YZFE 4ZO8A 3HPLA 4FQ1H 5I6XB 1JYWA 3BAWA 3U6RB 4EKJA 1LO2H 2VO8A 1WS7A 1G7HB 2FVNA 2YGNA 5HYSA 3CE1A 4K8RC 2FT6A 5I8CB 4MAUL 1RUKL 3U4EB 1VFBB 3LEYL 2FAUA 3MOBH 5B7FA 4IIQA 1REIA 3RU8L 2F7PA 1TO4A 4HW6A 1RFDH 4Z77A 3BDXA 3FUJA 4I85A 4UBDC 4UOQA 3GDCA 2IALA 4G1EB 4NPYB 4OLXL 4PJ6A 5EU3A 4DSYA 3QUHA 1GL4B 2WINA 4WO4C 3NAAH 1CR9H 1WFUA 2DQGH 3D39A 2WYTA 4H8WL 1DUYB 3NIFE 4P2RD 4KJPD 1XSJA 2F7OA 2IFFL 8PAZA 1CGSL 4PEEA 5GISH 3ESOA 4FLQA 2A99A 4OZHB 1FVEA 1YUHA 1MF2H 1KJMB 4KJYA 1E6JL 3PREA 1E6OL 2FSEB 1E43A 4ABVA 1KIPB 5AVRB 32C2B 3VI3B 4XNMB 3GXIA 4FZ8H 4B3VA 1KB3A 4GG6F 3VWJB 4QF1A 2GJPA 2XBDA 4XN2A 4YOKA 3T77B 4DTGL 1TQSA 2Y2TA 4G9FB 2D3NA 5K59E 4S1SH 4HV8B 2AFNA 4NPJA 1LNUB 2IAMD 2JF1A 1HL8A 4NQEA 5KVFH 1XD1A 2E7DA 2WO4A 5DCCA 5DLML 3FH8A 5AOMA 2PPCA 1A65A 2P5ED 4H1LH 4WFFE 1SN2A 4CC4A 2W5PA 2HFFB 3SCMB 3G04B 3VH8A 2W0FA 3RHWK 2BVOB 3IDXH 2CDEB 1BFOB 3I9GH 4NN6B 1OAQL 2EIEA 5IMLB 1BVLA 1QUNB 1XGYH 1I7TA 1RUQL 3RWDA 1R3IL 1V3MA 3ARZA 3MROA 3P40A 2BDNH 3TO4C 1DBAH 1MFCH 2GC7C 1QLEB 3QHFH 4HXAH 3NIDF 1RUAL 3ZGIA 3IE9A 4PJXE 1IE5A 4UOJA 2E27L 3ULVD 2FH8A 4Q2ZB 3G6JB 4MD0B 2FJGB 2ICES 4RMRA 5DHVH 3TBTB 3IF1B 3K5SA 2BY1A 5HDBE 4YR6A 2O5YH 3V5HB 1OD7A 2X44D 3LMJH 4EZLA 4DP9X 3GSVA 4TUOA 1CXKA 5ISZA 4O4YL 1DBBH 5DMJB 4YBQD 2OMYB 4GKSB 2DI7A 1HVXA 3RWHB 1ZLSL 2P42B 2AHIA 4JO2H 5D1XD 2P26A 4HIEB 1S9XB 2ADIA 3RPKA 1Q9LA 5ALBH 3BRFA 1JNLL 5IVXE 5JR1H 1FI8C 3WS6A 3LZQA 2RCSH 1F97A 1SXBA 3N41F 3S5ZA 1JBJA 3OKEA 1MHPL 1JV2B 4CVUA 1MCPH 1ND0B 5LXVA 4TNVF 3SDXA 2GITB 3LPPA 3ZL4L 5HYSG 5IQLA 1X4YA 2Z0UA 4WV1C 1FO0L 1S7SA 2EUZA 1BF2A 3LNGA 2IWFA 3CVBA 5B3JF 1JGUH 3OM3B 4MDIB 2RACA 4G8AC 5K9QI 3BJLA 2Q87A 4P59L 4QXGH 1A7PH 2H8PA 3C5JB 1NDTA 1RXLA 2X4OA 1E2ZA 4FYSA 4AM0B 3GHPA 4IJTA 2XDHA 2XWTA 3ZPDA 1MRDL 2VKXA 3HJ0A 4K3JH 4IMLB 4AEHH 4YMPA 1G1CA 1MCHA 1UHVA 1Y6NR 4ZTPL 5F1NA 3OB0H 3CFJA 5D2NB 3P4LA 1EEZA 3B2UC 2HVBA 4F7MA 5MEPB 1F45A 4J6IA 1MELA 5IB5A 1CU4H 1FSKC 4E41B 1NCGA 4PVBA 1H3UA 4AMKL 2O5XH 3T8XB 2MRYA 4PV9B 5ANHA 3WEMA 1HDMB 2WIIA 4FZEL 1KCLA 1HI6A 3EGSA 1XV8A 1V55B 3SYCA 5KSBB 4OLWL 3ZY7A 3R4DA 3P77B 3QFJD 2CJTA 1XF4B 5EHFA 1CD1B 1J87A 3TH2T 4JFEB 4ZTOH 3OAYH 2OULB 2BRRL 3SE4C 4DKAA 2FJFA 5GGTH 3BVXA 1C16A 3RIAK 3ZKNC 2LAGB 2R2HB 3VH8G 2XVLA 2XRAH 3MRKB 3PGFH 4I89A 1E5UI 2CD0A 1J18A 4OCRL 5AENA 4R5VA 3V79C 5CR1A 4OFYD 3UTQA 3QXDA 3CN0A 5GJSH 5JW3H 3DX7B 4YDJB 5FFOA 2WZ5A 2QHRH 1J5OH 3DBSA 3TVMB 1SMDA 2WBJB 4NRZB 5DJ6A 1MWAH 5LGJB 2LQRA 5EEXA 2LLNA 1OGTB 3FZUD 5GGRY 1ZANL 1URLA 2D3LA 5AAWA 4C4UA 3VXTA 4JZJA 1FNHA 1OZUA 4NUGL 4H88L 4RLDA 4YL4A 4CUCA 3LZFH 4FG2A 2ESVE 4O2FA 3BZEA 2AJ3A 3TYFB 3DHPA 3HZKB 3CHRA 3RL1B 1VRSA 3L1OH 3SYPA 5T33L 4GG8B 2AJUL 4PJFA 2G0LA 1WV7T 1TQBC 4Q58C 4D9RE 2CBTA 3TXAA 1T21A 2F53A 3ILQC 2YHGA 3HG4A 4PJIE 1M7IA 1WEJL 4OBRA 1FNSL 3L4UA 3PWUA 4U1JB 2WXQA 3QQ9D 4X83A 3PGCB 2APWA 2YD9A 4G6MH 3PE9A 3FQWB 3LEXA 5D7JC 1MVFA 2W65A 5D2LA 5IB2B 2QDWA 4BHUA 4U0RB 2OTPA 4AE0A 1CLVA 3C2SA 4Z95H 3RZWA 4FXKC 4NXSA 4S0HA 1JRHI 4X42A 5EU6E 3TP4A 4GSRA 1JZFA 1IZJA 4P9HH 3BW9A 4KUZH 5DZJA 3CPLA 4FXTA 2IH8A 1ZVSA 4ENEC 5LGKA 3ZBMA 4WUUA 1G43A 4K3DL 3RX7A 5A2CA 4HQQH 2YEQA 3PWVB 1CJYA 1OP3K 3RDJA 3NAAL 1CR9L 1DQLH 3PHOA 4XNUH 5D96C 4NZFA 4ZFOL 1OW0A 4WK4B 4HCGA 2ATPB 4FCHA 3CPUA 1R46A 1OKEA 2Z91B 4JKMA 3KLKA 5AUMB 1TYRA 4XMZA 1ZE3H 5C0AA 2NY5H 1U30A 3JTSB 4UIKH 2VABA 4RBPH 3IFNH 5IJBC 3ZHDA 4HS3B 4WK2B 5T1KD 4OCMC 5EF1A 1AYOA 4ABUA 4RZCA 4MA8H 4WY7H 1YHPA 4AIOA 2JJVA 3V7AG 3TCLB 2W1NA 4NNPH 5C09B 4AT6A 4S1SL 2YD7A 4LCWA 2IXQA 1WTGT 1S8DA 2D2CC 3BGMB 4WHYG 5C71A 3R8BB 3QUXC 2JFCA 3UG5A 4YJZL 5EA0H 3NDYE 3H9SB 2XWRA 5FIEA 2ICWA 4BKSC 3L3JA 4FFZA 1WA2X 2NR6C 1NIBA 2X09A 1GYWA 4YPJA 4UT7H 4AGPA 4CDGC 4XX1E 5BVJB 1JWSB 1GTNA 1GYCA 2BZ7A 1ZK5A 4JPVH 5IT2H 2BDNL 1FYTA 1EHXA 4QMEA 1DBAL 3B9KD 3D69B 4RWYH 2WWOA 3QHFL 4HXAL 2QDVA 7TAAA 4NI6A 4KI5F 1IU1A 2ENYA 3VNYA 1NEPA 1XF2A 2DS4A 5HHVH 2EYSA 5EZJA 4JM2D 2DWDB 4FXGB 1MHCA 2IGLA 4LMQI 1NIDA 2PP9A 5DTFB 2Q20A 1H19A 4ESKA 5A43C 5HHQB 4JREB 1QSEA 1NBYA 2O5YL 3TBSA 2Q7YA 2QPEB 1OHQA 1DDHA 4GAGH 4YSDA 3MXVH 2Q2EB 1DBBL 5DDHA 4I18C 2FT7A 2A9NL 4NAJA 5I1KL 1RQ5A 3UCRA 1UOLA 4ZUUA 3F6JA 5G5DA 3UPAA 2YXVA 1UQSA 5JR1L 1CE6A 4B5EA 1DANU 2XN9D 2BSRB 2HZHA 1FLRH 3T3ME 4F57H 1M7DB 3KLDA 2WTPA 4AYFB 5D1ZI 3UERA 3OHXC 2DM2A 1U8CB 4JB9H 4YDIH 3WJMB 2BOBB 3ARBB 3TF4A 1G7JA 1DVFC 1MCPL 1Y18B 2DN7A 3MJGX 3RFRA 4CKQA 2X4RB 4JHAH 1F90L 2JIXD 2XG4A 3ZTJH 4AKOA 5MEOB 3DX9B 3UAAA 1M6UA 3ALXA 2HWZL 1PMYA 5L0QC 4QRRE 5FA4B 2NX5E 2RMNA 4PRPE 2ZP8A 1XCTA 3IJSB 1PG7H 4ONOA 3M8OH 4CA4A 1FE8H 1MFUA 3IDNB 1NEUA 2H3XC 2VXUH 4ZFZA 5A6MA 3FQNB 1CT8A 1P7QA 2JXMA 3KCWA 4AEHL 4AYEC 4FNQA 4LCUA 3EIFA 3VFVA 1W0VA 3N1QC 4R97C 4U1GC 4N90E 1QPKA 4GQ9H 1RJLA 3CH1A 1CF1A 5DUBA 1Z9SB 4LVOB 3QUYC 5ESVA 1CF8L 4J3OF 2VL5B 2RAMA 5F6IB 1QW9A 1HWHB 2IEPA 1P1ZB 5LBSA 2DMCA 1I8KB 4UAHA 4F37K 3VX1A 2HUEA 4GRMB 4O00A 1DTUA 4KOBA 35C8L 1CTOA 1PIFA 4FTVE 4NUJB 3U6RA 4EMZA 1OTSC 4OM0H 3T0EE 5BOJA 1AFVL 1G7HA 4P5KB 4TM9A 4BCYA 2WXLA 2YEZB 4N6QA 2EUWA 1ETZB 1I1AC 1VFBA 2BVYA 4ZTOL 3QEUA 2E9JA 4XNAA 2ADJA 5GGTL 3IXTB 3ZHKA 2J20A 2XRAL 4G1EA 4NPYA 3HMXA 4JO4L 3WTUA 4JDEB 3CMGA 5HHNB 4N28A 2JCCF 5B39B 3HJEA 3I6SA 3G6AB 4F8OA 3W3BA 4EUPH 5GJSL 5JW3L 5FHAH 3G5VB 3GSWA 1M42A 1FORL 1N8OE 4GS7C 1DUYA 4HYTB 1T20B 2C7UB 1SDAB 3AROA 3QDJB 3BUBA 4Q4EA 4TOYL 3ZMRA 1NBCA 2RBLA 4OZHA 4U3XA 2ED9A 4E9VA 3UC0H 1KJMA 3P3TA 2NY4C 3FFCB 2X7LB 2XC8A 2FSEA 5E2VL 4IRJC 3TURA 2CKBL 1KIPA 2JI1A 4I8DA 32C2A 3VI3A 3KPPB 3DYMA 4XNMA 3L1OL 4DEWA 2R0LL 2X1WL 3ZE1F 4MQ7B 1T66C 4Y19E 5ILTH 4JY5L 3CFTA 1KYUA 4GI8A 3T77A 3NIGB 3T0BA 4ICXA 5EN3A