4A68A

Mutations in the neighbourhood of cota-laccase trinuclear site: d116n mutant
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
509
structure length
502
Chain Sequence
b'TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSNGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPORE COAT PROTEIN A
publication title The Role of Asp116 in the Reductive Cleavage of Dioxygen to Water in Cota Laccase: Assistance During the Proton Transfer Mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 147
structure length 502
sequence length 509
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a68A02
3NJGA 1L9TA 2IDQA 1JZGA 3X1EA 1VLXA 1RZQA 1A4BA 1B3IA 1MZYA 5I6NA 4DP6X 2EILB 2J5WA 1A4CA 1NIFA 2GI0A 1JZIA 5I6LA 3DKHA 1MDAA 2XXGA 1SJMA 1N70A 1KV7A 4P5SA 1QLEB 2FQGA 3RYMA 3T6ZA 3QJVB 4KOCA 3GYRA 1ID2A 1NINA 2Y69B 1JVLA 4A2DA 2J57A 1AR1B 3UAEA 2W88A 2JKWA 4EF3A 2PPAA 1PZAA 2FQEA 4KNTA 3ZDWA 9PCYA 3ZIYA 6PCYA 4JKNA 2FQDA 1KGYE 1WS7A 2EINB 1JXDA 2Y1AA 2BWIA 3OQRA 3TBBA 1V10A 1SHWA 3HB3B 1RKRA 4HZ1A 1XMEB 2HRGA 1JVOA 2CALA 3NJHA 4Q89A 4W9ZA 2BO0A 2VM4A 1XB8A 4GP5B 1X9RA 3UAAA 4AI7A 5AFAA 2FT7A 3NSDA 3FS9A 5F7AA 1IC0A 5B1AB 3S3BB 3HEIB 3NJIA 1ZDSA 3C75A 3CVDA 4WTQA 4GP4B 4HCIA 3WG7B 2YAMA 4A67A 4F7KA 3FPXA 1AAJA 3V9EA 4PAZA 1NPJA 2CUAA 4GYBA 4UANA 1J5CA 1ADWA 1A4AA 1PF3A 2B08A 2XYBA 1L9QA 5F7BA 3FSZA 3CDZB 2UXGA 2IWKA 1RZPA 1SFDA 2I7SA 2VM3A 4UF7C 4KO7A 1NIAA 5I5IA 4JHUA 3T6WA 4P5RA 4YSEA 3NSCA 2VW6A 3FQ2A 5B1JC 1DZ0A 1AZUA 4BWWA 1TEFA 2QT6A 2W8CA 4K9JA 2PCFA 1L9OA 3FQYA 1OCCB 2JFCA 1PZBA 1HAUA 2QPEB 3MBWB 4YSPA 2PPFA 2A3TA 2UXTA 3WKQA 2FT6A 1MZZA 4DPAX 1CYWA 4E9QA 3AZUA 5IY5B 2BP0A 2UXFA 1MG3C 4KNSA 3ABKB 2DWSA 2YAFA 1AZRA 1ZV2A 2H47C 2VSKB 3FYIB 1GS7A 4L0PB 5I28A 4DPBX 1E65A 3ASOB 2BHFA 2JXMA 1PLAA 5B1KA 3NP4A 1OE1A 3QJRB 4DP8X 1J9TA 5D4JA 4BDVA 1E30A 1BXUA 1NZRA 3S3CB 4YSSA 4A2HA 3PCYA 4GXFA 1NIDA 4AKQA 1L9PA 2HLEB 3TASA 3AW5A 2TSAA 2FTAA 3QJTB 4F2EA 3UADA 1A3ZA 4N8UA 3ABMB 3S3DB 1OF0A 3UABA 2IDUA 4YVNA 4A2EA 1NTDA 3N55A 4FAAB 2YAPA 2GSMB 1M56B 4KO5A 5B7EA 4ENZA 1OE2A 2BP0B 3NP3A 1SF3A 2FJSA 2R7EA 2H3XC 2AZUA 2GB2A 1AANA 1CC3A 3X1GA 3NT0A 5B1BB 1AOZA 2DYRB 1QHQA 5LDUA 1ILSA 4YSCA 2ZONA 2GBAA 1SFHA 3NYKA 1J9RA 1N68A 1IBYA 3T6XA 2PCYA 4BXSV 3FSWA 2AFNA 2HX8A 4E9WA 1E67A 2BWDA 5AZUA 1KDJA 2IDTA 4DP7X 3OD3A 7PCYA 1V55B 2YAQA 4AKPA 1TEGA 2P80D 1GS6X 1JXFA 1BQRA 1TU2A 2WO3B 3G5WA 1HFUA 2CBPA 5PAZA 2BW4A 1ET8A 2XV0A 2IDSA 4G7RB 3PPSA 4DP5X 1ZPUA 3NJLA 1BYPA 1OCRB 1SDDA 3SBRA 2GC7C 1KYAA 3ABGA 4TXVB 2YAHA 1NIEA 3WKPA 4W1TA 2BZ7A 5I6MA 1CYXA 1XB6A 4A66A 3WNIA 3OM3B 1KCWA 3OMIB 1GY1A 3EH3B 1NDTA 4YSQA 2FWLB 2J56A 1GSKA 5I26A 2OJ1A 1JZFA 3BQVA 4GY4A 1ILUA 1UATA 3EH4B 1AZCA 5I5MA 2CJ3A 2XLLA 3QQXA 3FU8A 2VMJA 4YVUA 2EIKB 3TU6A 1XB3A 1OCZB 2NRDA 4YSOA 2YQBA 2XV2A 3T6VA 2DV6A 7PAZA 1SHXA 1AG6A 4HCFA 1OOWA 2OCCB 3KW8A 3X2QB 1NWOA 5TK2A 3FQ1A 2BP8A 5FC9A 4MFHA 2ZXWB 2ZWNA 4QLWA 3ZX1A 1ET5A 2J55A 2AZAA 1JERA 5I6OA 3QJQB 1TKWA 4BWUA 1AS7A 3ABLB 3IEAA 2Q5BA 4HIPA 2IAAC 3NJJA 5AKRA 3WIAA 3QJUB 4HHGA 2WSDA 4HALA 2UX6A 4G71B 5B1JA 1L9RA 2HX7A 1KCBA 1YLBB 3DTUB 3AG4B 1W6WA 4E9XA 1AQ8A 3JTBA 4BK5C 5I6KA 3SQRA 1ZIAA 3X1BA 1FWXA 3PAZA 3AG3B 3NSFA 4E9SA 3FPYA 1JXGA 3IN2A 2YAOA 3FSVA 1ET7A 4YSDA 4DP4X 2IDFA 3S8GB 1MG2C 1BXAA 3X1NA 1KBVA 2LLNA 3PXLA 4G7SB 3JT2A 4BWTA 4PCYA 1NWPA 3CG8A 1QNIA 5E9NA 4G70B 1BQKA 4E9YA 1EZLA 1NICA 4KNUA 1BYOA 4E9VA 2VW7A 4M3HA 1A8ZA 4Q8BA 1AZNA 4AX3A 1E5ZA 1BEXA 1IUZA 3N2JA 2PPDA 4YSAA 1V54B 1SF5A 4DP0X 2EIMB 1PAZA 3AG1B 4DP2X 3H4FA 1NPNA 1WS8A 3BVDB 4NAJA 1ETJA 1KDIA 4DP1X 2PPCA 3TA4D 1BQ5A 1BAWA 1KBWA 1AZBA 2AVFA 3X1FA 1A65A 4BDVB 2I85A 2QDVA 1J9QA 1W8EA 2UXVA 2IWEA 4YSUA 1WAEA 1RCYA 2I7OA 1SNRA 4CSPA 2WO2B 5I5JA 2QPDB 3S8FB 1AS6A 1URIA 3L45A 1E5YA 1GW0A 3GXUB 1DYZA 3CVCA 4M4RB 4YSRA 2VW4A 1AS8A 3TBCA 5B7MA 3NJNA 1AG0A 5B3SB 2HX9A 4WKXA 1GY2A 4G7QB 5I6PA 4E9RA 1BXVA 2DWTA 2PP8A 1PCSA 4CSZA 1IBZA 2R7EB 1M9WA 3CZUB 3EF4A 3WNJA 3DIVA 3IN0A 4KO9A 2IWFA 3CDZA 1ZIBA 5B7FA 2HRHA 1JZHA 4A2GA 1J5DA 1IKOP 2UX7A 1HAWA 3T71A 5PCYA 4N4YB 8PAZA 1PZCA 4YL4A 2FQFA 2XVBA 4KO6A 3UACA 2MRYA 4QKTA 2XX0A 4G72B 2BW5A 1ASQA 3FU7A 1PLCA 4AZUA 1ASOA 4E9TA 1J9SA 2B3IA 2YARA 2XU9A 2N0MA 2PPEA 3U25A 4DPCX 2OV0A 3EHBB 3MX0B 1PLBA 3SBPA 3FT0A 3ERXA 1SDDB 3NJKA 4FA7B 2HZHA 2EIJB 3IE9A 1PMYA 3NJFA 4HAKA 1X9UA 5D4HA 4HCGA 2PP9A 1EHKB 1JZEA 2P80A 2E86A 1PNDA 2YXWA 1WA2X 4DP9X 2TSBA 1OV8A 2IH8A 1M57B 1I53A 2QDWA 3KW7A 3GDCA 1ZDQA 3V9CA 5A7EA 1PY0A 4A68A 2HXAA 2GC4C 1WA1X 4AKOA 4NERA 3ASNB 4UAHA 1GR7A 1ASPA 3CVBA 2XWZA 3PAUA 2X88A 3NSYA 2CAKA 4X4KA 5TK4A 2BZCA 3SBQA 3FU7B 2RACA 1R1CA 4NB7A 3D12B 1FFTB 2YXVA 1AIZA 3NJMA 3PLYA 3ZBMA 6PAZA 3T9WA 3QPKA 4BXVA 2ZOOA 1T5KA 2DYSB 3FSAA 4YSTA 3WI9A 2BP8B 4HHWA 3UGEA 2VN3A 1GS8A 3H4HA 1L9SA 1AACA 2XUWA 3AY2A 1OE3A 2VSMB 4F2FA 1GYCA 5ANHA 3FU9A 2XXFA 1JZJA 1OCOB 2IH9A 2PLTA 1CURA 2CCWA 3H56A 1JOIA 5EHFA 2FT8A 1W6LA 2GIMA 2FNWA 2Q9OA 3AG2B 5D4IA 2YAEA 3EH5B 2X87A 4ZK8A 2MTAA 4GP8B 3FYEB 3PAVA 2XX1A 3OMNB 4JHVA 4RH4A 1FA4A 4A2FA 2GHZA 3QJSB 4KOBA 2XV3A 2AANA 1PNCA 1WA0X 3OMAB 3IBOA 2PP7A 2DY2A 2H5UA 1NIBA 1F56A 1CUOA
chains in the Genus database with same CATH superfamily
3NJGA 2COQA 2X2IA 1L9TA 4OLUH 4TN9A 4LLDB 3BVUA 2G9HA 4DERA 1MFMA 1JPSH 1JZGA 3QRLA 4DKAA 4HOZA 1E90A 4MNGA 3X14B 4FFYL 1PG7X 2ITCA 1I1YB 4R7VA 3SDAA 2W65B 3QI9A 4R90H 1BBDH 5DHDA 2F54D 2QPFA 3FFCE 1QD0A 1QPPA 1CD9B 4Y4FC 1HCFX 4DPRA 1LK3H 3CHQA 1SY6H 3T6ZA 2XJKA 4NUGH 3QS3A 3HI1B 3CC5B 1KTJA 2MQCA 4AQEB 1I7UB 4IRJA 1U8HB 1MN4A 2YUVA 2PPAA 4I3SH 2VDLB 4NRZA 5FO7B 3AQZA 3HR5B 5CN1A 4KMTL 3O3EA 1MVUB 1QRKA 3I75A 2OBGA 1TVBB 2RD0A 1GGBH 2W9EL 4JN2A 5GRVK 5TPWL 3R8BB 4ZX4A 5C0JA 3OQRA 1SLUA 1T0NA 3VG0H 1G94A 5FHAL 4ZMLA 2B14A 4MB5A 5JXEC 5JIQA 1EEUA 1E7UA 4M7JH 4L5FL 2ITFA 3C6LB 1S8DB 2A9DA 3H54A 4QD2E 4Y1AE 1LP9A 4XBPA 3CSYA 1VFOA 4HEPG 3UAAA 2EYSB 1EHXA 3MNMA 2CO7B 4P0DA 3V6ZB 3FO9A 2YFOA 2AV7B 1ZA3A 1MREL 4PW3A 4XN5A 5IROC 4I0KA 1J8HE 3ZQ9A 1OKEA 2NOYA 1JGDA 2EACA 5SV3A 3VXTA 1FZKB 1OPOA 1U8JB 2VLRD 4APQD 4JKPH 4DFIA 5C86A 3L13A 4FJ6A 2EQDA 4K7PH 1AC6A 3TBWB 4UOQA 3I9PA 5DR5H 3UDWC 1A4AA 4UDUA 4D9RD 1J5OL 4RWYL 3DOSA 4WUUE 1CFNB 5E6IA 5IEHA 3PWPB 4X99B 1F5WA 4HJIA 4WI5A 2EYTB 1U2CA 1MW0A 3RVWC 2E56A 3RWHA 3M17B 4Z7OE 1H8LA 1PU0A 4TOYH 5B1JC 1TVHA 5EC2A 2QMKA 4NWUL 2IV8A 2ZXAA 1A7BA 4BUHA 4ZAKD 4K9JA 3GIVA 3JZYA 2VRKA 4N90D 1GHFH 4YN3A 3MACH 1N5YL 5AZEH 4H5SA 2FT6A 4IRZH 5KSBB 2ATKB 1YJDC 5FUOL 1CK0H 5T1MA 2CGRL 2CO2A 1IBHA 3ABKB 4R7NA 5TDOB 3WO4C 3GMPB 43CAB 5IREA 4NRXB 1KN2H 3JBG7 2UZIH 4PWJA 5EBMB 1UA6L 5B1KA 5I1KH 5L2KE 1DO5A 1DSFL 2OZ4A 4Q56A 6FABL 4DK5A 1VFAA 4ZBJA 1LDPL 4BDVA 5FK9B 4L4TD 1BOGB 1FBIL 1NCIA 2D0HA 2Y7OA 4Y19E 3BZEB 3MO1A 3CH1B 1CU4L 4GXFA 4G9DA 4LK4A 4NQQA 2EC9U 2MPVA 3TASA 2JNZA 3H0TA 3JWNE 9CGTA 5LHDA 5AYUL 1P84J 4HKZA 1P53A 1TFPA 3O2DL 1XX9C 1CFSA 1SLVA 3A4AA 1XF4A 1I3GH 1YYML 2R1WA 3L3IB 4YVNA 4LDOB 4I48A 4AT6A 3QORC 3N06B 1G7JB 1S9KC 2DWXA 1XH2A 2JKSA 5HDBE 1OE2A 4BFJA 5AVSB 2CR6A 1Y1UA 2FJSA 3IMRA 4Y4HC 4OM0L 5SX5H 1MKFA 2NDFA 2F58H 4XMZA 2G75B 4HAFA 4JGNA 4E68A 4U1SB 3OX8B 1CG9A 4KZ0A 4NENA 3VSQA 2EH7H 3O3AB 1I3UA 3DMMD 2PCYA 2HA1A 4G59C 2ZCHH 3D52A 3IKCA 1RUML 4MLSA 4GO8A 4O02H 2AXGB 1F4YH 2IAND 3S6CA 4CDGC 2B4CL 3H3BC 3BP6B 1FUNA 1WZKA 4M62H 4YDKL 4O9HH 1YPZE 2IDTA 2PWFA 4AKPA 3ZXAC 3VFNB 2P80D 3QUYB 5AVZB 4Z76B 3LKQB 1N0XL 1MH5A 3G5WA 4O58H 4Z8FH 3LIZA 5IB2A 4H8WH 5I76A 4WEMB 3GSNH 3FTWA 3MJ8A 4UOJA 5C0RH 1C1EH 2CR0A 1SHMA 2ZCLH 4PJDA 1AP2B 1QUPA 4H8PA 3C60A 3VFUB 2PYEA 1AO7A 1WQVT 5CLXA 4C83A 1YYLH 1CE6B 3BSZH 4F7PA 3IDYC 3NIFB 2NYKA 3MRJB 3MRRA 3H6JA 4IOFD 2ZTBA 3JV4A 3KM2A 4WFGE 4MX7A 5ISZE 4PBDA 5D7LA 3O4LB 4YHKL 4BZYA 5JDJA 2Q20A 3OPUA 3EO1A 2A6IB 4OLEA 2CBTA 4F8QA 2PF6A 3MZGB 2FX7H 4QTIH 5DFTA 3IFOA 2Q7YA 3DO7A 2BVPB 4U1NB 1YECH 5TDPB 2XC8A 1UA7A 1QWHA 1E2VA 5D1QE 3WFBL 2ZXQA 3HZYB 1OOWA 4J3OC 2PWHA 4BFEA 4NQUA 2O6PA 5TK2A 4YFLF 5L8KB 5DI8A 4PJ5D 4JFUA 3VGHA 1KBBA 3FQXA 5B3JE 3VW3H 3MA9L 2LLLA 1REIA 3E6FA 1A7NH 2J72A 4UCFA 3U1SH 2B7DT 3FT2B 4JFXA 1HT6A 4C58B 1JDAA 1KB5A 3BSGA 2WYHA 4LE8A 4PJ7B 2J71A 3QARA 3GLAA 3GBMH 5CCJA 2LABA 1A3QA 1KCBA 4X4YA 3G5XA 2QL1A 5AVYB 2C9XA 2GFBB 2Z31C 4JY5H 5C0CA 3BPOC 2WVSA 3SQRA 5CGBA 4AEIH 4Y2DD 4N68A 4P9HH 1TFHA 5DWUL 1H3WM 4M6OL 3L95A 4RISL 3UTOA 3IN2A 1U58A 4ADJA 3WFDL 5C07E 3S36L 4E41D 3OKEB 1G9EA 1Y6NR 1ZT1B 3WL9A 2AJZA 4FFZL 2F5BH 2V3EA 3TV8A 4ZW8A 2XPYA 2BY1A 3SKJH 1E5AA 4CJ0A 5J1AB 4PTTB 1SXSA 4AENB 5ELIA 3PP4H 3CVIH 1QSED 5FFGA 3LNEA 4NS0A 4RVBA 1EAQA 1MWAL 4PJ8D 1XVSA 4BFKA 2IADB 1AIFA 2HTKD 2Q76A 5CO1A 4Z7WB 1WRFA 4JL2A 3VXRE 4H20H 2K6WA 3POHA 1GZPB 1MHPH 3TF7C 5C0DA 3HG4A 4KRPD 3FRPG 3NCYS 4YGVA 5DJYA 1GPOH 4J3TA 1DBML 5E1GA 1G9NH 4FTDA 4I2XA 4OJFH 1OK8A 1RUPH 2PO6B 3RDTA 3W9EA 2ZICA 1I8LA 3BAIA 3L4ZA 4C4BA 1T7YA 3SGEH 4OLVL 1KBWA 3MV7A 1F3DJ 3KCPB 5F7EH 2WUBL 1F6AA 5F93C 2NW2A 3Q9QA 2BSRB 1WAEA 5CINH 4QRSB 1ZT4A 4YC2B 5DFAA 5I5JA 1CICD 1IGIH 2QPDB 3DNKA 3QQ3A 4TULH 3MRPB 4JFDE 4LAJH 3KXFA 1BREA 4KQ3H 3S88H 4AL8L 1BAFL 3CVCA 2H3NA 4NUQA 2DICA 5DK0B 2VW4A 2Y7NA 2YMXL 4AQAA 4XB8A 2QELA 2A4CA 2XN9E 3ARBC 3FCSB 5I6PA 5KBKA 4MQ7B 5IVOA 3VFPA 1BXVA 3WD5H 4CU7A 3IGLA 5FYLE 3OXRB 4UQCA 2RQ8A 3A5VA 5AW4B 5F7LB 1WFOA 1WZAA 1WG3A 2W9DL 3QZBA 1NGXA 3QEQE 2JB6A 1AMYA 1S3RA 5IQ9A 2NT0A 1IKOP 1CFVL 5EZJB 5FYJL 4JLRB 3MODL 1TVDA 3IT8D 2OYKA 4B7IA 2WNGA 1M9SA 2EDJA 2J2ZB 2E7DA 3NN8A 2GKIA 4PVBA 5LGKA 4BFBD 1NGWA 2K7PA 4KHTL 3QDME 3TA3A 2Y07L 5EU6A 5T5FL 4HS3A 4AVJA 3FHQA 4HUNB 5L7XH 3ECBA 3LKSA 1H6EA 3ARTA 4P3DB 4P2QD 3S35H 4J1UA 5IFJA 1J9SA 3ULAB 1G7PB 3OJ2C 4PJGF 5GGVL 3BD3A 4LQ1A 2PPEA 3D2TA 1C9SA 1PLBA 3SBPA 5KVFE 2PWEA 2FEDD 4GLRH 2EIJB 4L8BA 2R56H 3IPBA 4JJ5B 5FOJA 2QKIA 4HAKA 4LARH 4I85A 2NY6B 3ETSA 2WWMD 1FNGB 4WHYG 5EO1A 2Z92A 4X7CC 3IE4A 2QGDA 2VYRE 5LGYA 3LV3A 1S9XB 4L4VE 4ZFGL 4K5OA 1JZ5A 2VITB 1FYTE 5JPNC 3U7AA 4PUBL 3HPLB 3VXSA 3DXAD 1DBKL 4PSPA 1GCFA 3SE3A 4LPVA 4PGJA 2E46A 3EDKA 3H7BB 2P7TB 1KYOK 2WLNA 1V7ML 3CVBA 2YA0A 4NQXB 4GAJL 5JW4N 3QUXD 2X88A 3NSYA 4U6VL 4X4KA 5IBUB 1ZLUK 1QZ1A 1KV3A 4LVHC 4HWEH 5KYXA 5FOBB 4P46A 1DJWA 3NVQA 4NZUL 1VFBB 2N1TE 1Z2KA 4BXVA 4YHMH 3LIZH 4DUXA 5BS0B 4Y1TA 1HHIA 1A5FL 3O6KH 5LN8A 4P2RA 1QRNA 3SDCB 1GRWA 3U2IA 4UDTA 3UAJD 2MSPA 4GXUN 3UOAB 2R2HA 2FJUB 1NEUA 1NFAA 3FN0L 2PCPB 4XCYA 5D8JH 1L9SA 1AACA 3BQUA 4GRWH 3GMMA 4HMDA 2NXYD 4Z77B 3BWUC 4L1LA 2QPUA 5AKSA 1OAYL 4ETYA 1BVLB 4IOIA 4C56D 3WJMB 1AXTL 2QVIA 3H56A 4NHUB 4A7GA 1E4WH 3ROOA 2Z8RA 3H3PH 4KY1L 3BAYA 2WXNA 4X83A 4S1DC 5CEYA 1TXKA 1X7QA 2X87A 5T1KA 1JXKA 3H9SA 5IJVB 2V9QA 3QEGL 2BXYA 3RWDB 2MTAA 4UQBA 1VEOA 1MFCH 5AAMC 5I1GL 5JTWA 3FKUS 1OANA 2LGNA 2XHNA 5LG6A 3G5YB 1OT2A 1IAIH 2VISA 3ZDZE 1N6VA 1AE6H 1I9IL 1NGZB 4Y5YA 5FA3B 3WE6B 1YEIH 4MMZB 3TCLB 5CR1A 2W59A 2CE6A 5JORA 1NGQH 1B4JL 3DRQB 1ZGLM 3WFCL 3VFTB 2JJVA 3F6LA 2WQ8A 1WH0A 4HCRA 1RZQA 2VQUA 5D1ZI 3LOWA 3QZWG 3HI6L 3TC9A 5BUAA 2GI0A 2A9NL 1HDMA 2AJUL 4LLWA 3TFKD 1VEMA 4EN3D 1M7IB 1UT9A 3CFKB 3WIFB 4G43B 3TH3T 1JK8B 4NXSA 3SE9L 5ETUB 5D96B 1EJFA 3QEHA 3CFMA 2Y69B 3RVXC 1T20B 1MCIA 3Q5OA 1FF5A 3QG7L 1AGCA 1CTMA 2AJSH 1Q1JH 2LW3A 3RIKA 1QLFA 3ZRCC 1IM9D 1D3CA 4QXGL 1WS7A 3UP1A 4AH2B 5IVNA 2B1HL 4UM9A 5JR1H 1RKRA 3VSVA 1NEZA 3L08A 4HUUB 5AOJA 1Z5LA 4OCXH 4N2AA 1KLFB 4ZUUA 1UFUA 3X11B 1H3GA 3ILQC 2R8SL 1DQKA 1FIGL 3P3UA 4KXZI 2ITDB 4WTZA 5KN5A 1BD2B 2HLFC 1B0IA 5A6MA 5ID0B 2JB5H 2BHUA 2IALA 2X4SB 1L6PA 4TUKH 1D5BB 3K2KA 3GSRA 3NSDA 4ZXBC 5DSCB 3QIWC 4WO4B 1DQVA 5INDA 4R26H 3L6FB 3ZL1A 5DRNA 2YC1A 4OCSL 5DMKA 5IK3B 1MUJA 2OR8A 4GP4B 3V4UH 1CL7L 1VSCA 1VAHA 4PHZA 2A99A 3G6JE 1P7QA 5A3IC 4J8RA 4J8QA 3VE0A 3LQZA 2EXWC 3V79C 2OK0H 1ADWA 2YKKA 1MAMH 1D9KA 4YWGH 3PHQB 1CE1H 3RWJB 5T1LD 4OF7A 3PABB 5F3HB 5F7HA 5BZXA 4J3OF 4JO4L 4PCTA 5IF0A 1HCVA 3MRKA 2CCVA 4O2FB 3V0HA 2XXCB 3GSQB 3II3A 1TEFA 3DYMA 3EDDA 4B9ZA 5CZVL 4L8CA 3FULA 3ESNA 2DQGL 1ORSB 4M43H 4R83A 5A6LA 1H3PL 3BE1H 1BMWA 4NO5A 4GUPA 1KCVL 1MRFH 5JXAH 4LSUH 1WBYB 1QKZH 1DBAH 4N3UA 4HUWB 4BV1A 1RZKL 4UYQA 1K6QH 2EZ0C 3S3JA 1DJSA 3MGOB 3MXWL 1P84K 2H47C 4KXCA 3GMRB 3LKOA 4DPBX 1WAAF 2GIXA 3BLPX 3CFDB 1MJJA 3VFOA 4BKLB 3OKDB 1YY8B 1SMAA 3MV8B 3JWOC 2WQRA 3PXHA 4OLYL 4WO0A 3N43B 4DP8X 3LEYL 3DRTB 3UJTH 1OT4A 1RY7B 3H9ZA 4G8EB 2KLSA 3RU8H 3IJHA 4AKQA 5F6IB 1XGUA 5EUOA 2D03H 1HILB 4QRUB 3TH2T 3V0GA 1OLLA 2Y5TB 1MQKL 1IGMH 3RTQA 2J5LC 3I9AA 1SJEB 4I5BB 3PGFL 3LXCA 4FQCL 3UABA 2OR9H 4H8HA 4NKMA 3RZCB 5C0BA 1DEDA 3KPMA 4LP4A 5C09B 1XTMA 3HB3C 5SWQB 1NC2B 3PP3H 3HE6B 2D2OA 3OB8A 3S5LB 4Z18A 1ZAGA 4ZS6D 4PY7A 1MAJA 1HC1A 4GW1B 1OTUD 5D1XA 4WWKB 1N3NA 3NT0A 3BH8B 2DYRB 3EYVA 1YQVH 5JHLA 5D2LB 4Y4KA 4OZHF 4I0PD 1HSBA 5DD5L 4V1DE 4D7PA 3VCLB 4D8OA 4ISVA 5IMMB 2D7MA 4EI0A 2AEQL 3MLSL 3U1QA 1S46A 2JIXB 2WVUA 4DP7X 7PCYA 3T6QC 3MBXH 4APXB 2CA4A 4G7VL 4LBEA 3ECVA 2IBZX 5IHBA 3VI4E 1WBXA 1PZ5A 4X0KB 2VR7A 5PAZA 3MFGB 4LQFL 3NIDB 1SDDA 4NCC2 3O45A 4HFWA 2CLZA 4OLZH 3KJ6L 4XNZC 1PIGA 3O6FD 4W1TA 3KDMB 2J20A 3S0PA 5JW4Q 4MXQC 1YC8A 1AZZC 3L4TA 5IJKA 2BHYA 5FS5A 3FO2A 1IEAA 4V2BA 2G5BA 4L9LA 4U1IB 3WS3B 3ZRFC 2R9HC 3RDJA 4A6YH 3OPZH 2DQIL 4FZEH 1BQSA 2FWLB 4YFEA 1KJMA 3GKWH 3IFLH 4Z9KB 4DCQB 2VDLL 3VWJD 5I1EL 1PX4A 3TVMA 3F5WB 2HKHL 4TVPH 1CD0A 3ZZQA 3GSXB 5E00A 3D1MC 5ITFA 3HC4H 4XVJH 3A4FA 4NWTL 2ZOLB 1QBML 1KPRB 2EDHA 3FFCB 4LSTH 4HSAC 4N28A 2DV6A 3BWZA 1J88A 3EFFB 4G6KL 1CD1A 4Z7UA 3UBGA 1NCTA 5H37A 3E9UA 4TLSA 1X4XA 2C9QA 3P77A 5FO9A 5EO9B 2HFTA 4PRPE 1SYSA 4HLEA 5ESQA 1JTPA 1AGBA 3FO1A 4HCRH 5FYKH 5JNYA 4YIQB 4A55A 4Z95H 2X4NB 4F7CB 2V5YA 2R2EB 3U46A 3WFHB 1KTBA 1OY3B 4HOWA 2ZJSL 3WO3B 3AROA 2C3HA 5F0PB 1T80A 5EIIA 3QJUB 1LXMA 3LEVL 4WI9A 1IKFL 1OLZA 2F1AA 2O5XL 1ZSDB 3TN0A 2IPUK 1QHPA 5I6KA 1IGCH 5LWYH 1WIPA 2NSMA 3ELAT 4JM2A 1DE4A 4B97A 4PGEB 4X7SL 5L4MA 4HWBL 3MGTB 2VDRB 4R5TA 4DKFL 1JXGA 1VDGA 3AWFA 5ID1A 2QVFB 1I8UA 3ZPDA 5KSVA 2IDFA 4WW2A 2VB5A 2DQTH 1U2YA 4F15B 1JWMA 2ERJC 1DVSA 3L4CA 3P02A 3PV6B 4RZCB 1IFRA 4G8IB 4X98A 3B34A 1OGTB 3BMWA 4MXVE 5HHOA 4PJCF 1AXSB 3NH7H 4XMWA 1TJGH 1WWBX 3GPSA 3QUZD 4AZ8B 1NICA 1ZXKA 2QFRA 4KROC 3FB7B 3ESMA 2DIJA 1EGJL 3DX7A 3EBAA 4G1EA 1JZ6A 3OAUL 4FXTA 3G08B 4MMXA 4YBLC 4FYSA 5AVRB 2FB4L 3JWDC 4W9KC 4XR8C 3BWUF 4U0RB 3CLFL 5D7HA 4AV5A 4Z7OB 1O6VA 3VXPB 4IBZA 2V9TA 5D71L 4Y9GA 5C2UB 1KGUA 1SEQL 2WWNA 5DJ8A 2VAJA 2NY6D 3T04D 4JB9L 3RQ3A 4IKKA 3ZTJH 2DMCA 2QHRH 4R8WL 1NOFA 4RRPM 4JFHD 3NRPA 5E70A 2XETA 1PGRB 5D7SL 3TA4D 5EIVA 1KIUA 2VSCA 2Y1VA 4MNGE 4I1NB 3LZFL 2DEYX 4JFOB 4KTDL 2XQ0A 3IDIA 4IOSD 1LO4H 3E2HB 1EHLH 1PEZA 4OM1H 3F7YB 4Y8AA 1KXHA 4YBHA 1OP4A 4OTXL 4B96A 1AJ7L 3VI3E 2ZYHA 4YE0A 2H8PA 4LVNC 3RGBA 4J6RL 1E8YA 1HZHH 2XQYA 3APNA 1HH6A 4Q4IA 4M3KB 5K59F 3TT1L 4Y19B 2BK8A 2CXGA 1IGTA 2ILLA 4O5LL 3TBCA 4ZFZB 3S4SA 3VWKB 5B7MA 1O7DE 4HF5L 3RI5K 2GAZB 5HDLA 5B3SB 5GZNC 5FLVA 3B2MA 4UQEA 2X6VA 5BS0D 1M42A 3OG6B 1U8MA 4NP4H 2LFGA 1JRHH 3MJWA 3SDCD 5I2IB 4K2UH 2CKBB 1M9WA 3CZUB 3VD7A 5KYWB 2D2CC 2Y5EA 2VZVA 1U8LA 4GAAA 4KAQH 4OGYL 3FTVA 4GXVL 3S5YA 3TH4T 1WWAX 3DSFH 5AVWB 1SPDA 4LU5L 1OM3H 1YEDB 3ES6A 8FABA 5D70L 1GVIA 5CCGE 1OSEA 3EOBA 1ZSHA 4K5NA 4QKTA 3AM8A 4RMSA 3V6OA 4GRLB 1A25A 2AJ3B 3DX0A 3MROB 3T8XB 4WY7L 4C55A 4E9TA 3D39D 4P3CH 4CC4C 3JUYA 4AY0A 4BSJA 2A83A 3L3HA 3EHBB 1HH9B 2GYSA 3FUMA 3DBXA 3NDZE 1W0WA 1SVBA 2DQEH 1YPZB 3ERXA 3RJOA 1CIDA 1P4LB 2H0PA 1Z9OA 3W39A 1ZLVK 2PP9A 3ARFC 4AEHH 4I3RL 5I8EA 1TQVA 3BT0A 4PJ9B 3BDXA 2TSBA 4UB0H 4ODTL 2IH8A 3KD4A 2OPCA 4KGLA 2AXWA 3P40A 1MHEA 4XOBA 4JQXC 2ZXBA 4NC1E 4R0LC 1WHPA 2P24B 2XWZA 1DFBH 3V2AR 5IOKA 3QIBB 2Z91A 5EFIB 2XTJE 3QWOB 1UGKA 1UASA 5ISZB 2C3VA 3KJ4B 3F58H 4R96A 3K7UA 2AGJH 3UYPA 3NCJH 3QCUL 3UO1H 1MNUL 1KTKE 2QR0A 3SGKA 2E7HA 5GRVL 5IW6B 1D6VH 1MNNA 4KY2A 2B16A 1B0RB 3JQOB 5KS9F 5D1QB 4OZFB 4EI5C 4H1LH 2ARJQ 4OJYA 4PJ6A 3N9GL 2WZ5A 2ZP9A 3SDDD 5L88H 2CDGB 2N7AA 3FU9A 4RGOL 1YUKB 4YXLL 3BFQG 4Z5RA 3QG6A 3PL6B 3OLGA 5E56A 4J3OG 5EU4B 2LR4A 5AD0B 2X1OA 3JTTB 1R75A 2FNWA 2PR9A 2X1XR 3UO8B 4JAMA 4UT6L 4Y5VC 2GEEA 1S7XA 2NQ3A 3TEYA 3ILPA 5I8KH 4PRDB 1U6AL 4I3GA 5ENWA 4JG5A 2OMVA 5HYJD 3MRIB 1XT5A 3B9DA 2FATH 2PMZA 2COVD 1K8DB 1U91B 2WXRA 4K73A 2X7LA 4U1GB 5JW3L 1DJZA 1X5FA 3G3LA 4UZGA 4IHOA 4J12A 3HE7D 5LGHL 1MXDA 2WQUA 1AOHA 1RURH 3H2PA 4G9FA 5EOCL 1S9YA 3EW3B 1UWEL 1G7MA 2IDQA 4UV7H 4BZ2L 4HIEA 4FKEA 1ZLSH 1MRCH 2Q3XA 4IGBC 2BIIA 2A74B 3AREC 4UV4H 4V33A 1JWSB 1NIFA 3T8VA 1UWXK 1G7IB 3ULUF 2VCOA 1N0LB 5IV2B 1LE9A 2G0KA 4L3EA 3QUHA 3Q2WA 5AW7B 1RK0A 3IRPX 3OKNA 1E43A 2BNUA 4YGAB 2ORBL 2DWYA 1NOLA 5BNXD 1U33A 1TQBC 1JGUL 2P8MB 1ID2A 2YS4A 5DFVD 5DHMC 1MCSA 2HG5B 3K5RA 1AR1B 5CIPA 4D0CA 4LCCB 1JHKH 4PJDE 4KNTA 3MV8D 3GJFA 2PYEE 3L3JB 3O8XD 4GRWE 3D85D 1B2WL 5D72L 5BRQA 5EU3A 1UXMA 3QB7C 3LRHA 3DUHA 4HJ1A 4U3SB 4F93B 4W4OA 4NOFA 3ZE0B 2CCLA 5ALBL 3NZUA 4UQ2B 3RBGA 3TL5A 4DN3H 4KH2A 3FUKA 1JNNH 5D7LE 1PW3A 2GPZA 3O2WH 2WTRB 5C0GA 1TTUA 2CG9X 3C5ZB 5DVLA 1X5LA 3LCYA 3QUMA 3QXUA 1SUHA 4BQCA 3FQRB 4R7DB 1WZLA 3UMTA 3O4OC 3QFJA 4N0YH 4JFDB 3CVDA 4UNUA 1NAMA 1R3KA 3FPXA 3EGDB 4JHAH 4OBSA 3F7KA 3FFOA 1JXJA 1AI1H 1U93B 2EE2A 3IPFA 1PF3A 3CQQA 1DCEA 1AR2A 1EFXB 1VFUA 1FL6B 2XYBA 3KNBA 4LL4A 4DH2A 5HP5A 2A0LD 3IAPA 4K9EL 4KDTA 4F3FA 1RZPA 3O41A 1RHHB 3CLEL 3WUWG 3DK0A 2MCMA 2Z4QA 3P3TA 5BVJA 3SQOL 1R0AH 3MRNA 3MV9B 4A2LA 5GRXG 1YUHA 1BECA 1DQLH 2JIXD 4KKCC 4GT0A 2FR4B 5BZWB 2OJEA 2D3LA 2YO3A 3QEQB 3M1CA 2XNAB 1HAUA 4FFYA 5E0FA 4H1LG 1XCTA 3GI8H 5C0CE 2VR8A 4AG4H 1WFIA 1AGDB 1NCWH 4FI7A 1E2ZA 2X3AA 2FZ3A 3QDMB 3HCVA 3ZW3A 4BBWA 1AZRA 3IDUA 5DZOA 2D3JA 2DJ4A 3TBVB 4APQC 4GRMA 2UY6B 4KZDL 1TNNA 2GJZA 4OR1A 4B9YA 2AXFA 1A02N 2XTLA 4ELDA 1FH5L 1EVUA 2D3VA 1GOHA 4PGBB 3WXWL 3WS6A 1ZD6A 3QXVA 4NJAL 4MA7H 3VXNA 2P5EA 2FWOA 4YSSA 3F7PC 2ADJA 3KLKA 1LEGB 4PU2A 4M5SA 1U36A 1RULH 2CO6A 5E8PA 5CZKA 4NM8H 4L3FA 1FAIL 3SCMD 3D2UA 1BZ7A 2EVIA 1BVNT 4ZAKC 1FYTB 2NY1B 1UURA 1QEXA 1Z3RA 3ZN6A 4DNLA 2GTQA 3NFSH 5FAAA 1DBBL 1RAMA 1L0XA 1V3KA 1UWGL 1KJ3H 1MFDH 4DKEL 3NQIA 2NPLX 1W15A 4ZQKB 1Y0LB 1N19A 4JPWL 3ARGD 2FJFA 3MV7E 5FUZH 1YHPA 3OAZH 4HJ0C 2YR3A 2P9RA 3X3GL 2E8ZA 3VRJB 3QNFA 2CR3A 1SFHA 3MLUL 3KWUA 5C3LD 3SOBL 4L0ZA 5AW9B 5ICUA 3LSOA 1DTUA 1SOXA 4PJAF 4U1JB 2F61A 1YMMA 4ZW6A 5I30H 5FCSH 1OF2A 1ORQA 3CIQA 4LOFA 3L9BA 3KH3A 5BV7C 1KY6A 1K4CB 3GHEL 3TEXA 4POZC 1RP8A 5I1JH 1FLRH 1IFHL 4ZTOH 5DYOB 4CILA 3SN6N 3LYRA 3PDDA 1I9JH 4LASL 2E9BA 1MIMH 3HNTH 5GGSB 4JX0A 5I8OL 1IL1A 5KVMC 3KM1A 1V7NH 3BUDA 4NUJA 1AQDA 3WKPA 4EZMA 3UTSD 4FXKA 2WBJC 3GEFA 4X9BA 1A6VH 1G9ML 2YGNA 4JRXE 3UIZA 3DX9A 4LCYA 1NKRA 3V0WL 4I77L 3ZDZB 3I85A 3NGBB 4KKAC 5EU6E 3JWOH 4M1CC 3WNIA 4M02A 1EWHA 1TJMA 1U42A 5I1AB 5DJXA 2A9BA 5CILL 2N7SA 5KYNA 3B9KA 4LLAA 5B4MD 3T5WA 1WZ1L 1UYWH 5AW1B 4ZNEA 5DD3L 4P4RB 2AW2A 4X42A 3CZFB 5SX5K 5JW4R 2NRDA 1FNEB 3O2DA 4UZUA 3PQYA 1FZJB 5TGBA 3N6YA 5D2NC 2C3GA 2FBOJ 5F7MC 4B9JA 3T77B 2Q87A 3X2QB 1KJ2H 1ZVYA 4PJBA 4X5RA 5I66A 4I9WE 1BFOB 5I82A 3WJLA 2IEPA 3VXSE 1SDYA 3SPHA 4YPGA 3LRMA 3SO5A 1OAQL 1ET5A 3QRGH 4MGXA 4M8UA 1U95A 4U7MA 3IBEA 4D9LH 2SODB 3KL3A 4YHLH 4LLYA 1TLKA 4XCNA 3WN5C 2JQAA 1GYVA 3GMLA 4UNIA 2Z0UA 4HHGA 1CZ8H 4XNYL 5D7IF 3DJRA 1IE5A 3ZHFA 5L0QC 1I1AD 3U4EB 3F65A 2AITA 1S7QB 2HWZH 3DTUB 1DN0A 2VZTA 4P4KB 2CGYA 1P5UA 1ZA6B 1EO5A 3SY0B 4BK5C 1A9EA 1PTZA 1QPKA 1TZGL 4OZIA 4P2RE 1QRNE 4XNXL 2NR6C 4CDHA 5CIPH 3FZUC 4NQEA 4ODWB 3LZNA 3DECA 1KEGL 3FAXA 4UQDA 4K8RD 4JE4B 2O5YH 3A23A 4MA8L 5CMAB 3THML 5HGDB 3TV3H 4BH7A 3G6JB 3NCCB 4YDNA 3E0GA 3KS0H 2BSTB 4L3AA 3BRGC 12E8L 1CFQA 3BN9D 1T6BX 1GKEA 4BINA 5IW1A 2VW7A 4TVPE 4HT1L 3RKDC 3QW9A 3QUMH 3VO0A 2CIKB 3TZVB 3ARVA 5CXPA 3R0NA 2KUTA 4GKLA 1CXEA 3MMEA 3S37L 4OQTH 5TQ2L 1L0YA 1PAZA 3QULB 1F4WH 1RIUH 1OSZB 2HTLD 2BNQA 4HLZG 3DPBB 2ZUUA 4NO3A 4R7LA 3ZTNH 3TOPA 3RA7H 4Y2DC 2ZOKB 4DP1X 2W91A 2I60H 2EEFA 5FYKE 1F8TH 2AVFA 4FERA 2EYRA 5E08H 5LNDA 1MFEH 2AJXL 3EO9H 3IFPB 2IWEA 5FIEA 1ICTA 2CBOA 5JHDB 3MNWB 2B20A 1AS6A 1OD9A 2WN2A 1URIA 5D9SB 4K3EL 4NO0B 1HCYA 5ACZA 2RFXB 4IIQA 5CKAA 3K46A 4FFYH 5JHAA 4XO8A 5F8QC 2JI2A 1AG0A 5LJYH 3QDGD 1BEYL 2FBJL 1QAWA 3D69A 1NL0L 2APXA 2KYIA 2WLIB 1Z9SB 4HP5A 4OCYH 1NDGA 1Q9KB 4ZZKA 3KMDA 2WQVA 4XXDA 2KC0A 2V33A 3CFBB 1G7LB 2CGZA 2X6AA 4KRPC 4KXZH 1HHJA 3I6SA 4HIHA 2EUVA 3PE9A 1P6FA 4HZAA 1HXYB 2VC2H 4K0OA 1JZHA 2VDMB 1LP9F 4H8VA 3FTGB 4AQ1A 4JO2L 5DEGB 1HXMA 4KMTH 3NJVA 1WCBA 1GOGA 5TPWH 3P69A 1CICC 1JN6A 1XGQB 3FT4A 4ZFOA 3E8VA 1EBPA 4FFZA 1DANU 2EXSA 5FHAH 3V9FA 4AZUA 2EE6A 2F54A 2ED9A 4HJGA 1NKGA 1RIVL 5DEFB 3TO4B 1TYJA 5KJRL 4L5FH 3L3DA 3WN6A 5IHZB 2CDEA 2H32A 1CQYA 1MWAA 2HZHA 2EICA 2AC0A 1X9UA 3BD5A 4NQSB 1EHKB 2ISDA 3KPRD 4ATWA 3RL2B 1FVEB 4LMQI 3HRZB 4KH9A 3VI4B 1EFQA 1ULVA 5JYMA 5HGBA 1P5VB 1P2CB 1E4KC 1CGYA 1DDTA 4Y16B 3CU7A 4H2CA 5MHSD 1I53A 2RBLA 2IVFC 4AMKL 1X5IA 1XH3B 4N2DA 1NQBA 1PQZB 1J5OH 1D5ZA 2P8PA 4RWYH 1TQTA 1JZ4A 2VL5B 1T83C 5MEQA 4AKOA 2ENPA 3KPPA 2B5IC 5E2WL 5EBWB 3UFIA 2YRZA 3ZL2A 2ARJB 3AXLA 4Z0XA 5KVEL 3QC6X 3Q8CA 2YD1A 4MNQD 1E27B 4UUJB 3RY4A 1VADA 4CRPA 2GBVA 4QRQA 4NWUH 4K5LA 3GUFA 1BPLB 3QPXH 3LZOA 1I4FA 4HHAB 3VQLA 1WCQA 5J4MA 1XGYH 5CGMA 2I32A 2ICCA 3IJEA 1N5YH 2VLRA 5K1JA 1X3DA 2WWMC 4LFHD 4ZTPL 1T7WA 3LRKA 4LPWA 5K9OB 2H2SC 2CGRH 1KNOA 3C5ZD 5EUOE 4AQ8A 3AS1A 1MHCA 2YKLL 5IMLB 3GUTA 3JV0A 1GYCA 2WBWB 1GTNA 3GMQB 5DUPL 3HKFA 2XWTA 4XVTL 4O02B 4OZ4B 1R4XA 4R3SA 3TURA 1UA6H 1BQLL 1F41A 1SXAA 4PRPB 1MI5A 6FABH 3IETA 5C0BE 3HBQA 3FRPB 4MTMA 4ZAKA 3DBSA 2YPVL 1BVKA 2VDRL 1FBIH 4RZKA 1QEWA 2DLGA 4XCEB 3QUXC 2O6DA 5T5FA 1CI5A 1V5JA 3VX0A 5K69A 2EP6A 1LK2B 3T4AC 3VTMA 1M1XB 1F97A 5D1XE 2GEQA 4B53A 5GGUA 2VDOL 3BZ4A 2ZSVA 3DJTA 3GSNB 2H5UA 4YDJA 1L0PA 1KIPA 2J43A 3M46A 1Q9OA 1YYMH 3R18A 3MV9D 1TTAA 3WHXA 1TTBA 3MLXH 4S11A 2M1KA 2XIIA 3GXMA 4ZW7A 4IK6A 3UAJC 2K4AA 1QBAA 3BVWA 1YG9A 2Q7AA 2V2XA 1WISA 2X4PB 5FGCE 3REVB 5GS1A 4QCIB 1QO3A 3IDMA 4O2CA 4OM0H 3N1PC 4L4TA 4PW9A 2V5TA 3QIUB 3FRUB 3IVKA 1R5WA 1RK7A 3OKMB 5TTRA 2HH0L 3SZ6A 4UNVA 3DO3A 3OXSA 5TE4L 4BIKA 2DKMA 3K8MA 1BBJA 4F58L 2GT9A 1NINA 4RWHA 4A2DA 5HDRA 4EI6A 4ES9A 4XBGA 1B2YA 1PZAA 3DV6A 2B4CH 4YDKH 4HFUL 3ZIYA 3OKLB 4N0CD 1TZOA 3PG2A 5EU5A 1I8MB 2ZXGA 3LPPA 1KGYE 2EE0A 2EINB 4JW3A 4K23L 5EC1B 2VR3A 3LNFA 5DZVA 3COOA 3TIEB 3L1OL 4Y7OC 1N0XH 5L8LB 3JUZA 2HRGA 2NYYC 3OB0K 4NJ9L 2WVVA 4Q89A 4U1MB 2BO0A 4MNGB 3ZE2F 4BCYA 5KBLA 5CNHA 3DMMA 2YOAA 3SDAB 3PUUA 4HH8A 3TFKC 1EQWA 3VFMA 2PXYB 5EA0L 2IANA 3EJCA 2CKBL 3QXTA 3B2XA 3NJIA 3VI3B 2VR9A 2XFXA 4U4IA 4F7KA 4Z7UE 4BCXA 1I85A 2FCBA 3KPSD 4WGWB 2CUAA 4ORGB 3SKNB 3D9AL 4G42A 1JPEA 5AZ2L 5KG9A 1U30A 3GSOB 4WI7A 4NRZB 5C0EA 3BP7B 5J6HA 2DWDA 4IRSB 3I75B 3MJ9H 5I0YA 4HS6B 2FUTA 1AQKL 1R3HA 2V2WB 3KYMA 5EO0B 1TO4A 4OIFA 5E51A 3INUH 4GUQA 4MSWA 3NCFB 3AY4C 3EJTA 4JFYB 1AZUA 4WFHE 3WFBH 2MMXA 3L3OB 1XIWC 3UPCA 4IIZA 1QTPA 5JLZB 4JZNB 4XBPB 2W95A 4WGKA 1CPUA 3EXLA 4RNRA 2VAAB 2BP0A 3IGAA 4D3CL 4JREC 4Z7NE 4PLJC 1LO0H 1LO5B 1ZA3B 2Z8SA 3LD8C 3MTXA 2YAFA 2XPGA 2ZYIA 5C7XL 3LRGA 1TTGA 3QRBA 1XD0A 4JFEB 3TBSB 4NN7B 4UOZA 2BY2A 4OU3A 1QMUA 4YJZL 3Q2NA 2BVUA 3ZYIA 2JXMA 4GAYA 1J8RA 4X6FB 2P3YA 5HHOE 4PG9A 5EIQA 3DOSB 3PU7A 4CMMA 5BOPA 3UG3A 4XNUH 1NZRA 3S8WA 3K8LA 5DWUH 4HPOL 4PJ5A 5IB4A 1RUKL 3DI3B 4RISH 1QNZH 1SOQA 5GIRB 1BA9A 2ENJA 4XX1E 4MDIB 3A47A 3WFDH 3T65A 2CIIB 4PN6A 5EC2B 1PG7L 1XTLA 3JV5A 4Z7AA 4P5KA 4FFZH 3VG9B 4PRAB 4A2EA 3FOMA 4QHNB 1OGAE 3ZDXF 1TJHH 4H5SB 2FD6H 3BJLA 1OP5H 4YOKA 2MPAH 2H32H 1MWAH 3QCTL 1LILA 5DMIL 5CJOH 4NRYA 4P2CG 1JZDC 2XTJB 3L7FA 5KBDA 2CWRA 4P49A 5DJZA 2ALAA 5C0ND 1QHQA 2YMOA 2GBAA 3HBGA 1F4HA 3JVFC 4XWGL 3OHXA 3K81A 1Q9LA 3U4KA 4BCZA 4E41A 5FECA 1XR9A 1NCUA 1XF3B 2QQNL 1IVTA 4FI8A 2A5UA 1DBMH 2VR5A 5AZUA 1QA9A 3K2MC 3WHE1 3WIIH 3MO1B 4OLVH 5T8IA 4P4KD 4EIGB 4E0RA 3WMPA 2WUBH 1INDH 2H6PA 4PRBA 1CFSB 3MPCA 2OMWA 5DF0A 4PJ8A 1JCKA 4R5XA 4IS6A 3HMXL 4I48B 2OTPA 1NBYA 4YO0A 1EA9C 2VTFA 4AL8H 1BAFH 1LD9B 4DO5A 1ZT7A 4NN5C 2GK2A 2YMXH 3VACA 4CU8A 4P04A 4PWEA 3SZKC 1PPIA 3HJ0A 4URKA 3KYNB 3L7EA 4YHZL 1OTUC 1JVKA 3GK8H 1IQDA 1BM3L 1XGRA 3FQNB 4I0PC 4NI3A 4NENB 3BPCB 2O93L 3OMIB 4MAYA 1DVFD 4YSQA 3AGWA 2W9DH 1HL9A 4M8QA 3PP3K 5JUEL 1CFVH 1NCNA 5FYJH 2HT2C 3MODH 1UKQA 1IGJA 1QR4A 3RPIB 4KHTH 2XV2A 2Y07H 5T5FH 1MH5B 1V3LA 3AVEA 7PAZA 1X44A 5IB2B 2AAVA 4AIOA 4QXUL 1FVCA 1GZHC 5GGVH 4XTRC 4P48A 1S7TA 4LCWE 3WHE0 2NY5L 2BP8A 3FQ1A 2R1XA 5JHDD 4OJDH 5IUCA 5L4JA 1HEZB 5F7WC 1OAZH 2YPLA 2D3NA 4NO0D 1AS7A 3TO2A 1R9FA 4GINA 2G2NA 2XKNB 4HXBH 3UTPD 3WGVB 1KWKA 1F02I 1UEMA 3HZVB 3OG4B 5GRZA 1OD7A 3FCUB 4WVRA 2XYCA 4HALA 4S2SA 3WJJA 4OD2A 5AB9A 5FM4A 1ODUA 3QE5A 2H6OA 1RJCA 4PUBH 3WENA 1JTTA 3WKML 1DBKH 3L3KA 3TWCL 4EDWH 4P23B 4P2QA 2BMKA 1ZIAA 3BUYB 3VA6A 2Q7YB 3DO7B 4M1GL 4OGZA 4OFDA 1CXHA 5FYLL 2X6MA 1JGLH 1V7MH 1ET7A 3ETBF 4GAJH 3RPIA 3JTSA 4FQXA 4PYGA 4XO4A 4E36A 1F0LA 2AXHA 4EJ1C 3CV5A 2X6BA 4NZUH 5E9NA 2L7JA 3X14A 4FNUA 3T3PE 3O3UN 4E9YA 3H7LA 3FQXB 3X13A 1ZLEA 1I1YA 1A5FH 1PD1A 3DXAA 3BAEL 4ZMZA 1CLCA 3FN0H 2Q8BL 1VB9A 3L9RA 1MCLA 3LN4B 3M86A 1G0XA 5SV4A 3HI1A 5C6TH 1I7UA 1U8HA 5KVFL 3GBDA 3BVDB 4U49A 4K3JL 4X6BA 1CR9H 1S5HB 3HR5A 5FO7A 1O7VA 4G9FE 1MVUA 3OLEA 2IAMD 1TVBA 4NM4H 3HN3A 1EERB 5JQIB 1U58B 2WP3T 4RA3A 1A65A 4F9PA 3H9HA 4M9OA 4AJWA 3KG5A 2Z9TA 4G6AD 4DAGL 3DYOA 4N9OB 5DJDB 3QYMA 2AJZB 4L3EE 2QHLA 3C6LA 4J3UA 1I9IH 1S8DA 3B1UA 3BC9A 1MCWM 2YGPA 3M7FB 1TZHA 3QUZC 1WO2A 5HDQL 1PDKB 2EYSA 2JTYA 2P1YA 2CO7A 4I4WA 4M4RB 3V6ZA 3FUIA 4J3SA 4C56A 3BJ91 4AMXA 5HYSA 4LVEA 2NLJB 4X4XA 3GLEA 3HI6H 1NMCB 2A6JB 2GW5A 3GHBL 1UADC 1FV1B 1FZKA 1U8JA 2A9NH 2AJUH 3UBXG 2RALA 4HSCX 4W9JC 5F8RC 1HESA 4LEOB 4ONHA 4DO6A 3DIVA 5I15H 1G1CA 2NY3D 3TJPA 3SE9H 1VFMA 1FPTH 1CLYL 4HX1A 2EYTA 3EJZD 1J5DA 4TUOB 5K9QG 4HWBA 5AAWC 1HZLA 2KERA 2SEBB 3DGDA 3M17A 5T33L 4FG6D 3MV7B 4U31A 2VO8A 4P57B 3SGDH 1UZGA 4KO6A 1A7QL 1OPGH 4P5MB 1F6AB 2F1BA 4KK8C 4XP6L 2YEVB 2B1HH 2K45A 2X41A 3QQ3B 3N91A 1KFAL 4QF1B 3BESR 2EVHA 2ZD0A 4WDIB 4EN3A 4CKVX 2K9FB 5KSBA 2ATKA 3U82B 1EGJA 5TDOA 4Y4FB 2FO8A 3VMNA 4NPYA 3GMPA 3FXIC 2HFGL 4NRXA 1DL7L 43CAA 2ITEA 4HWNA 4ADGA 1QQDB 1XSJA 2APSA 3O11B 1M7XA 4XMTA 2CRZA 5EBMA 1U3HD 5F71A 5GPRA 1PZSA 1S9VA 4OCSH 3MQIA 4PV1C 1QFWL 4MASA 1CL7H 4GG8B 2NT1A 3AU1A 5FK9A 1M1SA 4JRYD 1BOGA 4POYA 1NGXB 2UVEA 4LRIC 3BW9B 3CH1A 2MH4A 4ZMPA 4JRXB 1HQ4B 4QRPB 5CLZA 4XGZB 4M7LL 3Q6GL 3TA3B 5EU6B 1F3JB 5D7JC 1U3JA 2CAKA 5EF2A 1LLAA 4C57C 3UXFA 1ZMYA 4J1UB 5SX4H 1AIZA 2DZEA 1MWOA 5EG6C 1YEKL 4H8QA 4M93C 2CDFB 5CZVH 1T5KA 4BSWB 1J0JA 1D5IL 1H3PH 5C0FB 2O6FA 1XCQA 1P6WA 2NSQA 3RIAF 3RWIB 4YEFA 3NCYP 4HHWA 2VN3A 2P5EE 1P4UA 2ZKXA 3BFWA 1CLOL 2G75A 2IWGA 4M5ZL 3J8F7 4U1SA 3OX8A 3O3AA 3SJVD 4FJYA 1OE3A 2YJQA 1BVZA 3NIGE 3IMVA 4KUCF 3FC8A 4UTBL 2XZQH 2PXYD 3QDJE 4NCC1 4L5FE 3VXSB 3BP6A 3CQFA 5F7NC 1EEQA 4KTGA 4OLYH 3LJ3A 4UT9L 1PLGL 1FYHB 3S96B 3VFNA 3LEYH 2K9UA 4PJIE 4QIRA 4Y5XC 5INCB 1AHWA 1J12A 4Z76A 2LQRA 1BF5A 2HG0A 4LSSL 3LKQA 4GP8B 3FYEB 1A8JH 4N86A 4RH4A 5IGXH 2ICWJ 1UD6A 4UT7H 3QUKB 4P46B 3IBOA 5JQ6H 2YGVA 4P05A 5JYLA 5GXBB 5GJTL 4FQCH 1AP2A 1JHTB 3WO4B 3KGSA 1CXIA 4QOKD 3VFUA 1HHIB 4R90L 1X5HA 5CGYD 4P2RB 3Q7JA 5FGBC 3TWYA 1CE6A 3B5GA 5BW7C 4UDTB 1YMME 3NCMA 2IO5A 4IBLT 4XCYB 4W6YB 5EEZA 1QI5A 1LK3L 3F64A 3GIZL 1R47A 1SY6L 3IDXL 3SDDC 2R2BA 1GL4B 1JS4A 2VLLB 4NKQB 4DTGL 2XXGA 3O4LA 4A6YB 2W0FB 5CGTA 3ZKXC 1TCMA 4I3SL 2A6IA 5CHNB 5JDSA 3U36B 1E50A 5E4EC 4PVLA 1XZ0B 4IKLA 1DQML 2BVPA 2EXYD 1KPUB 3P3RA 4U1NA 3QUGA 2GK0B 1GGBL 5T1KB 3RHWF 1O5DT 2AQNA 5TDPA 1BF2A 3HZYA 1KMGA 4G7VH 4AVIA 4WWOA 1JNLL 5CFAA 2NY2C 1GJIA 1EH9A 2OX5A 3EO0A 3HE7C 2X6CA 4LQFH 1QPXA 4Y4HB 3KLDA 5I9QC 2CPCA 5GJSL 1OWWA 2J4WL 3ZHDA 5D1ZC 1OTTD 1XHHA 1WIOA 4IW4C 4L48A 4AI7A 3PV7A 4CGUB 3UPAA 5DJCB 2Q86B 1DBJL 3AWGA 3BP4A 4GAFB 4ZNEE 3EH2A 1MW1A 2JJSA 4K7PL 2XFGB 4WU5B 3PQYE 2YN3A 4EZJA 3K8KA 4FHKA 2YAMA 3TYFB 2QGEA 5ICYA 3NFNA 4KK9C 4UMGA 4Z3GA 1UB5B 1U8CA 2O72A 2DQIH 3BAXA 2VDML 3EOAB 4UT6A 4IBTA 3GO1L 3HLAB 4P9MH 4NHCL 5BQDA 4JCMA 5I1EH 2Q7NA 2UXGA 2XWBA 3P0YL 4HJJH 1AGCB 2IOOA 4KO7A 1NIAA 3O8XC 3V6FB 1ZT1A 4U6YB 2QSCL 4NWTH 2VQ1B 1X5ZA 4UM9B 3O6FA 3FQ2A 3LZPA 3NZHH 2K6ZA 4X5QA 4G6KH 4UMSA 1QTSA 5AZEL 5J1AA 4PTTA 2PCFA 2AI0L 4AENA 4G5ZL 3ZKND 3IDYB 3JVGC 4BZ2A 5KN5B 2PPFA 4GPVA 2UXTA 5L8JB 1AMXA 5SWSD 3WLBB 3ZO0A 4DPAX 3GSRB 2NUTB 3T0ED 4OZIE 2UZIL 1HKLL 3DWTA 1QSVA 4NQEE 3VWJA 3T2PA 3J2PA 5IOPA 1IKNA 3F84A 1MUJB 2D8KA 3MRQA 1MFUA 3CC1A 1E65A 4C8XA 2D7OA 4M6NL 4QI3A 1UQSA 15C8L 4GQ9L 1IC4L 3IFNH 4GH7B 4BFRA 3VE0B 2A0LC 2O5XH 2PR4H 1T7XA 1OE1A 1GH7A 1D9KB 3KCPA 2DKUA 4X6DA 4NX0A 4X7SH 2BSRA 5LG1A 1L9PA 4C47A 4QRSA 4DKFH 1I3GL 3R4DA 3S2CA 3MRKB 4ETQB 1PFCA 4MS8C 3Q8FA 3OR6A 3FB6A 2ZUWA 2BRRL 4DZ8A 2AQQA 1G6VK 5DK0A 4JKWA 2BNQE 3NCWA 4L8CB 1IIKA 3C2AH 4LHUD 4G3YH 2OSWA 4MQ7A 1EGJH 1TTCA 2F58L 4J5VA 4R9HA 3OAUH 3S97C 1JFQL 4LGPB 5AYQA 1N59B 3CLFH 1WEJL 3TBTB 2Z31B 3B56A 2ADYA 3BPOB 1GGTA 2ZCHL 5DCCA 1KCLA 1SEQH 1MJJB 5J9PA 4JB9H 1LMKA 3K91A 1N68A 4O9HL 5JOPD 2QPSA 4JLRA 4R8WH 1OHQA 2J2ZA 4ZYKB 4E9WA 1I8AA 5HD8C 3BCDA 5D7SH 3MLTB 2X38A 4KTDH 4WFFD 5EUOB 3ML8A 4P3DA 1WLHA 3SCMC 2VJXA 3Q0HA 3RTQB 3GSNL 5C0RL 1M3IA 1AJ7H 2JTDA 2AQTA 2A9CA 1RPKA 3SO3C 3SBWA 4J6RH 2QADB 3Q6FB 1YYLL 1XBDA 3BSZL 4BQ9A 1FNGA 2AS5M 4O5LH 3ARGC 1XFPA 4HF5H 1BCIA 4X8JB 1HJCA 3VM5A 1S9XA 3D50A 4ANVA 1IC5L 3U1PA 2VITA 3ATFA 4M6AA 5D1XB 1A66A 1N3NB 1XB6A 4GW5B 3HPLA 1DP0A 4PG2A 2Y7LA 3R19A 4JR9H 4OVUA 3H7BA 2F54E 5ADOL 3B9EA 3E3QC 4OGYH 2P7TA 4NZTH 2X4OB 2DQDL 1KB9J 1G0YR 4F5CE 2GJ6D 4NQXA 1FE8L 2Y6SD 3N0PB 4ODBD 2BNRD 5FGCB 1KBPA 4LU5H 1DQJB 4EAEA 3BGAA 1F4AA 5FOBA 4LBEB 4P07A 3IPEA 4ANUA 1VFBA 1PZ5B 3D30A 3RY6C 5BS0A 3B8SA 3CE1A 5JQHC 4KJQC 4WY7H 5CBEA 3SDCA 4HFWB 1G1YA 1ZJAA 2CLZB 1NEZG 3GSUB 4ZW5A 1K3ZA 3UGUA 4JZJC 5F9JB 4X9IA 3IDGB 5CM1A 4NZRL 5C0AB 2HPOA 3IMUA 5FWRA 2VDPL 4H1LB 3EUDA 3WEBA 3ZIMA 4I3RH 3GBML 1YNTF 3IEAA 2Q5BA 2X89D 1IEAB 4OFYD 1T2QL 1SUJA 3WJMA 2ZWZA 2G5BB 4L9LB 1JIBA 1YEHL 4JY5L 2IC2A 3VVVA 4G71B 1ETZB 5IJVA 4P9HL 1TUPA 4PSRA 3CZEA 3RWDA 5B4MC 4R97C 3ZL4L 2ZWSA 2A7BA 1R5IB 2VQTA 4XNQB 2VLRE 4B0MB 2FYVA 1K8IB 5E00B 5ITFB 3G5YA 1ZV5A 2ICEC 4RGMC 1NGZA 5FA3A 2F5BL 2RA1A 2YN5A 3WE6A 4D9RE 2AKRB 4MMZA 2WTPA 3TCLA 1YSOA 3FN3A 1CD1B 2WSPA 4Z7UB 1UH4A 1HEHC 1YQ2A 3DRQA 2OQJB 4ODVL 1NWPA 1PJ9A 3PP4L 3KYKH 3P77B 4PRHD 3VFTA 3VGAC 2YRPA 2OM5A 3QCUH 3P0GB 3GSWB 4N0UE 5FYJE 1KTRL 4PYHA 4MYWB 4WWNA 2X10A 4DIXA 3FO1B 3N04A 3QWNA 4LHQB 5JPNB 1M7IA 3LRSB 5JNYB 3CFKA 4N90E 4G43A 3WIFA 1QG3A 4N8VB 1SEBA 3U46B 1MFNA 1Q9WB 1FZMB 1SGKA 5IVXF 5ETUA 2E8YA 3N9GH 4HKXA 4OJFL 1T20A 1CXLA 2DH3A 4YXLH 3ARPA 1NPNA 3WY1A 5E23A 5F7EL 4LVHB 5TJWK 4OZGE 2WWOA 4TKWA 2UWEF 3O6LL 2WCSA 4JM2B 4OT1L 2I26N 4ELKB 4Z7NB 4K07A 1G43A 4AH2A 4TULL 4K8RC 2DRUA 4WW2B 4KQ3L 1KLFA 3X11A 3S88L 3C6EA 5JXED 4L4TE 4XMPL 5CZRA 3IGFA 4PJCB 4MWFA 5FGBA 3TCTA 2EDTA 4QRPD 1X5GA 3MBEC 5ID0A 1A4KB 3WNLA 3MLWL 3BN9C 1A7RH 3RP1A 3T3MF 2X4SA 5LGHH 5DSCA 4XN8A 3CWGA 4WO4A 4BZ2H 1TZAA 3L6FA 5EU7C 4JQVA 2ZUXA 5KYUB 4NKOA 3TX4A 3SPVA 5K1VA 5IROD 5IK3A 1L5GB 5LVEA 2QBWA 4N2HA 5DJ8B 5AW0B 2HTLC 5F7DB 3S2AA 1X7SA 4FNPA 4YX2L 3PHQA 1RZGA 2ORBH 1OGAB 3A3YB 4ZUTB 4HBCH 3RWJA 1JGUH 3FNKA 3ZUNC 2O26U 2WKOF 5F3HA 2H2PD 1KIUB 5C7ZA 3GXFA 3T71A 1KIRB 1D5MB 1ROCA 5DJ0B 4FQQB 2XG5B 3I6KB 3GSQA 3ZJAA 1A7PH 2VKXA 5D72H 1T22B 2IANE 3CFNA 4EOWL 4P8QA 1JF6A 3PHSA 4XOCA 1NUNB 3PJSB 2BDNL 2Z35B 3U7YL 3CN4A 2H8PB 2RR3A 2QQKL 1ORSA 5ALBH 2X2UA 3NEEA 5HBBA 4F57H 4FGMA 5EOQH 3DUSB 1WBYA 4NFCA 1KUMA 3FT0A 4IBQA 3EYSL 4D9QD 1MELA 1PMYA 4ZO7A 1YA5A 5EN3A 5D4HA 4E9LA 3L1GA 3H1ZA 1U8MB 2RMNA 3FONB 3CFDA 4BKLA 3HC3L 3D06A 3AUWB 3OKDA 4IEFA 3MV8A 3MOAL 3AMKA 3CDFA 1FFPB 3D85A 3DRTA 3NPSB 1FNFA 2XA8H 1HILA 3V9CA 3LXAA 2WWKO 3P2BA 4QRUA 4A68A 2Y5TA 1FVDB 4K9EH 3WTXA 1R3IL 3L5WB 3CN2A 4HIXL 2WYTA 3ASNB 2VDKL 2H26B 3L1EA 3LQAC 4I5BA 5J1TC 3T0WA 1P7BA 4Q97A 4YHML 3RGVD 3MUZ1 4ZXBB 3NTCH 3GI9H 5C09A 3QIWB 3QORD 2X1PA 5FKAA 5TE7H 5SWQA 1NC2A 1QFWI 4QLRA 5AW6B 2ZOOA 3DBXB 4ICXA 1W0WB 3S5LA 4EUPG 5D8JL 2UZYB 4GW1A 3W39B 3GM0A 3HFMH 1CDHA 4Q9BA 2N4IA 4BFIA 5I8EB 1R3LB 4PJ5E 5D2LA 3STLA 5I75B 3Q05A 1EX0A 2YLHA 3HFFA 5IBLD 5F89B 1Y07A 2XXFA 5IMMA 5DLML 5CBAA 1OCOB 3GZOA 4LCWB 4WRLA 3V5KB 4AXWB 1MFCL 3SYOA 2JIXA 2FHFA 5K1NA 1QSFB 4PV9A 4APXA 2YAEA 3WXWH 4CUCA 4NJAH 2R0ZL 2R2CA 1IAIL 2JCCF 4I88A 1KWGA 1AE6L 4PJXA 4F2ME 3PAVA 4JFFD 4X0KA 1RZJL 4MJHA 2Z91B 5HVGB 1NLBL 2WB1A 2XV3A 1FAIH 4TV3A 1NGQL 1LEIB 2G30A 2IOIA 3UYRH 3ULVC 4IMLB 3UYPB 4E41E 1G7HB 1DBBH 4AVHA 3KDMA 2E7LA 2QR0B 2EUZA 5I23A 4DKEH 4PGZA 4Y88A 2ZG1A 5CS7A 4JPWH 2J5WA 5D7KD 4TL4A 3F62A 3F12A 3WS3A 2G3MA 1MF2H 1MDAA 3CXDL 4AQZA 4U2YA 3WTWA 1QSEE 2DF3A 4UQ3B 3X3GH 3RYMA 4N2FA 3T3PB 4H2AA 3MLUH 3B7TA 4PM1A 2AJSL 3F5WA 3SOBH 4LL1A 1WBZA 3Q43A 2J5LB 4Z3EA 4U4BA 2CJUL 4XI5C 5H2BB 2ZOLA 1QVOB 4PRID 1IBDA 3I2CL 5JR1L 1C12B 4OCXL 3EFFA 4JO3H 5JW4M 5ENWB 3VVWA 3GHEH 4J3OD 1OSPL 1NFDE 1KJ2B 1V10A 1F2QA 1TF4A 3HB3B 1ES0B 4AE0A 5EO9A 4RMQA 4J6IA 1IFHH 2JB5L 4JM4H 2ZKMX 2YWZA 4TUKL 3VXUB 4ERSL 1K85A 4ZX3A 4G9FB 1OVZA 5FA4A 1OP3K 1P4BH 4XP4L 4R26L 3F01A 3U0PB 2FWUA 2VM4A 1ML0A 4YIQA 2X4NA 3QPQC 4F7CA 2F7IA 1YO4A 2R2EA 3HNSL 3OSVA 4GXUM 4U2ZA 5DYFA 3WFHA 3TESA 1H5BC 2P49B 1G9MH 1IJ9A 1OW0A 2E7BA 5I5RA 3T2OA 3V0WH 1E28A 3OZ9L 1LE9B 4JPKL 4KX9A 1DUZB 1HHGB 1MAML 4XE0A 4HCIA 1ZSDA 1RK0B 5L2KD 4CNIB 2Q0ZX 5HYQB 2X53A 3ARDD 3V9EA 3MLVH 1UZ8B 4G7YH 5CILH 4X6CF 1F00I 3ESVF 4QRFA 2YPVA 1YEGH 1QFWM 2XBDA 1WZ1H 3T0AA 4HKBB 3L3GA 4OGAD 3T6WA 3IJSB 5HJBA 3GLDA 3FF8A 4DEPB 3PV6A 4AGLA 4G8IA 5EU3B 5DHVH 4JS7A 1XAKA 4M43L 3ARUA 5HDOA 1AXSA 3GZPA 1UVQB 4AZ8A 4CVXB 3BE1L 3VFRB 3PFUA 3AXHA 5C0GB 1I82A 1QKZL 3K5SA 3G08A 1CLVA 1TT6A 1K6QL 3QUMB 5CCKH 3KEHA 4PVNA 4P2QE 1NBQA 5LBVA 3VXPA 4IU2B 3ZDYE 5BRPA 4PGCB 5E2VH 2CQVA 3QCVH 3V7AE 2YQGA 1JZ2A 1ZS8B 4YXKL 4LSPH 2AEPH 4DGYH 4RMRA 3V7MA 3UJTL 4KZEH 4XNYH 2E7CA 3PGDB 3RU8L 2X1WL 2J8UE 4RA0C 4U6XB 4JMNA 5ABZA 5GGVY 4N2EA 1LVEA 3M45A 3DV4B 4F3FB 1TZGH 3O41B 1IGML 1BXUA 1WFUA 4LIQL 3S98A 3FT3B 4PIBA 1PKQE 4XNXH 4CVWA 2WM0A 3DXAE 2AQRA 4TUJA 1HVXA 2OR9L 3MRNB 2NY4D 3H55A 4ZUVB 4R4NC 3THMH 3W82A 4R2GC 3LVEA 3KWWB 3WIHL 2DB8A 2HUEA 3ZE1F 4ZFZA 3VWKA 2WIIB 2GAZA 1SZNA 1GKOA 4AC2A 4J4PC 3ARBD 1IMHC 1I1AA 4L2YA 1WUZA 2WXHA 1SF3A 4XZUB 5I2IA 2CKBA 2WYIA 2AZUA 1IT9L 3ORJA 3HS0A 3S37H 5B1CA 5C0AD 4FFWD 4GRMB 3VFVB 1T1WB 5TQ2H 2GJZB 3D34A 2QZ5A 2VC2B 3HG1B 3LS5L 2WYZA 4KFMA 4QO1A 4L0YA 4R6UA 1OAKH 2AFNA 2NCEA 3UP6A 5FFLA 4KI5F 1YEDA 3MR9A 2F9BT 3VXNB 2GHWB 3MLRL 4C56E 4FYQA 4PLOB 5E9DD 2ICWB 4GRLA 4LSQL 2AJ3A 1RZKC 4XN9A 3MROA 2CHZA 2HCZX 4TVSa 5E8PB 3T8XA 1JXFA 4KROB 3NIGB 1A6TB 1XDTT 3P11L 1YJDL 3D2UB 1BZ7B 3OKYA 3QR1A 3QDJB 4OFQA 1ET8A 4YBLB 5CJXC 2XG4B 5AOKA 3VRIB 1KLUB 1A6WL 1KB9K 1MFAL 2YAHA 2YBGA 4K3EH 2V3FA 4PJIB 3VYPA 4G6ML 4NIYE 4XHJC 3W3BA 4B5ZA 4A04A 1YYCA 4GSUA 2FBJH 4JFPB 5IT2H 4FHBD 5F7YC 1NL0H 5GRUH 5IMOA 4A6YL 3OPZL 2BZDA 1GMEA 4FZEL 1VZIA 1CYXA 5ESAB 3G9AB 4A66A 3IFLL 3SKOB 4JN1L 2QJDA 4B7LA 1UC6A 4CGTA 2Y5QA 4TVPL 5IM7B 5I26A 4LPXA 3BDYH 4XVJL 5KSBE 3LZLA 2VZUA 4TQHA 1YMMB 4LSTL 3FOLA 4DF9A 3TTSA 3SGJA 5EFIA 1USZA 1J86A 3D7PA 4LVNB 4CVUA 4JO2H 1LQBC 4ODXB 2WLYA 4OCMC 4RIRB 3V0VB 2YGQA 3QDGA 3MRBB 5F1OB 2J8OA 2ADGA 3VQMA 3GC3A 3MRCB 3I9GH 2C4XA 1RIVH 4ODHL 4HCRL 5IW6A 5KJRH 1MY5A 3LVTA 1B0RA 1VENA 2ZWNA 3QP3A 4N6QA 4TPRL 1N2RB 4NUJB 1LWJA 2G4GA 2H41A 5D1QA 4FXKB 4OZFA 3P9LB 4A63A 2NQCA 2CDGA 5I73C 3C6SA 3ABLB 3UZQB 4HIPA 3HN5A 3B7YA 1IB5A 3VXRD 3NJJA 5EU4A 3WIAA 5AD0A 1KIQB 3JTTA 1XR8A 3HW7A 1IGCL 3L2NA 1X5JA 1OO2A 4H44C 1L9RA 1MCWW 1TO5A 2IG2L 4EVNB 2Z6FA 3DSNB 4UILH 4AMKH 2UY7B 1KXVA 3JTBA 3JSSA 4L3CB 1CBVL 3H8NA 3X1BA 5EDXA 4QNPE 3MRIA 3FPYA 1UCBL 3HBZA 2C3WA 5E2WH 5E95B 4KVCH 1K8DA 3K72A 4RSYA 2BFGA 2E9GA 4DP4X 3PQYB 5KVEH 3X1NA 3FMGH 3NH7L 1TJGL 3HMXA 2ED8A 4FQLL 4EKJA 4Z3JA 5MEPB 2DBJA 2B3RA 1LJMA 4YLBA 2ZOWA 4YPGB 2A74A 3MI6A 3VRLE 4MB3A 1BYOA 4E9VA 1G7IA 1U95B 5F9WC 3AMLA 4UTAL 4WV1C 1N0LA 4Q8BA 5IV2A 3DVIA 4LLYB 5J89A 3CZGA 5D7IB 4FP8L 2E6PA 4QT5B 3O0RL 4YAQB 5DHXB 1GSMA 1DHKA 4WTXA 2YKLH 1Z9MA 2P8MA 1BFVL 1N8ZB 1O75A 4FYTA 4YHYB 1L7TL 2HG5A 2JI3A 2WMPB 5DUPH 5CFHA 4R0LB 5B39G 4JDVB 3IAGC 4CMHC 4LCCA 1LO3H 1BQLH 4TMPA 1LO4L 1EHLL 2F5AL 5CP7B 2WNKA 5H4YA 2ZUVA 4OZIB 2FIRT 3GB7B 2YPVH 5KVGH 2VDRH 3MA7A 3NIFE 4U3SA 3U9UA 3CPUA 4WHCA 2L7EA 1BPVA 2BVTA 3ULVF 1HZHL 1KTLB 2I7OA 3ILQD 2VDOH 3C5ZA 1JNJA 3D09A 1EZVY 4M6ML 4EI5B 4ZZFA 4KKLD 5IW1B 3SGEI 1JRHL 5LBSH 1J8KA 3FQRA 1AS8A 4OGXL 5TH2B 5HYIA 2HP4A 3QIWD 1EBAA 2HX9A 3U0TB 2DJMA 1A22B 2YD6A 2DWTA 4HWUA 4U1HA 4Y5VB 3MUGA 3F2LA 1TITA 3EGDA 2R7EB 1U93A 5A3ID 3DSFL 3QEUB 5I74C 5TQ0L 2EXWD 4PBVC 4F8NA 2WK2A 5TE4H 4ODUB 5DRXB 4NO3B 4GJTB 1OM3L 2IAMC 1JGVL 3RL1A 1ZHBB 3O9WC 2J1ZA 4AIZB 3HG0A 4F9LA 1PZCA 3MV9A 2Y2WA 4HFUH 1RK1A 1QSFD 3SE8H 2BERA 3FUFA 3UBFA 5BZWA 4U05A 2O6CA 3I02A 4P2OC 3RWCA 4IGBB 4ANXA 5BOJA 4LSDA 2UZXA 3AREB 1WK0A 3VYNA 2KHAA 1H5BA 3KLAB 2BIHA 3HOGA 4NJ9H 1AGDA 2BC4A 3BI9X 3QDMA 5ACZB 4IIQB 2B59B 5FHBL 2WW8A 4PP1C 1YNLL 1A3LL 2BIOA 2Z7ZA 3NJFA 1I75A 4PCSA 2Q3AA 4KUZH 1TQBB 1FN4B 4GG6F 1JZEA 2EO7A 2UY6A 4XXDB 1PNDA 5EA0H 2IOMA 2PTTB 3BGFB 4HUXB 4PS4H 2NY3C 1RXLA 5DA0B 2WN3A 4PGBA 4X7FC 1IZJA 4X8CA 4GLRI 1HYRC 3D9AH 2WINB 1ZDQA 1MCBA 4K8RH 1LEGA 5AZ2H 1IILE 4FG6C 1BOYA 1PY0A 4LEEA 5IJBC 4ANWA 3NCEB 3QNXA 2D9QB 3DK2A 1E8ZA 1YY9C 5FWQA 1FYTA 5LCVL 1EDYA 4PREB 1UHVA 3FT4B 4M7ZC 3NCJL 1AQKH 4ZFOB 2BZCA 3UO1L 2CO4A 1SXBA 2EABA 3BKML 4NB7A 1FFTB 3VGDA 2F54B 2DQHH 2EDDA 3DIDA 3HC0B 4HJGB 4A2MA 1D6VL 4ZQKA 3HHRB 3P4MA 3LH8A 2YWYA 3O4OB 1T4WA 3J27A 3CBJB 1QATA 2H32B 4YSTA 3ZHKA 5CWSB 3EFDL 4X6DE 3VXUD 3KPSA 2X1QA 3SYPA 4D3CH 3EXJA 5FDWB 3S3SA 3VRJA 3ULUD 5C7XH 3QHFL 2BS71 5FM5M 4JDTH 5HGBB 1IEBB 1V3MA 2V7HB 4W6XB 3RZWA 4U1JA 1IZKA 2J1KA 4RRPG 1FDLH 5DC0A 2FT8A 3SSGA 4NKDB 4AV4A 4PJFA 1K4CA 3V52L 4FMVA 5A16B 3QJZA 2FATL 5ABAA 4RLDA 1N12A 2VSDA 3AUVA 1FA4A 1FFNB 4HPOH 1RUKH 2A1WL 5DYOA 2OYLA 3ZHLA 4FQ1H 1M7UA 2AANA 1RURL 1VADB 3MYJB 4KTYA 1PG7H 3P0VL 4QRQB 5D5MA 4FQXB 5GGSA 1ZLSL 3IMWA 1NLDH 1M6OB 2CKNA 1B6DA 2R0WH 2Z0BA 4UV4L 3RRQA 3APFA 5KW9L 4APQB 3X1EA 3TEZA 2P5WD 4HEPA 3AB0B 2PW2B 4MYPA 5E8EB 5EH1A 3HA0A 1A4CA 4XWOC 1M4KA 1IAII 3EJUA 3HRPA 3OJVC 3QCTH 4OZFH 5DMIH 4ESKA 4YLCA 5B8CC 5I1AA 4KU1A 4JJHA 1KY7A 3B7SA 4WK2B 2R9HD 1N70A 2XWTB 3UTTD 1Z0MA 4PJHE 3UBXB 1JHKL 1F45A 4HOXA 4XWGH 4N0UB 1B0GB 2BLFA 3NPZB 3IETB 1JVLA 1NBVH 2QQNH 4P4RA 4M03A 4TLTA 3CZFA 4ZAKB 4GBXD 3W57A 3ZU8A 2ODIA 4O4YH 1MCFA 4EF3A 2O1AA 4N2CA 1FNEA 2H1LM 3R06B 2YUWA 2XVLA 4MMYB 1JNNL 3BUBA 3ZOAA 5GGUB 1YN6B 4LCUB 1JE6A 1R34A 5D6DA 4MB4A 1KIPB 3SYAA 3EGSB 5IQ7L 5ECJE 3ZZSA 1USQA 3HMXH 5CGYC 4FJZA 4OZGB 2A9ML 2LU5A 2ZCZA 5FCUL 1IGFL 2ZUQC 4GP5B 2G60H 1SLWA 4N0YL 4YZWA 1X4ZA 3BO8A 3EYQC 1J0YA 4L4TB 5T3XD 4A7VA 5BRZB 3N1GC 3VD3A 3U4EA 1BM3H 1AI1L 1R5WB 2DM4A 4UTBA 1S7QA 1WFJA 4P4KA 4V11A 4Q52A 5BS0E 3SY0A 5BV7B 1FSKC 2AF2A 4K71C 4UT9A 1AC0A 4NDMA 4RAVB 3IWUA 4EDXB 1L9QA 3PYCA 4ODWA 3HG1D 1GC1C 1U41A 1J1OH 1F3DH 3CDZB 4N87A 5EBLB 2R51A 5FW8A 4ZRGA 1R0AL 1QLRB 1Z9LA 4RGNC 4P5RA 5CMAA 1KCKA 2LVEA 1H8SA 2CHWA 2BSTA 1Z1WA 4OSUL 4LGRB 1DZ0A 5CJ5A 2EIDA 3GI8L 2WXIA 3N3EA 4QXUH 3DHMA 3MZTA 2PO6C 3LNIA 2NY5H 2CIKA 2A3TA 1CDBA 3QVAA 1XGTB 2JJWA 1DVFA 2WGXA 5I0XA 3D39E 2EUXA 1SY6A 3LPFA 2V7NB 2BHZA 2DQJH 2FX8L 3QULA 4EZKA 3KPNA 4LEXL 1OSZA 2PYFA 2CNYA 1JPST 2ZQKA 2FJHA 4MJID 3DPBA 2ATPA 2K3TA 3UZEC 1OARL 1P7KB 1BQUA 3SYCA 1PZUB 3QRFM 4G42B 4AK2A 5KTEL 5I18H 1ZGLP 1KCSL 3QJRB 3TWCH 1K3IA 3E6HB 5C0EB 5IZ7A 1E30A 2I07A 2XA3A 3SDYL 4A2HA 1X5YA 1R5VA 4M1GH 3KAAA 1E42A 1ED3A 3LN5B 5FYLH 3DX8A 1T5WB 5JHDA 1R3HB 1S6NA 2ZP0T 2OMXB 2X40A 4MSWB 1IAIM 4N8UA 5EUKA 4BHUI 2V8MA 4FTVD 1A1OB 1WWWX 4BKSC 5D9SA 4NO0A 3ZKNC 2RFXA 4FZ8H 2JKNA 1FGVL 2CJSA 4YEEA 3MRDB 3WN5B 4GB9A 1WSST 3NAAL 3T0EC 2YD2A 2WLIA 1Z9SA 4RNRB 2BP0B 1H0DB 1Y18B 5L0QB 1UD2A 2OTWA 2JF1A 3BAEH 4FLSA 1G7LA 4JFQB 1BAGA 2C1PB 4KI1A 1OSYA 4X2UA 1HXYA 1SM3L 3F8UB 2Y2YA 4CAGA 3B37A 5I30L 2Z1PA 3FTGA 4JFTA 3T1FA 5LQBL 4K3JH 4HZLB 2IGFL 1T6VN 5DEGA 1ZS2A 1E67A 2BWDA 2OSXA 1TENA 1ZLVH 5IWLA 1DLHB 3D4ZA 4WJ5A 2AMGA 3CHOA 3NFPB 3Q01A 1XGQA 4PJ5B 1FLRL 2DN7A 1WD8A 1GS6X 2D7NA 3QJHB 1UZ6E 2NY0D 2OJZL 4QJ4B 4KKZA 1D2PA 5GZOA 1AFVL 1D7CA 3HNTL 3ZDXB 4NNYA 3D48R 4G7RB 4P5KB 5IP4A 3DX6B 5IHZA 3P73B 1DVQA 5CN2A 3FOMB 3L4UA 4Y0GA 5HYJE 2P4AB 4K94C 3CFUA 4NQSA 4F91B 4WW1B 1U4EA 3ARFD 1TYRA 3RL2A 4F2MB 3HRZA 2JKRM 3VI4A 5HHXH 3JWOL 5E6ZA 5HHNB 3KLQA 4FLOA 1FHGA 3ZQXA 3L7FB 1P2CA 5C2BH 3QJFA 4QYAA 5AUMA 3S48A 3GHBH 4Y2DB 4Y16A 1WT5C 2YQ3A 3OJDA 5C6WH 1XH3A 4E41B 1EJ8A 1PQZA 1ADQH 2VL5A 2VDNL 4E2OA 1X6LA 2OJ1A 3WCYA 1HXKA 1CLYH 2CXKA 5EBWA 2Z7UA 3DROA 3EDFA 2XLLA 4U3XA 2K4WA 4G5AA 3FL7A 3QQXA 5T33H 4YVUA