5E2VH

Anti-tau at8 fab with doubly phosphorylated tau peptide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
208
Chain Sequence
DVQLQESGPGLVKPSQSLSLTCSVTDYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKNRISITRDPSKDQFFLNLNSVTTEDTATYYCTRGSLVWGQGTLVTVSAASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords AT8 LIGHT CHAIN
publication title Epitope mapping and structural basis for the recognition of phosphorylated tau by the anti-tau antibody AT8.
pubmed doi rcsb
source organism Mus musculus
total genus 49
structure length 208
sequence length 213
ec nomenclature
pdb deposition date 2015-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e2vH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e2vH01
3RU8H 4K8RL 1IKFH 5EB9A 4HHAA 3K46A 3C5JB 3I02B 1MVUB 4HCRL 3HG1B 1J1OL 1GGCL 5C0BB 2NX5B 5C0AB 1YMME 3MXVH 1QR1B 1XR8B 3OX8B 4BQBA 3ZKSD 2A6DB 1VEMA 3K0WA 5A16B 4EN3B 3ROOB 1AQKL 3GDBA 4GRMB 4P23B 4YFLF 3UROR 3W5NA 1TZGH 3TIEB 5I19L 1Q1JL 2NYYC 4LPXA 1DBAL 4ZO9A 3IFNL 2HH0H 3VXQB 1NBQA 1TETH 3BP7A 3KPMB 2LAGB 4BZ1H 1FRGH 1R3IH 2DD8H 2E9BA 2VLLB 2X6MA 3ARFC 4H8WC 1EFXA 4XNUL 4KJQC 1SYVB 1CBVL 5FHBH 3IAGC 4X5XA 4X7FC 4WENB 5IHUH 1YEIH 4I3SL 3MYZA 2B8OT 2DIJA 5CKAA 5CD5D 3P4NA 1DQMH 4PJHF 5DTFB 4MD0A 5D93B 1C5BH 4M7LT 1E28A 1FE8L 5HD8D 2FSEA 2VE6B 4U1GC 1AP2B 2VH5L 4G8GE 4JFFD 2PW2A 3ZDXF 5DA0B 3ULVC 4KAQL 4HUVB 4UIMB 1A3QA 4YNYB 4QRQA 2HTLD 1WTGT 1XGRB 1UG9A 2ICEA 2O5XH 3VGBA 3S4SA 3NCMA 1GGYA 4NCC2 3T0WA 1UZ8B 1I7TA 4YXKL 1DQJA 1OT2A 3TN0B 1M6OB 3GMQB 3R06A 5E8NB 1AO7B 3QO1A 3BEWA 5CD3A 3O6MH 4Z0XB 2D0GA 5CEZD 4OGAD 4ZPVB 4GXUM 2QR0A 3QDMA 4OLEA 4K8RH 3GM8A 1LK2A 4XXCA 4AM0A 1HWHB 1MJ7L 4KU1A 1R24A 4HCRH 4ZFOA 1J1OH 5T3XH 5T1KD 1IGMH 3LQZA 4YR6A 5E2VL 1WSST 4DCQA 4PGEB 5LAXB 1A1NB 4LPWA 1EZVX 5LXGH 4YAQB 5HHOD 5I1DB 3Q3GB 4D0BA 1RZKC 1C12B 5EUOB 2JB5L 1V3KA 4HLZH 4PJ7A 2BVOA 3KWWB 1Q1JH 4YHPA 2YXMA 4UILL 3SDXF 3X11A 1SY6A 2X1PA 2OTWA 5GGRB 2X1OA 5I1AB 1EO8H 3U2SB 4JKPL 2F9BT 3MQIA 5TFSH 3O3AA 1HZHL 1MY5A 4V1DD 5JDSA 5CMAA 3KPPB 1ONQB 2UYLB 1L0QA 4HWEL 1B4JL 2F53B 3FT2B 4XNUH 4XMKL 1CBVH 4OZFH 3BPOB 3DX6B 3FB8B 4G9DB 2YUWA 2OL3B 1VFOA 5HSFA 5MERB 4MMXC 3QWOB 2V17H 4Y2DA 3WNOA 4E5XA 3K4ZA 2EE9A 4OLXL 1W72L 2D7MA 4WWKB 2K7QA 4KZEH 1J12A 2MFNA 3KHQA 4RGNE 2VH5H 5DRWA 1KGCE 2ZCKL 4HXBL 2LE9A 4OFYD 1OM3L 3TBWB 3C87A 4Y1AB 3TNMB 1N4XL 4ODHL 3UYRH 4AQ1B 3QA3B 3AMKA 4JPKH 2V2WA 4DZ8B 1P9MC 4YXKH 5IB3A 4LLMB 2ZSWA 4WUKL 4OZHA 2ITCA 4XWOC 4Z7NE 2FJHA 4WW2C 2VL5A 1V7NL 1DUYB 5FOJA 2DTSA 1DN0B 1YMMD 1R5WB 2ZOLA 3CIQA 5MEOB 1NC2B 3ALXA 1FBIH 5KW9H 5D7KD 2IG2L 1E6JH 4LKXA 1MJ7H 3QFJA 3QXAB 5F72S 4GRLB 4PY7B 2HLFC 3AAZA 3TA3C 3BZEA 5DUBB 5E2VH 5JIHA 5DRZB 3ZE2F 1CFQB 3KPOB 5DS8B 2UY7A 3PL6C 4DOHE 5IMMA 4X9IA 4YGAB 2KUTA 5F9OL 2P45B 2NY4C 1ZLSL 2Y07H 3JWDL 4N5UA 2I9TB 5BS0B 1E27B 4UILH 2NR6D 3LIZH 3V0AC 4FXGA 3JV4A 4JKPH 2XWBB 5IT2L 4ERSH 1QA9A 4GS7C 1NCTA 4NBZB 4UUJA 3WD5L 5CZXC 3SGKA 2ZUQC 3MROB 5EIVA 4XMKH 4AQOA 3H9SA 2IPTH 1ZT4B 1UADC 3QIUA 32C2A 1SEBB 5DJ0B 4JRWA 4Y16A 2PYEA 5FKPA 3GJFH 1G7MB 4I0CC 1HK6A 1U8KB 2C1PA 4KRLB 4QLRA 1J8KA 3TVMA 1U8IB 3E8UL 1QP1A 4HPOL 1I7RB 5D7JA 4XNXH 3NCYP 3FCTB 4PG2C 4AMKL 2NY0D 2ZCKH 4K9EC 5C0CE 5E1HB 2QSTA 3BDXA 3T4YB 3BD4A 1OM3H 4OLWH 4YHZH 3SCMA 1N5AB 3QI9B 1D5ZB 4ODHH 4U7MA 3BMVA 4PLOB 1ZGLB 4QHUA 3HR6A 4HS6B 3AB0B 3MUGA 2WBJB 5CKGA 4PJHE 5HY9B 4X6DA 5CINL 5C70A 5TGBA 3VWJB 1FVEA 2X4QB 3W0WA 2GJ6E 4U05A 3VFTA 5BRZD 5GRUL 3TCLA 1TXKA 5DC9B 2IG2H 3DUUB 5ILTL 2PO6B 3D39A 3I6GA 4M1CC 5TF1L 4R0LB 4CVXA 4K3HA 3TFKD 4QRRE 1WCBB 5DD1H 5BQ7B 1T5XB 1I8MB 1QBLH 2H8PB 1PYWB 2DYPA 1W8OA 4P2OC 3FRPG 4KK6D 3V6OC 4NQEA 4KC3B 4RFNC 3VXMB 1ZLSH 4M62L 1P7QA 3UJJL 3DXAB 3F8UB 3H7LA 5GXBB 1N6QL 5JLZB 1DSFL 1OP3H 3D69A 3PQYE 4YH6A 4QXUL 5IT2H 5D72H 1XGPA 3W9EB 1WBXB 5EBLB 1JPGA 12E8L 2R39A 5GRWA 5D5MB 5HDOA 2F74A 2BHUA 4M5ZL 4H1LH 5HGHA 4FFWD 5IMKB 1F4AA 5T3XE 1G6RL 5F9DC 5D96B 3ROLB 4KTDL 2NW2A 4KPHL 3RZCD 4MNGA 5LQBL 4RGND 3CC5A 2VUOA 1L7TH 2EDBA 3SDXE 3ULSA 1HKLL 5EBMA 5I1JL 5FYJU 4FFVD 3VWKB 2CLVB 1J9CT 4RGMB 4NFDA 3HA0A 1Y18A 3GHEL 4GLRI 2YRZA 1KEGL 4EDWH 3N06B 5E95B 3ZKXB 3KDMA 3HUJB 3PWJB 5JQHC 3LKOA 1A14L 4K94C 2APTA 2E8YA 3NIFF 5KVEL 3M17A 3VI3F 1OARL 1VGKB 1OWRM 3DNKA 3GBML 2E5EA 3C6LA 5CINH 5IMOB 4TSCL 3TLRA 4XP6L 3ARZA 1I1AD 5GRUH 3BUYA 2Z4QB 5DF0A 4MJIE 4A6YL 3DV6A 1KACB 3D9AL 2HRLA 1HI6B 4PG9A 4YZFF 4B50A 5ESVB 4I48A 5TF1H 1UYWH 4H0IA 5HI4D 1FAIH 3KPRE 2XY2A 2X42A 1YY8A 3QEQD 1EEYB 4YHYB 4R90H 3L3DB 4JFDB 5B38B 2K1MA 4HC1A 3FOMA 4FXKA 3GUTA 1I85A 1I1YA 2DKUA 4G6AD 2FD6L 1HHKA 3G08A 4P0DA 1HH9B 4PLKC 5T5FH 1RK0A 3O41A 4HJ0C 5KSVB 4QXUH 2XQBH 4HKZB 1AIFA 1IEBB 1RZ7L 4HWBL 4J7RA 4K2UL 1LEGB 4XWGH 3NIGF 4ALAL 1D9KA 4UDUB 3ZE2E 3RNQA 2ADJA 3U46A 4TUOA 4ENEC 3L6FB 5DQJA 1FCGA 2W0FB 5D1QC 1JYVA 1F13A 3MFGB 1YPZF 1P7KA 4L3EA 4F7TA 4L8DA 1OP5K 1ZLWK 4Y4FB 4GQ9H 3O3EB 3Q5OA 5C0CD 5EU7E 4UU9B 2Z31C 5D71H 1AGBB 4MJ6A 5DR5L 1LP9F 1AR1D 2Z8RA 4IMLA 1KEGH 5TE7L 2V2TA 3K8MA 5AAMA 5CIPH 1YEFH 2FYYB 5HI3D 1FDLH 3MV7E 1KPRB 3V4UH 2J7LA 2XWTA 4I2XB 2GTWA 3C09B 3QNYB 2JIXD 4HG4K 3ZT5A 4K7PY 4HGWA 2C7UA 4WDIB 3LKQA 4XHQA 4XPHH 3RIFK 3UTTA 1NFDF 3GBMH 5GS2H 2ILLA 1S78D 4ZS7H 4IRZL 2HP4A 4RGOH 4LK4A 2XTLA 4DFHA 3FFCD 2PW1A 2B5IB 3VRJB 1QRNB 1JI1A 1NUFA 3IKCB 4U1IB 3PV7A 3QHZH 4Z0BL 4HZLB 1IC1A 2BXZA 2WUBL 4POZD 4QRRD 4X6EA 4A6YH 1XF1A 1Z0NA 3ZSTA 4RX4A 4NYLB 3M8OH 4W6WB 2WLZA 3C5ZB 4ODXA 1PD6A 2MNUA 3ARDC 4NHUB 3CPLA 3SGEH 2BRQA 4JY4B 4YEFA 3FQNA 3EJYD 2P5EB 4G9FA 4P9HC 5CZVH 2IADA 4L4TE 2IBGA 1R0AL 4YUEH 2ZG3A 1WWCA 4Z77B 5HVHC 3C5JA 1KB9J 3I02A 2VXUL 1T1WB 2FD6H 4JFXB 1N7ML 3GIVA 4OM1L 5C0BA 2NX5A 1WZMA 1QR1A 1UEMA 1RIUL 3T8XA 3OX8A 5T3XD 3MFFB 1BEYH 4D0DB 3RTQA 1OTSC 3ROOA 1HINL 5F9AC 4ALAH 2QADB 1IZKA 4ZNCD 4LCIH 1P4IL 2VXSL 2OM5A 4GW5B 3BH9A 4ZYKA 4JHWL 5IB2A 5TDOB 4BUHA 5A1AA 4AEIL 1MWAB 2X4TB 4FG6D 4WI7A 3PWVB 2R2BB 4IOSD 3DMMA 4PJ8D 3VDAA 2VLLA 3ZKMD 1MIEL 2AJZA 2VLJB 1EV2E 4GOSA 1SYVA 3BEVA 1A3LL 4U1HA 2J6EH 1NMCB 1FFPB 5CAYB 1ZEAH 4PRBA 2DIBA 4KY1H 1CLOL 3QP3A 4XMLL 3PIQA 4RNRA 2VE6A 3D2UB 1AP2A 4MJID 3VXOB 3O6FC 4IRZH 4FNLL 5IB4B 4HUVA 3VG0L 4YNYA 1G9MC 3KPRD 2R56L 5K9QI 2NY1C 4ZSOE 3QIBA 3I3EA 4UZGA 3RFZC 3EOAB 2VQTA 4JCMA 1MIMH 1UZ8A 1CGYA 2VITA 1I1CA 1YYLL 4LNRB 1M6OA 3GMQA 5HHVL 1ADQA 5D1XD 2ZG1A 4RBPH 1N2RA 4LSVH 3X12A 1AO7A 3INUL 3SDCD 3WS6C 4UTAH 3VRIA 5HYSB 4JM2B 2BVYA 4ZPVA 3HC3H 3LPGA 4U1JA 3KS0H 1R0AH 2VXUH 4P9MH 1BFSA 1N7MH 3ULUH 2Y06L 3L3OB 4OM1H 1RIUH 2ESVE 5SWSE 3QEGL 3QG6B 4MZ2A 5FB8A 1A1NA 1JWUA 2C4XA 3RUGB 3ULUF 1IFHH 1U8OB 1HINH 3Q3GA 2MPAH 1G7JA 4G6JL 1PG7H 4YGVB 5EUOA 1KTLB 3G5YA 4GG6E 5F1KC 5EO9B 4PR5A 3GSQB 1QLRB 2Q6WB 3RWDB 1EJ6A 1OLZA 5F3BB 4YXLH 5JNYA 5I1AA 4AEIH 3H9YA 4YPGA 1C08B 4H20L 1VA9A 1ONQA 2UYLA 1MIEH 4H5SB 2DQDL 4ISVA 3FT2A 4QY8A 4LCUB 3DX6A 1A3LH 4HF5L 3NIGE 2H32H 1KYOK 3AREA 2CRIA 3FB8A 4X9FA 3BGAA 4G9DA 1TCMA 2H26B 2V7HA 5HGAB 4L8SB 3J7HA 3O2DA 5J9PB 1V3JA 4BK4A 3QWOA 1U58A 1CLOH 4IRSB 2V9TA 4HIJB 2N7AA 3MLYL 4MZ3A 4XMLH 5FYKL 5DD6B 2PR4L 2ZUTA 2XA8L 2EDWA 3PHQB 5ACMA 1NANH 1LP9E 4HKJB 4FNLH 1T80A 4M8VA 2NLJB 3TBWA 4PJ5B 2A9ML 3DECA 5KSBF 4YDVB 2R56H 5LWYH 3QA3A 1WJ3A 2DKMA 4DZ8A 3CH8A 2D2OA 5E1AA 1YYLH 5BMFL 4ODWB 4LLMA 4PGDB 3WKML 4PJCA 4BH7A 3SGJC 1NFDE 4FZEL 2APWA 1IJ9A 4XVUD 1DN0A 2APFA 1R5WA 2Z9TA 3FO2A 5AAWA 4NRXB 1REIA 3O4LE 4PLJD 5DUBA 4JFQB 2OMBA 3QEGH 3UTSA 3KPOA 3AS3A 2EXYC 3DETD 1JZ5A 1PW3A 1G7LA 5FOBB 5F71A 3T77A 3WIFB 4D3CL 1H8SA 2I9TA 3GEWB 5BS0A 5CP7A 1QSED 2EIZA 3BXNB 4M6OL 5SX5H 1BJMA 5IW3A 1NFKA 2XWBA 4KI5F 4H20H 2FJGA 5JZ7D 3MV8A 4M8QB 1HE7A 3MODL 3MV9B 4HF5H 4OZIB 4HW6A 3MLVH 1ZT4A 2OZ4L 1A9BA 1SEBA 5DJ0A 3O45A 3ESUF 4LPYA 1G7MA 5C07E 4QWWD 5GSVB 2JJWA 3F12B 1KIPA 2RGSA 1U8IA 4MQSB 3MLYH 5FYKH 3RKDC 2RIKA 2PR4H 4WU7B 3QXWA 2F15A 2XY1A 4PRHA 2AQ1A 1CQYA 1N5AA 3OHXB 1LE5A 1D5ZA 5M95B 4APQA 1EMTH 1ZGLA 2VWEC 1WITA 1QFWM 2WBJA 4O2EB 4P4KC 2E27L 3HRZB 3GSOA 2NXYD 2VDKH 3VW3H 4KDTC 2KZ1B 1TNMA 3X14B 1NPUA 2A1WL 4MXQC 3QDJE 4YQXL 1QFOA 2ITDA 4NQCB 1JI2A 1WIOA 4NOBA 2ESVD 5SWSD 5DUPL 1U3HC 1ETZA 4MXWH 3KPNB 1CICD 5C0DB 2C5DC 1E4XL 3ARGC 3QUYB 3I9GL 4K23H 5F70A 5BQ7A 2CMRH 4HIXH 1T5XA 1A7PL 1I8MA 2FRGP 2H8PA 4G43B 1PYWA 2Y23A 1FPTL 3H3BC 1Z9MA 3VU2A 5E8EA 4JO4L 5SV4A 3C60B 4RQQB 2R0ZL 4U7KA 2X7LB 4RFOL 3W5MA 2WWKO 3RVUD 5EORH 1HYSD 4Z95L 2BVTA 3LKSB 3TZVC 2EO1A 3GSRA 4KVCL 2GYSA 1WBXA 5EBLA 3VXRE 3LMJL 4WWID 4MNQD 4L9LA 2FIRT 3JTSB 3ULUE 1SVCP 3MODH 1X6LA 4Y19B 3ROLA 1CTNA 5EU6D 5IEKB 1U9KA 3D3VD 2DMKA 2OZ4H 4PJDA 5IMLB 4RDQG 1HIML 5DJ8B 3DGGB 1VENA 3NCJH 1T5WB 1AXTH 2E7LA 5HYEA 4OCYH 3VWKA 2CLVA 3VFNA 5J3HC 4BSVB 3RWIB 2J8OA 3SDDC 1PVHA 4XC1L 5E8PB 5HYJB 4XPGL 3MUJA 4WTXA 4MNHA 1YEEL 3STLA 3OB0K 3S5LB 1SYSA 3TEUA 4R2GD 1VGKA 5DZNA 5EUKB 2O5ZL 3U7YL 1UEYA 3RAJL 6FABL 2E27H 5GS2D 1F4WH 2OQJA 4HFUH 4PJEA 2FX8L 5EFIB 3O4LD 4S0TD 2X1QA 1GAFL 1OAYH 2PUQT 3QIWA 4DK3A 2AVGA 3BZDA 1U8HB 4FHBD 4TRPL 4QRPB 5KSBE 1VACB 3HE6D 2C3GA 3H0TB 1HI6A 3IKKA 4JQXA 3F5WB 5DK0A 2DQGH 5DYOB 3BQUC 3WFHA 5IK3A 3UTQB 5KG9B 4HUXB 3OB8A 4KDVA 1EEYA 3GSNH 3L3DA 5E6IC 2VLKE 1SVZA 5B38A 4F9PA 4JO4H 2J12B 5DMJB 5HJ3B 4JFEE 4J12A 4LIQL 4RFOH 1HH9A 3HMXL 2G2RB 1A7NH 4N0YH 3L5HA 2W9LA 5AD0A 4Z95H 4FQ1H 1IEBA 1ND0B 3W2DH 4E41A 3OJDA 4Y8DC 1SM3H 3MNWB 4LGPB 1OAKH 1EJOL 1DBBL 5C07D 2VQ1B 7FABH 3L6FA 1B6UA 3BZ4B 4IHOA 4LPUA 2W0FA 3MGTA 3SQBA 5KJRH 3QHTC 5KS9B 5AG8A 1MSPA 3IFLL 4ZAKB 5I75C 4XI5D 2EDYA 3MJ9A 5IV2A 4P5TB 3OKYA 3VCLB 4E42A 5GPRA 2IAMD 4LRIC 4G6KH 2NNAA 5CCKH 4FQIL 3R8BB 4F7MA 2DKSA 2V5SA 4QRSB 5JXEA 4BYHA 3QNYA 2J8HA 5B8CB 4DAGH 3QDJD 1YMMB 3V0VA 3L3GB 4LFHD 2O5ZH 3U7YH 3RAJH 1T7ZA 2FH6A 1OTUC 4RISH 4Y89A 2RJMA 1NAMB 2GIYA 3VRJA 3TYFB 1QRNA 2EC8A 3IS1X 4M93C 5FYKE 4NKMB 1FIEA 3IDNB 4S1DD 4HSQA 3V79C 4OCXH 5FFLA 5GGVL 2FATH 3GRWH 5ALBL 4K7FB 4K3DL 2YSSA 3C5ZA 1G1CA 2W9EL 1BJ1J 3EGSA 4CJ1A 4NHUA 5IJVB 1KXVC 2QHLA 1QEWB 4MX7B 2P5EA 4UT6L 4WI9A 4WEBL 4QYOB 2C3WA 2L7UA 5F1IA 5C0JB 4JE4B 2XTJC 4Z77A 3VD9A 2EE2A 2G9HB 1MHPH 3IDUA 4HV8B 5CFHA 4XCCH 1MI5B 4NRYB 3HMXH 3ULUD 1IC4H 4KRPB 5J12B 5LGHL 4D0DA 4N8VB 1BOYA 4DGVH 4G8GB 5TDNA 1ZVYA 2WQRA 3HE7D 2I26N 3GMLB 3RBGA 4CU6A 1DBBH 2WMPA 4GW5A 4IRJC 5IESL 2AXFB 1PAMA 4KKCC 1RJLA 5E8OB 5TDOA 1I7UA 5I6XB 2FECL 1MWAA 1RZFL 3IFLH 1QO3B 1XIWC 3HCVB 4UV7L 1DQQB 2VLJA 4OF8A 2KZWA 5CJQL 2BNUB 1CLYL 3BT2L 4CUCA 1FFPA 3VXNB 2OP4L 5DVNA 4FQXD 2O26U 5IP4A 1S3KH 4IBLT 5JORA 3K1DA 2IQAB 1CDHA 3OKNB 4LHUG 1XFPA 1TZHA 2HT4D 2VLRE 2LFGA 4P3WA 5JHDA 1OGAB 1Y6KR 2EDTA 4PP1D 4LCCC 4KK8C 1X5XA 3CFBB 3EHBD 4C58B 1KFAH 3CH1A 3MLZL 3C9NB 4ZFOL 3U7AA 3EOAA 3GZKA 3HKFA 4LHQB 4NC0B 3RGHA 5CBAA 1KOAA 5GRYA 1V3LA 4NM8L 3D5OF 4LCWA 1MFAH 1ZXQA 3GSUB 2H3NA 2IPUK 4JFED 2YD8A 3HI6H 4UT6H 4Z7UF 3ZTNH 1JZ2A 1LO2L 4WEBH 5BJTB 5T1LD 3GMPA 4XVSL 3I2CL 1SY6L 4P46C 3L5IA 4ZS6D 2PXYC 1PY4A 3ULVH 1NUDA 3OPZL 3QBTB 3U6RA 5E0QA 2DAVA 5LGHH 4GBXB 1BD2E 3ULVF 3CX2A 3RVVD 1UXWB 1U8OA 2Z91A 5J6GB 1MAMH 3SKOA 1KTLA 3EUUA 1ZA3A 2IALB 3GSQA 5E6ZA 2G5BB 1QLRA 3RWDA 4KI5D 35C8L 2WSKA 4JFPB 5I16A 1RZFH 1H5BC 5HTSA 5C0EA 3ORJA 1MFCL 5C09D 5DURB 4UTBL 4YHLH 4UV7H 3QZWA 1WEJH 4PTUA 2X89A 5BV7C 1CXKA 4LCUA 5CJQH 1FYTE 3Q1SL 1G7HB 2IFFH 5K9QG 1MCEA 1VFAB 2GFBB 2VZ3A 5LCVL 4OLUH 2H26A 2OP4H 4X4YB 4L8SA 2YD6A 1MCCA 1HSAA 5J9PA 5D2LB 5FO9B 1KJ2L 4HIJA 3OWEA 3JTTB 1RZKH 4A2MA 5I73B 2YPLA 4M4RA 5DD6A 3E1F1 3MRMA 1FORH 1QKZL 2W07A 4HKJA 4LASL 2NLJA 4PJ5A 4OD1L 3ZDZF 4JO2H 3SJVE 1E4KA 2FO4B 4PRNB 3BISA 2R1YB 3IDYB 2A77L 5GQBA 3DVFA 4ODWA 3HI1A 2HJLA 4PGDA 5L6YH 3AXLB 2IGFH 1VPOL 5FECB 2P7TB 5BVJB 5C9KA 4HWUA 3UC0L 5JW4M 1D7FA 3H3PL 1YMHB 4XVJL 3NFPB 1MHHB 3RDTB 3I2CH 4TOYH 3BPLC 4L29B 4NRXA 3AY4C 4M6AA 5DLML 3T0BA 1GRWA 5KTEL 3VFUA 2EDKA 3OPZH 1FL3B 2IC2A 3FZUD 5HHXL 1S7WA 1F3DH 4ZUUB 4LSUL 1CVSC 5E99L 3MOQA 4S10A 4ZUWA 1A6PA 4XXCC 3T08A 5C92A 5MEQA 1X4XA 4OCRH 5IVXE 2ERJC 5L8LB 4I18B 1H0DA 2IANE 4J1UB 3BXNA 3OR7B 35C8H 3DUSB 4XMPH 5J7CC 2F54B 1X5LA 3DTXB 2QSCH 2X1XR 4NN5B 1K3ZA 1MFCH 1I8LA 4WW2F 1TCRB 5CSBA 5EOQH 5F1OB 4UTBH 5JIIA 1TLKA 1YJDL 2GJ6B 3O11B 4IJ3B 3B83A 3QUXB 3ZKND 4OZIA 1J7VR 3RY6A 4JY5L 5LCVH 3QQNA 5GIRA 4OLVH 5D1ZB 4YHOH 4RZCA 3QH3B 1KJ2H 3U30C 4B7LA 4KJPD 5EULV 4HT1L 3F12A 4MS8C 4NZJA 4OKDA 1CDJA 3B6SB 2UWEF 4WU7A 4QHKJ 5L2JB 3CMGA 4HAFA 4LASH 3ESVF 1FV1A 3LZFH 1KJVB 2DMCA 3OHXA 2FB4H 4Y2DC 3QAZC 3U36B 1VADB 5I1GL 1YZZA 3FHQA 2DM7A 1WQVT 5EZLA 3PQYB 2RHEA 4JRXE 2A77H 3HNSH 4TQEL 4WFHE 4PJ9B 1E6OL 3O3BA 2VZ1A 1DVFB 2EIBA 3D85B 1AGFB 3SE3C 3OKMB 2GJZB 4NQCA 4D9LL 4XXDB 1TQCB 3CVHA 4XVJH 2V2XA 2MMXA 4X98B 5ANME 3LRHA 1MRDH 1BQLH 1BD2D 1D6VL 2NZ9D 1OAQL 5IG7A 3RX8A 3J8F7 5DT1H 1DE4A 2AJXL 5DJCB 3T1FA 5DLMH 4K9EH 2WLYA 5KTEH 4P3DA 2BP3A 1ZV5A 5C0DA 4JZNB 4LLWA 1X5GA 2Y5EA 4GRWB 3REWB 5HHXH 1U95B 2H9GB 4LSUH 3OAZH 4PJIF 5E99H 5JHLL 4G43A 5D4QA 2ZPKH 3UO1H 1M7DA 4P2QD 4ELMB 5GGTA 2DQTL 2IPUG 4RQQA 4JKWA 3LS5L 4L3AA 1EUTA 5IVZB 3B9KD 1F11B 4FRWA 2BFVH 1LEIA 4P4RB 1FYTD 4TPRL 3KXFB 3E2HC 5LBSH 1CGVA 5GJSL 3AS1A 4I3GA 3JTSA 1YJDH 1MNUL 4PGCA 3ULVE 1N26A 4DK6A 2IJ0C 2X4RA 1QOKA 3MR9B 2VDQL 1MFBL 2YZ1A 3IFOA 1JRHI 4X80L 1QQDB 1CFTA 3TBVA 4Y4KC 1IEAB 1BREA 5DFTA 5IMLA 4JFFA 4YBLC 1WT5A 4MQTB 5DJ8A 3DX7B 4KKNA 1A6ZA 1T5WA 3P77B 3SJVD 2K9UA 2ZUYA 1YEDB 5CSZB 3IDXL 3RWIA 4JFOB 4DN3L 5L2KD 1MY7A 5E56A 1JK8B 3LVEA 2APBA 5D2NA 4BH8A 5GZNC 1D5IH 2PKDA 1UCTA 3IJSA 1ZT7B 5AG9A 4OD2B 4KFZC 3WJLA 3SKUD 1CXHA 3MRKA 8FABB 4KKBD 3MREA 2EEAA 1ZSDB 2LVCA 2HFEB 3BVNA 3BRDA 3GO1H 5KSAD 3B9DA 1C7TA 3F58H 3NH7L 1K9TA 4X6CE 4P2RB 2XFXB 1U8HA 4OD3L 4PRDB 3HNTH 5GISL 5HHOA 1D6VH 1VACA 1UJTA 1OAQH 2JCCE 3MJ8B 2AJXH 1URLA 1NGWA 1OT1A 4K94H 4O4YH 2QTEA 3UTQA 5KG9A 3HFMH 3HR5A 5C0RL 3P2TA 2IAND 5GGSB 1K2DA 5JHLH 2EDFA 5I8EB 2DQTH 4JZOA 3N1QC 3MV7B 4I0KA 5IFAL 2WZPD 3I75B 3LS5H 1KIQB 3GSWB 3WEXA 4O51B 3S98A 4R4NC 1A4KA 1YNLL 3IETB 4CMHC 5D7SL 4D0CB 5F6IB 3EZ8A 1ND0A 4F57H 1NCWH 1XF3B 3CZJA 1SEQH 2WW8A 3GJFB 5I1HL 3EYVB 3MNWA 1W72B 2VQ1A 1FVCB 1L9NA 4N8CL 5CJOH 3SGDH 3FO9B 1AHWA 1DN2A 4ONHA 4ZAKA 1RHFA 2VABB 4R97C 1A1OB 1PX3A 4P5TA 3S96B 5C6TL 4DN3H 3F7VB 1NBYB 1UB5A 3VXUE 4L4TB 1CGWA 2X4NB 4ZOAA 5F89B 4PJAE 2OLDA 1XH3B 4JRXD 4WFHD 5DVOA 4X83A 1K8IB 1KENH 4N1EA 3OAUL 4LDLB 3VG9B 1IKNA 1OLLA 5EO1B 4PV8A 1B6DA 3WN5B 1YMMA 1OSZA 2ADIA 1JGLL 2NYYD 4HH9A 3MBEB 3ZE1F 1A5FL 3OR6A 3TYFA 1V05A 3FQTB 1J05A 1QHPA 2G60L 1NDMB 4OQTA 4NKMA 4PY8J 2R2EB 4IMKC 4TVSa 5GRVL 5B38G 3ARFD 3SDYH 5GISH 2E3VA 1MCOL 1DANU 4KJQD 3PHSA 3A6BL 3C6LC 2ZNWA 3WXVL 4TNVF 1FNHA 2Y7QB 1HXYB 5IJVA 1NC4D 2CXGA 5F7YC 3HAEH 3FB6B 4MX7A 3WLWC 4KROC 2ATKA 4FTVD 3U4AA 5FV1L 4QYOA 1KCUL 3FMGH 5GGQH 4FZ8L 4Y4HB 4FFZL 2G9HA 1TNNA 5IFAH 4OAWA 4H1LB 2DM3A 4EVNB 4OV6F 4WU5B 5FGBA 3ULVD 3F62A 3RHWF 1XEDA 4DKEL 5LG1A 3GJEB 2YA2A 4G8GA 3I84A 4MA1B 5I1HH 2EDDA 4D9QD 1L0XA 1X5AA 3GMLA 4WJ5A 2AXFA 1NGPL 2M2DA 1IGYB 5E8OA 4M7JH 5LJYH 3D87B 3OKEA 1TMCB 4P9HH 1QO3A 3TM6A 3LEVL 4RBPK 1D9KC 5C0NC 3WSQL 1DQQA 1KNOA 5I18L 4HIEB 2YBRA 4LVNC 4YEEA 4YK4B 1UWGL 2BNUA 5MENE 4J4PA 4P49A 4M4PA 3VXNA 4M9OA 1DZBA 2BRRL 1S7XA 2NXYB 1ZE3C 2R23B 3OAUH 3DOSA 4JEGB 2GUOA 2IQAA 3HNVL 4KK9D 3OKNA 3O4OC 3A6CL 3LN4B 4MLIA 1JE6A 1RUAL 1U3ZA 1EA9C 3ETBF 2DS4A 1FN4B 5EOTB 1U8JB 4HWZB 3SE4C 1OGAA 1ZT1B 1S7VB 2CIKB 3V6OE 3B2VH 1ZLUH 2BOBB 2VDNL 3C9NA 2VSCA 4MD5B 1Y0LA 1MCOH 3R0MA 1T04B 2P46B 3U9PL 4NGHH 1WFTA 4Q0XL 3JBG7 2VXTL 2NY2B 1FG2B 1WF5A 1JJUA 4X4ME 1KCUH 4KTYA 1YYML 4XP5L 3RY4A 4FZ8H 4XNQB 4FFZH 3B2UC 3LKRA 1RJYB 5C8JB 3RZCA 4G5ZL 4GBXA 2XZAL 4MAYB 3B43A 1CN4A 5C7XH 5H35B 1FP5A 1PKQB 1TJGL 3MLRL 3O2DL 2IALA 2G5BA 4XC3H 1ERNA 4XWOD 4JFPA 2VKXA 4QRUA 1R3JB 3FT3B 5CIPB 4BQ8A 3L3KA 4EN3C 5D6DC 3U4EB 3IDGA 3CXDL 1I9JL 4P23C 1AY1H 1WWAX 4FFYL 1BFVL 4G80B 5I18H 2DQHH 1T2JA 1CDYA 4OLYL 1XF5B 4HKXA 3C6SB 4X8XA 4ZUVB 2BZDA 3MLWH 2GFBA 1XT5A 4G8IA 4LVEA 4NSKA 2XKSA 2BRRH 1N0LA 2HLFD 3TA3D 4X4YA 2H6PB 4GKSA 5D7LB 1FGVL 5D2LA 5FO9A 3P4OB 1DFBH 4CRPA 3PL6D 3NA9H 5FA3B 4XPFL 1UA6H 3A6CH 3OKKB 5EDXA 2NY4D 4A6YB 5A2IH 5D8JH 3GMMA 1ED3A 1BQHB 1AGCB 5FUOH 3D6GA 1T1ZB 5HYSG 5F6HJ 1INQA 2AXJA 4WO4B 2VDNH 3G5ZB 4PRNA 5D93C 5SX5K 2R1YA 5CZXD 2Z93B 3ILPB 2AP2A 4XX1E 4JGUA 3AXLA 5E7BA 3U9PH 1I1AC 5FECA 2Q86A 4YFDB 5BVJA 4JFZH 2DI7A 2E6QA 1GOFA 2VXTH 2Q8BH 1JWMA 1YMHA 3NFPA 1BX2B 3RDTA 1T21A 3TN0C 3L1OL 1FFOA 4JPIB 1FL3A 1T0PB 2FHCA 5TDPB 3HMWL 4ZUUA 1RZ8B 2XZAH 1NJ9B 3QDAA 4P59L 3O3DB 2D7TL 1K5NB 4W70A 3CNKA 5C0CA 3MRIB 3ZHLA 3BESR 1FLRH 4XTRC 3ARRA 3IF1A 4HJGA 1OSPH 1EEZB 5F8RC 5I2IA 4PBVC 3F6IA 4I18A 1DANT 3L7EB 1KCVH 1P4BL 3DUSA 3Q5YA 1N59A 3DTXA 4U2YA 1HHIA 4X4XA 4GH7B 4PJHA 2J8UF 1TCRA 1I9JH 5J8OA 3VFVA 1BFVH 1E4JA 2GJ6A 3P4MA 3O11A 4OLYH 4Z7QF 3QUXA 1P4LB 4XAWL 4M1CD 2XG4A 2IPKB 2XT1B 2CSPA 4OCWH 5D1ZA 4Y7MA 1UM6L 3QH3A 4H88L 2ORBL 1CTOA 2AJVH 3V52L 4O5LL 3PV6B 4P2OD 4LPVA 3MRRB 4ZNEE 4QRRA 5KANI 1V8HA 1S7RA 2X4UB 3BPOC 4PGBB 3B6SA 4UNTA 5FCSH 1IGFL 1DLHB 4JY6B 5L2JA 3V4VL 4UIKH 1X7QB 1J11A 1WV7T 2X10A 2VRAA 2NZIA 3MRFB 4OSUL 4YDLB 5IKCA 4RA3A 1Q9OB 3U36A 2NY3B 3QWQB 1VADA 5EPMB 1FNSL 4WWKC 4QOKE 1S9YB 3BPCB 3PQYA 2VR5A 4PJ9A 4ZXBB 1GHFL 1O5DT 3VXRB 3WYRA 3NMEA 2N1KA 4HCRA 1AGFA 1EVTC 4GKOA 3T65A 1SBSL 1JZ4A 3X13B 5MP6L 1JNHB 1PLGL 3U0PB 1MREL 3BKJL 5IEHB 1G6VK 1S9VA 2G75B 1IE5A 4X98A 5I9QB 1S9WA 3BKML 3VA2C 1Q0XH 2D31B 4U1NA 5IR1B 3SDXA 4NUGL 3FQXB 1F6AB 2UUDH 3REWA 1ITBB 2M26A 3G6JF 1YECH 4KUZL 1U95A 2H9GA 2D7TH 5IBUG 4PYHA 2CRYA 1GH7A 1DEDA 4ZUTA 5ISZE 4GRLC 4Z78A 4FQHB 4OZFA 2EH7L 4H26A 4YPJA 4P4RA 1F4XL 1P4BH 2H32B 2PTVA 3PNWB 4Y5VB 1CR9L 3PXJA 3TT3H 5ICYB 2XPGB 3RPKA 3FONB 5E2TL 2GSIA 2YWZA 1P69B 5B39A 2FJFB 3MRNA 5IOPB 2QEJA 4UINL 1W0WB 2XI9A 4WI2A 1OAZL 3MR9A 3Q2CA 1DR9A 2Z8VC 1P1ZA 2MKWA 5E2UL 4MJIA 1PSKL 4ZFFB 5ADOL 1PJ9A 3DX7A 4POUB 4H88H 3KPRA 3V52H 3TH2T 4O5LH 1N5YH 3EYUH 3MRCB 1YEDA 2AXGB 3MLXH 5ESAB 3WE6B 2P5WB 4JFOA 2VLKB 1AD0A 1BIIA 2R4RH 5EOCL 4UOJA 4PLKD 2QBWA 4YHKL 2HT2C 4I0PB 3S36H 3GHBL 4EXKA 3IU3A 5EA0L 1T1XA 4HJ0D 1X9QA 5E5UB 4ETQA 4OSUH 3SDCA 3RA7L 1TENA 1DBMH 1RJZB 3LY6A 1FNSH 4MGXA 4R7DA 3BWAB 3FB7A 8FABA 5C08E 4ACPA 4OF5A 4ENED 2CKBL 1WAAF 1GHFH 5D1QD 3LEXB 2ZCLH 5TJWK 1Z2KA 5L88L 3QI9C 3HZKB 1KT2B 5MP6H 2EYSB 1MREH 1KPVB 3BKJH 4ZOCA 1D5XA 2Z31D 1HQ4B 3CDGB 3L5JA 1F42A 2HFGH 3KR3L 3AB0C 3RGVB 2WBJC 3R4DA 2EYRA 5DD3H 2ICWJ 3VWJC 1CCZA 3V5DB 1KIRB 4IIQB 1CIUA 1CYGA 4Z7VB 4EI5B 1CT8B 2DM4A 4I5BA 5I8EA 3SE8H 3BDYL 3MV7A 2E8ZA 4RMRA 2EZ0C 1P84J 2PO6C 3I75A 1FJ1A 1KIQA 3GSWA 4R0LC 4O51A 2YD5A 2EH7H 3TV3L 3K4AA 5ICXB 3IETA 1R3LA 1HOCB 3VFOB 1CR9H 1RFDH 3MJ9L 1DUZB 2YRLA 1S7QB 3QUZB 5E2TH 5GRJH 4YJZL 3FT4B 4PREA 3GJFA 3EYVA 2P8MA 4G6FD 4PB9L 2OSLA 2JJVA 2VUYA 4OZ4A 1OAZH 5EU5B 2NQCA 2DQEH 3T0DA 5E2UH 4OCSL 1PSKH 3ARDD 2DF3A 4KH2A 2ZKHL 4JQIH 3FO9A 4KK5C 1AI1L 5HGDB 1V3MA 3S5LG 4CN1A 1KB5H 3SDAB 4WW1B 1KCRH 4Y5XA 1HH6B 3S96A 1FIGL 3BRGC 5D96C 1F6FB 3F7VA 1NBYA 3BKCL 4PB0L 4TYUA 4QOKD 5EOCH 5BW7C 4L4TA 1MJ8H 1XH3A 1NQBA 4NZDA 4Z7QE 2DN7A 4TTGA 1OTSD 4IDJH 2V5YA 2UZYB 2XQYK 2E7LC 1RZJC 2B1HL 3VWKC 3BP4B 4RGMC 1CF8L 5CWSA 2VZOA 4OF6A 4ONGH 1VFMA 2LAAA 3T1WA 3ZKXC 1MQKL 3P73A 2CKBH 5J13B 1AQDA 1A6WL 4X9GA 3GSVB 5MI0B 5DJ2B 3FQTA 3I6LE 3QO0B 3MCLH 4UDTB 1NDMA 2R2EA 1BECA 2DQJH 1C16B 3C8DA 1HILB 2EDJA 4GW4B 3DYOA 2JB6A 8CGTA 1HXYA 5JOEA 2FZ3A 2R29L 1NLDH 2GAZB 2R0LH 3G6AA 1PX4A 1YC7A 2RFXB 5DI8A 1F58H 2W0PA 1IAIL 3BDYH 4ZQKB 1BAFH 4CL7A 4H1LA 4JQXC 5D7IE 5ADPL 2W1NA 4X99B 4ZTPH 5KVDH 4WU5A 3O6FD 3TCXA 1YNKL 1NDGA 1PEWA 2CDFA 2CJUH 5IHBA 4QF1B 4BFBD 4YHYC 3QNXB 3QDGE 3KLHD 2VLRB 1C5DB 2NY1D 1B4RA 5GGUB 3QCVL 1NBZB 4O2FB 3L9RB 3G6JE 2OR8A 2C4FT 3IDIA 4PB9H 2HAZA 4XCEA 2FEDC 1MFNA 4ZSOA 4JB9L 1IGYA 5CEXB 3IVKB 1VFBA 1RMFH 5JPMA 3RI5F 1HSBA 2VWEE 3ZZ1A 2WINA 4NO3B 4Y5YC 4Q9BA 1U6AL 5C2BL 1CL7H 3MJ7B 1PQZB 2VAJA 2R8SH 4M48L 3BKCH 1DCLA 1LQSR 2QQLH 2XN9B 3IB4A 3LKPA 1OPGL 4OB5L 4PB0H 3KYOB 5C08D 3KPSE 3EFDL 4R3SB 2R23A 4HS3B 4Y4FC 4NBYB 1GZQB 5TE4L 1W2KT 3LN4A 1CF8H 2ESVA 5SWSA 2FGWH 3MPCA 1MQKH 1FN4A 5EOTA 4PRPE 1QTYT 4NZUL 4AJ0A 1A6WH 3LQAL 1CICA 3H9ZA 4HWNA 1Q94B 3MLTA 5I8OL 5JXEC 1S7VA 1ZGLM 4GG6A 1J0KA 3C09C 5E4IA 4RMQA 2MTPA 3CLEH 4MCZB 2I9LA 3GGWA 3N85L 3F65A 1T04A 3D0VB 3T3MF 2Y4SA 2B5IC 1MAKA 1QBBA 1WAAE 2VN7A 4N8VG 1EHAA 1FG2A 3I3DA 5FUCE 2HN7B 4FOMA 1MOEA 4XBPA 3S37L 5K59F 1UXSA 4GSDL 1FNAA 5ADPH 3C5ZC 3U9UB 1BVKA 1OGTB 1YNKH 1OOAA 4NNYA 5C8JA 2OJEA 1UCBL 1CE1H 4MAYA 1JFQL 2XZQL 3GMRB 5CP3H 5F7LB 5I15L 3QCVH 4NO5B 5ALCL 3T0EE 1TDQA 1LP9A 4NO0D 1IM9B 3UJIH 1ITCA 3DHJA 4JB9H 5AZEL 2NY5C 2QQQA 3O9WB 4WUUB 4GMSL 3JVGC 3FT3A 5CIPA 1H8NA 2R0KH 4I77L 4NZRL 5DXWA 5KVMC 2YPVH 4M61B 2QADC 2BNQE 4RWYL 3V7AG 4Z7OF 4G80A 1NFDA 5SWZE 1U6AH 5C2BH 5F3HB 3B9AA 4V2BA 3C6SA 3D1MC 2QJDA 4O2CA 3Q6GH 1ULVA 5F44A 1OPGH 2ENYA 4JRYB 3MRGB 4PJGF 4C56D 2NCMA 2RCSH 3O4LA 3P4OA 5GS0C 2EXYD 2E9JA 1QSVA 2P24B 5J57B 4OIIL 1TQBB 5FA3A 3WFEL 3UBXB 3DI3B 3I6LD 3OKKA 2FEEL 4MDJB 3MGOA 4A6YA 1NMCC 5J56B 4CGTA 3MRJB 3MNVB 4NZUH 1A8JH 1BQHA 3GBNL 3LQAH 4WGWB 1A6TA 5I8OH 4S1QL 1CFVL 5IVXB 3EO1B 2YA1A 2BSSA 3VFWA 5BV7H 3BOVA 2BNRD 3NIDF 1UVQA 1QRKA 1EEUA 1NUNB 3K8KA 4ZTOH 3UP1A 1FLTX 3KJ6L 3QDGD 3RKDD 4CADB 1JPFB 1U8LB 4UBDC 3S37H 4YHNA 4GSDH 2WAHA 3WFCL 5C07A 3A67L 4U6VH 1CD0A 4JPIA 1NMBL 3ZHDA 3QEHB 3QJHB 2C3VA 4L4VB 1UCBH 2AAVA 5TDPA 1BZQK 4JM2C 1JFQH 1NJ9A 1B0RB 1S5IH 2XZQH 4TVPH 5JOFB 2AQ2A 1Z5LB 4QXTB 3C8KB 4P4KD 1D5BB 4K55A 1JYNA 3HC0B 4MA7H 5IM7B 3BYYA 3L7EA 3S35X 3H9HB 5INCB 4UT9H 3U7WH 2J6EA 4WV1B 4GMSH 2KL6A 3AU1B 3KYNB 3DX8B 3O2VH 3KPSD 4WVRA 5DHVB 1ZLWH 2D7OA 1U3HD 4EZMA 4W6YB 3QDJA 2MHAA 4LF3B 4K7PX 4S2SA 2AEWA 1P4LA 2VYRE 2IPKA 1WISA 3U0TB 3ARGD 5ANMB 1G7QA 5A2FA 4PBXA 4DKFL 4PRPD 5I71B 3FAXA 3DLQR 4OIIH 3W82A 4HHAB 3PV6A 3WFEH 2UV3A 3MRRA 4NN6B 2W65B 2X4UA 3FN0L 4PGBA 3OAZK 2GT9B 4WCYL 3LRGA 1MJUL 3CVHL 3N0PB 4L8SC 4R8WL 3TZVD 3MRFA 4JZJB 4IRSC 1CFVH 2XTJE 3O8XB 1RULL 1I75A 1S9YA 3ARBB 4WY7L 1B88A 4ZXBA 3VXRA 4PJ7F 4TSAH 5GGTL 1E4KC 1QFUH 3ES6A 2GW5A 3U0PA 1DDHA 4EKXA 5IEHA 5J4MA 1BF8A 4K7PL 2G75A 2A6IB 3QG7H 2D31A 5J3HD 3IU4L 2EH8H 3SDDD 4KQ3L 4X5XB 3WFCH 2GHWB 3W39A 5BCAA 4OGXL 4Z7WF 4XPBL 5LGJA 1U3JA 2DBLL 4ONOA 1MHEA 1ZLVK 3P4NB 5DO2C 2COQA 1R3KB 3T3ME 1J0YA 4F9LA 1S7SA 5I8KL 3GIZL 2DWEB 4QRTA 1JTOA 3DSFH 3WLBB 2BNQD 5SWZD 1BZ9A 4XNZB 4QRQB 5K59E 5FGSA 2H32A 2VDPL 3NZ8A 1Q0YL 3CMOL 4XAKE 1KN4L 1KPUA 1I7TB 2FJFA 2GK0A 2R4SL 3V95A 1IAIM 4XBEH 1J0JA 3MRLB 2D4DA 4X6CB 1QSFB 3QB7C 4DWHA 1NEUA 3BEWB 1N0XH 5CD3B 3BQUD 5GS1B 3H7BA 4ZFFA 5CEZL 5KSBA 4DKFH 2JCCB 4OZHF 5E6ID 2I07B 2QR0B 1D3CA 3QDMB 1LK2B 5KN5B 1DL7H 2XKUA 1CE6B 3QT2A 4AM0B 3MRCA 2AXGA 4PGZA 3FQWA 1R24B 3VJ6A 4ZFOB 5ESAA 3BHBA 3WE6A 1MAJA 2VLKA 5DD5L 3DGCR 4WCYH 2QSQA 5EBWA 4Z7OE 3LQZB 1HQRA 4W81A 4YR6B 3UXFA 4DCQB 2J4WL 5D6CA 4R8WH 1CS6A 2JLLA 3DROB 4HXAH 4JFEA 1OVZA 2BXYA 1JGEA 4PJGE 4ZD3L 3N50A 1RULH 3BWAA 3BWUC 4YHPB 4G3YH 3IYLW 1U0QA 4Q9RL 5L9DL 2OTWB 5EH1A 4KI1A 4GXUN 4NC2B 3GBLA 3PXHA 4PJBF 5CMAB 1DBKL 1KT2A 2EYSA 4PJFF 4S1SH 1KPVA 3L3JA 5F7UA 2EYTB 4AG4H 3CDGA 3VH8A 4XNYL 2B1AL 3IU4H 4XCNB 3RGVA 4KQ3H 4DGYL 5IB5B 2DQFA 4OGXH 4XPBH 3V5DA 3NIDE 1ROWA 4XHJC 1FZJA 1LO5B 4WIQA 4E5XB 4IIQA 2J3SA 2GY7B 4EI5A 4MQXC 4OM0L 3TH4T 4JN2B 4OKVA 3VXUB 1YEGH 4PJAB 3JV6B 1BZ7A 3STBA 5I8KH 4LVHB 3GIZH 1T4KA 4RMUA 5DRWB 4FQCL 3VXSE 1OTUD 5KZCD 3KAAA 4FQ2H 3HRPA 1IC5L 4ODVL 3QUYC 1CK0H 1NSNL 5ICXA 3SKNB 1KLGB 2VDPH 1JHKL 2AKRA 3VFOA 1UB6A 1DUZA 4ZG1A 3G04A 1S7QA 4RDQF 4ZODA 4JQVA 5ECJE 3FT4A 2Y36L 1N64L 1KJ2B 3C60C 2R4SH 2KQMA 5EU5A 2MWCA 2ITCB 4P5KA 2P42B 4RAHA 3RJQB 3X3FL 3O0RH 2FJHB 4BZYA 4TNVK 4X6DF 4TVPE 3WO4B 3B5TA 1J8HD 2YRPA 5E9DD 1LEKB 2YOCA 4X5LA 3F7YB 1LMKA 3MC0A 4WW1A 4LKXB 5GJTH 2XTJD 3QFJB 5CJXA 5C0GB 4OQTL 3BZEB 1F00I 3C8HA 2J4WH 4XZUB 1D6EA 1WT5C 1FZMB 3CCHA 4LCYA 2EE3A 3RHWK 2O61A 1NCDL 5IMMB 3ALPA 3BYTA 1D5MB 4ZD3H 3BP4A 1RUQL 4LSQL 3V0WH 3QQ9C 4IRJD 4JVPA 2FHBA 4KKCD 4JO1L 1K3IA 5L9DH 3IRZA 3JV4B 2ZNXA 5FDWA 3GSVA 1QA9B 2FLBT 5DJ2A 2JK5A 3GB7B 3MUHL 2AJUH 3QO0A 4OUUB 4UDTA 3MTRA 4GMTH 1TVHA 4QHNB 5E2JA 1XIWD 3WJLC 3DO7B 2VDML 2Q8AL 2B1AH 3VFMA 3H9SB 2WQ8A 4DGYH 1C16A 4PUBL 2CH8A 2DIAA 2Z92A 4GKZB 4Y16B 5IWLC 4GLRH 2HVJA 2R2CA 5HXMA 1S7TB 3FN3A 4FS0A 5MENB 3TVMB 4PRIE 1NLBL 1P5VA 4BFIA 3MACL 4HKBA 1T89A 3I50H 5H37G 4XAKD 3TJHC 1KELL 1G0DA 4ODVH 3SCMB 4X7TB 2AJYL 1YEJL 2NY7L 3SHSA 4NZTH 4QF1A 3MRPB 4KK8D 4Z7WE 2VLRA 2OZ4A 5GGUA 1NBZA 5DMKA 2VR4A 3FQUB 4O2FA 4NQXB 1N64H 3MUGB 1FNGB 4HS8L 4LAQH 1ZLUK 3NCEB 5FM4A 5JA9A 1FVEB 5I30H 2YZ8A 5CEXA 3W0WB 3VFTB 3MZGB 3ZL4L 1TVBB 3EOTL 4U1LA 25C8H 3UPRA 4PJXE 4NO3A 3T0AA 2CLZB 3D39B 4P46D 4XT1C 3ZKNC 4CVXB 4C59B 2PXYD 3KYOA 2FIKB 3AMLA 1J86A 1P2CA 3ECBA 2XRAL 1Z9LA 1YN7A 2YMXL 2DYPB 2OJZH 1T1YB 1I9EA 4ZAKC 5I1IH 5B4MC 5ITBL 5F7KC 5HPOA 5ID0A 4P5TC 1EAJA 1MFDH 5C0FA 4BKLB 5DEFB 1Q72L 1BD2A 5JR1H 4BZ2H 3D69B 4ZFGH 1XGPB 1JPGB 4QHLB 2CLRB 3SE9L 1RI8A 5JQ6L 3TIDB 2F74B 2EDEA 5B8CC 4MCZA 5FIEA 4CMMB 3GSNA 2GCYA 2VDMH 1E4XI 4UI2A 2NW2B 4U1MA 3JZ7A 4NM4H 4MNGB 3D0VA 5DMIL 1GPOL 3B9KA 1J1XL 3ULSB 1FYTA 2WK2A 4DW2H 1M1SA 4PJBE 4N0UE 5DQDH 4L1DA 2NXZB 4JDZB 1EFXD 4K3JL 2BHYA 4PJFE 1DQLL 4HUNB 2CXKA 3U9UA 5HI5C 5JMRA 1OAXH 1YEJH 2NY7H 4ZO6A 3EDKA 3MRBA 2D7QA 5DQ9B 1CXLA 1WBZA 4TVPD 4FQJL 5TE6H 4NQDE 3KYKL 2YK1H 5MHSE 3SJVA 3LEYH 5K33A 4HUUA 4L3CB 5FGBC 3CFDA 4XPTH 4KRPC 5J12C 1B90A 2WANA 3OKLB 3SQOH 1EGJH 4JCLA 4M61A 1FFRA 2R1WB 5BVPH 4I48B 1GC1L 5F3HA 1UKQA 2R1XA 3WXWL 1X5ZA 2AK4E 3ZLQC 1X4YA 5IIEB 5I6XC 1YY8B 3ZDYF 2HFFA 1GL4B 5HHME 5KSAA 3NBNA 2XRAH 1HYRC 3P0YL 1F02I 3RU8L 2JE8A 5J6HA 1IKFL 4DUVA 43C9B 3FOMB 4I3RL 3GUTB 3OB0H 3UBXA 4MDJA 4Z9KB 1JPTH 3HZMB 1HHKB 3G08B 1RUKL 4J4PC 4D8PA 3MNVA 1WVZA 3GRWA 3O41B 3G9VA 3CU1A 3UBXI 4LLUB 5IVXA 2A74A 1M7IA 2IANA 3HAEB 3B9EA 4FMFA 3RNQB 1TZIA 2ATPA 1ACYH 4TUOB 4AIOA 2HH0L 4FN0A 1XCTA 4L3EB 4L8DB 2YWYA 1TETL 1CLZH 1GPOH 1KLFA 1NEZB 1J1XH 1WGOA 2OCFD 3HMXA 5DSCB 1FRGL 4NQEE 1R3IL 2DD8L 3JXAA 1T7VA 3WUZA 3DVGB 3VGEA 1JGDA 4MS8D 3QPQC 4IMLB 1JPFA 1U8LA 5FHBL 2FGZA 3EZJB 5CZKA 2V2TB 3W9DB 4DFIA 1DQLH 1YEIL 1QNZL 4V1DE 5B3NA 3QEHA 1PZ5B 1CG9B 2XWTB 3IAPA 5ID1A 3KYAA 5CUSL 4OI9A 3ZHKA 4Q97A 4Y2DD 1B0RA 1C5BL 5JOFA 3UTTB 5IQ7L 1Z5LA 1T22B 3BGFB 1D5BA 3T4AB 3NFSL 2FCBA 4EUPG 1ZVSB 2O5XL 4GBXC 4M7LL 4X6EB 3KYNA 4Q58C 1G9NL 1CGTA 1GC1H 4LF3A 4ODXB 1E4WH 3WXWH 4UMGA 4TSBL 5ANMA 1F90H 4KV5F 1X5FA 4XVTH 4QT5A 3P0YH 1FC2D 3MBXH 4Z6AT 2A6KA 4I3RH 2UUDK 4OZGE 1N8ZA 1LO3H 1JNLH 4YBHA 2W65A 3RZWA 2FBJH 3DHMA 3FOLA 4E9LA 1RUKH 2J2ZA 3GIVB 2NTSP 2GT9A 5T3XL 3T8XB 1IGML 4WRLA 5HHQB 3RTQB 4NHCH 4XCYA 5D7KE 4JZJA 5LXGL 4EDXA 5ISZB 5F9JB 2ENSA 5I73C 3O8XA 3BH9B 1TJHH 4ZYKB 1NGZB 2DI8A 5F96H 1S8DA 3L95B 2XIDA 3ARBA 1FAKT 4ODUA 2Q87A 5IB2B 5EUOF 3WL9A 1EO8L 4JPWH 4Y4KD 4EIGB 5TFSL 3DMMB 4HK3N 3JWNC 1XZ0A 2GTZA 5GRZA 4LSPL 1ZHLB 2AJZB 2XWJA 1EAPA 2A6IA 2AERT 5DMYA 3BEVB 3IDYC 5E2WH 5T5NF 4N0RA 4GAJH 4U1HB 3QXVA 1QNZH 4NQDD 3QIUD 4PRBB 5GZND 5MHSD 1JGUH 2DTMH 2OL3H 1J88A 5CUSH 2PYED 2V17L 3CDYA 3ZKQD 2JKXA 1R3KA 3MLUL 3PIQB 4RNRB 4KZEL 4W4NA 5IQ7H 1RURL 2B0SH 2DWEA 2FECI 1WC7A 3NFSH 3PWLB 3QQ4A 3WLBA 3RWFB 2JJSC 3THMH 3UAJC 4WTZG 4MJ2A 4MSWB 2WUCH 3UYRL 2AK4D 5IW1B 3QIBB 5K9OA 3TBYB 4JPKL 4M7LH 4RA0C 5HHMD 2BK8A 1G9NH 2P44B 2VITB 2AW2A 3VGAB 2KH2B 5C3TA 3MRLA 4X6CA 2DLGA 1N2RB 1QSFA 4I18C 3X12B 3OZ9H 5GS1A 1EO5A 4KKLC 4TSBH 5DGQA 3VRIB 4RRPA 2JCCA 2I07A 4LSRL 4NN5C 4YHMH 2HVKA 4U1JB 1FBIL 5KW9L 5KN5A 5FDYA 1CE6A 4FQQA 1E6JL 2KPNA 1AKJD 4IJ3C 3NGBB 1UKTA 2ZG2A 3QUXC 2ED8A 5BRZE 2BSRA 4I4WA 4AZ8A 5F7DB 4N0CC 4R4ND 2HWZH 3OJVC 2DJ4A 1FZKA 5D1ZC 5FB8B 4XP4L 5HVWA 5IHLB 1JWUB 3DROA 4KK9C 5DUML 5IVOA 4EJ1C 1ZHKA 3WKNA 1RY7B 1YC8A 1G7JB 3ZDYE 4NQSA 5AZ2H 3G5YB 2QQKH 4NQED 3MO1A 2Y07L 3UMTA 4PR5B 3LIZL 1P7QD 1EIBA 2NY6B 1JP5A 5JNYB 1VESA 4I9WD 4YPGB 3GMNA 5JIKA 4ERSL 4LSPH 1C7SA 2EYTA 3HG1E 2FHFA 4ISVB 4KRNA 4QY8B 3KS0J 5C0AE 1Q9KA 4XCNA 1XGQB 2IPTL 4K8RC 3AREB 4PJ9C 5IB5A 1P9MA 1DVFC 1RD6A 2V7HB 3RRQA 1AC0A 3IJYA 5EC1B 1XR9B 1CFSB 1LO5A 1U58B 1G1YA 1TQCC 1UZ6F 2V9QA 4WI3A 4JM4H 1F8TH 3MLUH 4JN2A 4S0SD 5FKAB 3VXUA 4PJAA 4NUJB 4XNXL 1RURH 3JV6A 5JO5B 1T0NA 4M02A 2ADFL 3DRTA 1N6VA 4OLWL 4YHZL 4I13B 1KC5H 4KHTL 3SKNA 3QEUA 1KLGA 4M6NH 4LARH 5E1AB 4NNPH 1KJ2A 3PL6A 3C6LD 1PG7W 4PJCB 4BH7B 4PTTA 4X9BA 4L9DA 3S3SA 3WNPA 1FFNA 5K9JH 4RIRA 3WHXA 4TNWF 2I60H 1L6ZA 3OF6D 4LSRH 3WLWD 4KROD 1LEKA 3FO2B 4K71B 3F7YA 2GI7A 1I8KA 5C0GA 2XOTA 4XZUA 4NQUA 5DD1L 1NUGA 4OJFL 4XP4H 1FZMA 3UTSB 3B3IB 3GMOA 5GSRA 1QBLL 4PPTA 3MCKA 1CGSL 5D7IB 1H3WM 5DUMH 1G7LB 5TQ2H 1D5MA 3T77B 3IGAB 4KV5E 3EJZC 2A6JB 2YUVA 3BJ91 1MLBB 3P9LA 2Y72A 3QEQE 5DVMA 3UJTL 5CP7B 2EIZB 2JELH 3BPNB 3OKOA 4PG2A 2FL5B 5D72L 5TQ0L 4N1HB 1A2YB 2FJGB 3GB7A 3RI5K 3DBXB 3MV8B 3IS0X 4OUUA 4Q2ZA 4QHNA 2X4OA 3WHE1 3ISWA 1D9KD 5C0ND 1KUMA 2IEPA 3DO7A 5D5MF 3LD8B 5HHPB 3SO3B 2OTPA 1A9BB 5BZWB 4GKZA 5IB1A 4AEHH 3O45B 2HTKC 1L7TL 5EUOE 4TUJB 1MQ8A 1QLEH 1S7TA 1KIPB 1RZJH 5MENA 1G7IB 1EPFA 4NBXB 4EDWL 4J6RL 3KPQA 2D4FA 2ADFH 4PRHB 1IMHC 2D9CA 4YC2B 3WFDH 4LMQI 4X7TA 4KHTH 1LE5B 1A7OH 3MRPA 4B7IA 4NJAH 3HUJF 1J10A 2F53E 4APQB 1BGXL 1FO0L 3T2NH 5IFHL 3FQUA 4C4KO 4NQXA 4O00A 1FNGA 1TPXB 4RAVA 4P2OA 3GSOB 4HK0B 4N5EC 2BOCA 3V6OA 4LRNH 1ZVHA 2ID5A 5KBNC 4U6TA 2I25N 2A9NL 1R5IB 2ITDB 1I1RA 1TVBA 5ELIA 3ZDXE 3P0VH 5F6IC 1X4ZA 4JKKA 4LHUD 3TWCL 4DVBB 1ETZB 3FFCE 5MEPA 2CLZA 6CGTA 5EG6C 1DEEA 1UYWL 3B2UD 4Y1AE 2AV1A 1FAIL 4R96B 3MJGX 4X4MA 3QNZB 4R90L 2FIKA 1FNEB 4OJFH 2ZZUT 1CGSH 4G9FD 1OF2B 1T1YA 3CZFB 3C5SA 5E8EB 3ARSA 3CU7A 3FN9A 3NZHL 4N8PA 3UCRA 4BKLA 3OGCB 5DEFA 3UJTH 3HG1D 4NKDA 2IQ9L 3AROA 4JDTH 2YS4A 5T5FL 5C0BD 2NX5D 5C0AD 3T0EB 3GSRB 2XQBL 4WHYG 5TQ0H 4QHLA 4XWGL 3VG9C 2CLRA 4EN3D 1CI5A 3TIDA 4ZOEA 4L9LB 4CMMA 3WN5C 4QEGA 4P23D 2OS7A 4QGYA 5AUMA 1J5OH 3MBEC 2UZIH 4M6ML 1OY3B 4PJDB 1QYGH 5HYQA 4GQ9L 4S11A 1UWXH 2EDRA 5D71L 1R5VB 4ORGA 3VFNB 5BS0E 1JBJA 2F5AH 4JDZA 4J6RH 2BC4B 4MNHB 1YEFL 1B3JA 1FDLL 4M7KH 3STLB 3JWDC 3V4UL 3QJFB 1CGUA 1AJ7H 5EO0A 1SYSB 5E03A 3P11H 1LHZA 1U3YA 3TJEL 2N4IA 4UQ3A 5DQ9A 1BGXH 1FO0H 4XCFH 3NVQA 2DM2A 5IFHH 1MEXL 4XPHL 1JGVH 2V5RA 4Y4HC 1EEQA 3MNZA 2OQJB 4ZS7L 4RGOL 4L3CA 4PIRF 1IAMA 4PJEB 1PGRB 2ARJA 4GXVH 2A9NH 3U1SH 2EXWC 3QIWB 4HGKC 1VEPA 4EXPX 3QHZL 3OKLA 5DZOA 1N6UA 4MA1C 3TWCH 3EDFA 1U93B 2R1WA 4K3GA 3OGOE 3WFBH 3M8OL 5DK0B 3TN0D 1I1FB 3TF7C 3WFHB 5IK3B 5IIEA 2D9QB 1AO7D 2CKBB 5D1QA 3DVIA 3SBWA 1MH5A 2MKLC 5CZVL 1H3GA 1I7ZB 1JMZA 1XMWA 4F3FB 4YUEL 4RMSA 3NZHH 1OD7A 43C9A 3WFZA 1UM4H 4XTRD 3BO8A 4K3EH 1FSKB 3TO4B 3HZMA 4YK4C 2IQ9H 3K7UA 4LP4A 4LVOB 2NY5H 43CAA 5AD0B 1BEYL 1OW0C 1UGNA 1A4JA 4LLUA 4E41B 3OJDB 4M5YL 2VNCA 5IBTL 3WDIA 3HAEA 1JHTB 4LCIL 2VZTA 2DLFH 5LVEA 4U0QB 4UV4L 4IHOB 3MGTB 3V2AR 4M6MH 4X0KA 2F8OA 1NEZA 3EYFA 5DSCA 2P1YA 3NCYS 4UQ2A 3VXME 3M1BA 1WBYA 2OMNA 3DVGA 1XF2B 5IV2B 3DXAE 1AGDA 2F53D 5IROC 1A7RH 3ALWA 5FYLD 2J6EL 2ARWA 4E42B 4YXHH 1KJMA 3W9DA 2NNAB 1FFQA 1ZEAL 4LSTH 1Z3GL 5HVGB 4F7MB 1PZ5A 1RV6X 5D5ME 3KJ4B 1CG9A 4EQ2A 4ZNEA 4KY1L 2B4CL 2BVUA 3BE1H 1IL1B 2NY2C 3TJEH 5JW4Q 1B2WH 3V0VB 2HMIC 3P40A 1MEXH 4WWKD 3KLDA 5EBGA 1T22A 3QRGL 4GAGH 3MRHB 3T4AA 1PG7X 1CZ8L 2JJTC 3MV11 4Y8AA 4Y1AD 4LBEB 3RL1B 1ZVSA 3EFFA 2A83B 1CGXA 5A3IC 1RZIB 1ZMYA 1GXEA 1LO4L 3KLSA 1MIML 3T04D 4E0RA 3HUJE 2VERN 4CU8A 5DVLA 4P3CH 4IM8A 5EIIA 2YSSB 4LSVL 3EGSB 4PV9A 1MJJA 3K8LA 2IBZY 4UTAL 3KLAA 4LDOB 2F8XC 4L1HA 3VFGH 5FGRA 4LLQA 3HC3L 5F1IB 1NC2D 3MV01 1RUPH 4FP8L 4JM2F 1HXMA 4P9ML 1H3PH 5ACZB 3P30H 3ULUL 4MQ7A 4GRLD 5B21A 5F1NA 1H8OA 2W0LA 4WFGE 2E9WA 4NO2A 5HHQA 1IFHL 5ISZA 5TDNB 1LNUA 2MPAL 4M5YH 5F9JA 5IBTH 1PG7L 3RUGF 1NGZA 1KTDA 1HEZB 2X9WA 1IGCH 3L95A 4UV4H 1RJLB 5BS0D 1I7UB 4YXLL 4WEUD 1BM3L 4JFDE 3MA9H 5IFJB 4ELKA 3O6FA 4M9PA 2XACC 1NGQH 2A0LC 4WO4C 4YBQC 1ZHLA 1QSEE 2J5LB 4AL8L 3N1GC 5FCUL 2OR7A 1Z3GH 4C55A 2HT2D 3QYCA 5I74B 5JORB 3WHE0 1HN1A 2B4CH 2AJSH 1J18A 4JHZA 4FQPA 1XGUB 3WS6A 4KXZI 1UJ3B 1SMAA 3CFCH 3GKWH 4U49A 1UQSB 2JJUA 2YPKA 1TZHB 4U1SA 3QRGH 5I66A 1G0YR 3PWLA 1CZ8H 5FUZH 5JHDB 3BSZH 4JG1H 3RWFA 5T1MA 4MSWA 3KLHC 2YD1A 3HPJA 3QI9D 5C08A 3CH1B 1WCQA 1UWEL 5IW1A 5LWYL 2FWOB 3NIFE 3TBYA 2WWKT 1LO4H 1WZ1L 5CBAB 4F15B 3VI3E 2WBJD 4KJYA 3TPKA 3OV6A 4LCWB 4RFEB 4I2XE 2H3NB 3VWJD 1WICA 1KN2H 3GMPB 5FYJH 5EZJB 5AWNL 4FP8H 1JVKA 2UZXB 1JCKA 2EZ0D 2PO6D 1K4CA 3U6RB 5F7DA 1MCRA 2IF7A 3S34H 4YZFE 4QXWA 1U91B 4FA8A 2OXGA 2Z91B 3VXSB 5T3ZD 5CLWA 1WWBX 3SKOB 1ZA3B 3VXMD 2LVEA 1IAKA 5I8CB 1HKFA 3DXAD 3LS4H 3PGFH 5I16B 1BM3H 3AUVA 1IQWL 1U92A 3NTCH 4KK5D 1BBJA 4KMTL 4YDLC 5C0EB 3RX7A 1EVUA 2NY3C 1MCSA 3QZWB 3QHFH 4PTUB 3VXTA 1DTUA 1LVEA 4AL8H 4MJ5B 3R8QA 3PP4L 1P6AB 1ES0B 1XGQA 3MLVL 4KKAC 5FCUH 4ZXBC 5DVKA 1HSAB 2UY6A 3T0VA 4MNQE 4OZIF 5FEBA 1AH1A 5EC1A 1XR9A 4B41A 1CFSA 3V6ZA 3DRQB 4RCAA 1YPZE 4HUKB 3GSXB 4QHKI 5IGXL 5HHNA 3S4SG 2YPLB 5F21B 5TH2A 5EU6E 2VB5A 5FKAA 5I9QC 4KDWA 3VWKD 3D3VE 5M7QA 4NUJA 5E00B 3MRMB 5JO5A 4F58L 4Q6IC 2CQVA 5DWUL 1F6LL 1UWEH 4URTB 5FO8B 1EMTL 2WWMC 3IXTA 1WZ1H 5HYFA 3K2UH 2BERA 3HI1B 2HJLB 2DLTA 1RIHL 2VDKL 3VD3A 3VW3L 2CO7B 5FA4A 4Y5VC 3MXWH 4WFGD 5AWNH 4N9GA 4MXWL 4OFDA 2CO6B 2A38A 3VFUB 1BVLA 4PRIB 3DX9B 3SO5A 4J3UA 1S7WB 5TPWL 2B39A 4K23L 2CMRL 4HIXL 2Y1VA 3WDHA 3B3IA 4H25B 4JFDD 5D7IA 3H42H 1HHHA 3U79A 1V7ML 4ZUWB 1A3RH 3IGAA 5E5MA 4YX2H 5MEQB 2A6JA 1MLBA 3QDGA 1H0DB 2CRMA 2FEDD 3HI5L 5EORL 2FL5A 1IQWH 4I0PC 3G6JA 4KMTH 1A2YA 1N3NB 3DBXA 3BD5A 1U8NA 3LQMA 3QAZB 3L3HA 5ESQB 3PP4H 4JREB 3QULB 4KJWC 4OLZH 5HHPA 5GIRB 4P4KA 3RUGE 4F7EB 4PJXB 5BZWA 1W0VB 4R6UA 1GOHA 4RZCB 3NCJL 4KDTA 1F3DJ 4Y4FD 1AXTL 2AGJL 2Z35A 1EBAA 1OAUL 1INDL 3GI8H 4TUJA 3ZO0A 5IGXH 1G7IA 4OCYL 3KPSA 2DQCH 3LHPH 4N68A 1U3HA 1I8IA 4CN4A 1F3JA 1FV1B 4F58H 4YFEA 3ARGA 4IIQC 1WK0A 1U8PA 4U3XA 5DWUH 5JXED 3CLFH 1I9RL 3LOWA 5EZLB 1CD9B 2E6PA 1F4WL 3O3BB 4HK0A 1RIHH 3GKZA 1A64A 4HFUL 2ICWB 1OAYL 3NCFB 5DK3A 1R5IA 1QRND 1WWWX 3RP1A 2VTFA 3CVHB 3QUZC 2V2XB 3MRDA 4JLRB 3TZVA 3WUWB 1S5HA 1H3UA 4DVBA 5IG7B 3T1FB 2Z0BA 1DE4B 4PJ5E 2B7DT 2DQGL 1WAAA 4KQ4H 4P3DB 5EZIL 5EU3B 3C5ZD 4LLWB 4R96A 3QNZA 4JAMA 4N0UB 5TPWH 3TBTB 3GSNL 1FNEA 2C26A 2CDEB 2P5ED 3SDAC 1OF2A 2RQ8A 3CZFA 1M7DB 4MWFA 1CXFA 4YWGL 1V7MH 5GZOC 4MB5A 3FRPA 3OGCA 5C0IA 5KVGL 3HI5H 1LEIB 3SDDA 1A7NL 4N0YL 7CGTA 3PGDB 3T0EA 1BFTA 1IAOA 4FQ1L 5FYJE 3VA6A 1Q8MA 3W2DL 2L4OA 1E0OB 1SM3L 1OAKL 2GITB 4PGCB 2QADD 2X4RB 7FABL 5FHAL 4HD9A 5J1AB 4QO1A 3IFOB 1CFTB 3TBVB 3OXSB 1BIHA 5J13C 1PBYA 1A9EB 2IMMA 5KJRL 4HBQA 4JFFB 4MCYA 5IW6B 5SWZA 4ZUSA 3G5XB 1A6ZB 2H45A 4WHTB 5MI0C 2AGJH 1OAUH 2W0KA 1INDH 5GS0D 4HX1A 5KS9F 1R5VA 3D48R 2FH8A 1NL0H 2VLJD 3JWOC 3NACH 2BC4A 1YY9D 4G6KL 5D2NB 4BH8B 4NFCA 5CCKL 4NN7B 1AC6A 5GGRY 3IJSB 2E7HA 5F7EH 3QJFA 2RR3A 4U0RB 3BQUA 5J06A 4CN6A 1I9RH 1NCBL 1BBDH 3CXHK 4DAGL 3MV9E 3IDJA 3MRKB 1EUUA 2UVEA 1KB5A 2VIRB 3KYMA 3MREB 3D2UD 4RISL 1HHGB 3BVNB 2FBOJ 1NAMH 4PY8I 1LD9A 4LQ1A 2I5YL 5T1KB 3BP6B 1MFEH 3T2OA 4W4OC 4KVNL 4OCXL 1U93A 5HHOB 4MLSA 2FATL 2BVPB 3GRWL 4OFIA 4UBDD 3FTGA 1I1FA 1NGWB 4JVUA 5EZIH 5F8QC 3AS2A 2DDQL 1U8MB 4NDMA 3HR5B 2CKBA 4HBCH 1K2DB 3U83A 1A22B 3N1MC 4JM2D 2ZJSH 1I7ZA 4V1DB 3AM8C 4F3FA 4NPYA 1WTLA 3ZSSA 4YWGH 4JZOB 1RK1A 4ESKA 1MHPL 3WEXB 4XCCL 3TO4A 5KVGH 1A4KB 2CPCA 4MD4B 5FF6A 1IQDB 1IC4L 1QD0A 1JPST 3PABA 4BA8A 4DGVL 4KTEL 1XF4A 3GNML 1JHTA 4HEPG 1UKSA 4OUOA 3FO1B 4W6XB 1CDUA 5FHAH 3IRPX 1JPSH 3RX5A 4BFEA 5I76A 1FZOA 1AHWB 4ONHB 5JDJA 2IFGA 1ZANH 1XF2A 5ACLA 4KI5E 2X89D 1RUML 4OFVA 2AS5M 1UB5B 3CSBA 2VDRH 5IQ9B 1WUNT 2BMKA 5C09E 2OR9H 1GYAA 3EDJA 2LU7A 1S3KL 1JYXA 3CFJA 3QUKA 4N0FB 4OZGB 5ICZB 4OGYH 4IRSD 5FGCE 1IL1A 1NCBH 4PV8B 5IVNA 3OKDB 4Y19E 4EEEA 1OSZB 3LPWA 2ADIB 4X7DC 3SOBL 4HH9B 2P43B 3K80A 3MRHA 3GM0A 2W60A 1HNFA 3OR6B 4PJ5D 4LBEA 3RL1A 1J05B 2I5YH 1KFAL 2A83A 4MHHI 4H8WL 2Q76B 1RZIA 2DB8A 3KPLB 4KVNH 5C6WH 5HYJE 3D18B 1IILE 3CDCA 3EYOB 1MFAL 5H94A 2DDQH 4LDEB 3O9WC 2WIMA 3HI6L 5DO2D 2ATKB 3ZTNL 2NTFB 3TESA 5FYJD 4OAWB 5A2KH 2EO9A 4UB0L 5ACZA 5E4EC 5DJYA 3K74B 3ULVL 3M45A 4MAUH 3DJ9A 1UFUA 4QRPE 4CJ0A 1C1EH 1TJIH 1A6AB 5I1CH 4KTEH 1MAML 1TQBC 1ORQA 3WNLA 3GNMH 4WJ5B 1FL6A 1HEZA 5CEYB 2DWDB 3BAEL 3RPIA 2NY0B 3MMEA 1T83C 1XGYL 5IFJA 3OKEB 2OX5A 4NT6A 1A7QH 3KHOA 4LCCA 1IAII 5IJKC 4YHLL 4LQFL 1WEJL 1KNOB 1RU9H 2YBRB 1RUMH 2R15A 5CP3A 4IOIB 4LEXH 1IBGH 3MV9D 2IFFL 3PWUA 1GVIA 4OLUL 1S7XB 4MXVF 2F58L 3WIHH 5BRZB 2GUOB 1RZKL 1XGUA 4QTIL 4O02H 1UJ3A 5D2LF 2WV3A 3RIAF 2DQIL 5BO1H 1UQSA 5EN2B 3SOBH 3LB6C 3HZVB 1FORL 2BY1A 5KS9E 5F6HI 4HGMA 1LDPH 5AEAA 1BLNA 4PJGA 5DRNB 4JO2L 2PXYA 2Z8WC 2R69L 4HPYL 4KRMB 3BP5A 2FWOA 1YUHA 4H8WH 1L0YA 1Y0LB 4PYGA 5L6YL 1OQOA 4RFEA 4WHDA 2IGFL 3T09A 3ZT7A 3K2MC 4YE4H 3D25A 4WV1C 4XHJD 3BN3B 4DEPB 1NGXA 1KLUA 5C71A 4NQCD 2CIIB 3LN5A 1H5BA 4MQXD 4QXGL 4X7SL 4TOYL 5EZJA 3V8OA 4UB0H 5H8DA 3LKRB 4FABH 1ZS8B 3QUYD 4DZBA 3RZCB 2PTTA 2CR3A 1U91A 2BDNL 5I71C 4RGNB 1IGJB 4PFEA 3VXSA 1II4E 1H15A 3C60D 4NN6C 4OCRL 5AYQA 2CUMA 3CUPA 4NFBA 5I8CA 3BAEH 3LH2L 4EQ3A 4XMPL 4QRUB 1XGYH 4P2QE 2QSCL 3L3KB 4B0MM 4JZJC 4LLYB 3IDGB 5EOQL 4TNWK 4YO0B 4L8CB 4LQFH 3O8XC 4PS4H 1MI5E 3TT1L 4HKXB 4MJ5A 1ES0A 3ARBC 5J11B 4Y19D 5GRXG 3IJHA 4G8IB 4NSKB 2Y6SC 4OLVL 2F58H 4GKSB 4YHOL 4H0HB 1I1AB 3DRQA 5A40E 3GSXA 4QTIH 1WZKA 5SV3A 3BGMA 2DQIH 5E00A 1DQTA 4G7VH 3QQ9D 3GMMB 4YHIA 5HYJD 1ED3B 4DOHB 3O6LH 3AY4A 4WFFE 4GFTB 3LZFL 2CKNA 2R69H 2FB4L 4HPYH 3QEQB 1INQB 5FO8A 5L2KE 3C2SA 3DURB 3HNSL 2VZUA 2ZSVA 2VN4A 4OGZA 1CQKA 1T2QL 2Q86B 1GGCH 4XNZC 1X5IA 4XRCA 2X1WL 2BX5A 3V7AE 1JWMB 3WBDA 2BSED 2FEEI 1MRDL 1BQLL 4QXGH 1T21B 4X7SH 2DMBA 4QRPD 5DT1L 1AQKH 1OGAE 4K9EL 1FFOB 1AR2A 5I19H 3TJHD 4PRIA 3DX9A 1UM5L 5GS1C 2X05A 4GRWH 2EIDA 3F7QA 1MCWM 1Y6NR 1DBAH 3BX7C 3S8WA 2YUXA 3K3QA 3IFNH 2BDNH 1A7BA 4J8RB 4H25A 5T5NG 4GRWF 2ZPKL 3D0LA 5C0CB 3UO1L 2C1OB 3IF1B 4HJGB 1BVZA 5I2IB 3E3QC 4JJHA 4Z7WA 2BFVL 4ELMF 2VXVL 4CVWA 1EXUA 3LH2H 4Q6YA 2DQUL 1N59B 4I3SH 1HHIB 4X4XB 4PJHB 5LBSL 3L7FB 1N3NA 2HLAB 4Z5RB 2A2QT 3VFVB 2JIXB 3P4MB 1K8DA 5ESQA 3TT1H 3QULA 1FE8H 2HJFA 3EBAA 4F7EA 4PJXA 3WS3B 1GOGA 3FFCB 1W0VA 4AEEA 3HZYA 4KAQH 4AH2B 3SE3A 1KULA 3RVTC 4ZAKD 3NCCB 5B4MD 5DZLA 1VKXB 4QRRB 5DK2A 1S7RB 2O93L 3LSOA 1Z6JT 4P5TD 4PP2A 5SWQB 4JFYB 4XP1L 1D5IL 4MA3A 5IKCB 4F7CA 2LV4A 1KTRL 4Z76A 1TVDA 1F2XK 4MXVE 3V5HA 2WP3T 4LVHC 5FK9B 2VAAA 5D2LE 3GO1L 1T2QH 1DLFL 3T65B 3F58L 2ICWA 3QUML 5B3JF 2G5RA 4AEFA 4MA8L 1S9VB 4JLRA 3WUWA 1S9WB 3HNTL 2X9YA 1H9VA 2ICWI 4U1NB 4LAJH 1PKOA 4LOUC 1UWXK 3SDXB 3UYOD 2JB5H 4K94L 1X5JA 2VLME 4O4YL 5EU3A 4EI6A 1UM5H 1GZPA 5HI5D 3HFML 3E6HB 4G6ML 4PJBA 1YQ2A 3PJSA 4N0UA 3TBTA 2APXA 4Y4KA 3WO4C 4PJFA 3IAQA 2CDEA 3WJJA 1HZHH 4PJ8B 3EKCA 1FC1A 4ZUTB 4Z7UE 5DFVC 4HWEH 1B4JH 1Z9OA 4F8QA 3NA4A 4Z78B 4OZFB 1MI5D 2DI9A 4H26B 3PWPE 2VXVH 3B5HA 1RZGA 3PGDA 4FTVE 4G7YL 1XCQA 3OXRB 2DQUH 3I6KB 4NQDA 4KRPD 3TO2B 2GSIB 2ZOKA 1NAKL 4G8GD 1NCWL 4F57L 1SEQL 3FFDA 5B39B 3MRNB 2GITA 5DMGC 1P7HL 4OLXH 1W72H 5H37H 4BQ9A 5J1AA 3OL2A 1P1ZB 3MYJA 5CJOL 3OXSA 4FQLL 1A9EA 4MJIB 4YIQB 4AENA 4HXBH 4D9QE 1X6NA 5IW6A 3G5XA 4WHTA 2ZUUA 4U6YB 3DVNA 5CGYC 4WFFD 3KPRB 1N4XH 3SGKC 1LGVA 2AK4A 5DJDA 4OFPA 3FHAA 1ZLVH 4XNMB 1AD0B 1BIIB 4U6HA 2F54E 2CD0A 3QIUC 4J4PD 4XP1H 5D1XB 4N1CA 4WUKH 3IU3B 4Y16C 1T1XB 4ETQB 3SDCB 1KENL 1NFIB 2BVQA 1Z0MA 1V7NH 3DI2B 3TVMC 4R7DB 5ERWA 2EEBA 4JANA 5D7JC 3FB7B 3VFSB 2VIRA 1VFUA 1IGTB 1AKJA 1HHGA 1YJDC 3U82B 3SCMC 1DLFH 3KG5A 1OGAD 2BSTA 4DQOL 3QUMH 5T1KA 1DQDL 3BP6A 1D5XB 4MA8H 3PP3H 4Q74A 3SDYL 3ZDZE 2V6HA 4GQPH 2BVPA 3QPQD 1FGNL 5DDHB 2EYRB 3VGHA 4CU7A 2MJWA 2MCPL 4NQVB 5F9OH 4BFGA 3Q0HA 5JIPA 3JWDH 1U8MA 4G6MH 4NRZA 1XGTB 3VD4A 4GT7A 2CR6A 2X40A 4HIHA 4V1DA 3FMGL 4I5BB 4RMWA 5J0BA 5GGQL 3WD5H 1FJ1B 1MRCL 2X4PA 1X5KA 2E7BA 2IBBA 4MD4A 1IQDA 5IF0B 4G7YH 1R3LB 2EDLA 4L8BB 1K6QL 1JUFB 3NFNB 4GBXD 2B2XL 2Q7YB 2X5PA 1NAKH 1KGCD 4PREB 4M7ZB 3W11C 2P8MB 2OSLB 3CFEA 5EWIL 3FO1A 4OZ4B 3E8UH 4GRWE 3WDJA 2ED7A 4HPOH 4IOFC 4J3XA 4OV5B 2JF1A 3FB5A 4FQLH 4AMKH 2YC1B 4M7JL 3STZA 4OFYA 1ZHNB 2N7BA 4P9HL 4ELME 3B4NA 4IS6B 2WNGA 4Y5XB 1M7XA 5DURD 2W91A 4IMKA 4HFWA 4JGMA 4WTWA 1OD9A 5IQ9A 1HWGB 3KXFE 1RPQA 1U42A 4KMLB 4OZGA 1SQ2N 2HJKA 4N0FA 3NABL 4ODSL 4X8JB 5ICZA 3UX9B 3OKDA 4LHJB 5CWSB 5JPNA 3OF6A 2NXZC 1ZHBB 2Q3ZA 5CJBA 3P73B 2YKLL 2DOCA 1AQDB 2D0FA 2P8PB 3X17A 5ILTH 2VISA 2UWEE 3QISA 4DQOH 5BZDA 3IDMA 1T7YA 3B2VL 3V8CA 2VLMD 1DQDH 5L8JB 3FRUB 3V5KA 4PD4K 2Q76A 3KPLA 4Q9CA 4GG6F 2EKSB 1QVOA 1F45A 4ZPTB 3D18A 4AIZB 2BY2A 1FGNH 2NPLX 4GW1A 4OQ1A 2MCPH 1UENA 1CWVA 4OCMC 1MF2L 3EYOA 2JB6B 4FMKA 3WV0A 4NGHL 3LRSB 1QSEB 5EOCJ 4M62H 2FZ3B 3UJJH 3G6AB 3OJ2C 2Y25A 1N6QH 3PWPD 1AXSA 1DSFH 5DI8B 2NTFA 1CXEA 5B3JE 12E8H 4MMZC 3RDTD 2ICCA 4M5ZH 1MRCH 4Y5YB 1ZGLP 2CGRL 1NDGB 2IH3B 2B20A 2CDFB 3UAJD 1G6RH 3JSSA 4P2RE 1ZA6A 1G9ML 1WLHA 4KTDH 4KPHH 3SBWC 1K6QH 1Q9WB 5LQBH 1A6AA 2B2XH 2WM0A 2LTQB 5C7XL 3IDIB 1I85C 4PJIE 1HKLH 5I1JH