5E2VH

Anti-tau at8 fab with doubly phosphorylated tau peptide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
208
Chain Sequence
DVQLQESGPGLVKPSQSLSLTCSVTDYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKNRISITRDPSKDQFFLNLNSVTTEDTATYYCTRGSLVWGQGTLVTVSAASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT8 LIGHT CHAIN
publication title Epitope mapping and structural basis for the recognition of phosphorylated tau by the anti-tau antibody AT8.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 49
structure length 208
sequence length 213
ec nomenclature
pdb deposition date 2015-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e2vH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e2vH01
5JXEC 1LO2L 3FO0H 4JPWL 2BSSA 1TJGH 1QEWA 2GAZA 1T6WA 3EDDA 4YE4H 2AK4A 4DKAA 3PE9A 5EO1A 1S7TA 4OIAA 2NQCA 1MLBB 2EDEA 2CSPA 4PJGF 1LO3L 5C0DA 3S3PA 3KVQA 1IGIH 1V3JA 1S5HB 4L3CB 3GBLA 2YPLD 3STLB 3DROA 2I9LB 3D2UA 5IM7A 5T5NF 1QO3B 1I85A 5JZ7C 4WV1C 4L3EA 3WBDA 3HMWH 3L3GB 3O4LE 3QO0A 5D96C 4PJEE 4CVXB 2E6PA 2P48B 1DUZA 3KYKL 1F6LL 4U1KA 4FQIH 4DOHE 1ZANL 4ELKA 1T20B 2DJSA 3DVGA 4ZNEA 1KB9K 3EYSH 3EAKA 4HPYH 4NRZB 1ZA6A 5C71A 3OKYA 3GMOA 2UUDK 5T1DH 1VGKB 3TYFA 5I1GL 5DZOA 2B1HL 4X6EB 3GEWB 4MWFA 2X09A 3T0EC 4PJ5A 5GZND 4U6VH 5FUOH 2H32B 4FZEH 3T0EE 4BFIA 4L8SA 4D9LL 5IVXF 4OGAD 5DJDB 3MRGB 2DBLH 1WT5C 3IAGC 4HKZB 1TFHA 2X41A 4JJ5B 5A2IH 1H15A 1YEJL 1RZIB 2NY2B 3UTTA 1UB5B 1WICA 4MCYA 5DT1H 5E94B 3IFPB 2BOCA 3EJYC 1ZHNA 3QJHB 4Z7NE 4C56E 5IMLA 3H9SD 3GNML 3KDMA 4JRYA 2Q8AH 3B2VH 4R4FH 1IAIH 1E4KC 5T5FH 1ZHKB 4JFXA 2FX9H 2YD6A 2FO4A 3G08A 3MRIA 3QDJD 5F1IB 2GI7A 3JWOL 3SN6N 4YZFE 4WGWB 2BNQE 5LKNA 2X4QB 3MRKA 2D4FA 1CR9H 3QXTA 2MKLC 2D0FA 3BEVA 4ZXBA 1XR9B 1IEBA 2ADIB 4MMZC 4S1QH 3ZHDA 5JW4N 3ARUA 4OM0H 1EEUA 1AFVH 4GAYA 2IPKA 4RISL 3V4VL 1MREL 2BVQA 1K2DB 1SYVA 4GW5A 4HZAA 2FECI 4KJWC 5JR1H 1GOGA 4X6CA 1CT8A 1M05B 5DUPH 1JHLH 3PV6A 3X14A 1P1ZB 1MI5E 4BH8B 4AT6A 3FB6B 2AJXH 1I8MB 3VFWB 4ZOBA 5D7SL 4R0LB 3HZVB 4K7FA 1MFNA 1FVEB 1TETH 2H8PB 4MQSB 4HD9A 3GUTB 5DK0B 4WDIB 3QNZB 2GTWB 2CLZB 3O3BB 1HKLL 1T2XA 3HPJB 4PJCE 1X4ZA 3CXDL 2XXCB 3AS1A 4LHUB 2JK5B 4GUPA 4HHAA 4KRNA 3BN3B 3UJTL 1OAYH 4JFFE 4YK4C 3SOBL 1UJ3C 1X9QA 4XPFL 4FXKB 5J06A 3TBWA 2K7PA 1WK0A 4XMKH 1UXSB 1XCTB 5B3NA 5FF6B 2ZKHH 4NHUB 2ZWLT 4F7PB 4MSWB 4ODVL 1R24A 4DWHA 1BD2A 3MJ6A 5HJ3B 4O02L 2VITB 4J23A 4OV6F 4EKXA 2NY2D 5I1CL 4XMPH 3ZT7A 1DBBL 2W60A 3AROA 3QZWB 3RA7L 1G7MB 4ZQKA 2AKRB 5KVEH 1VESA 1AD0A 5GGRY 3QUZA 3BZ4B 3KPNB 2Y5EA 1DFBL 1Y0LB 1I8KB 4QLRA 4UINH 1CK0H 4LPVA 5TGBB 5JPMB 1W2KT 2Z8RA 4XWOD 1OW0C 2Q6WA 5EUOE 5E2TL 4NQCE 1FO0A 1QYGH 4XCFH 3W2DH 3EFDH 1IFHH 1WLHA 1HXYB 3J7HA 1BAFL 3AREB 2P45B 4YHOL 4W6YB 4I1NB 5GS0D 1F6AA 1BFVH 1MWAL 4C55A 1JPSH 1R3JA 4CU6A 1MFCH 5F9OL 3LPFA 4LU5H 2RFXB 4IEFB 1MY7A 1T0NB 2WINB 5EZJA 3P30H 1SJVA 1RIUL 4KMQA 2JJVA 5EOQH 5LAXA 3L95B 2EDDA 3MLRL 1W72H 1WISA 3GRWA 4NKOA 3EJZD 1DBKL 2R2EA 3ZKND 5MP6H 2R29H 3I3BA 1OP5K 5GRYA 2PW2A 5GRVL 3MRCA 4HJ0D 3VI3E 4OCNC 2R2HA 5H94A 4LHUD 5AZEH 3ULUL 1YUHA 2E9BA 5IFHH 1OLLA 3B9DA 3T2OA 1CGTA 3QEGH 4UOW1 4UU9A 1IAII 4F2MB 2DQJH 4JZOA 3UEZA 1JNLL 4LCYA 4X80L 4OGYL 4M7KL 1I9RL 3O2WH 5DRZA 2A74A 4NT6A 1J1PH 4QY8A 2NW3A 4YHNB 5ITBH 5ISZB 1CLYH 4FS0A 5DEFA 2E5EA 5KSBB 2AXFB 4RNRA 1EAPA 3D3VE 3MGOA 3ROOB 4GRWE 3VWJA 1RUPL 2D3VA 4RMUA 1HNGA 2R0LL 3IJSB 3WO4C 2R8SH 2ARWA 4A6YL 2PR4L 1J1XL 4WEBH 2SEBA 1Y6KR 3RWCA 1UACH 1D6VL 1JK8A 1WUNT 1KPUA 1QA9A 3GIVB 3QEUB 4Z7WE 4LRIC 4PV8B 5JW5B 3RBGA 3HZKA 3O3AA 2X4UB 5D7KD 4LF3B 5DDHA 4TNWK 3PJSA 5H35B 2UVFA 2P8MB 4Y5XC 3UAJC 3NIDF 4P57B 3LKOB 2FEDD 3AS0A 1R3IL 4G8GB 1XGTA 4N0CD 4ZS7L 3ARED 5F9AC 3BRDA 1J05B 3KAAA 2AEPH 2XQBH 3RWFA 3NA9L 1YY8A 2FIKB 3RP1A 4WI5A 5CS7A 3LRGA 4KROC 5EU4B 3O2DL 1JPTL 5IVOA 3WNNA 1HI6B 3OAYK 4WWKB 1K6QL 3R4DA 2ARJA 1ETZB 4L8BB 5ILTL 3IDGB 4HV8A 1BZ9A 1GGCL 3PHSA 1BX2A 1ZWIB 1MCDA 3F7YB 1QFWH 2FBJL 4LSQH 3WHE0 5I17A 2VLRA 3T4YB 4TULL 1TLKA 5HHXH 5ANMB 3BP5A 4FZ8H 4C58B 3HI5H 3C5SA 3QPQC 3NACL 3BP7A 3FMGH 2LU4A 3VU2A 1EHLL 3F7VB 4OD3H 3TO4C 2CXGA 2NY7L 2NXZC 3N0PB 5FKAA 5ISZD 5I16A 4JCLA 5E8DH 2E7MA 3P0GB 4IDJH 3HTLX 4ZPTB 5IG7A 4XBGA 4LCWB 3V5KB 2DQEH 4LAJH 5CWSB 4P3DA 1CD0A 1LO0L 1YMMA 5E99H 2G9HA 1I8IB 4LHJB 4LLWB 2HKFL 3RVTD 5EIIA 2CK0L 5FO9B 2XWTA 4NM8H 3BPOB 4NSKB 2XWJA 1I3UA 3H7BA 5E1AA 1TZGH 5EBGA 5DFVC 5DJCA 5EPMA 4QTHB 3G6JE 3UYRH 5K9OA 3ZTNH 1MRFH 4P9ML 1S7QA 5DI8A 5CCKH 2X4SA 5MEPB 1JRHL 3CFIC 4MB3A 4X6DA 4YDKH 5K33A 1JNHA 4GFTB 4G8GD 5C9KA 3EW3B 3DRTB 2ESVE 4ZUUA 2DM3A 4NO0A 3RWGB 5DJYB 2DS4A 4GKSA 4JM2A 1EEYA 4PS4H 5IB4A 4AIZB 2O5ZL 1IC4H 3EGSA 5BS0B 4AM0B 1W72B 2B4CH 3O6FB 1QHPA 4YBLC 5DD5H 4KGJA 1BVZA 2BERA 2GHWB 2GSGA 4WWKD 1MCQA 4RCAA 2EIZB 3Q0HA 1P9MC 1DQJB 5D2NC 5FYLL 4I9WE 1MNUL 4MNQB 2A6JA 2RJMA 2IH3B 3GI9H 3GSUB 3HHRB 5D2NE 3RUGB 3WV0A 2Z35B 4OQ1A 2AABH 4QHNB 1QSFB 3WLWC 2DYPA 4XNZB 4QOKB 4DAGH 4BSJA 1NUDA 3MXWL 3P2TA 3TCXA 3INUH 4U6YB 4J12A 4OCYH 5D93B 1D7FA 3H3PH 3S5LB 2FLRT 4P59L 5JDJA 2VXQH 3HMXL 3C6SA 4XCCL 5GSVA 2MOVA 1YQVL 3LN4A 5I74C 2KQNA 4XZUA 4Y4HC 1IQWH 3HI1A 4NCC2 4S0SD 1I7ZB 2R69H 1X5YA 3L5XL 3OKOA 3V0WL 4P23C 4LCWD 2DLTA 3DRQA 4YBQD 1X5IA 3HLAB 2ZCHH 2BXYA 4OD1H 3PNWB 3I50L 4D9RD 5EU3A 3M17B 4TTDD 3LVEA 1QRNB 5BMFH 4WI8A 5F6IC 1NFDE 1QUNA 4M93C 5IK3B 1HXMA 3CCHA 2EYTB 2P7TA 3O9WB 4EI5B 3U4EB 1MCSA 4HGKC 2Q3ZA 5T1KB 3NH7L 2VH5H 4YXKL 5E2UH 4DW2L 3MV9E 4P2QB 4X7EC 3ZKSD 4IMLA 1Y18B 4LQ1A 3RL1A 5LBSL 3CFDB 3VXME 1QFWI 3U1SL 5E2WL 2P47B 6FABH 3U46A 3REWA 1RK0A 2EH7H 5DEGA 3WFCL 4LSPL 3B8YA 2V5SA 1RMFH 5F7LB 1R0AL 3MV11 4OD2A 5BS0D 4GS7B 4M9PA 4RFNC 5D7IB 1YMHB 3O6FD 4N5ED 1HQRB 4LP5A 1CFTA 4OZFG 1V7MH 1WZ1L 2WBJB 4P4KC 4KWUA 3KLHD 3O6KH 4U49A 4OIBA 3BPLC 1FPTH 1FCCA 2DDQL 4MNQD 3T04D 3EYUL 3FO2B 1NLDL 5I1EH 1U93A 2DAVA 1JGVH 1QSFD 3MUGB 3ARDC 3QYCA 4K7PL 4QOKD 2R56L 2OBGA 3STZB 1FBIH 2HA1A 1QNZH 3GM8A 4NZUH 1DVFB 1NH6A 3BIKA 2ED8A 3Q6FA 1OARH 4YR6A 4PJAF 1J1OH 4OLUL 3LQZA 4PY8I 3MC0A 3GMMB 5FKPB 5KVFL 4PTTB 1LEGA 1OGAE 3OXRA 5DQDL 1EK3A 5LGKA 1Q94A 1KJMB 4KKLC 3RZCB 5C9JA 2FGWH 2H1PL 1MHPL 5E9DB 3HUJF 4P2OD 5I75B 1JZ7A 5IFAL 3S35X 1QRND 4MJ6B 3X3GL 4DKEH 2A9NL 5ALBH 3WO3B 3ULVH 4ODXA 1BLNA 4KZDH 3O9WD 4P5TA 4EI5D 2IAMC 3RVWD 4HCRA 4U1JB 3MFGB 1R3LB 1XCQA 5T1KD 5DJ8B 2Y7QA 3C87A 2YRZA 3QH3A 4MX7A 2NY6B 4P2QD 1S9VB 4KQ3H 1OF2B 2R0ZL 2VR9A 4LNRA 4Y4KC 3CH8A 3R06A 3CMGA 4GW1A 4ZUWA 3ARQA 4PRBA 3K74B 3REVB 4QO1A 1KLUB 3RGVC 3LS4H 2XQYK 3WJLC 15C8H 4DN3H 5T1MB 3BGAA 5IJKA 1EHXA 1DP0A 5C08B 1ZGLM 3LIZH 2MNUA 4Q9BA 3MRHA 1A6WH 5C0GB 1S9YB 2WBJD 35C8L 4N9GA 1IKFH 2P43B 2VLKE 4PB9H 2C1OA 4MGXA 3TV3H 2IPTL 4U6TA 5F1NB 4P9HH 3GDBA 4FP8H 2VABA 3DO7B 3DX6A 3U0WH 3ARVA 1F3JA 3PXJA 4OUOA 3S35L 3NVQA 3D48R 3GK8H 4M43H 2D9QB 1YPZA 2MMXA 3KWWB 2PKDA 4S1RH 1U8OB 1DVFD 1GXEA 5I1KL 2Z31B 3RI5K 4E41A 3LHPH 2A6DB 5F7HA 4C83B 2XG5A 3HC4H 5DMJB 1UA6H 3MUZ1 3JBG7 2ZUSA 4LSTL 1ZLSH 2H9GB 4NZTH 4WO4B 2EXYD 3D69A 3HS0B 4ZUVB 3TYGL 5CGYD 5ADOH 1E27A 1JF5A 3RZCD 3DUUA 4LIQE 1P69B 3P4NA 2AQ3A 1KJ3H 1UKQA 5C09A 4R4ND 3QDHA 5E9DD 5JMOC 3L7FA 4BQCA 5FHAH 4TSCL 5D7JA 1NLBL 4R7NB 4ZUSB 3T0WA 4OZFA 1KEMH 1H5BC 2ZUQC 1XGYH 3O11A 5MEOB 1T4KA 2PTUA 5F72S 3RDTA 1J8HB 4QHUB 2FHCA 1TQBB 2EDYA 3RPIA 4CMHC 2AJVH 2NY6D 3MNZB 4YHLH 1WC7B 3WYRA 1J0ZA 3VJ6A 5JHDB 3WS6A 4PRHE 1K3IA 1JTTA 5E08H 3TJEH 3CX5K 4H1LG 4EI6B 2E9WA 3H9YA 5I18H 4X5XA 2DQIH 3CFEA 4NJAL 1M71B 3CAFA 5KW9H 4HKBB 3T8XB 5C08D 4LRNL 4WCYH 4Y8DC 4MDIB 2OSLA 4NCC1 4IIQA 1DTUA 3LY6A 5C7XH 4ZAKB 3U0PB 3NIGF 2EDQA 5GJSL 2JELL 5HGAA 1A7NL 2VO5A 1KB5H 1XIWB 3HE7B 4L4VB 4N0UB 3TFKC 2DLIA 4QRPA 3GGWA 3WL9A 5SWQA 2X70A 4JFHE 4NN6C 1AR1D 1UWEH 3QXDB 4QRSB 4HF5L 4FQ2H 3IDIB 2BSRB 1QEWB 5C0BB 1BIIA 2Z31D 3RJQB 2VUYA 2H2SC 4XP9H 5IBLC 4BZ2H 3WXWL 1S7TB 4OLVL 1SM3H 4K55A 4WO4D 3X13B 1OGTA 5C0DB 1I1YA 3V52H 1FFPA 1PEZA 4YHKH 4ZD3H 2P4AB 4V1DA 3JWNC 4WY7H 5IM7B 4N90D 2OTWA 4ZFOA 4XHQA 5DZLA 1N59B 5E56A 4EDWH 3QO0B 2CIKA 4IRJC 1FNEA 4OUUA 4WJ5A 4U1KB 3GKZA 1LVEA 4TVPH 3RUGF 1J8HD 2BRRL 3GRWH 1VEOA 5DRWA 5IBUB 2OR9H 1QP1A 2QHRH 1R5VA 4JY4A 2Q8BH 4H26A 1XGRB 5JHDD 4H0HB 1AE6H 1KENH 1IC1A 3VWKA 2I60H 3KLAA 2PO6A 2RB8A 2R4RL 3PGFL 1CDHA 1JGEA 4QRUB 4HG4K 3B9KC 1ONQA 4MWFB 4KQ4H 4Z7QF 2RR3A 1IGFL 3PP3H 3BGFC 4YHMH 4YIQB 3CVIL 3BWAA 5TDNA 1JZ4A 3IFOA 1KB9J 3QULB 2F5BL 4BFIB 4OIIH 3CVHH 4L8SB 4RWYL 4XPHH 3TA3A 1FGVH 4KTYA 2LU3A 3LDBC 4EN3B 1VDGA 4ZAKD 3KPRA 5L0QC 5E5RB 1NGPH 5KS9E 3RTQA 3HCVB 5EWIH 2HWZH 3UTTB 4DKDC 4U6XA 1I1AA 3LV3A 2BOCB 1EHNA 2EEAA 5EA0L 1XIWD 2A9ML 4HT1H 3HE7D 4L4VD 1I7UA 3KDMB 2XFXA 5IMMA 3HE6B 4GJTB 4JFXB 3G08B 1E4XH 5ENWB 3DMMA 4IM8A 4KKCC 4U1HB 1JHTA 2YN3A 4MXQC 4G6JL 2CKNA 4XPGL 3BEVB 1N8ZB 2BSED 4ZXBB 2YS4A 5I8KH 3RVVC 5C0BD 3F12B 1CICA 2I9TA 1FG9C 3ARRA 3KJ6H 1VADB 3KPOB 2ICES 4XB7A 4ODTH 1KTLB 3PWNA 3HNVH 3FFCB 3S6CA 4ZTOH 2IPKB 4H1LA 1AP2A 1AD9B 1UEMA 3MBXH 5CSGA 1AGCA 2O5XH 2GTZA 3NCMA 1BP3B 1AKJA 4R6UA 3X14B 1CVRA 1MIEL 4Y5YA 4NKDB 4ONHA 2V17H 3H8NA 3ULVD 2X6MA 2LE9A 5JORA 5MI0C 4Y4FC 4O2FB 5GS2H 3FZUC 3IU4H 2CMRL 1UH3A 2B8OT 1F90H 4Z5RB 3NCBB 3RWJB 2VDMH 3MNWA 4UUJA 2CLRA 1MQKH 1OWWA 4F8TA 4APQA 1QLFA 2VKXA 3WCYA 4XX1G 3LN9A 5GGQL 7CGTA 4JO3H 4L5FH 4HIHA 5JXEA 4RA3A 3NZ8B 4GUPB 2J8UE 1JHKH 3KR3H 3NAAH 4HHAB 4DGIL 3BDXA 1JGUH 3LKPA 3S96A 3B3IA 2E27L 3TBWB 1L0QA 5CZXD 2V2XA 3QG7L 1GAFL 1J18A 3ZDYE 3D18B 4GQ9L 3QXAA 4EN3D 1A6AA 1KB5B 2HT4D 1PKQB 1PY9A 3O4LA 4WV1A 3UTTD 4PJEA 5BVJB 3CSBA 3MRRA 4FQLH 5E8OA 4ZQKB 1Y6NR 3VG0H 3L5HA 4NHCH 4N68A 3HE6D 3WNMA 1BZ7A 3QUZB 4BSVA 1A6ZA 5FA4A 3AGVA 3U7YL 1INEL 2OYPA 4GXVL 3QWRD 4JO4H 5L88L 1N7MH 2Z92B 4NUJB 4RFEB 1FH5H 2CD0A 1DEEA 4ZXBD 4UV4L 4TUJB 3BUYB 2QR0A 3MRDB 5EN2A 4JN2A 2APBA 4TQEL 4K94C 3MCKA 4HS6A 1KCVL 4EIZC 5ICZA 4GMTL 1QFUH 3FFCD 3QUXC 3T0EA 1R3JB 4DEPC 2ZCLL 1V3MA 1EJOH 1WT5A 1I1RA 2DL2A 5EZLA 3E8UH 1WBXA 3AM8C 2HTKD 1NL0L 4QWWC 1AXTH 4C56A 1KCRL 5LAXB 1B0GA 1Z9LA 4Y0GA 2NR6C 1LO5B 1AGDB 2DBJA 4OZHF 1X5GA 4M8QA 1N6VA 4POYA 2HVJA 2BNQA 2PW2B 1JYWA 2YD1A 3MRCB 4FQCH 5A2FA 4JRXE 1XGQA 5H94B 4RSVA 1BVLB 1PG7W 1NSNH 3QHFH 3F8UB 4AY0A 4UU9B 2E7LC 5HYIA 1FIGH 3VXSE 3IGAB 1E4XI 4HK3J 1YEFH 3CVHB 1CGVA 2A74B 4NT6B 2NW3B 1OP3H 1MWAA 3L3IB 5DEFB 1HSAB 2Y5TA 4RNRB 3MGOB 1I7RB 1DBJH 2IQAA 3BZDA 3DVIA 1OTTD 5F6HJ 1IEAA 3VWJB 2NY3C 2VDQL 2ZUTA 2BRQA 2FH8A 4Y16C 1JTOA 4P46C 5HVFB 2J5LB 3RWCB 3QUZD 1I7TA 1VFBA 3EJJX 5HVHC 4PJCA 3V0VB 4K8RC 1YEHH 2V9TA 3HZKB 1TXKA 2MHAA 1Z0MA 1MJJB 3PWPE 4J7RA 2WZPD 5DDHB 4ORGB 4BFEA 2OP4H 5IEHA 1UKTA 1Q0XL 3VD9A 3I2CH 3QUML 5A3IC 3ZMRA 5T3XH 1UJ3A 1XGTB 2IFGA 4K94L 2J4WH 3WFEH 4W4OC 3T09A 1SEBB 2FIRT 5L2JA 1P4IL 3EFFA 3HZYA 5FO8A 2AAVA 3PDOB 1AO7E 5BZWA 4CW1B 4M48L 4Z7UB 4H20L 1T2QL 1RFDL 4ERSH 2AJZA 1AJ7L 3FQTA 4RDQF 3I3DA 3UC0L 1B4JH 1QBML 1OSPH 3RGHA 4UOW0 4A6YA 4U1NB 2WANA 2ARJB 3A6CL 1S7VA 5TE7H 4OKDA 2OK0L 5DUMH 5EORH 1BX2B 4HC1H 4GMSL 1BOYA 4LLYA 5I17B 4JKLA 3O6ML 5IEKB 5EUOA 4X7SL 1OW0A 3U6RA 1U8KB 1S7SA 3BP5B 5LQBL 4GSDL 1DQDL 1UQSA 1SMOA 3QWQB 4M3KB 4U1IB 1YN7B 2IADA 4OF3A 5K9JH 3ZSTA 2F54E 2J7LA 4LHQB 2VZUA 1ZHLA 1EO8L 3D0VA 4LLMA 1P7QB 4DCQB 3O2DA 4XBGB 1C1EL 3JV5A 4Z7OF 3VWJD 3HAEG 4P3DB 1YMMB 2G9HB 3WD5H 3GSXB 3ULVF 1NAML 4JR9L 1A3LH 3LB6D 3OMZA 1NBQA 4FFYH 1T03L 1CGSH 3T1WA 3AAZA 2X1OA 4NO5B 2VLMD 4Q6IC 4S2SB 3F62A 3X3FH 1TVHA 5K9KA 4K8RL 1JTPA 4M9OA 1JPGA 2OL3H 3HNTH 3PG2A 3L1OL 5DI8B 1DN0A 2X4SB 1T7XA 2P24B 4X6DB 4HCRH 2NY5H 2JCCB 3I6LE 1OL0A 3FT4A 1KPRA 4NQEA 4XPAH 4ZUUB 4G7YH 1XF4A 1HN1A 1C7TA 2A0LC 1MCBA 2WLYA 5GGVH 3O3DA 4GKSB 3DSFL 4DGVH 4LVNC 4YUEH 3IJHA 1VGEL 3D3VA 5IB4B 3EHBC 1EFQA 1PLGL 3ROLA 3EGSB 1F3DJ 5GS2D 5DR5L 1CGWA 4RGOH 5CINH 2C9AA 3ZYJA 1YY9D 4D8PA 1A1NA 3MLYL 4UMGA 3RPKA 4CJ1A 4PP2A 5F97E 4JANA 2BNUB 3HPLB 2A6JB 5HHVL 4Z7WA 1MQ8A 2CKBL 3IJYB 3BDBA 4LRIA 3FAXA 1FL5A 1C08B 2DICA 4MJ5A 4ZDHA 3PABA 1Q8MA 4PJHE 3TT3L 1GPOH 1JZ2A 4HGMA 3TH2T 2J6EL 4Y5XA 4NZRL 4HPOH 4WGVB 1U92A 1YEEL 1TZHB 5GSVB 1P2CB 1ZV5A 3LN4B 4XZUB 3A0OA 3C8HA 2DIJA 4WW1B 1P7QD 1AQKL 4YBHA 1VPOL 4MZ3A 3MZTA 5DD6A 3MGAA 5HD8C 4X6CF 1F97A 1AGEA 2ERJB 3CU1A 1NAKH 1YMMD 2F53E 3K4AA 1N5YH 1K8DB 3KPLA 4P5MB 4JFQB 3I9GH 4LLUB 1U3YA 2BFVH 4I3RH 3P9LA 2R1XA 3OGOE 2ADGA 3MCLH 5E8PA 1HXMB 4F58H 3L9RB 2KZWA 2VRAA 2VDNH 3SCMC 5J3HC 5C0AE 3EYOA 3QUYB 3LKQB 2H3NB 3MFFA 1QPXA 1J0IA 1IGCL 4OFVA 1IM9B 1A7RH 3N1QC 5IFJA 1V7NH 4XGZB 5GRZA 3D5OF 5I1IH 3V7MA 4KJQD 5TE4L 3V0AC 3GM0A 3HMXA 5FUCC 2D9CA 2XRAL 3TO4A 2XICA 4OGXL 5FUCE 1RK0B 4JM2D 4PGCB 1OAKL 4OD2B 1AHWA 4GKZA 2DQTL 1DUYB 1T1WA 5GGSY 2XN9E 2YPKB 5DMKA 3VFMA 3VFVA 2NPLX 3JTSB 4LKXB 2GK0A 2BVTA 5I76A 4R90H 5A16A 5I6XC 1V3LA 3HAEA 3OR7A 2VNCA 3KYNA 1P7KA 1H3WM 2DLFH 3V5HA 2K9UA 1ZTXH 2VDKH 4OV5B 1PD6A 2DYPD 4JB9L 4LVOC 5CEZH 3MLUH 3T3PF 4K3JL 3B2UC 1YEKL 2ICCA 2K1MA 2MKWA 5LG1A 5BQ7A 3UPRB 3VD7A 2ESVA 3H6JA 1SJEA 2DQFA 4ZYKA 1TVDA 4TSAH 4RQQA 1GC1L 2GCYB 3FCTA 4LK4A 5EBLB 5HHOE 3TZVC 3RVUD 1C12A 1MH5A 2QKIB 4K3EH 2R0WH 3OXRB 2PW1B 1FFNA 1Q94B 4HDIA 4PRIB 1RUQL 1OD7A 5E6IA 1IGML 1ED3A 3IFNH 3QQNA 3L3HB 1P9MA 3Q1SL 4PJAE 3QRGL 3CH1A 4IS6A 2OL3B 2YXFA 3PWLA 4H88L 2C26A 4XH2A 5J0BA 3QUYD 4JO2H 3MBEB 4ODWB 5T3XD 4CVWA 3U30B 2Y7QB 4QRQA 4MX7B 1IM9D 1NUNB 2NY0C 5TF1L 2HKHL 1J0YA 4OCXL 5TH2B 4YGVA 4LNRB 5CKAA 1QSEE 3ESUF 3MLZH 4ZUWB 3U4AA 1LO2H 2OZ4L 4PRBB 4C54A 1KJ2B 3C60C 2Q3AA 5F7NC 4P0DA 5T33H 4P23A 2ITCB 2WIIA 2P1YA 4LCIL 5FGCE 3RAJL 1JWSB 1JZ5A 4PRNA 3WEXA 4RMQA 1NFDA 3BDYH 4FQPA 4ISVB 1S5IL 4I18C 3AS2A 4UAOB 1RPQA 4LNVA 2FATH 2WUBH 2VABB 3DX6B 3EUUA 4NDMA 3MV9A 2F8OA 3QDMB 2WWMD 4LDLB 2IG2L 1YEGH 3RNKB 1G7HA 2RCSL 3T2NL 4Y1AA 1ZANH 5EOCL 2VDOL 1YPZB 5C0CE 4XNUL 2BY2A 4J8RA 3UP1A 2X9YA 4E41B 2NY1C 2BVYA 4PBVC 5FK9A 4L8DA 4LSVL 5CJXC 3BXNA 1VCAA 1R3KA 2YXMA 3P73A 1U8NB 1D9KC 3O3EB 3QEHA 4NRYA 1FZJA 1E27B 4PRID 1WFOA 1B88A 1CXHA 3FQRB 3P4NB 5D2LE 5CHNA 3O0RL 3U36B 4D9LH 4P4KA 3FB8A 2VQ1A 1RIHL 1AGFA 5ALCL 5D7JB 1CBVL 3UPCA 3HB3D 1DJSA 1YEJH 3SO5A 2EDHA 3O11B 4IOFC 3QIBA 4LSUH 4P5TD 2QLVB 3RDTB 5C2UB 3MBED 1I9EA 3ARDA 3GNMH 3TNMB 4LPYA 1MCLA 5LGHH 3A6OA 5AEAA 3IDYB 4UBDC 5ID1A 1IJ9A 4WVRA 5FCSH 1XAUA 5HHNA 3C5ZA 1RD6A 3ARFA 4QGTA 3CFEB 4OQTA 1QZ1A 4P49A 5CILL 2OJEA 1UWXH 4UZGA 2HAZA 4M6AA 1AIFA 4AG4H 3R8QA 1WEJL 3TCLA 2I07A 4UTAH 1KXTB 2EZ0C 5HPMA 3P11H 2GKIA 4KRPC 4LVEA 4MDJA 12E8L 4MJ4A 1X3DA 3RIAF 4OFYD 3DVFA 4XCYB 4R96A 1NANH 4HGWA 4YDVA 4NBXB 2HFTA 5E95B 1YJDC 4Z78A 2IAMA 3GGWB 4D0DB 3SDAB 2MJWA 1MJUL 4XP4L 3QDMD 1AY1H 4PGZA 1KN4H 3G5ZA 5DURD 2Y1VA 3GSQB 1XZ0A 2XZQH 4MZ2A 1MRDL 4HUXB 4X6DF 4E41D 4RBPH 1VFAA 3GSOB 3NFPB 1OVZA 5FV2A 5IROC 3RGVA 3UJTH 2QSCL 3L3OA 1RZFL 1C5DB 1T04B 3Q2CA 4P4RA 3WJLA 3JV6A 4DN4H 1I1YB 4JM2F 4UILH 1FFPB 3MV8E 3O41A 4G42A 3SPVA 4V1DB 1UM5L 1UZ6F 5HI4C 2OTWB 3WSQL 4ZFOB 5EU6B 2VLKA 2ADJA 2M8XA 3H7LA 3GSNL 5D7JD 4CVZB 4ODVH 4GH7B 1AXSA 2CIKB 1RHFA 3OWEA 4U3XA 3S88H 1HHJA 2F5AL 4O02H 1ES0A 1L7TL 5DK2B 1FNEB 4G6FB 4OUUB 5C70A 4AIOA 1HHKB 2ZUWA 3VG9C 5I1CH 5BRZB 5EH1A 4NWUL 1DBBH 3RDTD 4YAQA 1YNLL 1GSMA 1RZ7H 3MRNB 3V9FA 4XI5C 5FYJE 1QG3A 5D6DA 4X5WB 4RIRB 4JY4B 1HDMA 3VXOA 4JLRA 3IS1X 3O45B 5IQ7H 5I1AA 3OKEA 4FA8A 5DJ0A 1JNNH 1P5UA 3FRPG 4HIJA 1ONQB 3PGCA 3TIEB 3MGTB 3IFOB 1EV2E 4WI9A 4HS8L 5GZOC 1HSBA 1C5BL 5GRUH 4YHOH 3MA9L 1MWAH 4JZNA 4PP1D 3RVXC 3KPRB 3ULSA 3DGGA 1VKXB 5IIEB 4PJ7E 4KKAD 3VXRB 4GG8A 3MMEB 4I48A 3FOMA 5KVDH 5HI5C 3HR5A 4HG4J 3BPNB 4JG0L 3SDXB 5CEZD 1H5BA 1RIUH 4PJIA 4G6KL 4QRPD 3EBAA 1A9EA 2LVEA 1OM3H 4PG2C 5EOTB 2BJMH 3LKRB 4LBEA 5CJQH 3DMMB 1JHTB 1FZOA 1KYOK 4PRHA 3GMPA 4ENED 4NN5C 3N1MC 4AEIL 1ACYL 5H8DA 2LABA 1MVUB 3PIQA 1CICB 2I9TB 4RGMC 3FONA 4XMLH 3SO3C 1V3KA 4WFED 3GSWA 2Z91A 4BZ1L 3L5WA 4LLVA 4X6BB 4HIEB 4X80H 4M7KH 1I9RH 2BY0A 4FFWC 5HVWA 1CS6A 4JY6B 4V1DD 5MHSE 4Y5YB 1D5ZA 4BQBA 1REIA 4ONHB 5KTEL 5EU6D 3T3ME 5JORB 2F15A 3UTSB 1G9NC 5HHME 1I1FB 3UMTA 4HWZA 5C07E 5J6HA 3BN9C 3GSRA 2DQUH 4G6FD 1JVKA 1RUPH 1S3KL 2IH1A 1FZKB 5BRZD 3ABZA 3FN9A 3MNWB 1WFTA 4NNYA 2PR4H 4LSRL 1J1XH 4APQB 1QLFB 4K3GA 3KPPA 5GJTL 1HCVA 1UYWH 4FQXC 1NANI 2VDLL 2YR3A 4HIHB 1D6VH 4G8FA 5IMOA 3S36L 3ZKQD 3NTCL 3N9GL 4NGHH 4HK3N 2CQVA 4NNXA 3VFOA 5EBWA 2JE8A 1FP5A 5BO1L 5DGQA 1Z3GL 4OLWL 1HHHA 3EO0A 4U0QB 2XA8H 2D31B 3OQ3B 1MIMH 5AYQA 4N1EA 1R3IH 3GMNB 4KK6D 3QXAB 4KV5F 1AGBB 4LPWA 1UGNA 1H3GA 1HH9B 3KPRD 4MJIE 2FGZA 1N6QL 43C9A 3RTQD 4OZIE 4WV1B 1MEXL 4PJEB 1J88A 4IRJA 5KSAC 4U0RB 5D96B 4Z0BL 3JXAA 2NZIA 1JPTH 3O2DH 4DOHB 4E0RA 3GSVA 4P2RE 2DI7A 5DGRA 2CUIA 1D5BA 1BZ7B 3LKNA 1OY3B 1CTOA 5HDQH 3THML 3DMMD 4XNMB 2W9EL 1LILA 5DJAA 5ILTH 5IB2A 1S7RA 1FE8H 3QI9C 1DEEB 3BGMA 4KTDL 2I26N 4UNUA 5HXMA 2P49B 4JN2B 4S1DD 4JFPA 1UM4H 1CICD 4X7TA 4NKIL 4QT5A 5TPWL 3MCKB 1A5FH 1ZEAL 3G9AB 4YC2C 2PXYC 3B9KA 3KPSE 3U48A 1WITA 5ICZB 4NO3A 1EXUA 3T0EB 2ENYA 1FL6B 3K8MA 4MXVF 4JQIH 4XRCB 5IHZB 1EHLH 5C0EA 1U3ZA 1X5AA 4CMMA 1DBAL 3FRPA 4HBCL 3ZTJG 1T5XA 4BKLA 4HWBL 3NABH 5KS9A 3I02B 2B5IB 5DVOA 3H42H 4LLQA 3UTSD 4G43B 1B0GB 4GRWH 3BRGC 2EH8L 2QADC 4MXWL 4WUUB 1LK2A 5E24E 3W0WE 1MF2L 3MACL 3BW9A 2BY1A 3BYYA 3OKLB 2HKFH 2YZ8A 2HVJB 2Q87A 4UT6H 4APQD 1JMXA 1RULL 2VLJE 3V8OA 1JGLL 1XGQB 3P4MB 3ETBF 1Z0NA 3GMQB 5JXED 3HFML 5BW7C 4NPYA 1NC2A 2NCMA 5E8NA 4IJ3C 3BJ91 1YPZF 4Q74A 4P9MH 5D7LE 5F9DC 3RJDA 3FL7A 4FQQA 1JRHH 3VGAC 2FX7H 1N4XH 4JRWA 2ICWJ 4S11A 1MWAB 3NFNA 4O2CB 3BESR 1JBJA 2CIIA 3UJJL 3VFGL 1KCLA 1OAXL 1MI5B 5J6GB 4QRRE 5K59F 4JG1L 3OKNA 1FFRA 2IQAB 3K3QA 4OCSL 4Y4FA 2DQDL 3TWCL 3DX7B 3FT3B 1T5WA 2NX5B 1FRGL 3MRBB 4G9FE 1JWMB 3EOAB 4WHYG 4OCMC 2DQCL 2Q76A 3IETA 2VERN 5E6ZA 4X0KA 5GRJH 4EEEA 3U7AA 4Q9QL 4UIMA 2WUCL 4HXAL 2VDPH 4MA8H 4H0GA 1BQUA 3GJFA 4MA7L 5KAQG 4FQHA 4JKMA 1HILB 1MNUH 2J8UA 1VACA 3BD3A 1GZQA 4GAGH 1LP9E 4JFFB 3QWOB 2N56A 3NZHL 4XVTL 2FL5A 1YZZA 4YK4B 3DX9A 4KVNH 1GHFH 1UJ3B 3F6IA 4G3YL 5E5MB 3VFRA 2FR4A 4M1DL 5L2JB 3EFFB 2V9RA 3LQAL 3T0ED 2BHZA 3TBVA 2YEZB 5GS1A 1IGJA 4P59H 1FHGA 3VH8B 4RMSA 4PUBH 1NC4B 3MR9B 1ZK9A 4F7EA 1PX4A 3ZT6A 5J4MA 1C16B 3L5XH 4JFEE 3V0WH 1EGJH 3EJYD 1F58H 4JKPL 1QLEH 4QF1A 1DL7H 4NQXA 4WUUD 5DS8A 1S7VB 4I2XE 2E9JA 4LSDA 2DQGL 3L5IA 3I50H 4HAFA 2FJFB 5JUEL 3CD4A 1KCSH 3Q3GB 1RUAL 4JM4L 5EUOB 5D70L 4XBEL 4NQCB 3U6RB 1S7SB 4U1MB 3C5JB 1FNSL 4KDWA 3QUMA 1UQSB 5D6CA 1EFXA 4PGJA 4QHLA 1KCUH 3LQMA 2NTFB 5EIVA 4YXKH 2A83A 1EO5A 2VAJA 3TBYA 2MFNA 5LBSH 5DQJB 2AJUH 4JKKA 3D0VB 3BJLA 1MI5D 3WFCH 5CBAA 4F8QA 3AM8A 1R0AH 1LGVA 1RSFA 2EKJA 2NX5D 4PJBB 5GSRA 1WFNA 3EDJA 5ID0B 5IB3A 4F37K 4RFOH 4G80A 1KTRL 2HT3C 2AK4E 3D6GA 5GGRA 4JRXA 5E8EA 4YNYA 1CD9B 3OL2A 2BMKA 2DDQH 4F7CA 1DN0B 2YOCA 4JFFD 1ZLVH 3VXSA 3IDMA 2E7LA 1DBML 3FT4B 1JN6B 1M7XA 2DOCA 1Q72H 4O2EA 1BQHG 5F3BB 2R56H 3ZKXB 5J13C 1QR1B 3EYQC 4HH9A 1QBLL 4D9QE 2VXSL 3G5VA 3N1PC 4OLUH 4XVUC 4GRWB 1NC4D 5DWUH 5I0DA 1RVFH 2E8YA 4TRPL 3RZWA 5KVFH 1JRHI 2YPVL 3V6OC 2H26A 2W9LA 3WO4B 4L29A 3V6OE 1A1NB 4D8PB 1NAMA 4Y16A 4P46A 4PP2B 3U83A 3MSPA 2EYRA 1MRCL 4JANB 5CBEB 1O7SA 2H1PH 2I5YL 4YLQT 2Z8VC 3A67L 3MLWL 3GKWL 1IGYB 1GGTA 4PTUB 2A9NH 3PWPA 4PJ5E 4MJ5B 4NQCD 4NWTL 2LAAA 4YHZH 3ZE0E 1BJMA 3NCJH 2P5EE 4Y5XB 5JXAL 1FN4A 1T7YA 3K1KC 3VMNA 4W4OA 4OB5H 4PB0L 1NBYA 1WBZB 1M7IA 1WZKA 2R0ZH 4JVPA 5AZ2L 1ZT1B 1AO7A 4JRYE 3TVMC 2KZ1B 4KROB 2DI8A 4XCEA 4YPGA 1H3TA 2CDEA 1AH1A 3DYMA 5DUBA 3QJFB 5DD6B 2DWDB 1GGBL 4PREA 2YD5A 3FRUA 4GRMA 1OWRM 3C6LB 2ZNXA 1QR4A 1CU4L 4QGYA 5TQ2L 4WHDA 5IJVA 5E8PB 2APVA 2CKBA 3VW3L 2VAAB 3TPUB 4DUWA 5F7DA 1QKZL 4DGYL 2X9WA 4IOIA 4KHXH 5GQBA 4XT1C 3UJIH 2J6EA 5IP4A 3S35H 1GOHA 1EMTH 5C0RL 3C09C 3DV4A 3P4OA 4DQOH 3CMOH 2F54A 1FG2B 3TO4B 2NXZB 2FJHB 2LQRA 4MB4A 4U1SA 3UTPE 2C1PA 5I1KH 3D3VD 1JZ6A 2XZCL 5CJOL 4OTXL 2C3WA 4LSTH 4OQTH 1DLFL 4XC1H 5E1HB 1VB9A 2HLAA 2HMID 1N6UA 2B0SL 3VFMB 4J6RH 4H0IA 5A16B 1BOGA 3WUZA 1UM6L 4PJEF 3OR7B 1KXQE 2FCBA 1G6RB 2DQHH 3G6JB 4Q6IA 2XIDA 1NLBH 2ED7A 4M03A 1P7KB 3V5HB 1X6LA 3IAQA 1MHCA 5DMGC 3W9EA 3AVEA 2R4SL 1MFEL 3QG6A 4F3FA 4U1LB 1JMZA 1O0VA 3UAJD 1BD2E 2ESVB 2XACC 1SJEB 3WFDH 4FNLH 5IBTH 4ZYKB 3HRPA 2W65A 1ZA3B 3M8OH 1D5IL 4OSUH 4WTZG 1MPAL 3OGCA 1BQHA 2OJZL 2IANA 1X5JA 3P77B 2Y9RT 4P48A 5C6TH 4L4TB 3LS5H 4KROD 3U9PH 1B6UA 1L7IH 1UVQA 2NLJA 5ICYA 1YA5A 4OT1H 4YBLB 2YRLA 5T1LA 3ESVF 4NKMA 3MJ9A 4WHTA 4PY7B 4KMLB 4LRNH 3C6LD 1ED3B 1E4JA 4HUUA 3DI3B 4Z7NF 5D2NB 5F1KC 4Y2DC 3CH1B 4IS6B 2Y07L 3SY0A 1CF8L 4JFOB 5M95B 1LK3L 4PJHA 3QDGB 1CL7H 4YZFF 3DV6B 4U7SA 4YO0A 3TP4A 3B43A 3FQNB 4HWEH 2Z93B 3QPQD 4YGVB 1CE1L 3KPQA 3SGKC 1P4LA 3I85A 4ODSH 1MCPL 1YQ2A 3CLEL 3TO4D 2NXZD 2BVOB 1MLCA 4Z8FL 1SEQH 4Y4HB 4FFVC 5KJRH 3PP4L 2PTVA 3WXWH 4OLVH 3Q5TA 2QL1A 1JV5A 1OTSD 5CUSH 4CVUA 2BXZA 2WIIB 4PRAA 3VFNB 2A1WH 1VFMA 2F53A 4EUPG 2MCG1 4ZFFA 5BV7C 1X5LA 5JLZA 4NYLA 4LIQH 4PRNB 5M7QA 1S7UA 5KSVB 2GUOB 1PKOA 4DZBB 3MODL 3HG1A 4MA3A 5AUMA 5F6IB 3OKDB 1PGRB 3TF7C 4M93B 2AEQL 5C0AA 3LPWA 1ND0A 3SCMA 5SX5H 4PIRF 4NDMB 3MV9B 1TJHH 4PJCF 2YUXA 2PTTA 4YPJA 2NYYC 3VXMB 2NY4C 3ULUF 3GHBL 2ESVD 2AV1A 2VQTA 4M6ML 1CFSB 5D71L 4J8RB 3SQOL 2OZ4A 1P5VA 5FK9B 2YD2A 3BPCA 4L8DB 1P6FA 2R4RH 1JE6A 4L4TD 3PGFH 1CIDA 5IW1A 4G8IB 4KPHH 4RFNB 4M62L 2XN9A 4NRYB 4MHHG 1IGFH 4PLJC 1PY4A 4HS3B 5HI3D 2G60L 3ALXA 5CHNB 4U3CA 4RWYH 4P4KB 2VQ1B 5MERB 4I9WD 5C0NC 4DZ8B 3BPLB 4GBXA 3T0XA 5GZNC 2VIRB 5EC1A 3IRZA 4Z77B 1J87A 4OGAC 4OCWL 3ARBB 5BXFB 3QDGD 2XPGB 1YYML 4Y7MA 3WLWD 5JOPD 3BT2H 3ARDB 1LMKA 2VQUA 1HIMH 5F3HB 5EUOF 3SDYH 3IFLH 2UWEE 4R26L 5ID1B 4BFBD 1H0DA 2MQCA 5SWSA 5HHNB 3SGDH 4G6JH 1CDGA 2R1YB 2WWKO 3V4PH 4Y4HD 1F02I 5KZCB 1OGAB 4GG6E 2OJEB 3IDJA 1HHGA 5FGBC 1E4WH 3TCLB 4P23D 4WTZA 5FYJU 1W0VA 4HFUL 3B9EA 4OF7A 4AH2B 2ZJSL 4E5XB 4FG6D 1Z5LA 5IW6A 2ADFL 2F74B 1MCOH 4W81A 4R96B 4KDVA 4FRWA 1N64L 4YDVB 4OKVB 5EC2B 4NFBA 4O4YL 4WI2A 4EOWL 4M7JL 4U2ZA 1ZT7A 2KPNA 2IAMB 4CN1A 3MV9D 3VI3F 1OP3K 1MY5A 2CMRH 3KYMA 3G5ZB 3GMRB 2D7TL 5J8OA 5JQ6L 3VXMD 1FAKT 2BC4A 4LCUA 5ITFB 4Y4KB 3TO2B 1PZ5A 1HE7A 1QSEA 1QRKA 4QKXB 2AW2A 3CNKA 4LKCA 2R1WA 1CL7I 4PJ9B 4RMWA 1CDJA 4P4RB 2DI9A 2YD9A 3QQ9C 1HYSC 3JV6B 4XNQB 2XTLA 5ICXB 4JFZL 3QG7H 3V5DB 1GAFH 3O41B 4G42B 3SPVB 4J3WA 2BVEA 4EDXA 4Z95L 2VLKB 2V2TA 4LSSL 4P4KD 3RIFF 2ADJB 4EUPA 1YC8A 3O2VL 4UT7L 5F89B 1AXSB 3CLFL 1HHJB 1ES0B 4I18A 4URTB 2CGRL 1RUKL 3ARBD 1KIRA 1A7PH 3HI6L 4YAQB 4BK4A 3E6FA 4Z7WF 3EOBB 3ARDD 5TE6L 5I8OH 3FB7A 4I8DA 2NY2C 5I1HL 1BM3H 1OHQA 2D7PA 5IV2B 3VXOB 4LGSB 4CGTA 3U7YH 1INEH 4GXVH 1V5JA 5C2BL 3KJ4B 4R2GC 4OM1L 3VFSA 4X4XA 3ZLQC 4ETQB 1W0WA 1LO4H 2N4IA 4HUVA 4BYHA 1P4BL 4L9LB 1OGAD 5CJXA 1UCBH 5KZCD 3WHXA 4TQEH 1LWRA 2X1WL 2GFBA 5JW3L 4NO2B 3FN3A 4XWOC 2YK1L 1D9KA 4MAYC 5JHLL 1HSBB 5D2LA 1NCAL 1WJ3A 3FTGA 4WI3A 4YH6A 1QHOA 5F8RC 4ZFGL 2ZCLH 1BQLL 3GSNA 1FYHB 4I48B 5CSZA 4JHWL 3LH2L 3HR5B 1N3NB 1CQYA 1HOCA 3ILQC 3CFCH 1H5BB 2ZUQB 4G9DB 3B6SA 2IAMD 3ES6A 1WFUA 3DETD 4CMHB 1N5AB 2JB5H 1IAIM 3UBXI 2EECA 3GMPB 2QV2A 4UNTA 5H37G 4Y4KD 1LQSR 4LQFL 4XVJL 3QIWB 3JUZA 4JHAH 2WBKA 3ZKNC 3PIQB 4FMFA 1YEDB 4LMQE 4PJ9D 1BJ1J 1RZGA 3CZJA 3BSZL 3VXTA 3CGTA 3GSWB 1IBGL 5EFIA 4RAUA 1KEGH 4K2UL 4QHKI 1KYOJ 3CFKB 4H8WH 2HJKA 1T1YB 4Q58C 2ZOKB 4JN1H 3SGDI 3Q5OA 3K2MC 3UBXB 1D5ZB 4R4BA 1FV1A 2ATKA 2VLKD 5DJXA 4HWZB 1IAOA 3MLTA 3VDCA 3OJDB 2VDQH 2E9IA 4MD0A 1CZ8L 3BKCL 4HAGA 1RZJL 3KPPB 4NN6B 2P8LA 3EOTL 2COQA 4PY8J 1RV6X 1XH3A 3LEYH 4G8FB 4YWGL 3PL6B 4KJPD 5EU5A 3F7RA 1TENA 2YHGA 4NNXB 3OJMB 4GQPH 2EEDA 1LD9B 1HHHB 3EO0B 1BREA 1Q0XH 4IRSC 5DD3L 3OB8A 5IROA 1UZ8A 3ILPB 1NCBL 4GW4B 1J0JA 5FDWA 4PYGA 5DLMH 1RURL 1U2HA 1Q9LA 3MV8A 3SEPA 4LEOB 3WNKA 4K7PY 1GZPA 1LDSA 2CUMA 2FDBP 5JTWA 2EO9A 2GJZB 2FEDC 1AQDB 4M48H 4DFHA 1T1XA 1RFDH 1VEPA 3RHWF 4BA8A 1AJ7H 4IRJB 3WN5B 2ILLA 4E0RB 2MWCA 4U4BA 1GOFA 2XYCA 1IQDA 5CD5C 4PJGB 1QBMH 3ZTJH 5DYOB 1UB6B 2VXUL 4IOSD 4WW2C 5DD0L 2IMMA 3A6CH 4K3HA 4F57H 3IKCB 4KV5E 2R23A 3U2SB 5DJAB 4Z76B 1KPVA 4GMSH 4NCDA 3JSSA 1KULA 4FXGA 3QIWD 5CZVL 4NNPL 3WFHA 2UVEA 4X7SH 4QT5B 4X7TB 2W0FA 4GSDH 4M4PA 2BSTA 1BZQK 3B9KB 4FFZH 2FECL 4NO3B 1XF2A 5HYJB 5I1JL 4CMMB 1H9VA 4M1GL 5L7XL 1T5XB 5KS9B 1HCFX 4PJ7A 1NGYA 2QQNH 1CG9A 1MUJA 1EO8H 3VA2C 4LLQB 1FNLA 1LEKB 3TNNB 1NDMA 2AXJA 5D1XC 3EYVA 3BW9B 1NFDF 3L6FA 4JFHD 3RL2A 5EBMB 5TQ0L 1A4KA 4KK8C 5EO9B 3DTXA 3KXFB 1X4YA 1MJ7L 2YSSA 3PL6D 4NQUA 1S9WA 3PHOA 3MRFB 4KDTC 1J5OL 4NPYB 1GH7A 5HHPA 2HH0L 2EDFA 2FEEI 3DURA 3VGGA 2H2SD 3HNSL 2NNAA 2ZSVA 1FJ1B 2MSPA 3PWVA 1CFNB 1TJGL 25C8L 1CGYA 2B1AH 4YE4L 3IU3A 2CIIB 2OLDA 4NN7B 3PWJA 2FX8L 5F93C 3NOIA 4YEEA 3H3KA 3OKNB 5DHVA 1VGEH 3G6AA 3EKCA 1PLGH 5C07A 1IGIL 4G8GE 5MI0B 4Y4FB 4IRJD 4TNVK 1A6TB 1T5WB 2BZDA 2Q76B 4O5LH 3IETB 2XQYG 2VLLA 2DWEB 3MLYH 3HMWL 4FHBD 4PRDA 5F70A 4Z0XB 4FQXA 3G04A 5IB5B 3QUKB 5C92A 1IC5H 4FQHB 3S3JA 2J8UB 5IOPB 4NZDA 2ZUUA 4WWKC 3LZFL 2CKBH 5J57B 4XP5H 5IR1B 3DX9B 1V05A 1AXIB 1RZ8B 3TT3H 2FR4B 3B9VA 3B9KD 3RU8L 5HYJD 5T1DL 5HSFA 3VGDA 1IGJB 1F4WH 2NZ9D 4WUKL 2AS5M 4MJIA 2AJ3A 2IALB 1U8PA 5B3JE 4OZIA 5DA4A 1M1SA 5I8EB 4F7EB 1X4XA 4U6VL 3ET9F 4FZEL 3LPGA 1AQKH 1VPOH 1BVKA 2MQ0A 5KSAA 4P2RA 1TNMA 5DJ6B 2DBLL 5DS8B 3UDWC 2YC1A 3FQUA 5IVZA 2N7BA 4AEFA 4Q0XH 1CVSC 1LE9A 3BH8A 2EYSA 4YBQC 3DBXB 3UTZB 3KXFD 3ELAT 4OFPA 4R4FL 1IAIL 4PR5A 3WLBA 3QI9A 1QFWM 2YWZA 4Q7DA 4IIQC 1K8IA 5GRXG 3FQXA 3RVVD 2E6QA 2CK2A 3K7UA 4B53A 1T22A 3BPOC 3P4LA 1CR9L 3KPSA 4BQ6A 1GGIL 5FO7A 2PXYA 4MD4A 3QUXB 4S1QL 3RWDA 5TE4H 3E6HA 4CNIA 4DEPB 4GXUM 3OF6A 2VXVH 2XRAH 1AFVL 5DD1H 1A7QH 4OGXH 4IHOA 3T1FA 4Y4FD 4HWNA 5B4MC 1OAKH 1U6AH 3FZUD 5DUPL 1JHLL 4X98A 1I4FA 2HP4A 5IB3B 2AJXL 5IVNA 3QQ4B 4JY5L 3MJ9H 3BEWB 3M1BA 5A2JH 3SKUD 1MFAH 5E8EB 4YNYB 1T89C 1TETL 8CGTA 3MXVH 3O6FC 4N5EC 2AXGA 4UV7H 3MYJA 5E00B 5BW7A 1KELH 4UDUB 3VXSB 3W9DB 3IDMB 5D7LA 1YNKL 5FAAA 3TT1L 2BHUA 2EDWA 2W0LA 3RX8A 4LEXH 2YUWA 3KPMA 4HH9B 3S7GA 1FAIL 1Q9OA 4QRRA 4XNZC 2VL5A 2X4NA 4DUXA 1QSFE 3MV7E 4QOKE 1KIPB 5ACLA 4YDJA 2F8VA 5D93C 3RFZC 1YNTB 4G9FA 2NY3B 2H26B 3BP4B 4L29B 4Y16B 2PO6C 1X44A 5E4IA 1M6OA 3JUYA 4HX1A 5AG9A 4PJIF 4XMPL 4OLXH 1HQ4B 5HVHB 4OI7A 2ZOLA 1A7BA 3EDFA 3PWPB 3TESA 3QRGH 1LP9A 1G7LB 5FECA 2YPLB 3NBNA 2GY5A 3WKMH 4UINL 2OQJB 1CK0L 5EIQA 1FN4B 1A7OL 1I1AC 2HKHH 1NBYB 4EI5C 1QYGL 3QUXD 3W2DL 3MA7A 3EFDL 1T6VN 1IFHL 4QXGL 1HWHB 3C9NA 3KHOA 4WENB 2FYYA 1ZT4A 2H2PD 2EDJA 4X8JA 3ARPA 2CDEB 3GMLA 1UEYA 2YUZA 4P2QE 4YPGB 1BFVL 5CD3A 1D5MB 4JFEA 3K1DA 4PREB 4QWWD 3FRUB 3MRLB 3KLSA 4ELME 4B5EA 3QP3A 4I2XA 4LU5L 2QEJA 1FZMA 4LCIH 1B90A 5CEYA 2EE3A 3P30L 1TVBA 1NGXB 5EOQL 1G7QA 2CKBB 4GS7C 1W72L 5D7IE 5I71C 5ACZB 5F7DB 1K5NB 3U0TB 2PNDA 2R29L 5CFHA 4WU5A 4DVRL 1EEQA 3VXSD 5B39G 5SV3A 3LEXA 2IG2H 5AZEL 3T0AA 4FABL 3IYLW 3T2NH 5IFHL 5EOCH 5H2BB 2VDOH 3LN5A 3H9SB 3GIZL 4PBXA 4XNUH 3JWOC 3O2WL 1NUGA 1J1PL 3V6FB 5JPNB 5ITBL 3S37X 1U42A 1CLYL 2BDNH 5TDOB 2HLAB 3DIFB 2NY3D 2MCPL 1G7JA 4Y16D 3TN0B 3BKML 3FOLB 1X5FA 3VXNB 3SJVE 2R8SL 4PYHA 1RIHH 5ALCH 1A4JA 5DVKA 1J11A 2R9HC 5FM4A 3RZCC 3PWPD 1MHCB 2E7HA 6CGTA 3W9EB 1C5CH 4AL8L 3QG6B 4F3FB 4MD5A 3T08A 5I75C 3D85A 1PFCA 2AI0H 1R5IA 2BVPA 5F71A 4GAJL 2W65B 4JJHA 43CAA 4D0BA 3N1GC 2CDFA 4LLAA 2AEPL 1UVQB 5E4EC 4M5ZL 5CILH 5T1LB 3NIFE 3MLPA 2E3VA 3V6OA 5KS9F 3X12A 1WEJH 3BVNB 3G5XA 1Q38A 12E8H 1X7QB 4JEGB 2X4OA 5C3LD 5FB8A 3OX8A 3EO9H 3S37L 3BHBA 1URLA 3VD3A 2X5PA 1BECA 3U82B 3VGEA 1I9JL 3EDKA 4JGUA 4Y88A 2E7BA 5DRNA 2P5EA 1DQML 1QFWL 4LLDA 2J3SA 3WIHA 4LSQL 1MJUH 3KPQB 4XP4H 5I2IB 1A9BA 1MRDH 2OM5A 4FZ8L 4F9PC 1ZS8A 1F11B 2HFEB 5GISH 2VISB 3BUTA 4WNQA 4KY1L 1KBGH 3GZKA 3TVMA 3AU1A 3JWDH 2BNRA 3QQ3A 2F53B 4R97C 2Z31C 1CQKA 1A2YB 4NYLB 5KOMC 1CDYA 3FT2B 3TH3T 4M5YH 4LAQL 3TN0D 2V9QA 4MA3B 2DQEL 2JJTC 3IDUA 5E99L 3LKSA 3GSNH 1B0RB 1WWBX 1IILE 1U8HB 1T21A 4NM8L 4R7DB 1L7TH 3GO1H 2XZAH 1HEZB 2V2WB 3I6LD 1TZGL 3QB7C 3RY4A 2J8UF 4HUWB 3ARWA 3UYRL 3ZTNL 1MRFL 2A0LD 5CCKL 5B39A 4XPTH 4ZO6A 3DGCR 5C0IA 2VB5A 3M07A 4QYOB 1CXFA 4QXTA 4XAWL 4YDKL 1A1MA 5I73B 5LGJA 1BPVA 5INDB 1TQBC 2HVKB 1S9KC 4X99B 2F8XC 3ZDYF 2I25N 4XCNA 3MOBL 5IW1B 5MENE 5BZDB 2XN9B 1WV7T 5I66A 5BVPH 1T0PB 5JHDE 5T1LD 3C08H 3L3KA 2Y6SD 4PS4L 3UX9B 3ULUC 3ULUE 1CE6A 4HS8H 1WZLA 4WTWA 1C5BH 1FSKC 2UV3A 2VC2H 4XX1E 3MA9H 5DD5L 32C2A 3D1MC 3U7WL 4J2XA 1CLOH 2FWOB 5LCVH 2G2RA 3ME0A 4ZAKC 4LVOB 1YJDH 1A6VL 1IGTA 3PWUB 1XR8B 1V8HA 5C6PB 4K9EH 2AABL 1XIWC 1NMBH 4M8VA 1X5KA 2IFFH 5HHOB 3AXLA 1NEZG 4NP4H 5HGHA 4OCYL 3TZVB 1YN6B 5J9PA 3RIFK 2A6IB 5J12B 3ARGC 2VXQL 3TIDA 4ODBD 3EZJB 2F53D 1NCCL 5HD8D 5B38G 3QFJE 3LEVH 1U2CA 3IRPX 5GGSA 1IQWL 3P0VH 1Z5LB 2H6PA 5C0BE 3VRIA 1K9TA 3NN8B 4PJAB 4KUZH 4Y2DA 5FOBA 2ZCHL 2BK8A 4YHIA 4OD1L 2GSIB 4C4KT 1KJVB 5J3HD 1QQDA 1D6EA 5DMIH 4ZNCD 1WVZA 1QLRA 3KYMB 3BIBX 1S3KH 1CYGA 2VDRH 5AD0A 2W0KA 4L4JA 4X7DC 3QA3B 5FYJH 2BC4B 3HUJB 4LCUB 5GIRA 3SGKA 1PZ5B 1QSEB 4GXUN 4NZJA 3VE0A 4LFHD 3CC5A 4C59B 2R1WB 2VDLH 5E2UL 3S36H 3N9GH 1E6OH 3C60B 1A02N 5BO1H 1Z3GH 4NQSA 2LFGA 2XN9D 2EH7L 5FGCB 4OZ4A 2XNAB 4RAVA 1RJCA 5HGDB 5J11C 4Q97A 3CXHJ 4Y19E 4EDXB 3ZT5A 4EQ2A 4JO1L 3CFJA 3MLSH 5DHYB 4WRLA 4NQEE 4DTGH 3MJ7A 2IBZY 4AK1A 1N6QH 2CO7B 4I18B 3CK0H 4O51A 5DJ2A 1U95B 1V7ML 4R8WH 5DJZA 1Q0YH 2ITDB 1HHIA 3QO1A 1KIRB 4K3DL 4EN3C 1E28A 3NCFB 1J86A 3MREB 4KHTH 1X6NA 5C0CB 2R2CA 5I1EL 3TM6A 1MCWW 3BRFA 1JGVL 2W9EH 2A6KA 4O58L 4DKFL 5IF0A 5KAQF 2O5YH 5FIEA 5HHOD 3HE6C 4X4MA 5DVNA 4KTDH 1QNZL 1W8OA 2YA0A 3TZVD 2D03L 4NZUL 2AGJL 5TPWH 4NKIH 5CLWA 2GFBB 1J1OL 5H37H 3GHEL 1S9XB 1ZEAH 2ICWA 4EVNA 4G6ML 2A73A 1NJ9A 5J1AA 4CADA 2XWBA 4PJFE 1NEUA 3VMOA 3MLXH 1DBAH 3PHQB 3RWHA 2Q7YA 4HBCH 1F45A 1UH4A 1S78D 5DHVH 2CR6A 1HOCB 5TF0A 2DMKA 2FGWL 3WIFA 5A43C 3ISWA 1G9NH 3TEUA 5DRXA 3QIUC 3WKNA 2EH8H 4MXWH 4X6FA 5ALBL 5DC9B 4UDTB 4KGLA 2UWEA 4HK0B 1QSED 3DNKA 1CFQA 5HGBB 5D72L 3HFMH 4KQ3L 1MCWM 4GG6A 4LHUG 3F65A 1T1ZA 1RZGB 3QDJA 4KK5C 4XP1H 2YA1A 3VXTB 3C60D 5EFIB 5FYLE 2G5RA 1OSZA 4RAUB 5FGBA 1N0LA 1NEZA 1JL8A 1ITBB 1FVDB 3JTTB 4KRPB 1CIUA 2ICEB 3A6BH 3LS4L 4NC2B 1F2XK 1FV1B 4DN3L 5L9DH 4B7LA 1OAXH 1MLBA 5B38A 1F13A 5TFSH 3LIZL 4NRXA 1B9ZA 1BJ1H 4L1HA 1A6WL 4KKBC 4OCSH 3NFSH 2R0KL 2WNGA 2DQDH 1S5HA 4L3CA 1PAMA 1IKFL 3TWCH 4PB9L 4OBRA 5FXCH 2I9LA 5L8KB 2DQCH 3TV3L 1OTTC 1AHWC 5C0CD 3MOQA 1XH3B 2N7AA 1PKQE 4P9HL 4FP8L 1NFKA 2VUOA 1QFPA 2WUCH 3L3GA 4WI7A 4IRZH 4CVXA 3U0WL 4CUCA 2F58H 4WFHE 3LMJL 4M43L 4P3CH 3WNOA 4AIXA 4CU8A 4XVTH 3NZHH 1G1CA 5GPRA 1T20A 4S1RL 3BAEH 5FDWB 2VMFA 1ZXQA 1KXVC 3LHPL 4G3YH 3MV8B 1Z9SA 3HC4L 1UA6L 4ONGH 2GITB 3DX8B 4NZTL 3BQUC 4D3CH 4XXDB 1MAKA 2AEWA 4X6EA 4WHCA 4ZS6C 5KANG 5ADOL 5LWYH 5F44A 4HJJH 3SDCB 3M45A 1YEIH 5DJDA 5FHAL 1D5XA 3DXAE 3IS0X 4N8VG 1ZGLP 3SDDC 2V5RA 4HKZA 4HMDA 5ESQB 4PJHF 2DQGH 1RZIA 2C3VB 4ODHL 5E94A 5JUEH 3IFPA 4UBDD 1INQA 3NMEA 1FC2D 5E6IC 1B2WH 3SGEH 1NGWB 4YHLL 1FNAA 1ZHKA 5F1IA 1CDUA 4JKWA 1FNSH 2BSTB 2DTML 2GY7B 4LARH 1L0YA 5ESVA 2MPAH 1XF2B 3TJEL 2QSQA 3RWEA 2X4QA 4J4PC 2QHLA 4CKVX 1TIUA 4TOYH 5I18L 4H25B 4I5BB 4LGPB 4MAYA 5FCUH 2DQIL 1XR9A 4M61A 2ADIA 4KRPD 5F1OB 5IMKB 4PJ7B 4XWGH 3T4AA 1CG9B 4FXLA 5DSCA 4HEPG 5ECJE 3EYFA 1JFQH 1VFOA 1NDMB 1K2DA 5C7XL 2AJSL 3DJ9A 1H3UA 2B7DT 2DTSA 1M05A 1P1ZA 2EXWC 1KB5L 4UOJA 1I8MA 3VFWA 2KL6A 4UQ2B 1A14H 4HW6A 1OTUC 4YX2H 3HZVA 3QAZC 3PHOB 4NN5B 1XMWA 1FVEA 2Q86A 4MCZB 5DK0A 3QNZA 5EULV 2NNAB 4RGMB 4P2OB 5HY9A 2GTWA 5BJTB 2CLZA 4FQ2L 4K7PX 5T3ZE 5L6YL 3PWVB 3O3BA 1WIOA 1DEDA 3HPJA 1RJYA 4LASL 3MV8D 4LHUA 4XP9L 4BZ2L 3PWJB 2DKUA 2JK5A 1SM3L 4M1CC 5DHVB 2VXSH 5HHMB 1T0MB 4FXKA 4F15B 1KGCE 5C07B 3KYOB 1CXIA 4YHKL 1RU9H 1UXSA 2YKLH 4Y1AE 4ZD3L 2UY7A 4FQ1H 4TRPH 5FF6A 3O8XB 2PF6A 4NHUA 4WY7L 5EDXA 3SDCD 2VLLB 5FYJD 4Z7UE 4DUVA 3E2HC 1UT9A 4PRDB 4PPTA 2VITA 1ZHBB 1OT2A 2I5YH 2OI9C 4B41A 1Z9OA 3SKOA 3UPAA 5JDSA 1JYXA 3A67H 3N85H 3GRWL 1G7MA 3RKDC 2ZNWA 3MZGB 1LE5B 2DIAA 4XP6H 2QHRL 3LD8B 4NWTH 2Q8BL 1YDPB 3BZ4A 4TUOB 3QFDB 4IRSA 1AE6L 5ADPH 1I8KA 1KENL 3ZDXE 5JXAH 1LNUA 3MO1B 5TGBA 1O7VA 1C7SA 3QIBC 4RRPG 1AI1L 5A2LH 1NCWH 4PB0H 3P3YA 2AJ3B 1HINH 1U58B 1U8PB 1Z9MA 4KQ4L 3RVXD 4OZIB 2FZ3A 1ORSB 1HXYA 4YHML 1II4E 3JV0A 4OIIL 2W1NA 3CVHL 4XPHL 5HI5D 1FGVL 5D1ZB 4P2RB 3C5ZC 4JQVC 4GRLB 1T3FB 3ARFC 2CDGA 3PGDB 1TITA 1IC7L 5EWIL 4WW2A 2VZVA 4FTVB 2RFXA 3BH8B 1T0NA 2WINA 4HT1L 2WK2A 3VFPB 5TQ2H 4N8VA 3QI9B 3V95A 4Z18A 4PGBB 2ENSA 1K8IB 3FQXB 1HZHL 1HNFA 1KC5H 1ZVSA 1QKZH 1FLRL 1FYTB 3P9MA 3DPBA 5T3ZL 4P5KB 3F5WB 3KPSB 1CLCA 4YC2B 3WXVH 3EIFA 2PXYB 5FO7B 1L9NA 4NQDB 5I8KL 4A2MA 3RWDB 3LSOB 3OKMA 4JPKH 3H9HA 5KSUB 3E6HB 4CNIB 4QXUH 2H45A 3KJ6L 2CH8A 4KMTH 3SGEI 3HNVL 5SX5K 2DM7A 1PQZA 2JCCE 4XPBL 5HHMD 3MBXL 5FUZL 5J56B 5C07D 2XZCH 2ARJQ 2V7HA 2O5XL 1EVTC 3W0WB 2L7UA 4X98B 4UQ3B 2QADB 3JV4B 3O8XD 5D1XA 3I6KB 3TBSA 5ISZA 5DTFA 2B0SH 5KSBA 2YD8A 2EDTA 2VLJB 5EU7C 1TZIB 1UM6H 2UYLB 3IU4L 2AXGB 4QNPE 5EU7E 2NXYC 5E6YA 1HH6A 1F90L 2VDML 4HKXB 4KDTA 1U9KA 5KVGH 1MQKL 1SJXA 3AY4C 3QCTH 4IJ3B 1VHPA 4L5FL 4OZHB 4F7TA 1MFEH 3S4SB 3VGAB 1JHKL 3GIVA 3NAAL 5LXGH 1TCRA 3WIHH 3I75A 2XXMB 5JW5A 1Q9OB 5AYUL 2X4UA 4ALAH 1JGUL 4QRRB 1ZLWK 4LF3A 3FO1A 4WFFE 5H35A 3C2AH 2P8MA 4G6AC 2OJZH 4X7CC 5D6DC 4P57A 3LKOA 4G8GA 5ESAB 5D2LF 4J1UA 4HXBL 4G9FB 4GKNB 3SKNA 1J05A 1EERB 4HLZG 1CI5A 4NQTA 4PGDB 5D1ZD 1BFSA 4P2RD 2LV4A 4GRLD 1M6OB 2FIKA 1GGYA 1KLGA 1I3GH 3WUWG 5EU4A 2IF7A 4FTVD 4FQLL 2ZOLB 3VG0L 1HI6A 2ERJC 2P46B 2Y07H 4NHCL 4WWKA 3QI9D 4AENB 1CF8H 1NKRA 2FSEB 2LTQB 4NFDA 2AK1L 1FYTD 4JO4L 1FNGA 3G5YB 3IDGA 3KPSD 1FGNH 1XGPA 2PXYD 4NQDD 3QUYC 5KN5A 5L2KE 3WIIL 4PJIE 5ANMA 3OF6D 1MHEB 3ZZ1A 3CLEH 1ZT4B 2YMXL 4AYFA 2CLVB 2G5BA 3C8KA 4RRPA 1G7IB 4DVBA 3QHZH 4KTEL 3BO8B 3PP4H 4AEHL 2K3TA 3QNXA 3ZKMC 3W0WD 4P2CG 3VI4E 5I30H 1U8QA 2QADD 1FZMB 4TNWF 3UDWA 1K4DB 3P0YH 5ELIA 3E8UL 3EO1B 2VLJD 1AXTL 1G7QB 3V5KA 5CWSA 4F9LC 5DC4B 3OAZH 2IBBA 3OHXA 1I8IA 4LLWA 2R2BB 4WU5B 5HYQB 2WWKT 4C57C 5FO9A 4FQCL 1BFOA 3VCLB 4NSKA 5SWZB 2UZYB 1A3QA 4NQVB 1BIHA 1NSNL 3QHFL 2HFGH 1FIGL 4M6MH 5I1DA 5D71H 4QRRD 4N8CH 3SQOH 2WWMC 5HYEA 5MEPA 1YEFL 3RKPA 4RGNC 4RGNE 2VE6A 3QXWA 5HGGS 1CFBA 4G9FD 4XNYL 2BSSB 3IT8D 2GAZB 4CAGA 4M62H 2V5YA 3RWGA 4ZOEA 4Z6AT 2AK4B 5EO1B 4YDLC 1OB1A 3RX5A 4AIZA 2G60H 1FO0H 5FA3A 3WS3A 5BS0A 1T89A 1W72A 3RRQA 3O6FA 2CJUH 3WNLA 4BQ9A 2EIZA 3DROB 4MD5B 4POZC 3D2UB 1DQJA 2BVPB 3T0BA 4L3EB 4MNQA 3CUPA 3X17A 2VZTA 1DSFH 4ZSOE 2OP4L 2WP3O 1H3PL 2Z35A 1DUZB 5J13B 4R26H 3I2CL 2NY5C 1S7XA 1GYAA 3MBEC 3CX2A 5T3XL 3U30C 1QSFA 3MV7A 4QOKA 43CAB 2J4WL 2CDFB 4ELKB 4RZCA 3DVGB 2I27N 3MRQA 1BMGA 4ZUTA 4JFED 1ZA6B 1NMCC 4PJ7F 3GMOB 4MS8C 3G5XB 3TYFB 1DE4A 2EC9U 1I8LA 2KH2B 2X4RA 4FMKA 5BV7H 3IVKA 2B2XL 1B4JL 2ADFH 3KPTA 4PJ5B 1N64H 2AQ1A 4O4YH 4EOWH 4M7JH 1BBJA 3WUWA 1IAKA 3PNWA 1OOAA 4HC1L 3N06B 4LLDB 4MB5A 4PV9A 1H15B 5DHXB 4LOUC 5SWZD 1KIUA 3B8SA 4MCYB 3UO1H 5JQ6H 1ZHNB 1BHGA 2EYTA 1ZS8B 5IMLB 4EI5A 3VGBA 3T2PA 3QCVH 4JRYB 4M6OL 4WNQB 5T1KA 2PYEE 3TVMB 4HH8A 4P2QA 2FO4B 3NPSB 3MRIB 3QDME 1Y18A 2IBGA 3MRKB 3CFDA 2QQLH 3H9ZA 1DR9A 2NW2A 2EDLA 2YD7A 5EG6C 4ELMA 3T3MF 1IEBB 2ORBL 4JFZH 2AK4D 3CFBA 1NGQL 2HT3D 1N2RA 1IAMA 4Z95H 4LSSH 4GAYB 3WD5L 3LKSB 3O2VH 5D7IA 1YMHA 1CXEA 3CLFH 1A3LL 1HQRA 1T21B 2BVQB 1SYVB 4GW5B 5CIPA 4X6CB 1CT8B 2CGRH 1CGSL 3PV6B 2HFFA 1NBVL 4CN6A 1SBSH 3D2UD 4U1GB 4AT6B 3X3FL 4L3ED 5TE6H 2OL3L 4K7FB 3C09B 5B39B 4D9QD 3MRJA 4HCRL 1A1MB 2NY5L 2J1KA 1NCDL 3MUGA 3DECA 3BD4A 4OM1H 4G7YL 1WCQA 2J88L 2FBOJ 2W07A 4XVUD 1IVLA 3IDYC 5GGVL 3OXSA 4DGVL 4YUEL 3L3KB 2D2OA 1YC7A 5JW3H 1CE6B 2YK1H 3ARXA 4OZIF 3HA0A 3QRFM 3WJJC 4I77H 3V4UL 3GMMA 1KTDA 4OCLC 2ZPKL 5FKPA 1ZVYA 3RX7A 3SJVA 4Y5VC 1KJ2L 1OAQL 4ZFGH 4KRLB 4PJ5D 3LH2H 3RZCA 4M6NH 5GS1C 5D8JL 1RIVH 1R24B 5E9DA 1IGTB 1BD2B 4HFWA 1XT5A 5EZOL 2W60B 4LQFH 4XVJH 3SDAC 1AD0B 1R3LA 4JRYD 4BM7A 4HPOL 4EIGB 3TVMD 3GI8H 4NM4L 1S9VA 3MLVL 2RBLA 1J9CT 5DK3A 3S34L 3FO9A 2Q6WB 5GGSB 1GJIA 1FO0B 4CN4A 2A77H 1QPPA 3REVA 1KLUA 2DMCA 4Y2DB 5T1MA 1NAKL 1N5YL 4YHIB 3FJTA 1INDH 5TJWK 2GJ6E 3GBMH 3VGHA 5I15H 1F6AB 1D6EB 3OAUL 3I9GL 3RY6C 4BQ8A 5C0GA 1S9YA 3MCLL 4OF5A 1CLZH 1MAMH 4F58L 1CZ8H 2C4FT 2D0HA 5EU6E 5EZJB 3GB7A 2FRGP 1I9IH 3VE0B 1A7RL 4NKOB 4YWGH 3UTPD 1V7NL 1EBPA 4F9PA 1G84A 5D4QA 2R2EB 3DO7A 4LPUA 3KNBA 4MNHA 2DL9A 4NQSB 3MNVA 5DD3H 3DLQR 1B6DA 2R2HB 1NCBH 4OZ4B 4RAVB 4TPRL 3ZL4H 1MFDH 1RURH 2Z31A 5BV7B 1YUHB 4C83A 1F4YL 4JZOB 2OCFD 2JJTA 1ADQL 1VFUA 2E7CA 4LCYB 3MJ7B 1MELA 4G7VL 5DRZB 3HS0A 4ZUVA 2JF1A 3W11C 2VN4A 4I4WA 4QY8B 5FGRA 3QO1B 5EZIH 1HHIB 1KIQA 4R90L 5KG9A 4OI8A 5DMGD 1EAPB 4ZFZA 4AMKL 4ZO8A 1BD2D 1LP9F 2VXUH 2NY4B 5F7UA 5DD0H 4EXPX 2WBWB 4R7NA 3T65A 3VXRE 4ZUSA 3OPZL 2VDKL 2A6KB 1OAZL 3AFLA 2ZZUT 3MLUL 2AXHA 2F9BT 1TPXC 3DARA 2SEBB 4KVCH 3B5GA 5CZVH 4NNPH 1JK8B 3MNZA 5MENA 1KPUB 1QA9B 3EZ8A 1WC7A 4TSAL 5JHDA 1A8JH 4EVNB 2IGFH 3O3AB 5I1JH 2XWBB 4S1DC 2J8HA 3PJSB 4K3EL 3BKJL 1UXWA 4OI9A 3L5JA 2G75A 3OSKA 1F00I 3RWHB 1BF8A 2Q7YB 5L7XH 4Y2DD 2C4XA 4HKBA 4HWUA 3RI5F 1ZAGA 3IAPA 3RWFB 5FEBA 1YY8B 5DRXB 4I0PC 5E03A 4ZAKA 3U0PA 1T66C 1WCBA 2UWEB 5TQ0H 3DHMA 2P5WE 3UTSE 1XIWA 5A40E 4TVPD 1CFQB 4N0UA 1MJ7H 1FDLH 2A2QT 2DLHA 4OBSA 1G9MH 4KUCF 4I3GA 1J5OH 2GK2A 4Q9RL 1NMAH 4HV8B 1BZ9B 1OSZB 4Y89A 3ARGA 1U8MA 5KOVC 4QRSA 1H3VA 3MLZL 4JDZA 2W59A 1NEZB 2VLRB 2X1XR 3IDIA 2BSRA 3QFJA 3BMWA 25C8H 2IBZX 5C0BA 3K4ZA 1H8SA 1R5WA 3E1F1 2FX8H 2O61A 3C5SB 5T33L 5B38B 3BP7B 2WQ8A 2EIEA 4NRXB 3X13A 4WI4A 2CXKA 5F9JA 5FKAB 2QTEA 5F7EH 5I16B 3OJ2C 4K23L 3BDYL 5F9WC 5CSBA 4CBPA 4P2YA 1CDCA 4KC3B 5IG7B 2NYYD 3D39E 2NY4D 4QXWA 1N59A 2FATL 1RK1A 2WUBL 4U0RC 1LDPL 2WIMA 5DC0A 1E6JL 1YEGL 5EIIB 3LZFH 4G8EA 2XWTB 1JZ3A 2XWJB 3Q6GH 3H7BB 1BEYH 5E1AB 5DJCB 5EPMB 1XGRA 3IF1A 3KS0H 2OMNA 5K9OB 3RU8H 4PLJD 4Y19A 1S7QB 4RAHA 3O4OB 4WUKH 4QRUA 1JNHB 5C0ND 4TSBH 1Z2KA 1CD8A 4YIQA 3OZ9L 3QULA 4NO0B 4CL7A 2IEPA 3ZDZE 4YFDB 1B3JA 4JM2B 1D5XB 1EEYB 4EN3A 4ZODA 4QHMA 1PEWA 2B5IC 2IANE 4U6HA 8FABA 1DLHA 5IGXH 4HQQL 3HCVA 3SE9L 1BFTA 4LSUL 1FCGA 3ZE0F 1INQB 2GSGB 1MFBH 4WUUE 4R2GB 2QSVA 5LGHL 3HE6A 1LEIA 1F4XL 5ENWA 4U1HA 5ESVB 3RWEB 3QWRA 1OCWL 4ZOCA 2VLRD 1GGIH 1N8ZA 2BP3A 3K2UH 4MAYB 4M61B 1JZ8A 5EB9A 1MVFA 4PJFA 2DYPB 1NGZA 3F12A 3DVNA 1A64A 4Z9KB 3T4AB 4AG4L 5DSCB 1GCFA 1VADA 3KPOA 4UTAL 3LRSA 3EYFB 1KTLA 3P11L 4LMQI 3FFCA 1TJIL 3C6SB 1AD9A 1GC1C 5C0JA 5HYSG 1A3RH 3QIUA 1YECL 3HI1B 1KFAH 2VXTL 4NKDA 5A1AA 4E42A 2O26U 3MTRA 4JY5H 3OKOB 2DD8H 2VJXA 3W5MA 3L7EA 2B39A 5HDBE 4D0CA 4O2FA 3DRQB 7FABH 4JREB 3K0WA 2Q86B 4YQXH 4CDGC 1AY1L 2NX5E 1KN4L 4Z5RA 5EU3B 5HY9B 2XZQL 3RWJA 2AP2A 4YXLH 1GGUA 2VKWA 1YNKH 3HG1E 3TT1H 1RJYB 3CCHB 3QQ9D 1HYSD 1BBDH 2P7TB 1PG7X 3NZ8A 4OZFH 1FAIH 5AWNH 4V2BA 4IMLB 4DN4L 4UILL 3RL1B 5IWLC 2YN5A 3MJ8A 2HTLC 4NO0D 3D18A 3U46B 3REWB 4JFDE 1YYLH 5DEGB 3VFUA 4NC0B 1KB5A 3S88L 1PKQA 3ZE1E 4N1CA 1CGXA 5JOFA 1CFVH 5BVJA 3SKOB 3UZVB 5JDSB 1CFTB 3T2QA 1R3HA 3QHTC 4X9GA 1RZ7L 3VXUE 4R2GD 1NBZA 3DYOA 5SV4A 4IRSB 4GBXC 5KVMC 4RMVA 1LNUB 5KANI 5IHUH 1A7OH 4KI1A 1N0XH 2Z92A 4NUJA 5IQ7L 3MUJA 4RFEA 4MAYD 2ZG1A 1U93B 2QQKL 1JNNL 4M7LH 3BUYA 3ECBA 2EKSA 4TUJA 3BQUA 3MRDA 4EJ1C 2FZ3B 1MJ8H 3VFTA 4QXGH 1F2QA 4ZTPL 5GRUL 1PG7L 3BIKB 3Q6FB 2GIYA 5B22A 3ILQD 4YR6B 5SWSE 3LQZB 2CDGB 3DXAA 1Y6MR 4WW2B 5F96H 5KVDL 1LEGB 3SDDA 2EE9A 1UWGL 3D25A 5DQ9A 4G5ZH 5FV1L 4A2LA 4HIXL 4N8VB 4KI5C 1OM3L 2X4TA 2BJML 5C9JB 2PN5A 4KI5E 5CJQL 1LO5A 1AGDA 1ZVSB 4PJBE 1QVOA 1WWCA 3P9MB 3Q5YA 4ZO7A 4DVRH 3WE6A 4LPXA 3CIQA 4ODXB 1BLNB 4J4PA 1JPFA 3OKMB 3H9HB 4P5TB 4X8XA 1BGXH 1BVLA 4FABH 2IQ9L 2Y36H 4XMLL 1XCQB 2X2YA 3H0TA 2W9DH 4TN9A 3GIZH 3QH3B 3IGAA 4CRPA 1PQZB 3CVHA 2V7HB 5GXBB 3ZKXC 3R06B 3TBSB 3L3IA 4JGJA 5D1XB 4GW1B 3QSKB 5DTFB 4JPWH 1HSAA 2MCPH 4OLZL 4DK6A 1I7RA 4J3VA 4TUKL 1OQXA 2DQUL 3BKMH 4WTXA 5E7BA 1NCUA 1HH6B 1FIEA 4HLZH 4OGZA 5HYSA 2HMIC 3V79C 5C1MB 4LVHB 2X89A 1JYNA 1LO3H 3MRHB 1UYWL 4N9GB 1PYWA 4AL8H 4F7TB 2WM0A 4IRSD 2C1OB 4NGHL 3V0VA 1TCRB 3I75B 2YUVA 2XY1A 3B9AA 2YA2A 1MJJA 4GAJH 4ORGA 3FO1B 2XA8L 1F3JB 3KYKH 1A6PA 3HRZA 5DURB 1MIML 4NJ9L 2XTJC 2DMBA 3SE3C 1TTFA 4J1UB 2XTJE 2KUTA 3SKNB 3LAFA 1SEBA 2RAMA 4M7ZC 4M5ZH 3HC0A 1EZVY 3PDOA 1KLGB 5CD5D 4CW1A 4Z7UA 5I1GH 3D69B 2B1HH 3DWTA 3S37H 5JIHA 3DUUB 3C6LC 4H1LH 4X9FA 1WWWX 4U1NA 2JIXA 5FYKE 2UWEF 1G9EA 5HDQL 4QHKJ 1P6AB 5C09B 5CIPH 1I3VA 1I9JH 1FNGB 3L7FB 1FE8L 1XGPB 1DQMH 1R6VA 4OZFB 4GG6F 5IEKA 4U33A 5KN5B 1UM4L 1EHAA 1T4KB 1U8KA 3QEQE 1EAJA 1A5FL 3BMVA 1JF1A 4XBPA 3RPIB 1U3HC 2G5BB 3C8KB 4KY1H 4DVBB 4U1IA 4JQIL 3QNYA 4WU7A 3VJ6B 4M00A 1YN7A 3HC3L 3JWOH 3QNXB 3UYOD 1U8QB 4JQVA 1C8PA 3NABL 4JVWA 5D1XD 5CEXA 4X5XB 3H42L 1P7QA 2W0PA 5E2VL 4DCQA 2D4DA 4KK8D 1OTSC 4LAQH 2E6JA 1JGDA 3S98A 2DJ4A 4PLKD 4ZO9A 2V5TA 3OHXB 5CGMA 2OSLB 3GSXA 4IIQB 4RISH 3V4VH 1MREH 4UT6L 3IB4A 1BFOB 5HGAB 5AG8A 4NO5A 4S2SA 1WSST 4FQJL 1SVCP 4QRPB 5D7SH 5I1DB 4U7MA 3WL9B 5SWQB 2EIDA 1FLTX 2X70B 2P24A 4OJFL 2FX7L 2L4OA 4XAWH 3TBTA 4I3SL 1N4XL 2JCCA 4WWID 2VE6B 4MA1C 1MCIA 3MOBH 1HKLH 1BIIB 3CXDH 3ZYOA 1QOKA 1OB1B 4PJ8C 4EQ3A 5FA3B 3WS3B 4L4TE 4H5SA 4QTIL 4U2YA 3SOBH 1OGTB 4XPFH 3U7WH 4OZGE 1RY7B 5FYKL 5GRJL 5HI3C 2VDPL 3AY4A 4MA8L 5C09D