5KVMC

Extracellular region of mouse gpr56/adgrg1 in complex with fn3 monobody
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
SVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGGSPWSWQEFEVPGSKSTATISGLKPGVDYTITVYASSFDWTIFPNYYSSPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhesion G-protein coupled receptor G1
publication title Structural Basis for Regulation of GPR56/ADGRG1 by Its Alternatively Spliced Extracellular Domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2016-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kvmC00
2J5LB 4JFDD 5DFTA 3MLVL 4HMCA 4XZUB 4U49A 1F8TH 1DVFA 4FQCL 2YZ8A 3U9UB 4HMDA 4F9PA 2DKMA 5I8EA 2W0FA 4WIQA 3ZE2F 3BXNA 5F9WB 3W0WB 2MQCA 5D1ZD 4P57B 2LVEA 1DN2A 4JKKA 1EAPB 2WIIA 2FSEA 4BSVB 2OCFD 3BIKA 5D9SA 1OAQL 2HT2C 1OD9A 3N9GH 3U48A 2ARWA 2B39A 3HMXH 4RAHA 4NFCA 1FZKB 4N9GB 3WKMH 1XR8A 5ITBL 3RZCB 2FGWH 2BY2A 4L1DA 3KR3H 4JFYA 5AEAA 5CAYB 3AFLA 1AXTH 4PV9B 3TCLA 1A5FH 4KKAD 2HFFB 1MJJB 1SY6A 1KENH 3A67L 4ZSOB 1CDHA 4JPVH 3F7VB 1G9MH 4ODHL 1IGYA 4JRYE 4F7TB 1ZWIA 2F8XC 5HYJA 4ZS7H 3UO1H 4R97C 2R0WL 2CIIB 1TTGA 1EZVY 3P2TA 5D1QA 3U1SH 5IB5A 4IOFC 3F7YA 5ACMA 3V4VL 1AR2A 2BERA 4P2OB 4P2QA 4UOW0 4XXDB 4U0RB 1XGUB 2BY3A 3D6GA 3ULVF 1OARL 4NPYA 1JPGA 1HKFA 1C5DB 3Q6FB 3QUXD 4YDVA 1YUHB 2IFFH 1PSKH 2A38A 4LSTH 2APFA 3CLFL 4PFEA 3ZMRA 1T2QL 2DWDB 4M9OA 4RZCA 4CW1A 3LV3B 5ABDE 1VESA 4N1HB 1TQBB 1XGRB 3G6DL 2DIAA 5FYLD 4K7PY 1VFOA 5HDQH 3MOAL 4GAYB 4HUXA 3IFOB 4JRXE 5IK3A 4PJFB 5EFIB 1C7SA 3PDGA 4H25A 3MLXH 4X7DC 3IJHA 1CGVA 1X4XA 3L5WB 1MHEA 1TVHB 1F02I 5JIPA 2DTML 5J3HD 2ED8A 4UT7L 4NQCD 2V9TA 3VFNA 4FQXB 5GS1A 4Y16A 4ZTPL 4JO4L 3ZTNH 2VDKH 1HXYA 3HC4H 4AEHL 2C4FU 1EEUA 4V2BA 1YEHH 1YQVH 2E7HA 2MQ0A 4HKXA 3WNNA 3M8OH 1UEMA 4K3JH 5MERA 3MACL 4R4BB 4G9FE 1A6TA 5DJ0A 5C0RH 2EDOA 4P5MB 5J6HA 1NBVL 3TZVB 2XTJB 1SBSL 1MIMH 3QH3B 1A6ZB 1I3UA 3HR5A 1JNJA 5BO1L 4JY5L 2R23A 3MJ9L 4ZODA 4S1QH 3GM0A 2LU7A 4EZMA 2CJUH 3SKJH 3MXVH 5DD1L 4JDTL 1LO4L 2X7LA 3T65B 1RPQA 4OV5B 1INEL 3L6FA 1DDHB 43C9B 2RJMA 5C0JB 1R6VA 4Y5XC 3K4AA 2Z4QB 4IOSD 5IB3A 2MHAB 4MJ6B 2BNRA 5D7IB 1N0LA 3TT1H 4M93C 5F7DA 2HJFB 1Z3GH 1D5MA 3QIWA 2VZOA 4XBGB 1ZHKA 2F8VA 2VAAA 2NW3B 4WI4A 1Q9KB 2Y4SA 2V2XB 1I1YB 5HGAA 4QHKJ 2YD6A 1RULH 4ODTL 4TVPH 4LSUL 4F9LC 4LMQE 5C0CA 2H8PB 4G6JL 4R7DA 1CE6A 1HDMA 3O11A 3QDJD 4W68A 5IBTH 2X40A 1H3VA 3TO4D 2BFVH 4U6YB 3F7QA 5B8CC 3MNVB 4MXQC 4XCEB 4AL8L 2AQ1A 3TBYB 3O41B 3FTGB 4F58H 4LLDA 3QRFM 3WIIL 1FCGA 1L9NA 2W9DL 3MOBL 4KI5C 2FL5B 4TNWK 1FN4A 1D5IH 3HPLA 4NO0D 4U1KA 5IB1B 5CWSA 2NY1D 4PJGF 3VFMB 3WL9B 1DBKH 1I3RB 3WO4C 3T3ME 1NCWH 5AYUH 3OPZH 1UENA 2A1WH 1VERA 1TJIL 1WTLA 5A16B 3EO9H 2FBJL 5I15L 2HMIC 3TNNA 3U7YL 5DJDB 4TSBH 4DQOL 4M6OL 2VNCA 1A6WL 2F5AH 1FJ1A 2JB5L 1ONQA 4YXKH 4C59B 5MHSE 4HF5H 4PRNA 4IS6B 4Y7MA 3OR6A 1ZTXL 3FB5B 2VZ1A 3DGGA 4OD3L 1MCLA 2HVKB 1BIIA 2F53A 3AUVA 4C54A 5K9QI 4WTZG 3UPRA 4G8GD 2R0ZL 4IJ3B 4PG2A 2A74A 3EOTH 3F65A 4JHWL 2AGJH 4YUEL 3UTTA 5KVGH 5I1IL 2DN7A 3KYNA 4ZNEA 3EFFB 4LKCB 3GNML 3GJFH 5DSCB 3ES6A 4PRIA 3PP4L 4TULL 5LAXA 3LHPH 1C1EL 1NCCH 3QXUA 2ADFH 2BOBA 5I16B 2W60B 4OUUB 4OI9A 5BZWA 5DMIH 4NBZB 1JRHI 1NFIB 2VDOL 4OCMC 3FQXB 1M1SA 3QIBD 4MX7B 1JGLH 1CF8H 4GXUN 4PD4K 1XR9A 4QHLB 1QFWM 1Z9LA 1G7HA 4RX4A 2FR4A 5ILTH 3KVQA 3UTZA 4QRRB 5EBWA 3HC3H 1I7ZB 4JO3L 1T83C 2MOVA 5IJVA 3U0WH 5GS2D 1U8KA 4ZD3L 4PJFF 4Y5XB 5BJTA 3BT2H 5DEZA 4QHMB 2I5YL 4KTDH 2J8HA 3R0MA 5EC2B 4M93B 1TCRB 3VH8B 5B38G 2IQ9H 2GITB 3KWWB 4GXVL 1CG9A 3KPOB 4OQTL 4XP1H 1KTDA 5SWSA 1BFOA 3AGVA 5I1GL 2IQAB 2IADA 5JA8B 3P4NA 3V6OE 1Q9WA 1S5IL 1CN4A 3QUZD 2Y5TA 3QZWB 3GSRA 5LGJB 2Y72A 1V3JA 4WFFE 2RB8A 4X6EA 5DHVB 3FB6B 3FMGL 1WAAE 2J1KA 3THML 3VMNA 3U9PH 7FABL 2FO4B 4WHCA 1S7XA 4P3DB 3VG9C 3OKDB 4XTRD 4PGDA 3V4PH 3FHAA 4OZFG 5JUEH 1IEBA 5D96C 1MI5D 1QSED 1IC4L 4OBRA 5DJ6B 5DZNA 4TNWF 1ZLUH 3QWRD 1ED3B 4KI1A 4PTTB 2BNQE 3SJVB 3RWFB 3D87B 1FVDB 3ARBC 1KC5L 3HZVB 3KPRE 5MEQB 3MRMA 4MAYA 3UBXA 5C3LD 2CO7B 3RWDA 3ULVL 3CZFA 5SV3A 1J0IA 4OT1L 3MV8A 3WO4B 4F7EB 3SQOH 1YMHB 4EDWH 2FWOA 5D7IF 1A2YB 5CHNA 4MWFB 1J8HA 4ETQA 3CSYB 4CAGA 1OSZB 3RTQC 2NY0C 3BP5A 3OAUL 1IC5L 1AR1C 5BRZE 3JTTB 4P2RA 3OR7A 3BDXA 4A2MA 4Z7NF 1G1CA 1NUFA 3ZTJH 2EDRA 2Q3AA 3PHSA 5MP6H 2N7AA 2RCSH 5JA9A 4PJGA 5MEOB 1RZ8B 2YC1B 3CCHB 5D7SL 1T0NA 4GT7A 3KPLB 1AQKH 2IAMA 2B1AH 4JQIH 3FFCE 4Y1AE 2KPNA 2KKQA 3HAEH 3KDMB 2PO6A 1EJOH 2HT3C 3PV6B 4RMUA 1N6QL 4S10A 3T0EE 4BSVA 4NQUA 2EYTB 1TCMA 2MWCA 4P9HC 2C3VB 5T33H 2CD0A 3AM8A 2BZDA 4OZHA 1EEZB 1L6ZA 3MBXH 4P49A 1AJ7H 1I1FA 1P2CA 4KMQA 4MJIB 5C09D 3MLYH 5F9OH 3S35H 3DSNA 4PV9A 3OWEA 1ND0A 2OS7A 5L2JA 5IHBA 1IAOB 4X98A 1DQMH 3GMLA 2BP3A 5ID1B 3RIFK 4YHIB 2PUQT 4N0FA 3QJHB 1QR4A 3ZYIA 4FHBD 3S7GA 3O8XD 1EGJA 3RGVA 1UB5B 4KK8C 1I8LC 2NLJB 1G6RA 2D2OA 2CO6B 2AEPH 4PRBA 2BVTA 5TDPB 2YS4A 2XZCL 1XGUA 3DYOA 4JJ5A 4F7MB 1FBIL 2ZNXA 3I9GL 3W9DB 3ZLQC 4WTWA 4EOWH 1H3WM 4FTVA 2GJZA 3Q1SH 1WZ1H 2H32B 1QSFB 4U1LB 3Q5YA 1NAMA 3ZE0E 3DRQB 4GG6A 4Y88A 2XWTA 4M1CD 5A40E 1W8OA 5CEYA 2O5XL 1U8IB 4XCYB 3HUJE 4G8FB 1OAKH 2Z8VC 3OQ3B 2YOCA 1RIUH 4APQA 4HLZG 3VG9B 5IOPB 1DQTA 5EOTA 4CVXB 1U42A 2GYSA 4PRHA 1B0GB 4P5KB 2AQ2A 5D96B 1IZKA 1BLNA 5B4MC 2IBZX 4QLRA 3V5DB 5IIEA 3ZZ1A 4LL9A 4BFBD 4FQXA 1UKSA 4RRPG 1DBAL 1G9NH 3MV9B 1OOAA 1KJ3L 1YYLL 4U4BA 4XHJD 3LKRB 4X4XA 4YAQB 3E6FB 4H88H 3ZO0A 1I9IL 3P73A 3MGTA 2NY0B 3TZVA 1URLA 4WRLA 3VXMA 5KTEH 2UWEB 3MRKA 5EU6A 5HHQA 1A02N 2XZQH 4QXTB 1KCRH 5BVPL 2XT1B 4OF6A 3NCYS 3GBLA 4HG4J 3C8DA 4QO1A 2P49B 1NKOA 5K93A 5BS0B 5I9QC 4XPFH 3GIVB 3L1OL 1IFHL 4OV5A 5DURB 2PXYA 3FOLA 3PGCA 3HE7C 1OP3H 3QUKA 1T66D 1U0QA 4B7IA 4LOUC 4PR5B 3FT3B 1CD8A 4TQEH 2OL3H 4NO5A 4I8DA 4KI5F 2EEAA 1B0WA 5KAQG 3FN0L 4A6YA 1PZ5B 1MNUL 1RQ5A 2DS4A 3MOQA 4LGPB 2W91A 1CZ8H 5EU5A 1BFTA 2VTFA 1YNTA 2YD4A 4X4ME 3PGFH 5HVHC 1CTOA 4JFEE 2NXZC 4LLUA 4BJLA 4QTHA 2GT9A 4WGWB 5E5UB 3GHEH 3S6CA 4Q6IA 5LBSL 4XMPL 3S3PA 2I60H 3TN0C 5CGMA 4NC1C 3LEYL 4HIJB 2AJYL 4PP1C 3O41A 1NLBL 2RIKA 4Z0XA 1LO0L 1MF2L 4PJCB 5D7JC 4NWTH 3RIFF 4W70A 3R06B 5FA4A 4HGKC 4LNRB 1MCSA 4Z77A 2EC9T 2IPKB 3DETC 1S9YB 2Y07L 5EIQA 3VI4E 1IL1A 1RZJC 3K3QA 3GRWL 2NMSA 3B6SB 4N8CL 4FFWC 4P5TA 4JN1L 3PE9A 4YXLL 2VN7A 2DMCA 3DMMD 4X5WB 5BV7L 1DL7H 4KFZC 5EA0H 4DN4L 4Z8FL 4YDJB 3MRFB 2VE6A 3MJ6A 1UT9A 3LOWA 3VXUB 1J05B 1U8JA 2IH3B 5L9DH 4ZFOB 1KXVC 1D9KC 2NPLX 5BVJB 5KJRH 5FM5M 5DJZB 2QQQA 3KNBB 5C07B 2NNAA 3I02A 2NX5E 5IB2B 1YN7A 3NFNA 3LN5B 4X8JB 5F7FA 2HVKA 3IDGB 5DUPL 2HWZL 4HHAA 4PB0L 5I1HL 5E5MA 1RIVH 2VMFA 5IEHB 1E28A 1NC4A 3BRGC 5ANME 1P4BL 3QFJB 5IQ7H 4LEXL 4KDTC 2R8SL 4LCUB 2A2QT 3V6BR 5B39A 2ENYA 3GKWL 3N85H 5I8OH 5KZCD 2YPKA 5DSCA 4NKDA 4XBPB 1AIFA 3LDBC 4ZXBC 2J4WL 2FJGA 4DVBB 3D2UA 1CFQA 1DQDH 2DQIL 1I8KA 2D0HA 1YA5A 1U58A 1P1ZB 1HOCA 1IQDB 1IAMA 1ZSDA 1NFIA 4JO2L 5C08B 4M7JH 1MREL 4MX7A 4XNYH 5HY9A 3D3VE 3ZKQD 4F33B 3BZ4A 2GJ6E 2EDJA 2VITB 5I9QB 5E6IA 5TPWL 3TIEA 4PB9L 5FHAL 1BM3H 3NA4A 3BRDA 4QRRA 2LU3A 4PGCB 4M3KB 1CL7H 2DL2A 3E3QC 1PEZA 5C0EA 1EPFA 4OLWL 4UNUA 3GZKA 3HE7B 5D5MA 2IANA 4ODVL 1S7SA 5E5RB 2A6IB 2BX5A 1OGAA 1WBXB 5LXGH 3IDJA 3WEXB 1I8MB 4RQQA 1G0YR 4K94C 1MCBA 4D0BB 4PLKC 4C56A 3S37X 5MEND 5ERWB 4MA7L 4P48A 1FNFA 1W2KT 2CMRL 4P4RA 3P0YL 1P7KB 3U7WH 4MLSA 5HVHB 1PKQE 2R2BA 5DHVA 3SY0B 4XPAH 4TOYL 1KCUL 4MSWA 3ZE1E 4MNGA 1T89C 3ZDXE 3MRJA 5DEGB 4R7NB 4ONHB 4QRQB 2UYLA 5IESH 3UYRH 3VXRD 1CT8B 2VDRH 5K33A 1F45A 3QNXB 2UWEF 2NY2C 1NEZA 5C9JB 2QSCH 2UZIH 5HDBF 5CZVH 3MCKA 4L8CB 3D5OF 3TVMA 2EKSA 2JJUA 3DECA 3SBWC 2J7LA 4JM2D 2DBLH 4GAJH 1A7QL 1AC0A 5MEQA 2QQNL 4XVSL 1O5DT 3SKNB 4X6DF 5LCVH 5AWNL 3VXNB 1KTLB 2HFEB 1F6AA 4OZFH 3IYLW 1RJYB 1A0QL 1CFBA 2B2XH 3GJEA 1A7PH 1QZ1A 4QT5B 1BEYL 3GUTB 4S1RH 3JTTA 4HQQL 5DRXB 3C6LB 1A1OA 4HBCL 3UTQA 2Y6SC 2EIZB 4HKJB 1NCTA 3STLB 3O3BA 5CKAA 5ESQB 3O2DL 5JNYA 12E8H 2LVCA 4AM0B 1D9KB 1WZMA 2V2TB 4R96B 1YNKL 2OZ4H 1AGEB 2B7DT 2R9HC 4P4KD 1R0AH 1QBLL 1S5HA 3TPUB 4YK4B 3P9LB 4L9LC 1F2QA 4C57C 1E4WL 3I6KA 3RNQB 5TQ0H 3DVNA 4J7RA 5F3BB 4LCYB 4PJCF 4WFGE 1LDSA 4MA8H 3RWGA 2YPLD 5F1NB 3UP1A 3LKSB 3AU1B 3MUHL 2CKBB 1KJ2B 2VIRB 3IU4L 4HCRL 4NRXA 4G42A 3CH1A 1PVHA 4U7KA 5AZ2H 5EOCJ 5DZLA 3HG1B 3DX7B 4ZXBB 1KGCE 2X4SB 4NNPL 1KLUA 2IEPA 1ZV5A 5L88L 5F96L 4NQDA 2HT4C 3L3IB 4U6VH 3R1GL 1I7UA 3ORJA 1LDPH 5ID1A 3MX0A 1N5YL 1FZOA 1KPVB 4LCCC 3CIQA 3VGGA 2IJ0C 1IQWH 3P4OB 3GSXB 4XPGL 4G8IB 1K3ZA 1CXHA 2FX8H 5C0BA 4JVUA 4Q9RH 1P6FA 4JQXA 5M95B 4S11A 4UILH 5HI3C 3UAJD 4JFQA 4F7MA 4NQED 5DJ8B 3TBWA 4UUJB 1KCSH 5DR5H 2JELH 5I1AA 5IG7A 4K8RC 2MPAH 1EEQA 2C1PA 3KLAB 1R5VB 1LP9E 4GW1B 3CU7A 5DVLA 1ZLSL 3NFPB 1GC1C 2DQCL 1JPFA 3FOMA 5I1CH 4P46C 3WFCL 3QPQC 1E6JH 1S7QB 4V1DB 4UTAL 2DQJH 2HVJB 4QRSA 4G8FA 1N8ZB 3KHQA 5F1KC 5CJOL 5GZOD 3B2UC 5IOPA 4HUWB 2PYED 4JG0L 3UXFA 2ITDA 4CVXA 15C8H 2NY2B 5GSVB 4RMQA 3CAFA 5C3TA 2QR0B 2X70B 1CQYA 3KPSA 3MV7E 3V5DA 3VXSB 4CUCA 4FP8H 25C8H 4RFOH 4DK3A 4LLVA 3SGEH 5AZEH 2AV1B 1TETH 2VZSA 1PG7H 4J12A 3BPLB 3QA3A 4R4NC 1FYHB 4D0DA 5L6YH 2ESVB 3B9KA 1G7PA 2HJLA 4RA3A 1T6WA 3WDJA 3F12A 2ZPKL 5L2KA 3FKUS 3MLVH 3G08A 1AO7A 1M7DB 3E6FA 3LQAH 4RGMB 4GG8A 2CUMA 4KJWC 5DLMH 3MRBA 4L3ED 1TVDA 3CVHB 2Z35B 2LAGB 1F2XK 4QXTA 3KXFE 2CSPA 4IRSA 1X7QB 1BJ1J 1OAQH 4Z78B 1PY4A 4F37K 5BS0A 1HHHB 4PRPE 1S7WB 1HNGA 2HN7A 5I8CB 2VLRD 4X6DA 5ITBH 3OJVC 2C7UB 1TFHA 3AAZB 1SM3L 3LVEA 1MCJA 2GSIB 5HHMD 4L9LB 3V2AR 4F15B 1RZ7H 3IGAB 5IW1B 2Q76B 3QXWA 3A67H 3O45B 1Z2KA 1KPUA 1U8NA 4DWHA 4KKAC 2EIEA 5FB8B 3K2UL 2B0SH 3ZKXC 3D39E 3SN6N 5JIHA 1FPTL 2DIBA 4I77H 5F7EL 5KSUA 2R0WH 1FLTX 4ONGL 4P2CG 4JCMA 2VH5H 2FATL 1WTGT 1JJUA 4PUBL 3RVVD 3MRPA 2F8OA 5C0AE 2BXYA 4IMKC 2QHLA 4J4PA 5FOBA 1CBVL 2O61A 2OX5A 3I50L 1FNLA 3QUMH 3WXVH 5I1EH 2Q86A 5I0ZA 4OQ1A 5I19L 2FX9L 4KK9C 3QQNA 3CLFH 3MPCA 1FZMA 5JOEA 1T2QH 1J1OL 5TDOB 4LNRA 1ZA6B 4LCCB 1JN6A 4FG6D 4UDTB 1S9YA 3MLPA 3MUGA 3FB7B 3MYJA 3ARGD 3MOAH 3MMEA 3VRJB 3T2OA 4HUNB 1CGUA 1DBJH 1F3JB 3TNMB 1B9ZA 3BN9D 4RGOL 1BVKB 3T0VA 2AJZB 2BSED 2DTMH 1ADQA 4UT7H 4ELME 1U2CA 4YHZH 1JYNA 5ICXB 1HN1A 4Z7WF 1PFCA 3HRZB 1BD2D 4JO4H 3QDGE 5J3HC 4H8WC 1I1CA 4AEHH 4KTYA 4YEEA 1L6XA 2AKRA 2IH3A 5AG8A 5BVJA 3T09A 2WUBH 4P46B 1NGYA 1I9JH 1K8IB 1CICD 3TEUA 5E08L 3D85B 3KNBA 3IRPX 1G7MA 4AT6B 2HTKD 5IB2A 4AMKH 1FVCB 1OB1A 1XGQB 4WENB 3MRDA 4QXGL 3IDGA 3GKZA 3U0PB 1MAML 4OLXL 5BO1H 3AS2A 4JY5H 4DJMA 4PJ5A 5ALBH 2V9QA 3MJ9H 4JO1L 4OD1L 3CXHJ 5HYSB 1NCNA 3IDMB 3F7RA 4DUVA 5DD1H 2EC9U 3V52L 3GGWA 3RUGE 1P53A 2CDEB 5CJQL 1HQ4A 5CP3A 4DGYL 1UJTA 4KAQL 3TC9A 2OI9B 4DVBA 5LGHH 3FCTB 4JFDB 4P9HL 3C60A 2VJXA 5C08A 3OAZH 2NYYD 5IMOA 2BVUA 4X6CB 4QNPF 3WBDA 1K6QL 1ORSB 4YHYC 2PW2A 4ODTH 4Y2OA 4F37F 4LSUH 4PJEB 4M00A 3VI3E 4G6JH 3D0VB 4J1UB 2Y06H 1DUZA 1FH5H 3WJLA 3KYMB 5J89A 1LE9B 2XN9A 1KLGB 3WUWB 1CR9H 1KPRA 3QPXL 2EZ0D 1SJVA 2EYRA 5DQ9B 2MQ3A 4K3GA 4NGHH 3HE6D 4KHXH 4PLJD 2W9DH 3C5ZC 1WEJL 3L3DB 3MOBH 5JOPE 1P7KA 2R15A 1OAYH 5D7LE 1XGTA 1A1NB 2D03L 2VXVH 1Q0XL 2OJEB 4Y8AA 4KK6D 1JWUA 4JFFE 1IKNC 2EXYD 2NY1C 3QNYB 4MGXA 3X3GH 1JUFB 4G43A 1AQDA 1CD9B 1TQCB 4JPIA 1IM9D 4ONHA 1QA9A 1UXWB 1BQHA 2J88L 5DRZA 5GRZA 3OJDB 2DM2A 3CD4A 1RZKC 4ZFOL 5IW6B 2WV3A 3U7YH 1F3DH 4NUJB 1J12A 1AC6A 3QUXB 3P3YA 3B5GA 5DYOB 4X99B 4M6OH 3SKMB 3FQUB 4QHUA 4ZNCD 1A3QA 2JB5H 3RI5K 1AXIB 5LQBH 4WV1A 1F4WL 2HFEA 3DUSB 4ZPVA 4WO4C 3WKNA 3G5VA 4PV8B 3DV4B 2FJFA 5DUBB 1GYAA 1MLBB 2R0ZH 1IRAY 3C6LA 5B3JE 2CLVB 3PWUA 5SX5K 4O2FA 5C0FA 3L7FB 4L1HA 3O2VL 1AFVL 1FIGL 1HH6B 4NQCB 1U8HB 3GNMH 1ZLVK 5HYJE 3TA3D 1FVEB 1JNNL 4MD0B 3OF6D 5CGTA 1A6VL 2W38A 1ETZB 1C1EH 2Q7YB 4JFXA 3P9LA 4Q2ZA 1TITA 4AG4H 1U8PB 2VDOH 4H20L 4IM8A 5EUOA 5F6IC 3BQUA 4RGNE 4MD4B 3MLSL 5DRWB 4W81A 3QEHA 3CFBA 4Z7WA 4GRLD 3QIBC 3IKCA 1PYWA 2W9EH 4JO3H 4LPUA 5T1KA 1S9XA 4ZD3H 3HG1A 4RWYH 1B4RA 1SEQL 4GAGL 4KU1A 1T6VN 2GTZB 2BHUA 5I1GH 1RK0A 3S36X 5ENWA 2YMXH 2VLLB 5HDOA 1S5IH 5FDYA 3VXQB 2HKFL 2RFXB 4X9BA 3RGHA 4M4RA 5DHYB 4YHYB 1X5IA 5C70A 2ZOLB 2CRYA 2V7NB 5FXCH 4YDKL 3FMGH 3QUZC 3THMH 4ZAKA 7FABH 3BIAX 3GMMA 3P4OA 3JBG7 5SWZE 3QDJB 1S7VB 4PJHB 3RWCB 3P9MB 2EKJA 3A6OA 5F7LB 3TO4B 5IKCB 3OKMB 2ICWI 1RZJL 3E1F1 4XTRC 1IC4H 1QPXA 4KKBD 1CDJA 1L0YA 4K23L 1TZHB 2X4QB 3SCMA 5ID0B 2AK4D 2DL9A 4M61B 4JB9H 1A6UL 5FOJA 1II4E 3VWJD 3ULVH 4N0UA 3KLSA 1ODAA 4LK4A 2D3VA 4NO0B 5EU4B 2NY1B 5CIPB 5FKPA 1GPOL 1Y6KR 1NBZA 4XT1C 3N1MC 3ARFA 3EOAA 4HUWA 5DO2D 1QTYT 2BNRE 5EOCH 4GKSA 4AY0A 4HULB 4X6CF 3QI9D 3VXSA 4C55A 5FV1L 2W59A 1U92B 5HVFB 4PJEF 3LQZB 1MWAA 3IDNA 4PJAB 2EE9A 2G75B 4PJ8D 2X4RB 2W0KA 3EOBA 5D7SH 4TUOB 3UJTL 3RI5F 1CGTA 3ARWA 4XB7A 2P7TA 5D6DC 1ZT4A 3HB3C 4PJXE 3VH8G 3VJ6A 4NZRL 4WO4B 3OKKB 2DJSA 1M7DA 1OWWA 4LLWB 1EVUA 4LQFH 1NFDB 4PJBB 4CBPA 1XCTB 1KJ2L 2CKBL 1PDKA 4BSJA 2DBJA 1P4LB 5EO1A 3QZWG 3ARSA 1N6QH 1CDBA 3KYKL 3ZE2E 5DQJA 2LV4A 4G8GB 1B6DA 1HZHL 4HFWB 4YR6A 5CS7A 1KFAL 4P23D 3PHQB 3G5XA 4RAVB 5T5FL 4HV8A 3ARED 4XVTL 3NBNA 4OFIA 1WFUA 1AE6L 2RGSA 3LKOB 3U79A 4JM4L 1E27B 3U7AA 5GS3A 2X9WA 1KCVL 4E41E 1O7SA 2Y25A 3O4LD 5E03A 4LHUD 3QULA 5F6IB 3DIFA 2R69L 2ICWB 3NCCB 3PHOA 4YFDB 3TH2T 3QIBB 4P9ML 4JKWA 4G9FD 4WCYL 5D72L 3P0VH 1N3NA 2ZUSA 2YRPA 4XC1L 2GSGB 4K94L 4LIQL 1T22A 5IFHL 5I18L 2EDYA 2XZCH 4LHQB 1RV6X 5TQ2L 3HNSH 4MYWB 4C58B 2RHEA 4QHNA 1OTTC 1FBIH 4LPXA 1NCDL 3T08A 3PWPA 1I4FB 3CNKA 1YN6B 3ULVE 4KY1L 3I3DA 2F53E 2JE8A 4TN9A 1HSAB 1NGQL 4Z7VB 3UJIL 3EDDA 4NFDA 2X6MA 3UTTE 4OGAC 1ZANL 1UADC 5TF0A 4M62L 2H9GB 1WT5A 4DZ8B 4UV7H 3QUZB 1UQSB 1I3GL 1RSFA 2Q8BL 5KSVB 1VFBB 3QT2A 3VRJA 4PRIE 3FQTB 3IKKA 5HHVL 3RWJA 4M1CC 5HJ3B 1BJ1H 3TNMA 1KYOJ 1MAKA 1JFQL 1FL5A 4KKCC 4OGZA 2A9ML 3AROA 3WSQL 4M8QB 3MA7B 1VEMA 5D2NA 5ICXA 4ORGA 1MIEL 4L3CB 3JWOC 1DBAH 2ZCLL 5KSAD 3B43A 1WICA 1YEGL 1YYLH 3WE6B 3CVHL 3OHXA 3L3KB 3QO0A 3FAXA 1MFCL 3CJJA 2H26B 4CMMB 2DM3A 1I9IH 5DMYA 3RKDD 4G7YL 1CLYL 1FVCA 1PAMA 4AIXA 3HCVA 3WXWL 2DQEH 2P42B 5ESAB 1TJHL 5BVPH 1JI2A 1TMCB 2CK2A 2PN5A 2F54A 5HGHB 1IFHH 1MCCA 3DLQR 1NBQA 2HRPL 3NZHL 3C5JA 5EO0B 3HI1A 2AXGB 2DLHA 4PJHF 1S9WA 1VACB 3NCYP 4MA1C 1U8LA 4HK3N 4O2CB 2JJTA 1MAJA 2VISB 1QFUL 3S34H 3QEQE 2H6PB 2WUCL 1T66C 3MRNA 3FN0H 1BBJB 4JZNB 1INQB 2OJZL 1N59B 1A47A 2Y36L 3HA0A 8FABB 5D1ZA 1K8DB 5DJAB 4XGZB 3KHOA 4U31A 3W39A 2NY4D 1OWRM 4HH9B 2ORBL 5LBSH 4OAWA 4HUVB 4OFDA 3DVGB 3EDKA 1J0HA 1D3CA 4XVJL 1CFTB 1JK8B 1TIUA 5TDNB 1AGCA 4Y4KD 3LPGA 5C09B 1J8HE 4FZEL 1MJ8L 1NLBH 4G3YL 3SGKC 2FZ3A 1MF2H 2D0FA 3BP6B 1FNGB 2P5WE 3ZSSA 4G6KL 3Q2CA 1NBYB 1P5VA 4P2RE 4BFGA 5HPMB 4H1LG 4PJAF 2Y07H 3QUYA 4CU6A 4L8SC 1KNOB 3GRWH 1OP5K 3O8XB 4PJGE 3SDCD 4K8RL 3QNYA 4QOKA 3PQYA 3Q5TA 2Y9RT 3MRCA 2ERJC 5E9DD 1H15B 1NFDF 1MH5B 3OKEA 2AV7B 4PJBF 5DD0L 1BOYA 1IEAB 4JN1H 5FM4A 1GC1L 4TRPL 4YXLH 1V3MA 3DXAD 4DW2L 1JF1B 1OLZA 4BK5A 3U4EA 3HZKA 1EK3A 1D5XB 1U8MA 3U30B 4Z8FH 1S7RB 1UKTA 3FONB 2CH8A 3L95B 4XWOD 3PL6D 3O81A 3IU3B 3U4BL 1UZ8B 3GSUB 3FQUA 4DZBB 1WWWX 4LRNL 2D31A 1NDGA 3DUSA 5ALCH 5DFWH 4OZHE 1AY1H 3I2CH 1M7IA 4Y4FC 1GGIL 3NN8B 5DUPH 3C6SB 4FQIL 1H0DA 4PB0H 1MCRA 5I1HH 4NWUL 2P5ED 4ZSOE 4OB5L 3X11B 2L7UA 1DJSA 2VDML 5SV4A 3OB8A 5FK9B 2R8SH 3GKWH 1MY7A 1QSVA 4IOIB 3C8KA 1UVQB 1SYVB 5DK0B 3EYFA 3W9EB 3PWNB 3G6JB 2AJSL 4MVBC 5GIRA 4AQ1B 5T1DL 3T1FA 4V2CB 3O6FC 4I18A 4JO2H 1U8PA 2EIBA 1A64A 3DVIA 2BNQD 3L5HA 1T2JA 3ZYJA 4Z7VF 3ZKMD 5FF6A 3BZEB 4FTVE 4TTGA 1JZ2A 2ZUQC 1SEBB 5A1AA 1I3VA 2ZSWB 2UUDK 3BGMA 5TPWH 4PB9H 5FHAH 2OTWB 1KN2L 1MPAL 1RK1B 4D8PA 4X4YB 2R1YA 1T0MA 4ZFZB 1KIRA 3H0TB 3ECBA 32C2B 1X5GA 1T5WB 4ODVH 4L8DB 5IGXL 4WUUA 1ORQA 4JY6B 4OCYL 1T1WA 3TO2A 4MA1B 4PJFE 4WTXA 9CGTA 4G80B 4PRHE 4UIKH 1YJDC 4MA7H 4RFNC 5JW3L 1ZVHA 3H2WA 2BRQA 4R4FH 5DHYA 5DUML 3CDGB 1CFNA 2VKXA 3TBVA 5ACZA 1HHIB 1ZT7B 5T3ZL 3HN3A 4TOYH 1IAII 4J3SA 4CVWA 1NPUA 2APVA 4Y1AD 1NMBH 3ISWA 3OBAA 4WHDA 3G6AB 1CXKA 3NGBC 3BE1H 1MRFL 2NY6D 4PJHA 3MROB 4MJ5B 1I9RL 4PS4H 3TO4A 4YDIL 5F1OB 3UZQA 4OTXL 3VXME 3IJSB 5EU6E 4M61A 1A7QH 5FYLL 3DO7A 4XVSH 2Z31C 3WS6A 5JO5B 5LWYL 4JRYA 4PTUB 4WHTB 5CSZA 1W72B 5AUMA 4DKEL 4L8SB 4NO3B 2NTFB 5EU4A 1J9CT 2VQ1B 2ERJB 2A9NL 3MLZL 4KC3B 2D4DA 4L29A 3WHXB 4JN2A 1DUYA 1UA6L 4BUHA 1RY7B 4H8WL 3BPOC 1BEYH 5D7IE 1CXEA 3ZDZF 4WDIB 3S96B 1JZ8A 1JPTL 4NP4H 1LE5A 4POYA 1MCKA 2APXA 5KANG 3K8KA 4HK3J 3O2DH 1IAIM 5KVFL 4Z7UB 3MZGB 2PKDA 3DMMB 3MBED 1BVLB 2AP2A 3W0WD 5KSBA 2NW2B 3VDAA 2N4IA 3T77B 1R3HA 3GO1H 1YNKH 2IWGA 1QBLH 5D7KE 3IXAB 3MTRA 1B4JL 3HR6A 3CFEB 2X1OA 3VFRB 4P4KC 3FB8B 4MMXC 1FFNA 2YBRB 3P11L 3H7BB 4ISVA 1UH4A 3K2MC 3JUYA 5DA0B 3TJEH 1JI1A 2ZKHL 2HKHH 3RDTD 1YEKH 1LMKA 4MXWH 4OCNC 4GRWB 2AJVH 5E1AA 3IU4H 5DJYA 4M5YL 3TLRA 1J5OL 1YNLL 4D9LL 3QWQB 1YEDB 2EO1A 5KZCB 4NNPH 1ZA3A 2XKNA 4YHNB 4RMTA 5F96H 4MHHI 1X4ZA 1MUJA 4HJ0C 5J11B 3R1GH 5DHVH 3QR2A 5JXED 2BVPB 5C0IB 1SVCP 5EBMA 3TYGL 1N5YH 5JOFB 4XH2A 1KB9K 3BX7C 5E2VH 3DUUB 5I75C 2V5MA 3OZ9H 3HMXA 1C7TA 2VR4A 2F19L 4XPGH 5GHWL 5FECA 1KN4L 3FO2A 5SX4I 2FHBA 1XGPB 2AEIT 4OCWH 4XXCA 1CFSB 1EUUA 4E0RB 4Y4HC 1EFXD 1INDH 3K8MA 3GDBA 3UAJC 1HSAA 3BD4A 4ZQKA 3SDDD 4RFNB 4DAGH 1JGEB 1RUKL 1A8JH 2IALB 3HZYB 4GBXD 4LVOC 5DJ2B 5MENB 4DZ8A 3WFCH 1RZKL 1N6VA 4HKZB 4X5LA 1VFBA 1JRHH 3FQTA 3G6JF 3O3DB 5CJOH 3Q5OA 1A14L 3K1DA 1BQLL 3CPLB 4JG0H 3SCMC 1JGUL 4TPRL 3ZHDA 1G7IB 2FB4L 5GZOC 3FT2A 5J1AA 3N1FC 4CVZA 3VXRB 4W4NA 2XTJD 3BSZL 5E8NB 3EDEA 4XCFH 4HWNA 1FSKC 4L3CA 2PCPA 2Z31B 1MI5A 1QSEA 1WJ3A 2I9LA 1DE4A 5CJBA 2R4RL 4HJGA 3QWRA 4JM2B 4DN3L 3QO1A 4NKIL 2ZPKH 1KTKE 5FUCE 1CGXA 4QRRE 5FO8B 2H26A 3WIHL 3ROLB 2X1XR 5D5ME 3D0LA 2BVOB 1VFAA 4HDIB 4LPCA 1KT2B 4P3CL 5ESAA 1U91B 4OF3A 3NTCL 2V7HB 5E2WL 2R39A 4C56E 2A73B 4N90E 3C09B 5HGHA 3IS1X 3VFTB 4CVUA 4U1HB 3JV4A 2AI0L 1JV5A 2AXGA 1D5BB 1SM3H 3M1BA 4R0LB 4XAKD 4WU7A 4P4KB 1DFBL 4MNGE 4HW6A 1HKLL 4I48A 4PJIF 1GAFH 3I84A 1T1XA 1LO5B 5GRVK 1QKZH 3A6BL 1KUMA 5I1JH 2GHWB 1GZPB 3K2UH 4MCYA 1EBAA 4HS3A 1FPTH 5F7EH 4Y2DA 2XWJA 3WDHA 8FABA 1NGWB 4O4YL 4KI5E 2EH7L 5DJAA 5FGBC 3SJVE 1AGBB 2YPLB 4BH7A 2H41A 3S3SA 4XC3H 4U33A 4HUVA 1CBVH 5D8JH 5DVKA 3RVVC 4IOFD 4ELKA 3B3IB 1JK8A 4JGMA 3PWVA 3B9AA 3LRGA 2EDLA 2V17H 2I25N 5I19H 1GGBH 3VMOA 4OF8A 1J1OH 3T2PA 3QDMD 2X4UB 3ARDA 3E6HB 3K74B 1EHXA 4Z7UF 3PIQB 4HK0A 3IXTB 4N5UA 4Y19A 5I75B 1LK3L 2F9BT 3REVB 2DDQL 4OIBA 4YBQC 4LCWB 4NQXA 3STZB 4FG6C 5TFSL 3O8XA 3KPMB 1MFEL 1T7WA 5CCKL 3VWKD 1I7RA 2VABB 4MNQD 3EO0B 4RGOH 1QEWA 3MLTB 2AV7A 2CK0H 5DK2A 3VMPA 1IEAA 2DM4A 4WFHE 5I6XB 3ULUC 3D3VD 3X3FL 1JF1A 3BN9C 1JMXA 2ZUYA 4HKBA 3RIAK 4NQEB 4GRWF 1S7RA 3FONA 1WIUA 3L95A 3K0WA 3UEZA 3CFJA 3IU3A 1UZ8A 2AEQL 3RJDA 5E08H 2XWBA 4KZDL 4NKQB 5B22A 1M7XA 3GMPB 1ZS8B 3QHTC 4MJIE 3D18B 5TJWK 3O0RL 2BMKA 4J3OC 1MAMH 1U2HA 4OLXH 4PRDB 2UVFA 4KJYA 2PYEB 5HHXH 4JO1H 4OD1H 4O51A 3ULSB 4X9HA 1DQLL 3IETB 4WU5A 4YIQA 1FSKB 3VFSB 3V52H 3BO8A 2V2WB 5EOQL 1VGKB 3HZMB 4MDJB 5IROC 1NCAH 3GSVB 1U3HA 4I3RL 1UVQA 3F5WA 1SYVA 4WW2C 3GBNH 1DZBA 3FQRA 4NUGL 3AY4A 5M94B 1O7VA 3ALXA 2YUXA 3V4UH 1T5XA 5C0BE 2W65A 4PJ9C 1NMAH 4OM0L 5F9AC 3HI6L 5FA3A 4L3EB 3NPZB 4RMRA 4MJ4A 5BRZA 2E7BA 1KF9B 1LNUA 2NYYC 2BOCB 1LEKA 1QSFE 5DEFB 3JZ7A 5D71H 2FYYB 3GJFA 5AYQA 2OTWA 3LEVL 1TZIA 3VD3A 4NRYA 5F3HA 3LY6A 5H8DA 3PNWA 4LU5H 4QRTA 1OAUH 2YRLA 3LKPA 5DS8B 4MB3A 1IZJA 3QPXH 4FXKB 4JY6A 4CRPA 4HGWB 1P84J 1Q9LA 4EXKA 5HHMB 1R3LB 3B2VL 2OYPA 1MELA 5T1LD 4MXQD 3HS0A 1WEJH 1A9EB 3FFCA 3BVNB 4HXAH 4XNZC 1QACA 4HS8L 1CK0H 4KXZI 3O3AB 3CDGA 4AEFA 1X3DA 4PLJC 3T8XB 4RFEB 2D03H 4JM2F 1NANI 4UAOC 3SGDH 1Q0XH 2H2PD 3DV6B 7CGTA 3T0EA 5HGBA 3RWEB 1Z0MA 3ZKSD 2R1XB 3G6AA 5L2KE 2DQUL 5IF0A 4KK6C 2EXYC 4MJ5A 1AO7E 4PJIA 1OHQA 5HYSG 1C12B 3QUYC 2JIXD 4JCLA 5C0GB 5E1HB 1V8HA 1JYVA 2ZSVB 3BW9B 5HDBE 4Q0XH 3NCJL 3L3OA 3LH2L 5F88B 2HMID 2WINB 4RIRB 3TV3H 5KN5B 2FGZA 1GGCL 3MO1A 4HAGA 5BS0E 3T3PE 4F3FA 5H35B 4M03A 4X6DE 3ARGB 4S1DC 3UPAA 3WHXA 3H6JA 4DK6A 3JWOL 4NBYB 1EMTL 4J3TA 4QCIB 4H5SB 3RIAF 5F44A 3GSWA 3U2SB 4NHUA 3DSFH 4JFHE 3RPIB 2G2RB 5DQDH 3RVUD 4PY8J 3H42L 2ED7A 1VSCA 4E5XA 2AJXL 3DMMA 3SPVB 3ZT6A 4AK1A 3SEPA 1BD2B 3EOYG 4BA8A 1A6VH 3WUWG 4PIRF 4NN7C 3KJ6L 1G6VK 5FUZL 3VFRA 1GZQA 1R3JB 5BZDB 1CICB 4H20H 1DBML 1FV1B 1KIQA 3H7BA 1AGFB 5JZ7C 2V6HA 1IM3B 1I7TA 2VLME 5EIVA 1AI1L 1IEHA 4HIXH 4QTIL 4PY7A 2R2EA 4EI5A 1W0WB 3S35X 4K7PH 4RISL 3IDIA 4WHYG 3UDWC 4RAUB 1FZJA 4GRLC 4I18C 1TVBB 2VLJD 4WW2B 1WZKA 3KPQB 4MDIA 3JV0A 1SEQH 5EN2B 4GAGH 3WCYA 4X6FA 2Y7QB 4X0KA 2X1WL 4U1NA 4EIGB 2O93L 4OZ4B 3HAEA 2BVPA 4JR9L 4LCIH 4HUKB 1FGVH 5JMOC 5EZOH 4NJAH 1H3TA 2HKFH 4I2XB 1N2RB 4UZGA 1NAKL 1CGYA 5IHUH 3SDXB 3LSOA 3DUUA 5EULV 1Q0YL 5FO9B 3LRHA 5FV2A 2QADD 2A6JA 3CVIH 3GSNB 3M17A 5IW3A 1OM3L 1H8SA 4Q9BA 1HXMA 3QWOA 1DP0A 1R5IA 4I0CC 1JNLL 2DQFA 5A2JH 4J3XA 1N7ML 4TUJB 3VRIB 5DRNB 1RZJH 1DANU 3BAEL 1W72L 2UY7A 4K23H 3UCRA 3QHZL 3RBGA 4MCZB 5DC9B 4XNZB 1C16A 4PJ5E 1A6UH 1FGNL 1TNNA 3HE6B 1EHNA 3TBTB 1NMCC 3EJYC 1IVLA 2GY5A 3D69B 3MFGB 4ZFFA 3I6LE 4UAOB 4WEUD 4EBQL 1S7TB 4NZTL 4JANB 1V5JA 3ARBD 3VWJC 1GPOH 1JF6A 3BZFA 4UB0L 5E94A 4KGLA 4Z5RA 3I6GB 2R2HA 4L4VD 5GGTL 4LLYA 4GOSA 4X4MA 1U9KA 5CKGA 1FYTA 4MB5A 2B4CH 3QIUD 1G7IA 5ISZD 1IM9B 5JORB 2VXQH 4POUB 3MLWL 4I0PD 5DO2C 3RTQD 1KB5B 1ADQL 3U36A 5C08E 4D94A 4XP6L 3QXTA 3REWB 4WWID 3QXAA 2C3GA 2ZCHH 3QI9C 4R9HA 5I71C 1M6OB 2KH2B 1L7IH 3BWAA 4JM2A 4OD2B 2ATPB 2VDLH 3QEUB 1PLGH 5FO8A 3F6IA 4D9RD 5GRYA 5A43C 1H3PH 2EO9A 3MLUL 1YZZA 3SQBA 4R8WH 2CKBH 1KJ2H 2JJSA 1MVUB 4BQ9A 1UZ6E 2IH1A 5IB4A 3CDCA 1ITCA 1UYWH 4QY8A 2CUHA 1PGRB 3RAJL 5F8RC 3ESUF 1WQVT 4ZYKA 5JR1L 4OCLC 2HT3D 1IAIL 1QQDA 5T5FH 5BMFL 4LVHC 3DBXB 4OGYL 4IDJL 5HGDA 1H8NA 2VSDA 3TA3B 5DTFB 1D5BA 5EO9B 4R0LA 2C1OB 1UEYA 1OSPL 1J0ZA 3AREC 1NGZB 1KCVH 3T0XA 4N5EC 5F6HI 4TVSa 3H3PL 2R69H 1GZPA 3CDFA 2OQJB 3ET9F 3KPNB 5HHNA 4PP2A 1P9MC 4JRWA 3NCMA 1BGXL 4KMLB 5D72H 3WLBA 5HYFA 4GRLB 4XC1H 2OK0L 4LIQH 5IFHH 3H3BC 3O6KL 5TQ2H 1KJVB 1YJDL 4HFUH 3DARA 5M7QA 5MEPA 5IUSA 4IRJD 1EJ6A 4JFPB 1NCDH 3QJFB 3UMTA 3MR9A 3WJJC 2A6KB 3NA9L 5IVXB 4KY1H 1BPVA 3C2AL 2OL3A 1NGQH 1OT1A 4G8EB 3MJ8A 3NMEA 2P8PB 5KG9B 3ZHLA 1YMMA 4PYGA 3OJMB 5F97E 4EUPB 3LD8B 1OAXL 2FX7L 3L5XL 4W4OC 1XT5A 3MCLL 5DDHA 1DSFL 5GRVL 1WFTA 4PGBA 4YNYB 5HHVH 2EXWD 5F93C 4ZTOH 5DD5L 4L4TD 4NOBA 1Q8MA 4N9OB 1QVOB 4NQVB 3EO0A 1JFQH 3V5KA 3MLTA 1QBAA 1RHHB 4Q9CA 2GAZB 3V7MA 2X4OA 1OGTA 2EECA 3E8UH 1IT9L 3LPFA 1MIEH 4X9FA 2L4OA 3TIDB 4WW1A 1UWXK 2ZCLH 5IMLB 1NMCB 3RL1B 3GMOA 4Z7WE 4CNIB 3LN4A 2AK4B 2YHGA 4P3WA 3CVHH 5KSAC 1MFCH 4PRAA 1NC2D 3VWJB 4FQLH 4H26A 1DQQB 1BVZA 1R3IL 5IQ9B 5EZJA 3HG1E 4G7YH 3GMPA 1ZS8A 4QWWD 1PKQA 1XCQA 2EDTA 1OTSD 5IR1B 2KQMA 5JOPD 2OP4L 4MS8C 3RKDC 4HLJA 5ADPL 4HC1L 3T0AA 3SDXF 1HHKB 5TF1L 4YHKH 3VFSA 5HSFA 2V2WA 3QI9B 3H9ZA 3K81A 2DLTA 5I71B 4MDJA 3A6CL 2KQNA 1EXUA 4NSKA 4YFLI 3H9HA 3I3BA 4BFIB 1GCFA 4PJ8B 4N0RA 1QR1B 1Y0LA 5C8JA 1UKQA 1FFOA 5BW7A 1G7JA 3QSKB 1QFUH 2AW2A 4HX1A 2Q6WA 3GBMH 4NM4L 3SO3C 1KJMB 4KVNL 3EUUA 2Y36H 2WIMA 5CEZH 4LKXB 4FQQA 1NGXB 5F1IA 2NY7H 3Q48A 5DEFA 4QNPE 4DVRL 3JUZA 4LVHB 4G9DB 1F00I 3AVEA 5C6TH 1JZ6A 5KW9L 4XVJH 3LZFL 3AREB 1K4CB 5DS8A 2NXZD 2VLRA 1JHKL 5F7NC 1MJ8H 2C4FT 4G3YH 3BPNC 4G5ZH 1R3LA 5F89A 3TN0D 4LLMB 1BP3B 3BYTA 3TBSB 2YD2A 4LF3B 1A9EA 4ONFH 3BKJL 4PP1D 4LHUB 3JV6A 1XIWA 5D1QD 3BHBB 3VXSE 2VXUL 1NH6A 1LD9B 2UVEA 1XZ0B 4XPTL 1SYSB 5D7JD 4P2QD 3ESVF 4MZ3A 4K8RH 3DETD 4WNQA 4G9FB 2WBWB 2ESVE 3RWEA 1JHTB 4JQVA 2YWZA 5F9DC 5EBLB 5CBAB 1GC1H 1HI6B 1JCKA 4FFWD 4UQ3B 3U6RA 4L5FL 4LAQH 5C7XL 4GAFB 3VGFA 1K2DA 4PGEA 5BOZG 5T5NF 4NZJA 4EI6A 5I1LB 1G7LB 3NIGF 1RZGA 2C3WA 1AP2B 1J0JA 5F88A 3U4BH 2BRRL 2NZIA 3STBA 4LRNH 4EQ3A 3OGCA 3HLAB 4XP5L 1T21B 5H35A 1JTPA 3N1GC 2VC2L 5B38A 3RA7H 2E6QA 2VWEE 3BKCL 5LG1A 2BSSB 1P7HL 5J6GB 1CFVL 4NKOA 3V0VA 4NIKB 5CILH 4JDZB 4OB5H 4Y16D 5IWLA 3E0GA 1K4DB 3V6OC 1J11A 3X13B 1QUNA 4Y5YC 1JGDA 3JV5A 5HI4C 3VCLB 1Z6JT 4WJ5A 1BAFL 1I85C 1BBDL 5E4EC 1MWAL 5KSAB 4F7CB 3QQ4B 1LP9A 4YHML 4GMSH 4X9IA 4M7ZC 4OZFA 4JFOB 1N5AB 3MGOA 1CICA 4FXGA 5I73B 1MRCL 5IVXF 5CEZE 3FRUB 4ZO7A 3DI3B 1FV1A 1W0VB 4X7TB 1IGML 4U1JB 5KBNC 3PWPE 2JCCA 3PG2A 4MD5A 3PP3K 3I75B 2ZJSL 1FNEA 1NEUA 2C5DC 3AY4C 3ZKMC 1MPAH 3O6LL 1E4KA 1U93B 4M6ML 4JE4B 1W0WA 4Z0BH 4U6XA 4DTGL 2JJVA 2D7TH 1LHZA 2OZ4A 1GGTA 5D1XA 1JWMA 1X4YA 2BNRD 5HYQA 5IGXH 1S8DB 5K9JH 4WWKA 5E6ZA 5SX5H 1HQRA 1GGYA 3DYPA 4XNQB 5EN2A 1CU4H 3QIWD 5CEXA 3FFDA 1LO2L 4XX1E 3BZDA 1FAIL 1ZLVH 3HPJA 1H3GA 2JLLA 4XNMB 3SO3B 1VEOA 4LSSL 1BOGA 5HHPA 5DJCB 1N2RA 1G84A 2AXFA 5IVNA 3V6ZB 2MFNA 3QNZA 4YO0A 43CAB 5C0CD 4LNVA 5EWIL 3LKQA 2Z9TA 4PGZA 5I76B 3KXFA 3OXRB 4OIIL 2DD8H 4PRPA 2NY4B 5INDA 5L7XL 4V1DD 1AHWC 5DRNA 5GRUH 2E8ZA 3GMQB 4OTXH 3IFPB 4J6RL 2NY6C 2W92A 3RQ3A 5CD3B 4Y4KB 1A7RL 2ICEB 2EDHA 5AAMA 1UC6A 4FQ2L 1JZ3A 3MODL 5JQ6L 5GRXG 5FYLH 1XMWA 1YYML 3RY4A 1FG2B 2PTTA 3HE6A 4ZUVA 1F4XH 3UTPE 4DKEH 3T04D 3ULUL 3V6FB 3CX2A 1M71B 1JTOA 2FLRT 3MLZH 5IFJB 4NT6A 3U83A 3OXSB 4P59H 1E4JA 3TFKD 4H8WH 4NQSA 3SDCB 3QHFL 4K3DH 4P2YA 3BDYL 3ARXA 1EEYA 1FL3B 5E9DB 1PG7X 5BXFA 5DD6B 4JFDE 5JDSB 3N0PB 2ZZUT 2JK5B 4WVRA 5KVFH 3S98A 2FH6A 3DXAB 2WNGA 4GKNA 1MFDH 1Q9OB 5F9JA 2XXCB 4X6CE 5JLZA 3C5SB 2DYPA 2X1QA 4PJEE 3MBEC 1B4JH 3GI9L 2E3VA 4DCQB 3P4MB 3DUHA 3PDOB 1JGVL 4XRCB 1OQXA 1WCBA 1S7UB 1VDGA 3BIBX 3P11H 4CADB 1MVUA 5GSRB 3X12B 1MCHA 1KG0A 1QNZL 2BY1A 2NZ9C 3N1PC 3RDTC 1J5OH 4M6NH 4PRID 2P5EB 1RFDL 4YHOL 4KVCH 4D2NA 4D9LH 4ELMA 1ZVYA 3MNWB 4BH8B 3B9EA 3QDGA 2V5SA 4JHAH 1MJUL 2C1OA 2R29L 4OFVA 3Q0HA 1NGZA 3ILQC 3ILPA 1WBYB 4QRUA 1KOAA 1BF8A 3NOIA 3GSNL 4NYLB 2D9QB 3TYGH 2QLVB 5I2IB 4KROC 3L3HA 2O5YL 4XAWH 2HT4D 4RX4D 5JXEC 3FO9B 2BNQB 5IFAL 2E6JA 4ODXA 3T4AB 3DURB 5JHLL 2EDXA 3SKOA 1ZOXA 4MQ7A 2BCKA 5JMRA 3GEWB 5GHWH 3BEVB 3P77A 4YFLF 2VZVA 3RUGA 4GW4B 2ATKB 2W0PA 1RJCA 2VUYA 4J8RB 5SWSD 2E7LA 1ZGLB 1FE8L 3MRLB 1CVSC 2YEZA 4AH2B 3FQWB 5I74C 4NRZA 2QTEA 2MMXA 4WI3A 3QDAA 4AIZA 5HI3D 5CIPH 1RUKH 4U1GC 3R4DA 2KZWA 1CD0A 4LSRL 1V7ML 4UT6L 2YSSA 4LPTA 4U6HB 2I27N 4UV4L 4ZUTA 5DD3H 2K7QA 3SDDC 2WBJA 2BSRA 1DEEB 4B53A 1RZKH 4NQCE 4HIHB 1C5CL 1GIGH 3MREA 4GBXC 2L7JA 1XF2B 4GW5A 4YNYA 3KPPB 1BQLH 1KB5L 1NJ9B 2QHRL 1GXEA 1JGUH 3QPQD 4TPRH 3UPCA 1UJ3C 1AHWB 2VLKD 4O9HH 4Y1AB 5ICYB 1LVEA 2NY6B 5L8JB 3VFUB 1SJEA 1LK2B 5CD5C 3SE4C 2X4TB 3QRGL 1QD0A 5IMKB 5JW5A 5EIIB 3MV8D 2R4RH 4NKIH 1B90A 3B83A 4P99A 2P24B 3WIHH 1J8HD 4R4ND 6FABL 3BUYA 3RY6C 3OGOE 4WUUE 2ILLA 3LRSB 4JFFA 4YPGB 1YECL 4P2RD 4P3CH 5BQ7A 3R0NA 5DMKB 1KEGL 2X4PB 3NTCH 4Q6YA 1UACL 4KJWD 5FYKE 3PJSA 3HC0A 4QYOA 3NIDE 5E2WH 3RRQA 4ZUSB 5F70A 5ADOL 1IKFH 2X4NA 3GMNB 2HH0H 4M1GL 5EPMB 3VXTB 1D6VH 2JJSC 2CKNA 4U1SB 1CE1L 1DN0B 1HH9B 3MBEB 5IV2B 1E6OL 5E8PB 4PJ8A 2RR3A 4NHCL 1Z5LB 1DFBH 1HKLH 5C0DB 5F7WC 3SE3A 1CDYA 4XPHL 5KVMC 2G9HB 3VFGL 1UCBH 4PJHE 2R4SL 3EFDL 1G9NC 2DLFH 1ZT1B 4U1IB 1VKXB 3MJ9A 4OLVL 3PABA 3T1WA 1IAKA 4JHZA 4JZJC 4ONOA 4UDUA 4LKXA 4NKMB 3RDTB 1QYGL 3WFEL 5GS2H 1BFSA 4Z76A 3VD7A 1Y18B 1CXIA 2X2YA 4HWBL 2BSTB 1GRWA 4LGSB 3HUJB 4WFED 4PBVC 4AEIL 1IGTB 4P23A 2IMNA 1CDIA 2ADIB 4X83A 3NZ8B 3VFWB 1MCDA 1H5BB 2ARJB 5E7BA 2APWA 5T3XL 2R0LL 1L7TL 2E6PA 4LLMA 4X5XA 4IIQA 3O4LA 4LF3A 5IM7A 3SDAA 5T3ZD 3RGVD 2P8MB 1JPSL 4KK9D 3EJZC 2GJJA 3DX6A 1D5ZA 1LD9A 1RZIA 3WS3B 1LEGA 4XNXL 4ZUWB 5KSBE 5TFSH 4PJAE 3JWNC 5IVZA 1A22B 3BKML 4F7PA 2DKSA 4MHHG 5C86A 2HG5B 2HJKB 2VXTL 1T04B 3MZTA 4FTVD 1HI6A 3X3FH 3VWKC 4D0CB 2A0LC 2HFTA 4R2GC 1NFDE 4PJBE 4M8VA 4PG9A 1B0RA 4U1GB 1EFXB 4F8TA 1HYSC 4FZ8L 1RJZA 1J1XL 3SDDB 5ICZA 1WAAF 3QQ3B 4YWGL 5CBEB 3HLAA 4GBXB 5GISL 5GXBB 4APQD 5I66A 1RURH 3VE0A 3MRIB 2FIKB 4ODUB 1UM6H 3BKYL 4LSQL 1UJ3B 3IDXH 4PRHD 1UH2A 3O0RH 2GFBA 3O9WA 4XCCH 4GRMB 3MYZA 4WY7L 5BV7B 2J8UB 5SWZA 4OZIA 4JDZA 1DQLH 1OP5H 5CLWA 3LIZL 5I0DA 1JZ5A 2JB6B 5EOQH 4PLOB 1BX2A 5DF0A 4QRPD 2ENSA 3DROB 4ODWB 3N50A 2NXYC 2ADGA 5DXWA 1ZHBB 3CC5A 3VXMD 4O2EA 4TSCL 3FRUA 4L8BA 3RU8H 4OM0H 5H37H 3HI6H 4U1JA 3L3JA 4YX2L 3VFVB 4YGAB 5F7MC 1HHGA 4Z7VE 3S4SB 1A7OL 2BDNL 4HAFA 2EDFA 1U93A 3LEVH 3NFSH 5CJXC 1X5YA 2PXYD 5IEKA 5LGKA 1TJGL 5E8EA 5GPRA 1A6AB 1BWMA 4RBPK 4CU7A 5IP4A 4KJQC 3BEWA 2A6DA 3CLEL 3G5ZA 1NQBA 2G5BB 2ADJB 3FRPG 4MB4A 5INCB 5JQHC 1F8TL 5FKAB 3B2VH 4PJXA 4JAMA 3LKNA 1K5NB 2VOTA 4XNMA 1KXTB 2WZPD 2HLAB 5IHZA 4FMFA 1R24B 3C5ZD 3QFDB 3MRQA 3EO1A 4HPYH 1MI5E 1A21A 1QSEE 1WV7T 4D9QE 1WBZA 1XGYL 2I9TB 2E7CA 4K9EH 3WN5A 4DUWA 4EIZC 5DWUL 2DQUH 1S9VB 2EC8A 3MSPA 1JWSB 3KYOA 2H2PC 4R97B 5EORH 1PX4A 2MCPH 3KR3L 2H45A 2UUDH 4OQTA 1AXTL 1A5FL 4JFZH 3HHRB 1LO3L 5F21B 5IT2L 4Y4KA 5HHOA 2ICEA 3OKLA 3OX8B 4QHKI 4K7FA 5ANMB 2AJ3A 4E41A 3DTXB 3NCJH 1BFVL 4YC2C 3QDMB 4JQVC 1GGCH 4ZS7L 3ZL4L 3UO1L 5JPNA 5JXAH 4I5BB 4ZPTA 2CXKA 4EN3C 1S78D 4GH7B 3U1SL 3PWJB 4ZUUB 3CH8A 1RAMA 2EDEA 4P5TD 3MJ7B 4DEPC 1EMTH 4FQHB 3SDCA 3SGJC 4WO4D 5TGBA 3VWKB 1MFAL 4MNQB 5E9DA 1PD6A 2GTWA 5DD6A 5E00B 2AXJA 4FQPA 1KULA 4U3HA 2JK5A 1A4JB 3VXOB 3D3VB 3ZDZE 4XBEL 1PSKL 4AEEA 2GJ6B 1XF4B 1G7QB 4LSTL 3IF1B 5EU7C 3QCUH 1CDUA 3RVUC 4JKMA 5JPMB 4U0QB 3HUJF 1MJ7L 1XF5A 3L7EB 3GSOB 3PL6A 3KJ6H 2ZUUA 2CLZB 2F5BH 3GMRA 1DLHB 4OI8A 4XWGL 2JJWA 2J12B 1CL7I 1NC4D 2K3TA 4ZFGL 2I26N 2K1MA 2OTUB 5TH2A 1OL0A 1AI1H 1QLRB 2MKLC 4QTIH 1NL0H 1HEZB 2X5PA 2BHZA 3KAAA 3ZKNC 5C92A 1LEIA 3MXWH 3VXPA 4RNRB 4Y19E 3ZTNL 2CDGB 2YZ1A 4X80L 2DF3A 4TVPE 4BH8A 1KCKA 3D2UD 3EGSB 1YEHL 2FHCA 2O26U 1CLOL 3M8OL 2EH8H 2CLRB 1KSRA 4KRPD 2DKUA 1XAUA 5C0RL 4JR9H 4EKXA 1YDPB 3WFBH 1RUAL 1MIML 3RWHB 5I2IA 5KVEL 35C8H 5J9PB 1NAKH 3QB7C 1Q0YH 5E6ID 1U3JA 3OJ2C 4WWKC 3S5LB 3MFFB 3VDCA 2SEBA 1D6EA 4S1QL 1SJHA 1PBYA 4PJ7B 1OM3H 3ABZA 2IAND 2QADC 4KRLB 1X5FA 4J3WA 4YXHL 1OGAD 4CN4A 2ATKA 4Z95L 3BAEH 1ZVSA 4AH2A 3TT1L 4HIIB 1IGJA 1ITBB 1W72H 2J8UF 1B6UA 3EYOB 4YQXL 4HIEA 4Y5VA 5B8CB 6CGTA 5T1LB 3AS3A 3WFHA 3GK8L 2LU4A 3BP4B 3QEQA 4EBQH 4NZTH 5GGSA 4EEEA 1V05A 4KJPC 4OCXL 4FFZH 4F80A 2ZUWA 5GGTH 3IVKA 4N8VG 1RJLA 3H9YA 2BFVL 2VR5A 2EYSB 2WANA 1A4KB 2QBWA 1AKJA 2HRLA 3TVMD 4LRIC 1T20A 1NFKA 3MLWH 1CTNA 3M07A 3T2QA 4Z7OF 3U0TB 3QIUC 5GGRA 1GGUA 2OM5A 4E42A 3PGDB 1EO8H 3DVFA 4ZOAA 4YC2B 4I0PC 2JIXB 2FJHA 1K9TA 2GUOB 4R3SB 5C71A 4J23A 4S0SD 3O6MH 1U95B 2P5WA 1QHOA 1X5JA 3EZJB 1DCLA 4LEOB 1DBKL 2P24A 3BI9X 1WCQA 3CFDA 5IJKC 1J88A 2Z0BA 1DQJA 5JTWA 4GRWH 4HUMB 5CGYD 4DEPB 3HB3D 2CIKB 3UTSA 4HZLA 3V0WL 1FNSH 1GOFA 1UM4H 1WIOA 1ZLWK 5GS0D 4OZGB 5C6PB 5DI8A 2A1WL 3G5YA 3EO9L 4XZUA 1IAIH 5CP7B 3DRTB 4YE4L 3U9UA 3AMLA 4ZUSA 3PUCA 3K7UA 4OGYH 3BP7B 4C83B 4IDJH 4U1SA 3W0WA 5JW4Q 5B21A 4P57A 3CFKB 1EAPA 1OSPH 2IG2L 1Z5LA 3LB6D 1YEFL 3QG7L 4HF5L 2EICA 1UWEH 4AYFA 3VG0H 4XCNB 4XP9H 2G9HA 2O5ZH 2XACC 3I3EA 1FZKA 4PJIE 4N9GA 4U1IA 1VKXA 3RZCA 5BOPA 3F62A 3UROR 5KVGL 3D25B 4NKMA 1BGXH 3LQAC 4LSDA 2HFFA 2F74B 3HTLX 1MJJA 4ZSOA 3F7VA 4YGVB 5JDJA 3O6KH 4F7TA 1QFPA 4OCRH 3CMOH 4NQDD 2VLJB 3NZ8A 2FECI 5EDXA 2CIIA 1QHPA 3NA9H 5D2LB 3MNZB 2XICA 3C2AH 2DI7A 5DMIL 4IRJC 4ZDHB 3JVGA 4QF1B 1OTTD 4P2OA 4JDVB 4BQCA 4LLQB 4XXDA 3NH7L 1OT2A 3W81A 1CF8L 3RZWA 1OAXH 2FX7H 2PR4H 2Y1VA 4Z7UE 4GKZB 1C5DA 2E7LC 4OGAD 3Q6FA 5ILTL 1YUHA 5C0BD 2QADB 3KJ4C 5DD5H 4AENB 2DWDA 3U0WL 3LV3A 4NO2B 5I30L 2EXWC 1CLZL 1XGRA 2BVQB 1NGPL 2ZUXA 1IT9H 5T5NG 4GAYA 1T1YB 3IFOA 4PJFA 4KKCD 5EFIA 4OGXH 5F72S 4R6UA 4GRWE 1FO0B 3QQ3A 3L5WA 1TVHA 4OJFH 5CBEA 4JGJA 3GRWA 1R3IH 4EQ2A 1ZEAL 4BZ1L 3ARBB 4LARH 2M26A 2ZNWA 2OP4H 3QP3A 4L4VB 3KPSD 4H1LB 5J06A 4QWWC 5ADPH 2ZOKB 3V4PL 3QIUB 5ISZB 1OTSC 4R4BA 5HDLA 5JUEL 4I0PB 3RTQB 1RD6A 4P5MA 3CX5K 3RWIB 2P43B 3FT4B 3HNVL 3B9KD 3QH3A 5EU3B 4CN6A 5L2KD 3ARVA 5SX4H 4PJ7F 1A6ZA 1A9BB 5C0AB 1AO7D 1I1AC 3RVTC 1WWBX 3IFNL 4G6MH 1QLFB 3RVWC 1DVFC 4ETYA 3T65A 4F9PC 4NM4H 1DDHA 1FORL 4EUPG 1WITA 4IRSD 43C9A 4KVNH 5C0JA 4UT9H 2Z4QA 4H0IA 2MHAA 4MJ6A 5D7IA 2JF1A 2CPCA 3GI8L 2HJFA 4NNXB 3Q6GH 4ZS6C 4XBGA 1OF2B 5MP6L 1FFPB 5KW9H 4JVPA 2NW3A 2A83B 3LZFH 1Q9KA 5E8OB 2V2XA 1GJIA 1I1YA 1JHKH 1AQKL 2GCYB 1A3LL 4JFHD 2NY3C 3O2WH 1CYGA 1BZ7B 3ARPA 1FYTE 2H8PA 4KZEH 3V8CA 3N1QC 1PZUB 3BKJH 4Z7QE 1T3FB 1ES0B 2VERN 4U6YA 4MA3B 3VXRE 4R90L 1EJOL 3MNVA 2VXUH 4XCEA 1BECA 1R24A 2P48B 3GSQB 3TBYA 3RFZC 1QBMH 3FTGA 1TPXC 5D1QC 5KANI 3MBXL 2FL5A 4KTEL 1MHCB 3OKNB 3MLYL 5IB1A 3J7HA 3PXHA 3TCXA 3VFMA 3WL9A 2ZG3A 4OZGF 4RGNC 4L5FH 1R3KB 4IRJB 1I3RA 2APTA 5C7XH 3WLWD 5HYIA 2IBZY 1LQSR 1V7NH 3EYVB 1DQML 5GGVY 2QSQA 3SE9L 2BRRH 4YHLL 2RQ8A 4ZG1A 5A16A 3K4ZA 1NDMB 4HMEA 4TUKH 2B1HL 5H94B 5MI0C 5L0QC 5DJDA 2KDGA 1RUML 3JWDH 3BKCH 4I4WB 4FQHA 4OLYH 4L4TB 2XRAH 3GB7B 1F13A 1BF2A 1CFVH 4FNLL 4Y4FD 3TT3L 2PETA 1SMOA 2ZG2A 5GJTL 3AC0A 4EOWL 1A4JA 4IS6A 5ITFB 3Q1SL 1WZ1L 3FB5A 1MCPH 5GS1C 4Y16C 1BAFH 1H3UA 1NLDL 4JGUA 1KELH 1T1ZB 3E2HC 1RMFH 1HHJB 4YHMH 4NC0B 2YPLE 1AD0B 1DLHA 1NC2B 2V9RA 3EHBC 3EFFA 1MRCH 4LKCA 5D2LF 1RIUL 2DLGA 1OTUC 1YPZB 4LHUG 4PJ5D 4MVBD 1HIML 4D3CH 2C26A 1IBGL 1GOGA 1KACB 1F3DJ 3O6FD 1QLRA 5ELIA 3O2DA 1Y6MR 5E6YA 1HEZA 5I16A 2W60A 4OUUA 1YMME 5GRJL 4RNRA 3IFLH 5EC1B 3FQXA 1G9NL 5FUOL 2IPUG 2VQTA 2YD7A 4HUUB 3LS5L 4NCC2 3EGSA 2BC4B 4QHLA 1LO2H 1DVFB 3C60D 4NCC1 2ARJQ 1I7ZA 4WI9A 5I8EB 3QIWC 4M7KH 1MRDL 3BXNB 4Y5XA 1C8PA 2WIIB 2XZQL 2FSEB 2GEEA 4QHMA 1KCRL 4N8PA 4NQEE 5EC2A 1TCRA 3VH8A 2XG4A 3BIKB 1J8KA 3VU2A 5EWIH 2GITA 3KWWA 5GZND 3KPOA 5LJYH 4PJ7A 3NPSC 2IQAA 2XN9D 5DJXB 4GMTL 1XR8B 3HI5H 3VD5A 4JFYB 2DQDL 5L7XH 1MCOH 3QZWA 3W11D 3TCLB 4QKXB 5LGJA 1YEJH 1QLEH 2DAVA 4F9LA 4J6RH 3FB6A 1ZAGA 2NXZB 4OIAA 5HBBA 3F58H 3MODH 2MKWA 1YYMH 1IGYB 4MNHB 2FO4A 2PYEE 3TN0B 5HPOA 3BRFA 2AK1L 4OFPA 4P3DA 5HYJB 3OKDA 3T2NH 4RMVA 5D1QB 3F7YB 2Z31D 3UC0L 5D7JB 3PGFL 1UWGL 4P2QB 5DJ6A 1ED3A 3QHFH 3GHEL 4PTTA 3SJVA 3RWFA 1FVDA 3HZVA 3BDYH 3WFZA 4NPYB 1JPGB 3TFKC 4L4JA 4F7EA 4YDVB 1YMHA 4KMTL 1A2YA 4MWFA 4L3EE 3CSYA 1OSZA 4RZCB 4CW1B 1T03L 4KPHL 4R3SA 3CXDH 1N0XL 3DO3A 4N1EA 3GI9H 4JPKH 4QEGA 2QL1A 4KH2A 5MI0B 3BISA 1VEPA 2QKIB 3SOBL 1JHLL 1FP5A 4HUXB 5IK3B 4H25B 2VLRE 5MEOA 1RZ8A 2YC1A 3CCHA 4OUOA 4OZGA 3X14B 1MHEB 1A7BA 5HHME 1NANH 3KPLA 4PG2C 3VFNB 5KVDL 1BMGA 4K2UL 1RFDH 4YHOH 3L5IA 5GS1B 4Y16B 4OM1L 3DX9B 1HXYB 1MQKH 3KDMA 3PV6A 4HKXB 1MJUH 2R29H 2YD8A 5CUSH 5MERB 2EYTA 1EAJA 1A6TB 3BGFC 5DJ0B 3BQUD 1KTRL 2C3VA 3GSNH 5J6HB 3LDBB 4O5LL 1EEZA 2O5YH 4LDLB 1C08B 4MJIA 4HJ0D 3U82B 2MSPA 2R23B 1RIVL 4UI2A 3D25A 5T1KD 5JHLH 4U7MA 4M7LT 1IAOA 1WUNT 2X7LB 3N85L 5I8OL 3L6FB 4YHIA 4LCWD 3QJHA 5IB3B 2VLJA 1FE8H 1G0XA 2BNRB 3UYPA 2YKLL 1UB5A 3MNZA 1D5MB 3BMWA 3QIWB 1FLRH 3PF2A 1ZHKB 2VAAB 2NLJA 4JDVA 4LSRH 4UT6H 2MNUA 4NOFA 4Y4HD 5TDPA 4XNYL 4UV4H 3VI3F 3K80A 2IPTH 2X9XA 2ZCKL 5HGAB 5KOMC 2YPVH 4ZAKD 1C5CH 3CMGA 3W9DA 2Q87A 1WFNA 5C0CB 4R7DB 2FD6H 3NPSB 2H32A 1CE6B 3O11B 4AENA 1QSFA 2QHRH 3CUPB 1CL7L 4U1LA 4NO2A 3DRQA 1YPZF 1JF5A 3SCMD 5LXGL 1U8IA 4N0CD 3KLDA 4LLDB 4XCYA 2CQVA 3QRGH 2G60H 2JCCE 3OAYK 4YPJA 3HPLB 4U1KB 4MAYC 1B0GA 4P5KA 4XI5D 4PJDB 6FABH 3ARFD 1BJ8A 4XPAL 1JP5A 3UJJL 3ARBA 5FYJD 4JG1H 4JREC 2GY7B 4J3UA 3ZT5A 3MV9A 2OR8A 1KEGH 4HLZH 3V9FA 4L4VA 3UYRL 4H1LA 1UACH 4FRWA 3K4DA 3LKRA 2QSCL 2UZIL 1MCEA 4FQCH 3TNNB 4YAQA 5CZVL 2QQLL 4I2XE 3RTQA 4M1GH 5ESVB 2VUOA 1CE1H 2UWEA 1E6OH 1FJ1B 1A9BA 4NHCH 1ONQB 5LCVL 2B8OT 4PRNB 3JSSA 2IAMC 2J5LC 3ARYA 4O58L 1UWXH 3QDHA 4HJJL 3DGGB 2QSVA 3GIVA 3EFDH 5E0QA 1BIIB 3WNMA 5B3JF 2GKIA 1A7PL 2FBOJ 5CINL 4GQPH 4OLVH 3UPRB 4S1RL 4LP5A 2PO6C 3UTTB 3WFEH 1ZGLP 1QYGH 3UBXI 3KYNB 4NNXA 4PR5A 3FT3A 3VDBA 4ODHH 5CSBA 1QRND 4PRIB 4AEIH 3AM8C 3VD4A 2DB8A 2OZ4L 5LAXB 1PZ5A 2UY6A 4EUPH 2BOBB 1U8QB 3V4VH 4KUZL 2R0LH 1H8OA 1BZ7A 3UZEA 3EKCA 2X09A 3DPBA 4HGMA 1RI8A 1FG9C 1XR9B 5E2UL 1OARH 1G7HB 4HIJA 3FZUD 2FR4B 4XNXH 3UTZB 3RGVC 3ALPA 1WF5A 3WHE1 3BKMH 4PJCA 5IJVB 1U8KB 4YBQD 3R06A 5BJTB 2FEDD 3PWPD 2IPKA 4U0RC 2VXTH 4N0YL 3EDJA 3G6DH 2VYRE 4XNUL 3EBAA 1FO0L 4QXWA 1I8LA 3OB0K 1CG9B 4LDEB 5SWSB 1KTDB 1BFOB 2DJ4A 4PBWD 3ULUD 3B6SA 2IADB 1J1XH 3MA9L 3P4NB 1Q9WB 4YWGH 1WC7B 2Y5TB 3GSRB 5GISH 1TQBC 3NIGE 2XQYG 4X6EB 4X5WA 3OTTA 1IQWL 4KV5F 4ZTPH 1CS6A 4E9LA 1X44A 4YDJA 2GW5A 3MRFA 4LSQH 4APQC 1S7XB 3VXUA 4L4TA 2YD3A 1J05A 4Q9RL 4ZFOA 1EZVX 4WY7H 4PGDB 4UILL 5JHDD 5DJZA 2VLKB 3WV0A 3MACH 4LLAA 3K1KC 5C07A 1IEBB 2P45B 1KCSL 2JELL 1VHPA 3O3UN 2MPAL 1NBVH 1SBSH 2ZP0T 4FQXC 1Y6NR 3LN5A 4X8JA 1ERNA 3MRMB 4ZO9A 3UBXB 3RWDB 1RU9L 3TPKA 2FECL 1A7NL 3VD9A 3MV8B 4WUKL 3ZTJG 1ZHNB 3S3JA 5IEHA 1AD0A 1PW3A 3QFJA 2FWOB 5FM5O 2DQJL 5C2BL 4JDTH 5CHNB 1LO4H 4JREB 1J8HB 4LCUA 3RHWK 1INEH 3BP5B 2XQBL 3NIFE 4I3GA 1RIHL 3TZVC 4XBPA 4K7PX 4P2RB 2F54D 4F2MB 2YR3A 3IDYC 4PJ9D 2P1YA 1A7OH 2BDNH 1P1ZA 3HAEG 4YZFF 25C8L 1A6PA 1IQDA 5AZEL 3WD5L 1TETL 1PG7L 2IFGA 3B9VA 3A0OA 3OSKA 4HH8A 4PJGB 5EC1A 3RPKA 3MC0A 2PXYC 1T0NB 3CLEH 1YQ2A 4DGVL 2BC4A 3EAKA 2IAMB 4F33A 1G0DA 2VITA 3RKPA 1X6LA 3LQAL 5EZLB 4PGCA 5DLML 3NCEB 2R0KL 2PO6B 4K07A 3HE7A 4JKLA 2A6IA 4AL8H 1WBXA 1XGYH 3WEXA 1I8MA 4PJDF 3WIIH 4D0BA 2AK4E 1F6LL 5DWUH 4OZHB 3ZKXB 3TESA 1I1FB 1P2CB 5DJXA 5ERWA 3H9SD 4Q6IC 1UCTA 3PP3H 1B2WL 3L3GB 1ND0B 2D7QA 1G1YA 5L2JB 1LO3H 1RZ7L 3SY0A 1OCWL 5IT2H 4X98B 3GMLB 4WGVB 4F57L 1BFVH 4MNHA 2EE2A 5DEGA 3DYMA 4R7NA 3TN0A 5J8OA 4QRQA 3QUYD 4N0FB 2B0SL 3ZL4H 5DVNA 1CT8A 5GJSL 1TJIH 4I77L 3QNXA 3O4OC 3RGVB 5C9JA 2FBJH 5I15H 4QOKD 3PQYD 3UYOD 2VH5L 4L8CA 3C9NB 4Z18A 2HTLD 4HS6B 5D7JA 4WI6A 1G6RB 4DQOH 3N06B 4PRBB 4TTDD 2EIDA 2J6EL 1A6WH 1S78C 3WNKA 3KYAA 1MFAH 3SKNA 4JJ5B 3QUML 4S0TD 4S1DD 4P5TC 3WXVL 3VXNA 5I1EL 3S4SG 1KTLA 4M02A 4FTVB 2GJZB 4XBEH 1ZTXH 4M9PA 4OD3H 1RJYA 2LE9A 1NAMB 4QT5A 4GG6B 3GUTA 1MJ7H 2WSKA 2XWTB 4JHWH 5DRXA 5C2UB 4YUEH 4BQ6A 4LQ1A 2EIZA 5I1IH 5CEYB 4HD9A 4HKJA 4ZMAT 1SHMA 2QKIA 3STLA 4PD4J 5ESQA 4BQ8A 4XWGH 1DBJL 4APQB 1MQ8A 2X89A 4AM0A 1D9KA 5EOTB 3PP4H 2V2TA 4TULH 4R96A 4ZFGH 1AGEA 4PRHB 3X14A 3TPUA 1BLNB 4IJ3C 1VCAA 4YHZL 5IIEB 3IB4A 5JZ7D 3MRGB 3O4LE 1U6AL 3LMJL 2LQRA 3DX9A 4X80H 3RNQA 5F3BA 4LCYA 2IF7A 2WUBL 4M7LL 1CLOH 1I9JL 4QRPB 4X4XB 5F1NA 3LKSA 3NAAL 3AU1A 4KDTA 2CKBA 1KJ2A 2VIRA 2XYCA 5I8KL 4U3CA 1T80A 3P73B 3MGTB 3RHWF 4AMKL 1RUAH 2P44B 5C9KA 2XNAB 3DX7A 3VXMB 5KVEH 4KRPC 4ZXBA 3MRKB 2X4SA 5EU6B 5HHQB 1C08A 2I5YH 3EIFA 3IDYB 1OY3B 2VSCA 3BPCB 5ALBL 5J12C 4GXVH 4OQTH 4HT1L 3L3IA 5E6IC 2I07B 1IC7L 5FUCC 1YC8A 3CSBA 1SY6L 3V7AG 4WUUD 2PXYB 5T3XD 3FOLB 4YXHH 4CMHC 3PGCB 1KPVA 4BQBA 4Z95H 5FYKD 1N6UA 3QUKB 5LGHL 4NZUL 4NM8L 2EE6A 2VDQL 4KQ3L 4YQXH 4DOHB 2H3NB 3GSXA 3CXHK 3VW3L 2DI8A 4G8IA 4NO5B 4OZIE 3GK8H 4OLZL 4A6YB 4O02L 1T7VA 1JNHB 2HFGL 3TH4T 5DJ8A 2Q8AL 3BOVA 5EU5B 1YNTB 4UUJA 4OCXH 3EJYD 4LLUB 3C5ZB 4QTHB 1RUPL 2GT9B 2Y06L 3EYQD 3KLAA 1FH5L 1R5VA 4GW1A 4Q6IB 3CUPA 1KC5H 3NFPA 1CR9L 3MV01 4OT1H 3QQ9D 4BUGA 1S7QA 4V1DA 4NGHL 4Z0XB 3TVMC 1T89A 2HVJA 1F90L 3DGCR 1N8ZA 4AJ0A 4KHXL 3OAUH 3BJ91 4JRYD 1IC5H 5FA4B 5FCUL 1KIUA 4Z77B 3IAPA 3O4OB 3S8WA 5GSVA 4UINL 3B5TA 2QR0A 2X70A 1IL1B 1OAYL 4PJDA 3SBWA 2VXVL 3F8UB 4HXBL 2AV1A 3V0WH 3X3GL 1YEEL 4MXVF 3NABL 2D0GA 5CGYC 4P5TB 4YFEA 2ESVA 5FO7B 3S5LG 1BJMA 4M5ZL 2GI7A 1UGNA 5GS0C 4YE4H 1X5XA 2VE6B 4MQTB 5ESVA 4KHTL 3CVHA 2Z35A 1U8JB 1OPGL 4WEBL 4OZHF 3OKYA 4LVNC 2IG2H 2RAMA 5LQBL 1QFWI 1UH3A 1YEFH 1X7QA 3QG7H 1U36A 2NNAB 3I02B 1BHGA 4Z78A 3V95A 4GQ9L 1HHHA 1YN7B 4JRXD 3NFNB 1MOEA 1S7WA 3LB6C 5I8CA 3BN3B 2C7UA 4HHAB 3TH3T 5E56A 1WSST 3AAZA 4N5ED 5E5MB 5HHOE 1E28B 2GSIA 1AD9B 2E9JA 1NC4B 1J0KA 4L9LA 1JZ7A 3IGAA 3AS0A 5IW1A 2Q76A 4BZ2L 3O45A 5B39B 2YPKB 4NKDB 2NY5C 5FB8A 1AIFB 1TTUA 1QG3A 2FJGB 3D2UB 1CFQB 1I8KB 3W2DL 1U58B 4EVNB 1U8QA 1HOCB 5E95B 1BZ9B 1U41A 2YRZA 1ZSDB 4AG4L 2PTVA 4KRPB 5E9DE 3NH7H 5HY9B 1F6FB 2EDQA 5J12B 3DXAE 3BZ4B 3I9GH 4GG6F 1JYXA 1MCNA 5E6IB 3TIEB 1DLFL 5E24E 2W9EL 4OCSL 1T4KB 3ZT7A 2X42A 5TDOA 4CMHB 5C0EB 3WMSA 4RWYL 5D5MB 5I30H 2IANB 1ZA6A 2IGFL 1S7SB 4LCCA 4UDTA 1CLZH 2WWMC 3CU1A 4JQXC 5HI5D 4UIMB 1NGPH 3FB7A 1OGAB 2O5XH 3IDJB 4RQQB 4NC2B 1F3JA 4C56B 1OLLA 2YMXL 5HD8C 1IJ9A 1BVKA 4P4RB 1WC7A 2AJZA 3CX5J 2P5EE 2YK1L 4R26L 2R2BB 2VZ3A 2MJWA 1ZEAH 4MSWB 3HRZA 4BZ1H 4MNGB 3MRJB 4LASL 2UYLB 1KJ3H 1MCWW 2Z8WC 4P46A 1NEZB 1K8IA 2VLKA 3MCKB 3D85A 5TE6L 3TVMB 2EKSB 4X7CC 3RL2B 4D9QD 4AT6A 4MS8D 3HNVH 3WHE0 1XGQA 4EJ1C 1JYWA 4NJ9L 2WQ8A 4Z9KB 4JB9L 1PQZB 1QSZA 3U0PA 1ZHLB 3IFNH 3B9KC 1ZHNA 5HYSA 3IDMA 5JW4R 1F6AB 5DC4B 4K3EL 2XI9A 3L1OH 3GJEB 1YEIL 2CDEA 4Q9QL 1EA9C 1FORH 3L5JA 3O3EB 5EOCL 3V8OA 4MMZC 1A1OB 2EDKA 3UTQB 4F2MA 1EO5A 4F8QA 3GI8H 3O3BB 4IRSC 2CR3A 5JNYB 3FCTA 4JFDA 2CXGA 3MLRL 5DGRA 4LVNB 4X6CA 1MNUH 3DOSA 1S5HB 1ORSA 5MHSD 1A3LH 4PJEA 3P40A 4X7SL 5EZLA 3D0VA 4J1UA 4LQFL 3I6KB 3BGAA 3DVNB 4Y2DD 4XMPH 4Q97A 3KYMA 4R90H 5FDWB 1LE9A 1KLGA 3LEYH 3WUWA 3OL2A 2X1PA 2AJYH 3RWGB 5DQ9A 4NRXB 4G42B 3CH1B 1LO0H 3L3DA 5DT1L 4QGYA 4KTEH 4LPYA 1KLUB 1MHPL 4J4PC 3ME0A 4OFYD 1HK6A 5HYEA 2VXSL 1ULVA 5GGQL 3PWLB 3L3GA 1A1NA 3UTSE 4NQDB 5CSGA 3ARDD 2OJEA 1SBBA 1I7UB 3BJLA 4Y19D 4RBPH 1JUFA 4IMKA 4N8CH 1Z9OA 3SE9H 1FZOB 4TVPD 4YHLH 1GL4B 1UXWA 4LGRB 3WLWC 3OJDA 5I1KL 5BV7H 5IW6A 2B1HH 3C9NA 1RUMH 4HS6A 4NUJA 4DN4H 3P0VL