5KVMC

Extracellular region of mouse gpr56/adgrg1 in complex with fn3 monobody
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
SVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGGSPWSWQEFEVPGSKSTATISGLKPGVDYTITVYASSFDWTIFPNYYSSPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Regulation of GPR56/ADGRG1 by Its Alternatively Spliced Extracellular Domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Adhesion G-protein coupled receptor G1
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2016-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kvmC00
3FN0H 3RWCB 3VFWB 1RD6A 3KPPB 2VXTL 2YZ8A 4ZFOA 3U0WL 4M4RA 1AO7A 2EDYA 1E4XI 4P57B 1YNLH 5ID1A 4JHWL 2VISB 1TMCB 5D1ZC 5DRZB 3GMRB 3SE4A 4JHAH 4I3RL 1H0DB 4BYHA 4LCWD 1OARH 5CBAB 4UNTA 4CBPA 4YFDB 3D39D 2OBGA 3SGDH 4F57H 2JB5L 1Z9SA 3K74B 3PE9A 3TIDB 3ILQC 1WFUA 1L0QA 1PFCA 5KSBE 2DKUA 1PKOA 1A6WL 3QNYB 4L4VA 1WV7T 1GGTA 5TPWH 4A2LA 1Z9MA 2FATH 2AK1L 3CLFH 1YEEH 4R7NA 4KMQA 3GJEB 5F7EH 5EO0A 4P4KA 4NJ9H 5KJRH 4NYLB 4K7PX 2W1NA 1LDPL 3KXFB 4HIJA 4HUWB 5E8NB 3FFCD 5T3ZD 3FJTA 4MA8H 4GG6E 3T04D 5J06A 2JCCE 1DZBA 4HXAH 3AY4A 1S9VB 2EH7L 3DOSA 2R4SH 1Z0NA 3U46B 4IOFC 5L2JA 1FC1A 2A0LC 3QFJB 1VPOL 1BAFL 5EFIB 4M5YL 5FV1L 1GOHA 5DFVD 1ZHKA 4JY4B 2YUZA 4MQTB 2BNRE 3L5XH 4HCRA 1KIRB 5CJQL 4NZTH 3THMH 1HH9A 5CHNB 1YMMD 3QUYB 4X9HA 3HZMA 2A83A 4KK9C 3CU7A 4Y2OA 4DCQB 2EKSB 2DTML 2DLFH 3NGBC 1JMZA 2N56A 4XWGH 5E8NA 4JM4L 3SDAD 1I3GL 4WUUA 3MLTA 2KDGA 5JPNA 4I0CC 5L9DH 2ZUUA 2FIKA 2FJHB 1YECH 2DDQL 4MAYB 2D7TH 2PTVA 4HPOL 2NY2D 3MRFA 1PG7L 3A6OA 1A7OL 5BRZA 1U3JA 4N8VA 2HVJB 4LRNH 2EDLA 5CMAA 4PJIE 5DQJB 4XVSL 2APBA 4LLYA 3ECBA 2GFBB 3W39A 2IPUG 3D85B 2GAZB 2E7CA 1U8PB 4BQ8A 1N0XL 5EUOF 4MZ3A 1N5YL 4PJ8B 1CICD 1EMTL 1MPAH 1R3HA 2EE6A 3D25A 5DRZA 4XBPB 4Y5VC 3OKDB 4Y89A 5JHDD 1JJUA 4NCC2 3ZTJG 2F19H 3VFTB 3MJ9L 4OZGA 5EIIB 1U36A 3FQUB 3MUZ1 5KS9E 4YZFE 3C5ZA 4BSVB 3OGCA 4M9PA 4NQCA 2LAAA 4XPTH 2NXZB 3RY4A 3HR5A 5GSVA 5CILH 4OLYH 5DMGD 1I3RA 3DV6B 4WO4C 2Y1VA 1I3RB 3FQXA 3PHOA 3VD9A 2ZUSA 3TYGH 3QXAB 4RGNB 2AXHA 1BM3L 3B8YA 2UV3A 4MNHA 1N7ML 1GOGA 5EIQA 4OCYH 1X5YA 3MYZA 3OX8B 1Y0LB 1I9RH 4NUGH 4LDEB 3BQUC 2EDTA 4NM8L 4E5XA 5JORB 3FAXA 3HNSL 1PQZA 1IGYA 2IWGA 1T1WB 4GUPB 3HG1A 2BY0A 2AGJL 3GI9L 2ZUQB 4MB3A 4RMTA 1MWAL 1A1MA 2BFVL 4Z77B 5MEOA 4FQ2H 3VXMD 1VFAB 1ZA3B 4M1DH 3V0WL 3TBTA 3MRQB 4M8VA 1RQ5A 2W9DL 3H9SD 4HUUB 4J3VA 4HUVA 5IOPB 1N6VA 3B9KB 1INEH 5KVFL 3E3QC 3DWTA 2D4FA 4NQED 2RQ8A 4M6MH 2DQUL 4Q9CA 5HY9B 4JANA 4UDTA 2H26B 1GL4B 1YEKH 2ZOKB 5MP6H 1NDMB 4AM0B 2ADIA 4LEXH 5CINH 3Q6GL 2N4IA 4BFIB 1EO5A 4C56D 4V1DA 1H8SA 3MNWA 2PN5A 1HZHH 2ENSA 2Y07H 1DQJA 2VWEE 5I1DA 4LLVB 3C60A 1A6UH 2D7TL 2NW3B 2DLHA 4G9DB 5TPWL 5H35B 4ZUUA 1MFCH 2AXJA 5LGHL 1T83C 2NY0B 3SE9H 1KB5H 4PRIE 3OZ9H 3SGKC 2X4UA 4KV5F 5E56A 3VWJD 4J4PD 4KVNH 1P7QD 2E8ZA 2GFBA 5K9KB 4NBXB 2R0WL 4F33B 2JIXD 5CZVH 5DMKB 2AV7B 2ADFH 4PUBH 3L3HB 2XFXB 3EYOB 1HIMH 2EDXA 4HIEA 5ACZA 1KTDA 4JFZL 1J0YA 1TETH 4ONHB 1BQUA 3W0WE 2R4SL 1K8DA 1X5FA 1KCKA 3WKNA 5HHNA 2ZCHH 3GHBL 1M7IA 3RUGB 2MOVA 4Y4HD 4BQ9A 1I9IH 4ZFFB 5K9KA 5F9DC 3ESVF 1S7RB 4HPYL 2HAZA 4GBXD 4HWZA 4OQTA 2DN7A 4JO1H 2A38A 4DEPB 2VXVH 4C56A 5D6CB 5IHUH 3CUPB 4Q6IB 2YPKB 5TDOB 4OV5B 4QRPB 4I13B 3DXAE 4PB0H 1H3TA 4X5WA 3S5LB 1I85A 2A77L 4JM4H 4EQ2A 3V5KB 4P2QA 3L3GB 4PY8I 1RZGB 3CPLB 1B2WL 1TQBC 1T1XB 5GS0L 3B2UC 1KIUA 1DSFL 2L7UA 4K3EH 1N2RA 1A8JH 5J1TC 4RRPG 1A7RH 1DE4A 5GIRA 2NY7L 4P2YA 2I5YL 3KLSA 3NFSL 4GKZA 1TZHB 1HK6A 5DUMH 5AAMA 3Q3GA 4OAWA 3JV0A 3SKOB 3T0EE 3GI9H 4WO4A 1N5AA 3QJHB 4S0TD 4U33A 4HGWB 2OJZL 2W38A 3S35X 2CKBH 1JNNH 5HHOE 4EN3C 1KENL 1N5YH 2HJKB 1NKOA 4U3HA 2GITB 3AREC 5HYJE 2VXUH 4XBEL 2EYTB 1JPST 1IARB 1ED3A 3KLAB 1VFBB 3HUJF 4ODWB 2IQAB 1P9MC 3TA3A 1EK3A 2Z8VC 4XXDA 5GS0C 2VNCA 4Y2DD 1EGJA 4HUKB 3GBNL 4KROD 3T3PE 5CILL 3TN0A 3VXUA 1T0PB 1Z9OA 1BD2E 2ESVE 3KS0H 3FRPG 5IMKA 3CVIH 1EBAA 5IFAL 2NX5D 1JWMB 1YDPB 2V5SA 4M7JL 4OB5H 3BUYB 1CD9B 4C83A 3UPRB 2W0KA 2IANA 2RFXB 3T09A 2XZZA 4PRPE 3PP4L 2XQYK 2F15A 2XWBB 3KNBB 2N7BA 5ANME 4Z95H 1EHLL 4HWBL 4WW2A 3QWRD 5FOBB 1OSPH 5IF0B 1S7XA 2Q76B 2HYMA 5HHMB 1AJ7H 1GAFL 1FN4A 1KACB 3L6FA 2FIRT 5HDLA 5IHZA 5ERWA 2XI9A 1LHZA 4JFZH 5IMOB 3L5JA 1IZKA 4YEFA 1GIGH 4P5KB 1WBZB 2DI7A 5C07D 1FNEA 4WFFD 5IG7B 1KLUA 1H3WM 4KI5D 2XTJD 1YA5A 1KLUB 2JK5B 1DJSA 1NGWA 2PYFB 1OT1A 4H26A 3WLBB 3PV7A 2UVFA 5SWSE 2VQ1B 1VESA 1PDKA 1OAZH 3KPNA 1WC7A 4ZNEA 1EHNA 2Z35A 4Q7DA 4YE4H 3G5VA 2CLZA 2KUTA 4NOBA 5ID0A 3BP7B 3O2WL 3GJFA 4POZD 1G7QB 1VB9A 4HT1L 4LCWB 4BH7A 5SWZA 4ZYKA 1IAIH 1S7SA 5HHXH 4DCQA 2BVEA 1EZVY 4JG0L 4KKAC 4C4KT 4KZDL 3EYUH 3MCG1 1UB6B 1FFPB 3RZCA 1I8KB 5CSGA 4NC2B 3OB8A 1I1RA 5FHBH 1ZT1B 5FF6A 5J3HD 4NJAH 2ORBL 1DVFC 2XWJB 4FQHB 4Y4KD 2WUBH 1LE5B 1FL3A 1REIA 1Q0XH 2CK0H 4R90H 4P46B 4D94A 1I8LC 4C56B 4G42A 1GPOL 2XA8H 3EO0B 2J6EL 2GJ6E 3VRIB 3HC0A 3U36B 2V2TB 4KPHH 2I07A 4ZMAT 1S8DA 5DMYA 2VL5B 4KQ4H 1JUFA 4YHML 1TJIL 5IB1B 5I1LA 3DO7A 4QRUA 3SE4C 3RGVD 4RQQB 5HYSB 3UC0L 4HHAB 1LEKB 1RUQL 1WFOA 3TVMA 4HK0A 2BVPA 4ZOEA 4ENED 1UJTA 5EO1B 5B38A 4E41D 3E6HB 1OLZA 1K6QL 3TNNB 1NEUA 3QIUC 3VXQA 4ZAKA 3DMMD 3VD3A 4BZ1H 4D2NA 2JLLA 5ECJE 1RZFH 2VYRE 3VRIA 1UWXK 2BDNH 2SEBA 3V2AR 2I9LA 2AJXH 1FLTX 3MJ7A 4PV9A 4Y88A 2VAAA 4PREA 4XZUB 3DYPA 1MHCB 5I1DB 1UM4H 3DGGB 3I84A 1T03L 3R06B 2J6EA 4QOKE 1NBZB 3BN3B 3NFPB 3S36H 2ADGA 3EYVB 5I1AB 2CUMA 3CAFA 2VXVL 5L2KA 4Y5XA 3S35H 1V3JA 3QUMH 4NQSB 5DRWA 1FV1A 1E4KA 2P1YA 4ZAKB 1D6EA 1JGUH 1CZ8L 3DVNA 2OTPA 2QQKL 4ZOAA 2P46B 4EDXA 4ETQB 5C0NC 1J05B 3G5ZA 3NZHL 4GMSH 4HUUA 4B7IA 3RX5A 5DFTA 1NGYA 4IIQC 3BEVB 4OSUL 4PJDE 1FPTL 1AY1H 3RX8A 1CFBA 3CVIL 5IFAH 2I9TA 5EBGA 4OZHE 3QDHA 3MC0A 2FR4A 3RY6C 4P2OA 5F7WC 2C4FU 4LGPB 2VOTA 4JZOA 3O9WB 3UBXI 4IMLA 5J11B 3V0WH 3T3ME 4NDMA 4MA3B 4JQIH 2OL3B 3RVVC 1LE5A 5HHOD 1VA9A 1I4FB 3SY0A 5KAQF 2F5BL 2JJUA 4X7SL 5FV2A 2Z31D 3D0VB 1IT9L 4OCLC 4NUJA 4QWWD 4D3CL 5J89A 2R23B 2V5YA 1RSFA 4Y5YC 4F58H 2EC9T 3ARTA 4BFGA 3PHOB 5C0FB 3EFFB 2Z8WC 4JFPB 5DK0A 4MQ7A 2G2RB 2GJ6B 3KPQB 5F1OB 3TPUA 5F7FA 4PP1D 5TDPB 4GAYB 4HKBA 3FN3A 4PJ7F 1RIVH 1A9EB 2VLRE 4O51A 4GAFB 3SDDB 4XBPA 1UFUA 2VLRB 5FO7A 5JNYB 4G8FA 5FO7B 4MSWB 3RTQC 4BUHA 2ARJQ 5IKCA 3F7QA 5JDSA 3MBEA 3BDXA 2YKLH 1G0YR 1LK3H 1JHKL 5DD3H 2VITB 5MEND 4I3GA 3WJJC 4PYGA 3IDJA 3K8MA 5D1XB 1NL0H 2MPAH 1AR1D 3H7LA 4ZUSA 2YD3A 2ATKA 1UZ6F 4JDTL 4I77L 3GO1H 3LKQB 5EOQH 1QFUH 3CFJA 1OVZA 5JNYA 4ZXBC 4QCIB 3Q2CA 5F9WC 1FLRH 3P30L 3MJ6A 3F5WB 4UINL 5HGBB 4BUGA 4R26H 4CADA 5I0DA 1OSZB 4RBPH 4EDXB 4ETQA 3OKOA 2BJML 2PW2A 1AP2B 3C6LA 5I6XC 1J0HA 3KS0J 1CGTA 3I3EA 1JWUA 4Z5RA 5SWZE 3I50L 2VRAA 1QVOA 3PWNB 3GMQB 3RI5K 2R9HD 1KIRA 4LVHC 3ARDB 4KWUA 3ELAT 4U7SA 3PNWB 5DXWA 2H1PL 1I7RA 5IW6A 1EZVX 2NY7H 4YHLH 4MDIA 5IMKB 4OGYL 1MCEA 3S4SA 2QADC 4I0PA 4X80H 2VQ1A 3QI9D 4ZNEE 1DBJH 1S7TB 1QSEE 4KRPD 1TNMA 2RHEA 1MAKA 4OLEA 3I02A 3MRHA 3EYSH 2Y23A 1A5FH 1G9NC 3X14A 3F58L 4JRXA 1XF3B 5EBWA 4KFZC 4KVCL 3C09B 4FQ1H 2EC8A 5E5UB 1IRAY 2AI0L 5I8KL 3VXOA 1WWCA 5EO0B 3KDMA 4GS7C 3RY5A 3LY6A 1Z5LA 1AGEB 2ADGB 3CIQA 5FYKU 4LHJB 2V9RA 5KG9A 1BVZA 3DSFL 1MRCL 2WBJA 3T3PF 2IH3A 4Y4HC 4DKAA 4PJAE 5GGSB 4WUUB 2QSVA 4UV7L 5EU5B 1OTTC 5DZOA 5FUZL 5ANMA 3BPLB 1QHPA 3DVNB 5DHVH 2VL5A 2V17H 2X70A 1KB9K 3O45A 4JO3H 4MQSB 1CBVL 3VH8B 4CVZA 2IMNA 3QPXH 4YR6B 1DE4B 3V6ZB 5JLZB 4MNQB 4PY7B 1KCLA 5IBLC 4K7PY 3VFVB 4M7ZC 2OMBA 3F7VB 3C60B 2OS7A 3MZGB 1LE9B 5GGQL 4D8PA 3INUL 1DN2A 1KB9J 1TCRA 4WWKA 2ESVA 3PWJB 4UQ3B 3VXUE 3NZHH 4OFKA 4Y7MA 3N1FC 3H9ZA 4Q6IA 1FORL 4OGAD 3SHSA 4RX4D 2I27N 1LDPH 1J1XL 4E0RB 5D9SA 1XH3B 3BYYA 3WCYA 3QZWG 1FL6A 2HFFA 3T0WA 2IAMD 1XCTA 5DEGB 2X1WL 5D72L 5DD5L 5DJ0B 3TVMB 4HWNA 4XPFH 4JQVA 5HHOA 3ZE0F 4F7TB 4P4RA 1LK2B 5GRJH 2DTMH 1YYML 5DSCA 3MRMB 3MXWL 1X4YA 3T0EA 4TSBH 3LMJL 4F9PC 2XNAA 4L29A 1CDUA 3N1PC 3QEQD 1EO8H 1WFNA 5B38G 3UDWC 3SJVA 3JVGA 1U8NB 2CDFB 4DGYH 2V17L 5B3NA 1H0DA 2DYPB 3CPLA 3WIHL 2WP3T 5KZCD 4JFHD 1RVFL 2VDOL 1BJ1J 4B50A 1S9KC 1W0WB 1KF9B 3VG0H 4QGYA 1GZPB 3ZDYE 3DXAA 4HXAL 2UZIL 2F54B 3QDJD 3HPLB 4L8CA 1CGUA 2SEBB 3GUTB 1A6TA 4YDIL 4NNPL 4FZ8L 2IADB 3ULVH 5E1HB 1D9KB 3U7WH 1JGDB 4FP8H 5HGAB 3L3DB 3OMZA 1U8JB 3U30B 3BI9X 4FQIH 5DD1H 1X5LA 4NJAL 1DQQA 3GHEL 4UNUA 1E27A 4LASL 3BKML 4GXVL 2NW2B 3FB5A 4Q2ZA 5C09E 1EMTH 4PJEA 1FIEA 3TH4T 1WZ1L 1ND0A 1CQYA 5IR1A 1UKTA 3G5VB 4F33A 5IVXF 1R24A 5IJVA 1I3GH 3P9MA 4LQFL 3SN6N 3BDBA 3L7EA 1CQKA 4G7YL 5E2VH 2Y6SC 5ITFB 1MCLA 1A2YA 4RAHA 4X4XA 1DUYA 5ESVB 1MVFA 3BGFB 3O8XD 3K0WA 4PJAA 1ZS8A 5D93B 3M45A 4H0IA 3MOBH 1SJVA 1F2XK 4GRLC 1NDGB 4G6AC 3HN3A 1OAXL 3HC3L 1CDCA 1T4KB 5C0CA 5DJZA 1XIWC 4V1DE 3GM8A 3RKDC 5GRVL 5IT2L 3EO9H 2PCPB 3T08A 3GO1L 3U9PL 1OT2A 4ELMB 2AKRB 2I5YH 4R0LC 5I8CA 3FCTB 3PXHA 4M7LH 5F88A 1W8NA 1I1AC 3C5ZB 4MVBD 4ZDHB 2WZPD 3TA3B 1BJMA 4G3YH 1NMCB 4JZJA 1IILE 4P5TC 2Q86B 3F6LA 1GZQA 3T0AA 5E5MB 1QBLH 4NC0B 1KGCD 1OW0C 3VXRB 2YD2A 2G60L 4O4YH 3D85A 4LOUD 1EEYB 2DWEB 4JCMA 2ZUXA 5IVZB 5GISH 3U4BL 4UV4L 1AD0A 4NSKA 3ZSTA 4G43B 4WTXA 4IOFD 1C1EL 2AEWA 5KN5B 5I0ZA 2GSGB 2JB6B 3KGRA 4MMXC 2YBRA 3ROOB 5DJ8B 4HLZG 3DUUB 5HI4C 5HHNB 5EZOL 3DYMA 1MH5B 3LH2L 2O93L 3S6CA 1RPQA 1JHLH 3EYSL 5M95B 2R29L 3BAEL 4JQVC 4L4VB 3X11B 2EO9A 4V2CB 5GGTL 1WZKA 2KL6A 1KIQA 4JZNB 5J12B 3H42H 1HILA 1MCIA 1JV5A 3SE9L 2W07A 3HA0A 1E4KC 4NQCE 5JW4M 1VKXB 4QGTA 2XWTA 1UM5L 4U1NA 1KN4L 1C16A 3UAJC 4NPYA 1EHLH 4J6RH 5E4EC 5TFSH 4AENB 5FUOH 1N6QH 2XZQH 1ZGLP 3S3JA 4N0FA 5F9OL 2BNQE 1HQ4B 4CN1A 4MHHG 4V1DB 5A3IC 2WANA 1HKLL 5I1GL 1A7PH 4X6CE 1ZAGA 2BY2A 4YFLI 5C6TL 5IFJA 2NMSA 3B5GA 1MVUA 5BRZB 2NNAB 4G6JL 4QRQA 3RVWD 2R69L 1FVDB 3OHXA 5BRZE 2D31B 1MIML 3RP1A 3GNMH 1G6RB 1YY9D 1DSFH 4K3EL 3V4VL 3MLWH 1FO0H 3TV3L 3GZKA 3VXUD 1HXMA 3DETC 3UTZB 4UTBL 1H9VA 1JE6A 2IPUK 4HV8B 4HIEB 5HTSA 5CGYD 4JKKA 3RWJA 1DBBH 3FQWA 1EXUA 4JFED 4RDQF 2R29H 5B39B 1G6RL 3KYMB 3PWJA 1ZKAA 4OCRL 5F8RC 4HWEH 3V6BR 3BUYA 1WSST 5CIPA 2PTUA 1XGPB 3LN5A 3CC5A 1CU4H 4HBCL 4PJDA 4RGMC 2P24B 2ZCHL 1FLRL 5ITBH 2EIEA 3EUUA 1U92B 5DLMH 1YNLL 4N0UE 5EA0L 2ARWA 3O45B 2Y5TB 2DF3A 2DYPD 5HYEA 4OZGF 4F15C 1T5WA 3KYKL 1P4IH 4KMTL 5ADOL 3GSNH 5HYQA 4GG6A 4LLDB 1F4HA 4KGJA 3SO3C 3BSZH 1EA9C 4Z7OF 4JFYA 1FCGA 1W0VB 4KK6D 1CE1L 5HD8D 2YPLE 5L88H 5MI0C 1FFQA 1NCTA 3QIWB 2YD5A 4JFHE 5TQ2H 5LGJA 1ORSB 4XP5H 2OXHA 4LPTA 3ZE1E 4M6NL 1IM3A 4X4YA 2W9EL 2MHAB 1C08A 3LEVL 4M93C 3LEXB 1A4KA 4XPBH 2O5YL 3MRDB 2HFEA 3EOYG 2X1OA 2G75B 2D2OA 3GMPB 4ZUVA 4XVTL 5C0RH 3MXVL 4G8IA 1S9YA 1IAMA 2NTFA 3LKOB 5ILTH 3TGXA 1FJ1B 5DVOA 3VFGH 3TFKD 4F7MA 2XZCH 4W4OC 1JNNL 5DGQA 1JF1B 2DM2A 5IESL 1UYWL 4R96A 4LPUA 5BVPH 3IETB 4LIQH 1YY8A 4HWBH 4OZIF 2VDPH 4S1DD 4EI6B 2DWDB 4F8TA 1N4XL 2LFGA 1CR9H 4HC1H 5CGYC 3PWNA 4B0MM 4NIKB 1T20A 2R0ZL 4TTDC 4W70A 3NACH 4YWGH 2WIIA 3BZDA 1AGCB 1OAUH 3CDGB 4P23B 5DRNB 4JZNA 3SQOH 3IKCB 1NPUA 4G80A 1QRKA 4R4ND 3GI8H 1S7WB 3CFBB 3LAFA 4XCFH 3ZE1F 4JN1L 1OP5H 3C2AL 2VLLA 3MPCA 1KB5B 4JANB 3IDXH 4NOFA 1AHWB 4JFFB 3LS5L 2EDHA 1AKJD 1P6FA 4HCRL 4LLMB 3MLYL 4JO2H 1C5CL 4MCZB 4G6JH 2J8UB 3BPOC 2E9IA 4KH2A 3O8XB 1V7MH 4HIXH 2F58L 1VFAA 4PY8J 1HHJB 2YUWA 4Z7OE 1KJ2H 4P3DA 3DURB 5EOCJ 2R2BA 3V4UH 4Z95L 4JR9L 5EUOA 5IFHL 1QR4A 4FQQA 4QRSA 2AV1B 1QNZL 2DLIA 3PUCA 1UB5A 2AEPL 4CMMB 2VJXA 2OR9H 5H35A 4KTEH 4O00A 1B90A 3GMLB 3PL6A 4OCWH 4PJHF 2VXTH 2WQ8A 4NO0B 3A6CL 4TVPE 5DF0A 3WN5A 1E27B 1MFEH 4LLMA 1KGCE 2F8VA 3LKRB 1OTTD 5E9DD 1JYNA 3U7AA 4NNYB 5T5NG 4AM0A 1SVCP 2WQRA 1LP9A 1W0VA 3QSKB 2A6KB 4APQA 1WUNT 4CAGA 3UTPD 3RY6A 4K71C 2UWEE 3N85L 2Z93B 4BSVA 1MUJA 5EZOH 2NXYB 3W9DA 3VD7A 2A73B 4ORGA 3GMPA 1OL0A 4ZUVB 1XF4B 4I5BA 2F8XC 5I18L 4AIOA 2B8OT 2DQJH 2MHAA 1SEQL 3PL6B 3STBA 5CBAA 2R2HB 2VE6B 3OKKA 5CJ5A 4XAKD 2VR4A 3MLYH 3W2DL 4JG0H 3DMMC 4OLVL 3PP4H 4P59H 4I1NB 1VEOA 1HWGB 4XNZB 4X6EA 1F6FB 4X7TA 3T4AA 2XIDA 4F7MB 4N8CH 3ROLB 4NN6C 2KKQA 3C5ZD 4OJFL 1X6LA 2IANE 4JZJC 4NP4H 4N8VB 4KKBD 4YBQC 4EOWH 2Z8RA 4F7TA 4DGVH 4G7VL 3F62A 3GJEA 1O7SA 4Y16C 3VXPB 4DUWA 1SYVA 3FL7A 2Q6WB 4PLKC 3OXRA 5CUSL 3X12A 1XT5A 5GRYA 2VLLB 1A7PL 4PJCF 2GSIA 2IBGA 5F9AC 3BX7C 3CVHA 3U4EB 3IKCA 2QQKH 5CEZE 2LU3A 1RJYB 2BK8A 3MUGB 1A7QH 1NLBH 1NJ9B 5AYUH 5ADPH 2ITCA 3IJSB 3B5TA 3VXNB 1HQ4A 1CD0A 5IBLD 5F7EL 1AR1C 2IFFL 1NCAH 4UIKL 5IBUG 2XKUA 5CP3A 2OL3H 4YPGA 1U91A 3LVEA 4MGXA 4W81A 4JCLA 2VIRB 3E2HC 3U1SL 2F5AH 2I9LB 5TE4H 3OKMA 3CH1B 2PF6A 2C4FT 1IAOB 5I1EL 5BZWB 1RUPH 2BOCA 1PVHA 4JPWH 3W2DH 5EC1B 4IRSC 2MCPH 4U0QB 2FX7H 3OZ9L 4NQDE 5T1LD 5A1AA 2XN9D 1G9MH 1FFNB 4F7EB 3MV11 5BZDB 4KXZH 4ZPTA 1KULA 3OAYH 3O2DH 4JQXC 4LHUB 4EVNB 4XCEA 5TGBB 2Z0BA 1M7DB 3NFNB 3CVHH 3MBXH 4YDKL 1CDHA 2A6DA 2Q87A 5GS2D 4JG1H 4R8WL 5IHBA 1JIBA 4UAOC 4F7PA 1XF5A 4UV4H 4QHNA 3HCVA 1MRCH 4M3JA 3WFBH 4PBXA 4FFVD 5KW9L 4L4TE 4FQLL 4ZUWB 4ALAH 5ETUB 3QUYA 1UZ8A 1L4IA 3FT4B 4XPTL 1RJCA 3HAEA 1BQHB 1IKFL 1FRGL 2Q8BH 3GSUB 3GI8L 2NCMA 1ZV5A 1IC4L 3QDGE 3L5WA 2Y7QB 3AGVA 5C6PB 2EDOA 3W0WA 1J8HA 4K55A 1C5BL 1NAML 3WDIA 2CXGA 4U3XA 3U46A 3HE6C 3TBWA 2C4XA 4YHOH 5F9JA 4CVZB 2R0KL 3GK8H 5C0IB 1QSFE 4HS6A 3ZTNL 3MRLB 2VXSH 1J0IA 3A6BH 1UYWH 3B9AA 3DMMA 3FOLB 3QUZC 2YMXH 4FTVD 1WIOA 4HFWA 2HTKC 4LIQL 2Q7YA 4JHWH 3LQZB 2IAMC 4NBYB 5F72S 4G8EA 4O5LH 2HT3C 1LO4H 1AC0A 4JDTH 5T1DH 2VLJE 4HWBA 4PTUA 3C8KB 1KEMH 3BKJL 4PJGA 4MD5A 4XP6H 3WNOA 2EEBA 3K4AA 1LGVA 3QUML 5F71A 2OJZH 4DOHE 3MRNB 5FM5M 4MXWL 1NMBL 2FEDD 2WBWB 4TULL 4Y19D 3PP3H 2FWOA 2YPVL 1KJ3L 5F7DA 4LARH 3TT1H 4JY5L 1QPXA 4AG4H 1P4LA 5ITFA 1F5WA 2LE9A 3FFCE 1IAII 1U8OB 4C57C 1MQKL 1RZIA 1HOCB 3DO3A 3EHBC 3K1DA 4F3FA 5HVGB 3NA4A 2IC2A 4WI7A 2R1WB 1QACA 3IDYB 5BMFH 5DYOB 1JRHL 1D6VH 4I4WA 4Y1AE 3C5SA 1XGYH 3EGSA 5BS0E 2DQIL 1G7HA 4L3CA 4C54A 5JOPE 5FYLE 1LK3L 2BX5A 3KWWB 5FCSH 5MHSD 1GGCH 5IP4A 5HI5D 4RMUA 1MCHA 2FHFA 4PYHA 4NKDA 3BP6A 1I7TB 4ZS7L 4CVXB 2GW5A 3PHQB 4HEPG 5F7YC 5B39G 1G9MC 4M48H 4ODTH 3AMKA 3VGDA 4PGCB 3NCEB 2XPGA 4P4RB 1U8KB 1UA6H 4OZFA 3IDNA 3QI9B 4ISVA 3RWFB 4L1HA 1L7IL 2A6JA 3NN8A 4JKPH 1K2DB 2VITA 2V5MA 4XC1L 3QXDB 2NY1C 5DK2B 1YUHB 1XCTB 2OR7A 1TVHB 3RVTD 2VZOA 4P2OB 5EOTA 2X4OB 5E7FA 4EDWH 1VADA 2BSTB 2HLAA 1A1NA 5JW3H 1CD8A 4GRMB 3FO2B 1JPGA 1A1OB 3FQRA 4WW2F 4FZEH 2BNUA 5FO9B 5I74C 2OSLA 4TQEH 5BVJB 3WIIH 1MF2H 4XAKE 3HE7C 4PJ8D 3V52L 2R2EB 3FHQA 3PP3K 3GKWL 4JFDA 1NCAL 4UIKH 1I1YA 1NC2D 5JHDE 2YK1L 3L3DA 1TQCC 4TUJA 4POZC 2EE3A 2DQFB 2IADA 5JXAL 5I8EB 4R2GB 5B8CC 2J88L 3LRSB 5DRXA 4X6CB 3MLRH 5EO9B 3B5HA 4ZXBA 5DJZB 5C70A 2QV2A 4IM8A 3HUJA 4FN0A 3NFPA 1CI5A 4KJQC 5ANMB 3MOAH 3L3GA 1N64L 5I1KL 1WEJH 4MA1C 4IRJA 4H1LH 3IU3B 5DA0B 4X5XB 3DX7A 4N0RA 1BZ7B 1N8ZB 3TJEL 5MEQA 5EU7E 2PO6D 1FGVH 2WINA 5SWSD 4LHUD 5GS1C 1CFTB 1AGFA 4OTXL 1ZHBB 4U7MA 5CEZD 3SDDD 2VXUL 1RZJC 4XBEH 5LVEA 4HJGA 3PIQA 5GS2H 4YHIB 4N0YL 4JGMA 3HE7D 3BMWA 4D0DB 5I19L 1NGPH 1TTFA 3JWDC 2H32H 1BP3B 5SV4A 5HI4D 4M61A 1KEGL 3I6GB 5D2NB 4TUOA 3HAEH 2XRAH 4NUGL 2WBJB 5I1CL 3VXME 2E7BA 1P6AB 2EDNA 3O4LE 5IK3A 43CAB 1OB1B 5C7XH 2NXZC 1FL5A 4O2FB 4G6MH 1PAMA 4PRNB 5GRZA 4F80A 3OGOE 1NFKA 5I73C 1F4XH 1HNGA 2ITDA 1FIGH 2JCCA 2B39A 3BXNA 4NQEB 4PV8A 4NQDD 5EU3A 1BF8A 4I0KA 3DV4B 2RR3A 1QO3A 4FXGA 4WW1A 5SWQB 3H3KA 4UOW0 2APTA 4RFEA 1A0QH 1U93B 4ZNCD 1MHCA 4KQ3L 3BOVA 1AJ7L 2QSCL 5FECB 2W60A 3SJVB 2QQLH 4H25A 5DQDH 2ATPA 1CGXA 2IQ9H 1A6ZB 5CINL 4EN3D 12E8L 1HHIA 2DM7A 3E6HA 1F00I 4ELME 3O6LL 4FNLH 2NY5L 1JWSA 2O5XH 1H15B 4MD4B 4E41E 2GT9A 4PJXE 4YC2C 4N1HB 5FO9A 5JDSB 3G6DL 3ILQD 4HJJL 4YBLB 1YEJH 3VGAC 4LCUA 3E1F1 5BV7B 3B2VH 1E28A 1NQBA 4L8SA 4Q9QH 2D4DA 3P0YH 3EO9L 4KHTL 1AO7E 2UZXB 32C2B 5DDHA 1MI5E 1RUAH 4AEIL 5DK2A 1BOYA 4FQIL 2BNRD 2D7MA 4WEBH 3NPSC 2PO6A 4XRCA 4NZUH 4BKLA 3FB8B 1OGTA 3UP1A 1K5NB 4QHMA 3DXAD 1D5IH 1CGVA 4JFQB 4M43L 3DVGB 5D7LA 2EXWD 3JWOH 1A6AA 4JO4H 2NY0C 4AH2B 2DQCH 3D0VA 5FGBC 3ARDA 3SGJC 4HPYH 5DTFA 1QBBA 4M5YH 1NBVH 4PJ5A 4X8XA 2X05A 4KK9D 3V0AC 1UXSA 2ZUWA 4IOIB 4OD3L 4XNYL 5DMJB 4K3JH 3QPQC 4K7PL 3TCXA 4L3ED 4GRWE 4B53A 4PR5A 1MCDA 3OGCB 2MSPA 4O4YL 1ITCA 4XCYB 3RDTD 5KSAA 5CEZL 3L3OB 3T0ED 3MLVH 1A6AB 4ZS6D 3BVNB 1GGCL 1ZLUK 3GSNA 3O6FD 5D7KE 5I1EH 4R0LA 4JJHA 4KROB 5GGTH 3LKPA 1ZANL 4M7LL 1BFVL 1YMHA 3HZVB 3BD3A 3U7WL 1ETZB 3ZKMD 3TP4A 1L6ZA 4DTGL 1GC1H 3CFCH 4LSPH 5IV2A 1LO5B 4A6YH 1AFVH 3MRIA 1MJJA 1FIGL 3BT2L 1U8QA 1QTYT 3GSRB 2BOBB 2W65B 3ARUA 2BDNL 1I1FA 3CVHL 3LSOA 3MBXL 4K94L 4PTUB 1KCRH 1QR1A 2YSSB 4LCCC 1RURH 2HKHH 3V8OA 4LLWA 2Z92B 3OAUH 1MY5A 4PJDF 5I1IH 2OL3A 2P5WE 3L5IA 2WIMA 2X09A 4CJ0A 4M4PA 1NC2B 2DLTA 4OFVA 43C9B 4FA8A 4LLQB 3V4VH 5KBNC 4L8SB 3WFEH 4RGNE 4XHQA 4XPHH 3NIGE 1QHOA 1FL5B 2HTLC 4YHOL 5E08L 4YHPB 1ZHNB 3QFJA 1XF2B 2VH5L 4HX1A 5GGRA 3A67H 4GBXC 2DD8H 4LNRA 3H9YA 4W6XB 4XZUA 2DQDL 3ARFC 1B4JL 2A6IA 4MCYB 1R0AH 4PJIB 4X0KA 4LAQH 2GY5A 3F8UB 1TDQA 5FKPB 2OLDA 2K9UA 3MV7E 3WUWA 1BHGA 4JVUA 4I18B 5BW7A 1M7DA 1XCQB 1GGBH 5H94A 5E8DH 1JFQL 2NZ9D 4TPRH 3UMTA 2OTWB 3O3AA 3QI9A 4OKVA 1KTDB 4IBLT 3HR6A 4HLZH 3GSVB 1F42A 1YQ2A 3MA7A 4CN4A 3QUMA 1CE1H 4YDLB 4IS6B 4X6DE 3O6FC 5GJTH 4PJBA 1MJ8H 3VH8A 2AK4B 4RMSA 2VKWA 4UNVA 3VXQB 3IDIB 2MQCA 1ZA6A 4DVRH 1KXVC 3TYFB 4F8QA 5CGTA 4ESKA 4V2BA 2O5XL 4NHUA 1OM3H 2Z91A 3SE8L 4WDIA 3ULUE 3MXVH 5AD0B 5BVJA 2BCKB 2HRPH 4EUPB 2QSTA 3WLWC 5DHXB 5F3HB 4QHLA 3V4PH 3QPQD 3K80A 5DYOA 2W65A 4JQIL 3G5YB 1TJHL 5C1MB 2VO5A 1MJJB 3CFCL 2HVKB 4P4KD 5LG1A 1AFVL 1A3LH 3DRQA 3UCRA 4BJLA 5E4IA 1ADQL 4FQHA 3IFLH 5F7NC 3LKPB 5DJ2B 1MRFL 5C8JB 4OFYA 2PW1A 3L3HA 1OAUL 3QIWC 2XN9A 1ZWIA 5GS0D 4HKZA 3WHXA 4FABL 5C3LD 3ZT6A 3HNVL 5ENWB 3TJHC 5TJWK 2B0SL 3DECA 1AGFB 3LEYL 4R26L 1QBMH 4OZIA 3JBG7 3U0PB 2OYPA 5IG7A 4YGVA 5IROA 2VZSA 3KJ4C 4ISVB 3RWFA 3STZB 5KTEH 4LCWA 5FYLH 3MRPB 1B6UA 4NZJA 1BM3H 5CGMA 1P2CA 4Z7QE 5KVMC 4G9FD 1KTLA 1E4WH 1T2QH 3DIFA 3F12A 4POYA 1KPRA 2R56L 2V6HA 5DD3L 1JWMA 5I8OH 1UB6A 5IGXL 1OCWH 2FLBT 1INQA 5HVHC 3KYNA 3WS3B 1CFQA 3V4PL 4I0PC 4PD4K 5E99L 3VD4A 4N90D 4JB9L 3IU4H 2ESVD 4UT6L 3MR9A 1I3VA 5E5RB 4LCIL 5C0BE 5IB4A 3MBEB 5DEFB 1O5DT 4X6CF 1QRNA 3QIUB 1AGDB 5A3ID 3QIUA 4PGDA 2AJUL 4TUKL 2EEDA 1AH1A 1BD2D 8FABB 4LSVH 2HKHL 2HT4C 1HHGB 4XT1C 3HG1B 5AUMA 4F7EA 1NGWB 3FOMA 4OF7A 1IM9D 1F13A 3K2MC 1BVKA 1PX4A 1LEIB 5EWIH 3KPSA 2WBJD 3LRHA 4FQLH 2UUDH 3H7BA 1OWWA 3NH7L 5L2KD 1MLBB 3N85H 5GZOC 4XBGA 1G7HB 5D7KD 3SPVA 1R5IB 1FNFA 1RUMH 4GJTB 4NUJB 2CGRH 1AHWA 2BMKB 3VFUB 1OLLA 1CG9B 5HHPA 4YXKL 3B9KC 1DANU 1C5DB 2HRPL 1EAJA 4H0HB 2PO6B 4NDMB 5TE7H 4H1LB 2DB8A 4ZSOE 1UH3A 1PBYA 4DGVL 1QQDA 2AK4E 3VFTA 4HKXB 2UVEA 1A7BA 1KNOA 3WNPA 2XTJE 3RVTC 2J8UE 1ZLSH 5C09B 1SJHA 3V6OC 3L7FA 5C2UB 3JZ7A 5DS8B 1W72A 1RU9H 2PW1B 4QTHB 1ZGLA 1WAAE 4F9LC 3UPAA 1BQHA 2YS4A 3CDYA 3O2VH 2FLRT 4LLYB 2VLKA 2PXYC 3SKOA 4ZUWA 1CIDA 3MA9H 4CDGC 4DVBB 4LBEB 1WBZA 2QR0A 3DBXA 1I9JH 4RGND 1F3JB 4F7CB 5MENE 4MVBC 1FNSL 3CMGA 4NQSA 3SDYL 2ILLA 4WY7H 4MJIA 1MCRA 4MDJA 1EDQA 4MAYA 4U6HB 2I60H 5A2LH 1D6VL 1AKJA 1BEYH 3NAAH 3NIDE 3UDWA 3MGTB 5L0QC 3QIBA 1B2WH 4Y16B 1NL0L 2EE2A 1MAJA 3OAYK 4OJFH 5MENA 1HYSD 1LO2H 3WS6A 3BGMA 1WWWX 2GUOA 5D6CA 4C58B 3V95A 3BP5B 2X4NB 4FQ2L 4CMHC 3WJLA 1E4XH 1IAOA 4M8QA 3UYPA 1JHTA 3L1OH 2H41A 4Y5VA 3D85D 1J8HB 1Q0YH 2O61A 1JP5A 5FFLA 5HY9A 2ZSWB 3TM6A 4PG2C 2X4RA 4JPVH 3O3UN 4OCXL 4K23L 5ID1B 2NR6C 3BH8A 1KN4H 3P4NA 3UBXB 1CLOL 4HHAA 5JW4R 4ZUTB 2BJMH 4JVPA 1B4RA 2NXZD 4X4ZA 4ENEC 5FCUH 4ZSOA 3BYTA 1ACZA 2HWZL 1T2XA 3MJ9A 1ES0A 3RPIB 1MCPH 3HNVH 3HC0B 3U36A 4ERSL 1LQSR 3F7YA 3AM8A 3OKMB 1C5BH 1UACH 1QKZH 1JGEA 1ZANH 1YEHH 4LU5H 1UH4A 1FNSH 1N5AB 1IGJA 5B4MC 1UM6L 1SEBA 2XA3A 3O6FA 3Q6FA 4J12A 4NNPH 3VXNA 5DMKA 5IW1A 3VXSD 3TV3H 5BXFB 4K3HA 5H2BA 2XZAL 3H3PL 3I2CL 3CZFA 4UB0L 3RDTA 4QRRD 1I8MB 3HE6A 1I7TA 4O5LL 4CVXA 5FYKD 1BIIA 3CH1A 1YNKL 2VXSL 3D0LB 3RWIB 2MKWA 1RURL 4UOW1 3CJJA 2YMXL 4UBDD 1T7ZA 1JYVA 1A3RL 1HI6A 2ED8A 1RHFA 1QRNE 2FYYB 3SDAC 3ARDD 1CD1A 4HUVB 1D9KD 3M1BA 4QOKB 1OTUD 2CO7B 3LCYA 3GMLA 3UJJL 5C0AA 1CLZH 1XAUA 1I1FB 3LSOB 5DJDB 1IKFH 1UKQA 1DUZA 4X6BA 2Z31C 3MOQA 5EOTB 1P7KA 4PJ9B 3WLBA 4W4OA 3H8NA 3T77A 5BMFL 1IQWH 1ORQA 1ZVSA 4NNYA 4QXTB 3LN4A 1TZIB 5E1AA 5ADOH 1UXWB 3QT2A 3QDJA 4ODVH 1ZT7B 4RA0C 4YUEL 3PXJA 5SX5K 2AW2A 4OM0L 4LRIA 2B5IC 1JGLL 1Q8MA 1MCSA 3BH9A 3HRPA 4XNXL 2G5BA 3KXFE 1JPTH 4ORGB 4A6YB 1NSNH 3RNKB 3RNQA 4PJCE 4JREC 2JJTC 5HJ3B 3CXHJ 3UJTL 1QYGL 3F7RA 4YBHA 3WIFA 1LO4L 2JIXB 3VXRA 1DBKH 3ZE2E 1Q9WB 3LQAC 3QEQE 1P7QB 4XPGL 2P8PB 4LCCA 1FNHA 3TVMD 4ODUA 3WKML 4U1IB 4RZCA 1NGQH 3SO5A 4QRTA 4YHNA 4MXQD 4GRWF 1DTUA 5ISZE 1KJ2B 2C1PB 2G60H 1MCJA 1JZ2A 3BH8B 4KDWA 1EFXA 3AVEA 3OPZH 4KKCC 4TOYL 4K3GA 4Y4FA 5IWLA 3IETA 1EUUA 3O6ML 3P4LA 3W5MA 2WUBL 3IS0X 1Z3GL 1EAPB 3RHWK 4N8PA 4JKPL 3P73B 1JRHH 3JTTA 3K2UH 3TBVB 3TO2B 3CX5K 3W39B 5HJ3A 2D03L 4KAQL 4PJFA 2G5RA 2UZYB 4JM2F 4CNIB 2QKIB 3LH2H 2IJ0C 4DAGL 5IOPA 3QRGH 2CGRL 1H3VA 2E6QA 3VG0L 4HSQA 5KSAC 1R3JB 2NZIA 3AU1B 3NPZB 3HMXH 4WWKD 2FD6H 5FGSA 5F6HI 1WWAX 3RZCD 4X4MA 3W11D 2DKMA 5KSBF 3SBWA 1S3KH 3T65B 3GKWH 4ZPTB 5IBTH 3RVXC 4JLRA 2DLEA 3QNYA 1UQSB 3R8QA 1IGFH 3RPIA 4WGWB 5SWSB 4DZ8A 1PJ9A 3ZDZE 1JHKH 3QA3B 3BKMH 4J6RL 2BHYA 2A83B 5I15L 4P2OC 1T89C 1CTOA 1YPZB 4PGEB 4ZUTA 3OX8A 1SYSB 5JW4N 3O0RH 4OCWL 3DHJA 3EDEA 4OTXH 5D8JH 5K9OB 1S5IH 5IB5A 2EO1A 1IL1B 3MJ8A 3GRWA 4UIMB 1EHXA 3UO1H 2XKNB 4M3KB 2PYEE 4U1NB 5CLWA 3MV7A 4ZXBD 4UT7H 3HC4L 5C07A 3ALPA 3T3MF 1PLGH 1GOFA 1YEKL 3BFOA 35C8H 3TO4B 3MODH 3MLZH 3EDFA 3OL2A 4HS8H 4N5ED 1OQOA 5I16B 4HD9A 2VDQH 4KAQH 5D1QB 1KEGH 2LTQC 3ARGD 4I0PD 3SCMC 4HT1H 3VWKC 4PJ8A 4QHKI 5CIPB 1LD9A 3S3SA 1WVZA 4M6NH 5EN2A 3AXLA 5EC2B 2NNAA 5LAXB 4L9LC 4LBEA 4JGJA 3U7YH 3W9EA 5L6YH 2VAJA 5FB8A 4E41B 1FQ9C 2Y5TA 2P5WA 3KR3L 5BO1H 5BJTB 1ZHBA 3L5XL 1N6UA 4M5ZL 3MYJB 4QTHA 5E94A 4AMKL 1ZGLB 5F89B 1N26A 1MPAL 1BX2A 2P42B 5F1IA 3LN5B 2X42A 4TNWK 1JN6A 3EOBB 3VD5A 5IHLB 4IIQB 5FYKH 3HMWH 4Y2DA 5E2UH 1DLHB 4HIIA 5D7IB 2NY5H 3CSBA 4GAJL 2BVYA 1I9IL 4N5EC 3CCHA 3LQAH 4KK8D 2ZSVA 3DUSA 1WITA 3OG6B 2NY6C 5E6IC 3RWDB 2FGWL 4YQXL 1KIPA 1G0DA 2X7LB 5C86A 4OV6F 4ZFGH 1JPSL 4ZO8A 4AENA 4N9OB 5T3XH 4KHTH 4AEEA 4WO4D 3P4OA 5FUCE 3BE1L 3GIVA 4OD1L 3BP4A 3EOAB 3OR7A 2EH8H 3QEQA 2J8UF 1NGXB 1CGYA 3VFWA 3VXRE 3DX6A 4U1JA 1CE6B 4Y5YB 3QBTB 2NY6D 5E6ID 2VQUA 4PJCA 3MRRB 1QNZH 3JV4B 4PJ5E 3ZKND 1K2DA 3H3BC 4PGDB 5JQ6L 4WJ5B 1R6VA 1T1ZA 4ZOCA 1MFNA 5BRZD 1BFOB 2X4TB 2Z31A 5DHVB 1F2QA 2ZJSH 1WTLA 4FXLA 4MCZA 4NNXB 3WUZA 5BV7C 4XVJH 1A6WH 3ARVA 3QXAA 1ULVA 3HB3C 1KIQB 3SDAA 5HYIA 1WT5A 1D5ZB 5KAQG 5C0AE 1MI5A 2RCSL 2NLJB 5JPMA 4OZ4A 4P2OD 2WMPA 3CFKB 4G5ZH 2LU4A 2QQQA 2R1XA 4X80L 4NPYB 1JVKA 1RUAL 4AEIH 1RIUH 5I17B 2JB6A 2H1PH 3VH8G 2A9NH 3FO1B 3QDMD 1K3IA 4NO0D 1P7QA 5DMIH 4ELMA 4YDJA 5HGDA 4RGOL 2QBWA 4HKJA 2NR6D 1MCOH 3F5WA 5HGBA 3L7EB 5DZLA 1KJMA 5FA4A 4K94H 4ZD3H 1EJOL 2QJDA 3ULVL 2VN7A 4OCXH 1ZHLB 4Z0XB 4U6VL 3U4AA 5ISZD 2UYLB 1QRNB 1Z2KA 2Q86A 1MLBA 4C55A 5I8KH 4V1DD 2CH8A 1FVEA 4AMKH 1SY6A 4K9EC 4H8WL 4EI5A 2FJHA 4ZQKA 3LZFL 3SKNB 3ZT5A 5DEGA 3SDXF 5IMMA 4PRPB 5T1LA 2LVCA 3WEXB 1A02N 2IGFL 4XPHL 4YDJB 4LLDA 1FZOA 2B0SH 4JO3L 5C08B 5E08H 1RK0A 3GGWB 1NFIB 1WBYA 5EUKB 2X9YA 3I9GL 5LBSL 1QSFD 3SPVB 1KXTB 2P47B 5JUEL 5CHNA 4WDIB 5KVEH 3TN0C 4K8RH 3VXMA 4I48B 25C8L 4OIIL 3QDAA 4ZFGL 1ZS8B 5DC9B 3UBXG 3U0PA 2G2RA 3QIBC 3FN9A 2VB5A 3U1SH 2DS4A 3FFDA 1JHTB 2R1YA 3VU2A 3K8LA 5KSBB 2VLJD 4YR6A 1CDGA 3WV0A 3FTGB 3CCHB 4IHOA 3WJLC 1JK8B 4Z7WE 2HN7A 2BY3A 2C7UA 3DIFB 3MO1B 4NRZA 5HGHA 1W0WA 3DHMA 2X6MA 3EJYC 4HIJB 1OAQL 2VDKH 3NACL 1I8IB 2X9WA 5KSUB 4MJIE 1EEQA 4M5ZH 5I75C 3HUJE 4JKWA 2ORBH 4F9LA 5JW5A 1MCFA 2ZUTA 2AXGB 4WV1B 3RWGA 5GJSL 2VLKE 3GJFK 3QQNA 1U8MB 1WIUA 4PBVC 3BEVA 3GKZA 2W91A 2Q7NA 5JHDA 1WAAA 5EWIL 1JPTL 1DBMH 1EIBA 1I1AA 5CJXA 1NC4A 4I18C 4JAMB 1IEAB 4WIQA 3UTSA 4JDZB 5JMOC 2DLGA 5J6HA 3KPMA 1QLRB 5JR1H 4P5TA 2AK4A 5JIIA 4NT6A 1CFSB 2V5RA 2XQBL 1AHWC 4LAJH 2MQ0A 3UYRH 1HHHB 2H8PB 2YWZA 1BVLA 4APQD 3CMOL 3ZTJH 5HHPB 3LDBC 3EDKA 2LVEA 5D6DA 3ULVE 4D0CA 5IB5B 2VAAB 2JCCF 3GHEH 4HXBL 1RZJH 5M94B 3GSXA 4ODXA 1G6RA 3U82B 2P44B 5CFHA 1PSKL 2GTWA 4P5MA 3X3FH 5BJTA 1FAIL 3DETD 4JM2A 1JTPA 4KKLD 5TQ0H 4PTTB 1ES0B 1FRGH 2Q8BL 2DI8A 4JEGB 4L8BA 4TVSa 1I8LA 5F3HA 4P9HH 3VWJB 1ZLVH 5AD0A 2JJVA 3T0DA 3OQ3B 4XC3H 5CJOH 5I19H 5C9KA 2DIBA 4GSDH 1KCVH 1MAMH 1HWHB 4PGZA 1YEGL 3LKSA 2RB8A 2NY1D 2ZZUT 4K2UH 2MWCA 5BS0A 1F3RB 3KPTA 3UYOD 5C0BA 5D7LD 4Y5VB 3MLWL 1LEGA 5KVEL 1NH6A 2NY5C 3D3VE 4UTAH 4JRXB 5KZCB 1DVFD 1HQRB 4EQ3A 5DR5L 1IGIH 1HIML 4TSCL 4WUKH 4H1LA 4XP9L 5GRXG 4KY1L 1CK0H 2AEQL 1OGAA 5TE6L 3CK0H 4PJ5B 2KQNA 3F7VA 4PRID 2YA0A 3RPKA 1BD2B 4KTDL 1F97A 4YIQA 3QUZD 2VLJA 1KPVA 5D93C 1H3XA 1X4XA 5ESAB 4OF8A 4TYUA 2MTPA 3R4DA 5DJXA 4YXHL 1PZ5B 3CFIC 4OZIE 4U0RC 5KTEL 5C08A 1CLCA 5EA0H 1DN0B 3PQYA 5EZIL 3QH3B 4U05A 4F57L 3EJJX 5T1LB 3TWCL 5AUMB 5E2TH 3DVIA 1OM3L 3PDOB 4I0PB 5ISZB 3QUXC 5I30L 3OAZK 4FS0A 4G8FB 3QJFA 1J8HE 1RJLB 5AZEH 2BOBA 3SE3A 5DD6A 4LKCB 5MEPB 5CZXD 4U4BA 2FSEA 4G6FD 3QDGA 2GT9B 1MF2L 4NKMB 3O3BB 1N3NB 3CLFL 1WBXB 3IDJB 4Q6IC 2FCBA 1AQDA 2E27H 3MRGB 3IDMB 3QDMB 1ZLVK 1G0XA 1QLFA 1NCBL 5HVFB 3WXWL 4L4TA 3P73A 4Z7UB 4ODTL 2X1PA 1FVCA 3GRWL 1XGQA 2UWEB 5CJ8A 1K4CB 4E42B 2BMKA 3VFUA 2W92A 5F1NA 3VI3F 4HUXA 3C08H 3ZYIA 2X1XR 5ICXA 1VFOA 5E2UL 2DICA 3E8UL 2BC4A 2VERN 5F6IC 5FUOL 2VTFA 3Q1SL 3OR6A 4HGMA 5CP3H 3HNTL 2NY4D 3QDMA 5FM4A 4PJBE 1DBAL 4KQ4L 3QWQB 1N3NA 5I2IB 3IVKA 3VFNB 2P7TB 2UUDK 4NCC1 1CCZA 2CDGA 2FHCA 3UPRA 3EW3B 1IC1A 3UC0H 4FHBD 3MA7B 4PRDA 1NGPL 4BH8B 3HAEG 1Y18A 1NFDE 4M1CD 4OLZH 1CXFA 1SEBB 2F53D 2X4TA 2C3XA 2DM4A 5I1HL 3WD5H 4XCYA 1NEZA 5TDNB 3U9PH 1U58A 4PRBA 4IMLB 3BD5A 4XH2B 4Y4FC 1GGIH 3C2SA 4NC1E 1JGVL 3FQTB 1KLFA 3GSOA 4MA7H 4UT6H 5E9DE 3B4NA 3QHZH 4LMQI 4CVWA 1NCCL 1E28B 5IQ9A 5ITBL 5C0GB 3GSXB 4ODXB 3FMGL 4L8DA 4PJBF 3QEHB 3D1MC 3MX0A 2ESVB 1U93A 1I85C 3QFJE 5F1SA 3PWUB 3SKJL 2ZOLA 3G6JA 3UTTE 4BH8A 3IF1B 5DQ9B 5HGHB 3ZHKA 3PWPE 3MLUL 5F3BB 3VWKD 3D0LA 3GSWA 3RZCC 4IHOB 3VI3E 3DUSB 4JFXB 3BP6B 3JXAA 2AJVH 5JW4Q 1ACYL 3KPLA 1Q9KB 1WFTA 3L3IA 3MGOA 3MTRA 4XWGL 2WNGA 5FO8A 1F02I 1YEHL 4LU5L 4GRLA 3OKNB 4J8RB 2NX5A 4J1UA 1NGYB 4X99A 1U8HB 1IGTB 1BBJA 2D0HA 4ZTPL 4BK4A 1BX2B 1Q72L 1KUMA 4ZPVB 4OCYL 2APWA 4U6TA 4BK5A 4HAFA 3IJYB 2BVQB 4WGVB 1P4BH 3VRLE 1I9RL 2UWEA 5HXMA 2P8LA 4LRNL 5DJYA 3BIBX 3VFPA 4NN5C 2P5WB 4U6VH 3IDYC 5HDOA 2ATPB 4DWHA 4YBQD 4M00A 2FX9L 5E0QA 1DQTA 1IGMH 1JF5A 4JFEB 5DGRA 5B3JE 3ULVF 1IGTA 4OZFB 2FECI 3U0TB 3FO9B 4WFED 3PDDA 3OKNA 5A2FA 3VXTA 4U49A 1WLHA 4PP2B 1F8TH 2PETA 3D3VB 2O61B 1EEUA 3ZDYF 1JZ7A 3QXTA 5I16A 3MJ9H 5D71L 3HFMH 2LABA 4ODHH 1IQWL 1QSZA 4LRIC 5I8EA 1YYMH 2YD4A 3VXSB 4XXCA 4EZMA 4HG4J 5E2WH 5C9JA 3MLUH 1JI2A 2X89D 3IGAB 4MS8C 5DJAB 5FXCH 7CGTA 5JXEA 3BHBB 4ZTOL 1VHPA 3FONB 1NC4B 3B6SB 2KZ1B 4MB4A 1NSNL 4GG6F 1P1ZB 3D6GA 3QP3A 4HK3N 5D7LE 4PRHB 1SBSL 4JO2L 2GJ6D 4DVRL 4CUCA 2FH6A 4BFBD 1EBPA 2F74A 3RQ3A 1W72L 1RV6X 1Q1JH 1LO3H 3B2UD 2IH1A 1DDHA 3GMMA 1QFUL 1N0LA 5FK9B 3QA3A 3CK0L 5DURD 1SJEA 3M8OH 2FZ3A 4EUPG 4PJ7E 4DFIA 3GJFB 4APQC 4MNGA 3QISA 5F70A 2W0FB 5CJQH 1Y18B 3ILPA 2FL5B 4WENB 1I7RB 3D18B 4ODSL 2FL5A 4WTWA 3EDJA 1RUKL 2BVTA 1KFAH 5GQBA 2B5IB 4HULB 1Q9LB 3V5HA 5F7LB 3O3EA 4PLKD 2EYSB 5DO2C 2ARJA 1JWUB 4Z5RB 4DQOL 2NZ9C 4QOKD 1D3CA 1MRDH 1I1YB 4J2XA 1RY7B 1YQVH 5J8OA 4MWFA 3T0XA 4CW1B 1UXSB 5JXEC 1H5BB 2VDLH 1F11B 1K3ZA 5EU4B 3T2QA 1NBQA 1QA9B 3EZJB 5C0RL 3VMPA 3Q5TA 1F58H 4PS4L 2YPLA 4KJYA 2CSPA 4PJFF 4X5WB 1HINH 4ZAKC 4L4VD 1QG3A 3WD5L 3AY4C 3WHE0 4XH2A 3QULA 1IE5A 1V05A 1T3FB 2VR9A 3BEWB 1I7ZA 4EOWL 2QHRH 2J5LC 4HQQH 4FFWC 4NNXA 1IGCL 2WBJC 1JGVH 3VW3L 2ZG2A 1S7RA 5EIVA 3D9AL 5ENWA 4YXLL 3T1FA 3OG4B 2PTTA 4R97C 3D39A 1M7IB 3RUGA 1S5IL 3O4LA 1WCBA 3N1GC 3PQYD 3T4YA 1J1PL 5I66A 5I73B 1EGJL 3JWDH 3MREB 4S1QL 4TN9A 3VCLB 1ZEAH 5GS1A 1BJ1H 5IHUL 3QG7H 1U8MA 35C8L 4RAUB 2IFFH 1LNUB 3RL1B 1IBGL 3KLAA 4BFEA 3JUYA 3GUTA 3GEWB 5EU6A 3MCKA 2B1AH 4DQOH 4RNRB 2F58H 3C5SB 3EGSB 1GZPA 2Q76A 1F6AA 1P1ZA 2VXQL 1U8HA 5LCVH 3VXUB 2FYYA 1DVFA 4LP4A 4FXGB 5EZLA 4NGHH 4OAWB 3SE8H 3STZA 3FT4A 3FB6A 3MUGA 4MYWB 5C0DA 4X6CA 4U1GC 3IAGC 2R4RL 3BWAA 3CVHB 3U4EA 1DFBL 5INCB 1V3LA 3SKJH 5J6HB 1T1ZB 1BFSA 1NBVL 3OPZL 5EO1A 2X41A 1LK2A 2P4AB 3K46A 2MCG1 5BQ7A 1B0GB 2YOCA 4X98B 5I71C 1JL8A 2PYEB 4Y5YA 3UTSD 4U1HA 2HT2D 3QCVL 2IH1B 3B9VA 5D7JD 3Q6GH 3MSPA 4H0GA 3ARBA 2DQGL 1QEWB 1CL7L 2AABL 1S9WA 2OZ4L 3QXDA 1LD9B 2IGFH 3LIZL 5F9WB 3KPRB 3VFSB 1RFDL 1RZGA 3L3KB 1QSEB 5TH2A 1UEMA 4IRJB 4KI5C 2MFNA 4XMPH 2E6JA 1TITA 3FRUB 4PS4H 4GKZB 4M03A 2PUQT 1LP9F 1HYRC 3EIFA 4ZG1A 3VXTB 2QADB 2ZOLB 2CJUH 4DN3L 3Q1SH 1O7VA 3PV6A 5MERA 5DJ6B 1Q0YL 3QEHA 1CU4L 3KPRA 3SGJA 3ULUL 3SDDC 1BGXH 1UWGL 1DR9A 4OZHF 2A2QT 4MJIB 1DEDA 3ARED 4UZGA 4JHZA 4L8BB 3B9DA 2OQJA 1R3HB 4FRWA 3PABA 1FGVL 3RTQB 4YHIA 3WEXA 3FFCA 1Q0XL 4GG8A 4GKSB 5HGGS 3REWA 5C6WH 1CFTA 3H6JA 5LKNA 4G42B 1T0MB 1V7NH 4P46A 5TF1L 3HZVA 2R2HA 2VE6A 4A6YA 5I1HH 3DGCR 3MBED 5KVDH 5C0CE 2IAMB 5IGXH 3KHQA 5IB2B 1XF4A 4EI5D 1DLFH 4Z0BH 3WDHA 2JELL 1ZHNA 4H20H 5HHXL 5EDXA 4OLUL 3BVNA 2CQVA 2HN7B 5FDWA 1XMWA 5JO5A 1SVZA 4HFUH 3PGDA 5IM7B 3I3BA 1MCOL 4GAGH 2AXFB 4PJCB 4KTYA 1UGNA 3BKYH 1R3IH 1G7IA 1PKQB 4QEGA 1F4XL 1IGYB 4LPYA 4W6YB 4XVSH 3O4OB 4XP1L 3O2DL 2FJFA 4M6AA 3VFGL 2XQBH 1QSFA 3H42L 4JDZA 5CSBA 4QXUH 3NIGF 3QEQB 3CX2A 2H9GA 4WHDA 5D4QA 5GHWL 5ESAA 4PJEE 4MHHI 4BFIA 3IFOA 4ODBD 5ID0B 4D9QE 2B7DT 5JPMB 3CFJB 1UA6L 2X4SB 5I1JL 2AJZB 3BZFB 4BQBA 1UC6A 5E6ZA 3RL1A 2KZWA 2ATKB 1YN6A 3X3FL 3ET9F 4YPJA 4O58L 4H8WC 1MI5D 3CU1A 3MV9B 4E5XB 3TVMC 5BXFA 5JORA 1MOEA 3BN9C 4KDTC 2XTJB 3MA9L 5KSUA 3V5HB 5E8PA 2VC2H 3KPSD 4PLJD 1R3LB 3IXTA 2UZIH 2YC1A 4LF3A 4PGBB 4TQEL 1FYTA 3AMLA 1YEGH 1G84A 3VFMA 3KHOA 2H2PD 2P7TA 3D87B 2J88H 5B3JF 2P43B 1JTTA 1WGOA 2YK1H 1S7WA 3CFBA 1E6JH 2R2BB 1PEZA 1NCWH 3BPLC 4K94C 4LVOC 4P99A 3IFNL 4PRPD 4KKBC 5KANI 2IF7A 1U8LB 4NZRH 5J9PB 1MWAH 1P84J 1X5JA 1J87A 1FGNL 3WFCH 4FABH 4RISH 3KAAA 2G9HB 2ZKHH 3S35L 1FZOB 3GMRA 3P9LB 3O11B 3C60C 4AG4L 4Q9RH 4BA8A 3G04B 4Y4KC 2EXWC 3GMNB 2X4NA 4YGVB 4NQCB 4Z8FH 1CF8L 2ZG3A 3MV8E 1EXUB 5F21B 1NFDF 3X3GL 3R1GH 4LCYB 1SJXA 4Z7UE 3KPPA 5FEBA 1IEHA 5BV7L 5CCKL 5B21A 4GMSL 4Y2DB 4WWID 1E4WL 4AY0A 1A4KB 2DQGH 1YYLH 4PJGB 3QQ3B 4P4KB 2GITA 3OXRB 1AE6L 4AQ1B 4HGWA 2WAHA 2VDRH 3ZL4L 5EZJA 3PWLA 2V7NB 1G6RH 5E2JA 5KN5A 3PABB 2O5YH 4JB9H 4N68A 4OLUH 1NAMA 3KJ4B 1X5AA 4FQXC 2YKLL 2XZAH 2X5PA 3ROLA 5TF0A 2R15A 1EX0A 1C08B 4XMLH 4KQ3H 4JPIA 4KXZI 1B0RB 2O26U 3QIWA 3HI1A 1RZ7L 4N0CD 4FMKA 5D2NC 2CK0L 2P45B 3VWKA 2W0PA 1ONQB 4NQXA 2JJSC 4QY8B 3QQ3A 4YO0A 4J3XA 2VDPL 4XB7A 1J11A 4KRPC 4O2EA 3ARFD 2HWZH 5HDQL 5HYQB 2H8PA 1CDIA 1JNLH 1KBGL 3RIAF 1YQVL 3S8WA 2AABH 2E7LA 2QQNL 3TZVB 5T3ZH 4HPOH 4HV8A 1KCVL 1XF5B 2CIKA 1QSEA 4P5TB 3WDJA 1CF8H 5SWZD 3MCLL 1IM3B 1F58L 3MLSH 4PP2A 3NFNA 2BVUA 5EBMB 1A21A 2J4WL 4RNRA 3U0TA 1KC5L 4P9ML 4B5EA 3CLEL 1QEWA 1V3MA 4URTB 4MLSA 1AC6A 1ZA3A 1VEPA 1T66D 1A14L 2NY2C 1CK0L 3FO2A 1U8IA 3UTOA 3WSQH 2EZ0C 2HLAB 3NTCH 3ARGA 4JR9H 3WIFB 1SBBA 4R3SA 1CVSC 5HHME 4P5MB 5IIEB 3P9MB 3C8DA 1DBKL 5DS8A 1GCFA 2BRRH 3RVXD 2X40A 2WV3A 4UINH 5L7XL 4WNQB 4MJ6A 3TFKC 3JWOL 5J12C 2VN4A 4GRLB 4UDUB 2JTDA 1U3HD 4R4FH 1A22B 1HHKB 3U9UB 3BJLA 5EZIH 1BZ9A 3MUHL 1A7NH 1XIWB 5T33H 3BGMB 3QRFM 1ZSDB 4Q9RL 1QFWI 4FXKA 1KB5A 1SY6H 1AXIB 1EAPA 2XT1B 3WFZA 3FFDB 4KJYB 2AK1H 4Z7WF 2H26A 4OM0H 3DX8B 5E70A 1DLFL 4JFOA 3EJZC 5FYJE 4X6FB 5EBLA 4DGYL 4OI9A 1KTLB 5E8OA 4KJWC 3TIEA 5CEZH 5DUBB 1XF1A 5JTWA 4L4JA 4TSCH 1NMCC 1OQXA 2AGJH 3KG5A 1NFIA 1WBYB 5AZEL 5AAWA 4I4WB 1HKFA 3TN0D 1WC7B 4HWUA 1N0XH 3MQIA 4OLVH 4P59L 4U1MB 1P4BL 3MRKB 1AQDB 5F7MC 5FDWB 5JO5B 3T4YB 1FNLA 3GFUA 1RHHB 3BZEA 3RNKA 3T0EB 1XR9B 2ICWJ 4EXPX 3VG9B 2GHWB 5AYQA 5T5FH 1XZ0A 1Y0LA 2NY3C 2NY4C 4LK4A 1IAKB 2DBLL 4K8RD 4IMKC 5L7XH 4O58H 3F7YB 3CXHK 3KYNB 4M02A 1F4AA 3SJVD 2R8SL 5SV3A 2XICA 1BJ8A 4N0UA 5FYKE 2CPCA 3DXAB 1YEJL 1CS6A 1SHMA 1HH9B 1FZMB 4N90E 5EG6C 3VXRD 2OZ4A 4U1SB 4F2MA 4PG9A 4RWYL 3S88L 2ZPKH 4F15B 1YDPA 4G6KL 1EUTA 4L3EA 3T2OA 3STLA 2R0WH 3IGAA 2VWEC 5DJAA 2VZVA 4Z7NE 4LSQL 4PJ5D 6FABL 5D2LF 1MIEL 3HI6L 1T04A 5E9DB 4IMKA 3QUMB 3CZFB 3RDTB 4QRPE 1J1XH 2QL1A 5L2KE 4HJ0D 4KHXL 5IR1B 1HHJA 3LKNB 2HKFL 4MS8D 1L9MA 2DQHH 4K3DL 2ZCKL 2HFEB 5DD0L 5C0EA 1EJOH 4MB5A 5T1KA 4P2RA 3EYFA 3O3AB 1RULL 4QNPF 3TJHD 4JM2D 4X4XB 2CR6A 4HDIA 1OF2B 2IEPA 3KDMB 5MP6L 3EZ8A 1YN6B 3BD4A 3T0VA 3RRQA 3QUKB 3T77B 3IYLW 2GCYB 1FFNA 4KDVA 1G7PB 4PJ8C 2CLRA 3DBXB 5D5MF 4KJWD 5DJDA 3GIZH 3WFHB 4IDJL 4WHYG 3VDCA 3LZFH 1P9MA 1YJDH 3ES6B 1MFDH 2BNQA 1J5OL 4XWOD 1ACYH 4Y8DC 5LQBL 1NFDB 2W0LA 3P11L 3LOWA 5D2LE 2YA2A 1MFCL 1HI6B 1D5MA 1KB5L 3L7FB 4XCNB 3VXSA 3KPLB 2AEPH 4LHQB 1U3HB 3DYOA 4XP1H 4P57A 3KPOA 1QO3B 5FA3A 4FXKB 1J12A 4PJGF 2FX9H 3MMEA 3D5OF 3FMGH 4ZFOB 1S9YB 2C3HA 3S37H 4HWZB 1TTGA 1AQKL 3IF1A 1TETL 1FP5A 5ICZB 2FEEI 4K07A 2ERJB 3OKEB 3ABZA 2DQUH 2A6DB 3VFSA 3ZKSD 3OJVC 3PHSA 1H3PH 1T0MA 4MDJB 2XKSA 3QIBD 4GKOA 1MLCB 4QCIA 1YEIH 3LN4B 5DJ0A 4YAQB 4MJ5B 4IRZL 2VZTA 2AJVL 2OR8A 4U1MA 4DKFH 4DKDC 2P8MA 4K7FA 2GTZA 1U8QB 3MJGX 4TVPD 4DGIH 4MXWH 1PZUB 4D0BB 2AXGA 2E5EA 5C0JB 2X44D 3MOBL 4ZPVA 4XAWL 1JPSH 3CFEA 3I75A 4ONGH 3SDCB 1EEYA 1A6UL 4C59B 3SQBA 1YEDA 4X6EB 2Q3ZA 2WWKT 3S97C 4JN2A 5JA8B 2K7PA 1S3KL 4JFOB 4HUMB 3LB6D 3S5LG 5T3XD 1WK0A 3QQ4A 3ARRA 1KIPB 1U8NA 2CDFA 4XXCC 3AU1A 3SDDA 1DBML 2FJGB 4LEOB 5K59F 3N50A 1AD9B 3IJSA 1AI1H 4QYOB 3LRGA 1MUJB 3W9DB 2NXYC 5D1ZD 5IT2H 4M1GH 4LCIH 4U6XB 5JHLL 5DVMA 1OSZA 2IPTL 2HT3D 3EKCA 3RIFF 5A16B 1RI8A 3DJ9A 3LQMA 4NQCD 2Z92A 5E99H 3RVWC 5D2NE 4QXWA 4RGNC 3S37L 1SYVB 2CUIA 3ZYOA 1Z5LB 2YN3A 2D31A 2M1KA 2YPVH 2ZCKH 5FYJU 5FHBL 4E42A 4QT5B 4WCYL 3BGAA 1RK1B 3CD4A 5EORL 4K23H 1D7FA 3O2DA 4UMGA 1U8IB 2FH8A 1QSFB 4LNVA 2AS5M 2A9MH 1JPGB 1SM3L 3W9EB 1KJVA 1C1EH 4PRBB 4MMZC 4OLXH 3ZDZF 3HS0B 1UQSA 4I9WE 4LPCA 4PRPA 3MNVB 3VJ6A 1FZJB 1YJDC 1D5BA 12E8H 5MEPA 4R0LB 3U6RA 1FDLH 5I66B 4QRRE 4XP4H 4PGBA 3O6LH 3ZL4H 2HJFA 3GJFH 2CXKA 1UCTA 5C09A 3ZSSA 1HSBA 3VI4E 5E00B 4GW4B 5BOPA 2EXYC 2FATL 3QIUD 4WTZG 1A7OH 5TE7L 1QRND 3KPQA 4OKDA 2IG2L 5F96L 3RGVC 4PJ9A 4ELKB 5DRWB 4XI5D 4X6BB 4KUCD 3IXAB 4AEHH 1U3YA 2XV6B 2EEAA 5L2KB 1TQBB 3E2HB 4AYFA 4X9GA 1QLEH 3OWEA 4R90L 4I48A 3QEGL 1OGTB 1CD1B 1T6WA 1ZOXA 1Y6NR 2YBRB 5DT1H 1IM9B 1HXYA 3BW9B 3WNNA 1OP5K 4TRPL 5C6TH 5IV2B 2QQNH 5C09D 3BRFA 5IROC 1FYTD 3SJVE 5J56B 1BGXL 1UWGH 2M26A 2VLKB 4OD3H 2XOTA 3SKMA 3O3BA 4ZTOH 1U8PA 4B41A 3H9SB 2Q20A 3IFPA 4M7JH 3PGDB 2MJWA 2ZUYA 4I2XB 1JGUL 3VRLF 3ME0A 2YC1B 4OD1H 2EDKA 5C8JA 2BVPB 4M62L 2EH8L 5J57B 1BFOA 5DHVA 4NO2A 4DZBA 5D1ZB 2FGZA 4QLRA 3AB0B 1I7ZB 1JWSB 4LCYA 4QO1A 3WSQL 3X13B 2W9EH 1IMHC 1L9NA 5LXGH 5CJXC 3P0VL 3IU4L 1ZLWH 4QRPD 1UVQA 5F93C 2Q7YB 2VKXA 3LD8C 4G80B 5J0BA 1WEJL 2UWEF 3CSPA 1EV2E 2R23A 2GJZA 3S98A 4MCYA 3UYRL 2C1OB 4U1SA 4F2MB 5A2IH 4XPGH 1ZEAL 4LNRB 3ULUC 4FTVA 3B6SA 1T5XA 3REVA 4EBQL 4U1KB 3AREA 4E9LA 1FYHB 5C08D 5TDPA 4ODUB 4OFPA 2LQRA 2AP2A 1MFBL 1MHHA 4HC1A 2FJFB 1KOAA 4NWUL 1LILA 4OZIB 4QYOA 3EOTH 2QADD 4ORZC 1GHFH 1S9VA 3QUZA 1TJIH 1S7QA 1GH7A 4OLYL 3M17B 4XCFL 1JRHI 4LVNC 3OB0K 4CMHB 4Y19E 4J23A 1UM6H 5DEFA 2C5DC 4JDVA 2EECA 1HNFA 5L88L 4MNGB 4OQTL 4PB0L 2VLME 3WXVH 1H8NA 4F37F 4HBQA 2A77H 4JRYB 3L95B 4HJJH 1CLYH 2ENYA 3DI2B 2XXCB 1MFAL 1VERA 3MRRA 1AIFB 2X4PB 1HH6B 1VGKB 3WLWD 3KPRD 1IQDB 4JRXE 3ZT7A 4M48L 3QUYC 2FR4B 1DUZB 1KJ2L 3GSOB 4NKIL 4YGAB 3VA2C 4X6DF 4L8CB 1UWEL 4HIHA 3V6OA 1PD6A 1C7TA 4G8GD 1U58B 4NC1C 1UJ3A 4TVPL 1OARL 3DX9A 4GMTL 3BRGC 3EFDL 4TTGA 2Z91B 4D3CH 2E8YA 4NQVB 5JA9A 2GQHA 1NEZG 5F6HJ 5MI0B 1OW0A 2E3VA 5ERWB 3MRJA 4M1DL 5IW6B 2CJUL 4OT1H 3B9EA 4JN1H 1NGZA 2CRYA 1JF6A 5GRJL 7FABH 2AQ3A 1J86A 1V7NL 2BHUA 3SQOL 4NO3A 3KPMB 3MRBA 1ZVHA 2XN9B 1MNUH 5DQ9A 4PBWD 5DFWH 1GHFL 1FO0L 2NYYC 4RWYH 3ETBF 5ALCL 4EJ1C 1FFOB 4Y4HB 4RMWA 1FPTH 3ARZA 1MREL 4UTAL 1UJ3B 5GRWA 3BP7A 1QFOA 3QFDB 1R5VB 3UJIH 4HAGA 2FB4H 5CP7B 3BO8B 4JPIB 4KKCD 4WVRA 5I18H 3OJDB 5I9QC 3K4DA 2OXGA 4P2RD 2GCYA 2OCFD 3SCMD 4ZQKB 3EO0A 4G43A 3IDMA 2DWEA 5IVZA 5HYSA 1NCBH 3EBAA 5KS9A 4JFEE 1FG2A 4OZGE 2IAND 5T5NF 4QF1B 3S3PA 4RCAA 3RAJL 2VLRA 4U2ZA 1A64A 4GXVH 3T1FB 4I5BB 4W4NA 5K9JH 3DSFH 2IPKA 3I50H 4Q0XH 5EPMA 1TXKA 1ODAA 3Q5YA 4FFZL 4NWUH 5FAAA 3FB6B 3QXWA 5JZ7D 3TO2A 1QOKA 4QTIH 3OKOB 5D71H 5I30H 5AG9A 2CR3A 5FF6B 3VFOB 5A40E 1ZT4A 3H0TB 5K93A 3BQUA 3GMOB 4U6YA 2DQTH 5ILTL 2VC2L 1KTRL 5DJ8A 1FFRA 2GK2A 2VH5H 3HC3H 1MREH 3WFDL 2CIIB 4WW1B 1SBSH 5SWQA 4L3AA 2MPAL 4PJEF 2AI0H 3U2SB 4DZ8B 2D3VA 4LL9A 1AXTH 4IOSD 2ICEB 4H1LG 1B0GA 1U8KA 1M6OA 4OZHA 2FX8H 1NUFA 2OP4H 4JVWA 5EUOB 1FE8H 4K71B 5EU7C 2EYTA 3P9WB 2FX7L 3TBYB 1NLDH 2VUYA 4YWGL 3TBYA 5HDBE 3CSYA 3PNWA 3TEUA 4NN7B 5E8DL 1B0WA 4NRXB 3QHFL 1HYSC 1I9EA 5KSAB 4JJ5B 4HKXA 5F7KC 1H15A 4MD4A 1HN1A 4ZFZA 3DRQB 4P23D 1UXWA 4KJPC 3U30C 2K3TA 1AP2A 1HHIB 1DP0A 3FQNB 1CFQB 1K9TA 3MRLA 1A6VH 3TT1L 4G6FB 4BSWA 4GSDL 3BW9A 3O9WD 5GISL 5J13B 1SY6L 3SGEI 3L6FB 3V0VA 2F54A 3MV9E 2DD8L 1N2RB 2FBJH 1FN4B 4Z0BL 4KPHL 1D5XA 3VDAA 1ZLUH 3M1BB 4NM8H 4QOKA 3RA7L 1QUNA 3SGDI 4MX7B 2Y9RT 4KUCF 1MI5B 4AJ0A 2R2CA 3DGGA 4JGUA 5E24E 1BVLB 4GLRI 3BHBA 4OQTH 2P8PA 3C9NB 3UJIL 4X7CC 2OR9L 3MZTA 3L3JB 2A9NL 4NKOA 5DWUL 3NCJH 5EOQL 1VACB 2FWOB 3BAEH 2JIXA 2R0KH 3GK8L 5GS1B 4YDVB 4QNPE 1IFHH 3ZTNH 1CFSA 2ITDB 1FGNH 3WFCL 2F53B 3GSWB 2X89A 2MCPL 4WEMB 3VGGA 4NQDB 4QXGH 3B8SA 5D70H 4HQQL 3D39B 3MYJA 5E94B 3BH9B 2EDDA 3GSVA 4RRPA 4O51B 5INDA 4NQVA 5HYFA 2QEJA 1J05A 3G5ZB 3G5XA 4HMEA 4WHCA 2A9ML 5T1DL 1SJEB 3HZYB 3R1GL 1K8IA 4KI1A 4D0BA 3BKJH 4QXTA 5FOJA 2GJ6A 5DJXB 5FYKL 2V2TA 5EC2A 3O2VL 2CUHA 1CT8B 4XNMB 2VABB 2YHGA 3D2UB 1RVFH 1KXQE 2VDOH 4OF3A 4X0KB 4ZTPH 4JRYA 1YMMB 1A6VL 3BIAX 4H88H 1ZT4B 3H0TA 4P3CH 5K33A 1FL3B 5D5MA 3I6LD 1MFAH 1SMAA 5LBSH 1GC1C 2H9GB 1E6OH 4Y1AD 3QWOA 5ALCH 4HH8A 2I60L 1CDBA 4PB9L 1JZ8A 4GXUM 4OSUH 5ELIA 2HFTA 4XHJC 4LLQA 1KN2H 3NABL 3QIWD 5IBUB 4OIBA 4LVHB 1WQVT 32C2A 4NT6B 4YO0B 5HHQA 3IFLL 4AZ8A 4CJ1A 4RFNC 5K9OA 4I3SL 1G7MB 1OB1A 3HI5L 4XP6L 3C6SA 3L5HA 4OM1L 2YUVA 3NA9L 5KS9B 4OZGB 5EIIA 1IAIM 3R0NA 5D7JC 3WN5B 4EIZC 1NCNA 4JFEA 2OSLB 3AROA 3ZHLA 4XTRC 4G7YH 3C5JB 4JFDD 4TSAH 1A1OA 3FQRB 2DIAA 5SWSA 3C87A 2I07B 1TZHA 4JM2C 4R4FL 4Q74A 4H5SA 4F58L 1A9BB 4GS7B 4N8VG 1JZ5A 3X14B 4X9BA 3QHTC 1NANH 3GIZL 1NBZA 3ARXA 4Z7VB 3R06A 5L9DL 1HEZA 3O3DB 3S4SB 4FOMA 1G7MA 5E8EB 1RIVL 4H88L 4P3CL 5EO9A 4ZXBB 5CAYB 3UEZA 1DQLH 4FZ8H 2FRGP 3G9AB 2F53A 4JFFA 1RUQH 3UTTD 3D48R 1NC2A 3V6ZA 5JLZA 1GXEA 3PWPD 4WW2B 5JR1L 4I8DA 2X70B 1LP9B 1LVEA 3FT2A 1J7VR 4LLVA 2OK0L 4PG9B 4O02H 1IM9A 4JG1L 1YEFH 4MX7A 5J4MA 5HI5C 4I3SH 4LQFH 1A3RH 3MV7D 1BD2A 4X9IA 2J6EH 4K8RC 3S34H 1G1YA 3UTQB 1CT8A 4XNMA 4BKLB 3K7UA 5CEYB 2Y72A 3V6OE 4RSVA 2P8LB 4H26B 2V2XB 3LPGA 1XF3A 3PF2A 3T8XB 5F7UA 1LEIA 1V8HA 1IAKA 5TQ0L 2BXYA 2DMBA 5MEQB 4LMQE 2EYSA 3VGEA 3ALWA 1F3DH 1I9JL 5HYJA 5E00A 4LKCA 2J1KA 4JRYD 3SE3C 4XC3L 5LGJB 4Y19A 3FZUC 3RFZC 1TZGL 2PTTB 3QDGD 1RZFL 1Z9LA 6FABH 3B9KD 3V52H 1I75A 3MRKA 4W68A 1DANT 4G9FA 2R1YB 4G6KH 4L1DA 15C8L 4MAYC 4U1LA 4JHAL 1WZ1H 2BRRL 4FTVB 1UWXH 2IANB 1KJ2A 2C1PA 2R4RH 1B6DA 1EGJH 4S1QH 4FTVE 2D9QB 4Y5XC 5EUKA 2OK0H 4P2QE 3MCKB 1BBDH 3CC5B 2W9DH 1VENA 4DOHB 3K8KA 2Y06L 1NMAH 4MWFB 1D9KC 4N0YH 4PJIF 4BSWB 4OFYD 3MRIB 5D7IE 5GJSH 4PG2A 4WCYH 4C56E 4CU7A 3SDYH 1ZK9A 4KGLA 2YPKA 4S1DC 5D1XA 5D7IA 1BPVA 1MIMH 4PJHB 1P5VA 1DL7H 1H3GA 4WI4A 1HDMB 3O8XA 2WM0A 4MSWA 4FG6C 1AY1L 4HKZB 1JHLL 3WS6C 4QF1A 3UTSB 2HJKA 3QYCA 3N1MC 1KSRA 4XP4L 5CKAA 3FO9A 1ZVSB 4WRLA 5FA4B 1B3JA 2FD6L 3P0GB 3MLTB 5BS0D 1DFBH 1GYAA 2VSCA 5JOPD 2E7MA 1TZGH 4P23A 5DRNA 4ZSOB 4XVTH 4G9FE 2CDEB 4X7EC 4OIAA 2F5BH 4DTGH 5D70L 4PRIA 3PIQB 3KWWA 5HD8C 5EN2B 1JTOA 3BO8A 3RAJH 1OWRM 2R1XB 4QHLB 4HUXB 3W0WB 1RZKL 3BQUB 5EU4A 3QXUA 2HJLB 5DVKA 2Y7QA 2H2PC 5JPNB 5L2JB 4ELKA 1MCPL 1TVDA 2ZUQC 3FQNA 2R8SH 1YEIL 3IDIA 5C0BD 4XNUH 5I1IL 2Z93A 4WFHE 2RIKA 5FGRA 1S7UA 4HF5L 3RWJB 2R69H 3MV7B 3RGHA 4O2CB 2JCCB 3MGTA 1W0YT 4D9RD 3HLAA 1JN6B 3EOBA 3G6DH 1RUML 4Z7VE 4Z78A 4K8RL 5ESQA 2OI9B 2BZDA 3C8HA 3LKSB 1FSKC 1G9EA 2W0FA 4J3OC 2H2SC 1I7UB 4QRRA 4KMLB 4GH7B 3P3YA 3BRDA 1RZKC 2BNQB 2W59A 1KTKE 3PQYB 5C0JA 2XFXA 3EYOA 2OMNA 4OGYH 5FB8B 3CFDA 3JWNC 3VW3H 3WFHA 3K1KC 1CYGA 3QNZA 1FV1B 2FX8L 3HG1E 3MUY1 4PLNC 2F74B 1UZ6E 3E6FB 4JFFE 5C0ND 2C26A 5EZJB 4F9PA 3GBML 4MJ5A 4NFCA 2WK2A 1J1PH 3QFDA 4DUXA 4PJXF 1X4ZA 2DL2A 3T2NL 5D72H 5DD5H 2BCKA 3IDUA 3V7AG 3GSUA 1XF2A 4NFBA 3CXDH 4NN6B 4PJFB 1JK8A 2QSQA 3LHPL 3BDYL 5ACLA 3FTGA 3OB0H 2FDBP 1OAYL 4CRPA 3AAZB 4IJ3C 5E4EB 2MKLC 1KCUL 1YNTA 5EOCH 3K2UL 4ZOBA 5D1XC 4JRWA 4XNXH 1EFXB 1MH5A 1C12A 3D69A 1I1AB 3C5ZC 4BZ2L 5EU6B 5M7QA 1G7QA 4N9GB 3LPWA 3RZWA 4U2YA 3V79C 3OF6A 4N0UB 4LSRH 2GJZB 2IG2H 3UTTB 3DNKA 1A47A 1G1CA 3OXSB 3O4LD 1UB5B 3IFPB 3OKLB 2FO4B 3QUKA 4WWKC 4DK6A 3MV8B 5IBTL 3IB4A 4X7TB 5CD3B 2BVQA