5KVMC

Extracellular region of mouse gpr56/adgrg1 in complex with fn3 monobody
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
SVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGGSPWSWQEFEVPGSKSTATISGLKPGVDYTITVYASSFDWTIFPNYYSSPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Adhesion G-protein coupled receptor G1
publication title Structural Basis for Regulation of GPR56/ADGRG1 by Its Alternatively Spliced Extracellular Domains.
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2016-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kvmC00
1OCWH 3ARBD 4I9WD 5B4MC 3SE8L 1J0IA 5JOPD 3PQYE 3TH4T 4NQCE 4OAWA 2AJXL 4QEGA 3BYTA 3C9NB 1CZ8H 5BV7H 4PJCE 4W4OA 2DICA 4PJAA 5EORL 4OKVB 3QUMA 3C8DA 4LBEA 3RTQB 3O8XA 4R7DB 3V0VA 1IGIL 1QLEH 4HUVB 5MHSD 1MREL 4Y2DC 4NKIH 1FJ1A 4PJFA 2B0SH 4S1QH 1JF6A 1HHIA 4YUEH 2WW8A 2V17H 4JANB 5DMYA 3HPJB 4ZSOB 3L9RB 4OGYL 3HUJF 3I6KB 3UC0L 5C0JA 3QDGA 1DJSA 3QIWD 5D7JA 1G7LA 3SKMA 4G7YH 4WY7H 2VL4A 5LAXB 1TDQA 2ADGB 3MRBB 5TQ0H 5DJ8B 4GH7B 3DV6A 2VN7A 5I1CL 5IB4A 5AEAA 1VEMA 3DX8A 4GQ9L 3H42H 1C16A 3KPMA 5KS9F 2H1PL 5D7LA 3FO9B 4RGNB 2DJ4A 2G75A 2CPCA 5HHXL 3RWCA 3WDIA 4M7KL 3LQAL 4BZ2L 4P49A 2CUMA 2GUOB 4R3SA 3AAZA 3TYFA 5FAAA 5B38B 3F58H 1J9CT 5K9JL 3T1WA 4FQ1H 3F8UB 5EU6D 1LD9A 3MRHA 4ELMB 1U92B 4NT6B 1SVZA 2DJUA 3CJJA 5ANME 2F8VA 1RURH 3ALPA 1SYVA 4KDTC 3RX7A 1DUYA 4RMVA 1IAKB 3P0VL 2BMKA 4YHOH 3PJSA 5J1AA 2RCSH 3R8BB 3NFPB 3K2UL 4ZPTB 1MHCB 1ADQL 4KK5D 3KJ6L 4OF3A 2P8MB 2WP3O 4JQVC 4UT6H 2J3SA 3BN9C 2Y36L 1J8HE 1R24B 1S7VB 1N0XH 3BQUA 1A6ZB 2MNUA 3P73A 3ALWA 4YHKL 3GSNB 2DS4A 3O8XD 1F6AB 3JTTB 5FDWA 4IOSD 4TNVK 3HE7B 1KCSL 2PETA 4YK4B 3OAYH 5AYUL 1YN7B 3QULA 3QXUA 1XZ0B 1NCDL 3T65B 1A6TB 3F7VB 1RK1B 5D72H 3U36B 1MOEA 5CBAB 2B39A 5JHDB 1PQZB 4K94C 3W39A 4J3UA 3TF7C 4JO4H 5KSUA 4WEMB 5C0BE 2UVEA 5JDSB 5ICXA 4HV8A 1WITA 3TFKD 1SY6A 4LPYA 1AXSA 4YPJA 2JIXB 4PJ8C 2AXGB 4L4TA 4M1CC 4IRJB 4Y1AE 4Y4KC 3AGVA 1EEZB 4U1GB 4NRYA 1EBAA 1JPTL 3GMLB 4HIEB 1KPRB 5BS0B 3RPIB 4FQCH 1JWSA 3HNSL 1MCJA 1KIQA 4OZGF 1CLCA 5EIVA 2PR4L 4ZMAT 3IVKA 4PP1D 1ZGLA 5BRZB 5D7LD 1BVLA 3D87B 3GMOA 1YC7A 2X7LA 2V5TA 4OQTH 3O0RL 1P7KB 4XP1L 2PTVA 4P3WA 1MFEH 3NCYP 4NZUH 1MHEA 3V5HA 4PJ9A 5B8CC 1XCQA 2XRAL 4OLYL 5DRXB 1G0YR 4MQXC 1JGVL 3WJJA 3IS1X 3MJ6A 5JDJA 1OPGH 4HC1A 1WUNT 5IBUG 3IAGC 2HJFA 3SDCB 4L8SB 4U1MB 4H1LG 4FNLH 2DN7A 1HNGA 1XAUA 4HD9A 4KI5C 1IGYB 3LPGA 1FLRH 5F93C 3V6FB 5I8KH 4PJGF 5IWLC 4WO4A 5J89A 3AY4C 5DMIL 5IUSA 1IGJB 4DZ8B 1XF5B 5J11B 4KRMB 1GC1L 1F6LL 3O9WA 5KVGH 1N2RA 4NWTH 1MI5A 2NPLX 4QRPA 4F80A 4IDJH 3UTSA 3QEQD 4BZYA 3WFBL 2R2BA 4HCRH 5EO1A 4YDLC 2Z4QA 1PZUB 4O2CB 1Q1JL 1QUNA 3BQUD 5D6DC 2A74B 3NAAL 4PJIB 4HK0A 2IWGA 3D5OF 3LB6C 4HWBH 2R9HC 4YBQD 5J0BA 1BQUA 4XX1E 4IMKC 3QEGL 4MHHG 3O41B 1QQDB 1Z9MA 3V4PL 5IHUH 1KN4L 2BHUA 4JFDE 4GUPB 1T0MA 5L2KB 2YN3A 1YN6A 4JLRA 1VDGA 3P9MA 5IROA 4MNGB 4FMFA 4KHXL 3BAEL 2X42A 3OXRA 3FB7B 2NXYC 1AD0B 1A1MB 1P84K 1OLZA 5I74B 2E3VA 1W72A 3T0WA 2EZ0C 4P2RA 4YX2H 3BZ4B 3IU4L 4HPOH 4UAOB 4UTBL 3MOAH 4L4TD 5I66B 4HGWA 2EH8H 2MHAA 1NEZB 4RWYH 5FUCC 4B7LA 4NNPH 5FO7B 3EOBA 5ENWA 1IKFH 3WFDH 3PE9A 5LGHH 4WUUB 3X3FL 1IMHC 4D9RD 1A7QH 3L7FA 3FQWA 3F6LA 2IPUK 1ZSDA 4HIJB 1P5VA 1EVTC 3OAZH 3UTTE 3MRDB 5I17A 4PJDB 2P5WA 4C58B 1ZLSL 1IEAA 3HMXA 2DQCL 1BM3L 5GGTH 3TN0A 5KSBE 3DV4A 5J1TC 1AQDB 3DARA 4V1DA 4PJ9D 3ULVE 1L0YA 2BC4B 2NMSA 4OF6A 4NN6B 1RSFA 4KGJA 2H9GB 3SDXE 2GK0B 1J7VR 2E9BA 1UJ3A 5BJTA 5SX5K 4KJWC 3BGFB 4WW2A 8CGTA 3G6JE 1PKOA 4IOIA 1HIMH 3I50L 5T1MA 3LDBC 3WE6A 1F4XL 4EN3B 4OLEA 4WO4D 2GSIB 3B9KA 5IESL 4YXKL 1FZKA 3ARVA 4PJEF 1A7PL 3O9WD 5DVNA 1E4XH 1MI5D 2VLRA 3EHBC 3ET9F 1FZMA 1KPUA 3UTSD 5F88B 2DWEA 4NM8L 4HXAL 5INDB 4D94A 4M6AA 2CGRL 4BYHA 5DZOA 4XHQA 2R0ZL 4JN2A 4XNYH 1MIEL 4G9DA 1U8QB 4L3EA 1FP5A 3CK0L 3ULUD 2HLAA 4XC1L 4FFZH 5BZWA 3VDBA 5F1IB 3VXME 1U36A 4H8WH 4EVNB 4NWUH 5ICZB 4YHML 5CINH 4UU9A 3VXTA 5H37G 5FCUH 3DVNA 4MA7L 3N06B 1BJ8A 4J8RB 1CXEA 4LIQE 3EFFB 1JZ4A 1OL0A 2FGWH 5FO9B 1DQQB 2FL5B 2GJZB 2CDFB 2ZWLT 4NBZB 1Q0XH 4JY4A 1EAPB 5J57B 4P2RD 1YZZA 3IFPB 5CEZE 5JQ6H 3SKJH 2XKSA 5C0DB 3MLYL 1TNMA 5AZ2H 2ZKHH 3MLVL 5DJ2B 4QOKB 4A6YH 1AO7D 3E3QC 3SOBL 2XXMB 3FQXB 4RA0C 3F12A 1Q94A 3IETA 5JW4N 3BZEB 2E7LC 2P5WD 2IAMC 2EYSB 2VZOA 2DLTA 5L2JA 1WFNA 1JMZA 2BNRA 4FQPA 4G42A 4XPGL 5E4EC 1IEBA 3EDKA 3TN0D 1P1ZA 1AP2A 5GRZA 1I75A 1QFWI 5J6GB 4V1DD 1SM3H 4LCWA 5D5MA 3MLXL 4L4VD 3TGXA 4ORZC 3CVHH 5DLML 2A77L 4LOUD 4MNHB 4QXTB 4AEIL 4OCSH 3QQNA 1PAMA 5D2NE 3QPXL 1NL0L 4KROD 3GSXA 3HUJA 4NYLB 3PDOA 2EKSB 3MRQB 1D5ZB 1KB9K 1LEGA 1NSNL 4WCYL 5IVXF 5D6CA 3LV3A 5C2UB 2R1XA 4U49A 4Y2DB 3OKYA 4JDZB 1I8LC 4K7PY 3B9KD 4XH2B 1UFUA 15C8L 2VLRD 4Q58C 4XCCH 4EUPA 4JM2C 2J4WL 1N5AB 3GJFH 5C0CE 4Y4HA 1F8TH 4H0GA 3VFVA 5KS9A 3WXVL 4KH2A 1I1CA 3GIVB 4G8GE 2UYLA 3DECA 2EDFA 2F58L 1YNLL 2XPGB 3K74B 4JHBA 3T08A 1K6QL 4F2MA 1I1YB 2ZUUA 4L3ED 3SO5A 5MEQA 3QWRA 2GFBB 3TCLA 4XWGH 4B0MM 5E2UH 5D8JL 4PJBE 1AGBB 1HZHL 3TO4C 5FK9B 2O5XH 1CFSA 2FSEA 4WTXA 1S7XB 1BQLH 2NYYC 4RAHA 1A6AA 4XVTH 3SGJC 3RIFK 4EEEA 3MREB 4PJ7E 1Y0LA 1A1NB 3EOAB 4C4KT 3L3IA 1LE5A 4ONHB 1BFSA 4TUOA 3G6DL 3VFUB 3P9LA 1ACYH 2QHLA 2KQMA 3L1OH 5E00A 4NN7B 2R0KH 3CFBA 3S35L 3TZVB 1OGTB 4JO3H 2Y72A 1A4JB 4G6AC 1BLNB 1MFAH 2ZUVA 1TNNA 3NCFB 2BXYA 5DS8A 5J13C 4OQTA 4GW4B 1NEUA 2WUCH 3U9UA 1UWEL 4E41B 4P9HH 1AXTL 4OCWL 4PRNB 3MACH 4P2OB 2BNRD 2WLZA 1HHKB 1CLZL 1NBZB 2XIDA 2QV2A 4LRNL 4LCWD 4OZIB 1UKSA 1Q38A 1R3KB 2R2HA 4IMLA 3FOLB 4YHZL 4ZOCA 3BDYH 5C6PB 2UWEE 4NJ9H 3O3UN 3UXFA 5F9JB 5BMFL 5D1QB 2BNQE 4OFIA 1W0VB 3OHXB 4MDIB 3LKQA 3QQ4A 2WQ8A 4PY7A 3VH8G 4M1GL 2MKWA 1NCNA 4JREB 5IT2L 5GJSH 4MX7B 2IQAB 1FYTA 4LSPL 2YD2A 4OZGA 3DETC 4HCRA 4U1KA 3FCTA 4Y4HD 5KVFL 2I9LA 1NJ9A 5FHAL 2P8PA 1JBJA 4Q2ZB 1F4YL 4Z5RA 3S4SG 3DMMA 3T8XB 3O4LB 2APXA 1PD6A 4ODHH 4Y4KB 4BQ6A 3B8YA 2G2RA 3QWRD 4JRXA 4XNUL 5E6IC 2R23B 5L6YH 4ZD3H 4X4YA 1JZ6A 5FA3A 4Z8FL 1YPZA 4LDEB 1XF2A 4XPFL 2QSCL 4YHYC 2K7PA 1I8MB 2IPTL 1XR9A 3LQZA 4GRWB 3KYMB 1AGDA 4QHUB 3C6SA 4XPHL 2BNUA 1R5IA 5DWUH 1GPOL 4L8CA 1WQVT 4AH2A 3CUPB 2XWBA 1G7MA 3DUUB 3HR5B 3MYJA 1HINH 5K93A 1EUUA 3ULSB 3BWUC 4HLJA 1B0WA 1WAAE 2L4OA 3FN9A 4WRLA 1FL6B 1T1XA 1NANH 1OT1A 4R0LA 4JFFE 1JRHI 4S1DC 5I9QC 4Y4FC 3THMH 2P5EE 1GYAA 5D1ZA 3TT1L 4N1EA 3QBTB 1H3PL 2HT2D 4FFVC 1T1YB 4M3KB 5GGTA 2GIYA 3GMPB 1IC1A 4JZJA 4P59H 2VO5A 2LV4A 4XHJD 2MCPH 1U8PB 4LLUB 4YPGB 2DQTL 4ZFOB 4LAQH 4WI4A 4DN3L 3V0WH 3QXAB 4PP2A 1FCGA 3VFPB 4MHHI 4CGTA 3EDJA 4X4ZA 4X6BB 4HAFA 4DFHA 5GZND 1KJ3L 5F6IC 5ID1B 3OQ3B 1R3IH 4CU6A 2C3GA 3S96A 3O6FA 1FNEB 1EO8H 3IT8D 4MQTB 1FYTD 3CIQA 1LDPH 4S0SD 3FQUA 3O2VL 4H5SB 3H9YA 1CLOH 4HUWB 3KPNB 2BY2A 3HB3C 3K80A 3MA7A 3EYSL 2B4CH 5BXFB 3OKMA 3GB7B 2EDWA 4FP8L 3GSWA 3DMMD 1G1YA 2VDPL 1UB5B 2E6JA 2EC8A 5DO2C 4DUVA 1YECH 4PRIE 4TULL 2VXVH 5L7XL 5CUSH 4GKZA 3WFHB 2IPUG 2CSPA 4JRXD 2D31B 2X05A 1S7SB 4KKAD 5DEGA 4OZFA 1OP5K 4D8PA 4QRRA 3RZWA 1JGLL 1DBML 2R4SH 4YR6B 4GAGH 1G9MH 4MDJB 4JFOA 2VQ1A 3SJVE 3JWOH 4WWID 4QO1A 3ZTJG 4BQCA 4FA8A 3MV8A 4OV5B 2JELL 1ZHNA 1GZQA 4LGSB 4PJEA 1HQRA 3VFRA 1JV5B 3GMRB 3PHQA 1ITBB 2HJKA 3MCG1 4TSCL 4LCIH 2AXFB 3RVUC 5IF0A 2BOBA 2FX7L 1S7QB 4N0RA 1UC6A 2P8LA 3OB8A 3KPRE 5EZLB 1CDUA 3TC9A 3LDBB 1P4LB 5C9JB 3HCVB 1QACA 5D1ZD 3NZ8A 4OD3L 2BY3A 4WDIB 3GM8A 1HQ4B 4U4BA 3K81A 4IJ3C 3WHE1 5IIEB 2SEBB 3DPBA 2ZUYA 2QEJA 4KJPC 5E2WH 3CVHA 4LSVH 3HPLA 3LN9A 4CRPA 4EBQL 1QYGH 4M9PA 4CN1A 3KWWA 1DCLA 1EX0A 3VXRB 4U6HB 2Y7QA 1OOAA 1YJDC 5E5RB 5I1DA 1II4E 2CK2A 3G5YA 4Y5VA 2FWOB 4UMGA 3RX8A 1KNOB 4WFHD 2DMCA 3O6FD 4Y5XC 1OARL 3GJFA 4ELMF 4POZC 5FIEA 4LLVA 3WUWB 4NPYB 5D1XB 4ODUB 2HT4D 2RFXA 1VGKB 3FKUS 4P57B 2F53E 1QNZL 1HOCB 2CDGA 1UZ6F 5T1DH 5EBMB 4G6KH 3U4BL 3BKYL 2C3VA 3I9GH 3LZFL 4NDMB 3U46A 4P5TC 3RNKA 5C2BH 1E28B 1F13A 5DMGC 3ZKQD 5FV1L 3UCRA 4K94L 3ZKND 1AGFB 4HWUA 2DTML 3NTCH 5LBSL 5I75C 4Z7VE 1F45A 3NPZB 3HG1B 3UPAA 5C08D 2BVUA 4C4KO 1DL7L 2NY1C 4NBXB 1DQDH 2CO7B 1QP1A 5J56B 1KCUH 4W6YB 4O51A 4JKWA 3F7YB 2ICWI 5GIRB 1Q9WA 1Z5LB 5IVXA 1OQOA 1P4BL 4XPBL 1ZLUK 4DWHA 3L5XH 5E4EB 2KQNA 1HILB 1C5DB 3FHAA 3MV8D 2PN5A 2F15A 3DX9A 5H2BA 4HXBL 4LF3B 1BD2E 4KK8D 4P4RA 2DQJL 3T77A 1NBQA 5F1SA 3ZT7A 1AD9A 1D6EA 4GW1B 2GTWA 3EYOA 1U58A 5KG9A 4XMLL 4K2UL 5C8JA 3S36H 5TPWH 2D7NA 1QBBA 3L3DA 2NW2A 2NLJB 1R0AL 3U7YH 1A4KB 1EO7A 4LLMB 1I7RA 1DEDA 1NGPL 3ME0A 4HFUH 5IJVA 5FKPA 3SPVB 2EDNA 4GRLB 1FGNL 1N59B 1FAIH 1TIUA 2ZCKL 5F7DA 3K2MC 3GEWB 4M6MH 4G5ZH 4DGYH 3NH7L 2BY0A 3ES6B 4E42B 2OP4H 4JDTL 1ZTXL 5HHPB 4NZRL 2VXTL 4HHAA 3RWDA 1MHPH 4JFPB 1G7IB 3GSNH 2ZCLL 2Q8BL 3D69A 2LVEA 3IDGA 4D0CA 3HRPA 4HBCH 4QGYA 1HKLL 4HQQL 1JHKL 1HXYA 3QI9C 2FGZA 3TO4B 1LGVA 1D5XB 4NC0B 1DQJB 4EI5C 3VXUB 4HX1B 2CRIA 1PZ5B 1FRGL 1KB5H 1NAML 2ADFH 2XY2A 1MWAL 4QF1A 1U93A 1MEXH 1I1AC 1TLKA 4XZUB 5JUEH 3IB4A 5C71A 4ZDHB 4QRQA 1DN0A 2X1WL 1YDPB 4URTB 3D3VB 4H20H 1FL3A 2XKNB 2HAZA 3FFCA 3I6LE 4XCEA 5DQDH 4L9LB 1A1OB 3HRZB 2I60H 4GG6E 1NMBH 5I2IB 4C54A 1HWHB 2DKMA 4MJIE 5CGYC 1HCFX 1TZIB 3NFSH 4PJIF 5EOQL 2HN7B 1DQLH 5JW4Q 4I5BB 3HMWL 3IJHB 1D5IH 4X83A 4OGXL 1YUHA 5ID0B 4M43H 2VL5A 4K8RC 2H2PC 1T6VN 4BZ1H 4IS6B 2ED7A 3BVNB 1TETH 1U3JA 3EJJX 3QUZB 3TIEA 1PJ9A 4Z7UE 5C0EB 3RP1A 1B4JL 3DVIA 5DFWH 1AE6H 3Q2CA 4RQQB 25C8L 4YDJA 3CSYB 4R2GC 4ETQA 5F9WC 4WU5A 1OWRM 3MBEB 2Z8SA 3QNZB 1EJOH 2Z92A 3T4YB 4U31A 2E5EA 3VGFA 4N5ED 4XP6L 4WU7A 5MEPA 5IFHH 2A0LC 4M8VA 4ZFGL 4NUJA 1J88A 4PREB 1NLBL 1V7MH 1FN4A 5GRUL 5C09E 4F9LC 1IAII 4AT6B 1IC7H 5EOCL 2CXGA 3U0TA 3AREB 2CKBA 3S97C 5IKCA 5GRJH 3P4MB 4IRZH 2EYTA 1XT5A 1UM5L 3OJMB 1T1ZA 1T7VA 2DQEL 3QDJB 4ZPVB 1J0ZA 3OAYK 3PGDB 4WTZG 2AAVA 2X9WA 5CCKH 1C8PA 5LJYH 1VFMA 2W38A 1NMAH 3DI3B 1INDH 5TFSL 3REVA 1GZPB 3IXAB 1WV7T 1OP9A 1TZHA 2MMXA 4RIRA 2F9BT 3IDIA 3VI4F 2IH3A 3TBWB 3U9PH 1A3QA 2AJVL 3BEVB 1JHTB 1EPFA 5FF6B 4WHTA 3FFCD 5JIPA 1T7ZA 1EEYA 2HFFA 4LCYB 3A6OA 5GGUA 4QHLB 5DK0B 1MJ8L 4JQIH 1ZMYA 4PJXE 3K7UA 5DK2B 5CKGA 2HKHH 2VZ1A 1FG2B 4PBWD 2WUBH 3IDNA 1BFOA 3MRGB 4MNQD 4CBPA 1UCTA 1MCNA 4NKDA 4K7PH 5I8OL 5DHYA 4ZUVB 3SDYL 4LQFL 4M93C 5FEBA 3HI6L 4N0FA 3O6LH 1CU4L 2P24B 3BH9B 5KJRL 2APWA 5LQBH 4R7NA 1EHNA 4HS6A 5FM5M 4UIKL 5HD8C 1YEEL 2VXUH 5JXEC 1F90L 3CZJA 4U3HA 5FGCB 1BZQK 4X80H 3C9NA 1JWMB 3MV7A 3LVEA 1V3LA 3MGOA 5EZOH 4KQ4L 4XBEH 3UJTH 2YKLL 2BFVH 4OKVA 1CICC 3T1FB 3RTQA 3R1GL 2VDRL 4HUVA 3MJ7B 1KLGB 1A3RH 3S37X 4PTUB 2QQKL 1UM6H 3CXHK 5SWSB 2C4XA 1HWGB 4ONGL 1JE6A 3LH2H 4HT1H 3ZE2F 5IW1B 4JANA 4LQ1A 3HPJA 1UCBH 3L9RA 3I6KA 4P4KD 4Z95L 1OSPL 1VGEH 5LAXA 1ZA6B 2ADGA 3MRBA 4KTEL 1G7QB 2H26A 3ZDYF 5DMKB 2IFFL 1RAMA 2JTDA 4RMTA 1FNFA 2EO1A 3H9ZA 4G6JH 4PB9H 2J7LA 2X70A 1EA9C 1MF2L 2FATH 3FO9A 4XNMB 2DQHL 5F1OB 3QYCA 5FYLH 3WO4C 3WDHA 4YHNB 4XWOC 2GUOA 1RHFA 1CDIA 3DX7B 3W0WB 1A02N 3ZHKA 4Q0XH 3OAZK 1NLDH 3WUZA 5B38A 1I9JH 1PSKH 4QY8B 5CJXC 2J8UE 2MQ0A 1PKQE 2C4FT 5GRYA 1C1EL 4ELMA 1XCTB 4JPWH 4NT6A 5CZKA 3DLQR 2B7DT 1RZKC 2EYRB 2R8SH 1GGYA 2PUQT 2VDLH 1IAKA 4TUKH 4O58H 3NFPA 1NCAL 3MX0A 3O3DB 5JW4R 3QPQD 4K55A 5I0ZA 4ZPTA 4LEXH 1MHCA 2H8PB 1NDMB 1I3VA 3PF2A 4Y5XB 5C0RL 1QKZH 2P8MA 4NO2B 1R24A 3EJZD 4AEHH 1S8DB 1S7VA 4JJ5B 4XVSH 1A0QH 1A6ZA 1FVDB 4XP4H 3U4AA 4OFVA 3GSNA 5EU6E 2VDMH 4QLRA 3RTQD 5DVOA 4DVBB 3JTTA 5DEFA 2JJUA 2HTKC 3DNKA 3HE7A 4P5TB 3LEYL 1YN7A 1XZ0A 4RX4A 4KDWA 1NFDE 1FC2D 3T65A 3F7VA 4OZIF 2ZSWA 1RK1A 3U36A 3NZHH 3VD7A 5CBAA 3PWVA 5JHDA 1PQZA 3VXNB 3S34H 1TTGA 2NY1B 2VLJB 3NIFE 4XMKH 5JDSA 3BKJL 2JIXA 2R1WB 4FABH 2AXGA 4IRJA 5IGXL 1UXSB 3J7HA 1EEZA 3GMLA 1CK0H 3VFTB 4F7CB 1KPRA 5BS0A 4YHIA 4RGOL 5F6HJ 2P43B 2R1YB 1TJHL 5EC2B 5SX4I 4QTIH 4RGND 3C5ZA 4JRYA 1V7NL 3B9EA 4FXLA 4LAJH 3SHSA 3C2AL 4BQ8A 3H9HB 1P7KA 1U8MA 1S7TB 2VC2H 1NKOA 1G7JB 2QSVA 5CZVH 3DXAB 3MOQA 5DRXA 2N1KA 4LIQL 5FYJE 4I18C 2O5ZL 2W59A 3QDGE 3EUUA 3QO1B 2QSQA 3TJHD 4WUKH 3SDCA 4Q9RL 2XTLA 4L8SA 4U1MA 1KACB 2GK2A 1UG9A 4R4FL 3C5JB 1EAJA 4P23B 6FABH 1IGYA 3D18B 5ECJE 1RFDH 3V6FA 3OZ9H 1Z0MA 2PO6A 4FZEH 2B1HH 4EI6B 2Y25A 1B3JA 5FGBC 1XF5A 5GZOC 3UDWA 5D7LE 1GGUA 3WKML 5ICYB 5TDOA 5EO0B 3BPOB 2PTTB 4EI5B 4KI5F 1AJ7H 5CJQH 2QKIB 2YEZB 5GGSB 4O2CA 1KEGL 4L5FL 2AEQH 1KCRL 3GJFK 2A74A 1I1AB 5D7IE 4PJIA 2AJUL 3UBXB 1NQBA 4RFOH 3HE7D 4M3JA 1XGUB 1BOYA 3O41A 4YAQB 4ZO8A 1QQDA 4RX4D 4KK9D 1VPOL 2IADB 2WBJB 4GUPA 2HFTA 5EBLB 5L2KA 4YDIH 1SJEB 5JHDD 3GI9H 3VW3H 2E7MA 4MNGA 1FAKT 2GJ6B 3HAEG 4GRWH 5L9DH 1A1MA 1KCVH 4WNQB 1TXKA 3BZ4A 2JIXD 4YHPB 5I66A 1BIIB 4IRJD 4OLVL 1NEZA 5GGVY 3R4DA 2HRPH 5FO7A 5C0AB 5BS0D 2WMPA 2ERJC 4JVUA 4WUUA 2VH5H 4GAYB 4JO1L 4DKAA 4HH8A 5T1LA 1NKRA 5BRZD 1J8KA 4HIJA 4BA8A 3MRDA 3QG7L 5HVWA 4N8VG 3U1SL 1BPVA 1UYWH 1D7FA 4R2GB 2X4TB 3BIKB 1E4JA 1R3JB 1DFBL 1FGVH 1J1PH 3RAJL 3SE9H 1J5OH 3CCHB 1MCWW 2MFNA 4HS8L 2JF1A 3MLZL 2H9GA 3R0NA 1I7ZB 2GK0A 1A6PA 3SDCD 2YMXL 2NY6B 2IH1B 3QQ3B 1J87A 3HLAB 2WNGA 3EOYG 3QIWC 1JRHL 3MLWH 5F7MC 1WWWX 4D9RE 4EN3A 4ZS7H 2X2YA 2D7TH 1X3DA 3E2HB 2RR3A 4GSDL 4HIXL 2DB8A 3IKKA 4FS0A 4KV5E 3EO9L 4P2CG 2JCCB 3RL2B 5F88A 3OGCB 3HZYA 4OLXH 1RUML 5INDA 2VISB 2EXWD 4R90H 5K9OB 2E6PA 1OW0A 2Y1VA 5EU4B 5AWNL 4KVCL 1YJDL 3C2SA 3N85L 4HKZB 1XF3B 1VKXB 4B7IA 3MLSL 1MIML 4O4YH 1U8QA 3KXFE 5KANI 5KSVB 2QJDA 5BO1H 5F1IA 4J6RH 3T0EB 4EVNA 5ICZA 1T0NB 5GGSY 1EFXB 4Z0BL 5L2KD 1BQHG 3CX5J 2VWEE 2EDBA 3QNXB 4IHOB 1MI5E 5IOPB 4QRPE 3EFFA 4P3CH 5FO9A 3TA3C 1DQQA 1HHHB 2FL5A 2GJZA 2CDFA 3LS4H 3ETBF 1LNUB 3RWIB 1EAPA 3T0AA 4XT1C 3O45B 1EHLL 3W5MA 1TJGL 2Z9TA 3BIBX 1A7RH 1WIPA 5C0DA 5F1NB 2OTPA 4JN1L 1AC0A 5C7XH 4KK5C 1N64H 3ULUE 4WUUD 3WS6C 4Z76B 5T3XE 5DJ2A 5DUML 2AS5M 4M1DH 4QOKA 5EN2B 3FQXA 5L0QB 3RU8L 3BZEA 1UQSB 2YXMA 1QSFE 2EYSA 2R69H 3O8XC 1BMGA 4ZNEE 3LEVH 4KXZH 2R29L 1DQMH 5J6GA 4E0RB 4EQ2A 1NCWH 3B2UD 5FM4A 1CE6B 3WD5L 4UNTA 1X5JA 1T0PB 1LP9B 2W9DL 2Y4SA 4MNHA 4QXTA 1AR1D 1VENA 5E2VL 3DGGA 4X5XB 5F7EL 4NYLA 5TE7L 2EKSA 2WANA 3PWNB 1S3KH 2LVCA 1NUGA 1PLGH 1EGJH 3FO0L 4EN3D 4Y2DA 4JDZA 2BJML 2B20A 4XH2A 4KZDL 1K4DB 1ZWIB 3FB8B 5KTEL 1N5AA 4MA8H 1VB9A 3WN5C 4MJ5B 2X4PB 3FRPA 3GK8H 3FB6B 5JZ7D 3GIVA 3KLHD 2A6JB 3GBML 3X14B 1FZOB 4RRPG 2XPGA 5KW9L 4PBXA 1XH3B 1I1YA 3BUYB 1TQBB 1YY9C 4MVBC 4EQ3A 2GFBA 1H15B 1I8IB 5CILH 3RY6C 1NUFA 4ORGB 1AGBA 2VDOL 4JM2F 2LFGA 2DQGL 4IBLT 5C70A 3D39E 1S7XA 2NX5B 2EE9A 1HCVA 4S2SB 3MREA 1A1NA 4J2XA 5CWSB 4JHZA 4M62H 5GISH 4HWZB 2R0LL 4MXVF 4ONHA 3VG9B 3OKEB 3VFUA 1JZ7A 1KTDB 5A3ID 1L0XA 1ZEAH 1WJ3A 3TZVA 1OGTA 4XXDB 1WZKA 1F42A 2YD7A 1A4JA 2VMFA 1E6JL 2X1QA 1BLNA 1E4KA 2PCPB 5IEHB 3GO1L 4GW4A 4QOKD 3VJ6B 3VRLF 1P6FA 1I9IH 2F74B 3IRZA 5CKAA 3BQUC 4KDTA 4E41A 4JG0H 4K8RL 1PG7H 4P48A 4PRNA 4P2OA 4UQ3B 2ITCB 3PWLB 4YBQC 3MROB 1HHKA 1EFQA 1NBZA 2FEEL 5B4MD 3MJ8B 3QO0B 3RVWC 5GGRB 1AGEB 4K9EC 4OZIA 1FC1A 3H9SB 1YNKH 1R3KA 4TSAH 1A8JH 4ZODA 3FOLA 4ZOAA 5JO5B 1U6AH 4N90D 4U1LB 4PS4L 5F9JA 5D1QA 1TFHA 1W0VA 4HUXB 3OHXA 4OCRL 1O7VA 4MDIA 4EXPX 4Y2DD 3FO2B 1INQB 3GI8H 4MX7A 5D7SH 4Q97A 1CGXA 2IQAA 1H8SA 4Y89A 3AB0C 3IU3B 1XF4B 5C0ND 3N9GL 4NQEE 2HH0H 4Q2ZA 1WCBB 3C6LB 4HFWB 4QTHB 1QR4A 3T8XA 3O4LA 4NC1E 4Y4KA 2YRZA 3BH8B 3V52H 5F71A 4MAUH 3WFEL 3HUJE 4PJ9C 1XGPB 2EDOA 3V4VH 2ADJB 5IQ9B 3WJJC 5HYJB 2FIKB 3MR9B 1DBKL 4HKBB 4PYGA 1H8OA 3QUYB 1JFQH 3KYMA 3D85B 4QHUA 1PX3A 1UA6L 4Y19B 5IMLB 2VIRB 1S5IH 1G7PB 3CUPA 5KS9E 2RGSA 3DUUA 3HR5A 3ULSA 4YXHH 4I18B 3O9WC 3SQOL 1ZT4B 3INUH 5LCVL 3TZVD 1IL1A 1CDCA 1FL6A 2Q8AL 4U3CA 3I3BA 5IHLB 1Z0NA 4R4BB 4JRWA 4E41D 1T1YA 3ULVC 4A2MA 3GMPA 1MCKA 5DR5L 4CVXB 4P2OD 3M17B 5HGDB 4OCXL 4HPYL 2ARJQ 1U8PA 4LLUA 4YPGA 4Z7NF 1GIGL 1LDSA 5FYKE 4ZFOA 1JGUH 3GSOB 3MCLL 2FR4B 2FCBA 1OQXA 3G9VA 2ZOKB 3QXAA 4NQDB 2BSRB 3WFCL 1Q0YL 5D6DA 2H1PH 5GPRA 4LNVA 4OD2B 5DD1H 1D5BB 4X6BA 1RUQH 1FFPB 5D1QD 3EYFB 2ATPB 1WF5A 4AMKL 5K9KB 4GMSL 2OJZL 4OQ1A 4IMKA 5GGRY 5ID1A 4PJHE 5C07E 5TGBA 3VG0H 1A3LH 2AJZB 4R4NC 2EE6A 1FNEA 4H5SA 4HUWA 1UH2A 3KPNA 4R96A 5BXFA 4I77H 3GB7A 1YEGH 3SGDH 3VFGH 1T66D 1KC5L 1UB5A 3O4LD 4K3EH 4O5LH 4Y4KD 1AIFB 3TN0C 4XAWH 3SEPA 3WFHA 4BK4A 2D31A 1S7SA 2MOVA 4TVPH 2N7AA 1UWGH 1WZMA 3S5LB 1KLUB 4LOUC 1N5YH 3GM0A 2WWMD 3B4NA 4N0UB 1NCTA 4HUMB 4LRIC 4YR6A 2VXSL 3NACL 4KROC 1NDGB 4TUJB 2I25N 4LL9A 2KKQA 3O2DL 1FYTE 3RHWF 1IKNA 4OZGE 4OV5A 3OJVC 1XFPA 3BRFA 3B9KC 1JV5A 3GMRA 2A9NL 1SQ2N 1Z3GL 4UI2A 2AXFA 4TTGA 4LVOC 4RSVA 2VLMD 2ZNWA 1S7QA 3IAPA 4KI5D 5BV7C 1U8IB 5C9JA 1P4LA 3HCVA 1U3HB 3WYRA 8FABB 3BKCH 4WDIA 1INEL 3GFUA 3KPOA 1HQ4A 3PQYB 4FZ8L 3OAUL 4NQCB 5IIEA 4JKMA 4ZOBA 4PJCB 4LVNC 1ZLWH 3IFOB 2J8HA 5T33H 4PJGE 4U1NB 1Z9SA 3EJYC 5IW3A 3MPCA 5MI0C 4I2XE 3RX5A 3P4LA 3VXRA 3EFDH 1EGJA 1GOFA 3OPZH 1U0QA 2QSTA 2R9HD 2FWOA 4XP1H 1C5BH 1LO2L 1KNOA 1BWMA 5I15H 3JTSB 5INCB 1XGTB 4PB0L 3WUWA 5D1XA 4M5ZL 4ODUA 2MPAH 1VGKA 4ODVH 4P57A 5E5UB 1BVKA 4AK1A 1JHLH 5EBMA 3QHFL 5E8DH 1T2XA 4NDMA 1E28A 4RAUB 2NY4C 1AGFA 2VDNH 3O3EB 3MRRB 4HG4J 3HG1A 4DGVL 1P5UA 1UWXH 4K23L 1NGWB 1JPST 2E7LA 1J0KA 3A6CL 2X09A 1H3GA 2FDBP 4JFQB 1HILA 3KDMB 1C5DA 3ARGC 1G6VK 4LF3A 3ZDZF 2J12B 4Q9CA 1OAKL 5GJTH 5HVHC 1X5XA 4GW1A 5ANMB 3HE6B 5HHQA 4G3YH 1RQ5A 4JM4L 4KJWD 1RULL 1FG9C 4Y4HC 2ZCHL 1ZHBB 5I18L 1G9NH 2DLIA 3TESA 2NLJA 1BBDL 2D7OA 4X7SH 1A4KA 2ORBH 4LLMA 4XI5D 4QRRE 3OSKA 4JPKH 1I8LA 1NH6A 2P4AB 3SPVA 1S9VB 4GRLA 4RDQG 1N59A 1OP3H 5IJKA 4OF0A 1VACB 5ELIA 3WN5B 1RZJC 3DYOA 3ES6A 4JB9H 4RMWA 4E42A 3MV8E 5HHPA 3CAFA 1BGXL 3TV3H 3NMEA 4PJEE 1RHHB 4JFPA 1G7IA 1L7TH 1U2CA 2FLRT 1ZHLB 2VNCA 3VXRD 2NXZB 1MRFH 2MSPA 5E4IA 5AZEL 4QNPF 2XTJE 4N0YH 3B5GA 4K71C 2XOTA 5I8EB 5TE4L 1ZLSH 1KFAH 4NFDA 3KLDA 5B39B 3TO4A 1I7TA 4W81A 5IM7B 5GGVH 5TF1L 1D5XA 1DQJA 2V9RA 3QWQB 4KUCD 4TQEH 5C0BB 3VXUA 2HWZH 2D2OA 4FFWD 4NZJA 4HX1A 3B43A 4TTDC 1KGCD 3SGJA 4Q6IB 5D1XD 1PZ5A 1FDLH 1FFNB 4FQXC 2A9MH 4MSWB 4Y1AB 3L5JA 2HTLD 4WI6A 4F9PA 1BJ1J 1U8HB 3BPCB 3PWJB 4G8FB 4ZDHA 2OZ4L 5D7KE 5E2TL 1YDPA 1J86A 3ZKSD 3W9EB 3D3VA 4AL8H 2D7QA 1BQSA 4XHJC 3RZCC 4KZEL 3RBGA 4L9LA 1A1OA 3HRZA 2H3NB 3HG1D 5I2IA 3LRHA 5KVDL 1TZIA 5I19H 1ZHKB 3BD5A 3WLWD 1T2QL 4I5BA 1A6UL 3KR3L 5ID0A 2OL3B 4I8DA 1YEHH 3ARXA 3MOBH 4C56B 4IS6A 1WIUA 3QUZA 4NP4L 3V6OE 5EU7C 3VWJB 3O6ML 4X4MA 5C0EA 4HH9B 5HVGB 5MERB 4TSBH 3RPKA 4JR9H 4FHBD 3UJIH 4RQQA 4NOBA 3IFNL 5DURB 4UV7H 3CSYA 3EZ8A 5IW6B 2GSGA 5HI4D 3QNZA 3TYGH 2CD0A 3T4YA 3QCTH 3S6CA 4GRLD 2AK4E 4EOWH 3OL2A 1QSEE 3ZT5A 5IVXE 1OB1B 4PREA 4JZOB 6CGTA 2DRUA 5DVMA 3WIFB 5HHVH 4B41A 2KBGA 4AT6A 3AREA 2XI9A 1RIHH 1A9EB 1RUAL 3D48R 3OF6A 3P4MA 4NN5C 2ICWJ 4G43B 2NY2B 4LU5H 5E6IA 1IBGL 3QDJA 3GMQB 3TO4D 4ZPVA 3WNKA 1JPSH 4OM1H 3PGDA 4CN4A 2FEDD 2NYYD 3ARRA 3S36X 3VXUD 2ATKB 3VA6A 3FRUB 5ADOH 5DUBB 1I8KB 1WBXB 1IT9L 4JY5L 35C8H 5D1ZC 5I1KL 5I1EH 3PIQB 3V0AC 1K9TA 3J8F7 3TBWA 5I71B 1A7BA 2V2XB 2JCCF 3BEVA 1JHTA 3D3VD 3TT3L 1CYGA 1H3XA 3OWEA 3VD4A 3HNVH 1TPXC 3S3PA 4LCYA 3Q1SH 4QHLA 4OF5A 4XAKD 5DK0A 4UUJB 5KSBB 5DK2A 2APBA 1FG2A 1N6QL 1LO3H 1E4WH 1GRWA 5FUZL 3MRGA 3RY5A 1OAXH 3SDXB 1D9KC 3P2TA 3D9AH 1CTNA 3G6JB 3QUZD 5GQBA 3O6FC 3BUTA 5DDHB 1ZA3B 4O02L 4DFIA 2N7BA 1HZHH 1CXLA 3QUML 4FXKB 1ZK9A 3QDME 2B1AH 2P24A 3BH9A 4JE4B 1LO0H 5E08H 4RZCB 1BOGB 3QA3B 3MBED 4Z6AT 5IB3B 4NHUB 5FUOL 1IC5L 4CW1A 5GS1B 1BWWA 3KPTA 1Q9OB 4DUXA 4OCYL 2EH7L 4F37K 3ZKNC 4H8WC 4DKEL 1JWMA 3G6DH 3OJDB 5LXGH 4CDHA 2VDQH 4XVJH 1RK0B 3STBA 2Y06L 4PG9B 5J9PB 3T1FA 1S9XB 1U8NB 5JW3H 1KEMH 5IFAL 4MJ2A 5GRVL 4NJAL 3RVVC 3UBXG 4F33B 3MJ7A 3ARED 3VXMB 4PTUA 3NVQA 5SWSA 3OF6D 4JFYB 4KK8C 1DBAL 1AXTH 1RIVH 1AHWB 4OCWH 5ITBH 2BVTA 1PDKA 3DVGB 3QDJD 5IW1A 2X6MA 2QHRL 5TDNB 3GSRB 2C3XA 2DQDL 1BFTA 1RD6A 4H0IA 3ZLQC 4LCUB 1CLYL 1ZA6A 4LCCB 2GHWB 4DGIL 3GGWB 2UY6A 5JW4M 1G7QA 5F9DC 5DMKA 4BM7A 1IC4H 1OAQH 4KRPB 3TNMB 4M7LL 1FH5L 2Y23A 2FJHA 5DZNA 1CF8L 1CVRA 3AU1B 4XNMA 1MCPH 4TVPD 5T1KB 1S7WA 1L6ZA 2XQBL 3CMGA 2YD1A 5B22A 3I85A 4YHNA 1FNHA 4DOHE 2BP3A 2NNAB 3I2CH 3DX7A 3W0WA 3STZB 3V2AR 2GITB 3MJ9H 1DUZA 4FFVD 4EDXB 1CGVA 3SGKC 1RVFL 4QY8A 4R9HA 4XC3H 3UMTA 3F65A 3QP3A 5HI5D 4D9LL 3UTPD 5D2NB 4ODSH 4R6UA 1CGSL 1XCTA 5MI0B 3WNLA 2I5YH 2GY7B 1HDMB 2EYRA 2XXCB 1WZ1H 3MQIA 4PFEA 1NCBH 3PGCB 1OM3L 2AEWA 3VWKB 3QXTA 3B2VL 1OSZB 1NGQL 1QBAA 3O3DA 3B9DA 1G1CA 4K9EL 5C0CB 2H8PA 3ZT6A 1NDMA 4HJJH 1YQ2A 4Y5XA 1X5GA 3CFIC 5HHNB 4AYFA 3RKDD 3QH3B 4G8GB 2XZQH 3X13B 4DW2H 5ITFB 4JJ5A 4RFEB 1PBYA 5C86A 3DTXB 1CDJA 1FVDA 1SY6L 2QBWA 4DVBA 3PP3H 4ZTPH 4ZOEA 2A6DB 2Y6SC 3IYLW 2HVJB 4PJBB 5BCAA 4P5TA 3U83A 3VXSE 4LLWA 2FX9L 4GAJL 3GJEB 5SWSD 2NY4B 4KU1A 2AGJL 3QCUL 4PJ7B 2W07A 2AV7B 5IBUB 3VXNA 1JGDB 4H1LB 3PHSA 4YDKL 1DLFH 3UYRH 3DSNA 1AQKH 3BRDA 2R1WA 3PP4H 3KNBB 3OTTA 5IMOB 2AABH 3MV7E 1UXSA 5LWYH 3ARGB 4F7CA 3VFTA 5DI8B 4Y2OA 3CMOL 2EDQA 1U8JB 4LLDB 3ZL4H 4HC1L 5M95B 4N5EC 1R5WB 4UQ2B 5CBEB 1KJ3H 1CDGA 2AI0L 2R1YA 1A14L 1RZFL 1J1XL 5EC2A 3WXWL 4IRSB 5IQ7H 3RVUD 1WEJL 4N5UA 1U41A 2LE9A 2EO9A 1RZKH 3H9HA 1S7TA 4P9ML 1DSFL 2DMBA 3W0WD 3KJ4B 1G7JA 3R06B 4O00A 4Y16C 3DXAA 4X99A 5DJAB 2BZDA 2ICCA 2X4OB 3QO1A 2PXYC 5F9OL 4QHKI 2UWEB 2YD8A 3ILPB 1FL5B 1DBJH 1HNFA 3C5JA 4P23A 1UGNA 2B5IB 3VCLB 5L7XH 2BNQB 3D18A 3WV0A 1X5HA 2A6KB 4DKDC 4NO5B 4DQOL 3KPPB 4ZO7A 3ULUL 3MXVH 4K71B 5ICYA 3O2WH 4X6FB 3AXLA 2FJGB 5F96H 3OXSA 5EO0A 3QHZL 1NMCB 1RV6X 2PTTA 3IFLH 3GHEL 4XP5L 2E7CA 3QQ9D 4EI5A 2QKIA 2YEZA 2YRLA 5GGSA 1QBML 4FQXB 2YWYA 1W72L 1ONQB 1I1AA 5HDLA 4YJZL 1HYRC 4FQ2H 3ZE1F 4ELME 1A9BB 4NCDA 4OD1H 1XGUA 3MLRL 4YAQA 4P5TD 4KUZL 2HJLB 3RZCB 1FNGB 2IADA 2WBJA 5EBLA 3GZKA 1UZ6E 1SJEA 4X6DF 1FQ9C 2GJ6A 3QXDB 3G5VB 2NY1D 2VLJD 3U0PB 3HMXL 1OVZA 2XZCL 4YHPA 1BIIA 1QLFB 4PLNC 1AY1L 5C0AA 3TH3T 5J12B 3CVIH 4P5KB 3P4OB 4GAYA 4XNXL 4G8EB 4JO2L 3ARDB 4YO0B 1EZVX 1FE8L 1JCKA 3DIFB 3PXHA 4DTGL 1A6WL 1JJUA 3BIKA 4U6VL 2DKSA 1R3JA 3H3KA 2C4FU 2VITB 4D0BB 3AFLA 1QFPA 1OCWL 1YC8A 1N26A 1QNZH 3CCHA 3DXAD 1BX2B 5D93C 1I7ZA 2EIZB 1MPAH 1CZ8L 5BV7L 2IH1A 3AVEA 3QQ3A 4ESKA 3P30H 2Z31B 1SJHB 4P23D 2OSLA 4YC2C 4R26H 4HS3B 4LSRH 4P4KC 3MLPA 1QLEL 4DEPB 2OM5A 3SY0A 4NKIL 2ARJB 4HK3N 1CN4A 4RFNC 5I1GH 4JRYE 2B0SL 3QDAA 2WZPD 4S1QL 4OIIH 2JCCA 3RL2A 4YUEL 4TNWF 4NKMB 3OGCA 3S98A 2V17L 1T04B 2EDXA 1UACH 2VISA 5I1HH 5IVZB 4EI5D 1UADC 1KB9J 2FX8H 3G08B 3U79A 3L3HB 5K9OA 3QRFM 1BBJB 2O5YH 2NY5C 4G7YL 5EU4A 4WY7L 4HKZA 1XF3A 1YEFH 1VKXA 5TQ0L 3Q5OA 3U30B 1I1AD 4BFBD 1UM4H 2VZVA 4PRIB 3X12B 1EK3A 4KGLA 1OHQA 2FHFA 1V3JA 5KSVA 1SMOA 1NBYB 3T0EA 5LVEA 3H42L 5DFVD 3R8QA 1T0NA 2ICWB 2WBJD 4XCNB 1EFXA 1JUFA 1TPXB 4J3VA 3N1FC 3P9WB 3QNXA 4IHOA 3SJVB 2GJ6D 5IOPA 3BT2H 1HHHA 1TVHB 1F11B 1LNUA 3RWIA 1I9EA 3F58L 3BJ91 2F5BH 3MTRA 2W9LA 4AZ8A 2NY0C 3O45A 4FQ1L 5F1NA 2Z8VC 5C0AD 1AKJB 4J4PA 5EWIH 4Z76A 2PYEA 4GKOA 1JHKH 4JDVB 2F19H 3EJZC 5EN2A 1X4ZA 4XP9H 2C7UB 4LLYB 2IGFH 1RURL 5GS3A 2VLKE 1UQSA 1KPVB 3HA0A 4R2GD 2W65B 5HYSG 4BFIB 1ZGLM 2X40A 4YHOL 2RCSL 5DC0A 4BUHA 4BUGA 3CGTA 5JMOC 4E0RA 4RMUA 3IJYB 4WEBH 1CE6A 3LHPH 4UT6L 1LP9A 4NRZB 2NY6D 1FPTH 3OKOB 4X5XA 3IJSB 4PJAF 2HVKA 4CADB 1MVFA 2XYCA 3HC3H 1H5BC 1BF8A 3RA7H 3P0YH 4QRTB 3ISWA 4JY6B 4MAYB 1K4DA 3T2PA 1ZWIA 4PJFF 4X7DC 5D72L 3FB8A 3T4AA 3E1F1 4OGXH 4GRMB 1JK8A 4CDGC 5EZJB 4MJ5A 2X4PA 2F53B 4JO4L 3LKOB 3FB6A 3H7BB 4OT1H 4DCQB 4RGNC 2BX5A 4X9BA 1JNLH 5IR1A 4A6YB 1FZOA 1QFHA 3CDFA 1SMAA 3DSFH 4S1SH 1NC2B 1XH3A 1S9WB 3O2DA 3BUYA 4YFLF 5H94A 5HHMB 4YBHA 4KQ3H 1H15A 1I8IA 4GQPH 5E56A 1U8LB 4ORGA 4Z7VB 4FQCL 1R3HB 2IBGA 2WIIB 4DK6A 3T0ED 3UPRB 1J05B 3BZFB 1EFXD 1XGRB 4OBSA 4OQTL 4HW6A 5CWSA 3WNMA 1MFEL 4HWZA 4NZUL 2YD9A 4Z7WF 2XICA 5C3TA 1N4XH 3ZSSA 3OKEA 4U1JB 3SKUD 3DHMA 2M2DA 1OPGL 1JNHB 4I4WB 5EOCH 1F2XK 3VH8B 4N0CD 1JWUB 4FQHB 1UKQA 4XXDA 3PWPE 4FNLL 5HY9A 5IEHA 2PCPA 4J4PD 3MRPB 5E7FA 4R97C 5J7CC 1FLRL 4W68A 3VJ6A 3BKMH 2F74A 5I8KL 1HSBB 3OKKB 1FCCA 2YUXA 3FT4B 4UINH 4CU7A 4UQ3A 5KVGL 2ITCA 3S4SB 2WK2A 3PWLA 4JKPH 4NWTL 5IBLD 3MROA 3HE7C 4IDJL 4XXCC 5HD8D 3MJ8A 3QO0A 3P4NB 4K7FB 5ERWB 5GGRA 1AGEA 3UYPA 1ND0B 3H9SA 4KK9C 4HCRL 2OTUB 1G9EA 4I3SH 2D7PA 5JO5A 5CJBA 3ARZA 2CRMA 4NNXA 1ZLWK 1KCKA 2YA1A 4U1LA 3LMJH 4HUXA 3AC0A 4LEOB 4WFGE 5DRNB 4K3GA 4LASH 3TP4A 5E9DE 1WTGT 3FO2A 1INQA 4JGJA 4QOKE 1UEYA 1B88A 5IHUL 1T03H 3RHWK 1I3GH 2YA2A 3MA9H 1J1OH 4L9DA 1RUKH 4NGHH 5EIIB 3IU3A 3HZMB 3TJEH 3MJGX 4MB5A 1XF4A 2N56A 3DROB 3C6LA 1BEYH 4HFWA 4QTHA 4YX2L 1N8ZB 1RMFH 1T4KB 4HPOL 2FECI 2VR4A 3T2NH 4PY8I 3MOAL 2X4QB 3BH8A 2EH8L 3ZE2E 4RWYL 2J2ZA 4NNPL 1IKFL 1XGPA 1KUMA 4GG6B 3AS0A 3BSZH 5IQ9A 5LGHL 5HYJA 1NC4B 1BAFH 1A7QL 2FIKA 5F8QC 4MJIB 4L8SC 4HKBA 3QUYA 2NX5D 1RZ8B 2E6QA 3ZDYE 4AJ0A 1H3UA 2BXZA 4Y19A 4PTTB 5GGTL 3BJLA 3GSUB 1UWXK 5IMLA 2VIRA 1G7PA 2OL3H 1HHJB 5J11C 1M71B 4R8WH 4I18A 4WTWA 1ZT4A 1DTUA 4NCC1 4Z7UB 2PXYB 4PGEB 3TBVB 2DQUH 3VGGA 1B0GA 1CXKA 2EXWC 2G5BB 1OGAB 2LQRA 4WW1B 5JORB 3MUJA 5ACMA 2Z35B 2FZ3B 4R4BA 5DGQA 5DRZB 2X44D 2HKFH 4CVXA 4KPHH 1E4XL 2FH8A 3M17A 4YBLB 5HGDA 4OV6F 3MBXH 1CQKA 4HKJB 4NO3B 5C09B 3GSOA 3H9SD 2HFEB 4QRUB 2FR4A 43CAB 2CK0H 4FQJH 4M6NH 4NQDA 2ENYA 2ZOKA 2BSRA 4XNYL 5KSBF 1FZJB 3CZFB 3MRIA 3ROLB 4OD2A 5AUMB 1D5BA 1FFPA 3ULVF 2ATPA 2P42B 2HTKD 5K9KA 4FFZL 2ZJSH 4HUKB 4F8QA 4UAOC 2AJZA 1U8KA 4H8WL 3G6JF 3M8OH 5CINL 2UUDH 5IBTH 1JZ5A 4HDIB 5FCUL 1CD0A 3S37H 1FORH 1CL7H 4PD4J 1JP5A 2GAZA 4X4XB 5ALBH 1PG7X 4ZO6A 2FGWL 4HLZH 2H32B 3C6LD 4PJ5E 4OZIE 1Q0XL 1V3KA 4OZ4B 3V5DB 1ZLVH 1AIFA 5JQ6L 3SKJL 4ZS6C 1G6RB 4QHMB 1KJ2B 2D0GA 3BP7B 5J1SC 3B2UC 2DYPB 2DQFB 2VWEC 2YR3A 5AZ2L 2ZKHL 4B53A 5B3JF 1IM3B 5HYJD 3S5LA 4MCYB 2ZZUT 1DQTA 5SV3A 4N0UA 1I7UB 4PJXB 1AR1C 3CH8A 3RI5F 3QUYD 3FZUD 3BGFC 4OB5H 1NDGA 1QFWH 3D85D 4TUJA 2YPKB 5HVFB 2VDKH 4GXUM 3U7WH 4Y19D 1NAKH 3ULVH 3D25B 4G6FB 4JFHE 5E94B 1SM3L 5DSCB 3MXWH 2IPKB 3CVHL 3DYPA 3O4LE 1FBIH 1XMWA 3G6AB 4OCSL 3LEYH 2Y07H 2BSSB 2FJFB 2YPLE 3ZYJA 1U8IA 3U0WH 4YC2B 5JZ7C 1U3HA 8FABA 5T3ZH 4CVWA 5HDBE 3E0GA 1F3JB 1RZGB 2Q6WA 4LPXA 2VRAA 3HZKB 3GHBH 3FONB 3PQYA 4RFNB 1H8NA 1RZ7H 4N8PA 3CLEH 4NQCA 1KOAA 4XCCL 4PJCA 5AG9A 3IFOA 1F8TL 1FV1B 1QFUH 2O26U 2XA8H 3PABB 1IVLA 1LQSR 1Q72H 1JYWA 5ABDE 4NQDD 5HDQH 5DA4A 2ADIB 4HWEH 4QXUH 3MV9E 2AEPH 3OBAA 2VLME 3C5SB 3HC0B 4KI5E 4XWGL 5D4QA 5E2UL 3NIGE 4NO0B 2O5XL 2Q76B 4U7SA 3JTSA 5INCA 1KXTB 3MNWB 3CFKB 1XGTA 1BQLL 4XVTL 4QXWA 3TNNB 1TMCB 3VI3F 1MRDH 5EH1A 5ESAB 4HLZG 4G80B 4LHUG 3TA3A 2LU3A 3VE0B 3SE3A 1URLA 5CEZH 2CXKA 1I3RB 2NY0B 3MUGB 1Y18B 3L1OL 3MRCB 1F5WA 4MXWH 4RAUA 3Q6GH 1U8OB 4JO3L 1H3VA 4YDVB 3O3EA 1MFAL 3WS6A 1XF1A 4U3XA 2AEIT 5HGHB 1NGWA 3TVMC 2WUCL 1WWAX 3ARQA 4P9HL 3MACL 4JFQA 2J8UB 1MCEA 3LIZH 3KDMA 1KEGH 3MLTB 4DK3A 1PKQB 4ENEC 5ALCH 1Z6JT 2C1PB 4QXGH 1CXFA 1A64A 5D5MF 1IEHA 4OI9A 2ZNXA 3RDTB 5ANMA 3HE6A 3BDYL 4NJ9L 4ONFH 1ZHBA 5JA9A 5C0NC 4CKVX 3RGHA 1H5BB 1C7TA 3KLAA 1U3HD 3PV6B 1C5CH 1F2QA 1S9VA 4GLRI 3PQYD 3V8CA 1X6NA 4NQCD 3RWGB 4M7JH 3WN5A 4ELKB 4UDUA 3ARYA 4OLVH 2APFA 1YYLH 3V5KB 1GGCH 1IAMA 1RHHA 4NQXB 1ZHLA 3OG6B 3R0MA 4EDWH 4HGMA 4ODHL 4Z7WA 4GKSB 1NFDB 5I8EA 5FHBH 2HA1A 1BZ7B 3RY6A 2EC9T 4OTXH 2EEAA 5B39A 3IF1B 5L6YL 4ZD3L 2DIJA 5IM7A 4NN7C 3D2UB 4WI7A 5C0BA 3TZVC 3ZKXB 1D3CA 4Q6IA 1E4KC 1FFNA 4H1LH 3MLZH 5DWUL 4MSWA 4Y1AA 3QEHB 4LFHG 32C2A 1QO3B 5CEYB 4UIMB 3TA3D 1U8HA 2QLVB 3BPCA 3PWJA 4G8FA 1HHGA 1HINL 1X4YA 2OMNA 3FQNA 4P2OC 3WSQH 3W9EA 4XB7A 2IANE 1DANT 3QEQA 3BIAX 2XZAH 2LTQB 3LKNB 1FJ1B 2P7TB 3V6ZB 2BVOB 2H3NA 4R97B 3LPFA 1UKTA 1IAOA 3THML 4O2EA 4OM0H 1ZHKA 3N1MC 5F3BB 4WV1C 3D0VB 5D1QC 3MNVB 2OL3A 3QDGB 5D7JB 1FVEB 4P59L 1SBSH 5ILTH 4C56A 4LLQB 3VA2C 4N1HB 3LPWA 2MCPL 3GRWH 1O0VA 1MSPA 1RJZB 4H0HB 4JREC 4KRNA 5CSBA 2V2TB 4LAQL 4HH9A 1DLHB 1RZJH 3UZVB 5MERA 3HE6D 3V0WL 1W8NA 2R0WH 5B21A 2C3HA 3FFDB 1KB5B 1T66C 1OT2A 1ZE3C 2CKBL 4GT7A 1WAAF 2DQIH 2DLEA 3L7EB 1SVCP 1R3IL 3E3QE 2V7NA 1EO8L 1HXMB 3BD4A 3RVTD 1NBVH 1O5DT 1LDPL 2DTSA 1OAUH 3B8SA 3RIAF 1MQ8A 1CLOL 1OB1A 3CNKA 4JZOA 4HJGB 5D7IB 2B4CL 2WWMC 1U3ZA 3AROA 3NIDF 3MUY1 3QG6B 4X7FC 4GBXC 3WIFA 4MD0B 4XPAH 4Y5YC 1DBBH 4B50A 2NXZD 1A9EA 1KG0A 1T7YA 3A6BH 1YECL 5F72S 2QADC 2VXVL 1YY9D 4G43A 4MVBD 5T5FL 5CUSL 2DF3A 1C08B 4XRCB 2COQA 4F7MB 1QEWB 3VD9A 1YPZF 5D2LE 4LP5A 2R4SL 5C0BD 2ATKA 3NABH 4AEFA 4GAGL 2GT9B 1G9ML 1PY4A 3FRUA 3JWOL 2WBWB 4Y1AD 5DUBA 1I8KA 1WBXA 3C09B 4DVRH 3NN8B 4ZAKC 3PIQA 1X5YA 3DX6B 3KYKH 2V2XA 1BJ1H 4HWNA 2AJ3B 1VERA 4LCIL 2VE6B 4MXVE 1WICA 4NQVB 3BMVA 2VABA 5EZIH 5CLWA 4UUJA 1HH6B 3B6SB 5BVJB 4H26B 5KSBA 3VXUE 5IG7B 4P2QE 4M7ZC 2P47B 3SDXA 2CIIB 4C56D 1MAMH 2Z91B 1CGWA 1CFVH 5E2WL 3RVWD 1CI5A 3G6JA 4LSVL 3VWJD 1HE7A 1QYGL 1ZA3A 3RWEA 1JNNH 2VZ3A 5H37H 4FXKA 3D3VE 1UH3A 5DURD 1SJVA 4RZCA 1BOGA 3QA3A 5IB3A 4UILH 3ZSTA 4NHUA 5K33A 2DIAA 5GS1A 4WFED 2X41A 2ZOLA 4HF5H 2XWJB 3BN3B 2A6IB 4GXVH 3OJDA 1RK0A 1VFBB 4PG9A 5J9PA 1AO7A 5E2JA 3QFJE 4ZTOH 1S9XA 1U8NA 4DN4H 5T1DL 3QNYB 4G6KL 1CIUA 3KXFB 4X4ME 1S9KC 2YS4A 3I9GL 3VXMA 3KYAA 5C2BL 1IKNC 1RJLB 3D0LB 2AQ1A 3F6IA 2NY2D 5DXWA 4Q9QH 1AHWA 1N0LA 3NTCL 4L4VA 3DVGA 1GHFH 4QRPB 2XN9E 5TDNA 3GSRA 4LRIA 1QA9B 1DQDL 1KCUL 2DD8H 4LCUA 2R2BB 1X5ZA 4LCCA 2XT1B 3GGWA 1XEDA 3WDJA 3L5XL 3KPLB 4YH6A 5F1KC 3WIHH 5F44A 1CDHA 4G7VH 4XI5C 3HI1B 2YPVH 4RNRB 4YGAB 3TNMA 1WWCA 2CUHA 4HK0B 4YXLH 3FQRB 2KL6A 4CU8A 3AU1A 1FO0B 3T3PE 5T1KA 5EDXA 1QSFB 2J6EH 3S36L 5TPWL 2NNAA 3U7YL 2GY5A 3QDJE 3STZA 2GITA 3IXTB 4LLAA 4HFUL 4ZG1A 4EDXA 3ULVD 3QEUB 5E70A 1FAIL 4RMRA 1CS6A 5DMJB 4M6ML 1KTRL 4G5ZL 4I48B 1GVIA 5D2NA 4DGYL 3WLBB 5F9AC 2OP4L 4O9HH 3BEWB 5DF0A 4HULB 4FFWC 4HK3J 5D1XC 1MHPL 1HDMA 1FNSH 3GSNL 2EEDA 2F8OA 4XPTH 2HTLC 5F8RC 5T3ZD 4LGRB 4Z7NE 4UT9H 4HBCL 1OSZA 2A38A 5C0CA 1LE9B 4YQXH 2DLGA 5I73B 1HI6B 4R4ND 4XTRC 1FFQA 1YYMH 5HHNA 4NRXB 3STLB 3QH3A 5F70A 4G8GA 3X13A 5ITFA 4RFEA 2ADFL 1H3WM 5BZDB 1MEXL 2OBGA 1OTUC 1X5LA 5C0FB 5JUEL 5A2JH 4UB0H 1MJUH 3WLWC 2A6DA 4PJBA 2HVJA 3MRNB 3VXMD 4H20L 3GNMH 1FIGH 3GJEA 3D39B 1YMHB 4K07A 5DQDL 4PJ7A 1D5MB 3MGAA 2I60L 1NMBL 1JGDA 1YY8B 1RIUL 2HP4A 4H1LA 3NFSL 3TVMB 2VOTA 2DWEB 1DQLL 1GIGH 3KNBA 3QCVH 1D5IL 2KH2B 5DTFB 5IMOA 4M43L 5CEZD 5HI4C 3ARGA 2JLLA 3GMMB 4BZ1L 5DI8A 1TETL 1U8JA 3H3PH 1Z9LA 4LLDA 4KRPD 1R5WA 4UQ2A 4GRLC 5CBEA 4OGAD 4OLUH 1KN2H 5IJKC 2JK5A 1WTLA 5CGMA 4IRSA 3TEUA 1AE6L 3PV7A 5T1KD 5T5NG 3VXTB 4TNWK 3EYVA 5GHWH 4LARH 5JR1H 5DD0H 5I1AB 5CJOH 3C87A 1JN6B 1EJOL 3R06A 5DJAA 4KTDH 4Y0GA 2X4OA 3GRWA 4KKCD 4GG6F 1ES0B 2DWDB 4HUNB 5IFHL 1IAIH 2UWEA 3ILPA 4IOFD 1FL5A 1TQCC 1V7ML 1S9YB 3VCLA 2FEDC 2BNQA 3EJYD 5GS0H 2A6KA 4NO5A 1IC7L 3HAEB 5I1JH 2CR6A 5GRJL 1A5FH 4IRZL 4F9PC 3VWKD 4X6FA 1Q94B 2FJGA 4K3JH 5FA4B 3CU7A 3WHE0 2JKXA 5C0CD 1T3FB 2V5YA 4XMPH 4MXQC 3W0WE 5FECA 4NQEB 3UAJC 4CMHC 3CFDB 5CCKL 4G8GD 4L9LC 4I0PB 1NMAL 1INDL 3LN5B 4FQXA 1ONQA 4JFZH 4TRPH 4U6YB 4N8VB 2C1OB 1F4WH 1A9BA 2E8YA 3IDXH 3U9PL 1W0YT 3IKCB 4U1SB 2HJLA 5D6CB 4AIOA 3RZCA 1FNGA 5CD3A 2NY4D 3QUZC 2V6HA 4FZ8H 5F7YC 3GBNH 3QXDA 3TWCH 4EUPB 4JQIL 3HI5H 3U0PA 1PG7W 4WV1B 3MUHL 2YD3A 2HKHL 2YD5A 4F7PA 2WUBL 2ZUSA 2YXFA 2DI8A 2J88H 1T22B 1QLFA 2UYLB 3MBEC 4EKXA 1WAAA 3ARGD 4YFDB 2FECL 2R2EB 3CX5K 3MLUH 3N50A 4K7PL 4P5KA 3ABZA 3P4OA 3CFCH 4Z7QF 3CSGA 2K9UA 3ARDA 3MV01 4IRSD 2IG2H 4YO0A 4ISVB 4OLZH 2ARWA 2ZP0T 3O6LL 3ZDZE 4PB0H 4HMEA 2IJ0C 3S9DB 5LQBL 2VITA 4D0BA 2JB6B 3AREC 4HWBA 3VXQB 2VXUL 1BX2A 3EIFA 1ITCA 4X80L 5GRVK 2EIZA 5TJWK 1DDHB 3QZWG 3ZKMD 5EZOL 4XBEL 3UJTL 2BFVL 3O3BB 2Z31A 1SJHA 4KY1H 3CFBB 2BNQD 4GBXB 1BQHB 4XB8A 2YHGA 4HS3A 3W5NA 3BYYA 3JBG7 1EZVY 4JFEE 3B5TA 4Y5YB 4P46C 4PJHB 5C07B 3VGBA 4HZAA 1A3RL 2ARJA 3VFWB 1UM6L 2QADB 5EOTB 2ITDB 5E95B 3ZTJH 3A67H 3MRKB 4JVWA 3NCEB 1X5AA 3LH2L 4HT1L 4NKMA 2H6PB 4ODTH 1T04A 2H2SD 1UCBL 5IVZA 3G08A 3WS3A 3L3HA 5I1LB 4QNPE 1BBJA 4TTDD 4AY0A 5JW5B 3QXWA 1VGEL 4FQXD 1D6VH 2H32H 1IQDB 2FD6H 4PRIA 2ZG3A 4ZAKB 1F58H 3DWTA 1NUNB 1JZ8A 4F58H 1MH5B 2G60H 4U2ZA 1NBYA 5E1AB 1G6RH 4G6JL 1KJ2H 4PB9L 5A2IH 4NZDA 5HI5C 3RZCD 2FATL 2ICWA 3HC4H 3PNWB 4XCNA 2ID5A 4PRPB 1N3NB 1BFVH 3QR2A 3SJVA 1OY3B 1WISA 4QHKJ 3EOTH 1L7IH 1JYXA 4PRHE 2UZYB 5HPMA 1EMTH 1TVHA 1F11A 1P4IH 4Q0XL 5D9SB 1NLDL 2B8OT 3OB0H 2VQUA 3WIHA 1I9JL 5SWZE 1PSKL 2OR9H 4M7ZB 2I27N 1TTFA 1DVFC 1D9KA 3TLRA 3K8LA 5EUOE 4YE4H 1H9VA 4AEEA 2D3VA 4JDVA 3T09A 4JPWL 3RKDC 2DI9A 4MA1B 2C7UA 3ARDD 4LLYA 2EKJA 1BJMA 2R8SL 5DJ6B 1KPVA 2VDLL 1NCUA 2W65A 4BFIA 2YC1B 2OQJB 1J11A 3QJFB 5DD3H 4TUKL 1EEUA 4O58L 4LEXL 1YMME 1C7SA 4PJGB 5SWQB 3IJYA 4MS8D 4KDVA 1QKZL 5HTSA 4GMTH 4X0KB 4I2XB 4NRZA 4WEUD 4AEHL 2ESVE 3T2QA 4XVSL 5C08A 4JPIB 1A0QL 3OKOA 2AQ2A 2LABA 3IJSA 4XP4L 2NY5H 2Z31D 4NKOB 4CADA 4J12A 4LHJB 2VDML 4U0RC 5FKAB 3V4UH 4UZGA 2ED8A 5E1HB 4JY6A 1QRNE 4MAYA 4N9OB 1WBYB 3TCXA 3NZHL 3PDGA 2CLVB 2IQ9H 4GRMA 4PV9A 3PGFH 4JZJB 2NQCA 1T1WB 3S34L 1GXEA 3LKOA 1GC1C 3H7BA 3JWDH 4DCQA 4XMKL 4WFFD 2UUDK 4PGJA 4A6YA 3K1DA 3RNQB 4FABL 1MQKH 4LSTH 1NC2A 4PRID 1TJIH 2VXQH 5SX4H 1CK0L 1U8LA 4ALAH 3PL6B 4Z7VA 1R3HA 2R2CA 2WIIA 3UPRA 3NCBB 1V8HA 1ETZB 2W0KA 2AK1H 1T5WB 4QTIL 3BZFA 1XGRA 5IB2B 3SJVD 3FN3A 3FN0H 2VR9A 4KMTH 2JCCE 2VC2L 3ZYIA 3WJLA 1G9NC 3JWNC 5CZVL 4U1JA 3SGKA 1NGXB 1JNHA 4I4WA 4WUKL 1D9KD 2FNBA 4XCFH 3VH8A 4FQHA 2X5PA 3NIFF 4POUB 1AKJD 3QQ9C 3MRPA 6FABL 4L8BB 1YEJH 1RFDL 1RY7B 4OZFB 3OZ9L 1HSBA 3OKKA 2VAAB 4QRRB 4FZEL 2B1HL 4C83B 3FJTA 3FT4A 4OFDA 2QR0B 5E6ZA 3S4SA 4PRDB 4HGKC 2VQ1B 5ERWA 3P4NA 1RU9H 1ND0A 1GGIH 1BIHA 1AJ7L 2OTUA 3T04D 5C0GA 5JXAH 5CJQL 3RVXC 1JGEB 1KELH 2XACC 4M48H 5K59E 3K8MA 1JTOA 2AEQL 4JZNB 2OTWB 5GRWA 1U95A 2XTJB 2GEEA 5IF0B 4LEOA 5IV2B 3RVVD 5DRNA 2PYEE 4RFOL 5ISZE 4AIXA 3RI5K 2FEEI 3IDJA 4MAYD 3N0PB 4YDIL 5K9QG 5EO9B 3GI9L 3VW3L 4ZXBB 5EIIA 1OAYH 3LRSB 1IZKA 3F7RA 3HZMA 2F53D 3GIZL 2X4UB 1T89C 5L9DL 3KAAA 3DROA 1I9RH 3BGMA 1KCVL 1T21B 3HPLB 4QWWD 1N8ZA 1T4KA 2X4QA 1K3ZA 1NC2D 2FB4L 5HHMD 2HRPL 3ARPA 4JQXA 4LKXB 4GG6A 4F3FB 4BH8B 2VH5L 4MJIA 4TYUA 1WBZB 2CJUL 1N7MH 4UOJA 1WC7B 1RZ8A 3DGCR 2VAJA 1UYWL 4P23C 5JTWA 4F15B 4PTTA 3GSUA 1FGVL 1J1PL 5FYJH 3SE9L 1H0DB 3CFEB 4YIQA 2RAMA 4Y16A 1J5OL 1HHJA 3CPLB 3DUSB 2XA3A 3P11H 1M71A 4MWFB 3F7PC 4WI2A 3GUTA 3ZDXF 3L5HA 4Z7UA 4KK6D 2PXYA 4PGEA 4UTAH 4ZFOL 3BPOC 3TBVA 1TQCB 1MCOH 1OGAA 4WW1A 5JORA 2HMID 4MA3B 2E27H 5CJ8A 1MJ7H 2Z35A 2FZ3A 1QLRB 5DRZA 4ZS7L 1LO5B 2D7TL 4JHAH 2VKWA 4YEEA 3FT2B 4RISH 5BVPH 2AK4B 4LSSH 1QSEB 1TCMA 2DLFH 3OR6B 1VFOA 4G6MH 3TBSB 3WIIH 3IAQA 4OLXL 4U1IB 5DFVC 4NSKB 4HKJA 4NO3A 5C09A 1PX4A 4CMHB 2WBJC 4R90L 2HFEA 4QRUA 43CAA 4M03A 1MY7A 3H6JA 2ZSVA 5GS0D 1FZJA 3CZFA 3ROLA 5MP6H 4MJ6B 5AUMA 4O4YL 1UENA 5KG9B 1G0XA 4GW5A 5EA0H 2Y6SD 4MNQA 4YZFF 5BO1L 1CGTA 4J6RL 4NKQB 2ZG1A 1DE4B 4HDIA 3FOMB 3JSSA 5DJXB 3RUGB 1A2YB 2YA0A 3QB7C 3MCKA 4X4XA 1I1RA 4BSWA 5EB9A 4P3CL 3LS4L 4I13B 3H9SE 1CBVH 5D71H 1SEQH 4OZ4A 3V5DA 5LG1A 5IMKB 3SQBA 5J3HD 4QHMA 1A7RL 1KJ2A 3I6LD 3BP7A 2DYPA 2DQFA 5C7XL 3LCYA 1N64L 1P69B 1IM3A 1NC4D 4MCYA 2Q20A 3BO8B 1CFBA 4M1DL 5CMAA 4MJID 4Z77A 4PJXA 1I7UA 4X6EB 2NY6C 3D6GA 1CT8A 4PJDF 2YPKA 2R69L 3LEVL 1EEQA 3D25A 4ZUTB 1DQML 7FABH 4QF1B 4Y16D 1RI8A 3FAXA 4WI3A 3E2HC 1NCWL 5E94A 2ED9A 2IPKA 2PXYD 2HFGH 4D3CH 1Q8MA 2ZG2A 3G6AA 2BSED 1NFKA 3QDMB 2BSSA 2FJFA 5CD5C 2F54E 5IK3B 1OGAD 4XCEB 2WINA 1MFNA 1S3KL 5FOJA 4F57H 4P4KA 1UVQB 5J06A 1TZGH 4P46B 1PLGL 1EGJL 4M6OH 1F3JA 1RZGA 3EO1B 3HZKA 3FONA 2B2XH 2CRYA 1YEKH 1EHXA 3IDYB 4PY8J 5E8PA 4P5MB 4TOYH 3G5XA 4MA8L 2BRRH 4NUGH 4Y19E 3T0EC 3MFFB 1FV1A 3GK8L 2ZUQB 5C09D 5KANG 3BRGC 4U7KA 4F8TA 2ADIA 1KENH 3KPSE 1FHGA 3HC0A 3OKDB 5CILL 1V05A 3N1PC 4I0KA 2R4RH 4NO0A 2Q76A 3HKFA 1AI1H 3IGAB 3MNWA 3CFKA 4N0CC 3MMEB 4N8CH 4HIHB 3TNNA 4Y7MA 4J4PC 4X9IA 4AG4H 4M62L 5ESAA 5GISL 4G80A 4FQLL 3TPKA 2UZIH 4ZFFB 3MGTB 5L0QC 3VE0A 1IGCL 1I3RA 2NZ9D 3MUGA 3EKCA 1Y18A 3MRCA 4X6DE 5IBLC 1DVFB 1ZKAA 1ZEAL 1TVBB 5T3XH 1U8OA 5FO8B 4YDVA 2DYPD 3T0DA 3OKNB 1FO0H 4PGBB 3BDBA 1TVDA 4DOHB 1VFUA 5HGHA 1CE1H 5DQJB 4KVNH 2V7HB 4JG0L 3QFDB 3ZZ1A 4R7DA 4LHQB 2J8UA 1QSVA 3BZDA 3MLTA 3ZHDA 1PKQA 5HHOB 1MFBH 2AKRB 4G6FD 4FTVB 2C1PA 1R3LB 4TSAL 2F5AH 3RDTA 3K4DA 4LSQH 1U6AL 5EIQA 4S1RH 2EDRA 1QTYT 3NGBB 4ZSOA 4I9WE 4U0RB 1H5BA 5JOPE 5JHLH 1EEYB 1ZLUH 1IE5A 5GGUB 3PV6A 3GI8L 2QTEA 5DJ8A 5HYQB 1X4XA 1TQBC 5D7SL 4KKLC 3RWGA 5E99H 1KYOJ 3HTLX 1F00I 5DQ9B 4P3DB 4ELKA 4CVZB 3B83A 3V5KA 5MHSE 1MCSA 2HH0L 4NQXA 1YNTB 2NW3B 4KKBC 3FTGB 4CMMB 5TQ2H 3VXSB 4GKSA 1NFDA 3V52L 3VG9C 4ONOA 3IF1A 4I3RH 3V4VL 1DP0A 4ODXB 4NO0D 5F6HI 4PUBH 3EW3B 3L3KB 3D2UA 3GMNB 1JNJA 1JFQL 1GGBH 4G9FB 5F7LB 1LEIB 3RWJB 1U92A 3QEHA 3MV7B 1QO3A 3MGOB 2KUTA 5E5MB 4UIMA 5CEYA 2X9XA 1S5IL 3S7GA 2QQLH 2N4IA 3TIDB 3NA9H 5DT1H 4YXHL 5IEKB 3QIBB 2NY0D 2BDNH 5FM8A 3INUL 5IB5B 3NCJH 5E7BA 3LKNA 4H88H 1A22B 2P7TA 3V6ZA 2BVOA 1IGTB 2D03H 4MD4B 1XIWB 5DHVB 1GH7A 3K0WA 5F3BA 2D0HA 1XR8B 4OJFH 3EYUH 3BX7C 3I3EA 3D0VA 4QGTA 3MNVA 4I1NB 1FVEA 1F6AA 3RJQB 4LLQA 4XXCA 3RGVC 2E9IA 1RJZA 2H26B 2D0FA 1JGUL 1A6TA 2V2TA 1DLHA 3RDTD 1JIBA 5IVOA 3FFDA 4WTZA 2X70B 5D70H 4H25B 2CMRH 1KB5A 4LVHB 4YNYB 5DD1L 3HAEH 1RUQL 3UJJH 1P9MC 1TCRB 3C6LC 3HS0B 4FQIH 3L7EA 5K9QI 3VG0L 1LEKB 1S5HB 1A3LL 4PLJC 1HXMA 2Q1EA 4PJAE 4HIEA 3RPIA 2IFGA 4HJGA 1WFUA 5BRZA 5D7IA 2VB5A 2VZUA 3QG6A 3I6GB 4I77L 1YEGL 2FO1A 3QUYC 4MGXA 3FZUC 3VFGL 2JB5H 5BW7C 2VQTA 4MD0A 5ACLA 4U33A 4PJFE 1LHZA 4K3EL 5CS7A 4O5LL 5AG8A 4XAWL 2QL1A 4X6CB 1C08A 4XRCA 1P7QB 4F7MA 4JHWH 9CGTA 1QEWA 2BHZA 3MRJB 4TVPL 1UWGL 3LKPB 1N5YL 3D2UD 1F3RB 2WIMA 4YFEA 1A7OH 2GT9A 4EUPH 5DD5H 4GRWF 3JV4B 5L8KB 4PJHF 3X3GH 4D2NA 1UH4A 3NN8A 2E9WA 1IGJA 3DX6A 1YQVH 4DZ8A 3H2WA 4YWGH 2AJ3A 5DEFB 2QQNH 2IC2A 3ARUA 1NCCH 5TH2B 2VE6A 4Z7WE 1Z2KA 4NQVA 3W9DB 5I16B 1M4KA 2ZSWB 4BH7B 1E27B 3PWVB 3QHTC 1HH6A 3B6SA 5BVJA 4H26A 1AFVL 2DJSA 3L5WB 3BKCL 4NBYB 1RUPH 4KHTH 5IG7A 5FYJD 1OD7A 3QDGD 5D7JD 4UBDC 4APQC 2CIIA 1KBGH 2Z91A 4U05A 5FYKH 5I76B 3SO3B 3ZTNH 2GI7A 3V79C 4L29B 4DAGH 5T33L 1SJXA 2R56H 4YHIB 3T3MF 1T2JA 2CIKB 4ZNCD 3JVGA 3EFDL 3QEQE 4Z0XB 3FB7A 1AD0A 2D4DA 3OPZL 2OLDA 1NPUA 4NZTH 3C5ZB 4JRYB 5EFIB 2ZUTA 1C5BL 3NPSB 4N1CA 2OI9C 1U8MB 5I15L 4K3DH 1CFNB 2XWJA 3PXJA 2A6IA 5GSRB 2MPAL 3I3DA 7CGTA 1VFBA 4ODVL 4C56E 2EC9U 1JHLL 3VD3A 1C12B 3QNYA 4PJDA 3KXFA 4A2LA 4XCYB 5E8DL 4ERSH 1JTTA 1RJLA 3D0LA 1PGRB 2PO6B 1AQDA 2VDNL 2BC4A 5F3HB 1X9QA 4XNQB 1EV2E 4XNZC 5TDOB 1I85C 4EJ1C 1ZT7B 4WFEE 4NHCH 4EUPG 1QA9A 4L4TE 5C6TH 4LPCA 2Q7NA 4I3GA 1DANU 4OLWH 1IGFH 1HN1A 3BHBB 4YFLI 1S78C 2W0LA 1F6FB 3KPLA 1U3HC 1A6VH 4YHLH 3HI1A 4RNRA 2GSIA 3O4OB 5GJTL 3FMGH 4X9HA 2AJYH 3FQRA 4BSVB 2E9JA 4OCLC 4G3YL 1FO0A 1WFOA 3TM6A 2BVQB 4NNYB 2ZPKH 2VLKB 1QSFA 2GKIA 4WI5A 4LSUH 1G9NL 3CLFH 4ZNEA 2CUIA 4X7SL 1JL8A 3QRGH 2ORBL 2P49B 1CR9H 3W2DH 3IXTA 1IQWH 4JPKL 3QEUA 5CGTA 1IGMH 4F7TB 1L0QA 2EDTA 4I48A 3WLBA 5I8CB 1Q9LB 3BOVA 4JB9L 5HI3C 3HNTH 5DUPH 3BEWA 4OSUH 4ZQKB 3TV3L 5GRXG 4BKLB 5DJYB 2MJWA 1L7TL 3C08H 4U1HB 4UV4H 4J8RA 5FCSH 4NM4H 5T1LB 3LS5L 1MRFL 3UTSE 4PRBB 1L4IA 3SGEI 4N0YL 1DR9A 3SE3C 5EOCJ 3BWAB 1KFAL 3GDBA 5I6XC 2XQYK 1QFOA 3IFPA 4JCLA 5IHBA 5L88H 1LE9A 1HI6A 5GGVL 2UZXB 4TQEL 4KUCF 2HWZL 1MHHB 4NRXA 3STLA 5KAQF 3ILQC 3LOWA 1FDLL 2A73B 5BZDA 2A9ML 2GW5A 4FFYH 5C0FA 1FFOB 3KXFD 5HBBA 2E7BA 3HFMH 2HT3D 3MRNA 4N68A 1CCZA 2BSTB 3E8UH 2PKDA 3DURB 5BQ7B 4AL8L 3D39A 1YMHA 4ZS6D 5F21B 2AJSH 5T3ZE 1D5MA 4MQSB 5I1IH 1IM9B 4HAGA 4JKKA 2P1YA 1AGCB 1MFDH 4QRPD 4P2RE 1T6WA 1YY8A 3HE6C 2A1WL 3TVMA 5I19L 2CR3A 3HHRB 3HZYB 1ZANH 3BE1H 3QUXC 2OK0H 4WHYH 3MRQA 5DTFA 4M5YH 1D5ZA 1YEHL 3MOBL 2VSCA 3NA4A 2DDQH 5B3JE 1QG3A 3GMMA 4KJQC 1XGYH 3PWPB 1AO7E 3OB0K 5T3XD 3KYNB 3RVTC 2P5WE 4TPRH 5F89B 4TSBL 3W81A 3TBTB 4JR9L 3UJIL 5CP7B 3PUCA 2BK8A 1QSFD 4UV7L 5KVEH 1AH1A 4BK5A 4OZFH 4V1DE 4L4VE 5I1AA 5HGGS 1JN6A 4X7TB 3TYGL 2NXZC 5DJZB 4WJ5B 3QCTL 2BY1A 4KAQH 4CNIB 1CL7I 1ES0A 2DWDA 4EOWL 4X98B 5FK9A 4JPVH 1S9YA 5EULV 2BVPB 3CC5B 5HHVL 4Q6IC 3V7MA 1T5XB 3HAEA 5E9DB 3O6KH 1YEDB 3S88H 1RIHL 2VLRE 3EOAA 3UTOA 1T83A 1YEIL 1JPFB 5FA4A 4LU5L 2X89A 1T3FA 2NCMA 3HR6A 1JPSL 4OM1L 3RRQA 4NQEA 5ESVB 3CFDA 2DM7A 4I0PA 4L3EE 5A40E 5ADPH 3LN5A 4PG2A 1E6OH 4HIIB 5FGSA 3KG5A 5ADOL 1MCLA 5FYLD 4U6YA 12E8H 4N8VA 1LK3H 2C1OA 35C8L 3CXDH 3DGGB 3VGDA 3X17A 5I1EL 3BGAA 1WFTA 3H8NA 2NY3C 5DC9B 3IKCA 5BOZG 4U1SA 3VI3E 2W9EH 3D39D 4UT7H 1IFHH 5GGQH 2NY7H 3HNVL 3VWJC 1MELA 3Q1SL 4DJMA 4WHYG 1B2WH 3TVMD 4WV1A 4RMQA 1LO3L 5CJ5A 1E4WL 3Q0HA 1A7NH 1T22A 1OAXL 1X5FA 3RGVB 4DKFH 2R2EA 3N1GC 1MFCH 2VZTA 4ENED 2YK1H 3D9AL 3MODH 4WVRA 2P46B 1CFQB 4HJ0D 3RUGF 3BD3A 3FO1B 3GSQB 2BNRE 5HJ3B 5EG6C 2DAVA 4ISVA 4OZFG 1LO4H 1MRCH 2B1AL 5JQHC 1LO0L 5E08L 3E6FB 2LAAA 4LCWE 4W4NA 5D5ME 3UEZA 1LVEA 2JB6A 4ETYA 3VXQA 1RPQA 4L1DA 1MVUB 3S3JA 1KIPB 1WT5A 2NY2C 3B3IB 2R23A 5LXGL 1DDHA 2VDQL 1GAFH 1MNUH 2FBJH 4L3CB 4XVJL 2EDLA 1MUJB 3WHXB 2AV1B 3O3BA 3ZYZA 5I30H 1KT2B 5EBGA 4GBXA 3SE8H 1BQHA 5JW3L 1I8MA 1KEML 4Y5YA 2VUOA 2AJXH 4PJHA 5C07A 4Z7OF 4ZYKB 3VFWA 5EOTA 2ITDA 3MRKA 4FQQB 5EORH 5I71C 4BSJA 3ZE0F 3VFOB 1RIVL 2UV3A 5ITBL 2X89D 1IGIH 2H6PA 5E24E 5MENB 3PG2A 1R6VA 3GSVB 1MREH 4NQED 5I1LA 3SE4A 4J1UB 4PJ5B 4I0PD 5JW5A 4GO6B 4IEFB