5KVMC

Extracellular region of mouse gpr56/adgrg1 in complex with fn3 monobody
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
b'SVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGGSPWSWQEFEVPGSKSTATISGLKPGVDYTITVYASSFDWTIFPNYYSSPISINYRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhesion G-protein coupled receptor G1
publication title Structural Basis for Regulation of GPR56/ADGRG1 by Its Alternatively Spliced Extracellular Domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2016-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kvmC00
4FZEL 4PY7B 3ULVD 3TNMA 1XCTA 2W38A 3O4OC 3PIQA 5CD3A 5JOFA 3WJJA 3CDCA 3RU8L 3LPFA 4MD0A 1GGTA 2Z31C 4G6ML 4XBPA 3UJJH 3V52H 4LVHB 2YD7A 3WIIH 4JFZL 1XIWD 5IHUL 4PJIB 3PHOA 4XNQA 4I0KA 4C83B 3GMPA 4PJGE 4OCYL 5E6IA 1KXQE 1FNSL 2IPKB 2OSLB 1H8OA 3JTTA 4NZUH 2OLDA 4UUJB 5ILTL 2FSEB 5TFSL 4IDJL 3LKPB 5J9PA 3O11A 3PV7A 3ZYZA 2DQHL 1IBGL 5HGHA 2CKNA 1JGLH 1EGJA 1FQ9C 3ZE1F 5JW4Q 2X40A 3ROLB 3IKKA 4TNVK 3RIAF 3QIUD 1UB6A 4JFXA 2XN9A 1KLGB 4KK6D 4Z76B 4NWTH 5E5UB 1Y6MR 5DEZA 4ZUVA 4J23A 3TH2T 4M7LH 5IMMB 3BO8A 3NCCB 3L3GB 4ZUWB 3M07A 4KAQH 1KIPA 3MXVL 2UYLA 3C5JB 1LD9B 4AMKL 1U8JB 3BYYA 3U30B 3VXUD 1UCTA 4QHNA 5F9AC 5CAYB 3N1FC 3EYSL 4QHMB 2A6DB 5E8NB 1T04A 1G7JB 3IS1X 2DN7A 3L1OH 2EYTA 2FB4H 3QR2A 3MV8D 4TVPE 1A4KB 2OXGA 1CFSB 4KUZH 2AEIT 1RURH 5F1KC 1MCPH 2JJTA 5JOPE 5L2KA 1ZGLB 3H3PL 4ZXBA 5GIRB 2Q8BL 2VLJB 3OR6A 4FQQB 3HG1E 4RMRA 5F21B 2BVYA 2GJJA 3DRQA 3IGAB 5IFAL 5JXAL 4LRIC 2XXMB 3QIBD 2UWEF 1BD2A 2FJGA 3TEUA 4N9OB 4NKDB 3QIUA 4JR9H 2NY1C 1KN2L 2BZDA 4GW5B 4BK5A 3VD4A 3MX0A 4HH8A 4L8BA 4GAYA 5HYJE 1Q1JH 1C5CL 4AZ8A 5K93A 5T3XE 3ISWA 2JIXB 3HZKB 3K7UA 1HXMB 3Q0HA 1F97A 5FB8B 3PWLA 3RI5F 2X1OA 5HHOE 3QWQB 4BSVA 3MGOA 1JUFA 1E6JL 5F9OH 1OWWA 4FP8H 3NCMA 3BRGC 4KDTA 1WT5A 2ESVE 4G5ZL 5GS2H 3EYUH 4YHPA 3BVNA 4FRWA 3IB4A 2IPUG 5DQ9A 1O7SA 3VW3L 1KTLB 1QSFB 5JMOC 2DOCA 3MJ6A 4TUOB 4J3WA 1EPFA 2C3VB 4WNQA 4FOMA 1I9JL 4N0YH 1NPUA 4PIRF 1Q9KB 1Z2KA 4XVTH 4LDLB 5L7XL 3CC5B 3V6OC 3PP4L 4Y5VA 3VFMA 5C92A 43C9B 4APQB 4MWFB 1GJIA 4KVCH 3CMGA 3JWNC 4PJFE 4XMPL 3LD8C 2VDRH 1E28A 5FYJU 3HC0A 3WL9A 3JV4B 3ES6B 5DJCA 2DM4A 3U7WL 1U8MB 3GSQA 2FHCA 3VGAC 1KYOK 3VH8B 3Q48A 1AR2A 3RUGB 1F4AA 3TJHC 2VXQL 3PGCA 1ZMYA 1NCCL 1BFTA 1AP2B 3MNZA 1VFMA 3LSOB 1FBIH 4QXUH 5J1AB 4FFYH 5HDLA 4IS6A 2AJXH 3SKJH 4ZO8A 3QDHA 1IVLA 1H8NA 2VQTA 5JDSB 4YXKH 1FC2D 2DKUA 3I85A 4WFEE 3SDCD 3ZKMC 4ZXBC 3SQOH 5L2JA 1AXIB 4LU5H 3NMEA 1AE6L 3LKSA 1AR1C 2X4RA 4KQ4L 1OW0A 3DWTA 5E56A 2MQ3A 4D9QD 4TPRL 1TNMA 3EYOA 2JELH 5DUBB 4CU8A 3CFEA 3AC0A 4PLOB 1MRCH 2VH5L 3MYJA 2AJSL 3FHQA 2BFVH 1R3IL 4OKDA 1F2XK 3QPQC 4NSKA 4WI8A 4YX2L 3UEZA 4A6YH 1IE5A 3MRFB 1QFWM 3P4NB 4OAWA 4EI5A 5SWZA 1YEDA 3MGTB 2YZ1A 5ICYA 1BF8A 4YDKL 3GSVA 5DMIH 3FFCA 5TQ0L 1LP9A 4X4YA 4KVNH 1NUGA 2FX7L 5I0DA 4MNGB 5EWIL 5KN5B 2NYYD 5KSVB 5C1MB 1AI1L 1GOGA 2NW3B 4Y2OA 3TN0D 4LKCA 5IBTH 1EEUA 3GIVA 1NMAL 4KK5D 2D7TH 4HXBH 1NGZB 3OKNB 4X99A 3OX8B 1QRNA 3VXMD 4TOYH 1A6ZB 4JM2F 3DX7B 5A3IC 1JHTA 3IXTB 2NNAA 3LKRB 2WUBH 4IOFD 3L7EA 3MV9E 3MRNB 4L9LA 1FL5B 2EEBA 3PV6B 4PYHA 5C0BB 4ZTPH 2ICES 3M1BB 2A0LD 3MV7D 1MLCB 2IFFL 1T66C 5JUEL 1CDYA 2BRRH 4MSWA 1MCNA 4JY5H 3SJVB 3TBWB 1FIGL 4Q6YA 4L4TB 4S11A 2Z4QA 4D0DB 5HDBF 4LSUL 1ZLVK 5IFJB 3QYCA 5EN2B 1T6WA 2HMIC 3QZWB 4ODBD 4G6FB 5CBAA 1LHZA 5D1XA 1JF5A 3MRIB 4G3YH 3QHZL 3KXFA 1OGAE 2MQ0A 4JO2L 4LBEB 3QRGL 1U3YA 4UT6L 3BFOA 1SY6L 3OXRA 5GGSY 1JRHL 1P1ZA 2J6EH 3SKMA 2ZUSA 4JFDA 1MRFH 1H15A 4EUPG 2VE6B 3EFDL 2NY5C 4HJ0C 1S5IH 5IW3A 2A38A 2NY5H 2ZKHH 2GTWA 1FNEA 1TPXC 5K9KB 4DVRH 4JGUA 5LWYH 5DD5L 4E9LA 3S7GA 1A14L 3QQNA 1QRKA 5DYOB 4F58H 2XZCH 3I9GL 2VDLL 3KLAB 4N8VG 5IW1B 5L88H 3STLB 4X4XB 4S0TD 3RZCB 3HMXL 2E9JA 1D9KB 1CF8H 1SM3L 3ILQC 1U3ZA 1A4JB 3ZTJH 4PGZA 3QG6A 3TO4A 4NM4L 5B8CB 2FX8H 4KWUA 3RY4A 4DTGL 1ES0A 4MHHG 4H8WC 3CXDL 2R2EA 4H8WH 3HMWL 3GSXB 1A5FL 5B39B 4MD5A 3N1MC 3V4UH 4JHBA 3C09B 3B83A 3RDTC 3KPSE 1TZGH 4XXDB 4ZDHA 5BV7B 4XZUA 2AJUH 2OL3A 4OLXL 3TO2B 3WUZA 4KZDL 5C6PB 5BZDB 1WFOA 3QAZC 3LIZL 3VXOA 1KCRH 3ZTNH 1AIFA 2QQLH 1AD0A 1N2RB 3D3VA 3S6CA 3I6LD 4GQ9H 5GJTH 3VWJA 4TSBH 2I26N 4F9PA 5J1SC 4IIQB 4HUUA 3LKQB 3TJEL 1CFVH 2P46B 4OCXL 3NIGF 4U1NB 1Q72L 3J8F7 5D2LE 2B4CL 2R29H 4YFLI 3C8DA 5T5FL 3T65A 1CBVH 1NDMB 5FAAA 2BVOA 4Q6IA 4M7LT 4TTDC 1WZLA 4DK3A 2J5LC 3ILPA 4OZFA 4YDVB 1HSBA 1YUHB 1NGQH 2VSDA 3VXRE 3R0NA 1L0YA 4CN6A 1TVDA 4AEHL 3HUJA 3NGBB 5C07B 1S7RA 1SMOA 1KJMA 1NC2B 4HUNB 2BMKB 3UYRH 5GRUL 4X8JA 1IM3B 4GXVL 3V0WL 1FSKC 5KZCB 4N0CD 4JG0L 4C56A 2PXYA 3HAEB 5DRNB 3RAJH 2XTJD 4YUEH 2CGRH 4OZHE 5JR1L 1PZUB 1TPXB 4MAYA 5E0QA 3JSSA 3GMRA 1A6PA 2G60H 4DEPC 1W72A 4NUJA 4HEME 3REVB 1JK8B 5FYLL 4BUHA 4DZBB 1U8PA 2BNRE 2MSPA 5FYJH 1KLUB 1E4WL 1YN7B 2RQ8A 2Y6SC 4AENB 3RWIB 4OI7A 4XTRD 2R4SH 1M1SA 1NFIB 1QBML 1YNKH 1JNHB 3ZKXC 2D7OA 1KNOA 1V3JA 2IJ0C 3OZ9H 4GAGH 3SE4A 2UUDK 1BVZA 5CIPH 3D39D 3MLWL 3LEXB 4IMLA 1OGTA 3D1MC 3LV3B 3WS3B 2JJWA 4OLUH 4WFFE 2A6KA 1YEIL 3UTTE 2NY3D 3TPUA 4Y4KB 4PJHE 2EZ0D 1G7QA 2HTKC 3G6AA 1L7IH 1OTSC 4NT6B 4X4ME 3U36B 1PAMA 5CHNA 4ODXB 5I2IA 3L3IB 1PKQB 4XNYL 2W0FA 1LO4H 2ICEA 1I1AA 2UWEB 4R3SB 5SWSE 2CDFB 3FQRB 1K8DA 1FO0H 5I1EH 4PJ5B 1F90H 2YS4A 4ZQKB 4P5TA 3AGVA 1R3HB 4DCQB 1N3NB 2H32B 3D25B 4KKAD 1U42A 5DD1H 3THML 4X6DF 3MLUL 4Q6IC 1T0PB 3O8XC 3DETD 1FNFA 1T1ZB 4W6YB 3H9ZA 1BQHA 4LEXH 3EZJB 1BGXH 3C08H 3H0TA 4XPAH 4G8EB 4YHLL 4OV5B 5GS1B 1TZHB 1YEEH 3O45B 4YBLC 3LS5L 3GNML 3BZEB 3UDWA 3M8OL 5EO1B 4RGOL 3QFDA 4Z78A 4PB9H 2O93L 2I5YL 4FQCH 2DQCL 2A2QT 2R2BA 3R1GH 3PQYD 4ZNEA 2PXYC 3EDJA 1MIEH 4JQIL 5FGCB 2W9DH 3BEVA 1B4JL 4KI1A 4BZ2H 3QI9B 1BZQK 3BIKB 4UZGA 1MIMH 4XVSL 4X5LA 3NIFF 2Q1EA 1PYWB 2ADFH 1V7MH 3IDGB 1NBZB 4ODHH 4Z6AT 3QUML 3V0AC 43CAB 3MFFB 1I7UB 4TNWK 4X9IA 4YFLF 4P3WA 3QG7H 5ISZA 5C0RL 4UTAH 4FG6C 5K59E 1FYTD 3OKKB 3UXFA 4NC1E 2R69H 1ZWIA 2F5BL 3NZHH 2YD9A 4PJEE 2UY7A 3T0XA 2BSRB 4PR5B 5HYIA 2YKLL 4HDIB 2VL4A 4BQ8A 2CLVB 1KYOJ 2AEPH 5HI4C 4QOKD 1J5OL 1Z9OA 3PXJA 3V7AE 1ZA3A 1NEUA 5GRZA 2DQIH 4EBQL 4LVOB 1FZKB 1C12A 3RA7H 3WJLC 1IGJB 1YQVL 4HAFA 2J7LA 1XFPA 1I9RH 2WWKT 1XMWA 3LH2L 1PZ5B 4PTUA 2V7HB 1HI6B 5IQ7L 3PGDA 5IESL 1ZAGA 4GRWF 1R24B 3OGCB 3O9WA 1GAFL 1MCFA 4GW4A 1R0AL 1P4BH 1WIUA 3QA3A 4KKLC 2OYPA 4LLWA 4P2QA 3T77B 4X9HA 3FT2A 4L8CA 4JPVH 4GKSA 3X14A 4P23C 1BZ9A 3S8WA 4Q58C 1QHOA 3EYVB 3JV5A 2DYPD 5IGXH 1ZHNB 3GRWA 1BJMA 5E8PA 5KVFH 5FOBA 2DQGL 4Z7VE 4EDXB 4AT6B 4FMKA 2H8PA 3S35H 3S4SB 3B9KD 4U3XA 3HZMA 3RBGA 5TE4L 1CDCA 2VSCA 4LK4A 3C9NB 4KVCL 1INEL 4M5YL 4HCRA 4DFHA 2WNGA 5IBLD 3BE1L 4MX7B 5FM8A 2P24B 1KIQA 3AAZB 1EGJL 1FIEA 4XCFH 5HHXL 4GT7A 5EUKB 2V5YA 2P5WB 1OCWL 4JQVC 3RWDA 3S37X 2M2DA 2HN7B 1RK0A 2WIMA 4MXQC 5BJTA 1KJ2B 1D6EA 1Q0YH 3OGOE 2OX5A 5JZ7D 4OLZH 2CLRA 3FMGH 5C0CA 1C5DA 2CRZA 4Y4FC 4E41A 1IGIL 2APFA 5KSBE 1KXVC 3IDYB 4QXUL 1NBVH 1JPTL 3EOTL 4P3DA 3WHE1 4ZS7H 2NY2D 4POUB 2I9TB 5INCA 5TDPA 3LQZA 4JM2B 5A2LH 1L4IA 3W39A 2BJMH 3VRLF 1IAII 3VMNA 1HINH 1LK2A 3ARDB 4NZTH 2ZSVB 3DTXA 4FQHB 2KUTA 3X17A 4HLZH 5HHVH 1DQQA 1UJ3B 4S0SD 1BF2A 4HD9A 4K8RD 1NFKA 4Y2DD 3QNXA 1T2QL 3TCLA 3P9MA 2HJKA 2MPAL 3E8UH 3SE3A 5KANI 1UJTA 2AK4D 3R8QA 3ULUD 1HKLH 2CJUL 4KTYA 3QNYB 3TNNB 3QUYA 4F7EA 5D7LA 1KC5H 4L3CB 1H9VA 1YY8B 2VLME 3RTQB 5EU6A 4NOBA 4JPKL 2WQRA 4RGND 1IGTB 5DEGA 1ZLWH 2WP3O 4E42B 1CK0H 3ARGD 4TUJA 5DMGC 1BFOB 3S37L 1U93B 5TE7L 5D72H 5H94B 4JREC 1A02N 5F1IA 1CGXA 2R2HB 5C0ND 5T1KD 3RL2B 4J3SA 1G6RH 3JTSA 3GDBA 3PDGA 1GC1C 4OZGE 3TBSA 4L8SC 3MTRA 3QDME 1GC1H 2EDKA 3MUGB 4RNRA 5FHAH 3RY5A 1S9YA 4D9LL 1SHMA 4XX1G 4LCCB 3S34H 4D3CH 4Y19A 1HQRB 3RNKA 2X7LB 3X3FL 3ARQA 3FO1B 4MA7L 4ZTOL 4WO4C 3R0MA 2X4OB 3BP4B 1BVKB 3DYMA 3GI9H 2FO4B 1Z9LA 2LVCA 3OB8A 4KKBC 2CKBA 2DJ4A 3CUPA 5I1KH 1EFXD 2Y7QB 4PJXA 5EC2A 2YR3A 1OP3K 3LN4A 3QXDA 3FHAA 3HB3C 5CGYC 3CCHB 3BI9X 1I8LC 5GRJL 2PO6D 1KCKA 2F15A 4WEBH 4PJGF 4XPGH 5D71H 4NJAL 3QNZB 1KG0A 1A9EB 1NC4D 4FQ2L 1FNGB 3HKFA 1VERA 5DJXB 4G6KH 4GKZB 2SEBA 1ACYL 4P2OC 5BOPA 2YPLE 4MZ3A 4WY7H 3EOAA 4S10A 1CLYL 4EXPX 4KFZC 3VXUE 2WUCL 1DBAL 5DJDA 1QSEA 5D2NE 1GZQB 3J7HA 5I8CB 1LK3L 1RK1B 3O4LB 3MV8E 4J4PA 2E9BA 1X6LA 4FFVC 4OCRH 4HH9B 2W9EH 1RJZB 1X5XA 2F58H 4PB0L 2D7PA 3V8CA 4MB3A 4QHLB 2OJEB 2NY4B 1S5HA 5D7IA 3WDIA 1EHLL 2D31B 5E8OB 4YQXL 1OB1B 3ECBB 3FQWB 2XOTA 4HGMA 4PJIA 6FABL 4C83A 1HOCB 1MCKA 3MLTB 1DLFH 2IPKA 3SDAA 2OSLA 1X5ZA 4K7PY 4UUJA 2FSEA 3JV0A 5IB4A 4JO3H 1ZKAA 1BZ7B 2B1HH 1A7PL 4MJ6B 1R3LB 4NQVB 3LKPA 3N1QC 1J1XL 4PP1C 5HPMA 4Y4HD 3MRKB 3TZVC 1X3DA 2F53B 4PP2A 2XRAH 2X6MA 3ROLA 3TYFB 5IWLC 4LSPH 4Y5YB 1DBKL 2Q76B 1KLGA 5CEZH 2X4SA 3MODL 4Z76A 1GHFL 4OD1H 1HH9B 5IMMA 5KG9B 3L3GA 4ZUWA 4QNPE 3GIZL 1T1WB 4JHWH 3C5JA 2VR4A 1U8JA 2VLRB 4YO0B 3GI8L 3JVGC 1DBMH 2EIDA 1T5WB 4KV5E 4QHMA 5F6HI 4OZFG 1G7JA 4OIBA 3BPOB 1RVFL 4L9DA 4QRPE 4M43L 5FCSH 4NO0B 3BIAX 2ED7A 1A4KA 1MHEB 3SKOB 1CFSA 3IJSB 1MVUB 1ZGLA 3BH8B 1R5WB 1UKTA 2VLJA 5GIRA 4FQQA 1JI1A 5GS0C 4J8RA 1HE7A 1GGIH 1QSFD 4L5FH 4R90L 4JEGB 3IGAA 5GS0H 2A83B 4WENB 3SPVB 2EDQA 1IQWH 2VDPL 3T1WA 2D7MA 3ESUF 3KYKH 4GBXC 4JFHD 3T08A 3ALXA 3T0DA 4NKDA 2V9TA 2DBJA 4R0LC 1GIGL 5E2UH 2D2OA 2HH0L 4FMFA 4RIRB 4GW5A 1UH2A 2E5EA 5FA3B 1UENA 1MFEH 3RIAK 1UM6H 5KSAB 3MLVH 1UKQA 2PYEE 1ZHBB 1SMAA 3QDGD 1XAUA 4LQFH 1JWUB 2JIXA 3HZKA 5FB8A 1HXMA 2BHYA 4LSSL 4NRYB 5F9WC 1G6VK 2FDBP 2P7TB 5MP6H 5FOJA 2ADGA 1JTTA 4FABL 4RAUB 2DDQL 1MAKA 4GRWH 4P3CH 1OAUL 3IS0X 1JPSL 4NC0B 1AH1A 4Z8FL 4LIQL 1A0QH 4RRPA 5I8OL 1Q9OB 1WGOA 1IGMH 4CUCA 4I13B 2IG2L 1KGCD 5CILL 1DDHA 1KTLA 1T7WA 1QSFA 4TUOA 2C3VA 5D7JB 3F62A 5BRZA 1V7NL 2FL5B 2L4OA 3NN8B 4W4OA 1DE4B 1Q9KA 3QEUB 3CC5A 3BQUB 5JA9A 5EBLB 2Y07H 4PJAF 5SWQB 43C9A 5AZ2H 4HMCA 4APQA 3BP6B 4MWFA 5FECB 3OB0K 4XP5L 3CFBB 2PW1B 1HDMA 4JFEE 3JV4A 3ES6A 4MNQB 2RB8A 4FQLL 4OCSL 4XMLH 3KPMA 1U8MA 3F7PC 4POZC 2VR5A 1LVEA 1K6QL 3VH8A 4U4BA 4R4FH 1CFQB 4RWYH 3RUGA 5DJ8B 3VXSD 3U4AA 4TQEH 1AP2A 2VL5B 3LSOA 4DKFH 5BVJB 5J1AA 2OL3L 2Q3ZA 1B3JA 1H5BC 4OGXL 4NQDA 2Z8VC 4GKNB 5MENB 5JDSA 5GS2D 4Y16C 2BDNL 5J89A 1MPAL 2P5ED 1M7IB 4DGVH 3CZFB 3ZE2F 3U4BL 3PJSA 3MV7E 1F00I 4YDIH 2D0FA 1NUFA 2DS4A 4JN2B 5L6YH 3W2DL 1QVOB 5C0DB 2GFBB 5HHMD 4ODTL 5DUBA 4KUCF 4WI6A 5DJAB 1PG7W 5JORB 3MRJB 1DUZB 1BX2A 2K7PA 4TUKL 2CMRL 3IYLW 1GXEA 2GQHA 4JM4L 4HEPG 1QACA 3WXWL 1HWHB 1SBSH 4PPTA 1B90A 3SJVD 3MRFA 1JN6B 3P4NA 2OTUB 4HIXL 3DXAE 3O3AA 2Y06L 2YD6A 2ZZUT 3DI2B 1LO3H 5I1DB 3VFTB 4LVNC 5DK0A 4G6FD 4MNGA 5HYQB 2BOCB 2NW3A 3RBSA 4B7LA 1P84J 2XZAL 4QKXB 1MCJA 4P9HL 2KZ1B 1IC7H 3SE8H 1TQCB 1NGZA 1GPOH 3OKNA 4JKPL 3TJHD 3OX8A 3L3OB 2J8UE 2E6PA 1A6ZA 3H9SD 4HK3J 1N8ZB 3IXTA 1W72L 5C71A 3MRNA 1FL5A 1UVQA 2W0PA 3A6CH 4HF5H 3PV6A 4EQ3A 5C0BA 4LSTL 3M1BA 1VADB 1MLCA 1CXHA 2NR6C 3ZKMD 1EEQA 5BS0B 1KCVL 4EDWH 4S1DC 3HFML 3TBWA 1AR1D 3RY6C 4L4TA 1NGWA 4NN5C 4D0DA 3GHBH 4PJCE 3V6FB 4AIZA 4LSDA 2V2TB 3GSNH 3LQMA 3P3YA 3KYNB 3QZWA 5CMAB 3KPLB 3WDJA 5DRXB 2OI9C 1I1FB 2FEEL 3BPNB 1JZ4A 5C09B 3QPQD 3MRIA 4XCEB 5MI0B 1D5IL 2N7BA 1J18A 1S8DB 2PR4L 3VFGH 2FO1A 1XGRB 1JNJA 3MACH 3O2VL 4C4KO 4R6UA 4I3SH 2VE6A 5ICZB 3CFDB 4Z0XB 3SDXE 1NCDL 2VKXA 2EDHA 3G6JE 3DSFL 1JL8A 4QTHB 3EYQD 2YSSB 5I75B 2CUMA 3MBXL 5K9KA 2IH3B 1ONQB 4JJ5B 4TVPH 3BN9C 4F2MB 4F57H 5C2UB 3DX8B 5LQBL 1R5IA 4UT9H 3RPIB 5A3ID 4YBHA 3N1PC 3KPNB 4X6CE 2GHWB 5DYOA 2VAJA 4N1CA 2JKXA 4MLSA 3KLAA 5JTWA 5IW1A 3STLA 4UBDC 1T66D 5H37G 4X4XA 5FO8B 3RZCA 1D9KA 2B5IB 5B4MC 1A4JA 4KGJA 5B8CA 4I18B 3D5OF 2ZUQB 2VO5A 1F11B 4I9WE 4O5LL 5D2LF 3O81A 5JW4R 2AABH 4P2RE 2HMID 4OGYL 4PV8B 3ARVA 1BQLL 4LSRL 2VRAA 4MDJB 2A73B 5GS3A 2OM5A 4PD4K 4OB5L 3GSXA 1ND0B 3KPOA 5D70H 5A2FA 5B39A 5ADPH 3FQTB 2MMXA 1MJUH 4N90E 1VCAA 1P7QD 2ZOKB 1JYXA 1AD9B 4S2SB 3EDFA 3Q2CA 4XXDA 4OBRA 5L8LB 1G1CA 3CVIH 1HWGB 3GJFH 4I77H 2C4XA 4WI7A 2V5TA 3TO2A 1ZT1B 5D6DA 3L5XL 5KZCD 4RMWA 5BZDA 2O5YH 1JFQH 4HJ0D 1EO7A 5FIEA 1N2RA 4U6XB 3LDBC 4K9EL 3HC3H 4YHMH 4JKLA 5EU5B 3P11L 1I9EA 4PJ7E 4LVEA 3LKQA 1I3GH 1G7MB 4U1NA 4B50A 1JJUA 5EZLB 1J05B 3QULB 2OJZH 4ODUB 2J2ZA 4KPHH 3O6KL 3DIFA 1C1EH 1IARB 2MWCA 1EO5A 4KDWA 4YDVA 1YUHA 1AQDB 2X9XA 5DA4A 4M93B 1OOAA 4MA3B 3ILQD 1KCLA 4WUKL 4XP1H 5F7MC 8CGTA 1MRDH 3G5ZB 4AL8H 5D1QB 2FEDC 5H2BB 2R2CA 2IAMB 2HFGL 1TFHA 1NC2A 3LHPH 5C07A 4IRSA 1IM3A 2FIRT 4ERSL 4PJBE 4S1QL 5ESVB 1FLRL 4HUXB 3HAEA 2FATH 5DRNA 1BP3B 4Y4KD 3RDTD 1IM9D 3GI9L 1Q94B 1YMMD 3GRWL 3H3BC 3WXVL 2D4FA 1EV2E 1BQUA 5I1KL 3T4YA 1OP3H 3REVA 4WWKC 1JK8A 3CIQA 3T2PA 3VGFA 4IHOB 1QKZH 1T21B 4LASH 4DZBA 4HCRL 2R56L 1SJEB 4L3EE 1KLUA 5EBMB 1QFHA 1YN7A 4PJ5D 1FVDB 4L3AA 5D71L 1NFIA 1MH5B 5IVXE 1ZTXH 4I4WB 4I0PB 2X1WL 1EMTH 4FXKB 4YWGH 4XH2A 4PJ9C 1A7OH 1JNHA 1TCRB 2QQQA 1NLDL 1I85A 5ACMA 4K3JH 1RZ8B 5HYJB 5E2TL 3LEXA 3QH3B 1VFAB 1A6UL 2JJVA 5SV4A 3LV3A 3WS3A 4XBGB 5LGHL 3IDMB 1J87A 4Y4KA 3TYGH 1CR9H 2XQBH 2ZPKL 2O5XL 4HIJB 2ESVB 4WHYH 4E0RB 5ITBL 3RHWF 2G9HB 4NT6A 3U36A 4S1RH 2DQUH 1E6OH 3CH1A 4ODXA 3L3IA 1PKQA 3U7YL 3R4DA 3FT4B 1FZMA 1W2KT 3O6FB 2XFXB 5JPNB 4CVWA 3QI9D 4FZ8L 4GUPB 4QTIL 3FONB 1MY5A 3ULSB 2UWEA 3IU3B 4NGHL 4R3SA 4ESKA 2LU4A 3F7QA 1DLFL 2CDFA 2GJ6D 3FQRA 4PJ5A 4ZQKA 3OJMB 4P9ML 5DK3A 1R3HA 4DCQA 2D03H 2I24N 1S7VB 4LGRB 2EIZB 2H32A 3D25A 3KPRE 4U1MB 5J6GB 1CE1H 4YNYA 5DD0L 1WISA 3HI6H 5FYJD 1UWXK 4LSPL 1T1ZA 1ORQB 5K59F 2GY5A 35C8H 2CXGA 4G8EA 4LSQL 2Y6SD 5ALCH 4OV5A 5GS1A 4G6AC 1DSFH 1TZHA 3O45A 3ZMRA 1A3RL 4JVWA 4PJEF 5DZNA 3BZEA 1WICA 5D4QA 1YNLH 5EO1A 1DBJH 3V4PH 4AYFA 1DQTA 4Y7MA 3T1FB 4IRSC 2OTWB 4M3JA 2KL6A 3LRSA 1DL7H 1OAXH 4H25A 4K8RL 5TPWH 5FUCC 4EN3A 3SBWA 4WUUE 3QI9A 3T2NL 3WO4C 1MF2H 3BIKA 3MROB 1CDGA 4MQSB 3UBXI 4G8GE 4KK9D 2N56A 2WWMC 1PYWA 3IDGA 2HTKD 2CKBL 3GKWH 1IKFL 43CAA 3PWPB 1SYVB 3MFFA 1I7UA 2YWZA 3NH7L 4KQ3L 2YD4A 1ZLUH 2AGJH 1VEPA 4PJAB 2JE8A 1ORSB 2EDYA 3DGGB 5BMFH 5IP4A 4UAOC 5EIVA 5C9JA 4RRPG 3BP7A 5GGUB 4N0UE 3OKKA 4NN6C 4UILL 3MLPA 2JJSC 1IT9H 3D48R 5FUOL 3DHMA 4U6HB 3ZYOA 1WF5A 4Z7VF 5HYEA 1AHWC 2PYFB 5KW9H 1MFEL 4HJJH 4PR5A 5F6IC 1A6WH 4P4RB 4KJPC 1RUML 4HDIA 4UOW0 2F54D 1LE9B 2CLVA 3MBEB 3PXHA 5M94B 3DBXA 1QFOA 3MRGB 4XP4L 3O8XD 1PY9A 1PG7X 4GRLC 1FZKA 4HKBA 1IGJA 2VXSH 3F65A 5I16A 1IC5H 2V7HA 1HI6A 5DSCA 5F88B 3WFDL 3LN9A 3QXAB 1R24A 3OGCA 1U3HC 1S3KL 3EOBB 4KK8C 4NHCH 5E2WH 5KSBF 2IH1B 4JM2D 3T77A 4J2XA 4AY0A 4U1JB 4ALAL 5F7LB 3AROA 2JCCE 4LAJH 3VH8G 4GQPH 5D7KD 3VD3A 3EYVA 2HVJB 1ZHNA 3DARA 3MV9B 1YJDC 4LFHD 1J0KA 5ITFB 3AY4C 4AT6A 1CICA 1QSZA 1YJDH 1VA9A 4YHYC 3QHFH 1XF4B 1BREA 4KKCC 4OF5A 1RZFL 3PGFH 2P24A 2GK2A 4FG6D 4XPTH 2WV3A 1ZVSA 2PCPB 4JFFB 3OKYA 5EUKA 2P5WA 1UWEH 4R26H 3X13B 1YEHL 2HN7A 4X7CC 3C5ZC 1WZ1H 5F7EH 4X7DC 5ERWA 1KJ2A 5KOVC 2F9BT 4LPXA 2BNUB 5E08H 3ZDZE 1HYRC 1DEDA 1LDPL 2DQDL 1N7ML 4XCYB 4WU5B 3CFIC 1PG7L 2NY6B 1NCBH 3UTPD 1U6AH 1NCWH 3TBTA 2VABB 2I9TA 2QHRL 4GSDL 5DUPH 4UV7H 4WTXA 3FN9A 4YGAB 5EO9A 4EN3C 5CLTA 5JDJA 3ARDA 4MJ4A 3VGEA 2ZSVA 4FQHA 4NO5B 1AKJB 3MMEB 1TVHB 4R97C 5BW7C 4JKMA 1RQ5A 1UJ3A 4OZGF 5DD3H 3LS4L 2GEEA 3I2CL 4LLDB 5C0FB 5MEQA 4JO4H 1RHFA 5BVPL 4OLYH 3TWCL 3LKNB 4HW6A 2RHEA 4P23D 1X5GA 1BEYL 1JE6A 4WI2A 5CCKH 2AJ3B 3TNNA 4XCCH 4O2CB 4DN4H 5IB3B 1I8IB 2L7UA 4L3CA 5D1ZB 5E9DD 1YY8A 2V6HA 3RTQA 3C6LB 3MRMB 3SOBH 4XBEH 5IG7B 1IGTA 4DAGL 3T0EC 3MC0A 1YNTB 6CGTA 5DS8B 1BFOA 3VJ6B 5I18H 1QLRB 1U93A 1CT8B 3M17B 4L4VB 3S3JA 3DROB 2ICWI 3H9YA 2DLFL 2DIAA 1K8IB 1LEGB 3RL2A 4BJLA 4MXQD 4JFPB 3FCTB 3QZWG 2DLHA 3U4EB 4Y4FD 5I19H 3MUGA 3KPSB 3AM8A 1X5YA 4LCCA 5C08D 1OLZA 5EBWB 1M6OB 2X7LA 4AEEA 1D5BB 3FO1A 5AWNL 4I3RL 4DOHE 2X4OA 1T3FA 3BP4A 1BVKA 2FO4A 3ETBF 2YUZA 2O5ZH 1CICC 1KJ3L 2B7DT 5FKPA 4G42B 2X4NB 4OIIH 3B9VA 4G7VL 2AJZB 5C0AB 2Y7QA 3RJDA 3OKLB 1Y18B 5E8EB 3GMLB 5FYLE 4P2YA 4EOWH 2DLTA 2YHGA 3CCHA 2A77H 3RWHB 1IEAB 5D2LB 4ONGL 1FAIL 2WM0A 2ITCB 4KTEH 4LCWE 1A9EA 5CZXD 1KT2B 25C8L 5FO7A 1FNGA 5DJXA 3WS6C 2RFXB 2F53D 4GKZA 3D69B 3GBNL 3VXRB 5DMGD 2OP4H 2YMXH 5LJYH 2YD5A 4PJ8C 4PGJA 4BFIB 2ZG3A 1GZQA 4WTZA 1BIHA 1RK1A 2NXZB 3O4LA 4OCMC 4HH9A 2VLRD 2AEWA 1ZT4B 4QHLA 2AXHA 2OJEA 1YECL 1YEFL 3SGJC 1E0OB 1UM4L 1I1CA 5GGVH 4UT7L 5B39G 3VRJB 3GHEL 5E8OA 4HIHB 4HX1B 4J6RL 1ULVA 1NQBA 1OB1A 3ECBA 3FQWA 1CGSH 4PRHE 3LB6C 3AREB 1HOCA 3WLBB 4WO4D 3MLTA 3P0YH 2KBGA 3IAPA 1C16A 1YDPA 1BZ7A 4PY8I 3CLFL 2BNRB 1KFAH 4MJ6A 1R3LA 2P1YA 4NQVA 3BPLC 1VGKB 3I3BA 5AEAA 3VXTB 1W0VB 2GSGB 1I8KB 2NY7L 3MRKA 1DQMH 5I73B 4X6BB 4X83A 1HIML 3ZKSD 3BKML 4HK3N 4RFNC 2YZ8A 1U8LB 3O2WH 2FRGP 4RFOH 5BXFB 5E00B 3HB3D 2Q76A 4Y5YA 4WFHE 5CGYD 5DMKB 4Z7WE 3QSKB 3X11B 2EC9U 1E4KC 4CMHC 4CAGA 2CPCA 1MJUL 1HH9A 5KVEL 3VMPA 5IT2L 2UZIL 2FWOB 3U9UB 1T1WA 2VDQL 2GCYB 1K2DB 5J06A 1BFSA 3DO7B 4YO0A 5JQ6H 3BISA 1OP9A 3PL6C 4RDQG 4F9LC 2FNBA 4P2OD 4OD3H 1T5WA 3AM8C 2IBZY 2WW8A 3ZT7A 2BSSB 1OY3B 2H2SC 4LSVH 5DLMH 3RKPA 2YUVA 4NO0A 5MEPB 3IFNH 1AQKH 1FGNL 1FRGL 1MHEA 3SKOA 3IJSA 1Q8MA 1MVUA 1HHHA 3HC3L 4OI8A 2IALB 1R5WA 3BH8A 3OMZA 4V1DB 4N5ED 3H8NA 4FFVD 4FTVE 4JN1L 5T33H 5D7JD 1NLBL 3QUZC 5SWSB 5CGTA 2A83A 2RCSL 3SPVA 3BAEH 2BRQA 4YDLB 2NXYC 1H3VA 5GGTH 3VG0H 4F7TB 2OQJB 3HAEG 4HPOH 2VIRB 3SGEI 1RIVH 2EDEA 5SX5K 3BQUD 4RIRA 3K8LA 4G9FE 3IU4H 4A2MA 2NMSA 5FA3A 1NAKL 3MREB 2JJUA 4RISH 5KSAA 3AUVA 4PP1D 4UQ3B 1ZHBA 5BO1L 2NPLX 1Z6JT 2E27L 4IBLT 3SDDC 1T89C 1JWUA 3TZVD 2X1XR 3IKCB 2BNQE 4MNQD 1QYGH 5D5MA 2P7TA 5CEZD 5EIQA 2YN5A 4RAUA 4D9RD 1I3RB 2VXVL 3FN0H 5CLWA 2KH2B 3MLZH 4NJ9L 3CGTA 4JZJA 1FAKT 5DA0B 1K5NB 1Q9OA 3TA3C 3KYOB 2P5EE 3CVHB 4HWBH 4PGBB 2J88H 1A1NB 4UB0L 2FJFB 1WEJH 5DXWA 2FL5A 4LASL 3VA2C 4OJFH 5K9JH 3NN8A 4KMLB 4PGCB 2VDMH 5IVZB 3N9GH 3BUYB 2FBJH 3V4VL 4GMTH 2FD6L 1JNNH 4LHUB 1F58L 5EBLA 4NQCD 5SWQA 4X80L 3V6OE 4QRRA 3BP6A 1BBDL 5FECA 3MV11 1V3LA 2A9MH 4PJEB 4GBXD 1D6VH 3UTSE 4OF7A 3QDJB 3PWNB 3GSWB 1CFTB 5TF0A 1IGCH 1F4WH 2NX5B 2WK2A 5DURB 1MNUH 2XN9E 4MVBD 1HQ4B 5CKAA 4DGYL 5HDQL 1CFQA 5DJ8A 4XB8A 1RULH 3UJTH 3UAJC 2VL5A 5BV7L 4HHAB 1QFPA 5BVJA 4KHTL 3HE6C 2VXUL 5DHVB 1H0DB 4IRZL 4NNPH 4XNUL 4GKNA 4RCAA 1RZKL 5MENA 3FKUS 1J0IA 3NOIA 3VD7A 2FECL 1M7IA 3CZFA 4W6XB 3C60B 4O9HL 1NMBH 5L2KE 2FCBA 4JN2A 2DBLH 2ZCKH 3CU7A 4PRIB 1QVOA 3KJ6H 4K7FB 2J8UF 4HKJA 2V17L 4U31A 2LVEA 1CDUA 1HILB 3L6FB 2DM3A 4EQ2A 3QUZB 4Z7VB 5DJAA 2DMKA 5JORA 3MRJA 1DUZA 1KV3A 2DTMH 4YDJB 1FC1A 1BD2E 4KRNA 1RPQA 4P4KA 1FL3B 3P0GB 3B6SB 1JN6A 2OTUA 4ZUUB 5DD6B 4HV8B 4YEEA 4JRYA 4PJCF 3V4PL 1L9NA 5I1DA 3VFTA 1P7KB 2X89A 2Q3AA 3U9PH 4DW2L 1JHLH 5GGRA 5IMLA 3S96B 2BOCA 2IEPA 5E8DL 3WNKA 3AU1A 5KSBB 3GO1L 5LGJA 4OCWL 4YHIB 5EULV 4JZJC 1EUUA 2VISA 1LDSA 3H7BB 4Q9CA 4Z95L 1JYVA 2P47B 1OLLA 4X5XB 3CH8A 1N8ZA 1EEZB 4O51B 1X5FA 5CJQH 2KDGA 3E3QC 1AGFB 1RZ7L 1VADA 4Y16D 1IC4H 5EIIB 3SDXF 1AGBA 1MFDH 2IAND 3MJ9A 4JDTL 5BS0A 1N5YL 1NCAH 3IDXH 1DFBH 1RUAL 1X4ZA 5EFIB 5ADOL 3NACL 2V2TA 1QBAA 2HFFB 1CFBA 2VZ3A 4GFTB 3VDBA 3KYNA 4X6CF 5CMAA 1UT9A 3KPLA 5DRXA 2VLKB 1TZIB 4FS0A 1HHKB 1I1FA 4ZUTB 3S4SG 4I8DA 4ZFGL 2ATKB 4QLRA 5C09A 1O7VA 1VFBB 1RUKL 5JW3H 1PSKH 3NCEB 1CZ8L 1UA6L 5IIEB 2DRUA 3RVXC 1S8DA 3W0WD 1XGRA 3NA9H 4J3UA 4OM1L 5GZOC 2FR4B 3HTLX 5AZEL 5C0GB 5HD8C 5ICZA 4OZGB 4Z0XA 2HKFH 1QPPA 4QTHA 5GRVK 3EDEA 2YSSA 3RIFF 3U1SL 3WNOA 1DR9A 1OAYH 4LPCA 1NGPH 2KKQA 2IH3A 3TVMA 4JJ5A 5CD5D 1RIHH 4F2MA 3TIDB 3DX8A 4P46C 2OZ4A 2ZUUA 1XIWB 3LEYH 4YGVA 3RPIA 1N4XH 1CYGA 1QO3A 2W60B 3KPNA 4XVJH 3KPPB 2GAZB 5GGSB 4Q0XH 3RWFB 3VGBA 1J1OL 1HEZB 4B5EA 2EKSB 1M71B 2NR6D 4LFHG 4P4KC 4WFGE 5FDWB 3HLAB 4BYHA 3TT3L 4KJYB 1NANI 1AO7E 4CN1A 2H41A 2XI9A 2M1KA 3SO3C 1HH6B 3LQAC 5GZNC 1F11A 4N8CL 4U2ZA 3LQAH 1MELA 5ALBL 4MQ7B 4PV8A 3FFCE 1LP9E 3IFPB 2A73A 1Q9LB 1ND0A 3TESA 3BZ4B 4M6NH 4XXCA 3FQTA 4HT1L 5A16B 3MJGX 4U6VH 4NM8H 4JLRB 4M6MH 3VXUB 1LMKA 3OL2A 1AD9A 4S2SA 3GZKA 5HVFB 3NPSB 4TVSa 2IPUK 5BCAA 2IAMD 4F37K 5D2NB 1NAMH 1ZT1A 4UNVA 3MV8B 1MHHB 3GBML 3AVEA 1JBJA 1KULA 3LEVH 4OLYL 5HXMA 4FHBD 4KTDH 4PJBF 4U6XA 1G9EA 4MJ2A 4TVPD 5EU5A 4NOFA 1PX3A 3QJHB 5T1MB 3QIBB 4WIQA 3SHSA 3BN9D 5JOPD 2R0WH 2UZXB 5CWSB 4YXHL 1G7MA 1JRHI 1MCLA 5JHLL 1GYAA 4NO3B 5EZLA 2DQTH 3HG1D 1YYLL 1Y6KR 3QULA 4Q9RL 3D0VB 4ODUA 2ICCA 3IT8D 5EA0L 2A1WL 3FO2A 5JPMB 2VN4A 5C0JB 1T0MA 4M7KH 4UBDD 5TE6H 3DV6A 3P40A 4DFIA 3H42H 2C3GA 4MA3A 5B4MD 4XX1E 2NY0C 5CP7B 2AXJA 4QXGL 5IVXF 3B9EA 3G5ZA 5D1QA 4HPYL 1JHKL 5H2BA 4BQ6A 1JF6A 3OAYH 5CINH 1NSNH 1WWAX 4P5MB 4HS6B 1KJVB 2JB5H 32C2B 4M3KB 3VD5A 3RWGB 4U1LA 4JFDE 2FX9H 5ESVA 5HHOD 4HUXA 1RZJC 1I4FB 5EH1A 3EGSB 1F3JB 1JNLL 5JW4N 2HFTA 1RZJH 2ITDB 3L5IA 5HVHB 3OJ2C 3TVMC 3L5WB 4LIQE 2NZ9C 2ESVD 1Q94A 3TV3H 5JXEA 1EEYB 2GJ6E 3SN6N 4QHKI 3O6FD 4HXAH 3QIWC 5HY9B 4IHOA 1T21A 3BN3B 2HVKB 4F33B 1SJEA 4S1SL 3QQ3B 3VI3E 2GK0B 2R4RH 5EBMA 4YPJA 3AXLB 4ONFL 2EDLA 4OF8A 2EECA 5IUSA 3QUKB 3HE7A 4I4WA 4I0PA 1IAIM 3CD4A 4FXKA 1EO8L 4FA8A 3Q3GB 1UG9A 4K3DH 1TCRA 2VXTH 3BUTA 1KJ2L 3LVEA 1RFDH 1KCSH 1RZ8A 1FPTL 5D93C 5HYJA 4UIKH 3QH3A 3QCTL 1S7SB 1H3PH 3EJYC 4LF3A 5C0EB 3I3DA 4XBGA 5I74B 5KVMC 3IDMA 3P9LB 1JGDB 3MLYH 5I17B 4HIJA 4E0RA 1H3WM 2IQ9L 4UINL 2G9HA 4MAUH 1T7VA 2FEDD 3QCUL 2YWYA 3FT4A 2B1AL 5CZVH 3SDCB 5I15L 5JPNA 1NCUA 3JUZA 4GUPA 3FONA 3ULSA 1PBYA 3IU3A 2H2PC 1KPUB 1VSCA 4PS4H 1DVFC 3D3VE 3BZDA 4WFED 3V6ZB 4FFZL 4GG8B 1U8KB 3ORJA 2AKRB 3QCVL 3VFRB 1DQML 4U1MA 1OSPH 5J6GA 4ONOA 4WWKD 1YEGL 5E5MA 1SJHA 3F58H 1T03H 2DMBA 1G9NL 4LMQE 4C54A 5HGBB 3PHQB 2P8LB 2QQKH 4Q9QL 15C8H 2Y23A 4N0RA 5F3HB 1ADQA 4PJ9D 5IROA 3MBED 1TQBB 1ZANL 3KPTA 1GSMA 1FDLH 3O6ML 3T1FA 1S7WB 4GRMB 2OTWA 1P6AB 4XPHL 3TN0B 4D8PB 3WV0A 4XNZB 4H1LH 3EJZC 4CU7A 4M03A 4HFUL 1YYML 3VXMB 5FGBA 1CLCA 5E99H 3MROA 3SGEH 3HR5A 4BSJA 4NQTA 5BZWA 4FQ1L 1QOKA 1NL0H 3VCLB 2EO9A 3PWPA 2GT9B 3MV7B 4FZEH 1OD7A 4ZSOE 4PJAA 4U6TA 1ORSA 3DGGA 4HPOL 4MCYB 4JRXE 5GGUA 3VWKA 3VE0B 5L9DL 1T22A 4YC2B 5FM5O 3MV9D 2JCCF 5HGDB 4JG1L 1X5LA 3RU8H 4P5KB 1NKOA 4G6MH 4PRPD 4X0KB 3HE7C 5TH2B 2GUOB 4U6HA 4N9GB 3HS0B 4JFZH 5IHUH 3ULUF 4OLVL 2VITB 3VFWB 4P4RA 4OCYH 1PEWA 3D2UD 1FNSH 2R1XB 5TFSH 5ILTH 1LE9A 2MKLC 2QR0B 3MBEA 4IDJH 3RNQB 1DEEB 3R06B 3DXAB 4ETYA 1RI8A 3ARFA 3BWUC 3MRGA 3ARBC 5DHYB 4U0QB 4RFEB 1J8HD 5KS9F 2DQHH 1IBGH 2DWEB 1F3DJ 2AXFB 1KELL 1TDQA 1FVCB 2EDBA 4UV4L 1FGVL 1QR1B 4TTGA 5F88A 4OLWL 1OGAD 3ZDZF 4LKXB 1NMCC 3SGKC 5E4EC 3EOBA 3T0AA 4DKEL 2IH1A 1B9ZA 2ZUXA 3AMLA 3MXVH 2CRYA 4NQSB 2J8UB 4U1JA 4AMKH 1FORL 1MREL 4U0RB 4PJDB 1AKJD 3EYSH 5C3TA 1J7VR 2HVJA 3MV9A 2DD8L 5ITFA 3GB7B 1UC6A 4MXVE 3SDYL 4ZO6A 4NP4H 2P45B 3WFZA 2EH7L 3V95A 1X5HA 4J1UB 2WWMD 3FQUB 2D7QA 1UEMA 1XF4A 1I7TB 3H3PH 3MJ7B 2BC4B 2Q8BH 1U0QA 1D6VL 2K9UA 4PJCB 5IFAH 3O6LL 5JXAH 4NCC2 2PCPA 4JFFA 5KTEH 4IRJC 2JTDA 4KKNA 5B21A 2BNUA 1F8TL 2X4PB 4KJPD 3KYAA 4JJHA 1RULL 1KN2H 3OHXB 1KTDB 4LP5A 4XCYA 4WU5A 2VR9A 2GSIB 4BKLB 2DLEA 3WMSA 3T2QA 2EO1A 4NQED 3QUXC 4LDEB 3QXVA 2EE3A 4ZNEE 1PLGL 5F7KC 1XR9B 3MMEA 3MLRL 1TVHA 1E6JH 3IDJB 3AS2A 5E2JA 1JVKA 4G5ZH 3Q6GH 4LLDA 5C0FA 4KK8D 2COQA 1AFVH 1IZKA 3VWKC 3LKNA 3VW3H 4Y5XC 2EC9T 2H1PH 5IKCB 2AJ3A 4O2CA 4X6CB 4XB7A 1I9JH 2PUQT 5IB3A 1I8IA 3FO9B 5D1ZA 3C6SB 4Z7QF 2ARJQ 1UACL 3C6LA 2QV2A 3RRQA 4BUGA 4GG6B 5IG7A 5L7XH 1EHXA 4KKCD 3PP4H 3ARFC 1YNTA 5DS8A 3VJ6A 4EVNB 2UV3A 1QLRA 1UQSB 3L3DB 1CT8A 3M17A 4L4VA 3DROA 4IJ3B 1SEBB 4P2RB 1K8IA 3DVFA 4WV1C 1LEGA 4C59B 3C5ZD 5IQ9B 5T1LD 2YPVL 3U7WH 2F5AL 3BEWB 4JFPA 3WNMA 3SCMA 3FCTA 1IGFL 2J4WL 3KPSA 3EO0B 3MOAL 4HGWB 5DTFB 1QZ1A 1X44A 2XTJB 2VXQH 5EBWA 1M6OA 4O2FB 1NCCH 1D5BA 4LCYA 4P2QE 3W11D 4KZEL 1MJJB 1DANU 5KVGL 2IBBA 3ZT6A 4ORGB 3QP3A 3BDBA 5J0BA 2X4UA 1J86A 3F7VB 4LLMA 1NCAL 4FFWD 2W92A 2X4NA 4G42A 1BHGA 2WIIB 2AJZA 5ICXA 5C0AA 3I50L 1MWAB 5BQ7B 3UYOD 4JHAL 4OTXL 3GUTB 1Y18A 5E8EA 5EB9A 5T3ZL 3GMLA 1AE6H 4BZYA 5IR1A 5H35B 4KQ4H 5F89B 5F9DC 1MJ7L 1N59B 4U1GB 4R8WL 3RWHA 3V5HB 1D5ZA 1IEAA 3WNNA 4TPRH 3CNKA 4PG9B 2BNRD 2E8ZA 2ITCA 2JB6B 4WU7B 4J3VA 1G0XA 2I27N 1KT2A 2VH5H 2AJSH 2RFXA 1R3IH 1J0YA 3D39B 3D69A 4KY1L 3VXRA 4YX2H 2E7LC 2WBWB 1JF1B 5C0CE 2KQNA 3VFUA 1GOHA 1I7ZB 1EH9A 4E41E 2ZCHL 4NO2B 4YDKH 4BFIA 4Z7WF 5TQ0H 2NY3B 1JTOA 3INUL 3KS0H 5EWIH 4PJBB 1CVRA 1AI1H 5B3JE 4CADB 1ZT4A 3C87A 4WFFD 2VZOA 1IGYB 3UTTD 2LE9A 2LQRA 4JFQB 1NMAH 3ZZ1A 3VRJA 5FV2A 1NANH 3BX7C 5CSBA 5ANME 4HIHA 4HX1A 3UJIL 1KEGL 1QEWB 3AREA 4ELKB 3WLBA 1ZHKA 1A8JH 3K81A 4EI6B 4RGMC 1QBLL 5EZOL 1Q0XL 2I07B 5SWSD 2FGZA 2V7NB 2EDWA 1VGKA 2DTSA 1MQKL 5D7LE 3VXTA 1W0VA 1D5XB 2IF7A 2GSGA 2IFFH 4XP9L 5JUEH 4X6BA 1UH3A 5EU6E 5IVXB 1OTTC 1U8LA 3GSOA 5BXFA 1FIGH 1PGRB 3QWRA 5E00A 5DMKA 5C70A 2DICA 1QQDB 1LGVA 4LSUH 4OD2B 5CEZE 1P5UA 4UOJA 2DIBA 3RGVC 3ZYIA 4QWWD 4NM8L 2FWOA 3U9UA 2CO7B 4YR6B 4RSVA 1VHPA 3SCMC 1K2DA 3WLWC 3DO7A 3PQYB 1X5AA 1ODAA 5F72S 4KRPB 3QHZH 1U58A 2BSSA 2Z9TA 4JO2H 3OPZL 3QRGH 3DVNB 4UT6H 1OQOA 5T5NF 1SY6H 4PJ8D 1JRHH 4BFEA 5MEPA 4Y19E 2ED9A 3BDYL 3NABL 4G8IB 5IEKB 2ORBL 3DX6A 3AB0B 2IALA 4V1DA 5AYQA 3MJ9L 4LOUD 5DVLA 3SO5A 3EFFB 2QSCL 3ARTA 3D18B 3FFDB 2ARWA 1G0YR 4NWUL 1FYTB 1IRAY 3KHQA 4F7TA 2OQJA 1IMHC 3WKNA 4PJXE 1CE6B 1RHHB 4Y8AA 5DD5H 3DSNA 3LB6D 1HHGB 1A14H 3F12A 4U1HB 4H88L 3I9GH 3MREA 2AS5M 2VDLH 5E5RB 3BGFC 4QOKB 5F1NB 4UQ3A 1GOFA 4MS8C 4YE4L 3HMXH 2X5PA 3IKCA 1SM3H 5DQDL 3KAAA 4GS7C 2LTQC 3LRHA 4FXGB 2L0DA 4NM4H 1I3RA 5JIKA 4DTGH 4WW2A 4Z77A 2BY1A 3TCXA 1QSEE 3CXDH 1K4CB 5JHDE 2XKUA 4G8FB 1K5NA 3PNWB 4XRCB 3HMWH 5DQJA 1HSAB 1A5FH 2IMNA 3KYOA 2QL1A 4FQXC 4M1DL 3CVHA 3O2DA 1KPVB 3PL6D 4PGBA 4OZIF 1TJGL 1A1NA 2OZ4L 2X9WA 2FJFA 4G8GB 5D7IE 2DYPB 2H2SD 2YUWA 5DRWB 4RMUA 3K8MA 1H3UA 3H7LA 4OLXH 3IRPX 5IVZA 3BUYA 3B9KB 1RJYB 4MGXA 5CJBA 5E95B 4KZDH 4PJIE 3LIZH 4LHUA 3W5NA 3IDNA 4G6JH 3QUZD 2NXYD 3OAUL 4I1NB 4JPIB 4O58L 3F8UB 1SQ2N 3K4AA 3TJEH 3QDJA 5I6XB 3U46B 5IJVB 4NNXB 2EYRB 3PWNA 3GSWA 1Q72H 1CFTA 4KROC 2QTEA 2NX5A 2ZCLL 4Z18A 1EK3A 3LMJL 1HQ4A 5T5FH 2YC1B 4ZOAA 2KZWA 4AEFA 1CI5A 2M26A 5D7SH 4HUWB 4RBPK 2NY2B 1FFRA 3VG9C 5C3LD 1LO0L 4HHAA 3SDDD 1IQDB 1FZOB 2XA8L 5DHVA 1H0DA 4AEHH 3CJJA 1I1RA 4K3HA 2VDKL 1P9MA 2FLBT 5E7BA 3CSBA 5GRUH 3D85D 3FO0H 3C60A 4GXVH 3V0WH 4Y2DB 3ZHKA 3TA3D 4JG0H 4PRIA 4OFVA 4K7FA 2WBJC 1VB9A 2VLJE 3EYFB 2AK4B 5F8RC 3L6FA 1HILA 1T0NB 5IJKC 3QEQA 1H3GA 2AJYL 2I60L 4YH6A 1Z5LB 3CMOL 1F4XL 4NFCA 4YDJA 3F58L 1YMHB 4I5BB 3BOVA 3KWWA 4ZODA 1H3XA 2R0ZL 1FL3A 5TQ2L 1T6VN 3B6SA 3PWUB 5KS9B 1M4KA 1A3LL 4ZUUA 3BD5A 3MNVB 3ARGB 4HV8A 1E4WH 3M45A 1DQJB 1NUNB 2VLMD 5J12B 5FYKL 4EUPH 4OQTA 3E6HB 3S96A 3W0WE 1QBMH 1T1XB 3IDIA 3C8KB 4WW2C 5T1KB 2B0SL 1A7RH 5ENWA 2EE9A 4ZAKC 4CGTA 2IGFL 3OR7B 1XF3A 3MLWH 3VFSB 4UDTB 3EO9L 2XPGB 3DMMB 3UAJD 3MLSL 3QEHB 3VDCA 1EEZA 4O51A 4PG2A 3HE6D 1YEIH 1P2CB 2D7NA 3QDMD 1TMCB 4ENEC 1DCLA 3WN5B 1AGFA 4JY4B 5IV2B 5EIIA 5BRZE 1BMGA 1MSPA 3N1GC 4XNYH 1FNHA 5I9QB 4OF3A 1EFXB 3WFEL 4UIMB 5DGQA 3CSGA 1AGCB 3MXWL 5EFIA 2BOBB 4XWOC 5J13C 2V5MA 2HFFA 1PY4A 2PO6B 3OV6A 4ELME 3BJ91 4W70A 5D6CB 1KACB 2VLKA 1JGVL 1TZIA 5IVNA 3S36X 4ZUTA 4F15B 4HLJA 3W9EB 2G2RB 1MCBA 3THMH 3RX7A 1NC4B 5T3XL 1C8PA 1VFBA 2EH8L 5MERB 3MLUH 4W68A 3GSRB 3DLQR 4U33A 2XV6B 4XAWL 3NCFB 2P44B 4OGZA 1IKNA 5IIEA 2FH8A 1KXTB 1LILA 4YHLH 2FR4A 4H0GA 3EIFA 3LS5H 3GNMH 5DFWH 5C0GA 1MOEA 3M8OH 2YPLD 4OZGA 5HHQB 4LMQI 3F6IA 4RGOH 4NQDE 5I66B 2I5YH 2FHFA 2GYSA 2DQCH 5DI8A 1OAZL 5I1JL 1VPOH 4NP4L 3V0VB 4XMKL 3Q5OA 3BJLA 3TIDA 4JQIH 1B4JH 1XIWA 2W60A 4XVSH 3TH4T 1CIDA 1J11A 3KPPA 2GAZA 5GGSA 3RWFA 5I1GL 3QUMH 1HEZA 2VQ1B 2EKSA 1M71A 4QHUA 2OR9L 5FDWA 3HLAA 2CD0A 4KJYA 4Y4HB 1NGYB 5C0RH 5KTEL 2AI0L 1UXWB 1HH6A 1M7XA 4OUUB 2W91A 1MLBA 1ADQL 3IDUA 2NZIA 2F5BH 3S36L 2AERT 2B2XL 4LCWB 4MQ7A 5GGVY 3AS1A 1FE8L 3IFPA 3BMVA 1Q9LA 2DLGA 2YKLH 5A16A 1OHQA 3P4OA 3T2OA 4JLRA 3VXUA 1J5OH 4M7ZC 4JPWL 1TIUA 2GITB 3N85L 5L8KB 4EBQH 2XTLA 5CJOH 4F8QA 5D2NA 3RVXD 1UB5B 1YQVH 2YBRB 5HJ3A 3MV8A 3Q6GL 4R7NB 1P4IL 5FUZL 3IFOB 2P8MA 3LH2H 1Z0MA 1AFVL 5HD8D 5T1DL 5IQ7H 5IESH 2FEEI 4NFBA 3WEXB 2HT2D 4QRPD 3WJJC 1GAFH 2H1PL 1CTOA 3O4OB 1R0AH 1Q9WB 5C0BE 1FV1B 3OF6D 4CMMB 5T1MA 1EZVY 3QIBA 1QLEL 4LCIL 2Z31B 3WIHA 1ZEAL 5CWSA 2VOTA 2UY6A 5E6IC 1MFAH 4NO3A 2OK0L 4DN3L 5DRZB 4WHDA 4L4TE 2HT4C 1W8OA 3V7MA 2O61B 2DQGH 3D0VA 1CDJA 4GJTB 5GJSL 5TE4H 5JPMA 4MMXC 5C0JA 4ORZC 3SKNB 3GM0A 1INEH 4M5YH 2PTTB 5IHZB 3BE1H 3QDGB 4RX4D 1EGJH 5CP7A 5HHXH 4P99A 5GZND 1OCWH 4XHJC 1WIPA 3ZYJA 2PYED 2XWBB 4HS6A 1BBJB 2Y1VA 32C2A 3B2UC 3RWGA 3ULVC 2BX5A 3H9HB 1I4FA 3EGSA 1IGIH 2VKWA 3KDMB 2ITDA 5GISL 1JPTH 3EOTH 3L5WA 3NAAL 1T4KB 3OKMB 1EEYA 1IEBB 1ZLSL 3EO1B 3G9VA 2JJTC 1LEKB 1BFVL 3L7FB 1Q38A 5IOPB 1KB9J 5HY9A 3QJFB 2AJVL 2HVKA 4F33A 3GBLA 3QQ3A 2GK0A 2YRPA 3QUMB 1FP5A 3VGDA 3CX5J 2ARJB 3AXLA 1JMXA 1T2QH 3QUKA 2MPAH 4D0CB 4JAMB 3QIUC 3Q3GA 2CJUH 3CU1A 3CFCL 1K9TA 1PDKA 3DRTB 4KK6C 4YFDB 4O00A 3CDGB 4XC1L 4C57C 3TM6A 1KSRA 3EOYG 2NY1B 2HJLB 3NFPB 3S88H 4LLYA 4JFED 1QG3A 4JPKH 5I1CL 4D0BB 1GL4B 3VXSB 2VLLB 3FOMB 5GRVL 1S7SA 4WGVB 4L4JA 5LBSL 3O0RL 3AMKA 5C0EA 3S37H 5A40E 4YK4C 3P9LA 1JGDA 4ZO9A 5TE7H 5I17A 3SDAB 1L7TL 4KDTC 4YBQD 3T0BA 1WT5C 4K71C 5AG9A 2VDOL 1T7ZA 2NW2B 4X7TB 3SDCA 2P5EB 3E2HC 3Q1SL 2DI9A 2E7CA 4D9LH 5HVGB 1GGBL 5HHMB 4WDIB 3O3DA 2NZ9D 3BPCA 3X3FH 2Y5EA 3OWEA 3QFJD 3V6ZA 4GG8A 1U8KA 2HT3C 4PRPE 4MA7H 4ZTOH 5ACLA 2BSED 2BVQA 2XWTB 3VFRA 1OM3L 2VZ1A 4R2GC 4PUBL 4Y5VC 3QIWD 2AV7B 1E4XL 3TIEB 3C2AL 12E8L 5GRXG 5EOTB 5HGBA 3OTTA 3PHQA 4KMTL 4Z0BL 2P8LA 2IPTL 3UTSB 3BRDA 1J8HE 2LU7A 3K0WA 5F3HA 5IMOB 3LD8B 5GRJH 4HBQA 3NBNA 4JFXB 3DXAD 4Q2ZB 4GRMA 5F3BB 4ZPVA 4M5ZL 4NJAH 3TN0A 5F7NC 4D8PA 3VGAB 2AAVA 4FQ2H 5K9OA 3W9DA 4OZIB 1KIPB 1ACYH 2R0KL 3LN5B 1MFCH 2H3NB 3MJ8B 3VXMA 1KN4L 3EJYD 4X8XA 1CLYH 3H9SB 2WUCH 3IF1A 1DBAH 5FUCE 1FCGA 3CLEL 2J12B 3VCLA 3BHBB 1CU4L 2GT9A 3MV7A 1LK3H 1DQLL 1C7TA 4PB0H 1OW0C 4ZXBB 4GXUN 4MCYA 3U0PA 3OR6B 3VE0A 4Z5RB 5EOCJ 5HGDA 2J8HA 3QISA 2H2PD 2WQ8A 4P5KA 4D94A 1EHLH 4YQXH 4X0KA 5TH2A 2GUOA 5AYUL 1DVFD 4MXVF 3HS0A 4BK4A 1OP5K 1IAKA 5L8JB 2VITA 6FABH 3FB6B 3GMQB 2FJGB 2FGWH 4WHTA 1N64L 3IJHB 2R1XA 5E2VL 3QXTA 1JCKA 2QR0A 3RNQA 4A6YB 4RQQB 1DEEA 3R06A 4EI5C 1A7PH 3VRIB 3S9DB 5DHYA 1J1XH 5EUOA 4RFEA 4LHUG 1DANT 4GAYB 4GH7B 2DWEA 4NKIL 2AXFA 3CX2A 3FB5A 1JGUL 1FVCA 1DBKH 2ZNXA 4NQEE 5F7YC 1QR1A 3MGOB 3MODH 1GHFH 2I9LA 4LKXA 1FFNB 5E1HB 1EAPB 3GIZH 2R1WA 4NQSA 2J8UA 1PKQE 3EJZD 4KHXL 3GI8H 4B7IA 5DQ9B 2HLFC 4PJDA 4PLJC 3ZDYF 5EU4B 2AQ2A 2VQUA 3GB7A 1RVFH 4L9LC 2UWEE 4M43H 1VGEL 4J1UA 4G6JL 3FQUA 1I7TA 3MJ7A 2BC4A 5J8OA 3CSYB 2ADIB 3TGXA 5I71C 4PJCA 3F7YB 4R90H 1HNFA 2OBGA 2VDPH 1OAKL 4LAQL 3FRPA 3HC0B 4JQXA 4RA3A 3VD9A 5D7SL 2CDGB 2X4PA 5D1XC 1GIGH 3ZHLA 2HH0H 2O26U 3OHXA 1KTDA 2GSIA 4C4KT 4I9WD 1P7QB 4P2RD 4TYUA 4HBCL 4LSSH 1MFNA 1CDBA 4JCMA 4MXWL 1T1YB 3MNZB 4DGIL 2QLVB 5HTSA 4TSCL 1XZ0B 4FABH 3FO0L 2DDQH 1M7DB 4N90D 5D96C 4EIZC 4HG4J 3IDJA 1OAUH 5EZIL 1GZPB 4LARL 5I8KL 3RVVD 1JPSH 5HPOA 3NIDF 4U2YA 3ARWA 4Z8FH 1UEYA 4LIQH 1IEHA 2HP4A 5I8OH 5I1AB 3ET9F 4DQOL 2W07A 4RZCB 2IG2H 5L2JB 1TTFA 5CILH 3A6BL 5GGRY 5IKCA 4X6CA 1V7NH 1JZ3A 2FIKB 3C6SA 1TETL 5DK2B 4GG6A 5J1TC 2OXHA 4FNLL 3FB8B 3MYJB 1AO7B 3FN3A 3TO4C 4EVNA 5TF1L 4ETQB 4XVUD 1UQSA 2MCPL 3T0EE 2KPNA 3RL1B 4XP5H 1SEBA 1YEKH 1A7RL 4YHNA 4IRJD 4QXWA 3K80A 1OF2B 5IQ9A 5E4IA 4FQLH 3BEWA 4L1DA 5HHPA 4OCSH 1CD1B 4QCIB 3MUZ1 2HKHL 3CVHL 3EO0A 5KVDH 1K6QH 1KENH 3IFLL 1G0DA 3O2DL 4HGWA 5CP3A 5DTFA 4RAVB 4H20L 4O2FA 5LCVL 3RDTB 3RVTC 4ZG1A 1IM9B 1YMMB 5F93C 1MJJA 3QUXD 4ORGA 2OL3H 2VC2L 3OAZK 2QADC 4OGXH 4P57B 4V2BA 3F7VA 2NNAB 2WIIA 3L7EB 5B3JF 2BDNH 3VWJC 1MWAA 3QAZB 1MPAH 1WJ3A 2ZOLA 4F9PC 3GUTA 3U4BH 1BIIB 4KC3B 5H35A 5F89A 3W2DH 3V5HA 4MA1C 3GK8L 2CXKA 5F96L 4ODTH 4NZJA 4PG9A 4L3ED 2VDNL 1BVLB 1FN4B 2JB6A 4WU7A 4HWZB 4TUKH 2CMRH 3CK0L 4JM4H 4IOSD 1F3RB 3WXWH 3HNTL 3O3UN 3D39A 5FM4A 4OZFH 2J5LB 1JF1A 3MRPA 4PLNC 1SEQL 1ERNA 1I7ZA 1DN0A 1V8HA 1QFUL 1V3KA 4HIXH 2Q7YB 4MB4A 1PX4A 2Y06H 3NCYP 5CBEB 4NO2A 2FZ3B 5GGQL 1G7LB 5C0IB 1F45A 1NBYB 1VPOL 4CADA 5JIPA 3EHBD 4P9HC 4KRPD 2XZAH 2AEQL 1IGYA 4XP6L 5DC9B 2VN7A 5DJZA 1FSKB 4JFQA 4QRSB 3DI3B 4P9HH 5D8JL 4JKPH 1YC8A 2GJ6B 5DUMH 3PABA 3I3EA 4MAYC 4W81A 1QEWA 4ELKA 5DVNA 4EI6A 4GOSA 1W72H 3BSZL 4ZUSB 4DEPB 2I07A 3ARXA 4CVZB 2V7NA 1J1PL 4LSTH 4Z7NE 2OS7A 5IHBA 4YHOL 1MCWM 3ME0A 5KAQF 5IVXA 1KCVH 5EORL 1URLA 3HFMH 1NDGB 3K2UL 3KPRD 1QQDA 4OQTL 2X1QA 1HCVA 1KCUL 3BESR 3ALWA 4OD2A 3SE4C 1G9ML 3ZKXB 1U2CA 1KB5A 1ES0B 2DQEL 4YR6A 5KJRL 5CIPB 2M8XA 1Y0LB 3MUY1 1TVBB 4XT1C 5CJOL 3PQYA 1S7TB 8FABB 2X70A 1QR4A 3GJEB 1D5IH 3DVNA 5CP3H 2PR4H 2NQCA 1CN4A 3W5MA 3V79C 4TN9A 3O2VH 1P84K 2CSPA 4G8IA 5GSRB 5K9QG 5IEKA 2EIEA 4X7SL 5IK3B 4WUUD 3BGAA 3EFFA 4NN7C 1NCDH 3D18A 3FFDA 1I1AC 3DSFH 1MCQA 2X42A 1AIFB 1FYTA 4G8GD 1MFAL 3D3VB 3QRFM 3MBXH 1S9VA 1FO0B 4P5TC 3ZKQD 5D7IF 1CE6A 1RHHA 1P53A 5LQBH 1BM3L 3U2SB 1HHGA 2DQFB 2ERJC 4JB9L 4PJIF 1WK0A 7FABL 2F54B 4CBPA 3UX9B 3UTOA 4NBXB 4QOKA 5F1NA 4Q6IB 3O8XB 2W9LA 1Z0NA 3GMOB 5IB5B 1VENA 5IB1B 3OG4B 3KLDA 4HWEL 3UDWC 3BKCL 3QXUA 4YBLB 5KSUB 3D9AL 1LO2L 4N0FB 2V5SA 4O5LH 1T2XA 1X7QB 1PJ9A 3RP1A 3ULVL 3RGVD 4OGYH 1K4CA 1XGQB 1BQLH 4LSRH 4JO1L 5JNYB 4G8FA 3KNBB 1RUQL 3PNWA 4XRCA 3HA0A 4OB5H 1HSAA 3HR6A 3WLWD 1U9KA 3O4LE 1EBPA 5CJ8A 2PXYB 1S9KC 4G8GA 1MUJA 2Z8WC 3FRUA 2DYPA 2Y25A 3MCG1 2YA0A 1Z9SA 4FQIL 3LKOB 4IMKA 3B9KA 1RJYA 4F7CB 4ZSOB 3L5XH 3GMRB 3RWCA 1JZ8A 5EPMB 4JRXB 4K9EC 1I9IL 1CGTA 4K9EH 4JPIA 5J11C 3MRCB 2Q7NA 3P11H 4U1IB 2CO6B 5FCUL 3U46A 5IJVA 4NNXA 3KJ4C 3S88L 5JMRA 3P30L 3DURB 2YC1A 4WTWA 2Y5TA 1PD6A 4XI5D 3O6KH 4HUWA 5TDOB 1IAOB 1WZMA 1IQDA 1FZOA 1JIBA 1WTLA 1ED3A 4WUKH 3OXSA 2R23B 3LRGA 2A6KB 3TPUB 5CS7A 2YA1A 4JY6B 3O9WC 2HFGH 3I6GB 3TT1L 3CXHJ 1AJ7H 4ERSH 1XGUB 4OFDA 4Y2DA 3DMMD 4S1QH 3SE9L 1FLRH 1EJOL 4FQXD 3EYFA 1MAML 3FT3B 4DZ8B 3NVQA 3WIHL 2AK4A 3E0GA 1T0NA 5F97E 1OAQL 4P23B 3MPCA 4TNWF 3GRWH 4J3TA 2ZSWA 3S5LB 3WXVH 5ID0B 3FJTA 1ZLVH 4YAQA 1YMHA 3PE9A 4I5BA 4WCYL 5E9DB 3KGRA 4NC2B 5F9JB 1JTPA 1HHJA 3PWUA 5KS9A 4HCRH 2R56H 5IMKB 3MNVA 4XC3L 3ARGA 1WFUA 2ID5A 1DQJA 1BQHB 2D9CA 3MZGB 1DTUA 5I1HL 2ATPB 4ELMF 3E6HA 1YPZE 4K94C 1T1XA 5EU7E 5DC4B 5T1KA 5D5ME 1MCOL 1NLDH 3F5WB 4K94H 4KROD 2IC2A 1MFCL 4Y4FB 5E2TH 3OR7A 3ZHDA 5IF0A 4Y89A 1NEZB 3VFSA 1A6UH 4UDTA 5C08B 2XPGA 4N1HB 3DMMA 2MTPA 1PQZB 3QEHA 4KGLA 5LGHH 4PY7A 1P2CA 2WSKA 3WN5A 2DL9A 2ZPKH 2O5XH 4JY4A 3VDAA 5IV2A 5ITBH 5H37H 1J0ZA 4HKXB 2J1KA 3E3QE 3U7YH 1EFXA 2CK0L 4UIMA 4ZMAT 4GAJL 1OP5H 3SE3C 1XT5A 4NBYB 1AGCA 3K4ZA 4FZ8H 3EUUA 1QHPA 5JW5B 3K2MC 4CNIB 4QTIH 5IFHL 2BOBA 2WBJD 3B8SA 4NGHH 2DI8A 2CRIA 1MHCB 1T83A 2FGWL 3QUYC 4BM7A 1ZWIB 2PO6A 1MY7A 4QRRE 5JIHA 1QNZL 4P9MH 5D6CA 3OKOB 5FYLD 3W9EA 1QFWL 3NFSL 2G2RA 3UZVB 1NC4A 2BVUA 5DD0H 5MERA 2FECI 2W0KA 3GSRA 1GGCL 5E6YA 1MHPL 2DIJA 4BZ1L 2E7BA 1QBBA 5HGAB 4LCWD 1LE5B 4LSQH 4WJ5B 1A3RH 4JREB 1G6RB 4U05A 5HHQA 1LD9A 4LPVA 1WFNA 3NIFE 3FRPG 2F8OA 4ZAKD 4K8RC 4L8SB 2A6DA 5E8NA 1YN6B 3QA3B 1DLHB 4K8RH 3V0VA 5EOCL 3K46A 1F2QA 2YEZB 3T2NH 3X14B 3KLHC 3NCBB 1R3KB 5I76B 1J8KA 4WO4B 2GTZB 4NCC1 5CFHA 2CR6A 4ENED 5FOBB 2CKBH 2AQ3A 1IKFH 3NH7H 4KQ3H 4PRHD 4PRBB 5L0QC 2Z31D 4Y4HA 1NGYA 1CL7L 3MA9L 1U8QB 1UXWA 3WFCL 1FH5L 1UCBL 4OUUA 4UILH 4PREB 5FUOH 4HIIB 2D3VA 4JRYE 4HC1A 3RKDC 4Y8DC 1A2YB 1KTKE 1RUMH 3E6FB 4WFHD 3G5XB 1T80A 4PJFF 2FH6A 4Y1AE 4XP4H 4P2OB 2C3HA 3O41B 1UB5A 5TDPB 4GMSL 4W6WB 2YBRA 2FYYB 3W39B 4R7NA 4J4PC 3IFOA 3DTXB 5DT1L 3WFDH 4K23L 5FFLA 3MUJA 3WEXA 2XZQL 3DGCR 3KR3H 1S3KH 1Q9WA 3N06B 5ANMB 1FV1A 4CMMA 2MHAB 2OR8A 4LVHC 4ALAH 3P9MB 2Q8AL 1DQDL 4PRAB 3BH9B 3SDAC 3VGHA 4FTVD 4X6DB 3MA7B 4I2XB 5DRZA 3JXAA 2O61A 1B2WL 1BOGB 5DO2C 3SKNA 3X12B 2GY7B 2UUDH 2PTTA 1RZFH 5IHZA 1YEKL 3QDGA 3QWOB 3QXWA 3TZVB 1A7NH 5C09E 4G9FD 4PGDB 4TUJB 4LRNL 3UC0L 4Q9BA 3ARUA 1PKOA 5GQBA 3VRLE 1YEHH 2NY1D 2XWBA 1HHIB 5KVDL 1KENL 3RI5K 1BBJA 1U92B 1SVCP 4K3EL 3H9HA 2BNQD 4OF0A 4U3HA 3U30C 3I6KB 1LDPH 2DQDH 1N7MH 3MRBB 3OAZH 1PG7H 3P0VL 1IFHL 4Z7UE 2QHRH 4GSDH 3WFHB 5EZJB 1EAJA 3OKMA 1CGWA 1IEBA 4CVXB 3EO1A 1A7QL 2AVGA 3L7FA 5IOPA 1F42A 3QFJE 3QJFA 1TJIL 2L7JA 3LS4H 2XICA 2ARJA 4TULH 3CUPB 1RMFL 3CDFA 3I2CH 4YEFA 4NQCB 4M61B 5E03A 5BVPH 4LRIA 4O4YL 1P5VA 3UMTA 2YK1L 4JAMA 3TWCH 4GBXB 1BEYH 5E6ID 4X4ZA 2HT4D 1MCCA 3DRTA 3CDGA 4R0LB 4LLQB 3MGTA 3C2SA 3C5SB 1VEMA 2HJLA 3NFPA 2LU3A 4D0BA 3K8KA 3UTSD 2XXCB 3VXSA 2VLLA 3FOMA 4DAGH 2F19L 2VUOA 1IJ9A 4EXKA 3CFJB 5KN5A 2XN9D 5F9WB 4GRWB 5KSVA 3MZTA 4PFEA 1WAAE 1A6VL 1QSEB 3U0WL 4XHJD 5JHDB 2DLFH 2DKSA 2NW2A 3VFNB 5FGRA 3QEGL 4X7TA 3B2VL 3B2UD 2P5EA 4NKMB 5DUML 1HXYB 5ESAB 3WUWB 3DX7A 1S5HB 5D7IB 4WDIA 1NCNA 3LPWA 3LKRA 5J57B 4MDIB 1XH3B 5FXCH 4W4OC 5AWNH 1GVIA 2Y36L 2XWTA 4I3RH 3DUSB 3BD3A 5L2KD 4ZXBD 4NIKB 4TRPL 1KJ3H 1INQB 3SJVA 4G7VH 2R0LL 3V6OA 5IB4B 2AV7A 3TIEA 4JKWA 4APQC 3JV6B 5EOTA 4NHUB 5IFJA 5HPMB 1BD2D 5EN2A 3UTSA 5CEYB 5HYFA 1HKFA 3UO1L 5J7CC 2RAMA 2PW2B 5DZOA 4K2UL 5I1LB 4PP2B 5IMOA 2KQMA 3SQBA 4ODSL 4ONGH 4I3GA 4Q2ZA 1FAIH 4P48A 4E5XB 2X4SB 5F3BA 5CSZB 1FLTX 5FYKE 3O3BB 3LOWA 25C8H 4LBEA 4OZIA 3RWEB 3GBNH 1ZT7B 3LN5A 1QLFB 2H3NA 1BAFL 5DR5L 3MJ8A 2R15A 1DUYB 1OT1A 3H9SA 5F7UA 1A22B 1FNAA 1JWSB 1INDL 4R96B 1WBYB 1RU9L 1H5BB 1PEZA 1I75A 1I3UA 4WI5A 4YHZH 2EDOA 3BHBA 1ZXQA 1UYWL 4Y16B 1MWAL 1CQYA 1BECA 2IANB 5F7FA 1DBBL 4Z5RA 1YECH 4J8RB 1YEFH 3RFZC 5C7XL 1UM4H 3LPGA 4UT7H 3PWVB 3GHEH 5I30L 1B0RB 4J6RH 4X5WB 3TLRA 4MJIE 3FB6A 3GMQA 1D5MB 1T2JA 2HT3D 1EVUA 4OBSA 2FHBA 2AQ1A 4X6FB 3IJHA 1FVEB 4R2GD 3DECA 4RQQA 4A6YA 1FFOB 3CLFH 3VRIA 2EDTA 3Q6FB 4K7PX 2NY7H 4PTTB 1K4DB 1HIMH 3BKMH 4YPGB 3W0WB 3BWAB 4JANB 4LVNB 2ADGB 2LV4A 5C2BL 4UTBL 2ZJSL 3LZFL 1WBXB 2XACC 5MHSE 5KVEH 1FFNA 1AGDB 4M48L 5IT2H 2UZIH 1EAPA 4MB5A 2VDQH 2BXYA 5CEXB 1OSZB 2ZUWA 3ZE0E 1YEJL 1VESA 1DDHB 5EU4A 5E94B 2Q6WB 5BRZB 1C5BL 3DNKA 1FGNH 1FRGH 4NQUA 2RIKA 4OZ4B 2WANA 5AAWA 4OZHF 3CSYA 2ADIA 2AXGB 1Z3GL 4IIQA 4JN1H 1NLBH 3F7YA 3H2WA 2OMNA 4PJGB 2RCSH 7CGTA 3WFBL 5DWUL 1P4LB 4NN5B 3GSNB 4ELMB 2BSTB 2NLJB 3DVGB 3MCLL 1HDMB 4WFGD 1NDMA 3HRPA 3OBAA 1KB5L 2OTPA 2CDGA 1AO7D 2BHZA 4QXTB 5EBGA 2OI9B 3NCJL 4B0MM 3KPMB 4EEEA 4K7PL 4EI5D 1UWGH 2WINB 5SWZD 1NAKH 4X7EC 1P7QA 3WD5L 4BFBD 3EJJX 4Z9KB 3W81A 5BO1H 2E27H 3FFCD 1MFBL 2CUHA 5D9SB 5GXBB 1T5XB 2J6EA 1T1YA 2BMKA 1XZ0A 1M7DA 1AJ7L 1GZPA 4XPFL 3BP5B 4NQDB 5IM7B 4LP4A 2VXVH 1LWRA 2G5BB 4AM0B 4NJ9H 4XWGL 4QT5B 5I1AA 3WKMH 3PWPE 3PJSB 4RZCA 1QRND 1YC7A 1ZK9A 4PJHF 4NZDA 4ONHB 4PJAE 5SX4I 2HLFD 4PLJD 4UB0H 1UM5L 4F3FB 4MD4B 3HG1B 5CUSL 3TPKA 1CLOL 4LGSB 2FIKA 4NDMB 3FZUC 1BX2B 3PUCA 5DK2A 2VUYA 3FB8A 5GHWH 3RZCC 1D9KC 4MQXC 3V4VH 3RWIA 4AENA 1AO7A 2FD6H 2HRLA 1F58H 3S98A 4ETQA 5B8CC 1CLZL 4X80H 1XGYL 2QQNL 3RL1A 1BBDH 3O3AB 4MNHB 4M62L 4K94L 4UOW1 1OF2A 1ZLWK 2BY0A 3U79A 5DK0B 4TTDD 1CD1A 4QCIA 4MQTB 2E7MA 5D1XD 3C09C 3QPXL 4DGYH 5HHOB 3KXFD 2K1MA 3EYQC 5HDQH 4LGPB 2Q87A 3ZE2E 4RAVA 5BV7C 4BSWB 1OQXA 3RDTA 5B22A 2CDEB 1IM9A 5JLZB 5DC0A 3GJFB 4KI5C 1YMMA 5BV7H 1FZJB 5CZKA 3NTCL 5D6DC 4OT1L 4JFDD 4KHTH 2VXUH 1RZKC 5CJ5A 1OD9A 1TCMA 4IRZH 4AIXA 4P57A 4NZRL 3G04B 4XNUH 1RZKH 5HSFA 1AY1L 5IB2B 1UVQB 1MI5E 2UVEA 1BIIA 3DHJA 3MOBL 3MQIA 4IIQC 4O9HH 3LDBB 2CLZB 3QO0B 1M05B 4HFWB 4POYA 2V17H 1NGWB 4QF1B 1N3NA 4OSUL 4O02L 4AIZB 1WUNT 4LPYA 4JFFE 1BVLA 1FN4A 2E9IA 2ZUTA 1K85A 2XQYG 4HWZA 3K74B 4Z7NF 3OKEB 4PJFB 5AD0B 3QT2A 3A67L 4AG4L 2Q7YA 3TO4D 5CBEA 2Q86B 3NGBC 2FZ3A 3G5YB 4DW2H 1G7LA 5C0IA 5FHBL 5F70A 1RIUL 1NBYA 3CPLB 1HZHL 5M95B 4KDVA 1OPGL 4C58B 5E8DH 2C4FU 1L0QA 1LO5B 3GO1H 4OCWH 2Y72A 4QRSA 3HAEH 4XNXL 5C6TL 4Z95H 2GJ6A 3D87B 3ULUL 3RVTD 1N0XL 4MA8L 1NBZA 3WSQL 1J9CT 5TJWK 1OTSD 5I8EB 4BH7B 1R5IB 4YIQB 4G7YL 2QADD 2V5RA 4ZUSA 4CVZA 4WWKB 1RZ7H 1CS6A 3D3VD 3VWJD 4JDTH 3ZLQC 3RZWA 1N5YH 4JFYB 3RVWC 1NDGA 3VI4E 1RUAH 2BSRA 1XGTB 5ADOH 3NACH 4R9HA 1I85C 3U48A 3ZL4L 4PJ9B 4RMTA 1E4JA 2VMFA 4L4VE 4NUGL 4NYLB 2W0LA 3HCVB 5CIPA 1Y0LA 5DMJB 1TVBA 4M00A 4ZFGH 1CTNA 1S7TA 8FABA 3KPOB 1RUKH 4BQBA 1F13A 2BCKB 3MLXL 1CZ8H 4M6AA 5I1IL 1EXUB 1PZ5A 3GJEA 3KVQA 4Y4KC 4ZOCA 4GLRI 5LXGL 3STBA 1UA6H 1MEXL 4H5SB 2VZTA 4LLVB 1F6LL 4OM1H 1RUPL 1B6UA 5GSRA 3KR3L 3B5TA 5AZEH 1KEML 5IK3A 2JK5B 3IAQA 4OIAA 1EA9C 1FFPB 4C56D 2PXYD 2I25N 2G75B 3Q5YA 5DZLA 2YD8A 3U1SH 5C0AE 1FO0A 4EDXA 4YHKL 4PRPB 2HWZL 3S4SA 4MAYD 3U2SA 1TLKA 2R8SL 3C9NA 3OB0H 4JRXD 2YPKB 2DQFA 4DUVA 2H32H 3D2UB 2BVPB 4MX7A 2F54A 1CCZA 3AAZA 3L3KB 1A7NL 1J1OH 3O8XA 3DIFB 3TT3H 1J8HB 5GS1C 3GMOA 4OM0L 5IB5A 3BT2L 5IB1A 1YY9C 3VXPB 4AQOA 1I3VA 1U91B 5KSUA 1CGVA 4N8CH 4N0FA 1W0YT 3U7AA 1X7QA 5ALBH 1OGAB 2Z91B 1XGQA 5HI4D 5JNYA 3KNBA 4HSQA 1LEIB 3MCKB 4YXLL 4HQQL 4IRSB 3ZDXE 4JM2A 4HT1H 4M6OL 3SBWC 3QI9C 1OARL 1I7RB 2HTLC 4IEFB 2CIKB 1WIOA 4CDGC 3WO4B 3PP3K 5T5NG 2APTA 3LKOA 3QBTB 4F7CA 4TULL 4ZSOA 3GBMH 1WSST 3T4YB 4KKLD 5EPMA 4JRXA 1MCEA 4ODVL 4R4BB 3T0VA 4X98B 1I1AD 4UAOB 2H26B 3QNYA 1ZE3C 3BKJL 3MRCA 4NN6B 3X3GL 1G7IB 4U1IA 4GO6B 4P5TD 3G6DL 4YZFE 3HC4L 4YXHH 4LCUB 3Q5TA 4HC1L 5JHLH 5AG8A 3JWDC 5FKAB 2GIYA 1AHWB 4XH2B 1YYLH 5F6IB 3I84A 3VFOB 4Q9RH 3JWDH