2L4OA

Solution structure of the streptococcus pneumoniae rrgb pilus backbone d1 domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
175
structure length
175
Chain Sequence
METASAATVFAAGTTTTSVTVHKLLATDGDMDKIANELETGNYAGNKVGVLPANAKEIAGVMFVWTNTNNEIIDENGQTLGVNIDPQTFKLSGAMPATAMKKLTEAEGAKFNTANLPAAKYKIYEIHSLSTYVGEDGATLTGSKAVPIEIELPLNDVVDAHVYPKNTEAKPKILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Streptococcus pneumoniae RrgB pilus backbone D1 domain: in vivo protection and implications for the molecular mechanisms of pilus polymerization
rcsb
source organism Streptococcus pneumoniae
molecule tags Cell adhesion
molecule keywords Cell wall surface anchor family protein
total genus 25
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2010-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2l4oA00
5DS8B 3U48A 4PPTA 1JHKH 1H8OA 2IAMB 3U30B 3UTTB 2PF6A 4UNVA 4PRHD 3SCMD 3VFVA 4OCNC 4JHAH 2H2PC 4N90E 4G42A 4ODHL 1FORH 4MHHG 1MH5B 4ZPVA 5IBTL 1QEWA 1I7RA 5GS1C 2A2QT 5F6IB 4DWHA 3W9EA 3VRJA 4N68A 3QCVH 3MV7B 1J18A 1T0PB 1P6AB 5EWIL 3QULA 3AU1B 3IFLL 4PJXE 4RFNB 1QFUH 2VH5L 1UYWH 3BJLA 2D31B 2QBWA 1KCSL 4LDLB 2W9EH 3RUGE 1IAKA 4L1HA 2HT3D 2ERJB 4PJCA 5KVEH 3GHBH 1RIVH 1I7ZB 4QF1A 5ITFB 3RA7H 4AT6B 1SMAA 3NPSC 4GXUN 5E94A 4O2FA 2PW1B 4XC3L 1QFWM 1XR9A 3KNBB 2VO5A 1JGVH 2X4TA 3QI9A 1MF2L 4PJHE 3FFCE 1A3RH 2Y7QB 4UDTA 1QFWL 2OI9B 1ORQA 4QHLB 4ZXBA 2G9HA 3KPSB 4OV5A 5DFTA 3EJZC 4HCRH 1VEOA 5DC4B 1A2YB 2DQUL 4HS3A 2VDPH 2XI9A 4FQJH 2YD3A 5E7FA 2YEZB 2YEZA 3P40A 3LS5L 2AKRB 3BKYH 4TULL 5E6ZA 2BVUA 3V2AR 2XZCH 1ZANL 4MSWA 1OT1A 4GAYA 1MQ8A 4Y16A 1BD2E 1TPXB 4HZAA 2WUCL 3K4AA 4X7SL 4NKOA 4JR9L 2R8SH 2NZ9D 4L8DA 1IBGL 5CD3A 1A7QL 1WBZB 2NXYC 3HZMB 3TNNB 2AEIT 4K07A 3PABB 2F53A 3QQ4A 5C0AE 2IPKB 5DRZA 2X10A 4X6CE 1JZ6A 3EJYC 3Q48A 3LPGA 4AYFA 2D7NA 4XBPB 3OQ3B 5HI3D 1U42A 3O6LL 3ZHLA 2GSGB 3HS0A 4DFIA 5ILTL 3RAJL 2DM4A 1CU4L 2DYPB 3NCJH 4OB5L 4I4WA 5DFVD 1IGTA 1WWBX 3QEQD 1E27B 4M62H 4WFHD 8CGTA 4MLSA 4ETQB 2JKXA 1F00I 5EULV 5HVHC 3PUCA 3ZL4H 3BIBX 3MRQA 2JE8A 1OTUC 3E6HA 5TJWK 2DL9A 4IRJB 3SDCA 2GUOB 4QRRA 5T1LA 3ULVC 2IFGA 4RX4D 1UB5B 3IU3B 3MJ7A 4LSQL 2X09A 4ODUB 5A3IC 1CIUA 1JF5A 4J8RA 5D7KD 2MCPL 4MD5B 1YMMD 2ZCLH 3QRFM 5E08L 3IJSA 4AQ1B 1IM3A 1K85A 1ZS8A 2HJLA 2ZOLB 1ZS8B 1CGXA 5LXGL 3N85H 4U1MB 4NJ9L 3MRHA 2YA1A 3EYVB 5EBMA 4GXVH 2ADGA 1MRDL 2R2EA 4CW1A 1G7LA 4OSUH 2Z0BA 1PDKA 4G9FB 1A3LL 4HUKB 5LAXB 1TZIB 4UU9A 1ZA6A 4Q9CA 4YDLC 1B90A 1GGUA 1QFPA 2C4FT 2DTSA 4N8VB 1NCDH 5E6IB 5IMOB 2B1HL 5EC1A 5T1DH 5B8CC 3IS1X 3GSUA 2QKIB 1VERA 3KPNA 4X99B 4QOKA 3QIWA 3BEWA 5KN5B 4U6VH 1QBBA 3W11C 5CFHA 2W0KA 1RZJL 3PGFH 4QRTA 5D7IA 3CIQA 3MACL 4P4RA 2EC9U 1T1ZA 3U46B 3KWWA 4CNIB 1EEYA 5CCKL 1HQ4B 5ENWB 3MXWL 3IDIA 5HVHB 2FO4A 1NSNL 2HP4A 5IESL 4LVHB 3L6FA 4P9HC 5IG7A 4QOKD 3O0RL 1OAZL 3PF2A 2OS7A 1G1CA 3ARBB 1QVOB 2C26A 5I18L 4OTXL 4WHYG 4ZD3L 4HMDA 3U4EB 1RK0A 3M8OL 4WU7A 2JTDA 3RWEB 2F8VA 4L29B 4P5TD 1D6VH 1SJHB 3T0EA 1JWMB 4XTRD 4UINL 4F33B 1FHGA 1NFDF 2R23B 5T33L 3GSNA 5GGVH 2X89A 3T2QA 1G7HB 1MCCA 3VFPB 3VXUE 4ZXBC 4CJ0A 3B9EA 3RWGA 4FZEL 4XTRC 5H37H 3RWGB 2Q3AA 1I8IA 3GEWB 2DQFB 3GIVB 1KLFA 3QRGL 1RVFL 3NFNB 1V3MA 4MNQA 3BAEL 5T3ZE 1JPFA 1CVSC 4PGCB 4HDIA 3W39B 3E6FA 1DVFC 1A9EB 4WW2A 4ONOA 5F6HI 2DBLH 1LK2B 1OGAD 5HY9A 4Z5RB 3FZUC 2AEWA 4HCRA 1MWAH 5IKCA 3WMSA 2NR6C 3VXQA 3AUVA 3N06B 4F33A 4KV5E 1UFUA 5E6ID 4V2BA 2FEDD 1J1PL 1GHFL 1WBXA 1S9KC 1OAKL 3VXUD 1UB6A 1ZVSA 3T77B 4JN2A 3QUYB 4YZFE 4QRPA 4OCMC 4ZUWA 5EBGA 2JB5H 3B9VA 1F13A 4JB9H 1FNHA 1UB5A 5GS2D 4NP4H 1QKZH 2BOCB 1A47A 4HGWA 5MI0B 5J4MA 5DJCB 2NMSA 1OAYH 2EDJA 4Y4FD 4I0PB 2R2BA 1CXKA 1ORSA 3N1FC 5J3HC 1TJIH 2VDML 2I5YH 4U1NA 1R3IL 4U1NB 4JREB 1A02N 2VXQH 6FABH 4LPCA 1MCWW 4ERSL 2PW2A 3PDDA 5E2UL 2ICWA 5EU6A 5C0FB 1N0XH 2PYED 3WXVH 4TSCL 3VW3H 5KJRH 2XTJD 2BNQE 2BY3A 4JZNA 2ZUQC 4HT1H 1GIGL 3U30C 2XZAH 4JG0L 4OLYL 3CAFA 2XA8H 5TE7L 1MRFH 2OZ4A 5HGDB 3KYMA 1KPUA 3VXTB 4XXCA 1CR9H 4F3FA 4WIQA 4CN6A 3SY0A 5KG9A 1I3GL 2AJ3A 3WBDA 4MJ5B 3OJ2C 4IRJD 4LVHC 1C12B 1DCLA 4PB0L 3S96B 3I2CL 1F4YL 4K3GA 4JEGB 5BCAA 1MLCA 4XPAL 3V6OC 2W65B 4TOYH 1LDSA 1IAIH 2R29H 2P43B 3B3IB 5E2VH 3ULUD 1BF2A 5SWSB 4YDVA 5I8OL 4HLZG 1FNEB 2RCSH 2C9AA 1J0YA 1NH6A 4Y5YC 3M45A 2D9CA 1HH9B 1A1NB 4M9PA 1U8LA 2HRLA 1P7QA 4PJAE 4CADA 5JOPD 2WWKT 3T2OA 2ADJB 4PLJD 1BVZA 3BGFC 3O3BB 4YDLB 2O5ZH 4OI7A 1U92A 4HIJA 3UBXG 1NCBL 1UYWL 5L7XH 4XNXL 5ADOH 1OVZA 4HWEL 4OD1H 1NANI 4YDJA 4HLJA 3TA3A 5I1DA 4F7PB 2IMNA 1EFXB 4MA3A 4ZTPL 4YGVB 4PS4H 3QDMA 4I77L 5DJAB 1CT8A 2VSCA 1OSZA 4HFUL 3IAQA 4QHNA 1HHKA 4RAVB 3S37L 5HBBA 1JGVL 5KSAA 1MVUA 2CO7B 4N0FB 1AGDA 5FCUH 3MODL 1QLRB 4G80A 4XP4H 3RDTC 3HAEB 4GRWB 5C6TH 4DGYL 1J05B 5SWSA 4HKZB 1K4DB 5C08E 2XPGB 4WWID 4P3CL 1HXMB 3JSSA 3ZDXE 3OGCA 3D9AH 3ARBA 5I76A 4EI5B 1A7NL 5HHVH 1UH4A 4JY4A 2BK8A 5ACMA 2GJZB 3AS2A 1G84A 1JGDA 4K71C 3QZWG 1H5BB 1MCKA 4JO2H 1CDHA 5HXMA 1VPOL 4KMTH 1H3XA 2D4DA 2P4AB 3NCCB 3PP4H 4UT9H 1G7HA 1NGWA 5HHMB 4KTDH 3CFIC 4P46B 2WANA 4QHNB 3ZKMC 4PGEB 3U2SB 3SHSA 5DQJB 3TN0C 4OZHE 5GS0L 2X1OA 1QBLH 3REWA 5EOCL 3O45A 4I0PC 1S8DB 2VDRL 1EGJA 3MLUL 4YR6A 4M7LT 5IR1B 3D69A 4QGTA 1IQWL 5AUMA 3SBWC 4I3SH 3BW9B 2W92A 2ADFH 3OKNA 4XPBH 3ARTA 4NRXB 5AAMA 1UVQB 3M17B 3KPPA 5C0ND 3RVWC 5HSFA 1P7QD 5ILTH 1RV6X 5KSUB 5KSUA 5DJCA 3KYKH 3A6OA 3KPMB 5C0CD 3QDGD 1P84K 3I6LD 4E41E 3TO2B 1P2CB 4MNQE 2B1AL 3LEXB 3DETC 4JFPA 3SE4C 5IF0A 1JN6B 4ONHA 4ZO7A 1RZFH 4MAYB 5ALBL 4HIIA 3VFTB 4XMLL 2E6PA 4CVXB 4HD9A 3QXAA 3STLA 4RGNE 3H0TA 1QHOA 3QXAB 1FPTH 2BOBB 1EEQA 1V7NH 5DVNA 4AK1A 3MOQA 4ALAH 1CFQA 2UY7A 3C5SA 2LFGA 3QPQD 3QXUA 3C5SB 4F3FB 3U9UB 3U0WH 2XFXA 2L7JA 2I9LA 1FYTA 3FO1A 4QHMB 5DSCA 2X4OB 1L0YA 2OR9H 3ZSSA 2FEDC 4YHNB 3DO3A 4PTUB 4M7KL 4RSVA 5ACZA 4JHAL 4QRUB 1Q0XH 2EXWC 1JRHI 5EC2A 5IF0B 4HF5H 5DHXB 1TVDA 3WFEL 1RQ5A 5I1GL 4XMKL 2AJVH 4WHCA 5L8LB 4PRPE 4I0CC 2HWZL 5ANMB 1RZJC 3W11D 2A73B 4GT7A 3L3OB 2RB8A 3JZ7A 2V5SA 3JWOL 1TENA 3ZDYF 1O5DT 3GHEL 3VFNB 3VD5A 3KPOA 1NAKL 3MA9H 4KQ4L 4M6ML 5ISZE 2DQDH 4S10A 1ZLWH 4PR5A 1QKZL 2X9XA 3LQAL 4JCLA 1AGFB 5F93C 1N6VA 5CKGA 3MRJA 2H3NA 2KKQA 1CFVL 1WIPA 3NCMA 3ARQA 5DJ8B 4Y1AA 1EERB 1FDLH 1Q8MA 3TYGH 2YC1B 4LFHG 3VXQB 3B3IA 4AL8H 4F37K 3TFKD 4PUBL 1CICC 2A83A 3WKMH 4KHTL 2A6JB 2Z91A 2NX5A 1WWAX 4PTTB 2MFNA 5D96B 4PJIB 3GJFA 5C08A 1H9VA 1ZHLB 4NHUB 3W2DH 2HH0L 2VAJA 4PJGF 3VMNA 2HFGL 2Q20A 4M7ZB 4GBXC 4NO5B 4CUCA 3KLHD 1KB5A 3ZKQD 2APWA 3CC5B 1YUHA 4Y5VB 4HKBB 4OGYH 3W0WE 1U9KA 3F6IA 3ZSTA 5ESAA 4L5FH 5D7JA 3R06B 3IRPX 2JCCB 3FQXA 4JGMA 4UNTA 4HBCL 5C0BD 4HWBL 5F9JB 4YHKH 4HJ0C 1FN4A 1KLGA 5DMIL 2Y36H 3H9HA 4QTHB 4RWYL 1LHZA 1G7PB 1KLUB 4EQ3A 1HHIA 3DURA 5CP7A 3CX2A 3LKPA 4ZUVA 3NTCL 2O26U 1U8LB 4X6DB 5JW4N 3OAZH 3FN0L 1U8OB 3BUYB 2FD6L 1BVKB 2YUZA 2OYPA 1QG3A 5ADOL 4DKDC 1CTNA 1KJVA 5DFWH 4KFZC 5E03A 5I9QC 4TTDD 3O3UN 1AHWB 5F7DA 4X5XB 4Y8AA 3L3JA 4PP1D 4I77H 4M3KB 4U0QB 3BWUC 1CLZH 2CLVB 5C07E 1BIHA 2BERA 5KVFL 2YZ8A 1Y18A 3RGVB 3G04B 1HCVA 2YRLA 3SDCC 3T4YA 3VFRB 1MPAH 4EN3D 1QP1A 3MRKA 3MV8E 4S1QL 3T65A 2CIKA 3BT2H 4I5BB 4X6CA 2Q8AH 3O9WA 1BGXH 1DLFL 4KKBC 4WO4C 5T1KA 3L5HA 2FHCA 2C3WA 1UZ6F 4JVWA 1A7NH 4NKDB 2VLJD 3KHOA 4D0CA 1RUMH 1A4KB 4EN3A 1WAAE 5IW6A 1I7UA 4PJ5D 5I8CA 2OR8A 1UM5L 3ZKNC 4DN4L 1BHGA 1VHPA 2VC2L 3MJ9L 1D5IL 3ZTJH 2OXHA 2DLIA 3CCHB 2PO6B 4NCC2 4PGEA 3UBXI 4JRYD 4MSWB 4E0RA 3RJQB 1KACB 1ZK9A 2BX5A 4KK5D 3IDYB 3JV4B 5H35A 5HPOA 3HC3L 5DK0B 3L3KB 1AC6A 3TJEL 5I1JL 4LDEB 2ICWI 1AHWC 1PX3A 5F8RC 3MACH 5IP4A 5E8PB 3EJYD 1HXMA 2VUOA 5F7UA 1A6ZA 1E6JL 1RMFL 2FD6H 5D6DC 5DC0A 4BFEA 2ZWLT 3NCFB 3BGMB 4DVRL 3TVMB 5ID1B 1FGNH 4P9ML 5ISZA 2XV6B 1PG7H 4YXHH 3EOTH 4ZAKD 1PYWB 1T3FB 1FH5L 3OR6B 2OTPA 4HJGB 2Z8WC 3FAXA 1YN6B 3C6SB 1G9ML 1ZHNB 3PP3H 3ARRA 5ANMA 4LCUB 2BVPA 1HSBB 3V6FB 5JHDB 1FL5A 2JIXD 4H25B 5EA0H 1OL0A 1R0AL 3GB7A 3QXDA 5I1EL 3EYUH 4IDJL 4PLKD 1T7WA 3ULVF 1P1ZA 2GFBA 2VIRA 2F15A 4Y4KB 5F9WB 3P3YA 3VG0L 4KROD 1DQLH 2AXFA 4MA1B 5TDPB 3TT3L 3QNZA 5L6YH 1U41A 2PO6C 4KAQH 2FH8A 5J6HA 2X89D 5C0JA 3NCEB 2DMCA 2VITB 4S1RL 1B0GB 1H3WM 4JQVA 2YWYA 3NIGE 5I1GH 5M95B 3DRTB 5L0QB 5FYKE 4DZBA 2YMXH 4NQXB 2AABL 1YYMH 3FB5A 2YD6A 1EO7A 3WN5B 1BFVH 1HSAB 1I8LC 3OKYA 1MWAB 4J8RB 3MCKA 1ZTXL 3EDFA 4NFBA 1LVEA 1U92B 4J23A 3G08A 3MLVH 3WUZA 5BV7L 4QRRB 3K81A 1SJEA 3EO0A 4ZFZB 4U1JA 4OGXL 1YMMB 3IFOB 2XNAB 3O3AB 2OL3H 3DVIA 4HIHA 2W59A 2XRAL 4NFDA 4DVRH 3I6KB 4PJ9D 4PIRF 1GRWA 4BK4A 4AY0A 3BX7C 5DD3L 1CGVA 1JI2A 3R0NA 2ZUXA 4AZ8A 4X4XB 3GSNL 1CDJA 4FQCL 1FLRL 3OPZL 2VDMH 4DZ8A 2H26B 1Y6NR 3SPVA 1NLBH 1FZMB 3OKOA 4X9FA 4HEPG 2VTFA 4PP1C 1HYRC 4XCYB 4LRNH 4ONFL 1EO8H 4LU5H 1WVZA 1BD2D 3VJ6B 2HN7B 2IFFH 1HHJA 5D2NB 1CGYA 5IMMA 2VDQL 5FYJU 4PY7A 1MIEL 4P46A 4WY7H 4MXWH 4G8FA 4XXCC 2DAVA 4L4VE 1NGYA 1WAAF 1YN7A 4OD1L 4HWEH 1QFOA 5M7QA 5T5FL 2D7MA 4PLOB 1M05B 4KY1L 5DJXB 3IF1A 1BM3H 4RAHA 4YE4H 4AH2B 3PWPA 3TBVA 2MKWA 1SJHA 4K2UH 4M61B 4RZCB 2ADIA 5T3XL 5DA4A 1S3KH 4YHYB 1SY6H 1FL3B 3MNZB 5DUML 1QTYT 3OGCB 2CQVA 2XQYG 3WJJC 1MFCL 1UWEH 4D0BB 4YDJB 3O45B 4LKXA 5D71L 4JRYE 5J6GA 2XRAH 3T1FA 5C8JA 1RY7B 4TTDC 1JZ8A 1A6AA 4N9GB 3RJDA 4WGVB 2AK1H 5ICXA 1KCKA 1OQOA 1F3JB 4AEHL 1A4JA 4J4PD 3GSQB 1RJLA 1NMBL 4OCSH 1RZKC 2KL6A 3HRZA 1RJZB 3HZYA 1T4KA 1X4ZA 5DJ2B 3C87A 1EXUA 1AD0B 5C9JA 3LIZL 1B6UA 1FV1B 2P42B 3QUXA 4FFZH 4JRYA 1ZHKA 2FJFA 3D3VA 2F5BL 4AT6A 3LEYH 5EZJA 3GBNH 5H94B 1FE8H 5I73B 5GGQH 3KPNB 4X99A 2PR4H 1YQ2A 4LPUA 1DBJH 4P99A 3RPKA 3U82B 5F44A 4ZG1A 1NJ9A 3VFNA 4FFYL 5HJ3B 4H1LA 2JCCF 2B0SL 3P0VH 1B0RB 4DN3L 2P48B 1N5AA 1CD1A 5CZVH 2BMKB 3GBLA 4XNZB 2DYPD 4RWYH 2CKNA 3CU7A 1RMFH 3MRHB 1EFQA 4LCCC 1S7TA 2NY6D 3INUH 4QRPE 5D72L 3UTSB 2GK0B 4P9MH 5F1IB 4CU6A 2J3SA 5IVNA 2X2YA 1R5IA 4L4TA 4HXBH 4P9HL 4FZEH 4L9LB 3VXRB 1J1XH 1JRHL 1A7RL 4WTZA 4P4KC 5DJ6B 2EDHA 1H3VA 5EZLB 4P59L 4H20L 1IQDB 4IRSA 4N5UA 5BMFL 3R0MA 5I1EH 4XMLH 3I3EA 4UQ3B 5GJSL 3FAWA 3MLXL 3G08B 1KYOJ 4KRNA 2VXTH 4LNVA 1LE9B 5FF6A 1DBAH 1YECL 3OMZA 1TDQA 3MPCA 1Q9OA 4XI5D 1VESA 3RKPA 2DKMA 5FGSA 2Z93A 3WXWL 4EOWH 3TNNA 3OXSA 3EYOB 1Z0MA 1LNUB 4K3HA 1TCRA 3U7YL 3B6SA 2DJ4A 4AIZB 4G6JL 4GMSH 1F4XH 2PW2B 3V5KB 4HAFA 4LLQB 4XBGA 1KBGL 2XG5A 2Q6WA 3RA7L 3HI1B 5CCKH 3HPLA 3QXWA 2BRRL 2VYRE 2BFVH 1P4BH 3U7AA 5ISZD 2NW2A 3F6LA 3QH3B 4GKZA 1SYSA 1P4LA 2FGWL 1ZVYA 2DD8H 1K2DB 4PJCF 3HRPA 4YGVA 1DUZA 1PY9A 3EYQD 3HC0B 1QUNA 1S7RB 43C9A 3TT1H 3V4UH 4KROC 1RIUH 2WBJB 4P2YA 1MCOL 5BRZE 5T1MA 4YHPA 1XIWB 3ABZA 3T0EE 4HGKC 4XPGH 3MZGB 4QYOB 5FHBL 1AGEA 2NYYD 3KPSE 4NNPH 5TE6H 4NZRH 2WUCH 3Q2CA 2J8UB 3VWJC 3C5ZD 3MV9B 5FIEA 3QIBC 1BMGA 5CP3A 4LHQB 1A1OB 4HIXL 1RJLB 4MMXC 4ELKB 1QRKA 5EOQH 3L3GB 1XGUA 3MRMA 1DEEB 1AXTH 4P59H 3ZE0E 4KZDH 3MNZA 2GEEA 3FFDB 4KJQC 4N8VG 5IBTH 3FO9B 1I7UB 4Y4KC 5F9WC 1QSED 4LEOB 4DK6A 5H2BA 1UCTA 2BHYA 3I2CH 5GS0C 1UKQA 3U0PA 3MLRL 4UV7L 1QR4A 3TF7C 2CDFB 1RUQL 3H2WA 4JRWA 4XHQA 1AXIB 4M1CD 5GQBA 4ZODA 3RI5K 4XB8A 4FZ8L 1CGUA 5IMKB 3IKCB 3RZCC 1GCFA 5F7MC 2MHAB 2VABA 4KZEH 1U8HA 3IRZA 1G6VK 1ORSB 4G7YH 4XVTL 4JFPB 1UZ8B 5DWUL 4XI5C 3PWPB 2EIDA 4KHXH 4BKLA 4XAKE 3SOBL 5IG7B 4MD0A 4FP8H 4LMQI 4QRQA 1FRGL 4XGZA 4GG6F 2ZCKH 2H8PB 1NC4A 3OKOB 4ODTH 2EDEA 4JFEB 1RIUL 4ZAKC 1VFAA 3I02B 1F6AA 3QFJE 1J1OL 4P4RB 4OF5A 5HHMD 2V5YA 3RX7A 1LO3L 2P44B 3G5VB 4KJPD 3B2VL 2ZUUA 1FP5A 5BV7H 3STLB 1JE6A 4JO1H 5DZOA 2P8MA 3VDAA 1RUML 3M07A 4NQDB 4OT1H 5DD5L 4JY5L 2BSSB 1CR9L 1NAMH 1S9VB 4NNXA 1XGYL 2VN4A 1GZPB 5BS0E 3WNMA 3HZKA 2V9QA 3FO2A 5EO0A 1C5CL 4HV8A 5IBLD 4JKLA 4KDVA 2QADB 1WFUA 4YO0A 3E6FB 2KBGA 2J8OA 1QRNE 3OKMB 1E27A 2VL5A 3GMPB 1D5ZA 1MCNA 4HS6A 3O9WC 2IQ9H 2WLYA 5C0GA 3WUWG 3G5ZB 3NFPB 3TJEH 4LIQE 3IJYB 5IHLB 3NFNA 2OI9C 4EBQH 1Q9LB 4X7FC 4RCAA 4C56B 3ARPA 4PRNA 3OR6A 3SO3C 2VB5A 4XP1H 3T1FB 5C8JB 4WI2A 3LRSA 3MJ7B 3VWKB 1IC5H 3K1DA 3QNZB 4YFEA 1UACH 2OZ4L 2YRPA 1NCNA 3W82A 5EO1B 3MREB 4G8GA 4Z95H 2GFBB 4POZD 4PJHA 1WIOA 4PUBH 1K8IA 4NRYB 3PQYA 3MMEB 1IKNC 4HBQA 2IPTL 1PKQA 2YXFA 1J7VR 4ELMB 5J1TC 4A2MA 3IU4L 1JNNL 2V9TA 2H6PB 2Q7NA 2X4RB 1G6RH 1FO0H 5E2UH 3P30L 3T0WA 4N0CD 1CG9A 1W0WB 4QKXB 2P1YA 3WD5H 3OBAA 3IFNL 1MRFL 2IADA 3O6ML 1QNZH 3ROOA 1P9MC 3OF6A 5D7JC 1B4RA 4U0RC 5FYKH 3GB7B 4RA0C 5C3TA 4APQC 4OFVA 3EZ8A 4YGAB 4XC3H 3DLQR 5I17B 1W72B 4LSPH 4C56D 1A6VH 1UEYA 1OWRM 2AV7B 1J1PH 1SVZA 1KCUH 4OM0L 1S7QA 4HIEA 5DUBB 1LEIB 3EHBD 1AXSA 1JNHA 3UZEA 3OF6D 2P24B 5HGAB 1IMHC 4HCRL 1MIMH 2YA0A 3DXAA 1KUMA 4G7VH 3WNKA 4JFDA 5CBEA 1MCHA 3CNKA 5FKAB 1QO3B 4Z7UE 3OR7B 5E1AA 5I71B 1AHWA 1QBMH 3CXHK 3DV6B 5IB1A 4JFFE 3LEYL 5DZLA 4P3WA 4X7SH 4CMHB 3QUYD 2EH7H 3AY4A 3PL6C 3NN8A 4YQXH 4BQCA 2R2HB 4YDKH 4OLUH 1OP5K 1MCOH 5DT1H 2UWEA 3JWDC 5JHLL 1MI5B 5HHQA 5IUSA 3EFFB 5I1LB 3WV0A 1JF6A 5HDOA 1UH2A 4LAQL 3S5LB 4JZOA 3CFEB 4GRLB 2XWBA 5JA8B 2XWBB 4GFTB 3MGOB 5CBEB 3JWDH 1BJ8A 4PTUA 3FTGA 4KXZI 4MB3A 1S7UA 4JFFA 3MCLL 1KJVB 3TZVA 5D7SL 4KU1A 5EZOL 5K59E 2B8OT 2L4OA 2E9IA 4F57H 1N6QL 3AXLA 2VXVH 1PSKL 2IH1B 5FA3B 4F7MB 1JZ5A 1U8NB 4MCYA 5J57B 4GMTL 1DQTA 2R9HD 3QEQB 4LCIL 3P4OA 4O4YL 1MELA 1MY5A 1BWMA 2DQEL 5D2LA 1EV2E 5J13B 2RFXB 3UX9B 5A16B 1OPGL 3B2UD 1CFTA 3QDJD 4MCZA 5DEFA 1VA9A 1U8KA 4PP2A 1NCBH 1OB1A 2CKBH 3H9YA 4M1GH 4DFHA 4O02L 5SWSE 4WY7L 5GSRA 4PJ8B 4NQCB 1DBBH 3NMEA 3DURB 1PGRB 3GSQA 2AXFB 4OFYD 4P49A 1DEEA 5CZXD 1NFIB 1NFIA 3VWJD 3ULSA 4NFCA 4OZFH 4BFIA 5I1AA 2A77H 4IMLA 5DJZB 5D1QC 2X4UA 3PE9A 4HX1A 3QIWD 2E9BA 5BO1H 1WZ1L 1NCTA 5GISL 3L3DB 3O8XA 4MS8D 5GGUB 2VLJE 3BO8A 4TRPH 1CLCA 1C5DB 1JL8A 2VSDA 4UB0H 4YFLF 5I6XB 5D2LF 5F7WC 4D9QD 2ZPKH 1S78C 3MGTA 4OIIH 43CAA 4GQ9H 4J1UB 3SGDH 4OBSA 1C5CH 1CFNB 1ZHBA 5CBAB 3U6RA 3BDYL 4NNYB 4WI5A 4P5KB 3QIBA 4LPVA 5B3JE 3O3EB 3QUMA 1YEFL 1QFWH 3CVHB 3X3GL 1ZKAA 4CW1B 1KIQB 1NMBH 4OCSL 4FQIL 4PB0H 4FFYH 4JZJB 3T2NH 2X4UB 4V1DE 2J8HA 2EDBA 5C0DB 2R0LH 1PEWA 4UTBH 4F7CA 1PQZB 4IDLA 5KSAC 3KAAA 1JK8B 4M8QB 2CJUL 2V2TB 3OJDB 1S7XA 1BAFL 3MA9L 4KQ4H 5KG9B 1YEDA 2J4WH 1CBVH 2Q76A 3D6GA 5B22A 3SE3C 1WFOA 4PRAB 4WNQA 2YPVL 5ESVA 5TGBA 5EPMA 1P7KB 4WFGE 3BMWA 3DX8B 1Z3GH 4HJJL 1EJ6A 3DX8A 2IBBA 3QIBB 4TVPE 4X4XA 2MPAL 4W81A 5IFHL 1FNLA 1NFDE 1O7VA 3QEHA 5E9DB 3DO7A 1J12A 3EYVA 4GRLA 1HH6A 1ONQB 4PS4L 3SGEI 4JKWA 5JXED 4NT6A 3UAJD 4NWTL 2N4IA 3V5DA 4PRDA 4O5LH 2FX9H 2Q8BL 4FMKA 1KTLA 5FKAA 3PDGA 2R4SH 5D7LB 3HMXA 4X4MA 1MCIA 2AXGA 1INQA 4LLWB 4TUJA 2BNQA 3U36B 5CLWA 1HINH 3OHXB 4PJDF 1OAQH 5JO5B 4HXBL 4P9HH 3BGAA 1AGBB 4X4ZA 2Q76B 4OGYL 1QSEB 4P4KA 3ULUC 3MV01 2HLAB 3MYZA 3S3PA 4MVBC 2AJSL 4DAGL 3RTQB 2VC2H 4U1SB 3HKFA 2VKWA 3X13B 4KI5D 1K4DA 1HHIB 4GS7C 4LHJB 3SE4A 3ARGC 2BNRB 4FQLH 2P24A 3LKOA 4PGZA 3EGSA 5IMKA 1PY4A 3D39A 2J8UA 1IGFH 3LQZB 4HUUB 2DQDL 1DR9A 4Y4HD 3TWCL 3B9KC 2H9GA 5D2LE 2R1WB 3MGAA 1LEGB 4XRCA 3OG6B 3TP4A 3ZHKA 4WEMB 4KXZH 1F6FB 4P5MB 5IQ9A 1NL0L 5MP6L 4LSSL 2WIMA 4JDTL 1MWAA 3GJFK 5SWQB 5CLTA 4OGXH 3U2SA 3TN0A 5GGVY 5F8QC 1CLZL 3X11B 4LSVL 3GJEA 1TJIL 1G7QA 2O5YL 4W70A 3MLTB 4HFWB 1RSFA 4L8SA 4O2CA 4TSAH 5J12B 3PGFL 4E5XB 1S9WB 4OCXH 1ND0A 4A6YA 1MAKA 3JWDL 4GRWF 2VZ3A 1VFBB 2FZ3B 4YBHA 5E8OB 5HHXH 2DS4A 4I9WD 3VG0H 2I9TA 1FG2B 2Y6SC 3GSRA 2F53D 5E5RB 4LRIC 4BZ2H 5EC1B 3UXFA 4K7PY 3AM8A 1DUYB 4OZGA 4JFYA 2Y36L 3TA3D 3W5MA 4POYA 5CJ5A 3ARUA 3LZFL 1I8IB 4OD2B 4R2GB 3L3OA 2JELH 1MFEH 4G3YL 1I7ZA 4QF1B 3W0WB 5DWUH 1GZPA 3LH2H 1N7MH 2C3VA 3NTCH 5D2LB 2EZ0C 4LLMB 4UAOC 1T80A 4KGJA 5CEZH 4MZ2A 4X7CC 3PWUB 4X8XA 2V17H 3C5JB 3QEUA 5JXAL 4BZ1L 1IEHA 4XP4L 2CDEB 3Q1SH 3RP1A 2JB6A 4OF0A 4Z7VA 4NKDA 3FMGH 4K8RD 3NABH 3I6KA 4YPJA 3P0YH 2GY7B 3T0XA 5MENB 2CO6B 3V7AG 4X5WB 5JOPE 4OQTH 5DR5L 5EZLA 1BJ1H 3VGEA 4AENB 3UJTL 3M1BA 4WI3A 3V0AC 5C0DA 4HW6A 4L9LA 3AMKA 3G6JA 4P3DA 3VXRA 4NSKA 4JFHE 3A6BH 2N7AA 4N0UA 3CMOH 5DUPH 4PJXB 3DRQA 2W38A 4YHYC 4M6OH 5B8CA 2WZPD 4RNRB 2FWOA 3ZDZE 2R56H 1KN4H 4F7TA 3HZKB 4GQ9L 2APFA 5ESVB 2VDQH 2YPLA 3N1QC 3VXRD 4GRLD 3MBXH 1KXQE 4JY5H 4XCEB 4ZO6A 2BY2A 2A9ML 1ZGLM 1VEPA 1H8SA 25C8L 3E8UH 1KLUA 3U4BH 5LJYH 1KF9B 5GS1B 3KYKL 4K7PL 4U49A 1MUJA 4RDQG 3L3HB 5HTSA 1XF4A 1N5YH 1FE8L 1I9IH 3UJIL 5GRVL 1HHGA 3DARA 4IRSD 4CU8A 1DBJL 4Q6IC 2ATKA 3SDXF 3DYOA 3H7BB 1RUAH 3IS0X 3GRWL 2CUIA 3PDOA 4OZFG 5AAWA 2B5IB 4A6YL 5IVZA 4PJFF 4PRNB 1WBYA 1YUHB 2DQUH 4KUCF 1KCLA 3QYCA 3BWAB 1AGEB 4JO4L 5TDPA 3OWEA 1U8PA 2X4QB 2LABA 1NEZG 1BQHB 3CZJA 4M4RA 3PV6B 5D5MF 4F2MA 4HJJH 1Z3GL 4WFFD 4JQVC 4H5SB 1Q9KB 4M7ZC 2WQ8A 4M03A 1S7SB 1QA9B 2PYFA 2VN7A 4FMFA 2CXKA 1HIML 5HD8C 3CGTA 1NC2A 2DI9A 1E4KA 1XCTB 1CDUA 2HTLD 1OCWL 5FM5M 2ZCHH 2ATKB 4WFEE 3BN3B 5C86A 3VWJB 4NO5A 1HKLL 2HN7A 3HI5H 3J8F7 4N8VA 4X7DC 1OW0C 3UTPD 2NXZD 4YHZH 1FNAA 2AJZB 2ZSWB 1FGVH 4XXDA 2OXGA 3RWDB 4JFEA 3G5XA 1CIDA 4NOFA 2NXYB 1IGML 3HUJF 3C5ZA 5I66A 2DB8A 1CXHA 4I5BA 1WT5A 4ENEC 5ENWA 4U1MA 3HB3D 3U7WH 3JUZA 1BM3L 2GQHA 3RGHA 3ILPB 2WV3A 4X4YB 1NBYB 3KYAA 2IH3A 3V5DB 3FQNB 3RL2A 5HYSG 1A4KA 3Q3GA 3TJHC 2H2SC 1CL7L 1KJ2A 2R4RH 4PLKC 2EDDA 5KSVB 3ETBF 1IGCL 1JN6A 4GQPH 1DDHA 2GAZA 3EO9L 1C7SA 1HK6A 3SKMA 1AP2B 2E8ZA 3SKJL 4OLVH 2NY0D 5DRXA 2NY7L 4ZPTA 3KYOA 3IDNA 3SDAA 3BZ4B 2BNUB 2YBRB 4WI7A 2YSSB 3VFRA 4UAOB 5HYSB 3L5XH 5FYKU 3OPZH 1FGNL 4L3EA 3QUZD 4ZSOE 2EDQA 5FECB 2CIIA 2D7TH 2NY4C 2PYEE 5JR1L 4A6YB 1M6OA 2RAMA 1V3JA 2DBJA 3MV9A 4QRQB 4XGZB 4P2RE 3W9EB 3GSVB 3ZKND 2QADD 4Z5RA 3CH1A 5KTEH 3QCUH 2WNGA 4O4YH 4LLVA 1LD9B 1IKFH 1YQVH 2NTFA 1K3IA 5I75B 3I3BA 3O3EA 3UP1A 2DM3A 2ESVA 2QR0A 4O58H 4RX4A 4YZFF 3F7RA 4NQDD 3FN9A 4G6KH 2BCKB 4MWFA 3G5YA 1UB6B 4JFDE 1S7RA 2FL5B 3PHQA 4OJFL 1DQQA 5LGKA 4KK8C 3X14B 1WV7T 1KCVH 2FGWH 2V5TA 2PYEA 5FGCB 4NBZB 4NO0B 5DD1H 4LVNB 3SJVB 4KZEL 4AMKH 2VQUA 1IFHH 1C08B 2VR4A 3PWPD 1BIIB 3MRDA 2IGFL 3R06A 4FQXC 3X3FL 4QOKE 3RY5A 2DJUA 2ZG1A 1I3UA 1KB5H 1ZLVH 4Z7VF 4ONGL 4WO4D 5GRWA 1Q1JL 5DLMH 1G0XA 4QRUA 5DQ9A 1T0MB 1T0MA 4BYHA 5CIPH 4KUZL 3RVXD 1A1OA 3OJVC 5EFIB 4G9FD 1WFNA 3DVGB 2J6EH 2A83B 4RFEA 4YK4B 5D1XD 5FKPA 5LQBH 3T08A 3CLEH 3LKSB 1HSBA 4J7RA 1VFOA 4IRSB 1IAKB 4G8GE 1QLEH 4J2XA 1CICB 3QUXD 4Z9KB 1UJ3C 5EOQL 3KDMA 1Q72L 3VD4A 2AS5M 1MPAL 3KXFD 3KXFE 4NUJA 3PQYE 4X5LA 3HE7C 2WBWB 4PJ5E 5DD3H 3HZMA 1YEFH 4JPWL 2XXMB 4EI6A 2VLRB 4HWNA 4B7IA 3GSUB 3PQYB 2P5EA 4HMCA 4M6OL 4LL9A 4LLQA 1G9NL 1DBKH 4G9FE 1CN4A 3E2HC 1RUKL 3VRIA 1JPSL 2A0LD 3WS6A 2NCMA 5GSVA 2WIIA 1N8ZB 1ITBB 4PJ7A 3FQTB 4RISH 1FAKT 1WF5A 2XZQH 2Q86B 3CDCA 5MEOB 2VNCA 2DRUA 5IEKA 4I3SL 3LKOB 5CEYB 2H26A 3P9LA 1A9BB 5AG8A 1EK3A 1MLBA 4ODSH 3HI1A 3S7GA 4APQD 1CS6A 3FTGB 3PGCA 4AENA 1JWUB 3Q3GB 1OP9A 3TA3B 4J3WA 1IRAY 1IFHL 3T3ME 1Q9OB 1FRGH 1G7MB 3MLWH 2FX7L 3HG1A 5FDWB 3NH7L 2IH1A 1AR1C 1XF3A 4X7TA 4P5TB 4NZTL 1YEJH 3MRIB 3FFCD 4RNRA 1GGBH 2R2HA 4HAGA 5F96H 5AG9A 5HHOD 5SWZB 1U3YA 3KPRB 3L7FA 3ULUF 4TSBH 2F54E 5A16A 1G6RL 3P11L 3BW9A 4TVPL 5DA0B 4DCQB 5DRWB 3HG1E 5HHPB 4HMEA 5E8NA 2RQ8A 3W9DA 4OCYH 2YUXA 4Z76B 4OLZL 1U8MA 3MYJA 4LARL 1NEUA 1XZ0B 2MSPA 2LQRA 4EOWL 4JFED 3RVWD 2AW2A 2DWEB 4UILL 3HNSH 2OP4H 4LK4A 4MLIA 3HE6B 3CC5A 5FGBC 2A6KB 1KJ3L 3IXTB 4M5ZH 1NCAL 1BEYL 1KCSH 2HWZH 2FIRT 1W72A 4KDTA 1W72L 3IETA 1J8HE 2BSED 3PV6A 1BQUA 2QEJA 1J05A 2WP3T 1F3JA 4JPKL 4ZOBA 3GBML 3D0LB 3BRDA 4QXGL 1T89A 2ZSVA 2K1MA 4JFQB 5EIVA 1GOFA 2XA3A 3UO1L 3IGAA 1K5NB 2Z9TA 4O51B 5I74C 1BFOA 1IC7H 5DJZA 4LEOA 5D7IF 4XH2B 1QFHA 1CI5A 3N50A 4QRPB 3BEVA 3BPNC 2WBKA 3MTRA 4OV6F 3TWCH 1E6OL 5C0BE 3FB5B 4L9DA 1EO8L 1ZHNA 5E9DE 4H0GA 4JPIA 4P2CG 5F7EL 4JG1H 5CWSA 3MUGB 3REVA 5MEPA 3VXSA 3C60C 1PD6A 1R3KA 3DETD 4JDZA 4UTAH 1DLHB 5E00B 1HCFX 5HDLA 1NUDA 3Q6FB 2XQBL 1B6DA 1OY3B 5IVXF 5J11C 4LSVH 5KVMC 1RK1B 1A14H 1IC1A 4GRWE 2VERN 5EB9A 3S96A 4R4FL 5IGXL 4UV7H 5EDXA 5GJSH 4OF6A 4Q0XH 3FOMB 4XCEA 1UQSA 3CVHL 4X80H 4EDWL 1MQKL 3MLUH 4MQ7B 2CJUH 4GMTH 4GSDL 3O8XD 4CGTA 5HYJD 1OP3K 4PJBB 4JFXA 2FL5A 1PG7L 4YXHL 4YHZL 4UMGA 4TPRH 3BI9X 2BSSA 5ANME 1QBML 3M1BB 2GI7A 5SV3A 1OD9A 1G9MH 3VI3F 1X5KA 4Y2DD 4OI8A 3RY6C 5JUEL 1YY9C 4DKEH 4PJHB 4DTGH 4XPFL 4M48H 3MOAH 2AJ3B 5F1NA 3B6SB 5JPMA 1A7PH 4G6MH 1LNUA 4KC3B 4KJQD 3S97C 4HGWB 1S3KL 1GAFH 1KIPB 1OAYL 2RHEA 4KJPC 4LDOB 5BQ7A 1H3TA 3MFFA 2DKSA 3V8CA 3ILQD 4PJ7F 5C0BA 3BKCH 1FZOA 4XHJC 4KQ3L 4YX2L 1JK8A 4M8QA 5C0FA 1WZ1H 5CGYC 4Y5XA 3ULUH 3TESA 1T83C 3O6MH 3FCTB 2EIEA 4KKAD 4RGNB 1JZ4A 1W0WA 1C7TA 2A9MH 4PV9A 2F8XC 1MRCH 3R1GL 4FA8A 1U2CA 4N8PA 5KANI 1ZOXA 3FQXB 2EDYA 5A40E 5D7JB 1JPTL 2FIKA 1XF3B 1KIPA 3EYSH 4KK9D 4X4ME 3WLWC 3MNVA 3QSKB 4NWUH 5L9DH 4U05A 2PUQT 3KJ4C 4U1HA 5IW1B 1RFDL 4Q7DA 3D69B 4Z7WA 4LSUH 3DBXB 4HKJB 3SE9L 3MLZH 3S3SA 1XGUB 2MQCA 4G43A 1IGJA 3HFML 2Z92B 4I8DA 1IKFL 3GBNL 3V6BR 3ARED 4Y88A 1D5BA 4OM1H 2ICES 1KIRB 1NGWB 4U2ZA 1KIRA 2I26N 4KI5E 3D2UD 4OAWA 1XGTA 3TBYB 3FO9A 2CGRH 1JGDB 2APBA 1ZLWK 4FQ1L 4HUMB 1XIWA 4X98B 1PX4A 3KPRD 2DTMH 2B0SH 5GGVL 1L6ZA 3PWLB 1G9NC 3DI3B 4G9DB 4I48A 3V7MA 1T6VN 3QDME 1U8PB 2X4QA 4R97B 5TDNB 4XT1C 2X1PA 1YPZE 4KTEL 3K8MA 1WISA 2IPUG 1EEYB 5EO9A 4F37F 1MCJA 3O9WB 1FGVL 3WE6B 2R1XB 1F3DH 1X7QA 4K8RC 5TDOB 3U83A 4CN4A 4JO1L 4BJLA 4KH2A 4I3RH 4NDMA 4MAUH 2HFFA 2PCPA 1KTLB 4MCYB 3QO1B 4YUEH 1DFBH 4KKLC 3U0TA 1S9XB 5F7DB 3HHRB 1JVKA 3VG9C 1JPTH 3ISWA 1FZKA 2GTZB 3VWKD 3EYSL 3K0WA 3OGOE 5I6XC 1T1XA 1KT2A 3OZ9H 3CMGA 4Y4HA 4Z7WE 5I16B 3RPIA 4FQQB 3SCMB 1JNLH 1YN7B 2DQIH 3WFZA 4QRRD 2NY2B 4P48A 4F8TA 4X6CB 4NNPL 4HS3B 5TE6L 4U6XB 3FOLA 1IZKA 2NLJA 3F62A 5FUOL 2CMRL 3RHWK 1IGMH 3FHAA 2ID5A 3UYRL 5ACLA 1A6TB 4PJAA 5E8DL 5C70A 1H3PL 3H9ZA 4F7TB 4KK6D 2GKIA 5KVDL 3HTLX 4XX1G 1TVHA 2FEEI 3TFKC 3OKEB 4QLRA 1TVHB 4JQXA 3ZT5A 3WIIL 1X5HA 3T04D 2QTEA 1GPOH 4BZYA 4NWTH 4TUKL 4YC2C 2A6DB 2BOBA 3ARFA 2V2XB 3VH8A 4LVNC 1BQHG 2QSVA 3P73A 4UINH 1R5VA 5FO9A 2JB6B 5J1SC 3IU4H 4K3JH 5FK9B 2VLJA 5D9SB 3C60A 3F5WB 4U1KB 4TUOA 1QSFB 4NIKB 1OP5H 1VSCA 1CL7I 4U1LA 3FOLB 5TPWH 1IAMA 3VXSD 4KRPC 1C5DA 3BDXA 4J12A 2R8SL 4HIHB 4MJID 3MBED 2O5XL 4PJXF 5IV2B 3GRWA 4Z0BH 4Z8FH 3LOWA 4NQVB 3I50L 1EXUB 4POUB 4ORGB 4J1UA 4NQEB 4A6YH 5T5FH 3NCYP 4KKLD 3BEVB 32C2A 2YK1L 1JF1A 3IDGB 2V2TA 4P5MA 5IQ9B 5CHNB 3MO1A 3WNNA 5D1XC 1QPPA 2GJ6B 1U2HA 4GKNA 5FYKD 2GY5A 2NY4D 3QUZB 5GRXG 2IALA 2M26A 1CD1B 5KANG 4YHMH 1S5HB 4LFHD 1TTFA 4WTXA 1MRDH 3IDJA 1NGPH 1FYHB 3FQRB 3V5KA 3V0VA 1U58A 1I1AA 1WQVT 5FGBA 4K71B 5BO1L 5KVDH 1GXEA 5T1LD 1R0AH 3MRBB 4Z7UA 4HIJB 5CP3H 5HDQL 3L5JA 5EWIH 4UV4H 3MBEB 1A0QL 1FVCB 2GYSA 3ORJA 4C59B 1H0DA 4I13B 2C5DC 5KOMC 1D9KA 1NDMB 1PG7W 5EG6C 1CE1L 3WFCL 3WIHH 4W6WB 3A67L 5CJBA 5EUKB 3ZYOA 3X12B 4CN1A 4KI5C 3ARSA 5JPNB 1F2XK 3WUWB 4BQ8A 5IFJB 1E28A 2DQTH 1T1WB 3C8HA 2HT4D 2IQAB 2EEAA 5E6IA 2FATL 2XZAL 3MJ9A 5D7IE 1BLNA 1TCRB 1PW3A 1KULA 5DEGA 4CVWA 1TZHA 4N0YH 4R7NA 5JHDE 1A14L 4Y4FB 3FQUB 2QADC 1WFTA 4QRRE 3K74B 5D7KE 1BQLH 1YMME 1A7OL 4NQCE 5AZEH 1XF4B 2NY7H 4GW4A 4ZS6D 1S78D 5J06A 4QOKB 3MLYH 2AEPL 5AYQA 1OF2B 5EBLA 3LMJH 4ODSL 3UBXA 4ONHB 3P11H 3QIUC 2FECL 4L8CB 4V1DA 3UAJC 1H5BA 2IPUK 1HZHH 5C0RL 2D03L 1S7VB 4X6CF 5GIRB 3QZWA 5BV7B 5JUEH 4R90H 1UKTA 3MUY1 2QQLH 2NYYC 2CR3A 2WK2A 4XWGL 4D3CH 4Y2DC 1JGLH 1KC5H 1RPQA 3C60B 3F5WA 4U1KA 1MWAL 1UJ3A 4PJGA 5FB8A 1LGVA 3GMNB 5FECA 2WM0A 1ZAGA 4U6YB 1QR1A 1RVFH 3UYPA 1T20A 1KNOB 3CFKA 1AY1L 3RWFA 1SJXA 1UWGL 2OSLA 3BH8A 2QSCL 1XR8B 3AREA 5I19L 3BPNB 1TNNA 2FDBP 4YFLI 5DVKA 4W4OA 2X4SB 5FYKL 4JRYB 1T89C 1T7XA 3QUYA 3DX9A 4LEXH 4U7SA 1MNUH 3MRQB 3CK0L 4MQ7A 1JTPA 5HYJA 1FIGH 1CE6B 3MRPB 2VIRB 3SGJA 4UILH 1HSAA 3RL1A 3MQIA 4Z7WF 5T3XH 2B4CL 4FFVC 3FRPA 1BP3B 3WFDH 1DLHA 3O2DA 1OM3H 1Y6MR 5DTFA 3MXVH 3HS0B 3N85L 4ZFZA 4N1EA 3TBWA 4H8WH 3U4AA 1ITCA 3BD5A 4P5KA 5E95B 3EDDA 1P4IL 2WINB 3IAGC 3HRZB 3HZYB 2X9WA 3MRJB 4X6FA 2H2PD 1P5UA 4OZGB 2JB5L 4QT5B 4QHLA 4EUPG 2HKHH 3LKNA 1KTDA 3BVNB 5ETUB 4JY6A 5B3JF 5C0GB 4M7JL 3LSOA 4NUGL 1ZVSB 3QG6A 4NQEA 4L4VB 1V7ML 3UJJH 1ZANH 4NN6B 2PW1A 3DX6A 4QWWC 4R8WL 3T4AA 4Q2ZA 3SDCD 4EN3C 3D5OF 4YHOL 4LBEA 3B8SA 3OXRA 1IEBA 3QNYB 1T03H 2CK0L 3MUJA 1R3IH 4UBDC 4MJIA 1BECA 2GCYA 2F9BT 3B2UC 1OSZB 1R3KB 5DYOA 1FPTL 2E9JA 3QFJD 3RZCB 3S88H 4WFED 3IYLW 4H26A 2PN5A 4GSDH 5MERA 2EDRA 4K3EH 2VR5A 2LU3A 5CJ8A 4U6HB 5I19H 4HBCH 4HUVA 3JV5A 5F72S 2V5MA 5C09D 3ARGB 5I8KL 1I3GH 1NKOA 3MBEC 1J88A 3OKEA 2NTFB 1I1YB 4JRXE 2CSPA 4N5ED 4NN5B 5BRZD 3KYMB 4PV9B 3LDBC 5KSVA 5FYJH 4OZIE 2FR4B 3KR3H 3GUTB 2AERT 3BKMH 1I4FB 4QRPD 2BCKA 3VCLA 3FFCA 2YWZA 2J1KA 4EVNA 3RRQA 5JDSA 4OD3H 2RCSL 1M7DB 3GSXB 1X6LA 2EDFA 1BBDH 2KZWA 3ALWA 5DJDA 4HHAB 3RNKA 3ZKXB 3WD5L 2R0ZL 5E5MB 4YPGA 5ALCL 3KPRA 3L7FB 5I30H 4ZS7L 2DM2A 2ZKHL 1EIBA 4XNMA 2LTQB 2DQIL 1Q9WA 3QO0A 5MEQB 4BH7A 3ZKXC 1CF8L 3WNOA 4LSSH 1J10A 1AR1D 2DBLL 1W8OA 3LQAH 4X9HA 3NIDF 5JW5B 3BUYA 2N7BA 5DO2C 5A2IH 4HGMA 5GGTH 3AMLA 1A1MB 4Z7NE 2C3HA 1YECH 4P2OB 2VXSL 1FG2A 2I60L 4OF7A 4HZLB 4BELD 1CLYL 2DQHL 4Q58C 4Z78A 1CICA 4Y5VC 3BQUD 2ZP0T 4HH9A 1DSFL 3S88L 1PBYA 5C2BL 3QUKA 1KV3A 5H2BB 4R3SB 4QNPE 3U0PB 1DBKL 1SEBA 5EOCJ 4R4BB 4BUHA 3BQUC 2B4CC 3MLTA 35C8L 4HFWA 1Q9WB 1QPXA 3CFDB 4R2GC 2FJHB 3LN9A 4NRXA 3RWDA 5IOPA 2WUBH 1VDGA 3IKKA 3O3DA 3VWKC 2CDEA 3VFWB 5F3HA 2FNBA 3JV0A 3FONB 2PCPB 4OZIA 4C55A 5J13C 4C4KT 1TQCC 1K8DA 3ARWA 4E41A 1F90H 3IT8D 1RFDH 2FH6A 1NDMA 3AS1A 4WCYL 4XAWH 4HPYH 1EEUA 3DXAD 5C0EB 2QHRL 5DI8B 1HILB 4N8CL 3ULSB 4BFIB 3VE0A 2I27N 3LSOB 3KLSA 1FNFA 4NZTH 4QWWD 5INDB 1C1EH 2GJJA 2YPVH 1ZSDA 5K9OA 3MR9A 1DE4B 1NUGA 2PKDA 1ADQL 4JRXD 4LHUB 2IBZX 5DGQA 1AKJA 2E8YA 5E8PA 1RK1A 3ARFC 4IOIB 1T2XA 4MAUL 1FC1A 2IBGA 3GSVA 3S36H 4TOYL 1YEIH 1EZVX 3UJTH 3O2DH 1A2YA 4XNYH 5HHOE 3LRGA 5BS0A 3I84A 3PQYD 1M4KA 4NRYA 4S1QH 1RZJH 2ATPA 2E7MA 1VGKA 4G8GD 3ARGD 1XMWA 3QFJB 3RZCD 4QXTA 1I9RH 2IEPA 1URLA 1CD8A 2F5BH 1LD9A 2DI8A 1CE1H 2JJSA 2AK4D 4PJ7E 5ITFA 2VAAA 2V5RA 2VZOA 3TH3T 4JN1L 4XPFH 3RGVC 4I0PD 3SDCB 1P4LB 2R0WH 5GRJL 4D8PB 1VADA 4K8RH 1P6FA 4DKAA 4NCC1 5JPMB 1I1FA 4IOFC 3DRQB 4UT7L 1GAFL 4R0LA 5I1HL 3B5GA 3SGDI 2D7PA 3RNKB 1DQQB 3N9GL 4XNQA 1UA6L 3QEGH 4XVSH 3ZMRA 1JV5B 3GO1L 4OUUA 3RU8H 4U6XA 3OZ9L 3BKYL 2EYSA 5I15L 2DYPA 4NQED 4RBPK 1J0KA 2LU4A 1P4IH 1YEGH 4S2SB 2ESVB 3ZTJG 1AGCB 5HHNB 2X4NA 4LRIA 2P8PA 4JR9H 1G7LB 4TQEH 4PJBF 5E8DH 1ZT1B 1KYOK 2VR9A 5BRZB 1TIUA 3SO5A 3G6JB 2VDNL 4UDUB 1VPOH 4KMTL 3JTSB 3UTOA 4FQIH 3Q5YA 1A6UL 1N6UA 4QGYA 1KJ2H 4CL7A 3WIIH 4RGNC 4PJ5A 4U7MA 3G9AB 1D5XB 4S1DD 3A0OA 5DMKA 5C0IA 3WXWH 4Y1AB 4GW1A 1OAUL 4PJ7B 3H42H 1G7QB 2CDFA 2HT4C 4M93C 1DN2A 1Q9KA 2GJ6D 2X4PA 4GO6B 3D1MC 4X80L 4EDWH 1EJOH 1Q0YL 3A6CH 1KB9K 4EIZC 1L9MA 3BVNA 3FFDA 4JM4H 1P5VA 5I76B 3RL2B 2W9EL 3PJSB 1QO3A 2XQYK 4LASL 2SEBB 2AXJA 4NUJB 4KI1A 1DBBL 5IVOA 1ZT4A 2BXYA 2PXYD 2MCPH 5CEZL 5BW7A 1L0XA 4FS0A 5F9DC 3O41A 4YWGH 1SEQH 5J7CC 1J0IA 1NMCC 5GRUL 5BV7C 15C8H 4F2MB 2G5BB 4YHLH 3PG2A 5HGBA 4Z7WB 5FHBH 2AJUH 1GIGH 1I75A 4ODWB 2AJXH 3EYQC 3DVNB 4X6EA 4RZCA 1JHTA 3FT2B 4W6XB 1ND0B 2DIJA 2YD9A 2VLKA 3AAZB 4KV5F 2L0DA 3PNWB 4AEIH 5E1HB 1B2WH 5EU3B 3E3QE 5DF0A 4LLVB 1BX2B 5DQDL 5J9PA 1CDGA 4PLJC 4OZGF 1INQB 3MRFB 3VFUB 1KNOA 3WHXA 3RVTC 4HZLA 5J6GB 3P2TA 1ED3B 3QDMB 2IG2L 4OGZA 3K4DA 3UZQA 5EOTB 3D0VB 2R56L 5SWZA 4NQEE 5I1LA 4NZUL 3CFDA 5KS9F 1T2JA 5ESQA 1GGIL 2HRPL 3QWRD 1I9JH 4MXQC 3MRDB 4NOBA 4PFEA 3AGVA 1U91B 3HUJA 3T0AA 1TJGL 5T3XD 3WNPA 2ERJC 1KJ2B 1PFCA 3IJYA 5C9KA 5DT1L 4W4OC 2JJWA 5J1AA 1MI5E 2FB4H 4EKXA 3V5HB 3BN9D 3VXPB 3IXTA 3TV3L 2BRQA 4OZHA 5AZ2L 2D3VA 2DQJL 4RFOL 1CICD 1IEAB 3QUXB 3SDXA 3PGDB 4TSCH 4EZMA 1ZEAH 3Q6GH 3ULUL 1YMHA 4FHBD 1F4WL 4MQSB 4RA3A 4K7FA 3TT3H 2ED9A 5LXGH 3OKNB 1DVFA 2OQJA 4L1DA 3EOTL 1MHCB 4YHKL 1V3LA 5E56A 3VGAB 2Z8SA 4WI6A 5FK9A 2HMIC 3BRGC 4DEPB 3H3PL 3IJSB 1YEKH 3TO2A 3EOAA 2GSGA 5IIEA 3PP3K 3I75B 5DJYA 1MF2H 1Y6KR 4X6BB 2BMKA 1KC5L 1S7WA 4Z7OE 3IDXH 3DUSA 5HYQA 2A38A 3DVGA 4RFEB 5FKPB 3W5NA 2BVYA 4MD0B 1QACA 3FN0H 5HHNA 3HCVA 4IMLB 5JOFB 2KZ1B 1ACYL 1KJMB 2APTA 1G9NH 3QO1A 3PJSA 1ZHLA 4NHUA 3WKNA 4L8DB 4O02H 1PQZA 1LP9B 2DF3A 3NIDE 4H8WL 4TULH 1DE4A 3MR9B 1DSFH 2PXYB 3H6JA 2X9YA 3QFDB 2UUDK 4M02A 2H1PL 3D87B 4JM2C 4LEXL 1AIFA 35C8H 2DLGA 5D7JD 2JJTC 4QHKJ 3U1SL 4M7JH 4FQ1H 3QEGL 4XVSL 3MA7A 4P2OC 5GSVB 5F70A 1AGDB 2OTUB 4HWZA 4Z7UB 1ZHBB 2W65A 4HWUA 4N0CC 4Z0XA 2J2ZA 3QPQC 1NCWL 3QWOB 5DC9B 1DLFH 1VFMA 2GT9B 2X70A 2CRYA 1OGTA 1U58B 3GSOA 3QCUL 4P0DA 5B38B 3NH7H 5DD0L 3TVMC 4JZJC 3U79A 1QVOA 1NEZA 3E2HB 4PJIA 5ETUA 5C08B 1SY6A 4KHTH 1ZT1A 4PRPD 1S5IL 2H9GB 4GAGH 4PY8I 5HHXL 5HGDA 4MQXD 1F4WH 4XP6L 1FVCA 4KK8D 5JO5A 4XPTH 4NM8L 3R8BB 1QLFB 4M7KH 4H1LG 4P23C 5F3BB 4XNUH 4G8FB 1D5XA 3FCTA 3UDWC 5DK2A 4ZDHA 3X13A 3O6LH 3PL6B 1N7ML 1KTRL 5I0ZA 3TBVB 3O9WD 3HC4L 4G8EB 3JWOH 4NM4H 1ZT7B 4LP4A 5JLZA 3AXLB 3WFHA 4WWKC 1CK0H 4GUPA 1RURL 1MCDA 3ZE1E 4G9FA 4RGND 1UWEL 4OAWB 3T0ED 2NXYD 3DV4A 5EBLB 3ESUF 2ZKHH 4WV1A 4LLWA 4HUXA 4F7EA 2F74A 3MZTA 1IGJB 3TPUB 1HHJB 1CGTA 1ZLSH 3DGGB 5IFHH 5GRVK 3SQBA 2V2XA 5FA3A 3QCVL 5IOPB 1IM9D 3MLSL 1JPGB 4DGYH 4LLYA 5C0CB 4KRPB 5CGMA 1FNGB 2OMNA 4DEPC 5CSBA 1MI5A 4F58H 2VXSH 4PJ9C 1Y0LB 5FUZH 2OLDA 1CFBA 3FO0L 3N1PC 1RZKL 1AO7A 2OK0H 3TIDA 2HJKB 5TPWL 2HFFB 4RISL 1JIBA 5F1SA 1CF8H 4JO2L 1A3LH 3CK0H 2A1WH 2H32A 3WFBL 5HI4C 5DHVA 2FX8L 3WLWD 3DRTA 3I50H 5SX4H 2EC9T 1MJUL 2IG2H 1SHMA 2GTZA 2EICA 5IB5A 3LKSA 4KMLB 4XMKH 3BYTA 1N59A 3GFUA 4H8WC 4J3UA 2EYRA 5IM7B 4EUPH 1RU9H 3TGXA 4ODXB 1CLYH 2I25N 1QQDB 3VFOA 3GJEB 2FX7H 4H1LB 5C09A 4EXKA 4M1DL 1WBZA 1NBVH 3NOIA 5AUMB 1AKJB 1S7XB 3C5ZC 4HDIB 2JIXA 3DXAE 3H42L 1VGKB 4Y4HB 4QT5A 3UYRH 5CD5D 2BHUA 4XBPA 2W0FA 5FOBB 2AI0L 4OBRA 1WIUA 1R6VA 1OTSD 2FJFB 1U95A 1Q9LA 5CSGA 1HYSD 4BSJA 2CK0H 5KVFH 5F88B 1GOGA 5B38A 3MLSH 3BMVA 3BGMA 1YQVL 4WDIB 1K9TA 2VJXA 1UT9A 3NZ8A 3D18B 2P7TA 2G5RA 4KK5C 5C6TL 3O2WH 4HJGA 1EA9C 5MEND 4UB0L 3P4MB 3K4ZA 1YPZB 4P46D 4CBPA 3VWKA 2OK0L 3LEVL 2DJSA 3B8YA 1UWGH 1DFBL 3HPLB 3SDYH 5DJ8A 2ZOKB 3MROA 3PWNA 3S4SB 3VI4E 1CDCA 5EIIB 1GGCL 1QRNB 2QLVB 3WDIA 2GT9A 3ES6B 1TJHL 5JZ7D 2DIBA 1FL3A 1FIGL 1AGBA 1RU9L 1YYML 4FQHB 3CSBA 4XB7A 5D2NC 1OAKH 3KGRA 3OKLB 2Z8RA 3QH3A 4N1CA 4YHIA 1E4XH 1E6JH 3LN5A 3GK8H 1N2RA 2QQNL 3ZYIA 4KUCD 4O00A 2GITB 2A74B 2W91A 5L2KE 2QKIA 3LKQA 3O4OB 4UTAL 1MHCA 1SQ2N 2DIAA 5HYJE 4GXUM 1DVFD 4PY7B 3U1SH 4RRPA 1D9KC 1X6NA 3H8NA 4PRHB 4I0PA 2LVEA 1U3HB 5LCVH 1LO4H 5D93C 1KPVB 4YIQA 1IBGH 5E4EC 4BH7B 3CXDL 3T3PE 3ZLQC 1SYVB 4WU5B 5EBMB 1JGLL 5IB1B 3N1MC 2P8PB 1ZLUH 3WXVL 1F11A 2NNAA 3QG6B 3L7EA 4EXPX 1M7DA 3GSXA 4JANA 5D7LA 3UC0L 5F71A 4RMQA 5AZ2H 5L2KA 3VWJA 3RBSA 2QSCH 2IQAA 3RUGB 4LCYA 1L9NA 4MXVF 3D48R 4Y5YB 4HIIB 4R0LC 2GCYB 3S34L 5F3BA 5F97E 4M6NH 5EUKA 3QDJA 5I66B 4LSRL 2P5EE 3E3QC 4D9LL 5EU3A 2G2RA 2DQEH 5D5ME 2NY2C 2OJEB 3SOBH 1IGYA 3ARZA 3P77B 3PXHA 4PGDB 2R2CA 1A5FH 4HUVB 5EU4B 4WRLA 3RBGA 4X6EB 2A6IA 2DLFL 5DRNA 4YEEA 1PAMA 4QCIB 5FA4A 2GTWA 3RTQD 1HDMA 2CDGB 3BPCB 1TMCB 3VD9A 4UBDD 2EECA 3BIKB 3LKNB 1SY6L 1DQDH 2R1WA 3TBYA 1KXVC 4J4PA 4NQCA 3BD3A 1NGPL 4PJ8D 1YEHL 4LQFL 5E99H 3LPWA 2R23A 4K9EL 4R4NC 4OI9A 1TVBA 3OXRB 2Y4SA 5SX4I 5F6HJ 4YC2B 5DEGB 1YY8B 3CLEL 4ISVB 4BUGA 1EAPB 1JMZA 3GMOA 3LCYA 3IETB 3SEPA 2AV1B 4P5TC 1FVDB 3MRRB 3QIUB 3QEQA 5CILH 1ZSDB 1U8JB 1YC8A 3NA9H 1IGYB 1IAOB 4ZO9A 4AH2A 4E5XA 1FYTB 1C8PA 2VQ1A 3K3QA 5FYLE 4ONFH 1LEKA 1NCWH 3AREB 4O51A 2NX5D 2DQTL 5C0EA 5JIPA 3VFMB 1AY1H 4NNXB 4IBLT 4IMKC 5C07B 1O0VA 1J0ZA 3FN3A 2W0FB 3W2DL 1OF2A 3NFPA 3GMNA 4L4TD 3VRLE 2YD1A 1U6AL 1MRCL 3R1GH 1C16B 5IJVA 3EDKA 1TQCB 3VXMD 2I5YL 3WIFB 3GMOB 3V4UL 3BQUA 2EDLA 1SBBA 3JTTA 4NRZA 3LH2L 3VD7A 2YOCA 4JRXA 4NJAH 2YPLB 5DK0A 4ERSH 2FB4L 1MI5D 7CGTA 5CAYB 4XP9L 3IB4A 1B0RA 1YNKH 2APXA 5IIEB 1C08A 1SJEB 2R1YB 3EO0B 4PJEA 1T04B 1T20B 3CFKB 1FFNA 4LCWB 4NZJA 5KAQG 1AFVL 3RX5A 1PLGH 1MVFA 3PWVA 1FO0L 4C4KO 3BSZL 1MLCB 5CEXB 2P8LB 2HVJA 2P8LA 3GM0A 4C56E 1L7TH 1T2QL 2D2OA 1II4E 1LWRA 3OKKA 1CLOL 1AGCA 1MAJA 3BZFA 3L95A 4XPAH 1DZBA 3ARBC 3I85A 3C6LC 1FZMA 5ICZA 2J88L 1T03L 4P23B 4Y2DB 5I8OH 4FQXB 4H20H 4KTEH 2E9WA 3MJ6A 4ZUWB 3G6JF 5CKAA 5EUOA 2E7HA 3OJDA 5KZCD 5CD5C 1T7YA 1Q0YH 1YEEL 3D39E 4OQ1A 5F9JA 4MD5A 5JIKA 4B7LA 2Q7YB 4G6KL 2VITA 3TIEA 1MVUB 3QJHB 1HHHA 8FABA 3FQTA 4MVBD 3NACL 1Z9MA 2WUBL 5IHUH 1H0DB 2NXZB 4HF5L 1FL6A 4Y4KD 4QXTB 5DRNB 2N56A 3ARGA 1TETL 5FUCE 4NDMB 2D4FA 3KYNA 3QHZL 4JCMA 5JPNA 1CGSH 1X5AA 3CSYA 1E28B 2FSEA 1OTTD 4XRCB 3QUZA 4UOW1 3VU2A 1ACYH 2QHRH 4XBEL 3MRCB 1D3CA 1T83A 4YEFA 1CFTB 2GHWB 2JJTA 5GGRA 3MUHL 1B3JA 3EGSB 1HHKB 1YNLL 2ICCA 3TH4T 5CJXC 3HMWH 1FVDA 3MRRA 3U4EA 1NPUA 1R5WA 3UPRA 2CKBA 4PJHF 1QRNA 2XQBH 2VLMD 1FL6B 1OGTB 2C4XA 1F58L 1QSFD 1UM6H 1ZWIB 4NN6C 2MPAH 3BE1L 5KSAD 5JA9A 2WWMD 4K55A 1ZV5A 2OM5A 3WHE1 1HE7A 3GIVA 5IBUB 4GG6A 3QUKB 5AWNL 4PREB 4XPBL 3CFBA 7FABL 2HT2C 4BZ2L 3EO1B 3VGBA 2W9DH 4LAJH 3GSWB 3DYMA 2MWCA 1KEML 1EGJL 1G7IA 4PLNC 3VH8B 5HYIA 3ARDA 1XF2B 1CZ8L 1OAQL 4ZNCD 4ODXA 5IT2H 2UY6A 4DQOL 4MGXA 2V7NB 5HDBF 2YRZA 1VKXB 3Q5TA 1E0OB 2CLRB 4KJYA 5DJXA 5D1QB 1Z6JT 4JM2F 3VRLF 4M5YH 4HPOH 4G7YL 4XVTH 3NAAL 1JUFB 5IV2A 2AABH 4YXLL 1NC4D 4LPXA 3RU8L 4XPHH 2D31A 1CGSL 1XZ0A 3G5YB 4ZQKA 2RR3A 5IFAL 4OZIB 1R5IB 1TZGL 3C08L 4UT6H 4X5XA 3LPFA 2XTJC 4X5WA 1CXLA 2B2XH 4P2OD 5F7NC 2K9UA 5DRXB 2H8PA 5JW4M 1YNLH 5GGTL 1RZ8A 4PJBA 3JBG7 1YDPB 4WFHE 5IM7A 4JJHA 1QEWB 4JM2D 3PGDA 1LK2A 4RMSA 1VKXA 5TGBB 1CFQB 2F5AL 5D1QA 3NPSB 1P1ZB 2EYTB 2Y06L 4N0YL 3QQ4B 3MV9E 4M9OA 3NZHH 1NBQA 3IFPB 3TNMA 2WP3O 4LSTH 1BEYH 1HILA 5C1MB 5F1IA 2CMRH 2UWEF 2YN5A 3UTSA 4YNYA 4ZAKA 1BX2A 1KN2H 3WSQH 3CUPB 3HR5A 5JNYA 3E8UL 3FKUS 3P9MA 1MCPH 5MEOA 1BFTA 3KLAA 2BFVL 3MLYL 3CVHA 4DN4H 3PABA 4LLUA 1L7IH 4YQXL 4IOIA 2ITDB 1AQDA 3D25B 4CDGC 2XG4A 3OSKA 2AV1A 4MA7L 2DLEA 1IC5L 4NKOB 3KPSA 1QOKA 5C09B 4P57A 2QSTA 2BVEA 4DOHB 2G5BA 4GOSA 1T1WA 3H9SD 4HPYL 4KDWA 2WBJD 2IALB 1QLFA 3TEUA 4PJEF 1S9YA 5DURD 1OW0A 5J6HB 4APQA 3GJFH 4JFOA 3O11B 2OMBA 1FLTX 1KXTB 1TZGH 5FOBA 1GYAA 2AJUL 3PNWA 4XP6H 5ALCH 1AO7E 4W68A 1LP9F 5TE7H 1BPVA 1JF1B 4P2OA 5F9OH 3MMEA 2E3VA 4PG2C 4WO4B 3P0YL 1WZMA 2IADB 1HZHL 3V6FA 1P7QB 4XWOC 2ZUTA 4XNYL 2OR9L 3QJFA 1A6UH 1K3ZA 2NY3D 1MJJB 1IKNA 2YK1H 3KPRE 2YD5A 4FQXA 3UROR 4EI5D 5A1AA 5DYOB 4LCIH 1NKRA 2QQQA 3N1GC 5C0IB 4R97C 3HE6A 5IK3A 1SBSH 4BH8B 4XNMB 1YEKL 1MQKH 4H5SA 1NANH 3LQMA 3W81A 1BOGA 4NM4L 2I60H 1BQSA 3B4NA 2MMXA 4MCZB 1CT8B 4K3DL 2IWGA 1Q94A 2W1NA 4L8BB 3CFEA 1HINL 2XOTA 3O3DB 3W9DB 4ZFOL 3BZEB 1NEZB 5KVEL 3KVQA 3MNVB 4PJEE 2HVJB 2ED7A 3HE7D 3VRJB 2HFTA 4DW2L 1T1YA 2J8UE 2V2WA 3VGFA 2C1PA 5JW4Q 3U7WL 1NUNB 1ZLSL 4EUPA 5HI3C 2J12B 1WGOA 3O0RH 5JLZB 1GGYA 1A7PL 4G6ML 5D6CA 1WLHA 5IWLA 4OZHB 1U8MB 4Z78B 1GH7A 2Z31B 4KKNA 4ZFOB 2W0LA 5IBLC 4HULB 4I2XB 1FBIH 3P0GB 3FO0H 1JNNH 1AJ7H 1X4XA 4IIQB 3S5LA 5EH1A 1S7VA 1DVFB 2OQJB 2BVOB 1H8NA 3QR2A 5HVGB 4FXGA 5A2JH 4XZUA 3C5ZB 3MV9D 2UWEB 5LKNA 1DTUA 2CRZA 4QEGA 5DJYB 4J6RL 4CU7A 1XH3A 3RWFB 2PETA 1A6WL 4X6DA 5JDJA 4Z8FL 2ICWB 4NM8H 3IXAA 3RWHB 4S0SD 1KCUL 4OM0H 2MCG1 1F6AB 1EPFA 3LRHA 4ODHH 3B5TA 4M1DH 5KVGH 3BKML 3RWIA 1FFRA 3MRFA 3VFUA 5F89B 5HI4D 1R3HB 2CK2A 2HKFL 5ESQB 2J4WL 5FYLH 3GDBA 2NPLX 2VQ1B 4RAVA 5TDNA 1MIEH 3HC4H 3DPBA 3REVB 2XN9E 4PRAA 4NBXB 2G9HB 4OV5B 1U8HB 4ZDHB 1DN0B 1ETZA 2BY0A 2DQCL 1FQ9C 2A9NH 1U3ZA 4H26B 5C0AA 1TJGH 4QNPF 2QQLL 2EDWA 1I1RA 3WHXB 4XWGH 4D3CL 2K7PA 2YZ1A 1JTTA 1EX0A 1K5NA 2QQKL 4PG9B 3O4LB 1LO3H 4ELME 2VZVA 4NGHH 4WI4A 4WUKL 3QHZH 4CMMB 4KAQL 2B2XL 1A0QH 3ZZ1A 3MO1B 1ES0A 3FT3A 2C1OA 4G6AC 4KMQA 3W39A 1NGQH 4ZUUA 4NZDA 3SDDA 4K94H 1UH3A 4FNLH 5ICXB 1LE9A 5FYJD 4ZYKA 2JF1A 1DL7H 2Y06H 4U2YA 4HIXH 4XCFH 1FAIH 4K7PH 1U95B 4BSWB 2ZSVB 4KDTC 3U9PL 3HNVH 3DUSB 2IQ9L 4BA8A 3QPXH 4LF3B 3D39B 2Q7YA 3WCYA 4P23D 4NYLB 2F19L 5E4EB 3VGHA 1KN2L 4WI8A 3BISA 4WFGD 1A1MA 4HKJA 3HC3H 3SE8L 3KPOB 2VISB 2EDXA 5KZCB 4UDUA 1G9MC 5CEYA 2V7HB 5D72H 4UTBL 5L8KB 5B21A 2R39A 4NKMB 1C1EL 2YKLL 1EJOL 4MA7H 1BVKA 4H0HB 4NRZB 2FWOB 3M8OH 2FRGP 5HJ3A 2I07B 1RZIA 3U46A 5DMKB 3QG7L 4LASH 3V0WL 3QB7C 1OP3H 3LAFA 3NIFF 5L88H 1B0WA 5DD1L 1HH6B 3H9SA 3ARFD 1ZEAL 4EEEA 3ILPA 3QRGH 2GK0A 5IB3B 2NNAB 3X3FH 2E7LC 4R4ND 3SQOL 4WUKH 2EXYD 2EE6A 3CDYA 3EKCA 2BNQB 3BP4B 1GOHA 4Y19D 3D39D 4XVJH 4M00A 3HG1B 3H3PH 5C92A 2ORBL 3RY4A 4KKCD 3TBSA 4KY1H 1EH9A 5E8EA 3IAPA 4OT1L 5DD5H 1JWUA 3RGVA 1MCQA 4PRHA 1PZ5A 4M8VA 3VXUB 5D5MB 3VXMB 3WS3B 1B2WL 3UDWA 3DMMC 4M43L 1JZ2A 1XAUA 1KJ3H 2ZCHL 5CJQH 1WC7A 2MQ3A 3PP4L 4UT9L 3N9GH 1MAMH 1TQBB 1IJ9A 1MFCH 1HN1A 3FQWA 5E6IC 3FMGL 4FTVD 1ZWIA 3TA3C 3BH9B 3JWNC 1J8HB 4HG4K 1XGPA 1OM3L 1IAOA 4HXAH 1M7IA 4MQTB 2ADFL 2ITCB 3BUTA 5CSZA 2EDOA 4QO1A 4YHML 3GMRA 1ED3A 1NBYA 2ARJA 3GK8L 2FHFA 3ME0A 2NY4B 3STBA 2VDNH 4WUUE 1JFQH 1U93A 2CGRL 3UTZA 4ODVL 5JQ6H 2V9RA 4AIXA 3VA6A 3CFBB 3ZDYE 3FB8B 3EDEA 4Y89A 3QQ3A 4F9LC 4L8SB 5L88L 3WLBA 2RFXA 3SJVA 3CMOL 2ZJSL 4RMVA 5FO7B 3S8WA 5CINH 4G9DA 3DVNA 4HQQH 3RL1B 1QBAA 1ACZA 2VL4A 4ZUUB 1Z9SA 3P4LA 4XBEH 3HE7B 3RNQA 4MNGE 2GTWB 2Y5TA 3KS0H 5HYSA 3BP5A 4TQEL 1CTOA 2MOVA 4U1HB 5IW1A 1J8HA 1FCCA 4UZGA 5GSRB 2ZUQB 3C2SA 1M7IB 1TCMA 2EYTA 2EH8H 2RJMA 3FO1B 4GW5B 4ZNEE 1X5GA 3LB6C 1UGNA 4K3EL 3DUUA 2AJYH 1D5BB 3EHBC 1CZ8H 4NQVA 1OWWA 1RHHA 4JVPA 5IVXE 5K33A 3CCHA 2DM7A 2D7TL 5I1AB 4YDIL 3QA3A 2P5WD 4QRSA 3MV8A 5T3ZD 3MRGA 4HS8L 3CSPA 3BZDA 3DMMD 4L3EB 1QSFA 5CJQL 4PJ9A 4ODTL 3PWLA 2RBLA 4K7FB 4NKIL 1FC2D 2CLVA 3QZWB 1I1FB 2VDOL 4KKCC 5I16A 1MH5A 4ZPVB 4LOUC 5B8CB 4OF8A 1JRHH 2JK5B 5KS9B 2DQCH 3NA4A 1CDYA 1MHPL 5FUOH 5HGGS 5K9KA 3RVUC 2EE9A 4X6BA 1WTLA 3CUPA 3MOAL 3ZT7A 5BZWB 4BFBD 4BKLB 3VA2C 1CLOH 2C3XA 5E2TL 2OL3A 3QFJA 3QHFL 3BGFB 3HAEG 4Z7VB 4GAFB 1N0LA 1WBXB 2JJVA 3VFGH 1TXKA 5BW7C 4NYLA 5FXCH 2IAMC 1VFAB 4L4TB 2ZUSA 5C0BB 2DDQL 3U7YH 3X17A 4B5EA 3TC9A 5KW9H 4TUKH 2FR4A 5T1LB 5IB4B 1YMMA 3IFOA 4HQQL 1I8MB 3T0DA 4NBYB 3K8LA 3NBNA 1FCGA 3CLFH 1KT2B 2WW8A 2DQHH 5ID0B 4K94L 1IL1A 5DD0H 2A1WL 4F15C 2FLBT 3QWQB 5AD0A 3GIZL 4JHWL 5LQBL 5BVJB 1RIVL 4ZNEA 3T65B 3NACH 5MERB 2NLJB 3ELAT 1EDQA 4EI6B 4UT7H 5I1HH 1ZMYA 2VXUL 4JJ5B 1KCRL 5BVPH 4OKDA 5T5NF 1LE5A 1Q94B 1WZLA 2EKSB 3BP7B 4F57L 1KPRB 2A6JA 3HI6H 2NW3B 1U6AH 1MLBB 3IDMB 2DL2A 3KG5A 2WQRA 4LPWA 4D0DB 5BZDA 2J5LB 4JZJA 1T22A 1TJHH 3CXHJ 4PD4J 3UCRA 2NXZC 2V17L 3ZYJA 1T1YB 2P5ED 5JXAH 1IGFL 5IHZA 2HG5A 4PV8B 3OR7A 4M3JA 1EFXA 2V7HA 3BDBA 3SKJH 3KPLA 2VZ1A 1EMTH 4JGUA 3FT3B 1U8IB 2ARJB 3CFCL 5A2KH 4PTTA 2XXCB 1MCFA 1PJ9A 5SWQA 5JDSB 5DQJA 2RGSA 2OTUA 2XIDA 1GSMA 3FB8A 1BZ9B 1OTTC 2NZ9C 4YBQC 1BZQK 4HIEB 3NIFE 1GZQA 1FVEA 2COQA 4YDVB 5DK3A 1EHNA 1LE5B 4APQB 1HWGB 5B3NA 2JCCE 5H37G 1A22B 5TF1H 3LY6A 5MENE 5D8JH 4OZGE 5ECJE 1ZLUK 2VXTL 2UWEE 4PRBB 3DBXA 3RWEA 1GJIA 1EO5A 1MIML 4HH8A 5LWYH 4JQIH 3K8KA 3DX7A 5SX5H 3IJHB 1I3RB 1EUTA 2EDKA 3TBSB 4Z77B 1HKLH 2AJSH 4DAGH 3VFPA 3QDJB 3IFLH 4HUWB 1NLDH 1A64A 1RHFA 5KSAB 1NGZB 3BD4A 5C0CA 4R6UA 1J0JA 2F54B 1JBJA 4TN9A 1UEMA 1HI6A 1N3NB 5E0QA 2IAMA 3SDDC 1SEQL 1IC4L 1QR1B 3UJIH 1KG0A 4P2RA 3K80A 1KB5L 1FFQA 4BQ6A 3H9SB 1SBSL 3I6GB 4XCFL 2X4SA 4P4KD 2G2RB 3LEXA 5E5UB 2HTLC 1W72H 3NABL 1H15A 4JFQA 3DV6A 4DW2H 1UC6A 3SE8H 5F7EH 3QIWB 5HD8D 3FQNA 3ULVL 1D5ZB 3TH2T 1JPGA 4PRPB 3PHOA 2NY3B 4LVOC 4FG6D 2OBGA 3D0VA 1Y18B 2MNUA 4NC1E 4OM1L 5D1QD 1CQYA 5I1CH 2D7OA 5HYJB 3G6AB 3SDAC 4JM2B 4B50A 4PGBB 2X4OA 1OCWH 2Z35B 3GMQA 3RY6A 1TZHB 1I7RB 5TF1L 3MUGA 3VFMA 6FABL 4TVPD 2JK5A 5KS9A 1CD0A 1HKFA 1X5JA 3AVEA 2WIIB 1V3KA 3HN3A 3GNMH 1UQSB 3T0EC 5J0BA 3U6RB 4X0KB 2W0PA 3O2WL 3V5HA 2AJYL 4U6HA 3MBXL 1ES0B 1LMKA 3NCJL 4LCUA 4TPRL 4GS7B 1Z2KA 5T3ZH 4ISVA 3MV8B 1WCBA 5HGHB 1QYGL 2QSQA 3WIHA 4DOHE 2B39A 5HVWA 5FGRA 1DANT 3VGAC 3NZ8B 5JORB 2FYYA 3LN4A 5TFSL 1AGFA 1OPGH 5M94B 3ARDB 2P5EB 4X9GA 1WCQA 5GHWL 5I17A 4R26L 3BP5B 4MQXC 3INUL 2NY6B 1CFSA 3S9DB 4CVUA 1T0NA 2YPLE 1T5WB 3BOVA 4GBXD 3G6DH 3GHEH 4KRMB 4XCCH 4NC0B 1XR8A 2X05A 4G5ZL 1PKOA 3IDMA 2NW3A 4JFOB 2E6JA 5D1ZB 4Z76A 3LQZA 5CIPA 4NUGH 2GJ6A 3G5ZA 1FO0A 5FV2A 4L4VA 2GJZA 3X14A 4IRZL 3GGWA 3CPLB 4PB9H 5CD3B 1DQMH 4NC2B 32C2B 3X3GH 1EHXA 4YHPB 3KS0J 3RUGA 5IMOA 1IGIH 5E24E 1SVCP 1S5HA 4U6TA 1U8IA 2FIKB 5ID0A 2VUYA 1QSFE 1TFHA 4YX2H 3P4NB 4OB5H 1T1ZB 4YJZL 2OX5A 3DMMB 1J0HA 2E7LA 3GHBL 4RBPH 1RIHL 2X7LB 3BP7A 1U3JA 5I2IA 2FJGB 4N0UE 4FXLA 1D6EA 3QP3A 5F3HB 3WL9B 3KLHC 3O6KH 3HC0A 1F11B 5BRZA 1P2CA 2OJZH 5LAXA 5I8CB 1RZFL 4MA1C 4S1SL 4LAQH 1DBMH 5F7LB 1UENA 2Q86A 2EXYC 1JTOA 4R4BA 1REIA 4DZ8B 3N0PB 2Y9RT 5DLML 3B43A 1AP2A 3MNWB 3TV3H 4G42B 1OAXH 4MDJA 5TQ2L 5EOTA 4QRTB 4WHYH 4XNZC 5EU5B 2CIKB 3LV3A 2BZDA 1NCUA 1S8DA 3DROB 3OJMB 3MV7A 3OXSB 2EO9A 3EFFA 3Q6GL 4ZTOH 1T21B 1HXYA 4OKVB 1OGAE 4TSBL 3BP6B 5JOEA 4R90L 1EHLL 3I3DA 3ZKSD 4JFDB 5F9OL 1CD9B 2CR6A 5A3ID 1FYTE 2XWTB 3SGJC 2ESVE 3CX5J 4FFWC 1B9ZA 3VGGA 4IOSD 4OLZH 3TZVB 1HOCB 5J11B 3B5HA 3U0TB 4IJ3C 1NMAL 1I3RA 1BBJB 1JWSB 1W0VA 3BT2L 3VFTA 4GW4B 3QDHA 4NCDA 4UV4L 1WJ3A 4U1GB 3RAJH 3ZKMD 4LNRA 1WK0A 4DKFH 5JZ7C 5KAQF 4MDJB 4WDIA 4GAYB 4Y16B 3P73B 4PRPA 2N1KA 3IKCA 3TLRA 1NAKH 1EGJH 4PREA 1QLRA 5IK3B 2C3VB 4RIRB 5IBUG 3L1OH 3PXJA 1BFVL 4M7LH 1A9EA 1RJZA 3AM8C 2H3NB 2IPKA 2G60H 5DRZB 4QCIA 4XVUD 5FA4B 4B41A 1ORQB 1HYSC 43CAB 3WFDL 3FRPG 2VWEC 4JY4B 5HVFB 1FDLL 3DTXA 4DN3H 4XH2A 1J1OH 3TO4D 4MZ3A 4NQTA 3QDGA 2OL3L 4DZBB 2ATPB 2ZPKL 3EO1A 1YN6A 3C6SA 2HTKC 2AKRA 2FO1A 3T0BA 4HK3J 4TVSa 5TQ2H 4CJ1A 5B4MD 2EYRB 4O9HL 3GM8A 1G7JA 3NGBC 3BSZH 4MHHI