2L4OA

Solution structure of the streptococcus pneumoniae rrgb pilus backbone d1 domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
175
structure length
175
Chain Sequence
METASAATVFAAGTTTTSVTVHKLLATDGDMDKIANELETGNYAGNKVGVLPANAKEIAGVMFVWTNTNNEIIDENGQTLGVNIDPQTFKLSGAMPATAMKKLTEAEGAKFNTANLPAAKYKIYEIHSLSTYVGEDGATLTGSKAVPIEIELPLNDVVDAHVYPKNTEAKPKILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Streptococcus pneumoniae RrgB pilus backbone D1 domain: in vivo protection and implications for the molecular mechanisms of pilus polymerization
rcsb
source organism Streptococcus pneumoniae
molecule tags Cell adhesion
molecule keywords Cell wall surface anchor family protein
total genus 25
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2010-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2l4oA00
1NBZA 4AYFA 4MQTB 3O3DA 1VSCA 1YECH 2FD6L 4ODHL 1YY8B 2ADIB 3D3VB 4XPFL 1A4JA 2BJML 1VFBB 2H9GA 2J6EL 1A6TA 3EYOA 2WIMA 3X3FL 4YZFF 3GMOB 5I1AA 1X3DA 1AIFA 5FA3A 4OZGB 1E4JA 4G8GB 3T04D 4RFOL 1C1EH 2KL6A 5CEXA 4IOFC 4PJ8B 4YXLL 5JQ6L 2IALB 1LO5B 4FS0A 4HJGA 1I7TB 1HH6A 3EYQC 3E3QE 4QTIL 3PV6B 3VFUB 3NN8B 5GGVY 1MFEH 2OCFD 1BOGB 3IJYB 4WI9A 3L3HA 2PO6D 1WFTA 4YNYA 5E9DE 3ZDZF 4CW1B 2IJ0C 3L3JB 5HYJB 1NAMH 5E00A 5D7LE 3BESR 3GMNA 1CICA 3MLVL 1FZKA 3PP3K 3HI6L 4JR9L 4K9EC 5DK0A 3TA3D 1URLA 1FG2A 1JGVL 4F37K 2JK5A 3FFDA 3IDNB 3D39B 5ERWB 4X4ME 5I71B 3K4ZA 4LKCB 2BVOB 3VXQA 4YDLC 1FAIL 3LHPL 3VFPA 43C9A 5GGVH 4EXPX 3MXVH 4R26H 1GC1L 3C60C 1P7QD 1KGCD 3RPIB 2W07A 1CFTA 1WZ1H 5FFLA 2C9AA 5CSBA 3ULSB 1QSEE 5EZJA 4K8RL 3A6OA 1QEWB 1YYLH 4OIAA 4PJDE 3VDBA 1AGBA 4Z18A 4MVBD 1PEWA 1KTRL 1V7NL 5C0JB 2J8HA 3IDYB 4WHYG 2IC2A 3QNXA 4GG8A 4XWOD 4LHUA 2A9MH 2W91A 4N90E 4PJXA 1I7RB 1BIHA 4PJCE 3QIUC 5CEZD 4CKVX 3DSNA 3QIUD 1RZGB 3M17B 3AMLA 5E94A 4EI5B 1S9WA 5LXGH 3MPCA 5B3JE 4U1MB 3K74B 1DBML 1J0JA 4LSVH 4O5LL 4NCDA 1RJLB 4ZUVB 3C09B 2R2CA 2ZOKA 4Q6IA 4XXDA 4HX1A 4XBPB 1AJ7L 2UWEF 2HA1A 1XGPB 5F1OB 1AI1L 4BYHA 3B9KD 5FO9B 2HT3D 5CSGA 3BWAB 1JPFB 5ICZA 5JZ7C 1CXEA 2K9UA 1CK0L 5IMKB 2HLFC 4G9FE 5LWYL 3DRTB 2X41A 1DFBL 4WHDA 4NN7B 3AREB 4JKKA 3L9RB 1BQUA 1WC7B 5GS2H 4YEFA 2AEPL 2XA3A 4YQXL 4M7KL 5HVWA 2BY3A 4O4YL 3DWTA 5FKAB 2PR4L 2LVCA 3GMMA 4K7FA 1OB1B 2QQNL 4KGJA 4C55A 1NANH 4XNYH 3OR6B 3CDCA 3RWIB 3BZFA 1C5BL 3PWJB 1PW3A 4YAQA 5GHWL 3VU2A 5ICZB 1EXUB 2P48B 4XVSH 3H3PH 5AYQA 5GSVB 3WIFA 4WCYL 4KKAC 4IRSB 3BIKB 2NY6C 1YJDH 4WEMB 4C57C 1FZJB 4PJ5E 1KCSH 1V7ML 5F1KC 1D9KA 2AAVA 5D2NC 1O0VA 4EKXA 12E8H 3C6SB 3D85A 1LK3H 1N64L 4LVOC 4YDIH 5JZ7D 1TPXC 4NQSA 5I2IA 4OF8A 4XI5C 1Z5LB 2CJUL 2R8SL 4EEEA 1HYRC 3WKNA 4YGAB 2JB5H 1NMAL 5GS1A 4R7DB 3I6LD 5IK3B 1ETZA 4LEOB 2R29L 3D48R 1WZ1L 1BD2E 2J5LB 1Q9KB 4Z7QE 2O93L 5IT2L 4U1IB 3QNXB 1G7PA 1XF2B 1P84K 3MLTB 5DJXB 5C0JA 3MOAH 1D9KD 2NZ9C 4IOIA 4PJGA 4O2FB 4M7LH 5C86A 3BUTA 4EN3C 2AJ3A 4P5TA 1D5IH 32C2A 1G7LA 1A7OH 1KPRA 3RWHA 4WY7L 3N0PB 4FXLA 3QRGH 4H20L 3MRJA 4OCWL 1VADB 5E2UH 3SDCB 5TQ2H 3MUZ1 1DQQB 1X5ZA 5H37G 2FX8L 3TNNB 1MIMH 1IGMH 3B9VA 1INQA 2J12B 4KHTL 4I18B 1MJ7H 5ICYB 3LD8C 5BRZD 1CR9H 1YMMB 2DQHL 1JNLL 2R0WL 1IL1B 3LN5B 5JOPD 3U7WL 4LGSB 4Y8DC 4WI8A 3DO3A 4MJ5B 2X89A 2Q8AH 3UDWA 3QO0B 4WVRA 1OF2B 1HH9B 4JFZL 3EJJX 5E00B 2OJZH 1A1OA 1MHHB 3JZ7A 5ISZD 4YWGH 1YZZA 3G6JB 1MFAL 5EDXA 2GSGB 4JFEA 5L8KB 1JF1B 5D6CA 1IKFH 4Y16B 3G08A 3NA9H 3QFJA 3UXFA 3WEXA 3QXVA 3RVUC 2PCPB 3MGOB 3ARZA 3KPRB 2I60H 4GG6B 1GGIH 4G8EB 1RUKL 1YNKH 1WITA 1PLGL 3QIWD 4RGNB 1KTDB 3QIWC 4KJWD 5HHXH 4OF6A 2H41A 3RVVD 2IQAA 2H1PH 2EZ0C 2C7UA 4C83A 3KDMA 5GZND 1S7TB 1XR9A 3QUYA 3QFJE 1DQJA 5A1AA 4OLVH 1WBYB 4MHHG 1R24B 5T3XD 1MFEL 1DQLH 3S4SA 2BC4A 4K7PY 3DTXA 3QPXL 1A9EB 1U8KB 2Y72A 2FB4H 3U9PL 4X8JB 4OQTL 2DQEH 4ONFH 1U8OA 4PJGF 3V4PH 4XNXH 2Y1VA 4FQXA 1MVFA 1XGYL 1YEKH 3C2SA 1ZOXA 4L4TD 5D8JH 3VI3F 4HBCL 2BNUA 1H3XA 3DGCR 1VESA 1Y6KR 4JFEB 1ZLSL 3B2VL 5AD0A 5CSZA 2ILLA 1P1ZB 2Q3AA 1NGYB 3V52H 4PRAB 4FTVE 2Y5EA 3DUUA 1MVUA 1ZT4A 5ICXA 4LDEB 4QHKI 5JW4R 3P0VL 5EOTA 3DYPA 1NQBA 2CDGA 4ONGL 4GKSB 4MXWL 3QDJA 4KMTH 4HS8L 4WUKH 3SDXB 3BKML 3FTGA 3VWJC 4JAMB 4POZC 2VN7A 3MCKB 4UDTA 3WNMA 2YKLL 3MJ7B 3NFSL 4OLVL 4RBPH 2VLJD 5EN2A 3MRBB 1CBVH 4GAGL 5A3ID 5T1LB 4DKEL 5DJ6B 3QEQB 4ZSOE 3RJDA 3T3PF 3NH7L 3RL1A 3TH2T 2NXZB 3H2WA 3AC0A 3LQZB 2FX9L 5HBBA 2RR3A 2G9HB 1JWSB 3ZHLA 2HRPH 2FEEI 4OZHF 5JXEC 1CGXA 1FYTB 4GBXC 5IB1B 3U30B 2A73B 2AP2A 2CIKB 4P9HC 4JKLA 4WDIA 4NQVA 2PUQT 2QSVA 2X4TB 4PJ7F 3DURA 3IS1X 4ZUTB 4JPWL 3GM0A 1ZXQA 1H8NA 5AEAA 4KK5C 3GIVA 4G9DB 4E42A 4E5XB 1B0RA 3ZDZE 7FABH 4CMMA 2EE3A 4NRZA 3IKKA 1KPRB 4ZFFB 4X7FC 2G2RA 4PJBB 4DTGH 4MA8L 1AQKH 3MUJA 3L3IB 1D9KB 5AWNL 5HGGS 3VGBA 1Q72L 3MUGA 1IMHC 4DEPB 2FSEB 2NLJA 3UYRH 4JZJA 2Y7QA 2UVFA 3GSNA 1QHOA 5A2KH 2YOCA 1Z3GH 1AXSB 1I3RB 1IE5A 5I30H 1U3ZA 2EIZB 1ETZB 4LEOA 1B4JH 4X6EB 1JPST 4LFHD 3OQ3B 4YUEH 2EIDA 3RA7L 4F15C 1NFIA 1KCRH 2C4XA 4YQXH 1YECL 2FD6H 4N0UB 1NMBL 2W9EL 2A9ML 5ID1B 3EOAB 4IRSC 4N5EC 4XMKH 3UYOD 5L7XL 2E7LA 1JRHL 4RFNC 4G9FA 5I66A 5L88H 1DBJH 2JF1A 3IDYC 5L2JA 3IDXH 1K6QL 2MQ0A 4NC2B 4Z9KB 4YHLL 3QDJB 4ODSL 2E7HA 4NQDA 1KJVA 3KXFA 3FN3A 4KUZL 2DQCL 2L4OA 6FABL 5E8EB 5DA0B 4YDKL 3DIFA 5SWZA 5E24E 1F58H 4R6UA 2EDWA 2EYSA 4P9MH 3W9EA 1EFXD 1AJ7H 2E9BA 5TDOA 2R4SL 3L7FA 4WGWB 5BRZA 2QSTA 3RL2B 3WD5H 1N6VA 4MMXC 4OLZH 15C8H 3GK8H 5D9SB 2OK0L 1ZE3C 2R2EA 3TPUB 4R2GD 4PJ7E 4Y4HC 1YQVH 2KZ1B 1KB5H 3FQUB 4JRWA 4MB5A 2XTJC 4HK3J 4ZFZB 3KDMB 3B8YA 4HMEA 2V9TA 1SY6A 4I2XB 2IQAB 3EHBD 3H9YA 5J89A 1T1WA 4GLRH 4QTHB 4K3GA 1AR2A 4IBLT 1EJOH 4RQQA 3CIQA 4PJDA 4N8CL 5F93C 5DVKA 3HR6A 3TA3B 2PETA 2V2TA 3O2WL 1OGAE 3ZHDA 1FL5B 3PABA 1DEEA 5AZ2H 5GGSB 1QSEA 2E27H 5DF0A 5JR1H 1DFBH 1BD2D 1GZPA 4PGZA 1JF1A 2H32B 4I8DA 4U1HB 3RTQB 5KBNC 1MQKL 3QUMB 1VGEL 3MODL 4O9HH 3VG0H 1MJUH 3LKNB 4WUUE 3QAZC 5T3ZE 1I9RH 3ZKSD 1OF2A 3WLBB 3PWNB 3CSYA 1XIWC 3TT1L 4K3DH 4RA0C 1CWVA 3RKDD 4PG9A 5CKGA 2FYYA 4XNUL 4MQ7A 2NW2A 3I75A 5K59E 4OF0A 2OYPA 2P45B 4O2CB 4QXGL 3WFBH 3KG5A 2YD6A 2FZ3B 5IQ7L 2X4OA 2DLTA 3MRRA 4MQ7B 5IGXL 4GW1A 1KENH 4JPIA 4Y4HD 5I1HH 3ZKMC 1WFNA 3GSQB 3GMNB 3L1OH 5DC9B 2WBWB 2ZPKH 1TTUA 3QUYC 5GISL 3SKOA 1FHGA 5BJTB 4RNRB 1B6UA 4PTTB 4WV1A 2A6KA 5FUCE 3F7RA 1FFQA 4QHLA 2H32A 4U1HA 5I0DA 1CFTB 1CN4A 1PKQE 4CL7A 1P7HL 3MRIB 2WUBH 4RMWA 5IVZB 4BSWA 1F13A 4O58L 1LO5A 4Q9RL 1GZQB 2JCCA 2PYFB 5CJQL 2W65A 3LQAH 3STBA 4J4PD 4PG9B 5DURB 3MZGB 4XPFH 3TBVA 3CMGA 5DK0B 4J3SA 4FA8A 4JQVC 3BDYL 3L5WB 1XFPA 2DMCA 1FO0L 2D7TL 4DZ8A 2RHEA 4LRNH 4Q7DA 4JY4A 2AQ2A 5D9SA 2D4FA 3W2DL 2NY3B 1QSEB 1S7SA 2IALA 4APQC 2F5AH 4PB0H 1IGCL 4ONHB 4XNQA 2NW3B 3NVQA 4KMLB 3AFLA 1IGTA 3MLVH 4JGUA 4LSQL 4Y5XB 2RCSL 2XKUA 4JZNA 4G8GA 3I3EA 4GRWF 5DS8A 5DFVC 2NY2B 3OG4B 2QADB 4YBLC 2JTDA 2VXTH 3QUYD 5E8EA 1VDGA 3QJHA 4YDJA 1CCZA 4PJ5D 3MV11 5ALCL 3S96B 4F7CA 4JFXB 1FO0B 3HA0A 4LIQL 2BNQE 3GMMB 2BRRH 2NQCA 4EN3A 4KV5F 3FAWA 5BO1L 1CXFA 5F3HA 3RVXC 4EBQH 3HR5B 1FCCA 1K4DB 4ZUWA 2WLZA 1A6ZB 3VFMB 3TBWB 2VSDA 4X4XA 2P44B 4IOSD 5CWSB 2HJFA 5FGBA 1DQMH 3G5XB 3JVGC 2JB6B 3DX8A 1IAOA 2VDLH 4NN5C 4KFZC 5ISZA 1LMKA 4QGYA 1HHIB 1D6EA 4RFEA 1FJ1B 2G60H 3VJ6A 3X12A 4DTGL 2O5ZH 1LDSA 4MDJB 4OLXL 2W0LA 4F2MB 1UGNA 1QLFA 4NP4H 1MLBA 4EVNA 2NLJB 3TWCH 1QQDB 3ZYZA 4XXDB 3REVB 2P5EE 4KZDL 3EO9L 1E4WL 1X6NA 4K71B 1PFCA 2J1KA 4ZXBB 1S5HA 1ZS8A 4GW4A 4FMKA 3RZCC 3WUWA 1NGZA 3RU8L 5KZCD 3VGDA 1LO2L 4LEXH 3QIWA 5KOVC 1II4E 5CMAB 5FYKL 3E2HB 3MNVA 4PJ7B 4FFWD 1NGXA 2IGFH 4QHMB 4JM4H 3T2PA 3KWWA 5DD6A 1HQ4B 1RMFH 4MNQA 1CGWA 5F6IC 5I8EB 3WFHB 2EKSA 2NXYD 4XCFH 2XWTB 4U1NA 4HH9A 2HFFB 3C60D 1N3NA 3WFDL 3BIBX 1ADQA 5DT1L 4IMKC 4JN1L 5IHLB 1A1MB 4Z7NE 3PWPB 4L9DA 4TTDD 3VE0B 4OCYL 5DUMH 3VD3A 2BDNL 4LU5L 2LABA 3R06B 3LKSB 4MDIB 3P0YL 4LLMA 4P23D 4W68A 4M6AA 1MHPL 4U3HA 3AAZA 2Z31A 1MFCL 3ARUA 3MQIA 1FFRA 5JW3L 4KI5C 2X40A 2AV1B 2DBLL 1EHAA 3FO1A 4KI5D 1XR8A 4NNYB 5CP7B 2DYPB 5IEHA 1T0MA 2B2XL 3HNSH 4XWOC 1CICB 3W39B 2PYED 1G9MH 3I02A 1OTTD 2GCYB 3ELAT 4BFIA 1OGAD 5I16B 1CDCA 3L5HA 2VDOH 4Y4KD 3L5JA 4HUXB 5KVEH 1EEUA 4RGMC 2QSCH 4LP4A 3IDUA 2B1AL 2IEPA 3MRBA 2DLIA 1DQDL 1JI1A 3SCMB 1A9EA 3B9KC 3IT8D 1LK2A 2X4NA 4P5KB 2RAMA 4P3WA 3VGAB 3RTQC 4HKXA 3WJJC 2ZOLA 3TCXA 3FOMB 5GSRB 3ARXA 4QKXB 4WWKC 3SJVE 4QXWA 4Y2DD 2HYMA 4UV7L 2Y5TB 4HK0A 4TTDC 1QLRA 3I9GH 1DBAH 3O3DB 5T3XL 3CVHB 3T0BA 5EU3B 1P4BL 3GBNL 2O5YH 2XNAA 4TQEL 5EU6B 1I1YA 1T3FA 2GUOA 1F3RB 1SM3L 1KJ2L 3NABL 1A5FH 2H2SD 1G9NH 4UOW1 4NCC1 5SX4H 5LGHL 3X14A 1KBGL 4JY5H 1OCWH 2B1AH 3TN0B 4DGIH 1T21B 1SEBB 3R0NA 4Y4FC 3VXUA 4JRYD 4AENA 1MEXL 2VDQL 1ZSDA 2VXQL 2CGRH 3RHWF 2OL3A 3H9ZA 2Z93A 3JWDL 1FIGH 4NGHH 2D4DA 1HH9A 2A6DA 4FQIH 4XP6L 3LKRB 4APQA 4JVUA 2WBJB 1MREL 4F7TB 1MJ7L 4NPYA 4FABL 4G8FA 4Q97A 4JPKL 1YPZE 4GG6A 1ACZA 5C07A 3U0TB 4LL9A 2NY6D 1I8LA 1OARL 2R4RH 2GEEA 1MIML 1FBIH 4PGBA 4WJ5A 5DEGB 5B39B 3WHXB 5D71H 4P46C 5GS1C 4MNGB 3HG1B 4L5FL 5TH2A 3W0WA 2QQKH 2NY1B 2E6PA 2VR4A 3PWPD 5BVJA 1U3JA 1JGDA 4QRUA 5HGBB 4AMKH 3ULVL 1F4XH 4N9OB 1WF5A 3TVMA 4FMFA 1CDHA 3GSWA 3IFNL 4QRRB 3I9GL 1UZ8A 4FQHB 4X7DC 1UACL 2ED8A 1JGEA 4R8WL 5IJVB 2HTKC 1W72H 2VB5A 1FG9C 1P2CB 2Z8RA 3OKOA 3OAZK 1SBBA 3KJ6L 4HQQL 1Y6NR 1Q9KA 4LSDA 5EUOE 1LP9B 1CFNB 1CXLA 3VWKD 3SDXE 1UB6A 1MEXH 2VXQH 3FT4B 4F9PC 4JQXC 1XCTA 3CFBB 4KDVA 4WENB 5C0GB 3PWUB 1EEYB 2AERT 1MFAH 3QH3A 5CP7A 1AXIB 4PJ9B 1MCCA 2APWA 3U36A 1AD9B 3IVKB 2GTWB 3BZDA 3QQ9C 4Y1AB 3SKUD 3CXHK 2NY4B 3IGAB 5ALBH 2CK2A 3P77B 3LKPB 2G5RA 1NCDH 1XIWA 1F5WA 5GS0C 1WBZA 3ALPA 1PD6A 3MRMB 4P4RA 1U3HD 2VDLL 2DKMA 2FEDD 3NTCH 3SDCC 3STZB 4YR6A 5DUML 3MRQB 2AK1L 3B9AA 3FCTA 1OD9A 3KPNB 2EKSB 4G5ZH 4K7FB 3WIHA 2CIIB 4KAQH 4UQ2B 2Y6SC 1IM3A 4ODUA 1QBAA 4KTDH 5F21B 3T09A 1WEJL 3MCLH 1XF4B 2NX5B 3BKCL 3QHZL 4NDMB 3WIFB 2ZCKL 2JCCF 3V9FA 5I1LB 4HWZA 3VXSD 2WWKT 4MAYB 4HIHA 5EU7E 2X05A 4TSBH 3ZDYE 4JO3L 2P43B 3G5YB 4X9BA 4E41A 1SYVB 1FZOB 2DWEB 4NO0D 5IMKA 4EI5C 4N9GA 1A6VH 4UB0L 1H3TA 3PUCA 4F80A 1MELA 1X5YA 3IFLL 4GO6B 3MV8A 4JO2L 4XCCH 5F9AC 5HJ3A 3VXTA 2CKBB 1OLLA 1KXQE 4XBPA 2ZCLL 4JKPH 4PLJD 4B0MM 1OQOA 1SVZA 1KJ3H 4ZD3H 4OLYL 4YHIB 3K4DA 3GBLA 3WFCL 4N1CA 3P4OB 2YS4A 4WI6A 3BISA 4BZ1H 3TESA 4S0TD 2V6HA 3D18A 2I9TA 3PHSA 5JXAH 4YHIA 3P4MB 3IDMA 3QQ4B 3QDMB 3EYFB 1AO7B 3TIDB 5EUKA 3MV9A 4D0BB 5K9KB 1NBVH 3VRIA 4X5LA 1RULH 4XCCL 3HAEG 3BH8B 3EOYG 1KPUB 1YYLL 4MA7L 2E7LC 5C07D 1J1OH 2VZTA 2PTTA 4HGWB 4MNHB 1BJMA 1ERNA 1LQSR 4LBEA 4RAUB 2F54A 1SY6L 5JOPE 4HIXL 4LLVA 5EU5A 3WL9A 3ZE1E 5B39G 4MSWA 3BQUA 3ULVC 4NQTA 3V5KA 3EO9H 1CLCA 3WS3A 3X13A 3EAKA 4RMSA 3RPIA 2NW3A 4HUVB 4ODSH 2IAND 4LCCC 1QA9B 4HDIA 1YMMD 3LN4A 4UTBL 1LP9F 5IWLA 3KJ4B 4FFVD 4M5YH 1R3IH 3Q1SH 3MRNA 5C09A 5EBGA 3ZKQD 2QSCL 3SE8L 4F37F 4R0LB 3OKMA 1AGDB 3O11A 1HHJA 1NEZA 1T4KA 4P99A 2E3VA 5ADOL 1DN0B 1YPZB 5IFHH 4P49A 3VXRD 4OGAD 1A7PL 1I8LC 4K7PX 4Z7VA 2C3VA 1NCCH 2EEBA 2DL2A 3O6MH 5FEBA 3ALXA 5C6PB 3TO4C 1RHHB 3GSVA 4HWBH 4Z7VB 4GRLB 1K4CB 2E9WA 4FQIL 1J1XL 5EUOF 5GRVL 4P2YA 2ATKB 4XTRD 4BQ9A 4PTTA 4ERSH 5E99L 4HWNA 3AM8A 1N5AB 3G6AB 4PTUB 3Q1SL 2HMID 5JDSA 2HMIC 1RFDL 2FZ3A 2IADA 3BZ4A 4S1QH 2VH5H 2B0SL 4O2CA 2NTFA 3CNKA 2VXSL 1NLDH 1G6RL 3HUJE 4OGXH 4FNLL 4W6XB 2P5WD 3X11A 2DTMH 2Y25A 4GKZB 5C08D 2HJLA 2ZUWA 1OAQL 4LLVB 5EU5B 3WL9B 3SDAB 2FH6A 4MSWB 1MJ8L 1VFBA 3W0WB 4ZFGH 1CQKA 3AY4C 1TVBA 1GZPB 4OGAC 3HE7A 3B5GA 1E6OL 5GRWA 3QCTH 1J12A 1WT5A 3VRIB 4Y88A 3BE1H 3QUXC 5GGTA 5TE4H 3JTSB 4V1DE 1DQTA 4H1LH 1AO7A 3QUXD 3TIDA 2YD1A 4OD1L 5IW3A 3RUGB 5K9KA 3NPZB 4PY7A 1G6RB 4LLDB 3RDTC 3S98A 1IEHA 5B4MD 4X6BA 2ZPKL 1J1PL 4MA3B 1EMTL 3VFWB 5ITFB 5KTEH 3D18B 3SY0A 5D7JA 1CGTA 4ZUSB 3W5MA 3QI9D 4JY5L 1AGFB 3B8SA 3QI9C 4XNXL 2CKBA 2X4PB 3E6HA 2NY7H 5IVXE 2B5IB 4QYOB 3IKCA 3ECBB 4YHMH 2OK0H 5HGAB 3LEXA 1SBSL 4N9GB 4KV5E 5F96H 1U8LB 5CS7A 1E6JL 4YZFE 5DHVH 1RVFL 2HTLC 4TUOB 1NDGA 1M71B 3ZSSA 5KS9B 4JG0L 2QQLL 2V17H 1QSZA 2ZG3A 3N85L 4S1DC 3IF1B 1UYWL 1HXYA 1S7XA 3UPAA 5CZXC 4KAQL 1X4ZA 2NZ9D 3V5HA 4QXUH 5FUCC 3SE3C 1TZIB 4RSVA 2MWCA 4Y19B 1HI6B 1FNAA 3SDDB 5IKCB 4ODUB 1HYSD 4HUXA 3MA9L 3AXLB 4C58B 1NFIB 3I84A 3EBAA 4DGIL 3UAJD 1FSKC 4B5EA 1EVTC 4P2QA 2DI9A 4GRMA 3QR2A 3L3DB 2ZSWB 4JFQB 2VZ3A 2YUZA 4JZOA 1CLZH 1C12A 4ERSL 5DEZA 3TYGL 3SCMD 3SGJA 4GUPB 3EO0B 5D7LD 1RQ5A 3U36B 2NY3C 4PD4J 2R4RL 2G2RB 4Y5YB 4WTZA 4ZYKA 3S35X 3BDBA 1S9VA 5KS9E 2W92A 3BYYA 4MDIA 1JZ8A 4J4PC 4G6AC 4CU7A 2YA2A 5E8DH 4WUKL 4E42B 1U3HA 4PV8A 3BHBA 1DQML 3E3QC 3BAEH 5ADOH 1G1CA 3CZFA 1ZANL 2Y4SA 1I85A 3OL2A 2V2WA 4TUJB 4ZNEE 4NQVB 4PRHA 5DRWB 2XWTA 4HBCH 2EDRA 1PSKH 1LO4H 5F1IA 3VG9B 2P8LB 3OAYK 4H88L 2ADJB 3SGDI 4QNPF 1IEAA 1E6OH 4NZTL 4KJWC 3JWOC 4EQ3A 4K55A 3OSKA 3GJFK 5GS0H 4TUOA 2NY5L 3RU8H 4ZUUA 5IESL 5D71L 2DBJA 4UMGA 1WZLA 3LPWA 4XPTL 5F8QC 2IH1A 1K5NB 3GFUA 3O8XD 5TH2B 1S3KL 4OZGF 1F3JB 3W2DH 1OAZL 1R5IA 1C8PA 3GMQB 2VLLB 4NP4L 2X4PA 1KIQA 4OCYH 2YXMA 4OFDA 4HGMA 5D2NB 4KXZH 4L3EE 2A6IB 1DN2A 5D1XD 1CVSC 4AQ1B 1JP5A 1TZGL 3PP3H 1DUYB 4RISH 1NUNB 1RIUH 3U46A 4OCRL 4WHTA 2DQGH 4PB9L 3LB6D 4PR5B 4GJTB 2VL5B 4U1KB 4PY7B 5D4QA 5IFJA 1A6ZA 3VFMA 4UUJB 25C8H 3LDBB 3KYKH 3V52L 3T0DA 5DRXA 4EXKA 2BMKA 1CG9B 2ZUQB 5GGRB 1X5GA 4C56B 2DBLH 4XPTH 3FQXB 1N6UA 3FT3A 1SJHA 3KYMA 1HILB 5FHAL 5HHME 4Y19D 5GRXG 2EKJA 2GT9B 4R9HA 4KXZI 3ZT7A 5KS9F 3EOTH 2DICA 1B90A 3OKLA 2L7UA 3AM8C 4HK0B 1CIDA 4GAYB 1IRAY 3RZCD 3WS6C 2ZUXA 2BVUA 5E4IA 3PIQB 5ACMA 1FL6A 4KKCC 4R4FH 1E4KA 2OZ4A 3BEWB 2BSED 2R69H 1RZFL 2Q87A 4M93C 2O5ZL 4GRWE 1N6QL 1FVDA 4JFDE 2BOCB 1JNNH 3RZWA 4DUVA 1DBJL 2IFFL 3GGWA 3HFML 3IFPA 2IADB 2OMNA 5DRZB 2IANE 2VKXA 4PP2B 2GY7B 4H8WL 3ALWA 4LSVL 4O5LH 5EO9B 2ZCHL 1YY9D 2BSTA 3LIZH 4OCXL 5IVXB 1FYTE 1PX3A 3A67L 1CE1L 3V6FA 3TZVD 5FYJU 4OZHE 2J8OA 4CNIA 4GKNA 3BT2L 4YHNB 4ENED 2AV1A 3O2VL 3WCYA 4BJLA 4N8PA 3CXDH 3N1GC 1JL8A 2MHAA 4Q6IC 3DUHA 3VG9C 4OM0L 1INQB 4MA8H 1UCBH 5DHXB 3C5SB 4KPHH 3O9WA 5H37H 2H6PB 2XN9A 4IRJC 4ETQA 3TBTA 3TZVB 2OLDA 2CO7B 4L8SC 1ZHNB 1H15A 1IM9D 2CDFB 2Z92B 4NO5A 4OAWB 4PJAF 4XRCA 5L2KD 3DECA 5EU7C 4KKCD 4XT1C 4XAWH 1UXSB 1AE6L 1NC2A 1I9IH 3FT2A 4E41D 1LE5A 3NCJH 4Y5VB 2EE6A 4I3RL 3QUXB 4O2FA 2A0LD 2X4OB 2HT2C 3O2DL 1MFBH 1EHLH 2G5BB 2Y36L 5FCUL 4ZODA 1FVEA 4KROD 4I48B 1MWAH 3MLWH 5BZDB 5I74B 4HT1L 4EIGB 5L2KB 4QRTA 2CRMA 4DN4L 5FIEA 3OKNA 2KBGA 3STLA 2A2QT 5EO0A 1LVEA 4MXVF 4LBEB 1WFUA 1K9TA 2PO6B 3KLHD 4JHZA 5I6XB 5E2VL 4U1GC 4CADA 3I6KB 1AHWC 1U91A 3AB0B 1CXHA 5I8OL 1UA6H 5MEPA 4XWGL 4OD3L 1CR9L 3U82B 1FRGH 2JIXA 4OIIL 1PBYA 1R5WB 5M7QA 1NMBH 4Z7UA 5F7MC 5JHDD 4JDTL 4JFDD 3G5XA 2RQ8A 4QRPD 5L6YL 5EBLB 4MA3A 4S1RH 5E8PA 1AGCB 5KVFH 2YPLB 4YX2L 4JFFE 2IG2L 1TVHB 1U92A 3ARDC 5BV7L 3BE1L 3D3VE 5L2KE 3PWLB 1U58A 4MXQC 2AJZA 3MV8B 3QCVL 1BX2B 1KLGB 2HKHH 4D0CB 1GAFL 5FA4A 5IQ9A 4I0KA 1BOYA 4XX1G 1FNGA 2PR4H 4NQXB 5IT2H 5EOQL 1DVFA 1OSZA 4UIKH 3N9GH 5HHVH 3ROOB 3VRLE 3CFCL 4U2YA 2Q7YA 2R8SH 5BW7A 2G75B 1OSZB 2GI7A 3TO2B 4HJJH 4KVCL 5C08A 3ARPA 4P23B 4PJBF 1M05A 4K94C 3L7EA 1CTNA 3JUYA 5BV7B 1QLEL 1I8IB 1YJDL 5DJ0B 2VZUA 3TT3L 2CKBH 2CH8A 2F8OA 1GAFH 1XF5A 4IDJL 5D7JD 1NDMB 4I77H 2EH7H 2VLKD 3N1MC 4XHQA 4RGND 4AH2A 3D39E 3BP5A 5HPOA 3DGGB 1KEMH 3KPLB 5MHSE 3MMEB 4OB5L 4OFVA 5FUZH 1NCAL 4FOMA 3R1GH 4MWFB 5D7KE 3BSZL 1OP5H 3PGFL 1QPPA 4P48A 3V5DB 8FABB 2R2BB 5LJYH 2VC2L 4LSRL 3TYFA 4Z7QF 1BM3H 1AD0A 4YFDB 3T0AA 4BH8B 4J3WA 1HCVA 2V5TA 3QH3B 1T5XB 2GITA 2VLKB 4AIZB 3P0YH 2BVYA 1N8ZA 1Y18B 4GRWB 4I4WA 5DO2D 1HNGA 3WMSA 4Z78A 2V7NA 1BWMA 4JFED 1NCUA 4D9RE 5K9JL 1FVCA 1CFNA 4NZUH 5SV3A 5JOFB 1TZHB 4JPIB 4LQFH 4L3EB 1OGTA 1QYGH 5I75B 1INDH 5FM5M 1YMHB 4WDIB 1EAPA 4UDUA 3EGSB 4LKCA 3BKJL 3I75B 2YUXA 1LEIB 2JK5B 1D5ZB 3FFDB 4X98B 5GJTH 3MXVL 4R3SA 4W6WB 4J7RA 1JGEB 5IJVA 1RZ8B 2NY1C 5IMLB 2FX9H 5IMMA 1KB9J 2C5DC 2Z92A 2ZJSL 4YHPA 2AKRB 4JRYA 4X6DA 1OHQA 2EECA 4MX7B 5K9QI 3C5SA 5JNYA 3LQAC 4Z5RA 5C0IA 5J3HD 1SJEA 3G04B 2WBJD 3QXDA 1VKXA 4DWHA 4Q9QL 3BWUC 4KVNH 1PYWA 4PJ8A 4PRBB 5F7LB 3O0RL 2FWOA 3V6FB 1RK0A 2H2PC 5C0CE 1R6VA 4Q9QH 4F7PA 5C0ND 1KT2A 4I2XA 3KPPA 4JPWH 4PGEA 4ELMB 4AENB 1NGYA 4K8RH 3Q6FB 1U42A 3HUJF 4I0PD 3WYRA 1LEGA 4JKPL 9CGTA 5CJBA 3HNSL 3GSXA 4KI5F 2XZAL 3M8OL 1TCMA 3IJHA 3RRQA 1PQZA 2APXA 4OF5A 5I30L 5I71C 1F6LL 5BRZB 4PJFA 4M1GL 1I1CA 1BJ1J 4J1UB 2WP3O 4BSVA 3NH7H 1T80A 3ZE0E 2XNAB 4JHAL 5I8CA 1JBJA 1K3ZA 4G9FD 1JGVH 4HHAB 4IRJB 2RB8A 3BD3A 5TDOB 1HNFA 3ARFA 4DKEH 3GNML 1CD1A 1UVQA 3DXAB 3V7AE 2Y5TA 1MRDL 5CCKH 3NFSH 1KN2H 3HLAA 1U93B 3Q5YA 3R4DA 4NRYB 1W72A 4U7KA 2F54D 4LFHG 1IGIL 2VDRH 3VXNA 5DHYB 1NC4D 4G9FB 3MV9D 4K7PL 5I66B 4NQCA 1JRHI 3RQ3A 1HHKB 1NGPL 5FYKH 5JHLL 2H2PD 3KS0J 3ARGD 4JLRB 2HRPL 5EA0H 3KPNA 3EOAA 4JFHE 1AGCA 1RIVH 3VRJB 5D7IA 5I1JL 1U0QA 5HYJD 1GRWA 3UTPE 4DKDC 1KJ2H 4I3GA 1X5JA 3AB0C 2AXGB 4P4RB 3AU1A 3KHQA 2L0DA 3INUL 2XFXA 1P4BH 5I18H 2CR6A 3U30C 5E5UB 3IGAA 1K5NA 1V7NH 4WTWA 4JZJB 3TT3H 5ICYA 3E6FA 1KYOK 2MKLC 1RZIB 4JO1L 2IPTH 4CMMB 2CKNA 1J10A 3EDDA 3C60B 4LCIH 3TH4T 4NKIH 3FONB 4X4YB 1YNTB 4OUUA 5T33H 1DBKL 3ARFC 1TFHA 1AHWB 4X99A 4AEFA 5EA0L 5JIKA 1NCNA 5HGHA 2P8LA 3G9VA 4M62L 4L4VD 2CMRL 2VDKL 4MA1C 2COQA 1MCEA 2ZCHH 2VAJA 3TO4A 3BMVA 4KH2A 5EO1B 2D31B 5FV2A 4GMSL 4PRHB 3T08A 3LV3A 5EZOH 4O51B 1YN7B 2W38A 5JIHA 4K23L 4NZRH 3Q6GH 3MYJA 2IG2H 1KCKA 2IPUK 4YX2H 1RY7B 2XV6B 1K2DB 3QDGA 2B4CC 1CK0H 3MNWB 3T4YB 5KSVA 5KZCB 5DEFB 1ES0B 4MD4A 5I1EL 4F33A 3FFCE 1S9VB 4Z7WB 4NYLB 5CIPA 5B22A 1T66C 4JFPB 1MY7A 4LK4A 4XZUB 3QO1B 4EZMA 3WHXA 1AI1H 4HUUB 3TGXA 2X4UA 4EVNB 2MHAB 5HHNA 4OFYD 1C5CH 2DQTH 3GSOB 4LPUA 4MDJA 2Z35B 1KCUL 3GI8H 3UMTA 2DD8L 2APFA 1G7IB 1CXKA 4WW2A 5DXWA 3K46A 1VPOH 1C5BH 4NHCL 4V2BA 4A6YA 3NABH 3BP4B 3TBWA 1B4RA 1DE4B 1G84A 4WUUD 4XCYB 4LPTA 1VACA 4D9RD 1ZHBA 3CDFA 4X8JA 4H1LA 2R0WH 4Q74A 2HG5A 1Z0MA 1CQYA 3HMXL 4NUGH 2HN7A 3VWKB 4Z7WE 4YDVA 3KYNB 4WHYH 3QWRD 3VXRE 4OZGE 4NFDA 1CD1B 1UVQB 2C7UB 4KKLD 4N0FA 3V8OA 5DMKB 1MJJA 2QQLH 2P5WA 1L7IH 1V7MH 3GZKA 5GGQH 5KJRL 1RUKH 3O45A 1RZJH 4X9FA 3HG1E 4Y16C 2YSSB 2EXYC 1IQWL 3FQXA 2HKHL 3QFDB 3IDXL 4JREB 4M7LL 4P5MA 1WQVT 3QFJB 3MO1A 4G8EA 4Z0BH 4JY4B 5HHOA 4NZTH 4QRRE 5L8LB 2FLBT 1HIMH 3MGOA 4K3DL 4XMKL 1DE4A 3SDAC 5F9WC 1VGEH 4ZQKB 4K71C 5C8JB 2H3NA 4OI9A 2ARWA 3G6JA 3QEUA 1JK8A 2WUCL 4L3AA 4OV6F 3RGVB 2MKWA 1ZVSB 1CFSB 4HIIA 5EUOB 5TQ0L 3BW9B 2CUHA 4S10A 2GIYA 1PVHA 2N7BA 4RIRA 3G04A 2LU7A 3QNYA 3HC0B 2VR9A 2EDYA 4OM1L 3H3PL 1RJYB 1PDKA 5C0EA 4OCWH 2BJMH 2J6EH 1D5XA 2VDML 4POUB 3D3VD 3FO9A 4P57B 5EZLA 3QDGB 2E9JA 1RZ8A 3HB3D 4GQ9H 4IJ3C 3B5HA 3CH1A 4EOWL 4ZO6A 1T2QH 1NJ9A 4MNGE 2EH7L 3UTTA 2WANA 5KVDH 4K3HA 1KNOA 2IPKB 4XCNA 3BIAX 3P73B 5J1AA 3DO7B 4KK9D 1MHEA 5DTFB 1LO3H 3Q0HA 5F97E 4EUPH 5ELIA 4ZG1A 1J8HD 3S3SA 2DN7A 2ZKHH 1J0ZA 5L8JB 2IPUG 4OZIA 2OJEA 4QRRD 4K8RC 3JTTA 4X80H 3QUMA 4RISL 4FHBD 2XQBL 2F58H 1H8SA 2GITB 2VLKA 3GSVB 3OZ9H 4UQ3A 5KW9L 3S36X 3QNZB 4TOYH 5GGRY 3BDXA 5GGSA 3SEPA 4I0CC 4MJID 3D69A 2XZCL 5DVNA 2XRAL 1LD9A 5FYJH 5HPMA 1JFQL 1NSNH 3V7AG 4F2MA 1DTUA 1X6LA 1MSPA 1QFWH 4MWFA 5C0DB 1EPFA 1JJUA 4RDQF 2FH8A 2R1YB 2E7CA 5AZEL 1BVZA 4XVUD 3TLRA 5HI5C 1TIUA 5JHLH 2H32H 3ULVF 1XGYH 5D8JL 5CWSA 1ZA6A 1HI6A 5JDJA 5FAAA 2YPKA 2VJXA 3UTSB 2W0PA 4X7SH 3PF2A 1TTGA 1CICC 1CZ8H 4WEBL 5IHZB 3IF1A 3SGKC 3RVVC 3E0GA 1ACYH 1U6AL 2G75A 2IAMB 4RRPG 3KLAA 3WXWL 4RMUA 1QKZL 5L0QB 3N50A 4MNHA 3HNVL 4YHKL 1A21A 1KUMA 1AKJA 4DN3H 4D0CA 1LE9A 4HH8A 5DS8B 1JZ7A 4ACPA 1G1YA 4ZOBA 3IB4A 3VXSA 4L3CA 3O3AA 2PXYC 4RCAA 4WUUB 3GKWH 2ZOKB 3NIDF 4Q6IB 2JJWA 2YN3A 1F8TL 4H25B 4U1JB 2XZAH 3M8OH 1PQZB 1BD2B 3ME0A 3HCVA 5IMOB 1YQVL 3SY0B 3S8WA 4G7YL 5JW5B 3Q6FA 4FQLL 1CU4H 5EBLA 5IJKA 4BQ6A 3L3KB 4RX4A 5K93A 1NAKH 3AS1A 3HC3H 2YC1A 3TBVB 1A7RL 3NFNA 2Y7QB 3EYQD 3LEYH 3IDJB 1N26A 4U49A 1NGPH 1QO3B 2VQ1A 2ZCLH 5DWUL 1NC4B 3VXME 2GSIA 4R2GB 1XGQA 4CBPA 2HLAA 3K7UA 5IEKA 2EE9A 1PKQB 1QEWA 2RGSA 1FSKB 4M4RA 5C0IB 5J4MA 4YHOL 1JNHB 3DVGA 5DR5L 4WV1B 2XWJA 1N5YL 2YZ1A 3B6SB 3F6IA 3GBML 2FJHB 1U8JB 4HUWB 2PN5A 1GGBL 1EIBA 3SO3B 4KZEL 3W11C 1MIEH 4DUWA 4HEME 1U8PA 5IB5A 5HDQL 1XAUA 4PJEB 1KCRL 4HXBH 4FQQB 2G9HA 1YMHA 1C16B 1W8OA 2X9WA 4FRWA 5C3TA 2EIEA 1NUDA 1A3RH 2K7QA 5I76B 4LSUL 4QHUB 3LRHA 5T33L 4L4VE 3P11L 5F7WC 1BQHB 2UWEE 5KG9B 5FM4A 3W9DB 2DQDL 2IPTL 5IOPA 4F15B 1F4WH 1T5XA 2Y23A 4M5ZL 2NPLX 2GTWA 2K3TA 3EJZD 1QFWM 4EDWL 5KN5A 2ZUSA 2HRLA 3TP4A 2BVPA 1G9EA 4MJIA 3WNOA 4CNIB 1IC5L 2R2BA 2VLRE 2GK2A 3ZDYF 3PWUA 3RDTD 3VFSB 3R1GL 5EWIH 4XP1H 4A2LA 1P84J 4HMDA 5FA3B 3FN9A 3NCCB 4S1SL 3NACH 1KEML 1T1WB 2ZKHL 2OJZL 4FQPA 4M6MH 3WXVL 2FBOJ 4QY8B 2CSPA 15C8L 4ZFZA 4H1LG 5C09B 4U33A 2A74B 3WKMH 4WU5B 1CD0A 4PJIE 3RWEB 3SPVB 4FTVB 4M6OH 3H9HB 1A3LL 4K9EH 4OIIH 5H2BA 3CVIH 3V0AC 3B9EA 2IF7A 3ARQA 3MV7A 3D6GA 2IFGA 4Y4FB 1NANI 4GAYA 5EC2A 1LGVA 3WSQH 1LWRA 1MCPL 4I3SH 5K9JH 5TGBA 4UB0H 3AS3A 5BXFA 1EJ6A 1V3KA 4LHJB 5DRNB 5C0CB 1ZT1A 4BSJA 3QSKB 3MOAL 1SJHB 5LCVL 5FECB 4G43A 3KPRA 4NJAH 3GB7A 4ELME 4RDQG 1RD6A 5D1QA 2EDOA 3WEXB 1QSED 5HVHB 4R2GC 4G6FB 4XNMA 4HS3A 2XXCB 5ACZB 2H45A 1N2RB 1DANU 2YPLA 1FDLH 3NCEB 4PR5A 1VENA 1CLYL 1SMAA 3BPOB 3BXNB 2DQEL 3P30L 1H3UA 1HIML 5HI4D 3VW3H 1ODAA 3A6CH 1X4XA 4MJ5A 4TSAH 3MGTB 2C4FU 1FH5H 1R5IB 1M1SA 5D5MA 2ZG1A 4HUKB 2K1MA 2VITB 1LP9E 3QG6B 5JO5B 4G42B 1T04A 4M43L 3U1SH 1JZ2A 3S88L 2GAZA 3IETB 4L4TB 4UBDD 3QO1A 5IP4A 1TJHL 2XT1B 4ZUUB 3ARTA 5CJOL 1YUHA 2V9RA 4I9WD 4IIQB 1FLTX 4NKDB 5I9QC 4BZ2H 3ILPB 3PDGA 1VFUA 4PP1D 2MMXA 4GXVH 2VRAA 4XI5D 5EB9A 1Q9WB 3QWRA 1LK2B 3ILQD 3MV7D 1K3IA 3S34L 2VYRE 1ZA3B 1YN7A 1LEKB 5F7EL 3W5NA 3O4OC 3LHPH 2NY6B 2A73A 2CIKA 3QIBD 3MV8D 2BNQD 4L9LC 3TO4B 1TJIH 2Z4QA 1JMXA 3RDTB 1KELL 2Z8WC 5CEYA 1MRDH 5CCKL 1EUTA 3MRPA 3O3BA 1R5VA 3UZVB 3TBTB 3RDTA 2ADGB 2NX5E 2D03H 5C0BB 4XPBL 1A6UH 2AXFB 5ANME 2F15A 3D9AH 4LHUD 1UENA 3U0PA 1RZIA 2NY3D 4DW2H 3RNKB 2ICCA 4XPAL 4M1CC 3O3EB 1T2XA 3UPRA 1T22B 4Z76B 1NUGA 4YO0A 5C0NC 5J06A 1MCKA 3OAZH 5E5MA 4J3OC 1ITBB 5D70L 1OQXA 3O41B 1CLZL 3DROA 4Y2OA 3X3FH 3ULUL 2SEBA 4HULB 3SDDA 4QOKE 5EU4B 5FGSA 5IG7A 4YGVA 3VD7A 3D0VB 5FF6A 1UFUA 3L3OB 5DRZA 3V5HB 4Z0XA 5IM7B 2D7NA 1EGJL 4Z77A 4U3XA 2FR4A 1WAAE 2XKNB 5C0BE 1V05A 3GNMH 3P2TA 2I07B 3V6OC 1UZ8B 4WV1C 3D1MC 1IC7L 4GW5A 1OGAB 3QAZB 3FB5B 4U7SA 1TENA 1LO2H 4U6VL 5J56B 1PLGH 4JO1H 4BQ8A 5HGAA 3REVA 1S9YB 3ARYA 1PKOA 4NO3B 3LEXB 3V2AR 2CQVA 5EIIA 2GAZB 1MFDH 1IAKA 3IETA 4WJ5B 3BKYH 3GB7B 1MCIA 5C07B 3U0TA 3T2QA 1MLCA 3BZEA 1CT8B 4KDWA 3RAJH 1NGQH 2JLLA 5F3BA 3AROA 3SOBL 1T5WA 1SVCP 3MRHB 5ITFA 4NM4H 5EORH 4PLKC 4GFTB 4HG4K 1I8KB 2FBJL 5DJDB 3L3GA 4IIQC 3VFOA 4PJEE 5L0QC 1EHXA 4O4YH 1T21A 2J8UE 3RWDB 3RUGA 3GRWL 2IANB 3L95B 4MD0B 4ENEC 3KPPB 4PY8J 5IW6A 1BFSA 3LH2L 4LLDA 4YFLF 5HY9B 2X89D 3DYMA 3VH8A 3TPKA 4QWWD 2XZQH 3MV01 5JORB 2ZNWA 4NC1C 5EU6A 3ET9F 2B7DT 2ICES 1AGBB 5AAWA 3CVHA 2R69L 4HJ0D 5B21A 5FYKU 5AG8A 5B3JF 3LZFH 5D7KD 5F96L 1JHLL 3OXSB 4Y4FA 2HT4C 2VLRB 2BDNH 4UILH 5F7FA 3SKMA 1EEZA 4YHML 1NCBH 5FYLH 1PX4A 1X5XA 1FL3A 3HTLX 3PWVA 3DMMD 1GVIA 1Q94A 1QR4A 5DLMH 1UEMA 2AJ3B 3C5ZC 4P5TB 4PJHE 1FPTH 3MLUL 4R90L 1KPVB 4JN2A 4HKBA 1JZ5A 3NCJL 5DJXA 1AE6H 1WAAF 5BOPA 1S8DB 3QQ3A 5EZIL 5A2IH 3FB7B 4U1IA 1G0DA 2MQCA 1HHHA 3WHE1 4NWTH 3WKML 1QVOA 5D6DA 3LAFA 4C59B 5MEOA 1U3HB 4PV8B 5SWQA 2OXGA 4I4WB 4ZTOL 4Y4KB 5FK9B 4QT5B 2HKFL 4FZEH 3HUJB 3T2OA 4L8CB 2HP4A 3LOWA 2V5RA 4QWWC 1X5FA 3C5ZA 1SM3H 5GHWH 3EO0A 4FQ1L 4LHQB 5CP3A 4ALAH 3C87A 2OTUB 4PG2C 3VFGL 1OOAA 1EBAA 3UEZA 3QULA 1KTKE 4OCXH 2BNQB 1MAML 1MI5A 4JM2A 3B2UC 5CGYC 4ZDHA 3CUPA 5FGCB 3B2UD 4PRPE 1MNUL 3PXHA 5F88A 2AGJL 3VDCA 5AUMB 3CMOH 3IU4H 1BVKB 2KUTA 2CLZB 4XP5L 1Q0YL 4Y19A 3V0VB 5EFIA 1G7QA 1GPOL 4U6HA 3W82A 2O61A 5DUPH 3LMJH 3CX5J 5E2WH 4OD1H 3WLBA 4NBYB 3ZHKA 4Y7MA 3HMWL 3KR3L 4NKOB 4YJZL 3CC5A 2QEJA 2OR9H 3R8BB 3LY6A 1I9RL 4QRSB 2Q76B 1AXTL 3RY6A 2PF6A 4FQ2H 4X6CA 4R97C 1CDUA 2GSIB 5GRUL 4D0BA 5K9QG 3JXAA 3D5OF 3FN0L 5E7FA 4KK6D 3QDMA 4LARL 5C0AA 3B9DA 2EDTA 5J9PB 1N0XH 3CH8A 4PRPB 5IVXF 3RIFK 2Q8BL 3GMRB 4PUBL 3JUZA 1E4KC 5F71A 3QQ4A 4LGPB 3L3KA 1NFDB 4HMCA 5CGYD 2QR0B 3MSPA 3QUZD 2IBZY 2PYEA 1YEEH 2LAAA 3ARDD 4IDJH 4MXVE 4OSUH 2EYTA 1PZ5B 1I7RA 5HJ3B 3VXTB 1ZT7B 4G6JH 2K7PA 1EFXB 1KJ3L 2ZNXA 3B5TA 5FCSH 4ZD3L 4FQJH 1QHPA 2AEIT 3N1PC 3VFNA 2JIXB 3PWPE 3ZL4H 4HWBL 1WIUA 1K8IB 4WI3A 2X4RB 3I6KA 4F7MB 3VH8G 1FV1B 3V4VH 1SY6H 3QG7L 3CUPB 2X4QB 3KLAB 1MI5B 4ZDHB 3HZVB 4WWKA 2DWEA 5IJKC 1BFVL 4LPVA 2ZUYA 5BVPL 4DGYL 4HLZH 4X6CE 1FFNB 2ESVA 3ULSA 4EDXB 3BO8A 1U2CA 3NFPA 4V2CB 2VH5L 2ZCKH 3QXWA 4C4KT 4AIOA 4RGNC 4I5BB 4PBWD 4ISVB 1A2YA 4HF5L 4Y5VA 3HG1D 3IDNA 2HFGL 2R23A 2EXWC 1G7HB 4XBGB 3CX5K 1F4AA 1FNEA 2ERJC 3SGEI 1EDQA 1M7DB 4F58H 4UNVA 4HD9A 3F62A 1ORQA 5ESAA 3UPCA 2B2XH 3DMMB 1X9QA 2BSSB 3TJEH 4AK1A 1EH9A 5FHAH 1MAMH 2UZYB 2V5MA 1BZ9A 2LVEA 3VFUA 43CAA 4F3FA 1RHHA 3MUY1 4X5WA 4EBQL 4PJBA 1DL7H 4ZFFA 2AXHA 1MI5E 1NGWB 3NZ8B 1BPVA 2ICWA 3CK0H 4LIQH 1P4LA 5J6HA 5SX4I 3HPLA 2OL3L 4WFHD 2GJZA 5DYOB 2E8YA 3FMGL 3BP6B 3TVMD 1RIUL 2Z9TA 4LDOB 1WUNT 1HKLH 3OKMB 2XQBH 1S7VB 5HI5D 4GLRI 3T0VA 5I8KH 5IB4A 1UWEH 1L0QA 1F42A 4LOUD 2GK0A 5BOZG 3LN4B 2P46B 5F9OH 1Q94B 2FRGP 2WV3A 2OZ4L 3BUYB 3J7HA 1W2KT 5A16A 5JLZA 3UTTB 1CICD 5MENA 5I17A 4M1DH 4J12A 4APQD 4OBRA 3CSYB 4R0LC 1MWAA 3BQUB 4BQCA 5HYQA 3GMLB 1WFOA 4M7ZC 3OX8B 1QSFE 4PJHA 4M3JA 3PV7A 4MJ6A 1X5IA 4UILL 3MRHA 1BQLL 1J1OL 1MUJB 2WBJC 3CFDB 3F12B 2GT9A 3PL6A 4JDZB 2JJSC 5B39A 4JAMA 3SE3A 5FB8A 2GFBB 1J0YA 3IRPX 2CRYA 5FO7B 5FOBA 4NOFA 1CFSA 2OTWA 2N4IA 3O45B 4XVTL 2R56H 1K8DB 1XMWA 5IB3B 3VXUB 5KSBB 1SEBA 3FL7A 2H3NB 4P2RA 3DUSB 4ZQKA 3LS4L 1ZSDB 3I50H 4U1GB 3JWDC 5E2TH 1XGTB 4LVEA 1I7UB 3O8XB 1L9NA 3BUYA 1I1YB 1T3FB 1D7FA 5EIVA 3PQYA 3QP3A 1MF2L 2AV7B 3GMPB 5D2LF 1BZ7B 1F4HA 4TULH 3P9MB 5DFVD 5EBWA 3O4LE 1F3JA 5LKNA 2ZG2A 4JVWA 2GTZB 4RWYH 2SEBB 1XH3A 1BGXL 4A6YB 1T1YB 5F9WB 3WJLC 1ZKAA 4PGDB 5ESQA 3IJSB 1T83C 2CPCA 5DMKA 4DKFH 1MJUL 1RUML 5INDB 2F5BH 5E5MB 4WW2B 4PJEF 1AY1L 4TNWF 2ICWB 4OZ4A 2XKNA 3I85A 1WTGT 4H1LB 2VXSH 4J3VA 4A2MA 2B0SH 3ZYJA 1OT2A 3L3OA 1OP5K 4JHBA 4Y1AD 1I9IL 3H42H 1L7TL 1UM5H 3BP4A 2BVEA 2WQ8A 3DLQR 3LN9A 1BBJA 3UJJH 4BUHA 3STZA 1IM9B 1ZTXH 2NCMA 5E8NA 5JA8B 5E99H 2YD7A 3FKUS 3MR9A 1RUMH 4M6ML 5B8CB 3EFFB 5GRYA 2KKQA 1G9NL 4K2UH 3MJ9A 2OM5A 3SGEH 4ZS6C 4S2SB 1HINL 1YMMA 2YBRA 1FLRH 3IDGB 3H9SE 5BMFL 4Y1AA 5C3LD 2VZVA 3MX0A 5HGHB 1HKFA 4D2NA 1MFCH 2MOVA 3THML 4OT1L 1UJTA 3BQUC 3ZTNL 1J1PH 3BQUD 2FL5A 2O26U 1NAMB 1CLYH 1YUHB 3C8DA 5CD3B 2DDQH 1UQSB 2UV3A 3T0XA 2DQIL 4OF7A 3HMXA 1UJ3B 4Z8FH 1CLOL 3HZKA 2Y07H 3H6JA 5HYFA 3F7VA 1EO8L 3DSFL 1JNJA 4R90H 5JIPA 2BNRB 1F90L 2VDOL 2DM3A 2DQIH 1KJ2B 3SGDH 3TT1H 2AS5M 1I7ZA 5FGRA 5DFTA 3GSNH 5CLTA 4MHHI 5CJ8A 3LEVL 5J57B 2VQUA 4LP5A 5D7IB 3CXHJ 1CDJA 3L6FB 2R29H 2IWGA 2VXTL 3OV6A 4M8QB 4G3YL 4Y2DC 5BVJB 4J2XA 4YBHA 4UT7H 1QSVA 1DVFD 4CVZB 1KJMB 2VE6B 5EN2B 5D1QB 5FDWB 3QXAB 5B38B 7CGTA 4XHJD 3EYVB 3HE6B 2UZIH 1TTFA 3MLRL 3B9KA 4J3XA 1G0XA 3CMOL 3PL6D 1AKJB 5ID0A 3X12B 1IAOB 1TQBB 3NGBB 1UB5B 1HHIA 1GSMA 1ROWA 5IBTL 3VRJA 4PREA 4UU9B 1TDQA 3ARFB 4NIKB 5GIRA 4PRNB 1K4DA 4PG2A 2YD5A 1XGUA 4XNYL 2R15A 3H9HA 5H2BB 1B0WA 3G6DL 2XIDA 4ZUWB 3WD5L 4Q9RH 1LDPL 4O58H 3CU1A 4J8RB 1ZHKA 4YK4B 1QP1A 3WV0A 5EU3A 3GSXB 3RY6C 1A0QL 1RU9L 2J2ZA 5LCVH 4NN5B 3S96A 3SDDD 4UINL 4LSTL 1ORSB 4O2EA 3KPSB 4LLUA 4C56E 2JKXA 1KN2L 2F19L 1D5MB 3DARA 3CDGB 4OKVB 4S11A 1S7SB 1A6AB 4G6JL 4MJIB 2ZOLB 3H7LA 1JWMB 1WEJH 1FBIL 1HOCA 5DLML 1FNSH 3H0TB 4UTBH 2F5AL 4PB0L 3QXDB 4X6FB 1VKXB 4QXTA 4MJ6B 4TSAL 4H8WC 4M03A 2F8VA 5SWQB 4KZEH 3DVIA 4UINH 1B4JL 1RZ7L 3L5WA 2X4SB 1H3WM 2IH3B 4ELMF 1V3LA 1ZLVK 1CXIA 1RUPH 4G8IA 3MLYH 5EOCL 3DX6A 3QQ3B 5HYSB 4EUPB 2HFEB 4PS4H 4YC2B 1NBYB 1T0MB 2JELH 3C6LB 4DVRL 2DYPA 5C2BL 4KRNA 2MNUA 5CJQH 1AXTH 4ZPTB 5ALCH 5H94A 3O4OB 1BQSA 5IOPB 2GJ6E 4LU5H 1SJEB 4TTGA 3VCLA 3LPGA 3X3GH 3HZYA 4KC3B 3A0OA 4KVNL 2VLRA 5KAQG 4MJIE 3BN9D 3DVGB 3WIIL 4X80L 3VXPB 2MCG1 3ZKXB 4QHUA 1GHFL 2AABH 3UYPA 4QO1A 3HI1B 3SOBH 1CL7L 3MBEB 4RAVA 2D3VA 5AG9A 1N3NB 1D5BB 1S5IH 5CBEA 1MCDA 1NC4A 4L1DA 4GW1B 3EYSL 5KSBE 3QEGL 5IB5B 1JPGA 5E1AB 2W0KA 4L4VA 4CVUA 1AKJD 3GSRB 2V5SA 4NQCD 1ORQB 2OQJA 4MS8C 4LVOB 4MD0A 2FGZA 3WS3B 4UT6L 3MBXH 4HUVA 1NEUA 1L4IA 1GIGH 4DKFL 3EDEA 3HNVH 4MA7H 2VIRA 3O4LB 2J3SA 4GXUN 4RAUA 5GGUB 1NDMA 1N5YH 3ZKND 4HJGB 4PYGA 1AO7D 3U2SA 3QJFA 1HXMB 1CT8A 1HOCB 2XWBB 3BKCH 5T5NF 1MCNA 1AD0B 1QRNB 5JQHC 3U4AA 2VKWA 3WE6A 3UJIL 2DQFA 3DI2B 5FGCE 1T7WA 5KSUB 4OGYL 3V5DA 1OTUC 1JN6B 4PFEA 4RRPA 1EO5A 1JVKA 3QXUA 3OXRB 3TO2A 2YWYA 4Y89A 1ZGLA 3MACH 2H9GB 3EYOB 3GJFH 3VXMA 1FGNL 4PJ5B 3BP5B 4F57H 4OGYH 1JPSH 5JUEL 3UJTH 4M5YL 3IFLH 3WFDH 4MAUL 4FZ8L 4UAOB 4PJCB 3MLSH 2NXZC 2R2EB 3TPUA 3S5LA 1FLRL 1U58B 3TM6A 5ILTL 3L7EB 2R1WB 1VACB 3QCUL 4YGVB 1Z6JT 2XPGB 1A1NA 3IRZA 1BLNA 5FDYA 2ENSA 4UT9L 2CK0L 4WI2A 3ULVD 1F6AA 3KXFB 5TE6H 3G5ZB 1GOHA 1A22B 5DI8A 5IIEA 3OF6D 1IVLA 3VXSE 3TJHD 4M3KB 5KSUA 1LNUB 3LSOA 1H3PL 1YEFL 3P9LB 3O2DH 2VR5A 5FA4B 5IQ9B 3UZEA 1J8KA 3CFJB 3D69B 2UY6A 2AJZB 2D7OA 2PXYD 4ZO7A 4HWBA 4FP8H 4ODXB 4UQ3B 3RI5K 4WEBH 1DJSA 2XWBA 3QEHA 4HX1B 1IM3B 5I1GH 1OTUD 1MCSA 3K80A 2ENYA 1RJLA 3HE7C 3FCTB 3BOVA 4JFYB 3PG2A 2DIBA 4KK5D 3DETD 3ULUH 1IAIM 5D1XA 1I1RA 4U1SB 4H0IA 4IOFD 2OQJB 3GSNB 1I8MB 3VGFA 2Q8BH 1IGYA 5GPRA 3OBAA 1Y0LB 3P77A 3DHJA 1MHEB 2I25N 1C5CL 4M7KH 4R4NC 2N7AA 3WLWC 5LVEA 1MREH 3ARGB 4M5ZH 2UYLB 2FNBA 3GIVB 3WS6A 2R1XB 3HI1A 3PNWB 5I74C 4LCYA 4OZIB 2VDQH 5IB2A 4DKAA 2R56L 4FN0A 3GIZH 4F8TA 1KBGH 4N5ED 5CJXC 1FE8L 1OW0A 1EBPA 2PW1A 1U8MB 3RGVD 1KB5L 3OJVC 4QXGH 1JWSA 1SHMA 2HFEA 4U6XA 3CCHB 2V7HA 2W9EH 5D7LB 3IU4L 4DOHE 3ARBA 2X4SA 4F9LA 4HW6A 2HT3C 4QOKD 5DJ6A 1MCPH 4FQHA 3VXOA 2CJUH 2VABA 1QRKA 1XF3B 1MCOH 1OSPL 3C5JA 3T1FB 4FQXC 5JPMB 1LO0H 1T20A 4JQVA 4X6FA 4JLRA 1UJ3C 4MNGA 5FOJA 3HC0A 2BCKB 4NRXB 4UNTA 4H0GA 4GBXB 3QFDA 4I9WE 1FL3B 5T1MB 3H0TA 1P7KA 4JKMA 1ZT1B 1EEZB 1P5UA 2NYYD 4E0RB 1JWMA 4QCIA 4KGLA 3OAYH 2IBGA 4O2EB 5E70A 3PIQA 4HS8H 3HLAB 4UV4H 4PGDA 5ESQB 5ACLA 3ULUD 5GISH 1A6TB 4YH6A 3FQUA 1A64A 4HIJB 5EU6D 4ZOAA 1BZ7A 3IFPB 1OTSC 3FAXA 4MXQD 3DTXB 4P9HH 3E8UL 3G6JE 4J1UA 5IW6B 1U8HA 2C3XA 3VI4E 3BX7C 3VFTA 1MCLA 1XGTA 1QFHA 2VL5A 4HGKC 4U1KA 5J6GB 1S7TA 4TVPH 2A83A 4WU7B 2FJGA 3LRSA 5T5NG 2ED9A 1N6QH 1DQJB 1MJJB 2DI7A 4P2OC 1OD7A 5E6ZA 3ETBF 1FFOA 3WXWH 4XC3H 3RBSA 1FCGA 5BCAA 2WLYA 3OKDB 4ELKA 2HN7B 1ED3A 3QI9B 5HHXL 4C56A 3QXAA 5B38A 5FB8B 5HHNB 5C71A 2BMKB 4KTDL 2P5WE 3QIBC 3HE6A 1BFOA 4PRBA 3REWA 5MP6H 1JTOA 3F12A 4ONGH 4GBXA 3UAJC 5CIPB 4R96A 1X5KA 2PKDA 2XTJD 2NY1D 3S34H 1P6FA 4WHTB 4F33B 3NCBB 2I5YH 4V1DD 3B2VH 3EHBC 3VXOB 2Q3ZA 5BS0B 5C9JA 4BH7A 3MBEC 4YPGA 2CRIA 3QO0A 3T1FA 3WUZA 1OAKL 4JCLA 5HHQA 1VHPA 4ODHH 3O9WD 4LLWB 4QHKJ 2Q7NA 4OI8A 4XX1E 3OJMB 3QZWB 2JJTC 3MRFA 2PW1B 4LPCA 4JDVB 2AJYL 5DQDH 1UQSA 4AT6B 3CJJA 2V2WB 1SJVA 5CBAA 2FL5B 4HXAH 2HKFH 5CGMA 4P3DB 4HPYL 4LCYB 5HDOA 1ND0B 1KN4L 4LAQL 4OUUB 4RMVA 4WRLA 1T22A 4PYHA 1D6VH 4TUKH 4Z76A 1S9XA 1CD8A 1NCTA 4LMQE 2I27N 4MCYA 1ADQL 2ID5A 3ARDB 4K3EL 5GRZA 3D85D 4FFZH 2YBRB 5IWLC 4KUCF 1N4XL 1WICA 4JQIH 4PJGB 2AEPH 4LEXL 4MNQB 5I8EA 2WMPA 4MLSA 3NFNB 3AU1B 4S2SA 1S7UB 2UVEA 1BWWA 3VFRB 4NBXB 5E8NB 2NY5C 4GRMB 4BFEA 4M02A 4OLUL 1F4YH 5CUSL 4AEIH 4JFYA 3HCVB 5IMOA 1CZ8L 4D8PB 3VMOA 2QHRH 4CDGC 2YPLD 1KGCE 4H0HB 3MJ7A 1T89C 1ZA3A 3EJYD 3CFJA 3ULVE 4P5TD 3PJSA 4M7JH 3REWB 5E2JA 3F7QA 4OTXH 1S7XB 5IFAL 3P40A 4MB3A 2XA8H 1W72B 4PLKD 3T65B 3LQMA 4ORGB 1F02I 3G9AB 4LSUH 4YLQT 3VFVA 1X4YA 3OR7B 4Y1AE 1TETH 2VXVH 3H9SA 5DVOA 1YMME 2KDGA 4AEIL 2YXFA 3RIFF 1QOKA 1HE7A 2XPGA 3OR6A 1K8IA 1YEKL 3ARSA 5DHVB 4FQXB 4QRPE 1FNGB 5BV7C 1OB1A 2VITA 4XP9H 1A6PA 2FJFA 3AREA 5D7IE 5FKPB 1I1AB 4CVXB 2F58L 1QNZL 1RZJC 3VGGA 4HJ0C 1AFVH 1HDMB 4WW2F 1U93A 3B83A 4U1LB 4L8SA 5E8PB 4YHZH 1C7TA 3JV4A 3N1FC 2DQCH 3UTQA 2YPVH 5DD0H 5IB3A 5ACZA 1G6RH 3GJFB 2XG4A 4KZDH 1NLDL 5KSBA 1XGRB 4JG0H 4UIKL 4RGNE 2AJSH 1KTDA 3LEYL 1RFDH 3RVXD 4L9LA 1AQDA 2EYRA 1H9VA 4LVNC 1P7KB 4TVSa 5F1SA 1DQDH 1LD9B 1YJDC 2H8PB 1H0DB 1YC7A 3QCVH 1F3DH 4X9HA 5DD5H 3O4LA 2GJ6A 5DDHA 1G9MC 1LEGB 3U83A 3LB6C 4G80B 4JRXB 3PQYE 3STLB 1RZGA 4PGEB 4F57L 4POZD 5JLZB 2DOCA 4NC0B 3MCG1 1NCWH 3HNTH 5IMLA 2VLRD 4LSPH 3RWEA 1T66D 2VXUH 1D5ZA 4OZFB 4PRIB 5DJCA 2W65B 1FVEB 2VZOA 4OGZA 3HAEA 2NTFB 1FRGL 2JJUA 4YHKH 4L4VB 3RWFA 4D0DB 3RWJA 1MHPH 3RPKA 5T3XE 1I4FA 2VXUL 4EQ2A 1NL0L 3EDKA 4YBQC 4KK8C 4NUJA 4AEHH 3MBEA 4X4ZA 3SDAA 2YN5A 3HZYB 1IGJB 4DK3A 3K2UH 1B88A 3MRJB 4NFCA 4OB5H 3NZ8A 5D2LE 2AK4B 5H94B 1I3VA 1JV5A 1P4LB 4FXGA 4LVHB 5DZOA 2QQQA 2NXYC 5BQ7B 2EC9T 5TE7L 1NGWA 5JW4N 4ODVL 2VLJA 3EGSA 4ZFOB 2ED7A 5F7EH 2JIXD 2X1WL 1F6FB 4OGXL 3HE6C 4X7CC 3BW9A 2M26A 4JRYE 2HT2D 1G7PB 43CAB 4KJQD 5IHUL 2CMRH 1OGTB 1ZVSA 1IGYB 4X0KA 2DIAA 4YHOH 4XBGA 4CVWA 2R23B 3QEQD 2VL4A 3M07A 4KKLC 4RAHA 5DJAA 4Z78B 5M95B 4HPYH 2IH3A 4RGMB 2X1XR 3LQAL 5F7HA 5HGDB 1NLBH 1YEGL 1XEDA 2R0ZH 3ZL4L 3MRNB 3FQWA 3HMXH 1XCQA 4GAGH 5FGBC 2VZ1A 1BOGA 3C6SA 3IJYA 3RTQA 3CFCH 5C0FB 3TV3H 4QRQB 4GRLA 2X5PA 3N9GL 3QIBB 4IEFB 1Q0XH 3UC0H 5GGSY 4KKBD 1JNLH 4IRSA 2ESVB 4ODWB 1H0DA 3O3UN 1HEZA 4Q9BA 3BO8B 3TA3A 3WN5C 2V2TB 1KIPA 5D2LB 4MAYC 3WIHL 3PL6C 4JE4B 4KHTH 3RJQB 5BZWB 1LNUA 3LSOB 4LSRH 4PJBE 5D70H 3DGGA 2R0LL 5IIEB 1JZ6A 1MCOL 1OSPH 2VAAA 2YWZA 5IF0B 4R0LA 1N0XL 3GO1H 3T3ME 4KJYA 1UG9A 2VQ1B 5CILL 5CZVL 3FT3B 3TBSA 4ZMAT 3HPJB 1UZ6E 3QT2A 4GQ9L 4HDIB 5FYJL 3T4AA 2KQMA 4OCSL 4YHYB 1QR1A 1QUNA 4JR9H 5FYKE 1WT5C 4PRNA 1IT9H 5IFJB 3IDIB 1M7IB 3AY4A 5JW5A 4NC1E 3VFOB 3BGMA 1H5BB 1KG0A 3DIFB 5SWZB 3TFKD 1KOAA 1NLBL 1YEGH 3KPTA 1T5WB 1DCLA 1HHGB 3OR7A 4X7SL 2PTTB 1CFVH 3U9UA 1JF6A 4G5ZL 1RU9H 1V3JA 2X70A 4Z7WF 1KPUA 4WO4C 2BSRB 5F7DB 4JQIL 3WE6B 5T1LD 1T1XA 1A9BA 1LO3L 1X7QB 4RWHA 1HXMA 3GO1L 4ZUVA 1UM6L 1ADQH 4CVZA 1BEYL 2QKIB 3G6DH 1P4IH 1OLZA 4GAFB 3QUZC 4X8XA 3CLEL 1KN4H 1Z0NA 4K8RD 4WW2C 2KH2B 1BBDL 2VDMH 4CU8A 5JMOC 3HI6H 2EICA 1DANT 4AM0A 5D96B 2Q8AL 4I77L 1P4IL 4GMTL 4MA1B 1F8TH 2BNRA 4Z77B 4FXKA 1RI8A 2WNGA 2PYEE 5KW9H 1CF8H 3MJ9H 4NNXB 5I18L 4TVPE 3MUGB 1IAIH 1YEHL 3FT2B 1LE5B 4YR6B 4HKJB 4X99B 2JELL 4DVRH 1ZWIA 3SQOH 3TFKC 2E6QA 1NAMA 2XXMB 1WBZB 1E4XH 1GC1H 2E8ZA 2D2OA 3SJVB 3GUTA 1OAXL 3E6FB 4KK9C 3NCFB 4LOUC 3FO0L 4CAGA 1WIPA 1OAUH 4NN6B 5E4EB 2WIIA 2XFXB 4Y4KA 5ABDE 1BQHG 3IDGA 4PJ8D 3VWKC 3MUHL 1GC1C 4MAUH 1GGBH 4FFZL 4JEGB 1QFWI 4CGTA 4K94H 1RZFH 4KI5E 1MFBL 4PJIB 4EI5D 5JW4M 4NZUL 1ZLUH 3FB7A 4Z7UF 4Y19E 5DR5H 3MR9B 4ZS7H 1HHHB 4X7EC 1IAIL 1YEHH 1KIRB 2X10A 4PJCF 5T1LA 5EBMB 3SJVD 1DZBA 4KDTC 1HQRA 4RGOL 3KPOA 2F53E 1JWUB 4TRPH 1BREA 1Q72H 5I15L 3KPMB 3MTRA 4UIMB 5KSAB 4NQCB 4WCYH 4UDTB 1UA6L 3MJ8B 3MCKA 4P2RE 4AY0A 2ORBH 3GRWH 3PQYD 2DQJL 3WDIA 7FABL 1W0WB 2XICA 3UTOA 2VUOA 1D5XB 3O2VH 3MRLB 2FBJH 2FEDC 4S1SH 3SDCD 1PAMA 2OSLB 1EAJA 1ZGLM 1MPAL 5F7KC 1CU4L 1U8LA 4NO0B 1A4JB 1CE1H 5F7YC 5AD0B 1RUAH 3C6LC 1I4FB 4UT6H 4PLOB 4OZHA 3BKYL 5E08H 1V3MA 3DVNB 4L1HA 3OKOB 3IKCB 1QSFA 5MERA 1WGOA 4J8RA 3EO1B 5D5MB 5JORA 4ZAKD 2X09A 4F7TA 1CFVL 4I3RH 2DQUH 3K8LA 2GHWB 4KHXL 4OZFH 4MYWB 4LCIL 3RWCA 4X7TA 3D25B 1JGDB 1TXKA 3SBWC 1WWAX 1I1FB 1T0PB 2Q20A 1CYGA 3QB7C 3TN0A 3IFOA 4JFDA 4XNZC 3FO2B 3RWCB 2OTWB 2VWEC 4XNMB 2DLHA 1J18A 1UCBL 4YHLH 3X14B 4F7PB 3KYMB 4P5MB 3RI5F 3CLFL 1KIQB 2HJKB 1HWGB 3UCRA 1MLCB 3BZEB 3BGFB 3MREB 1JPTL 5C1MB 1WZKA 2C4FT 4XBEL 3RIAF 4LGRB 3KAAA 4KY1H 3MXWL 4APQB 2MCPH 2WUCH 4EIZC 5EU6E 5TGBB 4M62H 2DI8A 4IMKA 1WJ3A 1TETL 2JB5L 4A6YL 2F53A 4HC1L 3KYNA 4PJHB 3C5JB 5HDBF 1VERA 3MXWH 1ZLUK 4YHPB 4YBLB 4GKZA 4NGHL 1HDMA 1BECA 4YDIL 3RY4A 2J8UA 3OAUH 4WIQA 1CE6B 2PXYB 5TF0A 3TO4D 2FJFB 3MJ8A 3WBDA 2VC2H 5KSAA 5GXBB 5TE4L 1IAII 3CCHA 3KNBA 1IKNC 3MOBL 3HC3L 1EZVY 5HVFB 4HFUL 3DRQB 4I18A 3INUH 2BHZA 3TCLB 1TZHA 4ESKA 2XZZA 4P2QD 1GIGL 1IC4L 3MRCB 2UZXB 2OSLA 4K9EL 2B4CH 3HI5H 3QUZB 2ZUTA 3GSOA 5J6HB 3PGCB 5KSAD 4GT7A 1BFTA 1J87A 5CP3H 1DSFH 3PJSB 5DD3H 2VNCA 4FFWC 2ESVD 1E28A 3BKJH 3VRLF 1LDPH 1JWUA 5C0BA 3I6LE 4JGMA 5KVDL 4LSSH 1WAAA 3DV6B 1FNEB 5A43C 3CZFB 1C08A 3PWPA 1K2DA 5IUSA 2X9YA 3MMEA 3R8QA 3MRPB 3O11B 2P5ED 2BNRE 3VFRA 3DV6A 4HFUH 1I9JL 3UZQA 1G7HA 4I5BA 4JCMA 4QOKA 2VDNH 5FHBH 4Y5YA 5CJ5A 2G60L 1RJZB 5J12C 3ABZA 3ZZ1A 3NAAH 4JHWH 1NGXB 4EDXA 1U2HA 1TNMA 2DM7A 4JFOA 5HDLA 4JFFB 3QUKB 3X13B 1C12B 3R06A 3S3JA 3QUZA 1IBGH 1M71A 1S9XB 5KS9A 4YXKL 4GAJH 3MGAA 5C0AE 2I5YL 3OF6A 3P9WB 3ULUC 4NKDA 2AEWA 2F54B 1ZWIB 1UXWB 3G5ZA 2ZUUA 4LF3A 5TFSL 3CDYA 3WIHH 3NIGF 1P9MA 1ZVHA 5A2LH 3AGVA 3RUGF 1X7QA 4HF5H 4OD3H 5DJZB 3EOBA 3MGTA 2Z91B 5FYLD 2FHFA 5HHQB 1UH4A 3F5WB 1KCVH 3SQOL 4LSTH 4WNQA 4BH7B 3TBYB 1H5BA 2RIKA 3EYUH 2IMNA 1IGCH 1S5HB 1YEJH 1ZS8B 4GOSA 4U6TA 3O6LL 5B8CC 1BVLA 2AI0H 4X4XB 2ZJSH 1BIIB 2EEAA 1W0VB 3OB8A 5CZVH 2C3WA 1M6OB 4XHJC 3DBXA 5J9PA 2DQFB 3H7BB 1JGLH 2EXYD 1T2QL 5MEQA 2LV4A 5DK3A 1FORL 3OKDA 5DC4B 3DV4A 3DX9B 2B39A 4YWGL 5DMIL 1SEQL 1RIVL 3M17A 2WINA 4X6BB 3TIEB 3F58L 1UKSA 1MWAB 1FZMB 3LS5H 3SN6N 2BVTA 3SPVA 1J0IA 3VFTB 1ZK9A 3HR5A 3EZ8A 3CX2A 3UJIH 3FOLB 4ODBD 5IB4B 3HE7B 3SO5A 2I9LB 3X17A 5GRUH 1ZHLB 1AR1C 1P7QB 4ELMA 5B3NA 3HB3C 2VLJE 1AR1D 5GS0D 5GGVL 2QLVB 5BZWA 4JM2B 4HXBL 5C2UB 5FUOH 4RBPK 5D2LA 3LKPA 1MWAL 3MLWL 4RWYL 3HC4L 1SYSB 2JJTA 1MIEL 2OTUA 4M1GH 5F70A 5FCUH 2BVPB 4DFHA 5DSCB 4GMSH 4PV9B 5DJ2A 4LSQH 4NRXA 1UWXK 2WQRA 1GCFA 5KVGL 1E4XL 5FK9A 3EYSH 3LRGA 5M94B 5I0ZA 5HGDA 1G7JA 3SBWA 1QVOB 4LAQH 1PG7H 5DD0L 3TN0C 1WWCA 4PJIA 3DNKA 3UBXG 35C8L 4XGZB 2FECL 1C16A 1INEL 5HI3D 4AIXA 5HHOD 5LBSH 4Z95H 1WCBA 3FOLA 2V7HB 1ITCA 2EC8A 1YYML 1WBXB 4ZFOA 1I7TA 4PRHD 4PJEA 4XP9L 2YD2A 5HXMA 3MRIA 4BSWB 4OZFA 4NO2A 4GQPH 4K2UL 1JV5B 1FVCB 5JOFA 5DVLA 5GZOD 4NWUH 2XQYG 1FC1A 4U0QB 3ES6B 2FJHA 4G7YH 3B6SA 1VPOL 5DC0A 3LIZL 1ZHLA 3JVGA 5JUEH 3PHOB 1PJ9A 1YEEL 1XGQB 3JWOH 3S4SG 3T8XA 5GJSH 3RVWC 5TJWK 3MACL 2UWEA 5IEKB 3ARBC 2XYCA 4EN3D 2AJSL 2P8PB 3RWJB 5E8OA 1RSFA 1UT9A 1DEEB 1UH2A 3O6LH 1QRND 5C0RL 4G8FB 4XPGL 4YDKH 1Y0LA 3IDJA 2VDPH 4N8VB 3RWDA 3S6CA 4NM8H 1FE8H 1TJGH 4HCRL 4U1SA 4MZ2A 4ODTH 3GJFA 5LWYH 3CFKA 3LKNA 3TN0D 4AMKL 4QRPA 4TVPD 3C8KA 4K23H 5DVMA 3ZKNC 4L8BA 4HT1H 5F7UA 4HIXH 1BAFH 4PLJC 1I8IA 5DJ0A 2XKSA 3RL2A 3B9KB 5C0AB 4L3CB 2BSRA 4NO3A 2X70B 4TNWK 4HWEL 4PJHF 1R3JB 3S37H 4YEEA 4P4KC 1UXWA 2BXZA 2VMFA 3RX8A 1V8HA 1YY9C 2Q76A 2F74B 4XVJH 4X5XB 4N0FB 1RK1B 4PD4K 2XI9A 4JHWL 4E41B 1MAKA 1EX0A 5DD5L 4OFPA 4PBXA 3FHQA 5DZNA 3W0WD 1O5DT 1Z9LA 3QUKA 5ANMA 5FHBL 4XWGH 2Z91A 2YPKB 1OP3K 5I8OH 1ZHBB 3ZYIA 3ZYOA 5IW1A 4FP8L 3V7MA 1UWGH 2UZIL 2EZ0D 1VFAA 2OP4L 4PJFF 5EC1B 2FIRT 4OJFH 4N8VG 5I16A 5I1DA 5F88B 4HSQA 3U4EA 4UTAH 1WSST 3RIAK 5D7IF 4DZBB 3O3EA 3ARVA 4AG4H 3LDBC 5EG6C 3LEVH 5HDBE 4YO0B 3NZHL 2AJVH 4NDMA 3FQRA 3HAEH 5A2FA 2RFXB 3HRZA 4HUUA 5ILTH 5F6HJ 3FFCB 3ZDXE 4GUPA 4XAWL 1UC6A 4E41E 2V17L 4KJQC 1DDHA 3F6LA 1R5VB 3EIFA 2MPAL 1QYGL 4Z8FL 2VXVL 2DM4A 5L88L 1IGFH 3SDYH 1UEYA 5CEYB 2WBKA 5B8CA 2WWMC 2YUVA 1Z9OA 3O3BB 3ULVH 1LP9A 1NL0H 3FRUB 3DRQA 4RFNB 2HH0L 4XB8A 3FB6A 5IVOA 2A77L 1LEKA 2EE2A 1AD9A 3IVKA 2FSEA 2YMXL 5BQ7A 3CH1B 1NC2D 4IRJD 2YHGA 5E2VH 5EOCH 1J8HB 3MLYL 3ARDA 3C8HA 4L8DA 2MFNA 5HHPB 2QADC 4QRUB 5HGBA 2H6PA 2KQNA 2XN9B 2QJDA 1FIGL 5INDA 3KPRE 1BJ1H 3RNQA 5HHMB 5C0EB 3TA3C 3WN5A 2BP3A 1Q38A 5CBAB 5J1SC 2J4WL 2B1HL 2AJUL 4OZIE 3QG6A 5JO5A 5TF1H 1RMFL 5D72H 3BAEL 3MZTA 1FQ9C 2ZZUT 4XPHL 3MV7E 2J8UB 3BEVB 3KJ4C 1S5IL 4ELKB 3TVMB 4OT1H 1NFKA 4MJ2A 1MCBA 5D7SL 2JB6A 3QG7H 3MLPA 1WIOA 5IESH 4X7TB 4NJ9H 4HS3B 5HHMD 5HHVL 1VA9A 2EDDA 1N2RA 3MLXH 4LLQA 2AK4D 5F89A 5FV1L 4K3JH 1YNLH 4KK6C 5F3HB 1F97A 1QSFB 5MERB 5T5FH 1NKOA 2BC4B 1X5AA 4FQCH 4WI7A 3S4SB 1CBVL 1FL6B 4NRYA 4HS6A 1F2XK 2OI9B 5ICXB 3QUYB 1ZT4B 3IFOB 2IMMA 2VISA 4C83B 5CHNB 3U6RB 1RZ7H 1S9KC 4U1LA 5KANG 4OLEA 4IRJA 5GSRA 3FQNB 4JFHD 4PRDB 4CVXA 4AJ0A 1D3CA 1ZLSH 4PJFB 3SE9H 2WAHA 3J8F7 3EO1A 3O6ML 4ZSOB 3KPMA 4UIMA 2J88L 4JO2H 1FNSL 4UUJA 5CLWA 4KKAD 3PGFH 4XPAH 5IM7A 4UT7L 3BSZH 3ROLB 1I3UA 5J13C 4OLWL 1KIRA 2XY2A 3ULUF 3I3BA 5FYLL 3S3PA 4HC1A 4PTUA 2R9HC 1EZVX 3KYAA 4P2OD 4G6KH 2HLFD 4ORGA 3VFVB 1VEPA 3I3DA 2GJZB 5DYOA 3S36H 4TULL 4NM8L 1OAXH 3GMQA 4Z7NF 3E8UH 2WIIB 5KN5B 3SE9L 3SCMA 2NZIA 2DB8A 4XCFL 5CGTA 4Z7WA 4N5UA 1CL7H 5D6CB 4JFPA 1BQHA 2IAMC 2DJSA 4MD5B 3WIIH 3ZKXC 1ES0A 3MYJB 4MD4B 4O02H 3RZCB 1PZUB 3O9WC 1T83A 1UH3A 4KPHL 1G7LB 5E5RB 3NIDE 5LQBL 5ADPH 4H5SB 1SBSH 3LN5A 3QCTL 4BFGA 5BMFH 4PY8I 5K9OB 4TN9A 4Y5XC 3SCMC 3ZDXF 3CXDL 3HZKB 1HK6A 3AS2A 3D0LB 4ZOCA 4FZ8H 1I8MA 3ZT5A 4KQ3L 2FEEL 3BT2H 1KTLA 2AEQL 3SE4C 4BZ1L 4TRPL 4X4YA 3TVMC 4HUWA 1SMOA 4JRXD 1A1MA 1ZLWH 2XWJB 4P3DA 1YEIH 3OKYA 2GQHA 2X4QA 3CPLB 4HFWA 4IS6B 4M9OA 4ZS7L 3VD5A 4ZYKB 3S35L 2MTPA 3O6FB 3FFCA 1Y6MR 3S37L 4P46A 4WY7H 3RVUD 4U6YB 1ONQB 2N56A 3PHQA 2P7TA 4DZBA 1J0KA 3U9UB 5KVEL 2VWEE 1ZT7A 1A6WL 1U95A 4JQXA 5E0QA 3KPLA 2EYTB 5I1DB 4DN4H 2W9LA 3WUWB 2YK1L 4MNQE 4UOJA 4AH2B 5EC1A 2A38A 5IKCA 1WK0A 1OAYH 3VDAA 3D85B 3EOTL 2X9XA 4KRPD 1TZIA 2B5IC 1E0OB 3MLSL 3RHWK 1NKRA 3QZWG 3WHE0 4OZIF 5JOEA 3GMRA 1FGVL 1MCWM 1OARH 4EN3B 5F7DA 3VI4F 4XPGH 4LLAA 5GSVA 3E1F1 5FUZL 3TBSB 2DAVA 1OVZA 3VD9A 3RWGA 2WM0A 3W9EB 2Q86B 4XCEB 4X6CB 4LRNL 5IBLD