2L4OA

Solution structure of the streptococcus pneumoniae rrgb pilus backbone d1 domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
175
structure length
175
Chain Sequence
b'METASAATVFAAGTTTTSVTVHKLLATDGDMDKIANELETGNYAGNKVGVLPANAKEIAGVMFVWTNTNNEIIDENGQTLGVNIDPQTFKLSGAMPATAMKKLTEAEGAKFNTANLPAAKYKIYEIHSLSTYVGEDGATLTGSKAVPIEIELPLNDVVDAHVYPKNTEAKPKILE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell wall surface anchor family protein
publication title Solution structure of the Streptococcus pneumoniae RrgB pilus backbone D1 domain: in vivo protection and implications for the molecular mechanisms of pilus polymerization
rcsb
source organism Streptococcus pneumoniae
molecule tags Cell adhesion
total genus 25
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2010-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2l4oA00
4DN3H 3O8XB 2EZ0C 4IMKC 2RAMA 5DFVD 4ONHB 3MBEB 5GHWL 3ULVL 2NY1D 5H35A 3RVWD 1CD1A 4UOJA 3S7GA 1J0YA 4GG8B 2D7MA 3B5HA 3DUSA 3PWPB 5DC0A 3EOTH 1NMCB 4F7EA 1YNKH 1U3ZA 1KJ2L 5BCAA 1CXKA 2D2OA 3TP4A 4ALAH 1CFSB 3RKDD 4YFLF 1XR8B 4XNUH 4JPIA 5DJZB 4AEIH 4UIKL 1DUYB 4GRWB 5DRWA 3LKQB 4AQ1B 1HE7A 2VOTA 2GCYA 2ZJSH 4NRXB 4NQDA 2R1YB 2X9XA 5FYJD 5F7EL 4IOIB 2DJSA 4QRSB 3RTQC 2NY5C 1U6AH 5K9KA 3CFDB 4P59H 4ZOEA 1UWEH 2F54D 4MZ3A 1QFWL 1I8MA 2NXZD 4W4OA 5J6GA 4UDTB 2V7NA 4MNHA 2WLYA 1ZMYA 3HR6A 3EOBA 3NN8B 3VGBA 4P2YA 1QBLH 3E6FB 5KVGH 3SKNB 5D2LE 1SVCP 3HUJF 1GL4B 4XC1H 1NC4D 5ICXB 3B6SB 4HF5L 5C2UB 1BECA 1KB9J 1AI1H 2D0FA 3UTQA 3DETD 1MAML 3RWFB 3C6LC 3FO0H 1A7OH 1FNEA 3LV3B 5FYLL 1MHCB 2XWBB 1EPFA 4HMCA 3CMOL 3D48R 3ZTJH 4M43H 3K4DA 1J11A 2FD6L 3BE1H 3ZHDA 4HT1L 1MRFH 3H42H 3BWUC 1PQZB 2G75B 4H0GA 2NYYD 4Y16B 2YRPA 3C8DA 2A73B 2Q86B 5IMMB 1IM3B 2WBKA 5HYJB 1A22B 1F6FB 4DQOH 2F74A 1DDHB 3OMZA 4EDWL 5FM5O 3MJ9H 5ESQA 1TTGA 4AL8H 4QLRA 5J6HA 1EZVY 1F4WL 2DQHH 3Q1SL 4G6FD 1CE1H 3LRGA 3BPOB 5IP4A 2CR6A 1OAYL 2N4IA 3ISWA 1KLUB 4PJEE 4G9DA 2HKHH 1E4KA 2CLRA 5ALBH 4XVUC 2WSKA 1MPAL 1T7ZA 4IDLA 4UQ2B 4WO4A 5DLMH 5FGCE 4ODXA 2R2BB 4GXUN 4LKXA 5I74B 1DVFD 3MRJB 3ARRA 1CXFA 1SM3L 5F7HA 5HYEA 3UTSE 5C0CB 2GT9A 4X4XB 3BKML 3VMOA 4HWZA 3C60A 4Y5XB 4HUVA 3CVHL 4ZQKB 1OGTA 4GAFB 4UV7L 3LEXB 1VACA 5A2JH 2A83B 2Q8AH 4WW2B 4QXGL 3O4OC 1KEGL 4I0KA 2J7LA 2V9TA 4N0CD 2H3NB 5CGTA 4L8SA 1UZ8B 3HR5A 4YHYB 1MRDH 5BRZE 4RAUA 1FDLH 4BFIA 2ZZUT 1J1OH 5IR1A 1N64H 1YEEH 3BMWA 1G7HB 2XZQH 1UYWL 5CGYD 3UXFA 5DD5H 4JRXB 1MFDL 3NFSL 1C16A 1T0NA 5F9DC 2YPVH 3TO4D 1BQUA 1JYWA 3TC9A 3TZVD 1O5DT 3AUVA 1AJ7L 4BFGA 4Q9QL 3N06B 5CZKA 2XNAB 3T04D 3KHQA 3F6LA 3VFSA 4NQXA 3RZWA 4PJBE 3NFPA 4X6CA 4QRPD 4UTAL 4X6FA 4EDXB 3V6OE 3RKPA 2NX5E 3BX7C 3MYJA 4ODWA 1A6ZA 2ILLA 3GSRA 2MCPL 2CDFB 2OI9C 2W07A 4WTXA 3MQIA 4DCQA 4A6YA 5I18L 5IFJB 3L5XL 1KENL 3QUZC 5FDYA 3BZDA 3MRRA 2GUOA 4XHJC 4BH8A 2DIJA 4LPUA 1FRGH 1CCZA 3CSGA 5LWYL 3OB8A 4UAOB 1IAIM 4DKAA 3O6FD 1NFDE 1XGUA 3ARFA 2Y6SD 4PJ7A 1OTTD 1FG2A 3IDXH 3G5VA 5HGBA 2P5WB 2X2YA 5IEHB 2O61B 4BSWA 2LQRA 3BZFA 4MQSB 3PWNB 5DTFA 3TBSA 3DIFA 2ZCHH 5CMAB 3QB7C 2R56L 4NKIL 1IAIH 2E9WA 3PV7A 2WMPA 4HIXH 2A9ML 4ZXBB 1JZ3A 1S78D 1CD8A 5KVDH 1IILE 5L2JB 1Y18A 3FQWA 4JFEB 5DEGB 3DRQA 1HILA 5MEOA 1SY6A 3E3QE 2R23A 3ARDD 3LH2L 1DQLH 3QUMA 4G3YH 3B3IB 4P9HL 2HVJA 1WAAF 3G6JA 5IJVA 3O41A 3WJLA 3WNMA 2VLRB 4YHNB 1DCLA 4APQC 3O3EB 4GW5B 4JHWH 1GC1C 4OGXL 4H1LB 5C09E 5J12C 5F7MC 4JM2F 4BK4A 4JLRA 3TZVA 2HFTA 2GHWB 4MD4A 2YD8A 2X4RB 1JMXA 1HHHB 5I1AB 3U4EB 4KZEH 1VGEL 4LK4A 4WUUE 3ULUD 12E8L 5SWQB 1JUFA 1R3JA 2SEBB 4J3OC 4NJAL 2ZG1A 1XF4B 4QCIB 4WENB 1OL0A 5C9KA 1NCWH 5L8KB 4K3DH 4N68A 4YX2L 1FIGL 2HJLA 3TO2B 4IM8A 8FABA 1DFBL 1U8IA 3K8LA 2AV7B 3BW9B 1K85A 4JR9L 2ZG3A 1EVTC 3MLWL 4LFHG 3UZQA 2NY1B 1DQDL 2PYEE 3MLVH 1YYLH 1IM9A 3AB0C 2YUZA 3R06A 2R2EA 2VDQH 3LQAH 4G43B 1MCFA 1ZHKA 3CXHK 5HI5D 1DSFL 2DTSA 4XPFH 3ZKXC 4YHLL 1ZVSA 1TFHA 3MLYL 1MHEA 5J7CC 2DL2A 2DIBA 3VFRA 1JZ7A 4AT6B 4X4YB 3GSNH 2HLFC 1GAFH 2OTUB 1EEYB 5K9JL 1BM3H 4ZOCA 5D7IA 1HKLL 5F7DA 1NC4B 1UFUA 4PJDF 1QBML 2G5RA 2Z92B 1IFHL 3VFPA 1I8IA 4EN3A 2P8LA 4PJIB 3S37L 4PREA 2Z4QB 1GH7A 5JLZB 3VFVA 1IC5L 4L8DA 1BFOA 1YJDL 4RGMC 5J13B 3RL2A 2DB8A 3D5OF 5ID0A 1HIML 4DUXA 5DEFB 1PSKL 4O02L 3L3OA 5IB4A 4DGYL 4K3EH 4K7PH 4NRZB 3AM8A 4LASH 5CP7B 4MYWB 3SJVA 5TQ0H 3MC0A 1HCVA 1CFNA 1Q38A 5KTEH 4G6MH 2HJFB 3QIUD 3MLRH 3V5DB 4QF1A 5ITBL 4WTZA 4F7PA 4ZFOA 3S5LB 3HC3H 4AIOA 1E6OH 2X4TA 2GSGA 5E1HB 3ZKNC 1HQ4B 5FYKE 5T5NF 1X6NA 4U6HB 3VXRE 3UTSD 2X5PA 2FWOA 3Q6FB 1NAKL 1T6VN 3ILPA 3MRNB 3GHBH 1KJ2H 1NFKA 1UVQB 4FMKA 4ZO8A 2X4SA 3T2NH 3MRKA 1JF5A 2YD6A 1QEWA 5F7LB 3MOAH 1BEYH 1LEKA 2GTZA 5BRZD 2VXTH 1ES0A 1LP9F 2R0ZH 1OGAE 5CEXB 1MWAH 3TFKD 3IKCB 2VLKE 1ORQB 2BP3A 5AG8A 1I1AD 4PTTB 1QYGL 1S7VB 1G7PA 4FFZH 4HBCL 5TJWK 3RGVC 2JELH 1DVFB 4UT7H 2F8XC 4X9FA 1ZT7B 4L29B 5BVPH 1B0RB 1NMCC 3PV6B 3UDWC 3D39A 3WFBL 4OQTL 5D1XC 5C92A 1S7XB 5T3XE 2FZ3A 1K8IA 3JBG7 3N1PC 2FGWH 3T1FB 5I0DA 3FQUB 4ZUUB 2X1QA 3T0EA 4FG6D 2VZ3A 1HN1A 1KCRL 4BJLA 3L7FB 1A5FH 1R5VA 5IB3B 5DQJB 3V0VA 5IROA 3IDGB 5GJSL 3GO1L 4PD4K 2IMNA 5IVXF 1BF2A 2NX5D 1OM3L 3UZEA 3I85A 2CRZA 1R6VA 5KSBB 3WNNA 4P46D 4ZTOH 4RX4A 5KSAD 3FB7A 4FXKA 3UJTH 2X7LA 2Z9TA 3TO4B 5KVFL 1CGTA 2XQBL 1JGLH 3IVKB 5B39A 3NA4A 1RUAL 3OSKA 4MX7B 1KSRA 4K7PY 3GK8L 4EXKA 1CE6A 3RWGA 3U0TB 3ZMRA 4C58B 1SJXA 1GGUA 3EYOA 1ED3B 4HC1H 4QRPB 1RUPL 1BIIA 5J89A 4LLYB 4ONOA 4EDWH 4HUMB 1QLFA 3IYLW 3O6MH 4MA3A 3KLAA 3MGTB 1URLA 2FIKA 1WC7A 1NCDH 2QQKH 2AK4E 5FGSA 2EDOA 2VDOH 4KKLC 3K4AA 3RAJH 3ULVE 4Y16C 2UVFA 3X3GH 5IF0A 3MJ7B 3DJ9A 5E6ID 1OLZA 1FZJB 4YDIH 2XWTB 2H9GA 4Z5RA 4DOHE 2IBBA 4I18B 4UT6H 2HWZL 4Q58C 5DRZB 1ZLUH 3OGCA 3H9SE 4MDIB 3O6FB 5EULV 2PW1A 5KAQF 1MCJA 3JTSA 3MNWB 2VJXA 3FOMB 1ZA6B 1YNTB 1DLFL 4YUEH 3CSBA 2EE9A 4O2EA 1OLLA 1BOGA 1DE4A 4HKBB 4I2XE 4NYLA 3ROLA 1CDYA 3GBLA 3KPNA 3A67L 3Q6GH 4PJFB 3MRHB 3UTZA 2VLJA 2HKFH 4ESKA 4NO2B 4JANB 4A2MA 4DZ8B 9CGTA 4ZPVB 3L3KA 3KYAA 3ARDB 5D7KE 3FFCE 5DHYB 1VCAA 1W0WB 3SDCA 1QNZL 2PR4H 4G9FA 4L4VA 2D3VA 3I9GH 2ICCA 2C3HA 4PJHE 1PKOA 4IRJA 5KG9A 3MJ9A 2R8SH 3ULSA 2CLZB 1T1ZA 3LKNA 4PRHE 4WW2C 5FYLE 1FL5A 5JDJA 1CZ8H 1G7LB 4MMXC 1ERNA 1AJ7H 3MLUH 3BXNB 2LVCA 1WZKA 1WSST 4YFDB 5B8CA 5D2NA 4YHYC 4GRLA 4LCYB 5K9OA 2PTVA 3BKCL 4PLKC 5HHNA 4QRUA 1U8QA 3OKEA 2A9NL 3IFPB 3L5IA 4C55A 1KCSL 2WIMA 2BK8A 3LKSB 1P9MC 2R1XB 2AXGA 1EHNA 5SWZE 4KPHL 4QHMA 5JNYA 3B43A 2R2HB 4ZFZB 1KJVB 2AERT 1TIUA 5I18H 1OTSD 4J2XA 4ODTH 5HHOE 1GIGH 2I5YH 2AK1L 3LQMA 4R0LA 2RCSH 4KMQA 4LCWE 1A6UL 3EJZC 4KJQD 3ZL4L 4EJ1C 5M95B 4XPBL 3VGDA 1BFTA 3GBMH 5JW4R 2I07B 1MCWM 2I25N 3QCTH 5D2LB 5HGHB 3CK0H 5C0FB 3QEUA 5HI3D 2DQDH 4RFEA 4JVWA 3DI3B 3MFFB 4Z8FH 1NGYA 3X11A 2YPKB 3UAJD 4OFKA 5E2VL 4ZYKB 4QT5B 3BQUD 4K23H 2ZPKH 2J8UF 1FZOA 2VXQH 4UAOC 3D25A 2B4CL 5GGTL 4IRSB 3KS0H 5HHXL 4E5XB 5FO7B 4JDTL 4CW1B 1WUNT 5DMYA 1U41A 4P9HH 2UY6A 5HHVL 1QACA 4PR5B 2Z8VC 2BJML 3IFLH 4N5UA 3STZA 5GRUL 3G5XA 5BW7C 3FHQA 4KKAD 1MVUB 4YQXL 3QPQD 4ZXBC 4QRQB 5GRWA 4OZIA 1GZPB 3F65A 1REIA 4HEPG 2PW2B 3OAYH 3QXUA 4LIQH 4XP4L 5FYKD 3ROOA 3RX5A 2P43B 4FQLH 3VXRD 2BNQA 2NY4C 2NY2C 5EC2A 3WIFB 3ZKQD 1U92B 4HGWB 5ANMA 3W82A 1FAIH 1T5XB 3P4OB 3KPOA 5TFSL 4CADB 1RZKH 3QIUB 1ZLUK 4PJEB 3BZEB 1U8NA 3NIGE 5FEBA 3TVMA 1PZ5A 4UUJB 3DGCR 5BJTA 3MRLA 2FX8H 3HPJB 1DJSA 5KBNC 1Q9OA 3QWOA 3WUWG 4J4PC 2ZUUA 3MLXH 5HDBE 2M8XA 2VLKD 4PGBA 5FGCB 3G5YA 1FE8L 4PBVC 5EUOE 1IEAB 2ICEB 3HTLX 5CILH 1Z5LA 1KTDA 1QFUH 1WBXA 1RJLA 2VZUA 3U36B 5T3XD 4M1DH 3MLTB 3ARGD 5KS9E 1RUMH 4TQEL 5HD8D 4QNPF 4K8RC 4S1SH 3T0XA 4MD5B 2XQYK 2W65B 4QHNA 1RY7B 2DI7A 3K0WA 5DSCA 1G7JB 3SKMA 3TLRA 5BS0E 5BRZB 5I76A 5L8JB 1WIOA 5DFVC 3BQUA 4WJ5A 2NY1C 3C9NA 3RVWC 1I1AB 4PJCA 2VC2H 4G42B 1ZGLM 2OTPA 4POYA 1EO8H 3O11A 5FHAH 1Z9OA 3ZE1F 2BY1A 3BKJH 3WN5B 3WYRA 4PRBA 3S36X 1IAII 1ZANH 2XN9A 2X1PA 3IDJB 2Y25A 5IT2L 3HAEG 1E4KC 4WIQA 4TSCL 5JQ6H 3FO1A 4PJBB 2BVTA 5TE7H 1DBKH 4G5ZL 5T1MA 2A74B 5J1SC 2AGJL 2NXYB 4JY5L 1MIEH 4R90L 2NX5B 2NXZC 4P46B 3V6FB 4G8IA 4P2RA 4BFBD 3MZGB 2CKBL 2AK4D 2EC8A 4GMTH 5ICYB 2EKSA 3C60C 1U8HB 3K80A 3ULVD 1EXUB 3QH3A 1X5LA 4Y8AA 4P2OD 4LU5H 4OFPA 3QHFH 3DETC 1G9EA 1NCCL 1PY4A 3H9SD 1NFDB 2CDGA 2K1MA 4U1MA 4BUGA 1ZHLB 2CIKA 1I9EA 5FM8A 3HUJE 3SKOB 1J18A 1LNUB 1LWRA 4M4PA 1ZOXA 1NAKH 1Z9LA 1GCFA 1A7RL 1D6EA 1IGTA 2NYYC 4OI7A 4TUOB 3GSUA 3KPSA 5DVKA 5E6IB 1MQKH 2YC1B 3GSNA 4Z7VA 3FN0L 4XI5D 5E2TH 4FQXD 4LQFL 1LO4H 3RVTD 3K2UL 5T3ZH 1HZHH 3FFCD 1IZJA 4NNYA 3DYMA 1I1YB 4G6JH 2YSSA 3EFDL 4QRRD 4U6XA 4AY0A 4NP4H 1BFVL 2FIRT 4J3TA 4Z7NF 5J11B 5C09B 3PGCB 3QZWA 4XX1G 1QSFE 5F89A 2BMKA 4PRAB 1KGCE 4NNXB 3M1BA 3IDUA 3RWIA 3T3PF 4AG4H 3PQYA 5FYLD 4PRHD 3OKNB 2D4DA 3E6HB 3HMWL 2F8OA 3L6FB 3REVB 43C9A 4OCXL 4WUUB 4ZOBA 4I48B 3D6GA 1KYOK 2KZWA 3TT1H 2VISA 5E8OB 1CQYA 2Z91A 1RFDH 4K3JL 1DVFC 1DQJB 1OSZB 2JE8A 3IJYB 4LKCB 4PV8B 3SE8L 1A4KA 2Q1EA 1Q9LB 3QFDB 4HKZB 4OT1H 1U8LB 2ENYA 3OX8B 2Y72A 1BAFL 4N0CC 1U8JA 3QQ4B 1KJ2A 3OKKA 2PYEB 1U8OB 1TMCB 1F45A 3G04B 2LU7A 4W6WB 2XG4A 2H45A 4HUUB 2LTQC 4LCWD 2FBJL 3DROA 1JNNH 3NZHL 1T1XA 2QR0A 4L3ED 5I66A 5CGYC 1X5XA 1MWAA 2J4WL 5DJ8A 4GRMA 3QO1A 1CK0L 3TO4C 3OZ9H 2VDMH 3LS4H 5DGRA 2HTLD 3TZVC 3CLEL 4OIIL 5E9DE 2JIXA 4OCYH 2A1WH 5KZCD 2IFGA 3IETB 3JWDC 1AY1L 5C9JB 2HWZH 2VLME 5FO8A 5FCUH 2E3VA 4YDLC 1ND0A 1YMME 3O81A 5DJZA 3FCTA 4QRRA 1OTUD 1DUYA 1K9TA 1E27A 3MV01 2QLVB 1HH9A 1RI8A 3DARA 3NCFB 5DUBA 1QLRA 2C1PA 1WV7T 4MNQD 1MRCL 1XF5B 4NQVA 1Q94B 1GOHA 1VFAA 4AMKH 1MCEA 3Q2CA 4WI6A 3QUKB 1NGXB 3OWEA 4YGVB 5JPNA 3O6FC 1DBJL 1KCUL 2DBJA 2L7JA 1AO7A 2Y6SC 3PHOB 1OTTC 4F2MB 5D96C 5FKAB 5EU7C 4HKJB 4F7MB 4PJ5E 3BMVA 3HFML 2PXYD 4HC1A 2YMXL 5E5RB 1UEYA 1BQHA 1UC6A 3RVUD 1CBVL 2W9DH 3VFUA 3KYKL 1S78C 2OL3L 4OLYH 3M45A 4XCFL 4EVNA 1PKQE 5FO9A 5J9PA 3SKJH 2J5LB 3VXRB 3WE6A 4NQCA 3ARDC 4G7VH 4D9LH 3SE4A 1YC7A 4DZBB 4L3EA 1AE6H 4ACPA 4K71C 3FTGB 1IM3A 4ZPTB 1TVHB 3VD9A 4WTWA 5L88L 1ETZA 4Q9RL 1KCSH 4XP9L 3QI9D 4FFYL 3A6CH 5BS0D 2DBLH 1VKXA 3OXSB 1TJHL 1OGAB 2GIYA 5D1ZA 2VLKB 4PLNC 1WAAE 4P4RB 1BLNA 3QJHB 2W0KA 2EDYA 3P0YH 4J23A 2WWKT 5C7XL 2A6JA 3QFJE 2FR4A 2HFFB 1F2XK 5HSFA 3ULUC 3A6BH 5EU6D 1WWWX 4WU5B 2F5BL 5ADPH 3ARGB 4KHXH 4NKDB 1EGJL 4Q74A 3D1MC 4ETQB 5D5MF 3HCVB 3IS1X 4JFPA 4LRIA 2QV2A 5A16A 4WNQB 5I8OL 4J3SA 4UQ2A 5CUSL 3WCYA 4JZJA 5EC1A 3W2DL 1CU4H 1SYSB 1M7XA 1N5YH 1WZ1H 5I75C 3TPUB 3H8NA 2IANA 3WD5H 5HYIA 5JOFB 3F7VA 3DX7A 5FUZL 3L3DA 3MRCB 5JUEL 4V1DE 1LO5A 1XGPB 3GI8L 5F1NB 4X4XA 3OKLB 4I3RL 2ZSWB 1MNUH 1XT5A 1PFCA 3T4AA 3MRGA 5I8EB 2XICA 4X6BB 3LEXA 3VFOA 3UBXG 2O5YH 3U9PL 2GY7B 2H3NA 1KEML 4XCEB 1UZ8A 3C2SA 3MRPB 2IAMA 2D0HA 5EPMB 3TIDA 1WK0A 2F19H 1RIHL 3NCCB 1DQMH 2JCCF 2X4OB 2VKWA 1A14L 3HZKA 4Y4HA 3GRWH 4YQXH 5EORH 1I7ZB 1DL7L 2COQA 4LVOB 4PY8J 4KK6D 5E7BA 4I5BB 3E2HB 1J88A 5ACMA 5ETUB 4P5TD 1M7DB 2R1WA 1I3UA 3TH4T 1F4XL 1QSEA 3GZKA 1SEBB 1YN7B 2AK4B 2GJ6E 3OR6B 4LNVA 3NTCL 1RZ7L 4DGIH 1S9XA 4CVZA 1G6RH 4P2OB 4BQCA 1EUTA 4KHTL 4DOHB 2IFFL 4NNPL 5TH2B 3H9SB 1YNLL 3P73A 1A6VH 1NGWA 1MCBA 2BSTB 2DDQH 4X7EC 3NABL 1LE9B 5IM7A 1P1ZA 2YXFA 4HZAA 5EU6A 4PJDE 4O4YL 4FXGA 3NBNA 3EW3B 2Q6WB 5CGMA 3DWTA 4UDUA 1FYTE 5IG7A 4I2XB 2ZUYA 1F3DH 4QXTB 1KIQB 4MA8H 3GB7B 4XWGL 3QIUC 1SJHB 4HAGA 2YA1A 4JKWA 1I3RA 4NHUB 1OAUL 1IJ9A 4K7FB 4R4BA 4R7DA 4XP6L 4FQXB 2ICWA 1UEMA 5DK3A 1KCVH 4I8DA 5IEHA 2O61A 1U3YA 3FFCB 4U05A 3PDGA 4LGRB 4MCYB 1Q9WA 3I75A 1FNGB 3X13A 1NGZB 1NBZB 3QAZC 4GKSB 1KPUA 5I1HH 2FX7H 5HXMA 3IDIA 4PJHB 1T5WA 2HT3D 2BOBB 3MOBH 3S36H 2AV1B 4Z95L 4ZFGL 4PRHB 3BHBA 2ADIA 2ZUVA 3DVGA 5E99L 1DQQA 5EOTB 4KAQH 3LEYL 4QXUL 2VDNL 3ZKMD 1X3DA 1JGVL 1UQSB 3QHZL 2GK2A 2ICWI 5EWIH 3ECBB 6FABH 1MCWW 4M00A 5SWZB 4UOW0 3BD5A 1LP9E 4KKCD 2IADA 4JKKA 3LPFA 1O7VA 4DVBA 3OJMB 3IDYB 5E9DD 4DW2H 2M1KA 1IBGL 5EBLB 2J2ZA 3S4SB 5SWQA 4FG6C 4RWYH 5HHOB 1JFQL 5IMKB 3ARVA 4KGLA 1RJYB 1KC5L 4LCWB 2X42A 1U42A 3WJJA 3V6OC 4J3VA 1HYSD 4POZD 4P46C 4K9EH 5KSAC 1BP3B 4IHOB 3GSVA 5ALCL 1ZV5A 3QIBD 4P99A 1BPVA 2CK0H 2WINA 1QR4A 5DJ0B 3WHE0 1A7RH 1YPZF 5IVXE 5KZCB 1BF8A 5D4QA 1D5MA 4YDKL 1UKTA 1YEHH 3BPLB 4KTDL 4PIRF 2CQVA 4LL9A 4NWTH 3CVHB 4OI8A 4FNLL 3K2UH 2VXVH 4HD9A 1HI6A 3F5WA 1EUUA 5DJ2A 5J1TC 1UM6H 2BXZA 4MD0B 5K9QI 1ZGLA 3RRQA 4PJ5D 3DX8A 4F3FB 4Z78B 4DVRH 1CF8L 1J12A 5IESH 5E08L 5F1OB 3NFNB 4LEOA 5GGVL 4HHAB 2PKDA 4CRPA 4AH2A 3IU4L 4NC0B 3BDBA 5IMOA 2YBRB 5E6IC 1HSBA 5B38A 1YYML 2IPUG 4UTBL 2ZKHH 3HNSL 5IFAL 3CSYB 1FL3A 3DURA 3O4LE 3E3QC 4H1LG 4GH7B 2CUHA 1I85C 1J1XL 3V4VH 4ZMAT 3MREA 4PGCA 4KQ3H 2XPGA 2BCKA 2PXYB 2WBJD 3T0BA 4KFZC 5J11C 1IGML 1KT2B 3FRUA 3ZE2F 2H8PA 3VJ6B 4XBGB 4KVNL 4KGJA 2PCPA 4QTIH 5GIRB 1NDGB 4KXZI 4ONGL 5J57B 4O9HL 3BKYH 4XRCB 5JIIA 5EUOB 4XPTL 3WKMH 2UUDH 1GHFL 4I13B 5FFLA 4JM2D 3V0WH 3HE7D 3SDAB 5KS9B 4WGWB 4EOWL 5GGQH 1AXSB 4R96A 4OF5A 3JWOH 1MIML 3EO0B 4KTYA 5SWSA 3TV3L 1EEUA 1FLTX 3DUHA 3QI9B 1WWAX 2CD0A 4X99B 5BS0B 1J0IA 3R1GH 4OV5B 1WJ3A 3MV8A 3ZO0A 3GKWL 4Z7OF 1FBIL 4V1DD 5HGGS 4J1UA 4U1HA 4OB5H 2XTJD 4XAKD 2WV3A 4JZNA 4LLDB 2J88L 1BWMA 1I8KB 2DQIL 1RHHA 1VADB 3P40A 5JHDA 3MUY1 1A1NA 1SVZA 1NC2D 4IIQB 5HGAA 4D8PA 1XEDA 3ORJA 4PPTA 3LKRA 4PTTA 4UNUA 5CLTA 4FMFA 3DHJA 4OFVA 4B0MM 3FZUD 2APFA 1WFNA 4L29A 2MCG1 4CJ1A 1OTSC 3MODH 3PV6A 3PABA 4MCZB 1FL6B 2APXA 4R4FL 2DQEL 2P8PB 4OM0L 1QTYT 2Z31D 1C08A 4E41D 4U3HA 4KJQC 1HHIB 4ZUWA 2GJ6D 4RISL 4KMTL 4C59B 1RJCA 2B5IB 4C4KT 4KRNA 3VRLF 1IGIL 3FQUA 2CMRL 4JG1H 1MI5D 2VDPH 4QO1A 5IW1B 1MREH 2MQ3A 3RZCA 5DRXB 2NZ9D 3IDGA 3TCLA 1NPUA 5TE4L 3UAJC 1NGQL 3BQUC 4N0FA 3QP3A 4OF3A 3TBYA 2OL3H 4P5TB 5BO1H 3HUJB 1JNLL 3QWQB 4DEPC 3MGOB 3HE7A 4YXKH 2CIIB 1FYTD 4KKNA 5DJXA 2ESVD 1FGVH 3S5LG 2OR7A 5AG9A 1YEFL 1UXSB 4HFWB 2H2PD 4P5KB 3EHBD 2VZOA 2FATH 4WI4A 5ERWB 1K4CB 4MX7A 3VXME 5SX5H 2J8UE 1KB9K 1T6WA 3OPZL 4KKAC 1D5XA 3IDMB 4TRPH 2E7CA 3MCLL 4JFOA 1TZGH 1ED3A 1ADQL 2EO1A 3LCYA 3Q5YA 1N6QH 3IGAB 3QPQC 4W6YB 4OZHF 4E9LA 5BXFA 3GMOB 4L9LB 1A3QA 5LQBH 1AP2B 3OTTA 4FQHA 3EOAB 4FRWA 1R3IL 4XAWL 4DKDC 3I3BA 4M6OH 1QSFB 1FPTL 1TQBB 2F5BH 2XXMB 3DBXB 3T77B 4H8WH 4NJ9L 4OD3H 2GSIB 3CDGB 2FL5B 2QQLL 1NC2A 1WCBB 3W39A 3ZTNL 2YKLH 1NLDH 1M05B 2ED7A 4EIZC 4EBQL 4JCMA 3IXAB 1QBBA 5IB5B 5JORA 2EC9U 4JVPA 4BA8A 1JL8A 5I1JH 4E41A 3T0WA 3ARGC 1A9EB 1L7IL 1KN4L 5HD8C 4CMHB 3KJ6H 3DMMA 4TUJA 1MI5A 4OZGA 5CCKL 5DD3L 1CLOH 4DZ8A 4RIRA 4PJGA 1OP3H 2EIZA 2VDKL 1HNGA 1FFNB 4P9MH 5IHUH 1F97A 1RIHH 1U8MA 4K94C 4ZTPL 1J1PH 2XKUA 5HDQH 2QQNH 3U83A 4QNPE 3HG1E 1YY9D 3GUTA 1C7TA 1HHGA 7FABH 3QDMA 4ELKA 2ESVA 1DLHB 1KXQE 2JB5H 4TNWK 1MJ8H 1WBYB 3C8KA 1PJ9A 3VW3H 1G7LA 5E9DB 3F12A 4M62H 1RZ7H 5I17B 3MFGB 3D18A 3WO4B 4LCYA 3SDDA 3V4UH 5IB1B 4Y19D 1G0XA 4O5LL 1T4KB 3ZE1E 5TDOA 2EH7L 4LSRL 1YMMB 4JPWL 4OZ4B 3QEGL 1WT5C 3FB5B 4Z77A 1A64A 1NBVL 3NABH 3PWLA 4OLWH 1JZ8A 1AD9B 1F4AA 3S6CA 2DM7A 4W6XB 3MV7D 2YK1L 5F9OL 4ZFZA 3QIBB 1QO3B 4A2LA 1JHTA 4FZEL 3ULVC 5KVEL 2HRPH 1NDMB 2XFXB 4ZS7H 1KIPA 4P2OC 1LEIB 1RUQL 3O4LD 1LGVA 4XPHL 4KROD 1JHKH 4Y1AE 1F2QA 1AGEB 4IRZH 2EDBA 2I07A 1GGBH 2EXWD 1X5KA 5H2BB 1PAMA 1H8OA 4PJ5B 1MJJA 1EMTL 3GRWA 3MACH 3GIVB 1PX3A 5BV7L 3U1SL 5TGBA 1TETH 5DD0L 4KZDL 4ZYKA 3W9DA 4M02A 1QBAA 3EYFB 4FTVE 2X1XR 1KCLA 1HEZA 4XI5C 3RVTC 1PKQB 3JV5A 5DJAB 5EU5B 1ZLWK 4F15B 2AABH 2AJZA 1G6RA 1EHLH 2EXYD 3LEYH 1Y6MR 1NQBA 2IWGA 4PR5A 5DEZA 5SX5K 2DQUL 1CLZL 2WBJB 2EE6A 5FOBB 4OM1H 1AFVH 4YHML 2MJWA 4H20L 2PW2A 1XIWB 3FO2A 3OR7B 3C8HA 4Y19A 4TN9A 1I1FB 4R7NA 3QFJB 4EZMA 1XR9A 3O2DH 5GZNC 5ACZB 4GQPH 4CBPA 4Z7NE 1N6UA 4HGKC 4PP1D 4JM2B 5FA3B 4HXBH 4KVCL 4WTZG 2AJSL 2AJVH 4RNRA 3T3PE 4XC3L 1SQ2N 4IMLB 3D2UB 5BVJB 5FUCC 5D9SB 4M8QB 1JPFB 2VN4A 4ODBD 2P8MB 2ICEA 1KG0A 2HA1A 4DKEH 1P5VA 3L7EA 4V1DB 3TT3H 2P5EA 5HVWA 5E2WL 3KNBB 1NMAH 2ITCB 4LAQL 5GS2D 4YDKH 1JPGB 5FGBC 1V3MA 3GSWA 5JA9A 3JUZA 1DR9A 4XHQA 5IGXL 3LQZB 3SE4C 2VTFA 3GMLB 3QCUL 1T7XA 1YY8B 5L2KA 4HEME 4MQ7B 2OMBA 4EI6B 5AUMA 3O0RH 4JN2B 1AD0A 2FB4H 2HTLC 1INEL 2AJUL 5HYSB 5GGVH 4Z0XA 4M93B 4YPJA 5D1ZC 1DEEA 1G7IB 1U3HA 4JB9L 4NZRH 4YEFA 5KSUA 3D9AL 4X80H 1KNOA 1NCBH 1BMGA 1LDPL 3KPPB 3IFNH 4W68A 4YIQB 4UMGA 5IFAH 3KYOA 1TCRB 5DD1H 1A6TB 2Z31B 4M6ML 5CSBA 2GJ6B 1OTUC 4N8CH 3GSOB 3QWRD 4MXWH 1QA9A 1R24B 4GG6A 5CHNB 3MA7A 1VHPA 1A1MA 2K7PA 2DWEB 3DGGB 3FN3A 1HXYA 3DVNB 2XV6B 4QWWD 1CDIA 2BFVH 2ZSVB 1U8KA 3PDOB 1OWRM 3GGWB 5F7WC 2APTA 4P0DA 3DYOA 3F7QA 4PJDB 4PJ8A 5ICYA 1CLYL 1FYTB 4Y4FD 1MUJA 1QFPA 4TOYL 1A7NL 3JTTB 3WXWL 1OF2A 5EO9B 1I9JH 4OCNC 1FFPB 4EI5A 2PXYC 2D9CA 3TA3D 4M5YH 2IAMC 3TBVB 1ZXQA 3RVUC 3BOVA 3DECA 1A7PH 5DR5H 2BSRA 4JJ5A 1ONQB 5KW9H 3BP6A 3N85H 1SEQH 4N8VA 4NO5A 1A2YA 5EN2A 2MHAA 5IVNA 1OQOA 4OD2B 4HCRH 3I6GA 1KPRB 1U95B 4PTUA 1IEHA 2DQIH 3WNKA 3G5ZB 5IBLD 4YE4L 5DK0B 4CU6A 1VFBB 2FGZA 5CJBA 4HAFA 3QI9C 2E6PA 5FECA 4U6YB 4X6DF 2EYSB 2VSDA 4C57C 4N0UE 5EIVA 2OJZH 5TF1L 5L7XL 3HG1D 1S7WB 5E8PA 2WK2A 3VXQA 3ZTJG 4JFQB 5GGVY 5CJOL 4YWGL 1QKZH 3BVNB 2LE9A 2DYPB 1LP9B 3P30H 4RDQG 1P2CA 4RISH 3BRGC 4PYGA 5AD0B 3AAZB 3BSZH 5AYQA 1DQTA 3L3GB 5AYUL 4UNVA 4P9HC 1NEZA 1V5JA 3THMH 1M6OB 5DK2A 1C5BL 4TVPL 2JTDA 2C9AA 5D5ME 3QBTB 4WWKA 3VFGL 2UY7A 2XZAH 2YN5A 2OTWB 2XTLA 1S5IL 5INCA 1D5ZB 2B5IC 1F58L 4HWBL 3EYSH 5EBMB 1E28A 3GMRB 3MRFB 3PGDA 4XPAH 5DC9B 3S35X 3D85D 4Y1AD 1AXTL 4GSDH 4L3CB 4KK6C 3GSQB 1RVFL 3O6KL 4H26B 2NY7L 4HUWA 4P5TC 2GAZA 5JIKA 1P4LB 1IKFH 4UINH 3QEHA 4NSKB 2BVPA 2JCCE 5A40E 4ODUA 3PWUA 4P57B 4YC2C 5C08A 4NJ9H 1ZGLP 4HJGB 5C9JA 4FTVD 3ZYOA 4Z0BH 3SGDH 5IEKB 4MB4A 4M48H 5EOQL 3O4LB 2FJGB 4NO0A 1A1OA 4NDMB 1ITBB 5E00A 2AJ3A 2B1AL 5E2UL 1DBBH 4NIKB 4L9LC 4N5ED 1T2JA 2XACC 4NOFA 3FQXB 3WJJC 1HWHB 4XNXH 1H3PH 1AGDA 4Q2ZB 3S97C 3VDAA 1IC7L 2QHLA 1Q94A 2J12B 2ERJC 4F7TB 3MLPA 1FORL 2OL3A 5C0BE 4WCYL 1IL1B 1JZ5A 1V05A 2PN5A 1S7SA 2CJUL 5CEZL 3AGVA 4YGVA 4XWOC 1E4XH 3AXLB 1QQDB 1ZSDB 4HPOL 1OVZA 2CKBB 2ZUQB 1K4DA 4F9LA 2YPLE 1HKFA 3RI5F 3QRGL 1RIUH 2EDRA 5IK3B 1WGOA 3DX6A 2RQ8A 2E7LA 2HT3C 5JMOC 4Z7UA 1YJDC 1KCKA 4YK4C 1B4JL 1ZHBB 2OCFD 3BD4A 3UYOD 3R0MA 3I84A 3B9KA 4I4WA 1CICD 1JZ2A 1GOFA 2H41A 3ZYJA 5TDPB 1W2KT 1OCWH 3WIIL 2VH5H 4H5SB 3L9RA 1VEOA 4WHDA 1ACYL 4PRPE 4LLUB 3AMLA 4EQ2A 2XY2A 1K5NA 2BX5A 2ADFL 1XAUA 1U58B 1T20B 2IH3B 4P2QD 2WQRA 4WUKL 1TJIL 3U2SB 4KKCC 3H3PH 2A6IB 3CUPB 5CEYA 1WLHA 4BH7A 3KXFA 4GBXA 3ZE0F 3QXAA 2E7HA 3WO4C 2EH8L 2D9QB 2PO6B 3TIEB 2KZ1B 2NW3B 1B0GA 3IJSA 4LLAA 3RX7A 1YEJH 2EYTB 2C1OB 1BHGA 3S96A 5EZJB 5I1CL 4ETQA 5I16B 3FOLB 3VFNB 1AQDA 5GJTL 1HYSC 4POZC 3GM0A 3RNQB 5JO5B 2Q7YB 1R5WB 1JHLH 3MNZB 1RMFH 3ARZA 4XP1L 3RWEA 3QIBC 4PJ7F 1UACH 3U1SH 2FJFA 5DVNA 4UIMB 5F1IB 1SYVB 2FX9L 3I2CL 4XMLL 1I9IL 5D1QD 4L1HA 1FQ9C 1S3KL 1FFOB 2AXJA 5J06A 1HK6A 3IDNB 4KY1L 3O2VH 4F33A 5H8DA 1QFOA 3Q0HA 3UMTA 4HJ0D 5JXAL 1EFXD 3VXMB 1YPZE 1U8PB 3PIQA 4RA3A 3ARWA 4I0PA 2J8UB 1SBSH 1BD2A 5AZ2L 2D03L 4WHCA 1MFCH 1EEZB 1LK2A 3G6JF 5TPWL 2LVEA 3NCYS 1SJVA 5ETUA 1P69B 4H20H 4TTDC 5C71A 3BWAA 3SO3B 5E6YA 4MJ4A 3IF1A 1JPST 2WUCL 5IQ7L 4LMQI 3MLSH 2ADGB 3I02A 4JO1L 5FM4A 4Y4FB 3MCG1 2L0DA 5GISL 1RJZA 2X09A 2Q8BH 2FO4B 2Q87A 1ZK9A 2WBJC 2I9TB 4ZFFB 3TA3B 4EIGB 4LPWA 5KOVC 1QFHA 5I1LB 5JW3L 1MLCA 1LE9A 5CJQH 2PTTA 3HZVA 1A4JA 1RZJL 1CDCA 1T3FB 4MS8D 5MENA 1V3JA 4Y2DD 4LGSB 3ZE2E 3C6SA 1C7SA 4LCIH 1I3VA 1WWCA 3HE7C 3PF2A 4HQQL 3TBWB 3SKUD 3ARTA 4LLMB 5IGXH 1RV6X 3HLAB 3C5ZB 4RAVB 4OZFH 3DNKA 1DZBA 3IU3A 3IAQA 4ZAKD 2R4SH 5C0RL 1TXKA 1X7QB 3X12B 3QZWG 3GMQB 3HG1B 4YHIB 3VGEA 1NBZA 4N9OB 3FN9A 2XTJC 1W72H 3QEQE 3WFEL 1YA5A 2AV1A 2DM3A 1O0VA 1IEBB 4GW4B 3O2DA 5L9DH 4Z7OE 2GTWA 5FGRA 1HHJA 4AM0B 4L4JA 5EOTA 2GFBA 1A7QL 1KF9B 1E4JA 1OAZH 2DLFH 2IH1A 2NY3B 2O5XH 32C2A 4Y5YB 5LXGL 1ZTXL 3HS0A 5D7IF 4NWUL 2EDDA 1Q9KA 1ZA3A 4PRID 3ECBA 1JV5A 3OB0K 5SWZA 4KTEH 2EDKA 2HLAB 2ZCKH 2Z31C 5C3LD 3MBXL 2VQ1B 3DX9A 2CR3A 1EFQA 1I3GH 3PP4H 1U93B 4JRYE 4CVXB 1CGSH 1GVIA 2VL4A 5HHOA 3WLBA 2KH2B 3ULUF 3VWKD 4EUPH 4I1NB 3I3EA 2FSEB 4R9HA 4P5MB 2NZ9C 1FAKT 2RFXA 4Y1AB 2VAAB 1WZLA 4PGEA 3WIHH 2X89D 2V2WA 4LDOB 3VRLE 3Q5TA 3CXDL 4XX1E 3FT4B 4IHOA 3MLZH 4G8FB 1LO3L 3HI6H 4TPRH 3O2WH 1C5DB 3DV6A 5C0BD 4DFHA 3LS5L 2KQNA 2R4RL 2H2PC 3QDHA 4NBYB 4DN4L 2ENSA 5KJRL 3INUH 1BVKB 1RK1A 3BDXA 1IC1A 4FTVB 1WWBX 3GJFK 4BK5A 2F5AL 3SDDC 1RULL 1GZQB 1AIFA 3TGXA 1G7MA 3UTTA 2DL9A 3F6IA 2YPLD 4MXQD 3TN0B 4DKFH 4F3FA 1IQDB 1V3KA 1ZHNB 3C09B 3SCMA 2OMNA 4S10A 3JV4A 3EYUH 4NRYB 1JGUH 3STBA 4IEFB 4XXDA 1AHWA 1UM5H 4OLZL 3FB6B 1JZ6A 2XZZA 2FBOJ 1TITA 4NHCH 1VPOH 4OZHE 3U7WL 1H3TA 4DTGL 3PL6D 3TCXA 5IJKC 1E6JH 5EBWB 5HYFA 2B4CC 1OAXL 5ISZE 4M5ZL 1T0MB 1KFAL 1JPSL 2FECI 3O9WB 5I71B 2CKNA 4U6VL 5DHVH 1HQRB 3QDGA 4PRIA 4KU1A 1C5BH 4HJJH 5CP3A 4FZ8L 1JCKA 3NA9L 1NAMB 5FF6B 1XH3A 2VABA 5CINH 5EUOA 1FJ1A 3PWVB 5C1MB 4HCRA 4GS7C 3MZTA 4K2UL 3VRIB 3S35H 1BX2A 2H1PH 4XMKL 4UU9A 4YPGB 2OR9L 4OLXL 2A6KB 1YY9C 5DUML 3VMPA 1FVCA 1IGFH 3WFHA 1RVFH 3PXHA 1B4RA 1SY6L 3AROA 3LKOB 3KDMB 3D3VE 4YHOL 1NCTA 3QUML 4YEEA 1C1EH 3CZFA 3VXPB 1FO0H 3LN4B 2ZUWA 2K3TA 4BKLB 3V0AC 5JZ7D 4JHAL 1AC6A 2XQYG 4XVUD 3OKDA 1I8KA 4HV8B 4NPYB 5C07A 1DEDA 3MXVH 1VADA 3UPCA 1YEDB 5I1KH 1P7QD 5E2UH 5IMLB 5GSRB 2Q3ZA 1YQVL 3FONB 4IIQA 2UYLB 3CFBA 1II4E 3PL6A 1FORH 1WEJH 4MAYD 1FL6A 2CUMA 5D1QB 1HINL 4YBHA 2A77H 1MF2H 3U0PA 2C4FT 4KROC 3DV4B 3LVEA 2EXWC 4G8EA 3V5HA 3GI9L 1A3LL 2IMMA 2IALB 1EFXB 1RIVH 2X1OA 3SQBA 1G9NH 1ADQA 1FZMB 2VNCA 1H5BC 1LD9B 2APVA 1VA9A 2HFGH 1R5IB 4TVPE 4LSTL 3HUJA 1B4JH 1DBAH 3O3DB 2ZUQC 1EK3A 1RZGA 4UI2A 1YN6B 4C56D 1UXSA 4HFWA 1ZLSH 2EXYC 1G9MH 1NCUA 2CXGA 2CUIA 3M07A 3QXDB 1LILA 4ZODA 4HZLA 1Q8MA 4UOW1 1RU9L 1X6LA 4TSBH 1M7IA 1PEWA 1T21A 1V7NL 2MWCA 3L3IA 3IGAA 3OGOE 4KI5F 2YOCA 4OLVL 4Y5VB 5LAXB 2H2SD 3DRTB 4N0UB 1OT1A 3QUZD 2MPAH 4HUXB 4WV1B 3KS0J 2HAZA 3DHMA 1RZIB 4Y2DB 1QSFA 3QEQD 2ICWJ 3I3DA 3SDXA 5SV3A 1YEKL 2PNDA 2R39A 3D87B 5IIEB 1AKJA 3KYMA 5FB8A 2ZCLL 2FHFA 4ZOAA 2X4UA 5EZOH 5K33A 3LPGA 1A02N 1N7MH 2DTML 4KK9D 2R0KH 1UH2A 4U1KA 3T4YB 1I7TA 1P6AB 2P47B 4M7JL 4HWEH 2XA8H 5I30H 4ZAKB 4MAYA 4XP1H 3SGDI 4ZUTA 1OPGH 2VLLA 1JPTH 5LBSL 1B2WL 4HWUA 4QOKD 4D3CL 2DQJL 5D5MB 4PJ9D 4KKBD 5HGDA 4GAJH 4XMLH 4O2CA 1K8DA 5EZLB 3FRPA 3LEVL 4Z76A 3RUGA 3HA0A 3FQRB 5E1AA 4PGZA 5CEZE 5D6CB 5EO1B 3CFJB 2RR3A 4JM4L 3VXNA 4H88H 4OLUL 3RA7L 4NKMB 1FFNA 2HRLA 1ODAA 4LPCA 5AZ2H 1E4XI 2D03H 4FABH 3UP1A 4F58L 3F58L 3Q3GB 3BO8B 2XKNB 4M7KH 4JG0L 4OTXL 1P4BL 3DYPA 1SJEB 3C2AL 5I1EL 1DLHA 5K9QG 5ILTH 1OW0A 3MV9E 3UZVB 5E94A 1A21A 1C12A 2JCCB 2V7HA 1MLBA 3SDYL 2GJZA 2MKWA 5L0QB 2D7QA 2VE6B 2R69L 5JOPD 1IC4L 1XGYL 5EZIH 4OZIF 3KJ4B 3GDBA 3WSQL 5IHZA 3TJEL 5GRYA 2AVGA 1HSAA 2AEPL 1B90A 3FB8B 1CXHA 1NMBL 5H94B 4XCNB 4QWWC 1CXEA 5FHBL 4JFFE 4YAQA 2B20A 5AEAA 2NLJA 5LGJA 4JE4B 5IKCB 1R3LA 1H3VA 3GHEL 1YDPA 4OCRH 4Y4FC 4GKZB 4JDVB 4Y4KA 5C0BB 2UWEA 3I50H 4HQQH 4ZDHB 1KN2L 4HIIA 1IQWL 4XCYA 1MHHA 4PV9A 4DN3L 3MJ8A 3TA3C 4FQQB 5J4MA 5IW3A 3RL1B 5ISZD 1D5IH 4X8JB 1FG9C 3D0LA 1F90H 1PYWB 1XZ0B 1RSFA 4QOKA 2YPLB 3SQOH 4LPXA 2J6EH 1S9KC 1YNKL 5C0DB 1WFUA 5I2IB 4ALAL 5B38G 3V7MA 2HLFD 4XNUL 3OAUH 4R3SB 4AEIL 1F4HA 2BRRH 5IBLC 2Q76B 4BSVA 1DN0A 1FV1A 1L4IA 4PJCF 2ZJSL 1P53A 3H0TA 1OB1B 3HE6D 3BGMA 4X7DC 1I7UB 1A0QH 3MOQA 3P4MB 4MHHG 3C6LB 4JHZA 4P59L 5C0AA 1UWEL 1JWSA 4PRPB 3BP5B 4RRPA 5EU4B 3HI5H 2OS7A 3MMEA 4NWUH 2NTFA 1CL7H 1INQB 4PB0H 4XGZB 1QBLL 3C5SA 3CFEB 5KVGL 1QVOB 3D3VD 2OZ4L 3EGSB 4NT6B 4X6DE 4XC1L 2P7TB 1QR1B 5BQ7A 1ZLVH 4D0BB 3CC5A 1AI1L 3P9MA 4OFYD 5A43C 4O2FA 2YD9A 4XH2B 2E8ZA 3QQ3A 1A7OL 4Y5YC 4OZFA 4F9LC 4IMLA 4L5FH 2RBLA 2NNAB 1OD7A 2JK5B 4M43L 1P4IL 3QG7H 3BE1L 4UB0H 4YH6A 1MRFL 1V8HA 3H42L 3O45A 1UG9A 2IG2H 1XF2A 2E7LC 1S7UB 4X5XB 1BGXH 3MGAA 5DQDH 1S9WB 2G2RB 1MCSA 1W72A 3QIWA 4OSUH 5DVLA 4DN4H 5DDHA 2HJKA 3NAAH 3EDKA 5EU3B 4DQOL 4LDEB 2OP4H 3LQZA 1LO2H 3MJ9L 1EHAA 1YY8A 4JKPH 1KIRA 4MSWA 4WEBH 4AL8L 1P7QB 2Z35A 3RGVD 4QXWA 5D72H 5MEPA 4PS4H 2DQHL 5I8CB 1VFUA 2D4FA 3W5NA 1ZEAH 4Z7VF 5I9QB 1CE1L 1YPZB 5D71H 3WUWB 5D7SH 2HT4D 2WZPD 1TZHA 2HKHL 4TVPD 3O4OB 3HE6A 5ALBL 1P7KB 4GBXC 2XXCB 3FT2A 4RQQB 3WMSA 3AU1B 1UWXK 5DLML 4HFUH 3BAEH 2HG5A 4XT1C 1S7TA 4ZNCD 1IZKA 3BT2H 4EUPA 4M3KB 5D7JA 3C09C 3VGHA 4N5EC 1BQLH 5DRNB 5J1AB 3KYNB 3QRFM 4DAGH 4HS3B 2HVKB 3PXJA 3IAPA 3WIHA 1JF1B 2BC4B 2P4AB 5HPMA 2ATPA 4HIEB 5HVHC 4PUBH 3GJEB 3RVXD 2Q8AL 3CCHA 4U1LA 5A2IH 3DO7A 3PDOA 2XWJB 4MA1B 1MRDL 2QSTA 3P77B 5DJYB 1FDLL 4JZOA 1FVDA 4PJDA 4LBEB 3BUYA 1J1OL 3DXAD 4GUPB 3PHSA 1N64L 2IPKA 4M1CD 1AH1A 1YEEL 3ULVF 5D6DC 2XZQL 4MB3A 4XNYH 3VGAB 3CFKB 5DD5L 5FV2A 3B2VH 4G80B 2F54E 4OLXH 3GMNA 3TBVA 3HAEB 1UH3A 3V6BR 3VXTB 4E42B 4WFEE 2YPVL 2OI9B 4KKLD 5CWSB 1HXMB 1IAKB 2YD7A 1NAMH 1N8ZA 2YD4A 3EYVA 4O51B 4NZJA 3QUZB 1MCCA 5MP6H 4YZFF 4KK5D 3BUTA 5DUPH 1CICC 5E8EB 4QRTB 4PGDB 5CKAA 3QEQB 4HDIA 3P9LA 3QDJA 3G08A 3EFFA 4CNIB 1NJ9B 4JAMA 5CEZD 4X7CC 1UH4A 3D0VB 3V5KB 1UKSA 5DHVA 5AAMA 2AJXL 1FVEB 1U2HA 4PRNA 3QUXD 4LRNH 2YD2A 1S9VA 5C0IA 1ZT1A 1F13A 4RBPK 5E8NA 1FRGL 1T22A 2L4OA 3RPIA 1OP5H 5CJ5A 1MJ7H 4JFDA 4LHQB 3QXWA 4PJ9B 5I8KH 2HN7B 2W92A 5E4EC 1KJMA 2DYPA 3IDXL 5JPMB 4HH9A 1CTNA 3MV9D 3CH1A 3JV0A 3NZ8B 4APQB 4ETYA 2C7UB 4JRYB 2P24B 3ZE0E 4EXPX 2V2TB 1IAIL 5IW6B 5J12B 4RGNC 3E8UH 1A9BB 1NSNH 4NN5B 3BYTA 4UQ3A 2KKQA 4U31A 5F72S 3MO1A 4HIXL 4X7TA 1T80A 1LQSR 1XCQA 4YDVB 3ZSTA 5D70H 5KVDL 1W0VB 5B3JF 1HOCA 5FYJU 3ZHKA 4PY7B 4JFFD 4CUCA 2I24N 1D9KD 2BNUB 3DXAA 2CSPA 3FO9B 1DQLL 4G3YL 2ZNWA 5GSVA 1FO0A 4LP4A 5MEQB 1D5ZA 3VFWA 4PJ7E 3KWWB 1NGPH 3KPMA 4JHWL 4HJ0C 2BVOB 4PG9A 4NUGH 35C8H 2CLVA 4LF3A 5GS1B 5C0GB 3ES6A 1JGDB 4KZEL 3GNML 5A2FA 3DUUA 2BNRA 1QOKA 5F3HB 4GXUM 2LABA 2Z93A 4OAWB 5T5NG 4R8WH 1X9QA 3V7AE 3NCBB 4IOFD 4ZUSA 3G6JE 1NCWL 1X5ZA 4K3DL 3PP3H 4OZHB 5CD5D 5ESVB 4M7LT 4LNRA 3FKUS 4IS6B 3QNXA 1BVLA 4U1JA 4X0KB 3PNWA 5ISZB 3VFMB 1OARH 2F53A 2GEEA 4Y5VC 3EDEA 3VH8A 5A3IC 4U1NB 4YNYB 4M7JH 1UWGH 3BH8A 1PLGH 4Q2ZA 3MLVL 1IVLA 1YYLL 1WICA 5CD3B 1FLRH 1UM4H 4Y2DC 1IT9H 1Q1JH 4PBXA 2VDQL 3LQAL 1S9YA 2L7UA 3CSPA 4HS6B 3QA3A 1AR1D 1NUNB 4Q9CA 1AGBB 4MWFB 3UO1H 1H15B 4XPFL 4DUVA 4X9BA 2BSSA 5FIEA 1N3NB 3MNVB 4MGXA 4JO4H 4HXAH 4P3CH 3EDJA 4ZAKC 4NQDD 3RWJB 1JGEB 1CD0A 3VXUA 4UILH 5J56B 1HHKB 1U2CA 5IK3A 2QL1A 4JQIH 3RWHA 4JDZB 1F3DJ 4L4TA 3BH9B 3GSNL 4LCUB 5I1EH 1GAFL 3U6RB 3U4BH 1VFMA 2UZIH 2WUBH 4F80A 3D3VB 1BM3L 1AHWC 4NM8H 4YDJB 2XRAL 1A6AB 1XGYH 5IBUG 1YZZA 1DANT 3JV6B 5CSZA 4WHYG 1E0OB 1L7TH 2GITB 4H5SA 4R6UA 2GK0B 5DYOB 2X41A 2VIRB 3FHAA 3X14A 5GS0H 3EZ8A 1AGFB 5MI0B 1BBJA 5FHBH 4KI1A 2Y7QA 4K3EL 4K7PL 4LASL 1MH5A 3MRMA 2A6IA 1FH5H 2H6PB 2ITDA 1CIDA 5KTEL 4G6ML 5L0QC 1OP5K 2R15A 3UJIH 2PO6A 3MLRL 2XKSA 3TIEA 4NN7B 5DJCB 1S7QA 5D7IE 3QQ9D 2EKJA 3FT3A 3VWKC 1JK8A 1MCPH 3HC3L 1E6OL 4JGMA 3RJQB 3ETBF 5GGRB 5KAQG 5EUKB 5INDA 1A6WH 3RGVB 1KLGA 3ULUE 1XGTA 5D1XB 1MCIA 3GHBL 5KVMC 5IBTL 4MJ5B 3T2NL 1AGCB 2Y5TB 4X4MA 1GXEA 2Z0BA 1GGIH 1SYVA 3SJVE 2AP2A 3MOAL 2DQGL 1BEYL 2E8YA 2VXTL 2R0ZL 3BD3A 1MWAL 3IDNA 4L8BA 3WEXA 3G6AA 3BEWA 4WO4D 4FFZL 3ILQD 2JELL 4MXQC 5HY9B 4UT7L 4OD1H 5BVPL 4LPYA 2NY5H 4OKDA 2RHEA 3L95A 1KB5H 3DVFA 2FGWL 4WFED 5DJ6A 4PGJA 25C8H 3GMMB 1HH6A 3BZ4A 4LPVA 4XNMA 3C60D 4D0CB 3ZYZA 2OZ4H 3PL6C 3UTPD 4FQJL 1PVHA 4YR6B 5BZDA 1A5FL 3Q48A 3UBXB 3ARED 3LIZH 4NUJB 3PHQB 2OSLA 5FOJA 2VSCA 5F3BB 2E27H 3ABZA 4HIJB 4ZTOL 4M7LL 4L8CB 3UJTL 1JI1A 3VG0H 3VI4F 1P4IH 4N8VG 3AY4A 3D39E 3BGFC 4NQSA 5T1DH 2J6EA 3UPRB 1JGLL 2PYFA 1T04A 4YFEA 5ABDE 4HK0B 3QNZA 5FAAA 2X9WA 5F1SA 4LEXH 1T1YB 1RURH 3RU8H 2NW2B 3MROA 3HZYB 4HC1L 4HPYH 5H37G 5T5FL 5C70A 3K8KA 4ENED 4NQTA 5DI8A 3O6ML 4PRDB 3MRQB 3C5ZA 4F7CA 3E1F1 2NR6C 1F3JA 3BPCB 1NCDL 2QQKL 5IOPB 2VDOL 4LSQH 1G7QA 4ZUVA 3T65A 4WFGE 3OHXA 3QULB 3RAJL 3X3GL 3CFIC 3QUXB 1N5AA 3QNYA 4YDIL 5CZVH 3V6ZB 4UT6L 5JZ7C 5I1IH 3CDFA 4WU7B 4I0CC 4OCWH 15C8H 1FNFA 4XPGH 2YEZA 4M1GH 3MV9B 5F88B 1J8HD 3ARFD 2W0FB 5D7LA 2CK2A 2VITB 4YUEL 2VZSA 1J8KA 1NEZG 3HPLA 5I9QC 2H26B 1K6QH 3KPLA 4GAYA 1XGQA 3RWCB 1H8SA 4G7YH 3Q6GL 1JNHA 4XCCH 2F8VA 2EE2A 4MAYC 2HKFL 4MJ6A 2O5ZL 4JFFB 2W9EH 4R2GD 1D9KB 2VL5B 3VXSA 3AREA 3BN9D 4LCCA 4ZG1A 2OQJB 4LLWA 3TPKA 4S1DC 3REWA 1UJ3B 2PR4L 1CL7I 1JZ4A 4LSPH 1F6AA 3I9GL 1S5HA 2Q7NA 5DMGD 1KUMA 2G5BA 2VZTA 3D69B 3SE9H 5IWLC 1KPVB 2D31A 3VA2C 2R8SL 2DWDA 3MUHL 1CZ8L 3PWJB 3MLUL 1JVKA 4M6NH 4MA1C 1NKRA 3WS3A 3QG6A 4JO2H 5FK9B 2VLJE 3F7YB 5DMIL 3WO3B 3EDFA 2Y07H 4H0IA 5DS8B 3VGAC 3ZLQC 1CFVH 5F7NC 2H32A 3IJHB 5JXED 5CSGA 4G9FE 4L4VE 1U91B 3VRJB 3OXRA 3HAEH 2WWMD 4RFOH 2AJXH 3LB6D 2H2SC 5GGSB 7CGTA 1ZWIA 3MA9H 4ODTL 1PW3A 1GIGL 2I5YL 4U1SB 5H35B 1CD1B 3ARBA 2RCSL 3CMGA 5D2NE 5T1KB 1EJ6A 5BV7C 1J8HA 1F11A 4F7EB 2JB6A 3GBML 5I6XB 4KI5E 1S8DA 3QCTL 1IM9D 1IGCH 3CK0L 4X6DB 2DD8L 1JWUA 4NBXB 3NOIA 5F9AC 2AXFB 4JPIB 4CMMA 2DQDL 2JJTA 4KK9C 5DRWB 3CJJA 4Z8FL 5ICZA 1BZ9A 5CAYB 3SPVA 1S7RA 4K23L 2JJSC 4ZS6D 4GFTB 2ZPKL 2VXQL 4PJ9C 5K9KB 2AKRA 2IBGA 4KKBC 1QUNA 1I8MB 2NY4B 2NY2B 3HC0A 5I1GH 5J6GB 2R2CA 2V7NB 4MNHB 3IFLL 4I3SH 5TE6L 2EDXA 3GBNH 1NANH 4J8RA 4NN5C 2IGFH 4XXCA 3EJYC 1GC1H 1D7FA 2A6KA 4EN3D 1YEGH 1X4XA 4LIQL 1ZS8A 3WNOA 4FQLL 4Z18A 3UC0L 3GNMH 1FNEB 2J8HA 2ICES 2DMCA 4F9PA 3QJFA 4LVNC 1FAIL 1K3ZA 1Q0YH 5JXEA 1NLBH 3S3PA 2YR3A 1RZKL 3BIBX 3B9AA 4YHKL 3SJVD 5GGUA 5C6PB 2B7DT 5JIPA 2FX8L 4JY4A 4HV8A 5F9JB 4NPYA 3VGFA 4U0RB 5GS1C 3MLXL 5C8JA 2AI0H 5E5UB 5CILL 2YUVA 3PJSA 1OSPH 2F74B 4AYFA 3SGJA 4OZIE 1QFUL 4KDVA 1H0DB 2EO9A 2E9IA 1R0AH 5ESQB 4M1DL 1RUML 1UCBH 3QXTA 5J6HB 2BNQE 4N1CA 1WBZB 1RK0A 4YHPA 2EDHA 1ZT4A 3V8OA 1FSKC 4S1SL 2FYYB 1CT8A 2N7BA 2E9BA 4ELMA 1X5AA 4PFEA 4PG2A 1EHXA 5FA4A 5F7FA 2CLRB 2JJVA 3MXWH 2OR8A 3I6KA 2VC2L 5CZXD 4ODXB 4RZCA 5I0ZA 1E4WH 4OZGF 2F54B 1FZMA 1EO8L 2V17H 5FHAL 4PJGF 3BKJL 2NXZB 3QCVL 2X4PA 1INDH 4N9GB 2Y5EA 3D39D 2APBA 4MJIA 4HWZB 1ZANL 4GAGH 3C60B 4HUVB 2C4XA 4AENA 1OGTB 1FZKA 1EX0A 3WFDH 1CVRA 1VACB 2FLRT 2BERA 3BP4A 3T8XA 3HE6C 4JQXC 2XRAH 3W9EA 5JQ6L 1Q0XH 2ZOKB 3T0ED 3HR5B 1DBKL 5TE7L 4NZUH 2EDWA 4BFIB 1F4YH 4BFEA 4ZD3H 1MIEL 4N0RA 5IR1B 3WDIA 1X5FA 4PJCE 1ORSA 3TBTA 1KTLB 3BISA 1UB5A 4D0DA 4GMTL 4WFGD 4NGHH 1C16B 1T0NB 4RX4D 3UPAA 2AJYH 4WV1A 4Q0XL 1H8NA 3RNKA 2LFGA 4NBZB 4LU5L 1YUHA 1RZIA 2XN9E 3FFDA 3QHFL 5EO0A 4MMZC 5HJ3B 1BBDL 5DC4B 1IAOA 3U46A 3KLHD 3VFSB 4NQXB 3NFPB 5MI0C 1F8TH 2X4NA 4X6FB 5L8LB 3MYJB 1I1RA 5HDOA 1A6ZB 4PLJD 4G6FB 3GSRB 3CLFH 4X5WA 1WVZA 4P2RE 3U30C 1QRNA 2KBGA 2CDEB 4YO0A 5IBTH 3TH3T 1MQKL 4NN7C 2OK0H 3WHXA 1U0QA 4DCQB 3AS0A 4A6YB 5E2TL 2ORBH 5ITFA 1LO4L 4X9IA 4YHZH 3MRRB 2DQGH 2GUOB 4BH8B 5T3ZL 4ONFH 1HZHL 5CJXC 3EIFA 4HMEA 4G6JL 3VD7A 1FNSH 1XGUB 5D6CA 3ARFB 1MCLA 4PJ7B 2X05A 4NP4L 1P6FA 3G5VB 3LHPH 4BSWB 3BZFB 3S88H 1X5HA 5DTFB 1VEPA 3TBSB 3DIFB 2HT4C 4AG4L 5E5MA 4JPKH 3K7UA 3DSNA 4PJXF 3GSXA 4MVBD 3KPSE 3EUUA 1Y18B 3L3JA 1PBYA 3QO0A 1B6DA 4GRWH 2VLJD 4Z7VE 4FQJH 5DZOA 1HILB 3TT1L 5MEOB 4JQVA 3DVIA 1WCQA 1RFDL 2LTQB 2R23B 3QUMB 4TTGA 3SDCD 2HVJB 1K3IA 5IJVB 3G6JB 3O41B 4NFBA 4G9FD 4L4VD 2P1YA 5F9WB 2V5YA 1A3RH 4OT1L 4M7LH 2BVQA 2F58H 3S34H 4WI2A 2VQUA 4AIZB 3RVXC 1YEIH 4JLRB 4IRJD 1TPXB 3TZVB 1IARB 4QHLA 3STLA 4MD4B 2FJHA 3PQYE 1WQVT 4GW1A 1P5UA 4P4KD 4LHJB 1RUKH 3LKPA 5FYKU 4GRLD 4M1CC 3MTRA 2EDQA 1JNNL 3HB3D 3K3QA 1JUFB 1R3JB 4YDLB 4Z6AT 3C5JA 4KI5D 2I9LA 5T5FH 1EA9C 3S3SA 4KDTA 3SEPA 3OAZH 4LLQA 4HIHA 3OZ9L 2VDML 3LS4L 2VB5A 2HJLB 8FABB 1PYWA 1U8IB 3RTQA 3NH7H 1KB5A 4N90E 3H9HA 4OCYL 2A1WL 4QTHA 4KK5C 4P23A 2BOCA 5FCUL 4X9HA 2OZ4A 1EAPA 1LK3H 1MJUH 2Q76A 5D96B 1GSMA 1IM9B 3NMEA 4LGPB 5DVOA 3R06B 2R2EB 1KLFA 2G9HB 3FAWA 2B0SH 4Z7WA 1ZHKB 4YZFE 4S2SA 4WW1B 4AMKL 3C6LA 1UXWA 2MTPA 4JFYA 3QUXC 4ODVH 1CFBA 5GGRY 3IAGC 1ZVSB 3RIFK 3WDHA 5JW5A 4OJFH 1OOAA 5T1LA 1MHEB 3VCLA 2O5ZH 2BVUA 1OHQA 4GG6F 1LE5A 3VFRB 4MJ2A 2DQCH 1QVOA 2WM0A 5ENWB 4G8GA 3ZZ1A 5I1DA 4U2YA 4D0BA 4QRRE 5D93C 4K71B 1J0ZA 1IKNC 1Y0LB 1I9RH 4PBWD 5D7IB 5F7DB 4LHUD 3BYYA 4YXHL 2W9DL 3VFPB 3DTXA 3WXVH 4YXLH 1I8IB 3BGAA 4OLYL 5C6TH 4EKXA 2P8LB 3T2PA 4EN3B 3QUYD 4PREB 3QSKB 3AS1A 4M03A 3VFVB 1N59A 2IJ0C 4L8DB 4P4KA 1BFOB 1D9KC 1T1WA 3SKJL 3RL2B 4G7VL 4D9LL 5ID0B 4TYUA 4X5XA 3RBGA 1UJ3C 2BNQD 1J9CT 3QDAA 3L3OB 1AO7E 5DMIH 1AE6L 3ARUA 2ZOLA 5IB4B 4U4BA 5B3JE 1CVSC 1OP9A 3SJVB 3BEVA 1MY7A 3CVIH 4NO3A 1CFNB 5FUCE 3A6CL 2DBLL 5JW4Q 3B9VA 3TVMD 4QF1B 4XBPA 4F7PB 1JWMA 3MRIA 5I75B 4ZFOB 1A7BA 3P0YL 2CGRH 4J6RH 2X4TB 1I4FA 1UADC 3A6BL 1CFQA 3DO3A 3MJ6A 5ADPL 3L5WB 4KHXL 4NQCE 1B88A 2FWOB 3KAAA 1IMHC 2K9UA 4IOFC 2QADD 4FN0A 3ILPB 4JEGB 1P7KA 4L3EE 4WHTA 5CD5C 1PG7X 4RQQA 2X4SB 2A6DA 4CN6A 2DD8H 5GRXG 1CU4L 1N5YL 1WZ1L 1QEWB 2HFEB 5DD6B 3WD5L 1LEKB 2GTZB 3NIDF 3SY0A 1ES0B 1X4YA 2WBWB 1TZIA 3WFCL 3KYNA 1I7RA 4MNGA 2NMSA 3U48A 1MNUL 5CBAA 1G7PB 3VWJD 2BZDA 43CAA 4QY8B 3HI1A 3TM6A 3W0WD 2G60L 2O5YL 3D39B 4BZ1H 2RJMA 3P4NA 5I6XC 1D3CA 4N8PA 2FZ3B 1K8IB 1AR1C 3DPBA 1MCQA 1UJTA 1ROWA 4LHUA 1IRAY 2F19L 2XN9D 3PGFH 4HX1A 1DQML 4V2BA 4GUPA 5TE6H 3N0PB 4TNWF 2FO1A 4MNQE 3GRWL 5EORL 4BQ8A 3QUYA 3HZMA 5BZWA 3CFKA 1KELH 1R5VB 2IANE 2DI9A 3BJLA 3V0VB 4O58H 5JHLH 4JN1H 4UV4H 1W8OA 3UC0H 3P0VH 1PX4A 5CWSA 1HXMA 4W4OC 3RWDA 4P2RD 1CDHA 3FB7B 4DGIL 4FXKB 2X7LB 4AEHH 4LLVA 1RZJC 1DBMH 1G6RL 2ARJB 2Z8WC 4YHKH 2NY0D 3UROR 4IJ3B 5HHPA 5C0ND 1A6VL 4H1LH 2DDQL 4S0TD 1CE6B 3CX2A 3RWGB 3D0VA 3EYOB 4XVJH 1BIIB 4BZYA 5TDNB 1FVEA 1QLFB 3UTSB 2WIIA 3QAZB 4MA3B 3B9DA 3KLAB 1J87A 2FIKB 1QSEE 3AY4C 1CDBA 4ERSH 4MA8L 1F02I 3FRPG 2QJDA 1T03H 4TUKH 5IF0B 4ODSH 2B39A 3QQ9C 4K8RH 2HMIC 3KPSD 1CR9H 1R3KA 3MCKB 2H9GB 1KCVL 4U0RC 1XGRA 4Z5RB 3NCJH 2DM4A 4DFIA 3OGCB 5CFHA 3LSOA 3RDTD 2PW1B 2V9QA 5EOCH 4APQA 4JRYA 5DJDA 3JTSB 5FUOL 3VWJA 2V2TA 5IW6A 1A9BA 3FQTA 5I1HL 2HH0H 2FX7L 1NFIA 1CG9A 5EU6E 3W0WA 3MOBL 3QCVH 3S36L 3S98A 5DWUH 1H3GA 4O2EB 1BOGB 1DE4B 4NYLB 5GGSY 3ROLB 4E0RA 1MHPH 5HHQA 5GRVL 4KJPD 3KPNB 3PQYD 3U4AA 4KAQL 3UTZB 2VLJB 3OJDB 3HMXH 3WKNA 1MELA 3GIZL 4CAGA 3L3KB 2WP3O 1PD6A 1NBYA 4WO4C 4Z7UF 3ILQC 5JDSA 5KSVA 4KQ4H 4U49A 1Y6NR 5FYJH 4Q6IA 1K2DB 4G9FB 4L4VB 5EWIL 6FABL 4QYOA 3O3BA 3B2UD 5KSAB 5GPRA 1NANI 4IRJB 4DW2L 5DO2D 4LIQE 5KG9B 5HYQA 4N90D 5C3TA 3ULSB 1T1ZB 4Q0XH 2CRIA 4J3UA 2ADJA 4NQEA 4YBLC 3LKNB 4RWYL 1FL5B 1BJ8A 2Z8SA 4UZGA 5JW4M 5B8CB 1KBGH 4L8SC 5D2NB 4XBEH 3AREC 1BBDH 4GRLB 4LCCC 4XP5H 5K9OB 1NCAH 2X4QB 3KVQA 4U33A 5HHNB 4QRUB 1U8QB 3OKEB 4IS6A 4K9EL 4TNVK 4G6AD 1TJGH 1UB6A 2UZXB 5IHBA 2R29H 3O8XD 2AXGB 2CK0L 1YMHA 2QEJA 4OKVA 1XF3A 3MBED 3MV11 5C0EA 4QHMB 5JNYB 2FEDD 4MQTB 5T33H 1LVEA 2ATKA 2AEQH 2JIXD 1YEHL 3PWPD 5GRJH 1JN6A 2DQTH 5F6IC 4NWTL 4X5LA 3VI4E 2VXVL 2VZVA 4H25A 3RDTA 3KPRA 1WIPA 5FDWA 3VXOA 1UM6L 4R0LB 4ENEC 3IT8D 4MWFA 5E03A 5IFHH 2DF3A 3VFTB 4DVRL 4DUWA 5IESL 3HHRB 3VE0A 4HKXA 4JFXB 3QEUB 3RWJA 2X6MA 4IDJH 4B41A 1TQCC 3MRDB 5TQ2H 4RFEB 3CX5J 3OAYK 1N4XH 2ZKHL 3WL9B 1NGYB 3BIKA 3X11B 4JDZA 2QBWA 2APWA 5GZND 5C2BH 1GPOL 2R9HD 1FZOB 3RVVD 1LEGA 3V4VL 3BP7A 3MUGA 5CBEA 2YA2A 3ARFC 1AO7D 2VZ1A 4KQ3L 3HRZA 4CJ0A 5E4IA 4C83A 1V7MH 4P3DA 4JY6A 3STZB 4OCSH 2JJTC 3G5XB 4QTIL 2C3VA 5IVZA 5DYOA 4YJZL 3BKYL 5JIHA 2QTEA 3B5TA 3WKML 5M94B 1VEMA 1IGYA 4R2GC 4OZIB 2EIDA 3BN9C 1CGUA 2QHRH 3V0WL 5D8JH 5GGQL 2BNQB 3MJGX 4NQCD 5KANG 2OLDA 5EC2B 3JWOL 3LRSA 3WJLC 4GQ9H 3Q6FA 4PJAA 3X3FH 4HW6A 4KUZH 5DMGC 3KPOB 5F9WC 3O8XA 4C54A 3R1GL 1U8NB 3V52H 5ADOH 4ONHA 1PZ5B 3MBEA 3TVMB 5BJTB 5GGRA 3MRLB 1L6ZA 1TPXC 1GGTA 1Q9OB 3QWOB 4GG8A 5D1ZD 3K2MC 3PWPA 4PGBB 2VXSH 4OB5L 3UDWA 2V5MA 2B1HH 2W59A 2ARJQ 1Z5LB 1CFSA 2B2XL 1AGCA 1KTDB 3TWCH 4F9PC 1TCMA 1WBXB 3O3UN 1QPXA 3JWDH 1RJLB 1XR8A 3LKQA 5JXEC 3IRPX 3O3AB 4NRXA 3T0AA 4EUPG 5T3ZE 2R1YA 2QSCL 2Y36H 5SWSE 3SBWA 4QHNB 4IOIA 4QRSA 2WWMC 5DSCB 1CGXA 3LB6C 3SKMB 3CFDA 5I76B 3MV8E 3MODL 2IAND 5FXCH 3BQUB 5GRZA 3WNPA 3AVEA 4LSSH 4WJ5B 4XVTH 4UDTA 4PJCB 5C0CD 4M7ZB 1LO0H 1MCRA 4DEPB 3NN8A 3E6FA 3O11B 4QEGA 5DA0B 3SKNA 4JG1L 3KHOA 5ICXA 3B6SA 4PB9H 2VDPL 4PRBB 5JHDE 1MREL 3QPXH 2XN9B 2IAMD 4PG2C 3GMPB 3RWFA 2VRAA 4LSUH 4YXHH 4MAUH 3LV3A 4NZTH 1MHCA 2XWBA 4Y4HD 4ZS6C 2F9BT 3FO1B 5DVMA 5BO1L 3V79C 5T1MB 4YXKL 4HLZG 5JR1H 1RQ5A 1G6VK 1PQZA 1FGVL 2G75A 4P2RB 4Y16A 1QSED 3KLSA 4WI3A 5E6ZA 2FATL 2A73A 2Q86A 2EKSB 2FDBP 5IMMA 5HYJA 3GEWB 3QH3B 4N0YH 2DRUA 3LRHA 4TRPL 1TZGL 3WS6A 1OWWA 1N6QL 1DDHA 4EN3C 2EYRB 4U1MB 4U0QB 5LQBL 4TULH 2CIKB 4XMPH 3K4ZA 3QULA 4M6OL 2ARWA 5EH1A 4H8WL 3ULUH 4OD3L 4ISVB 1KLUA 3AM8C 4X7FC 4NOBA 2BVEA 1PG7H 4ZNEA 1D6EB 1IGTB 3FL7A 2YKLL 1NLDL 3GSUB 3KPSB 1TVBB 4Z7VB 4ODHH 2R2BA 2VITA 1FHGA 4TVSa 5JW4N 3MRJA 3WFCH 4NNYB 5C0CA 4BZ2H 5I1JL 2YSSB 4U6XB 3U0WH 2XTJE 4Y5XA 4XAKE 2BDNL 4ZQKA 3LMJH 4KUCF 3KJ6L 2A83A 4WGVB 4HG4K 5LGHH 3QZWB 2G60H 4WW2A 5F89B 2BMKB 2DJ4A 1CLOL 3RX8A 1Z6JT 2VL5A 4R26H 1CD9B 3PQYB 3LDBC 5IHUL 4P9ML 1J1PL 43C9B 3NCYP 1UA6H 4WFHD 2QQNL 3BPNC 1G7HA 5HDQL 3K1KC 5KN5B 4RFNB 4FQ1H 5CZXC 4JRXA 2VISB 7FABL 1P9MA 2Z91B 2ED9A 5FCSH 2JB5L 1MJ8L 4CVUA 3VW3L 4E41E 5LJYH 4DGVH 2IQ9H 2UV3A 4M62L 1AQKL 4HUNB 1MI5E 2XNAA 4JFZH 4KDWA 3V4UL 3HNTH 4OZGE 3NACH 4PJGE 1U8JB 1AXIB 3T0EC 1KJ2B 3OKKB 4EDXA 2Y4SA 1SMAA 1JP5A 4OLWL 5IROC 5F7KC 3DROB 2DKMA 3AS3A 3VH8G 2QR0B 2CDFA 1GRWA 2BVYA 5AWNH 1MWAB 3QDME 5DT1L 3SOBH 2ESVE 4KK8D 1GGCH 5DJ8B 4GRMB 5GGSA 4LSVH 1T2QH 2FH8A 5IFJA 3QO1B 2HRPL 4FP8H 4ZS7L 4U1SA 3W11D 4XWOD 5T1KA 3N9GH 2JIXB 1JHKL 4IJ3C 4IRZL 2P5WA 1GGBL 3IKKA 3KLHC 5MHSE 4X6DA 5FO8B 3PWNA 1ND0B 2AXFA 4QRRB 3FCTB 5CMAA 2VXUH 1E27B 5FUOH 3FQNB 3MACL 5BW7A 1HH9B 2MFNA 1TETL 4PLJC 4KDTC 5DUBB 1MFBH 4M6AA 3RIAK 1QLRB 2C1PB 3E0GA 4ZXBA 4OGAC 5L2JA 4NQVB 1CXLA 3BRDA 4JFEA 1MCOH 5DEGA 1VFAB 3DSFH 3Q5OA 3FJTA 2AABL 3B3IA 1FGNH 4P23C 3M17B 1EHLL 5JPNB 2VLRA 1SHMA 4YHNA 4MDJB 1AO7B 3GIZH 3O3EA 4GW5A 2YWZA 3L5JA 5F44A 2W91A 4H1LA 4OM1L 1AFVL 2BXYA 3G6DH 4J4PA 2X4RA 1HHHA 5I1AA 1BQHB 3U4EA 3VI3F 3VFUB 4MVBC 3O2DL 1P84J 1EJOH 3ZYIA 3P11H 2SEBA 4IBLT 4EVNB 1XF4A 5FO9B 4HXBL 5J9PB 3WE6B 4QCIA 2AJVL 4NQCB 1OAQH 3SDCC 1Q72H 1OAKH 2PUQT 1MFAH 4L3EB 4PJXE 5F9JA 3TO2A 2AV7A 2M2DA 3BW9A 5T3ZD 3A0OA 1ETZB 5SWSD 3SDXF 2R0LH 5F96H 4OUOA 3T09A 4IRJC 1B0WA 4DKEL 3MV8D 1VKXB 3TT3L 3B4NA 1H0DA 4X4ZA 5D1ZB 5EFIB 1NMAL 4RGOH 3ZSSA 4XZUB 1BLNB 3U7YH 4P4KC 4Y19E 5B8CC 3LAFA 5D2NC 3OQ3B 2A6JB 1WBZA 2FR4B 4GRLC 1ACZA 3HB3C 3KR3H 4G43A 2FYYA 5E7FA 4KI5C 1BOYA 2LU4A 4DK6A 4XVSL 3HMXA 5JHDD 1N0XH 2YS4A 3O0RL 3MV7E 4JFPB 2FB4L 5A16B 4BYHA 5EB9A 4MNQB 2D7TH 4JZJB 5EC1B 3RUGF 2FECL 2YD3A 4NZRL 5EG6C 5B3NA 2F54A 2IANB 4TTDD 4AT6A 3F7VB 4X80L 1NCBL 3DX7B 4XB8A 3L3DB 3IFNL 4N9GA 1LO5B 2P5EE 5K93A 4X4YA 5DD1L 5EIIB 1YC8A 2OTUA 1J5OH 1GPOH 5LCVH 1EEYA 3T4AB 4R0LC 3MRGB 4N8CL 4KRPD 5ESAB 4MXWL 1NC4A 3VFOB 2VYRE 2Z92A 1B6UA 5L2KE 2ZOKA 3LZFH 4PJIA 2IAMB 2Z4QA 5IUSA 2Y06H 4X7SL 1J10A 5JLZA 1EIBA 3TIDB 3RZCD 5F97E 2BFVL 4FA8A 3HZKB 4Y4HB 1RZFH 5DEFA 1KTLA 4GXVH 4F8TA 2YZ8A 1PY9A 3BDYL 4NRZA 5CP7A 2R1WB 2YD1A 3L5HA 2EIBA 2KPNA 1QSEB 4HMDA 1I9JL 2HJFA 3VU2A 2IF7A 3IS0X 5HJ3A 4M5YL 3V5DA 1CS6A 2LU3A 5BMFH 1S9XB 4JO3H 3S5LA 3SGEH 4CVZB 4GG6E 2FNBA 1UGNA 1A7PL 5DR5L 3HNVH 5KW9L 3TESA 2VDRH 3N85L 1SEQL 2CRYA 3QUYC 2UWEF 1HQ4A 3P73B 5E8DH 4U6HA 1NGWB 4HCRL 5IM7B 1P1ZB 3MRNA 4OGYH 5EU6B 3BESR 1UVQA 2CDEA 4FXGB 1MEXH 2B2XH 2BHZA 4UDUB 5IG7B 2XZCH 5GRVK 5GZOC 3U82B 2OJEB 5CEXA 3TVMC 4R4BB 3IKCA 1I3RB 4R7DB 1ORQA 2QSCH 2ICWB 2OJZL 1S7VA 3HC4H 1DVFA 4O00A 1OT2A 1ZT7A 1B0RA 3V8CA 1Q9WB 3I75B 1S7XA 3KPQB 1QKZL 3X13B 3T1FA 4X83A 3P30L 4GMSH 2QADC 1KPUB 3IDIB 1T5WB 3BSZL 3UYRH 1A47A 3DMMD 4ZUUA 1L9MA 3W5MA 3L7FA 3ARPA 3BHBB 2ADIB 5IB3A 5DQJA 5A2LH 2CH8A 3DVGB 5JQHC 3THML 1DQQB 1B3JA 5KSBA 1HNFA 2XZAL 3VWJC 5J0BA 4M7ZC 4G6KH 4HS8L 4BELD 4AIZA 4WY7H 3TO4A 3QDMD 4I77L 3NIDE 3IVKA 2IADB 3EYSL 4YC2B 4DVBB 4XPAL 3ZT5A 3U0TA 3SDDD 3WDJA 1M1SA 4LVHC 4GSDL 4QRPA 1Y6KR 1Z9SA 4LLYA 5MHSD 1YECH 3MGTA 3H9YA 4Q6IC 5J8OA 3FMGH 1IKFL 1TNNA 4UINL 5FYKH 2ERJB 3MJ7A 2VWEC 4MA7H 3MUZ1 3GSVB 1FZJA 1RHFA 2F15A 4KV5F 2XWTA 4XNQB 4I18A 2WINB 4UNTA 2IPTH 4Z0BL 4KJYB 5DRZA 3WFZA 4M48L 4MDIA 3O6FA 2NY0C 4X8XA 3MNWA 5C0NC 3LQAC 1D5MB 1DBBL 3FOMA 1ZA6A 4ORZC 4LOUD 1YNTA 3TNNB 2G9HA 3O6LH 4OF6A 4XNXL 1H3PL 1HI6B 3F5WB 5DJ2B 1ZGLB 4S1RH 3OV6A 4HKBA 1KJ3H 4WW1A 2W0LA 3C08H 3DX8B 5F7UA 4M9OA 3V4PH 2BDNH 4JVUA 4LEOB 4F57H 4PJFA 3MRHA 5T3XH 1T83A 4YK4B 4AH2B 2UUDK 5F70A 3V7AG 4NO2A 5IMOB 1E4XL 4JANA 4FQ2H 5C08E 4ZPVA 1HSBB 5B38B 3ARDA 5DHYA 4IRSD 4U2ZA 1UZ6F 1W0WA 5ENWA 1FL3B 3DURB 4HK3N 3RDTC 4HWNA 2V6HA 2EDEA 1RIUL 1Y0LA 1XF1A 4K94H 3MREB 4PGCB 3MPCA 2XPGB 4FQIH 2BCKB 2CLZA 3FRUB 2H8PB 1DN2A 3S37X 3BXNA 5IQ9B 3BJ91 2PCPB 4KJPC 1JE6A 1AQKH 1C5CH 1QHOA 1BZQK 1OCWL 2XOTA 2VH5L 5SX4H 2O93L 4RFNC 3IFPA 4NC1C 3B8YA 1MCNA 5IB2B 3OJ2C 3LKSA 2R1XA 4R96B 1JIBA 2DLIA 1X4ZA 3F7RA 3B2UC 1VB9A 5DURD 2R2HA 3H3PL 5E2JA 5SWSB 4V2CB 1F3RB 1KJVA 2IEPA 3ALXA 4UBDD 5DT1H 5F8QC 4RSVA 4UT9L 4X9GA 4OF8A 5DO2C 4Z7UE 3MV8B 5GHWH 3ULVH 3L5WA 1YEJL 2P5ED 1VENA 1CI5A 4J1UB 4U1HB 4OIBA 1J0HA 4JZNB 2UVEA 2VERN 5D2LA 5HGHA 1RHHB 5C0FA 5JHDB 1JHLL 2WQ8A 1KXVC 4G6AC 1RMFL 2HFEA 5DD6A 1QFWM 4UIKH 1A1NB 5L2KD 3MFFA 3O8XC 2NCMA 1UACL 3LY6A 2YPKA 4QT5A 3MBEC 4NFDA 5HGAB 4D8PB 2FEDC 3LKRB 5F7EH 3ALPA 3KXFE 2C3XA 4MXVF 1U3HD 2BRQA 4IRSA 1PG7W 4QY8A 4E5XA 3PABB 5FO7A 1QFWH 4CW1A 2GYSA 3O2VL 4KRPB 4RMUA 1C08B 5CS7A 4ZUWB 1T7WA