2L4OA

Solution structure of the streptococcus pneumoniae rrgb pilus backbone d1 domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
175
structure length
175
Chain Sequence
METASAATVFAAGTTTTSVTVHKLLATDGDMDKIANELETGNYAGNKVGVLPANAKEIAGVMFVWTNTNNEIIDENGQTLGVNIDPQTFKLSGAMPATAMKKLTEAEGAKFNTANLPAAKYKIYEIHSLSTYVGEDGATLTGSKAVPIEIELPLNDVVDAHVYPKNTEAKPKILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell wall surface anchor family protein
publication title Solution structure of the Streptococcus pneumoniae RrgB pilus backbone D1 domain: in vivo protection and implications for the molecular mechanisms of pilus polymerization
rcsb
source organism Streptococcus pneumoniae
molecule tags Cell adhesion
total genus 25
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2010-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2l4oA00
1J8HE 4HXAH 4JY6A 3T0BA 5I16A 1KN4H 5IWLA 3VXQB 4ELKB 3SDYH 5GGTH 1OAZH 1W8OA 2BSTA 4X6EB 2R9HC 5IF0A 1AHWB 1IZKA 4NNYA 5DEGA 5F88A 3OJMB 1OPGH 4AH2B 3NZ8B 1YMME 2MCG1 2WP3O 4GRWB 2APFA 3SDDA 5E94B 3O8XB 5AG9A 4X80H 4KQ4H 5C9KA 2GITB 2HFEA 1ETZA 2VLKA 5HYFA 4YX2L 5I1EH 3FCTA 5F6IC 2R9HD 4WV1A 5ANMB 3VGGA 1CGXA 5LGJB 5EIIA 1T5WB 1EEUA 4OKVB 5TFSH 3BT2L 4PJIF 2XA3A 5FO8A 1EXUA 2ICWB 5IB3B 5JPNA 4HX1B 7CGTA 3JWDC 1X5HA 4L9LB 1OLZA 1VGEH 5FHBH 5IW6B 5IHZB 3Q1SL 2H6PA 4NUJB 2W9DH 3HUJB 4LCCA 3BWUC 1ZKAA 3BESR 5E8PA 3AS3A 5I1DA 5IFAH 5GIRB 3PP4L 3BSZH 5C0GA 2EE3A 5BRZB 4OQTA 4DKFH 5HVHB 3FMGL 4Y2DB 3WHXA 2EDDA 3Q6GL 4BELD 4XPFH 4H26A 1U8MA 1NMCC 4XNQB 3HLAA 3QIBC 5BVPL 2C3XA 5FUZH 3B5TA 1Z3GH 2XTLA 4X6BB 3KJ4C 3MRPB 4OLWH 4JM2C 3FB8A 1PKQA 1AR1D 4LSRL 4CMMB 5HYJA 2ERJB 5BZWA 3UEZA 2C9AA 5J7CC 4BJLA 1FP5A 1NUDA 3PHQB 1MWAL 2WIMA 4EI5B 3PWUB 1BZ9B 1CICA 3QCVH 4ODBD 3QQ4A 3RAJL 4NGHL 4FFZL 3FFDB 5C2BH 5KBNC 5C0DA 3QIBD 5J12B 2V9TA 1GL4B 3VGAB 5IIEB 3PF2A 2X4QA 1EO5A 2O5XL 3JBG7 4P2OB 3RL2B 4JM2D 5C09B 4DN4H 1YPZF 3AB0C 4FFWC 1JGEA 1QPPA 3AS0A 4PJFA 2VE6B 4KXZH 5DJCA 2PXYB 2AW2A 1EV2E 1CE1L 1RVFL 3IFNL 2WINA 3C2SA 5E2WH 3ZDZF 2BP3A 2OTWB 1D5XB 1FLTX 4WNQA 3VFOB 3EGSA 3SGKA 3HN3A 4TUKL 1T03L 4FFWD 4X99A 2HT2C 2ZOKA 1C12B 3BXNA 2DQJL 2H41A 1RULH 3EJJX 2EIDA 3NGBB 5EPMB 3L1OH 3ROLB 3WLWD 1A02N 4MNQB 5I1LA 4Q2ZB 4G8FB 4HKJB 3GIVB 3HAEA 4NSKB 4AIXA 3H9SD 3NCYS 5H94B 2ZCHL 2JCCA 5DJ0A 4L4VE 2GFBA 2I24N 4AK1A 2JB6B 2FR4B 1FAIH 5FGBC 4TPRL 3QFDA 2HT2D 3EYSL 3VXUE 4QXGH 3LSOA 4LVOC 2ZJSL 2NXYB 4TVSa 3BQUC 1KJ2A 4LL9A 1Q8MA 4PB9L 1LO5A 3T65B 5M95B 2WQRA 3S3PA 2AXJA 1QSEB 3SDXE 5GXBB 3T09A 4YXKH 3IKCA 3U4AA 2AJ3B 4TSAL 3ALXA 5I71C 4P4RB 2KL6A 5FYJL 3W11C 2J6EL 3DXAA 5IVXA 5IMMB 3TC9A 1JGDB 1RUKL 4X8JB 5EOTB 4FQJH 1N5AB 1INDH 4BQCA 43CAA 3BQUD 2X10A 4E0RB 2DLFH 1WAAE 5D6CA 5SX4H 3SCMB 4GBXC 1CD9B 1U95A 4Z7UA 3RTQD 3U7WL 2B5IB 4LF3A 4UT7H 3W11D 5IM7A 1RV6X 5C0JB 3KPMA 5HYSG 4LP5A 1U3HC 4MYWB 2GIYA 1H3UA 1HILB 3BW9B 3PIQA 2ZSVB 3DUSA 5JO5B 3I3DA 4XH2B 4JO1L 5EDXA 2P24A 1FFRA 5DQJB 4HAFA 35C8L 4LLDB 1PEZA 4PJXF 2F8OA 3D2UD 2NX5A 1BQLH 4L1DA 2BNQD 3MV01 2FJGB 4QYOA 1A7PL 5E5UB 2FATL 4PJGF 2ZWLT 5B38G 5BVJA 2OXHA 2P43B 3KNBA 5A2IH 1U3HD 2HJLA 4OGAC 3D39A 1U8LA 5DFTA 3WIIH 4L8SA 5E9DB 1IEBB 4H1LB 4PJHE 4QKXB 3VXRD 3BDXA 4JJ5B 3MOQA 2OYPA 4B7IA 4ZFOA 3HAEH 1HXMB 1NEZB 4XP1H 2AEQH 1MFCH 2IH1B 4PG2C 5LAXA 1M7DA 2J8OA 4R0LC 8FABA 1XR8B 1ZXQA 5C0IA 1REIA 4U6XA 3WEXA 1V3JA 3QDGB 4ZO7A 4MB4A 4OB5H 1GAFL 3EYOA 2YMXL 1HEZB 2UWEE 2V7NB 3EUUA 1G6RA 3K4ZA 1MHEA 4MB3A 2ORBL 3T3PF 5EULV 4Z77A 1I8KA 1HIML 3CUPA 3H9SE 3O2DL 3QIWB 3O6FA 1S7QA 4XC3L 1I9EA 1BJ1H 2QV2A 1K4CB 5T1LB 5IHUH 4ZUSA 1FVDB 3VXSE 1OAQL 5DJDA 2VDNL 1N3NB 1EGJA 4IJ3B 4RAUA 2OP4L 5HDQL 4G3YH 2O5ZL 1MH5A 4OIBA 4XBGB 3VXME 4KHXH 4J3WA 3L5IA 4KDTC 4L4TB 3NIGE 3EO0B 4NZRH 1OAKL 5DJYB 3NAAH 5E5MB 1N4XH 2GSIA 4WUUB 5C07B 3GDBA 2ZNXA 3GJFA 3EFFB 2BVOA 2PYEB 2R15A 4X5XA 3V7AE 4Q97A 4JZNA 3DIFB 1RJZA 1U3ZA 1G9NH 4MWFA 43C9A 1K85A 4NRXB 3IAPA 2I5YL 2QQNL 1DE4A 5I8KL 4LVHC 1BFTA 2EE6A 2BRRL 1ZT7B 1UQSA 1WIUA 1X5AA 3IDXL 5HHPA 4HUMB 3RZCB 2DM2A 2G75B 1IGYA 4MAYB 1CG9B 1W72B 1ZTXH 3ZKSD 1F90L 4NKOA 4CN4A 2H26A 3P30H 4OGXH 4P46D 5D7LA 2FJHA 3ULVC 4HW6A 3MNWA 3O3DB 5L88H 4QOKB 3VFUB 4Q9RH 1UKTA 3I75B 1X5YA 1KEGH 1MRDL 2IQ9H 5SWSD 1DANT 4NCDA 3T0DA 3VXRE 4J3SA 2E9BA 4IRSA 5EO9B 3SE3C 4YXLL 4P2QD 3GBNL 4NDMB 3ZZ1A 4RGNC 1Q0YL 4LMQE 4LSDA 1VEPA 1D5ZA 1SYVA 2NY0C 3DBXA 5CP3A 3QRFM 4Z76A 3KWWB 3CFCL 3P73A 3UO1L 1EGJH 2J88H 3RNKA 3CPLB 1TZHB 5E4EC 3BGFB 5DHYA 1JMZA 1OGAD 1X6NA 5AEAA 3T4YB 4ETYA 2NZIA 1HYRC 3UDWC 2E7BA 1RZJC 4U05A 4OSUH 3ARGC 3MCLL 5BS0B 2UVEA 4LQFH 3HPJB 3O6LH 5ADOL 3HAEG 3QNZB 2B4CL 4RGND 4U6HB 3QJHB 4OZGB 3VD3A 2NY0D 1PKOA 3GMRB 1KG0B 2R56H 3TT1L 4XGZB 2DTSA 2ITCA 1YYMH 2YK1H 1ITCA 4U1JA 1N6QL 3QH3B 5TDNA 1T1XA 2X9YA 2FHFA 5JHDD 3PWPB 3PXJA 3DVNB 4M7JH 1TVBA 2EYRB 3ARGD 2ZPKL 3P77B 1K6QH 1F2XK 5L0QB 1DQML 4HQQL 5IBLC 2AV1B 2D31B 2GK0A 2M8XA 3OKEA 4ODHL 4YHNA 3LVEA 5FOJA 1VSCA 1E28A 4CVWA 4PJBA 2UYLA 5KOVC 3UTQB 2BVYA 1LVEA 1NBVH 3VFWB 2AEPL 3QYCA 5JDJA 1JTPA 2MNUA 2N56A 1R3JB 1MCJA 3PL6B 3D85A 1V3MA 2NW2A 4GW5A 1INQA 1KC5L 4WHYH 4DTGL 3S97C 5IBLD 2BNRB 4XNYL 2VJXA 3KDMA 3GUTA 1JGVH 3MLTB 1LO4L 4GJTB 2H32A 2Q7YA 2VR4A 2DJSA 1Y6NR 3O11A 4TUJB 4S2SA 5ECJE 4HT1L 4NFCA 1MNUL 4IOSD 3HZKA 4LIQH 1CGUA 4MA3B 5CP3H 4MJ6B 1YEGL 1AXTL 4QXUL 4XPAH 1URLA 1T1YA 3C60A 2DF3A 1MJUH 2ZUYA 3PV6A 1ZGLM 1I3UA 4KZEH 3LEYH 1EFXA 1E6OL 4PRPB 4OCWH 4P2QE 5CD3A 2F19H 5GRUH 1ZANL 4HZLA 4F9LA 2DQTL 4NNXA 3LDBC 2FH6A 4M6MH 2QL1A 2VR9A 4UUJB 4WHCA 2V9RA 5CGTA 5KG9A 3ZTNL 4OCXL 1UCBH 1MVUB 3PGFH 5GGRY 2WP3T 2GCYA 1R24A 1OGAE 2NLJA 4WO4D 3MBXL 4X5WA 2DQHH 3ECBA 1LO0L 4TYUA 4Q74A 4BSVA 3LQZA 3DWTA 2BOBB 2CMRH 2J8UB 4UT9H 1KIRB 1KB5B 3QEGH 2YEZB 2R4SL 3O3BB 3S8WA 4X7SH 2AQ1A 2RBLA 3QDMA 1FZKA 3SDXF 4PJIA 4EXKA 3CFDA 5D4QA 1R5VA 5EOCH 4GG8A 4XXDB 2X4PB 4QHMB 4X4YB 3ZKMC 5MP6L 4DVRL 4G43B 3MSPA 1NCWH 3JWDL 1NGWA 2FO1A 3RWDB 8CGTA 4MJ2A 4JFPA 4PJ8B 1PZUB 1F5WA 1WAAF 3E6HB 1VFBA 1C5DB 3CFEB 1DBBL 3CXHJ 4C56A 4DW2L 2FSEB 4QHNB 1K8DA 3U2SA 5F6HI 1L9NA 1M71B 3SE4A 4JPWH 2V6HA 1PJ9A 5IBTL 2DLIA 2M1KA 2NY7H 2H32H 2EDJA 3ZKMD 1CL7L 4M4PA 3CFKA 3PABA 4L5FH 1E27A 1MFEH 4MNHA 4LVEA 4O58H 5C08B 4LK4A 3ARDC 1CXLA 1BQSA 4JM2F 4KJYB 2VC2H 4XX1E 5CKAA 2XQYG 5FYKD 5BOZG 4NT6A 4OZHE 3QFJB 5DO2C 2Z8RA 1I75A 4GO6B 4RQQA 4WWKA 3O81A 4UQ2A 4GSDL 3OV6A 4PJHF 1D6EB 5HDOA 3VXTB 3PV7A 3ARDD 2H1PH 3P4MA 1T3FB 4GMSL 4NO0A 1WCBB 5I2IA 4ZOEA 5I17A 3GSNA 1YPZA 4YX2H 2AJZA 1BBJA 3D9AH 4GAFB 3MZGB 3DV6B 4HIIA 4ZNEA 1HQ4B 4M5ZL 1JPGB 5DO2D 1Y0LA 4WHYG 5F89A 5FGCB 3BT2H 3RY6C 3SJVB 1IAOB 4A6YA 1EJOL 1MELA 2UWEF 3F58L 4YHYC 4UV4L 2VSCA 1QYGH 4ZAKA 5FK9B 2F53B 3BPLC 5DJXA 3Q1SH 4J4PC 3VD4A 3Q3GB 2XOTA 1YEJL 4UZGA 3F62A 4ETQA 1LGVA 2IAMA 3WYRA 1AO7A 1RHHA 3RBGA 5H35B 3QXUA 5FA4B 1GZPA 1WBZB 4L3ED 3PP4H 5D72H 4AIZA 2O26U 3EYFB 1QFOA 2ZG2A 3BP7B 1FNHA 3OAUH 5J89A 3AUVA 3FMGH 5FYLD 3NIGF 4J4PD 5CSGA 1OM3L 5EBWB 4J12A 5BVPH 1E4XH 1VERA 3C6LA 1A6AB 3U82B 2QSCL 1A4JA 2HJFA 3UMTA 2MPAL 1FL6B 1TCMA 2E7LC 2X4UA 1DQJB 5IW1B 1ZLVK 1JUFB 5GS3A 2CLVB 3NPZB 4S1SL 1TNMA 3JV6B 2G60L 3RAJH 1T4KB 2FX9L 4U6YA 3N06B 3TNMB 4OFVA 4K71C 3NMEA 4NRYA 3TA3A 3P0GB 4MNGA 5JORA 3GGWA 1S8DB 4ZUVB 1FNSL 2VO5A 5BXFA 3OG6B 5E6YA 2BVUA 5HYSB 1XF1A 1I7UA 4KI1A 4QF1A 5FYKE 3GSNH 1SEQL 3AXLA 1RVFH 3KPRE 4MDIB 4NQEA 4Y4HB 1JPFB 2VL5A 4IIQA 2X7LA 1GHFL 1U8KB 5EC2A 2D7OA 2APBA 3HKFA 3EZ8A 3QEHA 3R0NA 1MHPH 1ZHLB 4TUKH 1T03H 2QTEA 4JY6B 1JRHL 5I16B 3IAGC 2DQJH 5CZVH 1AI1L 2CKBA 2BSTB 4X5LA 5ICXA 3U1SL 1RSFA 5IF0B 4NNYB 5DEGB 5F88B 3IKKA 4YZFF 2XNAA 4PG9A 3TBTA 5HD8D 3RHWF 3EAKA 4NHCL 5GRVL 4P3DA 4HUUA 5E08L 4IRJC 1D6VH 3GB7A 3SDDB 3O6ML 5F1IA 4ONOA 5I1AA 3EYSH 3BN9C 4YAQA 2HFEB 2ZJSH 1BVZA 1ETZB 1ORQA 2NY2B 1A22B 2VLKB 5BO1L 2BZDA 4PB9H 2BVEA 3FCTB 4OJFL 4WV1B 3R0MA 4RFEA 3RUGE 5KANG 1X5JA 2XG5A 5EIIB 3LH2L 4WDIA 5FO8B 1EXUB 2FBJL 1UVQA 4IRJD 3BISA 1NUGA 1W0YT 2AQ2A 5E99L 4B0MM 5JPNB 2J6EH 2YS4A 4XWOC 3S3JA 4JFFD 5FYLE 2R2EA 4Q9QL 3BN9D 5GJSL 4P57A 1RUKH 1ZA6A 2H6PB 5ESVA 4LCCB 1F02I 1I8IA 1UM6L 5DGRA 3GK8L 3S9DB 3C08L 1WGOA 1OB1A 3MLPA 5E8PB 1EHAA 5I1DB 1WWCA 3SGJC 4RX4D 3O9WA 5IJVA 5E70A 5C0GB 4WIQA 3U7WH 4DGIL 5ERWA 4XWOD 5CJXA 5HI4D 3WHXB 2W0LA 4H26B 1U8MB 3HLAB 4X0KA 3MV8D 4JO1H 1U8HA 1BM3H 5BV7L 3DMMD 2UZYB 2VRAA 3QWOA 3FB8B 1PKQB 4RMTA 2BOCA 3WV0A 1A7PH 4X6DE 4W4OA 5D6DC 5HYJB 5BZWB 3OHXA 5F9DC 5D2NC 3DRQA 4Y7MA 3WL9A 4JRYD 1CICB 2COQA 3QQ4B 5C0DB 3RU8L 5DFVC 2AXGA 2X4QB 4KI5C 1MFBL 4F15B 1J8HA 1OSZA 2YPKA 5HYQA 2DIBA 2EDWA 2EKSA 3P3YA 4K7PX 4JPVL 1IGTA 2A77L 2IALA 1QLFA 3H2WA 1JGEB 3QQ3A 4YBLB 2OK0L 1F4YL 4PJFB 1QBLL 1FGNL 5EUKA 5D7KD 1GSMA 3AVEA 3G5VA 1YMMA 4JQIH 5DJCB 1GAFH 2YMXH 2HN7A 4ODUA 5IKCA 2ORBH 2AKRA 2WINB 5JOEA 1HIMH 2Y06H 4ZS7H 3VFGH 3Q5OA 3O2DH 4JREB 4P9HC 5TGBA 5DFVD 4XC3H 3ULVL 5AWNL 4KI5D 4WNQB 3HE6A 5DSCA 3EGSB 1BAFH 1MCPH 5T1MA 1OAQH 1MHCA 3TV3L 2VDNH 3MLRL 1BFVH 2HKHL 2ZOKB 1BD2D 5HDQH 2VXSL 3BXNB 3PWVA 4MD5A 5F70A 2O5ZH 3MLYL 3KR3L 3RJDA 1FRGH 3N1GC 4G8GD 2J8HA 1KB9J 3RWCA 5ESAA 5I1LB 3HAEB 1P5VA 3BO8A 2JCCB 4JFFE 5DJ0B 4N0YL 2GFBB 5A2FA 4AL8H 2HLAA 3QNYA 3BYYA 3FO0L 3QFDB 3QUML 2Z92A 2AGJL 4UTAH 3LSOB 2B0SL 1HN1A 3M1BA 3JVGC 1KJ2B 1FH5L 1J11A 1LO5B 5I1JL 5IMOA 3Q5YA 1N8ZA 3IKCB 5D1QC 4D94A 2OR8A 3QO1A 5I8KH 4PJEE 1RFDL 1P7HL 4R4FH 3DXAB 5IVXB 5KZCD 4HS6A 5K9QG 3VRLE 4CJ1A 2MCPH 4HMEA 3P40A 3MPCA 43CAB 4G9FB 3OGCA 4RFNB 5FM8A 1XIWA 4LAQH 3TF7C 1J05A 5D6CB 4OZHF 5I6XC 1M1SA 3GMOA 3WKML 4NKMB 5FO7A 5D1QD 1T7YA 1MFAH 3P9LA 4P5TA 1U95B 4Z7UB 4OI7A 4JRYE 4LF3B 3JSSA 5IM7B 3FQWA 4Y16C 3TZVC 4PD4J 3KPMB 1MRDH 1NBYA 3PIQB 3DUSB 2P24B 1LEIB 2YA1A 4KRMB 3V2AR 3GBNH 1J9CT 2NX5B 4G5ZL 2XZAH 1UB6A 3OXRA 5C6TH 1BWWA 3QWQB 4ORZC 4QYOB 3CFCH 4O5LL 1O7VA 1RD6A 5D7KE 3UO1H 3S6CA 3ULUC 1W0WA 5BVJB 1YJDL 4Y16D 3TZVD 3KNBB 2HJLB 3BGAA 4N1HB 3D39B 1U8LB 5ADPH 1ZWIA 1OARL 4L8SB 2EH7H 5HYEA 4KI5E 5I74B 2YUZA 3MCLH 4ZFOB 4JR9H 4JFDD 3VI3E 1E6JL 1SJEA 4RDQG 2D7TL 2B4CH 3ARBC 5LAXB 1M7DB 4NRZA 1BD2E 4MJ5A 3NCBB 8FABB 5C0IB 2FO4A 5GISL 4U6XB 3WEXB 3ULUD 3LB6C 2Q8AH 4G8GE 3L6FA 4O51A 3U9PL 3EYOB 1N6QH 1G6RB 1MHEB 2YBRA 4Z77B 2RHEA 1I8KB 5F1SA 5DTFB 3CUPB 4L4VA 4TRPL 3O6FB 1S7QB 4EI6A 1KIPA 4P9ML 3VXUA 2LTQC 2RCSH 3BPOC 3CDYA 2EDBA 2NZ9C 4D9RD 4HQQH 3ARBD 4ZUSB 4ODHH 5DJDB 4H25A 3U9UA 3ZDYE 1C7TA 1YQ2A 3LB6D 4RAUB 2ESVD 1H15A 3AC0A 3ZHKA 2JJSA 4R97C 1MH5B 3LMJL 4YEFA 4M93B 4PRID 3VJ6A 3GSWA 1RZIA 2GSIB 4UB0L 4FQHA 2J1KA 2NZ9D 1FFNB 5ELIA 4DTGH 2DI7A 3HE7C 1OP5K 3GJFB 5I73C 3OZ9H 3OX8A 2IFGA 1CTOA 1T22A 1FCCA 4GLRI 1WAAA 1I1YA 2BVOB 2EKJA 3PWNA 1AGCA 5HHOD 2EEDA 3I02A 1EIBA 4HKXA 4X5XB 4PJ7E 5CD5C 4JZNB 1RJZB 2BX5A 4MHHG 3MRNA 5BZDA 4FMFA 1KTLA 4MWFB 4HT1H 43C9B 4NOBA 1MNUH 5T5NF 2YD2A 4Y1AB 3F6IA 5I1IH 3KHOA 1YEGH 3AU1A 1DE4B 1DSFL 3GMLA 1SYSA 5F7MC 5GS1C 4KPHL 1UQSB 3HE7D 5A2LH 2HT3D 2WANA 5HHPB 3NA9L 4JM2A 5KS9A 1E6OH 1PFCA 4M3KB 1IGYB 3HFML 1C5BL 1YZZA 2W65A 5DMGC 3CX2A 1ZANH 4NKOB 4ZXBD 2UY7A 3MRBA 4HCRA 2H26B 5D7LB 5T1KD 3ZTNH 4YHML 2FJHB 4TNVK 3G08A 3MNWB 5E1AA 3SE9H 1IMHC 3UBXI 3PGDA 2EC9U 3BIKA 1S7XA 3MBXH 5F93C 2VMFA 1PVHA 3L5WA 3S35L 5TH2A 3BZFA 1L0QA 4S1QL 5KSBE 3T2NL 3BAEL 4IRSB 2R4SH 3BKCL 5DMGD 2C1OA 3MMEA 4KROB 3REVA 4O2FA 3RUGF 4BSJA 1D5ZB 1SYVB 3DBXB 1MREL 2UWEA 4LHUD 4PBWD 5AZEL 4Z76B 3ULUE 3P73B 3TT3L 3RNKB 4NFDA 5DHYB 1CBVL 3H9SA 5JIHA 4S11A 5MP6H 4DVRH 3ROOA 3JWDH 1YN7A 4J3OC 4QXTA 3VXSA 3MYJA 3QRGL 1DBBH 2YHGA 4DW2H 4ZFGL 5IESH 2ESVE 4ODSL 2BRQA 1V8HA 5IBTH 4PRIE 2ITCB 4S1RL 5D1XC 4HHAA 4U1JB 5TDNB 1T1XB 4NQSB 1AD9A 2AJVL 4QLRA 4FQQA 1TVBB 1UZ6E 4HGMA 1C5CH 3NOIA 2MJWA 2F8VA 3WUWG 3BQUA 5ICYA 4DAGL 2GK0B 1HKLL 3OKEB 4YHNB 4Y2DC 1J8KA 5D5ME 4X6DF 3OAYK 4F7MA 1E28B 4PJBB 2UYLB 5I1HL 5D1XD 2D4DA 3RTQA 3WIHA 3LQAL 4Y19D 1N0XL 1XZ0A 5ISZE 1VHPA 2VTFA 3LKQA 1IAKA 2WW8A 3D85B 2NW2B 4GW5B 1INQB 2ERJC 5HJ3A 1QFWI 4M5ZH 2FEEI 2R69H 4LFHD 3D2UA 5HHMD 3RIAF 5KAQF 4AJ0A 4EI5C 3GUTB 4ZQKA 4O2EA 1JF5A 2FECI 4QT5A 2H32B 4PGBA 5MEND 2Q7YB 3VGAC 3O11B 2MKLC 4S2SB 4UV4H 1A0QL 1LNUA 2MFNA 4P2OC 3HZKB 1U3HA 5J4MA 4HK3J 4L8BA 3VXRA 1YEJH 1MJ8H 3NPSB 1T1YB 3C60B 3M8OL 3PV6B 4CL7A 2X9XA 4KY1H 1EFXB 1IAIH 3SGEH 3QPXL 5CD3B 4F37K 1IGCL 3SPVA 4HZLB 4NNXB 3OL2A 4P2OD 4IEFB 3F7VA 3KJ6H 1Q38A 5KG9B 1XF4A 1U6AL 3QAZB 2GCYB 1OM3H 5JMOC 1R24B 3TYGL 3ECBB 2QSCH 3IT8D 2D0GA 4BSVB 3LQZB 3DHMA 2DJ4A 2MPAH 3RPKA 4HUNB 4I3SL 1UACL 4HXBL 4J3VA 5CLWA 3QDMB 4S1SH 1FZKB 4PJIB 2Q8BH 4FZ8H 3CFDB 2FX9H 1R5VB 5A16A 4GG8B 4PJEF 2QHRH 3EOTL 1Y18A 4DKAA 3HMXL 1KGCE 5I18L 4PYHA 2GAZB 4XPTL 5DWUL 2G2RA 1FNSH 2OZ4L 3VRLF 4M3JA 4HEPG 1NGWB 3FKUS 4Z18A 4JFPB 3V0VA 4U1HA 1FNGA 1VFBB 5F9WB 4C56B 4J3TA 2VQUA 3U2SB 4R26H 3K81A 1HE7A 1CU4L 3IFLL 4KDTA 1GHFH 4KRPB 1N0LA 3QR2A 2R1XA 2Z91A 5EIVA 4Y19E 2NXZC 3V4VL 1AE6H 4PB0L 3CFKB 3PABB 3HRPA 5C0BD 5L2KE 3F7RA 1TTUA 1E27B 3N1QC 4MNHB 3KXFB 3EDDA 1JRHH 5K9JL 1MAMH 5CGYC 4YHOL 1Q9OA 1AI1H 1H8OA 3ETBF 5HHME 3U1SH 4NT6B 2X4RA 5JUEH 4P46A 5MENE 3LEVL 1QRNE 5L6YL 4NHCH 5D70H 5JW4Q 4RQQB 4WWKB 2NXZD 5HXMA 5E08H 3JV4A 4UQ2B 5DQ9A 4HS3A 1KPUA 4KI5F 1X44A 3P4MB 3VI3F 4NO0B 5I2IB 5CGYD 1MPAL 3GSNB 1YPZB 2AJZB 1BBJB 5J06A 4P2QA 12E8H 4HIIB 2HFTA 1NGZA 3BKYL 1Y0LB 2RQ8A 5F89B 1BMGA 5J0BA 5L9DL 4NN6B 4N1CA 4NC0B 3LH2H 3MUJA 1BVLA 1CD1A 5C1MB 4PJDA 2FBJH 4A6YB 4EOWL 4F7TA 4ISVA 5IHBA 2B20A 4ZAKB 1OGAA 3SHSA 4Q9QH 4RGOL 5GJSH 5DJXB 5C0FA 3ARZA 2FH8A 2VXQL 1QQDA 1LO3H 2Y7QB 4OCMC 3SE3A 4ETQB 3GK8H 2IAMB 2V2XA 1AO7B 3C08H 1RHHB 5I30L 4JVUA 3V0WL 4I4WB 2AJXH 5E9DD 4OTXH 3ZDYF 4AIZB 2EO1A 5B22A 1KTKE 4DGVL 2XT1B 2HYMA 3QIWC 3GBLA 1TPXC 2WMPA 1XGYH 2IC2A 5CCKL 2DM4A 1GPOL 4JCLA 1L4IA 1J0ZA 4IJ3C 5IMLA 3E0GA 4OIIH 3MRIA 3ARGA 3MROA 3C6LB 2E3VA 3DTXA 2AI0L 4FABL 1A4JB 2HJFB 4M43L 3DX7A 1AQKL 4HAGA 4KC3B 2QHLA 4X7CC 3VMNA 2X4UB 4ZTOL 2MQCA 3QIWD 4PJ7F 1NL0H 1MCOL 4NBZB 3MYZA 2AK4D 4I77L 4JHWL 4OF5A 4CAGA 4Y5YA 4HS8L 1A6VH 1HSBA 1OCWL 1EX0A 3V7AG 3RU8H 4NRYB 1MFBH 3ARPA 4OZFA 3F7QA 1RUPH 3TA3B 4R7NA 4MNGB 4BFBD 5C0BE 2A77H 3GGWB 3RWFA 3QIUD 5BXFB 5SX5K 4WHDA 4L4TD 4M1DL 4N0UE 4GQPH 3MLVH 1YEEL 1F4YH 3KPLA 4XMPL 1I7UB 1FGNH 1YEKL 2R4RL 1IGML 4QF1B 5C07D 3ALWA 3AXLB 3FTGA 4X7DC 4NQEB 2VL5B 4IIQB 2X7LB 4XPHH 3RZCC 3ULVH 5AWNH 5EC2B 4ZODA 1CE6A 1WFNA 4MAYC 1KJ3L 1R3KA 4PRAB 2VISA 4K3JH 1Z9MA 3ZKNC 3QEHB 2VLME 4O4YL 3WO4B 3MLRH 4NQCD 3MUY1 5KSBF 4UI2A 2VXSH 4BA8A 2BHUA 3MLYH 5KW9L 3UTSE 3CMGA 5ICXB 1T6VN 1CGSL 3QSKB 3ULUF 4PG9B 3TBTB 4FQ1L 3RZCD 1F45A 4E9LA 3LS4L 4MAYD 1JGLH 4P3DB 4HUUB 5D7IE 3GB7B 1UWXH 5JW4N 4WO4A 5I1AB 2X9WA 1QLEL 3FO0H 4LPUA 3SO3B 3LD8C 2OSLA 3QUMH 5EUOE 4YAQB 4LPXA 2B0SH 1YNLH 1RZJH 1ORQB 2GSGA 4QOKD 3U4EA 1T7VA 3WN5C 4QWWC 2BVQA 1EZVY 4RFEB 2D7NA 5EIQA 1MCQA 4ENED 5CMAA 4WDIB 4M03A 1UVQB 4PTTA 2P4AB 5JQ6H 2R2EB 4JRXD 5EZLA 4LLUA 4P57B 1ZA6B 1UZ6F 5ESVB 5HVGB 1B2WL 5AG8A 4PP1C 1HI6A 1I8IB 4QWWD 1OB1B 3QCUH 3UP1A 1JGUL 3O9WB 5D5MF 5IJVB 4KMLB 3V4PL 4U1NA 4YK4B 4IRZL 3KYOB 5ERWB 4M7LL 2F5AL 3T0XA 4AM0A 4X0KB 2XN9D 4JO3L 1U8HB 1NCTA 3QZWG 4LHQB 4PP1D 2EE2A 2HTLC 1R5IA 3QWOB 3AY4C 2OXGA 5CUSL 4G5ZH 2FX7H 1HHKA 1I85A 2BOCB 3KPRA 3OHXB 4Z7NE 3DRQB 4DEPB 3WL9B 1RHFA 1IKFH 3BDBA 3QG7L 3V8CA 5I1KH 3KPSB 5KN5A 4R9HA 2EYSA 5JHLL 4OQ1A 3L7EA 2FHCA 2DD8L 1FLRL 4C54A 2AXGB 1E6JH 3ARDA 1J10A 2HTLD 4MJID 1J8HB 2YPKB 1OSZB 2BC4A 5HYQB 2EKSB 1J0IA 2D7TH 1IGTB 4NQCE 2IALB 1QLFB 1OSPL 1C1EL 3QQ3B 5GISH 5KSUA 4I48A 5EUKB 3G5VB 3U9PH 1YMMB 2HN7B 4ODUB 5IKCB 2AKRB 5TGBB 4TRPH 3K46A 4JZJC 5DSCB 3HE6B 4P9MH 4DK3A 2NY6D 1WZ1L 2JIXD 5T1MB 3OPZL 4YC2B 1T89C 5IJKC 1MHCB 4J7RA 1JK8A 2B39A 1IEHA 3PWVB 4MD5B 3TO4B 4ERSL 1BF2A 3RUGA 3RY6A 5E2JA 5F8RC 2QR0A 3RWCB 2AXHA 1OT1A 5ESAB 2QSVA 3HPLA 4GXVH 4K8RC 4J4PA 1N7ML 4OFPA 3BO8B 1NCNA 4JRXE 5FYJU 2HLAB 3QNYB 4LLYA 5SX4I 3H0TA 3VGBA 2EZ0C 2XXCB 3EHBC 2VN7A 2Z92B 4BKLA 5TJWK 3M1BB 5C0AE 1DANU 3QEQE 5IMOB 1N8ZB 2EDOA 3GJFK 4XPGH 1CXIA 4GT7A 1ZVYA 3WLBA 2F74A 4Z95L 2LVCA 4K8RD 3QO1B 1OW0C 3O4OC 4KPHH 3W82A 1HZHL 4PJ8C 2W0KA 1P7QD 2CRYA 1JN6A 1CLZL 4HS6B 3VFVA 3EHBD 2XN9E 4LAJH 1G7LA 3HFMH 3WUZA 2DDQL 2WM0A 4NQXA 4P3CL 1MCWM 3OGCB 1XIWB 1J05B 1BEYL 1RJYA 5LWYL 3GMOB 5FO7B 3GHEH 5IVNA 1INEL 1NCCL 4IM8A 3P9LB 4P5TB 1KCLA 4PJ8D 3FQWB 5FM4A 1NBYB 3VGFA 2V7HA 1OLLA 3S35H 4S1QH 5F1KC 1YC8A 4MJIE 4U6VL 4OIAA 4UAOC 3WHE0 4M62L 4OM1L 2G5RA 4JANA 1UB6B 3OXRB 3NFNA 1MREH 5AZEH 4F9PC 3BOVA 1MJJA 2HVJA 4FXGA 4M7LT 4U7MA 1E4JA 1DQDL 3QJFA 1W0WB 4P5KA 1S9KC 4YHIA 1X5KA 1U8QA 1ZWIB 3FRPA 1FC2D 4KK8C 3QFJD 3JUZA 1YY8A 5FYLH 1Q0XL 1SJEB 2O5YL 4RMSA 3QRGH 4ZFGH 2F54E 4NRZB 4MJ5B 3RWJA 4ODSH 2FO4B 4Z7WE 3F12A 3E1F1 1OTTC 4OT1H 1HQRA 4Q0XL 4O51B 4S1RH 2AP2A 4QO1A 3R4DA 4IRJA 2YBRB 4KK8D 5FGRA 4JFFA 4L4VB 5CEXA 2AJVH 3OKKA 5IEKA 3GKWL 4EI6B 1KIPB 3SJVD 3OWEA 3VXUB 3SGDH 1Q72L 5HHXL 5F6IB 1HKLH 2F53D 1I7ZA 1NGPL 4H25B 1XGUA 1MLBB 4RX4A 1OTTD 1H15B 3EFDL 5EU6D 1W0VA 3U30B 3NABH 1WK0A 3DARA 1IILE 1N0XH 4PJEA 3VJ6B 3GSWB 2VSDA 1RZIB 1AC6A 2R2CA 4FQHB 3VD7A 3MV8A 1A6UL 4FS0A 4OLEA 4EQ3A 1VADA 5KJRH 1CFNB 3DMMA 5JOFA 3OX8B 4K2UL 1T22B 4M1CD 1I1YB 3CJJA 3PWNB 3SGJA 1AGCB 3DRTA 4DN3L 3I02B 1KYOJ 4HKXB 3MRNB 5BZDB 4CRPA 4WW2C 1A0QH 1TQCC 3RRQA 2N7AA 4JRYA 1Y6KR 4UV7H 4HMCA 3ARQA 3AU1B 1NMCB 2PCPB 3K8MA 4K23L 3GMLB 1SYSB 3R06A 4RMQA 3KJ4B 4KGLA 3CH1A 1FL5A 4JM2B 5KS9B 5J11B 1IGCH 2W65B 2FB4H 2HLFC 1YNTA 4HPOL 1RZKL 3MRBB 2P47B 1KELH 4XNMA 3G08B 1U6AH 5E1AB 3PGDB 1TVHA 3BIKB 1JYVA 1S7XB 5C0CD 5D7IF 3LEXA 4M7KL 1AH1A 1IT9L 3L5WB 1U3YA 5IMKA 2Z8SA 1OY3B 3I6GA 5EUOF 4WI7A 3NA4A 2F5BH 3BZFB 4G6ML 3N0PB 5TH2B 3AB0B 4I3SH 3SBWA 1UACH 5FB8A 4HXBH 5CEYA 2HLFD 1BD2A 2V5SA 3STZA 5L8JB 3O0RL 2C1OB 3MMEB 1QO3A 4JFYA 4OV5A 3VMOA 4HBQA 1KEML 3REVB 3DURA 4JM4H 4G8GA 1L7IL 2UWEB 5EA0H 4OF3A 2DQDL 1P2CA 1II4E 5D96C 1FE8H 3EOTH 2NY2C 3HMXH 3H9SB 1S7VA 5I18H 1PX4A 4XPTH 1DUYA 5DWUH 3ROOB 2OZ4H 1DUZA 5ETUA 5DMIL 3OTTA 1EK3A 3KS0J 1YN7B 4OLZL 2W0PA 2YD9A 4LLWA 4QXTB 5CBEA 4OAWA 1A5FL 3MYJB 3AMLA 2E9WA 3ZHLA 2YRPA 1ZS8A 2C3HA 1CU4H 3IFLH 3MA9H 5EU6E 4CVXA 1J1XL 1TIUA 4UILL 2VXTL 4LCCC 5I8EA 1EUTA 3MGOA 5E6IC 4ZFFA 4HHAB 3V4VH 2VITA 1ODAA 1EZVX 4ODXA 5ESQA 1AD9B 3DVGB 5CZXC 1Q94A 4FQQB 2ZG3A 3QA3A 4QGTA 5K9JH 2Z4QA 5F72S 4LVOB 3GHBL 2OJZH 3H9ZA 3JVGA 4YHOH 3BQUB 5ICYB 3ARYA 4NZDA 4PJ7A 2Y36H 4RFOL 4F7MB 3LEVH 2C3GA 5D1QA 5L6YH 2YUXA 5E6ID 3V6FA 5DD1L 5I71B 3RTQB 5T5FL 1EBPA 2XG4A 3EJZC 1S7SA 1XZ0B 5F96L 3LKQB 1KNOA 5CZXD 1SVZA 1IAKB 1NC4D 1FHGA 3MRKA 1HYSC 4UT6L 4LDEB 5HJ3B 1QFWM 4HEME 1ACYL 5TF1L 4HK3N 1X5XA 4OCSH 1JYWA 3D2UB 3STLA 5HPMA 3WXWL 3K74B 4ZQKB 4O2EB 4QT5B 4PGBB 5D9SA 1U42A 4EOWH 2FEDC 1UC6A 1JHLL 4LSVL 3EJZD 2FBOJ 1LNUB 3TZVA 1KIUA 4ELMF 1KTDA 3G6DL 1U3HB 4Y88A 4L8BB 1HYSD 1IGIL 1MCKA 5IB4A 1B9ZA 3VXRB 4YBLC 5GPRA 4P9HH 5T3ZD 5KSBA 1MCEA 1G7MA 3A6CL 5I30H 3RNQA 1M7XA 3BRDA 1W72L 1HKFA 2BK8A 3JWNC 2QQKL 4TULL 5AD0A 1N6UA 2VERN 3AM8C 4RA3A 4DOHE 4DGVH 2GKIA 3FRPG 1ZT1A 3SPVB 2FEDD 1FNEA 4XP6L 3FO9A 3F7VB 3N9GH 3SGKC 5CCKH 3SQBA 1XF4B 5FM5O 3MXWL 5HI5C 1GPOH 2X4SA 1TQBB 5MI0C 2AI0H 5GGUB 2DI9A 4M43H 4KAQL 5D8JL 1TZIA 1AQKH 3ARBA 1WZMA 1MCLA 4PRNA 3BUYA 4ZTOH 4KDWA 5E2UH 2ESVA 4JHWH 1TJGH 2ATPA 3MGTA 4HS8H 4PRIA 5HI5D 3GSQA 4QGYA 3X17A 2AJSH 2OQJA 2Z8WC 2RJMA 5A16B 3KPNA 1JWUA 1Y18B 4O02L 4DJMA 2J7LA 3RI5F 2G2RB 2CDFA 5BCAA 1LK3L 1KACB 4M1DH 3ZLQC 5DR5L 3BWAA 1A14L 3L5HA 3QDJE 4UOW0 4XMPH 4R4BA 3V0VB 4U1HB 5C0RL 1IGMH 1FNGB 1MJ7L 1DR9A 5D5MA 1KT2A 2DQCH 2EYTA 1A9EA 1T1WA 3QZWB 1U2CA 4KTEL 4PPTA 4GUPA 5ISZA 1T83C 1MCHA 2R1XB 3PNWA 2OMBA 1KJ3H 4KMQA 3RWIA 5KANI 1SJHA 5ACMA 2UZIL 3HE7A 4O4YH 4U1MA 3EYUL 3IDIA 3J8F7 1BQHA 2ARJA 2K3TA 4KVNH 1RMFL 1X5ZA 1Q9OB 5KW9H 3EO9H 4C55A 2VDPL 4XCFL 4ZXBA 1CGSH 4CW1A 1J1PL 2X4RB 1YEIL 2BSRA 4P46B 5T1KA 4FQ1H 1P6AB 2V5TA 1CI5A 5CFHA 3LS4H 4LVHB 4OLXH 4PRHE 1B4RA 5GS1A 4R4NC 3JV4B 3ULUH 1N59B 1DTUA 1QLEH 4JKPL 5SWSB 5DQ9B 4HS3B 1G0DA 4G7VL 5EN2A 1A6TA 2BVTA 4PJAE 1NEUA 5TE4L 1KSRA 4PJ9A 4BUHA 1Q1JL 2LAGB 1YNKL 3LZFL 2ZUVA 4P2QB 2GJZA 4U31A 1NGZB 1ZLSL 2A73A 4Z7WF 2XTJC 5DFWH 4LHUA 1OD7A 1BVLB 1CD1B 4PJDB 5I74C 1LP9E 1ZEAL 4R4ND 1T6WA 4ISVB 4F7TB 4HH8A 5C8JA 1OGAB 3QULA 3HZVA 5C0FB 2DBLL 3U0PA 3D6GA 1KPVA 2ARJQ 1QQDB 3FN0L 4JHBA 5TF0A 1YEHL 2V2XB 1FJ1A 3EBAA 4TNWF 1DVFD 2AJYL 4N90D 4EBQL 1YEFL 2XTJD 4RGNB 4HDIA 3QDAA 2N1KA 2NY0B 3V4PH 3MRGA 5CKGA 2VZVA 2E8YA 5E4EB 3G6JE 4M7LH 3VFRA 1XR9A 1PDKA 3K2MC 1P4IL 3WDIA 1EEZB 4X4ME 4JO3H 5FECA 5IMLB 4JFHD 5AYUL 1F2QA 3MRIB 3NCFB 3ARGB 3MROB 1XGTA 1KB5L 3DTXB 2ZSWA 4YDVA 5CUSH 3QUZA 4M93C 3DX7B 4YE4L 1GIGL 5CSZA 4D2NA 5J57B 4FFYH 4K3EH 3RWEB 2I9LA 4P3WA 2E5EA 3CSBA 2YWZA 1KCRH 4KQ3L 4HWZA 5D1XA 4PGEA 2X89A 4Y5YB 3AS2A 3P11L 2VN4A 4JG0L 2BSSA 2DL9A 4Y19A 2VAAA 4MAUL 4WWID 4LCYA 5JHLH 1HSBB 2DD8H 1EAJA 2IMMA 2P45B 1PX3A 4OZFB 4MS8C 4R7NB 4JY5L 1Z0MA 4PIRF 5GGQH 4A2LA 3EOBA 3RWFB 1UB5A 2XV6B 3PDOA 1OSPH 1C1EH 3KPLB 1R6VA 3CAFA 5DUPL 1NAKH 5MENA 3FTGB 3UC0H 1SHMA 4APQC 4LSQL 4UMGA 3T2QA 4XTRC 5IR1A 5FCUL 1F6AA 2D03L 1CE6B 4MS8D 1BOGA 1R3KB 4UU9B 2VISB 4MMXC 5DHVA 2FHBA 3OPZH 4FQLL 3C2AL 4C83A 1NC2D 1T2QL 4BFIA 1KLFA 3MUHL 5DD5L 1TETL 4ERSH 4U1IA 4ORGB 1BBDL 3RVTD 3UROR 1PD6A 4FQ2H 1VEOA 2VZOA 5J1SC 4GRWH 4N68A 3MLXL 1SQ2N 2R0ZL 3T77A 4APQD 1AFVL 3G5XB 4XTRD 2HTKC 3QXAA 1N7MH 2B2XL 4IRSC 4GW4A 1CVRA 3NACL 5IOPA 5KSVA 2P7TA 4WO4B 4POZC 4KROC 1C16A 2OSLB 1JFQL 4NUGH 2GSGB 3U4EB 4OBRA 4OD3L 1F4HA 4N90E 2BVQB 2XTJE 1K9TA 2HTKD 3FONA 4Z95H 1B0RA 4U4BA 3T3ME 4WI8A 5CMAB 4XXCC 1NCDL 3UTZA 3BP4A 4HXAL 4PTTB 1JHKL 4POZD 4KROD 2GJ6D 1OAZL 1MAJA 1RZGA 5EZLB 4LLUB 5CJBA 3TYFA 1OPGL 2DDQH 4GG6E 1MOEA 1HI6B 3VH8G 2VABA 1CLOH 1J87A 3FZUC 4KKBC 4KTYA 3TCLA 1INEH 1NCCH 3S4SA 4KQ4L 4U1NB 1X5GA 5I0ZA 4URTB 4LNRA 4CVZA 1ZLVH 1D3CA 4TTDC 5F8QC 3W2DL 4AM0B 4EZMA 5C0BA 1RUAH 3QG6A 2G5BA 2L7UA 1MCWW 4U6VH 4P4KC 5INDA 3LN5A 1DLHA 4N0UA 4M48L 5TFSL 1R5IB 4JRWA 4M62H 4OM1H 4X4XA 4KKBD 4M4RA 1IM9D 1WTLA 5FHBL 4G6JL 1KLUA 3JWOC 1X5IA 4TTDD 5KN5B 2EYSB 5JA8B 3L7EB 4P0DA 5CEZD 1PZ5A 4P4KD 3FT4A 5IFAL 3ARDB 4HIJA 4OI8A 4G6KL 2BC4B 2O5YH 1MUJA 3BSZL 2VXVL 4DKFL 3RBSA 3UTSA 5KSUB 3UTTD 2FL5A 4I48B 3D85D 2APVA 4Q0XH 3I50H 5FUZL 1Z3GL 2Y6SC 1M6OA 3P9MA 4HV8A 3VGDA 3GKWH 3ULSA 2PTTA 4PLJC 1Q72H 5EUOA 4JFEE 5HHXH 1A6PA 5CHNA 4LHUG 1J88A 4J3XA 1JK8B 1NGPH 2YA2A 3UJJL 4Y2OA 2PKDA 3EFDH 3QCVL 4GS7C 3QAZC 3RUGB 4FOMA 1CFSA 2Y6SD 5HGAA 1W2KT 4YHYB 2QR0B 1FO0A 1EFXD 3HPLB 4RRPA 2DYPD 3WCYA 4MLIA 2ED8A 1WVZA 1HCFX 2GJ6E 3NFSH 4FP8H 4M6NL 4LLYB 1HINH 3H0TB 3KPQA 4BKLB 2CXGA 3HG1D 1FG9C 4NBYB 1B0GA 1I1FA 1U0QA 1DBJL 3TP4A 3WLBB 2AK4A 2F74B 2W9LA 2IPTL 1GC1C 4K23H 3C8KA 2BNUA 2X41A 1RY7B 4Y4FC 5ANME 2D9QB 4ONHA 3QDMD 1JN6B 3VFVB 1PAMA 3IJYA 1G7LB 3L1OL 3QIUA 3VXOA 5INCA 2NY1C 1EERB 3CXHK 4NQXB 4YDLC 1ORSA 3TJHC 1FVEA 3VFSA 1RJYB 4OQTL 1G7QA 4U3CA 1QOKA 1HNGA 1FAIL 3RVWC 3I3EA 4KH2A 4QXGL 3EO1A 3CFJA 4Y4FD 4K71B 5C71A 1ZAGA 2X70A 1CK0L 3S88L 4M7KH 1IT9H 3B6SA 4DZ8A 1EMTL 1HDMA 3ZDXF 1HHJA 2P42B 2V7HB 4OBSA 5CEZE 2BVPA 4G6MH 4PJAF 2NY1D 4LSPL 4NQCA 4YXKL 3TJHD 3GSUA 3LS5H 4OCRL 1KEMH 5T3ZL 4JANB 2APTA 1HXYA 3NFNB 4F7PA 1MJJB 2HVJB 4FXGB 5DVNA 2DQDH 4P99A 3RVWD 3QJFB 1LP9F 4H1LH 4FQJL 4P5KB 1U8QB 4HH9A 5DMIH 5GHWL 1FO0H 1YY8B 4HIEA 4NN6C 2Q76A 1U36A 2BCKA 1A5FH 3THML 5D71L 1CCZA 4WFHE 2GQHA 4ZAKC 3RWJB 5DJ2B 3F12B 2K1MA 1JNJA 1J1XH 5GQBA 4UILH 5T3XD 1HQRB 2VXTH 1S7RB 2Z8VC 4NO0D 2LU7A 1PY9A 3G6JF 4IRJB 2IAMC 3KS0H 5F7UA 5F6HJ 5AAWA 1EEQA 4JFFB 4MA1B 4FQXC 4JRXA 5CEXB 1BQLL 3OKKB 5IEKB 4XCNA 3GHBH 1TENA 4P5MA 1KV3A 3WN5A 4D3CH 5H8DA 4RA0C 1DQTA 4Z78A 1I7ZB 1XGUB 2X6MA 5DUMH 2G9HA 4RFOH 4O2CA 3W9EA 5CJ8A 3OB0H 5T5FH 4WEMB 2IAMD 4PJEB 1MFCL 4FQXD 5F96H 4CNIA 3BH9A 4FRWA 3B2UC 1OD9A 3MV8B 4UT6H 1OF2A 2XN9A 1VADB 3CLFH 2JJUA 4ZSOE 3S4SG 3DMMB 5JOFB 1ACYH 5TF1H 1MVFA 1KJ2L 4HC1L 4TVPD 4TUOA 3WXWH 2BHYA 4WEBL 3ZKQD 1I7TA 1JHLH 4LSVH 1LDPL 4I13B 5H37H 4JRYB 3SKOA 2IFFL 1P6FA 1UXWA 1IGIH 3R06B 3WXVH 3WFBL 5ID1A 4QRPD 1JJUA 4MJIA 3AY4A 3A67L 3CH1B 1FL5B 1NGYA 4KHXL 4QRUA 4TULH 2QQKH 4IIQC 1VESA 3F7PC 2ICES 1YNTB 4NZRL 5I1CL 4XMKL 1GGUA 4XP6H 4XNMB 4HJJH 4XNUL 4NWTL 3WO4C 4KUCD 5HGGS 4K7FA 1T7XA 1TVHB 4NJ9L 1J86A 2QKIA 3C87A 2P5ED 3LEXB 5IMKB 4QY8A 1NGQL 1G9NL 4KAQH 3I6GB 5D8JH 5HGDA 3RHWK 4DFHA 2JIXA 1J0KA 5GSVA 5DURD 3O2VL 1J5OL 3GSVA 5FB8B 5CEYB 3QUXA 1BD2B 3STZB 3B8SA 5ACLA 4OV5B 1CL7I 1QO3B 2CSPA 4JFYB 5I1GL 2DL2A 3DURB 3GZKA 3QNXA 4G8GB 3T3MF 4I18C 5T3XE 2D7QA 1TDQA 4NFBA 1P2CB 4EJ1C 1H8NA 3MJ6A 2ITDA 4JZJA 3IAQA 3QXVA 1S7VB 1ZVSA 3BH8A 1ZTXL 1DUYB 4H1LG 1MCIA 3HI5H 4ZFOL 2RR3A 1DUZB 5ETUB 3DX8A 1MIEH 1T89A 5DR5H 3ZTJH 3P30L 1XF5A 1A14H 1G7JA 4LLWB 4GG6F 1NEZG 2YPLD 5CBEB 4OAWB 5C0RH 3GSOA 1MJ7H 5L88L 3NCMA 1IC4L 4RRPG 1AXSA 1HWHB 4DKEH 1NBQA 1ZS8B 4KTEH 5IV2A 1G6RL 4K55A 4CVXB 3IVKA 4YGVA 2HT4C 2FLRT 2ED7A 5I8EB 3MGOB 4TQEL 2VITB 1A1OA 2UZIH 1P7QA 4ODXB 3EYUH 5ESQB 1D5MA 5KZCB 4DWHA 1Q94B 3QA3B 2Z4QB 1T7ZA 2VAJA 1RMFH 1EGJL 4LCIL 1R0AL 4TVPE 4ESKA 4PJ7B 1FNLA 5CJXC 5F7WC 4I2XE 5D1QB 1OW0A 1FVCA 2HT4D 2MHAA 4OSUL 3V6FB 2E6JA 1QHOA 1S7SB 4LQFL 4DQOL 2V2TA 4JKPH 4G7VH 4LNVA 5F9AC 3MRKB 3L3HA 2H2SC 5TE4H 4W4OC 1YNKH 3QPQD 4CJ0A 4UBDC 4GOSA 4DEPC 1ZLSH 3STLB 5I6XB 3NIFE 1VFOA 4I3GA 5DZLA 5D9SB 3DO7A 4FZEH 1ZEAH 5F1NA 3FQRA 1K6QL 4Y16B 3TZVB 1IM3A 1KTDB 4ZUUA 1MRCL 4HFWA 4PGCA 4DUVA 3T0VA 5H37G 5IB4B 2P5EE 4NKIH 3FN0H 1AIFA 5T33H 1RZ8A 1YEHH 5KSBB 3WHE1 1G7MB 4UBDD 4IBLT 3D5OF 3RNQB 4JLRA 3W0WE 1NBVL 2UY6A 4XAKD 4JQVA 5AD0B 5FHAH 4F9PA 1ZT1B 2BDNL 1L6ZA 2B1HH 2VDRH 1FNEB 1BWMA 1Z2KA 2BY1A 4GAGH 3FO9B 4ZYKA 3TWCH 3WD5L 4LOUC 5I15L 4PJXE 4YC2C 4ZPVA 2X4SB 1FV1A 3OR7A 1UWXK 3EOYG 2ZNWA 1TZIB 2JF1A 1N26A 1GIGH 3ARBB 3CZFA 2YPLE 4PRNB 3BUYB 1LK2A 4NM4L 1FG2A 3FQTA 2ESVB 4W6YB 4H20L 4XPAL 5EU6A 4F58L 1FFQA 2EDKA 3KGRA 3MGTB 4LOUD 4JG0H 4YFLI 4PRIB 3GSQB 3VH8B 5D7JC 3T0ED 2OQJB 1MJUL 3SQOL 3LEYL 1JRHI 3KPNB 3PUCA 1WBYA 1JWUB 4J3UA 4LPCA 4NNPH 4JY5H 2LTQB 4Q6IC 3V6OE 5TPWH 2CDFB 5A2JH 3HNSH 1FDLL 1WSST 3BWAB 3BZDA 1NLDL 1UCBL 4R4BB 4LASL 5DUPH 3ZTJG 4R97B 5D5MB 2J5LC 1OP3H 1KT2B 2EYTB 1A9EB 1T1WB 1T0MA 1CLCA 5D7JD 4LSQH 4GUPB 2D03H 5GGRA 3PNWB 4X6FA 3OAYH 3RWIB 3FJTA 1XIWC 3CFIC 1SJHB 3HE7B 1OVZA 4U1MB 4MD0A 4FQLH 4AQ1B 1K8IA 1A8JH 4K07A 5I73B 3C2AH 3LOWA 4WI9A 3IDIB 1T2QH 5DD5H 4RISL 1TETH 1BQHB 2ARJB 1BBDH 4ZXBB 4CW1B 3KYMA 4WW2A 2R0ZH 1AFVH 2EIZA 1P5UA 3ZT5A 2BSRB 5T1KB 2EDFA 4OGZA 1CD0A 2B2XH 3NCJH 3NACH 4HUKB 5GS1B 5H2BA 1UWGH 5JDSA 2VH5L 4YBHA 3JWOL 2V2WA 1A9BA 3D25A 3UYPA 5JW3L 1A6TB 3D0LA 4MX7A 2W07A 4I0CC 3G9VA 1HSAA 4W4NA 1X5LA 4OD3H 4CN1A 2GJZB 2NY7L 4MSWA 4XAKE 5SWQA 2V17H 1BOYA 1J0HA 2A73B 4EN3C 4LHUB 4L5FL 1SM3L 1NCDH 1MFEL 4O58L 2FX8H 2EEAA 1JHKH 2E27L 2VC2L 3QULB 3HZVB 3B5GA 1UKQA 3U0PB 2Y07L 1KPVB 2CKNA 1FCGA 3GNMH 1FJ1B 1RUML 5FXCH 1IE5A 1UA6L 5KVDL 1CFTA 4HDIB 3E6FA 4EN3D 3MRGB 5DK0A 3OG4B 2H1PL 3C8HA 1CDHA 4XB7A 1TJIL 3LKOB 2LABA 3T0EE 3VFRB 2WNGA 3MLSL 1XR9B 3D9AL 3W2DH 2UVFA 2DQGH 3DVFA 1YUHA 4DGYH 3BI9X 5FECB 3V95A 1D5BA 3FFCD 1XGTB 2JJSC 2ZSWB 4M48H 4XI5C 2EDRA 3U30C 3ZE2E 4YDVB 5F7NC 3GRWA 3QUZB 2E7MA 4R6UA 5CSZB 3VGHA 1QYGL 2HFFA 4L4VD 4H8WC 4QNPE 3H3BC 2I9LB 3GM0A 1IAMA 4G6JH 3VXUD 4PGEB 5D1XB 5E6IA 3DSNA 1G0YR 2J8UE 3K80A 2BSSB 1IBGL 4Y19B 2VAAB 5DDHA 4LCYB 2EH8L 1NGXA 1GGCL 3CC5A 5DLMH 1NC4A 1GZQA 1CWVA 4XI5D 3GEWB 4G6KH 5D72L 4PYGA 1AR1C 1B6UA 1F8TL 3EOBB 1UB5B 2VXVH 3IDNA 3JZ7A 3OAUL 5ITBL 3PDOB 3L9RA 2C4FU 5HHMB 1Z9LA 5GS2D 1E4XL 2CK0L 3Q5TA 5MENB 4PGDA 5IBUG 4PRHA 4CU7A 3VWKD 4XBPA 5IR1B 1F6AB 5ALBL 5GRZA 3MOBL 5J11C 3TEUA 1BOGB 3L3JA 5IVZA 1WWBX 4PJAA 5DHVB 3OKYA 3UJIL 3EJYD 3UJTL 2R2HA 3UJJH 4C83B 4BFIB 1G9EA 3NTCL 4RGMB 2DICA 4U1IB 4WI3A 2A6IA 1FN4A 2YN5A 3T77B 1LP9A 4X9GA 4U1GB 4L4JA 2RAMA 3ILQC 3IU3A 3QXAB 2E7HA 2YD1A 4UNTA 4GW4B 2Z31C 5IOPB 2WWMC 5KSVB 2P7TB 4F80A 4WY7H 1ZT4A 4M6NH 2W59A 1C16B 3GSNL 3I9GH 4NQUA 5E6ZA 1EHLL 4JAMA 4YNYA 4D9LL 2Y1VA 2R2BA 2HFGL 3AM8A 3WLWC 4XCCH 1CXEA 1DBJH 4XP9H 5IGXH 3QO0A 3IYLW 2ADJA 3LKSA 3FONB 4A6YL 1B0RB 3ILQD 2IPTH 3C6SA 3G6JA 3S5LA 1MHPL 4JKMA 3UTZB 2Z31D 3BP4B 2WWMD 3MBED 2NTFA 2EDTA 2AK1H 4X4MA 5CZVL 1RZGB 1ITBB 1IC5L 3FFCE 3TYFB 4P2RD 3CGTA 2VABB 3HC0A 1CZ8H 5SV4A 3S37H 1VFMA 1D6VL 1G9MC 4OQTH 3TCLB 4C58B 3S4SB 3VXSD 5JPMA 3S88H 2XKUA 1CK0H 4LNRB 4EUPA 4CVZB 4HC1A 2A6JA 4ONGH 1EMTH 3FN3A 1RAMA 5DVLA 3KHQA 5C0BB 3QG6B 2VZSA 3VXMD 3GI8L 4LSPH 4UOW1 2G5BB 1T0NA 5INDB 2I26N 3LN5B 1DLHB 4N0UB 2C1PA 2IQAA 4JFZL 4HWEH 5J56B 4XCYA 4OCRH 3RTQC 2MSPA 4W70A 4X4XB 5T3ZH 3BKJH 3NIFF 3NBNA 3BD4A 4LEOA 2FLBT 4POYA 4W6XB 1T83A 5SX5H 1KLUB 2H8PA 3DOSA 3V79C 4NC1E 3MRDA 2NXZB 2W91A 3EDEA 2RIKA 1ADQA 4KUCF 1WT5C 5GHWH 1PZ5B 3FT4B 2XICA 3RIFK 2Q86A 4HIJB 3THMH 5D71H 4CGTA 1MUJB 4TSCL 4QRRD 4LCUA 5IFJA 1A1NA 3OGOE 3UTSB 2FL5B 3MA7A 5E8NA 1S7TA 1UM5H 3F6LA 1BM3L 1M6OB 4QHLA 3I84A 3P9MB 4HV8B 4GXUN 4PBVC 1D9KA 5IW3A 5HHQA 3MOAH 3ULSB 2PTTB 1BVKA 5EUOB 5CHNB 3WJJC 1ACZA 4LPTA 1DVFA 2XKNA 4B5EA 1H3VA 2CKBL 4GRMA 2ENSA 3HI1A 2DKSA 5EOQH 1CFSB 5FEBA 3TBSA 1BF8A 1TQBC 5HGAB 3DYMA 1FO0B 1JF6A 4ZNCD 3K0WA 2ZUUA 5DHXB 2Y5TA 4MVBC 4MLSA 4IDLA 2CRIA 5B21A 4DZBA 4GG6A 4JQIL 3QCTL 4WCYL 4M02A 1ZK9A 3HMWL 4HC1H 1KJ2H 1JIBA 3MCG1 3KPQB 4U49A 5C3LD 3UYRL 4P2RE 1H8SA 1VKXA 2Y06L 4ZS7L 4WEBH 5IG7A 3VFGL 2DJUA 2I60L 2MKWA 3LN4A 1B0GB 1EO8L 1XEDA 2H9GA 1TPXB 4TSBL 1LDPH 2YXMA 2AK4B 2IFFH 3UPCA 1BAFL 1MCPL 4LEXL 4FHBD 1BFVL 3C8KB 4MVBD 2E6PA 2VNCA 2BNUB 3WFBH 4L29A 4WGWB 2A9ML 1VA9A 4ONHB 1XH3A 2WUBL 1OT2A 1RJLA 1FRGL 2PUQT 3A67H 3IJYB 1ADQH 3QIUB 3VXOB 5INCB 3IDMA 2XXMB 1ORSB 4QHUA 5I1CH 1FVEB 3VFSB 2OR7A 1QUNA 4XMKH 2R0WL 2WWKO 4XNUH 4LVNC 1G7QB 4NWTH 3T2OA 4AL8L 4Q9CA 1FPTL 3NVQA 1MQKH 4NJ9H 4UTAL 2W1NA 3EO1B 3CFJB 2X70B 3VDAA 5JLZA 3B6SB 4DZ8B 1NGQH 2LVEA 1HDMB 1HHJB 5E8EB 2BVPB 3O41B 4GKNA 3O2VH 5E7BA 4AIOA 2GYSA 1J5OH 1YDPA 4NQCB 4CDHA 1NC2A 1GRWA 1V3KA 1HHHA 4P46C 5TE7H 4QRRE 3GSUB 1D7FA 5I1GH 4KUZL 1HXYB 1WBXA 3GMPA 4R4FL 4F7PB 4APQA 4HSQA 5C7XL 3WS6A 2MCPL 4QHKI 4CUCA 3SGDI 4YXHL 1K4DA 1JWMA 4HH9B 1R3LA 1SBBA 4LAQL 4LSSL 1MLCA 4JFEA 4L8DA 1JZ4A 4HIEB 2Q76B 3C5ZD 2BCKB 1MCDA 1MFAL 2LV4A 1IC4H 3CFBA 3BDYL 3P2TA 2CXKA 1G6RH 5DRZA 1A21A 3CSPA 1A7QL 3VW3L 4TQEH 1NSNL 5DEZA 1EFQA 1ED3A 4TNVF 5GRJL 3OKMA 4JRXB 1ZLUH 5LGKA 2GJ6A 3LD8B 2XZAL 4XCNB 3DLQR 5C6TL 1WZLA 4YZFE 4JO4L 3ZE2F 4LCIH 4P5MB 1R0AH 5GRYA 3WN5B 1KJVA 4Z78B 4QNPF 2G9HB 3IS1X 3RGVC 5ADPL 4O2CB 2EH7L 3W9EB 3OAZK 4XXCA 4JR9L 2VOTA 4MD4A 1U93A 2J8UF 4M6AA 1U9KA 4DQOH 3O3EA 4CNIB 3BH9B 1XT5A 3G9AB 4R2GD 3GJFH 2HP4A 4JPIA 3WNLA 1OF2B 2XN9B 2Q8AL 1P4LA 3E8UL 2VDLH 4Y5YC 3AREA 1ZE3C 2XA8L 3RGVD 4I8DA 1IM9A 2JCCE 4PV9A 1MSPA 4OFYA 1I7TB 1SY6A 2ZUSA 1VFAA 2RCSL 4W68A 5DJ8B 1MRCH 4XVUC 1UXWB 1AJ7L 3MV7D 1RURH 2IJ0C 5ABDE 3L3OA 1A4KA 4P4KA 5ID1B 1CDJA 4MJIB 2DQFA 3EDKA 1NGYB 4QRUB 4KK9C 1AGBA 1RK1B 3GIZL 1O7SA 2BDNH 5F7KC 3UTTA 4XVJL 3VDCA 4PREA 3WD5H 4X6BA 1FZMA 2BY3A 2CR3A 4XVUD 2DKUA 5I15H 4KKLD 3OZ9L 4K7FB 4G9FE 4ZFZA 2QKIB 1I9IL 3ME0A 4CMMA 1I3GL 2JELL 4QY8B 4ZMAT 2NY6B 5HGDB 2JIXB 4KK9D 5SWZD 2VKXA 3NCYP 3GSVB 4Z7UE 1ZSDA 4KTDL 4NM4H 2VZ1A 5I1IL 4XCEA 1T20A 3VDBA 4H20H 1BJMA 4F58H 3QNXB 3QWRD 4WO4C 3KG5A 5FUCE 3SQOH 3RZWA 4WU5A 2ITDB 4JZJB 2DYPA 1PW3A 3BH8B 1ZVSB 2V5YA 1MI5E 4G8IA 2APWA 3DX8B 1QD0A 1FDLH 1XF5B 1G7JB 1LQSR 1NLDH 2XQBL 3LY6A 4LASH 3DJ9A 3GSOB 3SE9L 4PLKC 5HY9A 3HG1A 4JVWA 1AXSB 3O2WL 4YFEA 4F37F 3MJ7A 5IV2B 3FO1A 2FDBP 3IVKB 2XI9A 1EO7A 4YGVB 1NUNB 1XAUA 1A1OB 5DD3H 1P7QB 3KLAA 4WU7A 1CR9L 1D5MB 3CNKA 4N9GA 5EPMA 2DIAA 4ZSOA 1KPRA 4RISH 3IETA 3TPUA 4PLKD 4I0PA 5CEZH 2YSSA 2OI9B 5KTEH 3C9NA 2Q87A 2FD6H 2LU3A 5CILH 2BHZA 2DAVA 1NFDE 4LLMA 4J6RL 1FVCB 2MHAB 4UIKH 3O4OB 5IUSA 4FQPA 2VH5H 4Y4FA 2OCFD 2V2TB 4YDKL 3JWOH 2JE8A 4FXKA 5JW3H 1IAIM 3WFCL 3IU4L 3MV7E 1I85C 3L3HB 5IESL 5DMYA 5IBUB 5JMRA 1B6DA 1EA9C 3RA7L 4AEEA 1NKOA 1HHGA 5DMKA 1GOGA 2XY1A 1SM3H 1YMHA 3DO7B 4XT1C 2J3SA 4KJQC 1T2JA 5F1NB 1C5CL 3FQRB 1IM3B 5CS7A 2E27H 5M94B 5CBAA 4E0RA 4ZUUB 1H3PH 4HFWB 4OZ4A 4PGCB 1BJ8A 1JTOA 4XMLL 3F7YA 4M1GL 2Y07H 1V5JA 3KPRD 5DYOA 1AIFB 1Z5LA 1RZ8B 2WLZA 2YPVL 3VU2A 3TN0C 1RUMH 4UAOB 3MO1A 4Y1AE 1UA6H 5SWZE 2FIRT 5KVDH 4JLRB 4P2YA 4HCRL 4BQ8A 5KVGH 3LPGA 4KJQD 1TJIH 4ZYKB 2FGWL 1YY9C 4LLDA 3MLSH 1WICA 1MQ8A 4ZPVB 2IBBA 2R69L 3V8OA 1I1AA 3OR7B 1IQWL 5EU3A 3TN0D 4KRLB 5D7LE 1ES0A 5CGMA 3CZFB 4HG4J 3C5JA 5EORL 1LK2B 4OUUA 1FG2B 3WNNA 3FQTB 5EC1A 5I66A 4PY8J 1OAXH 1MJ8L 5EU6B 1YY9D 4YWGL 1IBGH 3LKRA 3MRFA 2PNDA 2EH8H 4FQXA 4KY1L 5CIPA 1IAIL 1GGCH 1WBYB 1RPQA 4RMWA 2A38A 5JW4R 3MRQA 1NQBA 3R8BB 1F8TH 4LIQE 5C0NC 5ITBH 2IMNA 3JV5A 3KJ6L 5DK2A 5EU5A 1MFNA 4KZDL 3IJSA 2NY5C 2QQQA 2CK0H 1I9JH 3SEPA 1PSKL 4I2XA 5DVKA 1TMCB 1T0MB 1EUUA 3A6OA 1G9ML 2LU4A 3TFKC 5ALBH 5GGRB 3MOBH 2C3VA 2J4WL 4X6FB 5B4MC 1F6FB 3LHPH 3UJIH 4MD0B 5C0ND 3GMNA 1K8IB 4QRPA 3UJTH 3KYNA 3KLSA 2Q8BL 3NTCH 4P23D 4FZ8L 3UBXA 1MRFL 5E5MA 2QHRL 4X9IA 5IROC 3KYMB 4WW2B 1BIHA 1EEYB 1TQCB 3JXAA 5EU7C 3V52H 2EIZB 2OM5A 3WIHL 1CDIA 1WIPA 4PGZA 3RX8A 3TFKD 3AFLA 1VPOH 1QSFD 1U8NA 3VA6A 5JW4M 5B4MD 5H2BB 5C0CB 5JDSB 5T3XH 2P5EA 3N1PC 2XYCA 2VDQL 2V2WB 1A9BB 3D25B 5DA4A 5B39A 1K2DA 2L4OA 4JHZA 3D0LB 4MX7B 4PJBE 1EHLH 4D9LH 1VDGA 2V9QA 2HFGH 1HSAB 2X4TA 4R26L 2Q6WA 2KKQA 3W0WA 5E7FA 1MY5A 1XF3A 5HD8C 1LE9A 4DOHB 1QSVA 2D3VA 4A6YH 1AE6L 3HI6H 1UADC 2VQ1A 4PJXA 4HK0A 1S5IL 1MAML 5A3IC 1LWRA 4XNXL 1IC5H 1H0DA 4PJGA 1GXEA 5JUEL 2ZUWA 3U7AA 2OTUA 2YPLA 4PTUA 5D70L 4YDIH 3E3QE 1CFTB 3E6FB 2IWGA 1JNLH 4MA1C 4I18A 4U33A 4TVPH 4Z7VE 5DK0B 5D96B 4IMKC 1FORL 2AERT 5D93C 5A3ID 2L0DA 4NDMA 2KQNA 3TBYA 12E8L 5IFHH 1YUHB 3GI8H 3MV11 1D5BB 2BFVL 3HRZA 5HDLA 4JFZH 3ZYOA 1F00I 3ALPA 1C8PA 3U0TA 4K3DH 4P49A 5HI4C 3VXPA 1T66C 2JCCF 4X8XA 2GTZA 1RIVL 4LSTL 1JMXA 4G8EA 3EYVA 1SMAA 5E6IB 1LO3L 3MACL 3DMMC 3D1MC 5DDHB 1N64H 1NGXB 2KZ1B 4XVTL 4TTGA 3QJHA 2AJXL 3CC5B 1QFUH 2AVGA 4JG1L 3MLWL 1NC4B 1GZQB 4OTXL 4YHKL 1DN2A 4TSCH 4LKCA 3IDNB 1KYOK 1XGYL 3PGCA 3L9RB 1T66D 4OCYL 2DB8A 1LDSA 4JKKA 4OIIL 5FA3A 5J6GA 2WWKT 4PRHB 4I1NB 4XBPB 1G7HA 4XWGH 3VWJC 1QSFE 1VEMA 3L3JB 5FYJD 5IVZB 1JYXA 5EB9A 1NL0L 4PJAB 2ICWI 2NY4B 2R2HB 2CKBH 4Z7UF 1V3LA 3ABZA 3B4NA 1A6VL 5EU7E 4MQSB 2A6IB 3PL6A 4NPYA 3NCCB 1FN4B 1RUPL 1LP9B 3IDJA 3RP1A 3S35X 3KXFE 1UKSA 3OSKA 5EWIL 3VWJD 3IU3B 3ET9F 1HNFA 4OGYL 3SBWC 4U1KA 4NKQB 1L7TL 6FABL 3MLVL 2HA1A 1ZT4B 3QCTH 4WCYH 3HMWH 3UYRH 4G6FD 4JAMB 4YNYB 4N9OB 2R2BB 4Z7QF 2C3WA 2I60H 2P5WD 4HWBA 1EO8H 2HKFL 2OMNA 4XPHL 3RWGA 1BFSA 1F42A 1G1YA 4TSBH 3FOMA 2DS4A 3QO0B 3LKSB 2ADJB 3FQXA 1HH9A 4K3JL 3OJDA 3C09C 3C6SB 4LEXH 3KYKL 5F7EL 3S5LB 2F9BT 3T0EA 4X99B 1RIHH 2NTFB 2A9MH 5MI0B 1F4AA 2VB5A 3X11A 1SJVA 2WUBH 2YA0A 2DQIL 1P4BH 1UCTA 2YUVA 1TCRA 1IC7H 1L0XA 1P84J 1XMWA 3SKUD 3HC0B 4FNLL 1JGLL 1CDGA 3FHAA 2FWOA 2R0WH 3DYOA 2B7DT 1NFDF 3VD9A 1FPTH 5D7JA 3OB0K 5JPMB 1YNLL 3L3KA 1RZJL 4EUPB 2A6JB 1S3KL 1YEDA 4MMZC 4Q6IA 4HKZA 1CXKA 1S9WA 1T0NB 3TVMC 4K9EC 2C1PB 2IQAB 3CK0H 4ODWA 1RQ5A 1JL8A 4XCYB 1NKRA 5DJ6A 5MEPA 2RGSA 4GW1A 4KUZH 5JQ6L 4YIQA 4LEOB 5C7XH 1G1CA 2H8PB 3U7YL 2YXFA 4YXHH 3TNNA 3MRDB 4Y5XC 3UBXG 3IXTA 4LSSH 1WUNT 1ZV5A 1BX2A 3QCUL 3STBA 1F4WH 3TVMD 1KULA 5FYJE 2Q86B 4PRDA 4YQXL 2DWEA 3F5WA 4LCUB 3R1GL 5IFJB 1DBKL 3BDYH 3H8NA 3MA7B 2PO6A 1S7TB 2QSQA 3HZYA 5B39G 3VW3H 1A7QH 4P2CG 3BPNC 1U3JA 1NSNH 5GRJH 4U1LA 4QHLB 3TESA 1D9KB 2YN3A 1C7SA 5HHQB 2FX7L 1EPFA 1U91A 2ZOLA 3B9DA 1BVKB 4JO4H 1RUQL 5I8OL 4NQEE 1DVFB 2XKNB 3UPRA 3VXNA 4WEUD 5C3TA 1IKFL 5I1KL 2P5WE 4GRMB 2XTJB 2QEJA 4Z0BH 3HI1B 3LRHA 4NN5C 4EN3A 3TBSB 1JF1A 2X05A 4FA8A 2VZUA 3M45A 4XVSH 1ZHBA 4I5BA 3GI9H 2Z93A 3DPBA 2Y5TB 2XFXA 4OF0A 3FFCA 2A6KA 4DZBB 4PV8A 3VFTA 4GG6B 4YGAB 3E8UH 2CDEA 2HG5A 5GZOC 1UGNA 3BX7C 1UENA 2XA8H 1VKXB 5IG7B 3LN4B 1HWGB 2H9GB 3IXAA 5ILTL 3U4BH 2P8MA 1U8JA 3BVNA 1AJ7H 4Z5RA 4L29B 1JE6A 3SDXA 1CGVA 1XH3B 5MEOA 1RJLB 3V6ZA 5GZOD 4FFVC 3FT2A 4WFEE 1I9RL 3GIZH 3IDMB 4GXVL 4XVJH 4QHUB 4HZAA 4F7CA 3G5YA 5LQBL 2ICCA 1TTGA 2HT3C 4RNRA 1NJ9A 3VWKA 1I9IH 5JLZB 2X1WL 1V7MH 1I3GH 2JELH 5HYIA 1AKJD 2XZQL 4ZXBC 4FFVD 1R3IL 4GKNB 4PJBF 2VR5A 4XPGL 3B83A 1YDPB 1IGFL 1NC2B 4KTDH 1HHHB 2HJKA 5ISZD 5FYKL 3DI2B 3GBML 1F4XL 1PG7H 1WBXB 2B8OT 3GMPB 4YO0A 4APQB 1IQDA 1FSKC 4MDJA 4ZUWA 1L6XA 4PJ9C 3MV9D 4D0BA 2WAHA 1K4DB 1JWMB 1QKZL 1R3LB 5EBGA 1MLCB 4JFEB 4L8DB 4MCYA 2BERA 3GHEL 2XQBH 3QQ9C 3KPSE 4PJHA 4AENA 3CFBB 3O2WH 4BM7A 1H5BC 1ND0A 5DRZB 2Q3ZA 3S36L 4TNWK 4Z7VF 5B38A 3LIZH 3GSRA 4OLVH 4PJ9D 1AQDA 1B88A 1SMOA 3IS0X 2Z31A 3MBEA 1ED3B 1NBZA 3OKMB 5FCSH 1CR9H 5DMJB 5E56A 2GJ6B 5LBSL 4NCC2 3QQ9D 4P2RA 5BJTA 1KJVB 1T21A 3O4LD 3PWLA 5CJQL 4J6RH 4F7EA 1AXIB 4N0FA 1YN6A 2LQRA 3BPCA 4H8WH 2PW1A 5JQHC 1LEGA 3GSXA 2KUTA 3PQYD 5FYLL 4D8PA 4MD4B 1U93B 5GS2H 3CVHL 1CVSC 3BE1L 4YDKH 5LVEA 1MY7A 3OJVC 3QUZC 1BP3B 3IU4H 3O3EB 3QHZH 3WFCH 4WI2A 4V2BA 2IGFL 2VDKL 2VL4A 4JPIB 1IARB 3I3BA 3VXMA 2JB5L 4V2CB 1A47A 4OT1L 1P4LB 3RA7H 5FKPA 1O5DT 2D4FA 3BD5A 3AREB 5KVMC 4LDOB 3SKJH 1KGCD 5F9OH 1IM9B 3RVVC 4PV9B 5IB5A 2W38A 1OP3K 1FYHB 3VFMA 3U48A 3UTPD 2NY5L 1VFAB 4F57L 3QUZD 3JTTA 2E8ZA 1GH7A 4XMLH 1S78C 1A7OL 4H5SA 4M1GH 2YRZA 3HTLX 4TOYL 4JQXA 3L3OB 1A4KB 4P4KB 3L5XL 4OZIE 2YPVH 3G04A 3KPOA 2X89D 2DQFB 3ARWA 1IKNC 4QRRA 3NABL 1WISA 3ZT7A 1QR1A 4U7SA 1AGBB 5GS0C 4HCRH 3RVVD 2AEIT 2A83A 1ZVHA 3UTTB 5L2KD 2V5RA 4PREB 5F7FA 2FGWH 1FZMB 1OOAA 1RJCA 5KJRL 1S78D 2C7UA 1WT5A 2HRPH 5DF0A 3DGCR 4ZFZB 3MV9E 1IQWH 3DROA 1IFHH 3KDMB 2DIJA 4RGMC 5FO9A 3TM6A 4N8CL 5DGQA 1QRND 5EBMA 5GS0D 2VLJD 5GGVY 4U1GC 2YZ1A 5EORH 3BEVA 1ZSDB 4UV7L 2X40A 2MWCA 1SJXA 3T0WA 4XCEB 2GK2A 1T20B 2H3NA 3AS1A 2NCMA 4YWGH 5LCVL 4EEEA 3FQNA 4R7DA 4NYLA 3ZYZA 4WU5B 2DYPB 3FB5A 2FB4L 1FNFA 4G8IB 3WJJA 2XPGA 1KELL 3ES6A 4KZDH 4GS7B 5HY9B 3HG1B 1PSKH 1QBBA 2CIIA 3O4LE 2NLJB 4NHUA 4X5WB 1A6WL 3MJ7B 3FO1B 3CMOL 1G9MH 1QNZH 1H3XA 2F5BL 3PQYE 1DN0A 2J4WH 5JR1H 2NPLX 5L8LB 5FUOL 3O45A 4C4KO 3KLAB 4WU7B 4JFOA 4N9GB 1NDGA 2PR4H 3SY0A 4L8CA 4JM4L 3VFPA 2I07A 4ZSOB 3J7HA 4BUGA 1KPRB 3IETB 3TPUB 1JWSA 5EA0L 2GHWB 4I0PB 1MRFH 2YSSB 1FE8L 5ITFA 3C9NB 3OR6A 3QUYA 3GKZA 3WIHH 4LLMB 3GO1L 3FRUA 3UTPE 4LLQA 4Y4FB 2VDQH 4FXKB 4XPBH 3BYTA 3QXWA 1K8DB 3Q48A 4LGPB 5CINH 4LCWD 3QI9C 2AJUL 2NY1B 2P8LA 3MA9L 4YDLB 2A1WL 5TDOA 1HHGB 4OM0L 5DMKB 5FF6A 2WLYA 1YMHB 3PWJA 2A9NL 1S5IH 4Z0XA 4WI6A 3QT2A 2OJZL 4G9FA 5CBAB 2IH3A 4OZ4B 4XNXH 2CQVA 3F7YB 2O61A 1LD9A 1MEXH 4NKMA 3QI9D 2Y36L 1XGPA 5DYOB 1Z5LB 3C5ZA 1A6ZA 2ADFL 3MO1B 2VLJE 4F33A 4KMTL 1EBAA 4AG4L 3DVIA 3HNTL 2VLMD 5ACZA 3WNMA 1LEIA 1FORH 4RZCA 4F2MA 5I17B 3LKNA 1EVTC 1QBMH 1WF5A 5KS9E 2D0HA 5TQ2L 1MI5A 1OWWA 4OCSL 3UTSD 1I1AB 5HBBA 4GBXD 2BFVH 5EU3B 4R90L 3MXVL 2DQUH 2DRUA 1ES0B 3P4OA 4RDQF 1KCUL 1F58H 5HI3C 4CBPA 2ZZUT 3BEWA 1TZGL 3C5JB 2QQLH 4OUUB 5EC1B 5I66B 4EKXA 1RIVH 4LSTH 3HC4L 5GGSA 4P9HL 3MACH 5DK3A 1NFKA 3LKRB 3MRFB 4N0RA 4FQXB 4XVTH 4J2XA 2ADIA 5CIPB 1GZPB 4JG1H 3MLWH 4YHKH 1A7BA 3SE8L 2AXFA 3KAAA 3MRQB 4Q58C 4X7TA 4BK4A 5J13C 3F65A 5HI3D 1P9MC 1ZA3A 4OGAD 2EIBA 3N9GL 5DK2B 1CDBA 1KCKA 4S0SD 3WFDL 4OCYH 5EU5B 5DTFA 3RGVA 3IJSB 4JFQA 1NFDA 4JE4B 4I2XB 2R8SL 1TJHL 2R1WA 5MEQA 1DFBL 3QIUC 3WS3A 2C3VB 3MV7A 5ALCL 1NAMA 3RDTA 5E2UL 5CJOL 3GMNB 4QRPB 3KYNB 2EE9A 1TJGL 4LCWE 2OL3A 1FFOA 5HDBE 1SEBA 1NDMA 2AJSL 3UBXB 4U6YB 5TE6L 5BV7C 5DJZA 3ZT6A 2EDXA 4K9EL 2ID5A 4Z7OF 5EFIA 4NQDD 1FFNA 5JORB 3S34L 1OQOA 4HIHA 5EWIH 4OGYH 1L7TH 1U8NB 6FABH 4OZHA 3MLZL 2P5EB 2LFGA 1NMBL 3ARFC 2DQCL 5B39B 1K2DB 2XWTA 4KJWC 2FJFA 2DM3A 4Y1AA 5DURB 5SWZA 5I19L 2X4TB 2Q6WB 5DI8A 3W0WB 1HH6A 2HKFH 2YD6A 4KHTH 1XF3B 2R39A 1WWWX 1LE9B 5JNYA 3MNVA 2N7BA 3QWRA 5F7EH 2ILLA 3KYKH 3GMQA 2CRZA 1BGXL 2VQ1B 4PJXB 3ARRA 4HK0B 2PTVA 5JW5A 4KVNL 2DQIH 5DRWA 3WFHA 3FL7A 3ARFD 3N1FC 2BNQE 2CKBB 3EO9L 4KJWD 1H0DB 1OAUH 3WDJA 1IEAA 4PJGB 7FABH 3VA2C 1A1MA 1CDYA 1EHXA 2XNAB 2OTUB 4MXWL 5C2UB 2YPLB 4NZTL 4PTUB 4FNLH 4ENEC 3QISA 2MTPA 4OLXL 5IQ7L 3BP6A 1LO2L 3ULUL 5DZOA 5F1IB 5C9JA 3UAJC 3X12A 4I18B 4CU6A 1XCTA 4U0RC 3TIDA 1BQUA 1VACA 1ULVA 1S3KH 3S3SA 3TBYB 4X7FC 5DS8A 4PLNC 3ULVD 3CXDL 3HRZB 4V1DD 5AZ2L 5I75C 1NCAL 1NAMH 3MFGB 5IK3A 3VFNA 1OTSC 3DGGA 4WTXA 3U0TB 3UAJD 3PHOA 2OL3H 3VXPB 4PGJA 2GTZB 1YYLL 3RWHA 3U7YH 4G8EB 3EYVB 3I6KA 5K59E 2XZZA 5C0AD 4OZFH 3QEQD 2WUCL 4NP4L 4NQVA 4YQXH 4OZIF 3O6KH 3TH2T 1FGVL 4LKCB 1OTSD 3R1GH 1TXKA 3WBDA 1DBKH 3PGCB 4PP2A 3RL1A 5GSRA 4NQSA 3H42H 2FGZA 4U3HA 4NQDE 2YC1A 5FA3B 4UNVA 4KXZI 5J6GB 1UZ8A 1YECH 1CQYA 1KBGL 2QLVB 3EYQC 1G7HB 2OS7A 1RZ7L 4FFYL 4K3EL 2W0FA 4OLUL 3DX6A 1RUQH 5I8OH 4OV6F 4BZYA 4LBEA 1KCRL 1NANH 1X4XA 4K7PY 3ZL4L 3LKPA 3G5ZA 3DSFL 4LDLB 4NWUH 1A3LL 4NPYB 5HPOA 4CN6A 1NMAH 1LMKA 3IDJB 3QXTA 5GGQL 3EYQD 2NY6C 1A2YA 4U1KB 1YJDC 3QUXC 4GMTH 3VI4E 1A64A 3ORJA 3TN0A 1OL0A 1NAKL 1G7PA 1CIDA 3UC0L 4ELME 1FZOA 3TBWA 3N85H 3RWGB 5ILTH 3FOMB 3CZJA 5SWSE 4Z7VA 3FQXB 2VZTA 4M5YL 1HH9B 3OJDB 1ZHKA 3W5NA 3T0EB 4OI9A 4E41D 2ZCLH 3QUXD 2CJUL 2F54D 2E9IA 2I9TA 3UYOD 3X11B 4ZO6A 2CIKA 4FQ2L 4Z8FH 4KRNA 1TCRB 1ZLUK 3B9KC 3ULVE 4RIRA 1I9RH 4PJDE 4V1DE 5HHVL 2X1QA 1PQZA 5E00A 3SOBH 3QB7C 4AT6A 2YRLA 4LPYA 3CVHA 5DD0H 1TNNA 3FOLA