2L4OA

Solution structure of the streptococcus pneumoniae rrgb pilus backbone d1 domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
175
structure length
175
Chain Sequence
METASAATVFAAGTTTTSVTVHKLLATDGDMDKIANELETGNYAGNKVGVLPANAKEIAGVMFVWTNTNNEIIDENGQTLGVNIDPQTFKLSGAMPATAMKKLTEAEGAKFNTANLPAAKYKIYEIHSLSTYVGEDGATLTGSKAVPIEIELPLNDVVDAHVYPKNTEAKPKILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cell wall surface anchor family protein
publication title Solution structure of the Streptococcus pneumoniae RrgB pilus backbone D1 domain: in vivo protection and implications for the molecular mechanisms of pilus polymerization
rcsb
source organism Streptococcus pneumoniae
total genus 25
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2010-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2l4oA00
3IKKA 4RMVA 3F12A 2Y7QB 5IMMA 3W11D 4PD4J 1J12A 2OMNA 1EBAA 4G5ZH 2AK4B 4GRLD 2MCPH 5C0CB 1YMHB 2K9UA 1HWHB 3RWCB 2VZUA 1WICA 2WSKA 4OLUL 1J8HE 4FZ8L 3F7QA 2FR4B 5KANG 1RK0A 5CLWA 1Q0YL 4XP4L 3L5XH 2J8UF 2VH5H 4IOIA 3QPQC 3WSQL 1PG7H 5I6XC 3OXSA 1QBLL 4M5YH 3SDAC 3LH2H 1KBGH 1UWEL 2WUBH 1T7YA 1EEZB 3U9PL 1TVBA 1XF5A 2IALB 1IGYB 4UQ2A 2PYEB 4EI5B 3D0VA 4QRTA 4LHJB 1CFSA 1NMAH 3V4VL 4DZBB 4IRSB 3O3UN 1A2YA 3WNMA 4Z0BL 4TNVK 2AABL 2CO6B 5D70H 3LEYH 3EDDA 4HSQA 3RWHB 4MQXC 1T83A 3SO5A 4PJ9C 1NUNB 4WHTB 4AEEA 4DGIH 4BQCA 1WF5A 5DD0H 2FRGP 3HR5B 2APXA 3V95A 1WUNT 2DJSA 2V17H 3TNNA 1MCKA 1PBYA 1DN2A 2YA0A 5L7XH 1KJVA 2EH8L 4UAOC 3ULUE 3BEWB 2W1NA 1D5XB 4TOYH 4JG1H 2AV7A 5JPMB 4HH9A 5KSVA 4FQ2L 2E8YA 5GIRA 1G6RL 1OWRM 4M6MH 2BVQB 2CIKA 4GOSA 4HJ0C 2ICWI 5DSCB 3VFTA 3UXFA 5AG8A 4L4JA 3GI8H 1H3TA 1KIRB 3ZZ1A 4GRLB 5TFSH 3BP6A 2IGFL 3C5ZC 1OTSC 1MCPH 4CU8A 3MO1A 3FQTB 4PLNC 3KXFD 4LASL 5E56A 3MLZL 1EK3A 2WIIA 4KMQA 4LCCC 3WIHH 1A64A 1JGLL 2CO7B 1ACYL 5I75B 1MRCH 3C6LC 4WEUD 5C9JB 2ZCKH 1GGIL 1KJ3L 3QG7L 5TF1H 2X4UA 3EBAA 2FCBA 3BZFB 5FUOH 2WWMD 3LIZH 1KPUA 2QEJA 2ILLA 2X41A 5AZ2H 3MRDB 1G7MA 3L3IA 4C54A 1FIEA 1MOEA 4EUPH 2ZUTA 5C0ND 3X14A 4PGDB 1CIDA 4NUGL 5JW3L 1A4KB 1BIIB 3S97C 5FHBL 3QDGD 1Q0XH 2NXYC 2VAAA 4BZ2L 2V2XA 5IB5A 4PP2A 1T0MA 2G5BB 3MRJA 4K8RL 4J3TA 1ZVYA 4PJIA 5SX4I 4IDJL 4OD2A 4ZS7L 4FQJL 2XTJD 2YD8A 4GQPH 3ULVD 1UENA 1RAMA 2ICCA 4OGYL 4OB5L 4X9HA 4DKDC 3RFZC 3JV6A 5E2JA 3L3DA 4XNMB 3QH3B 2KH2B 1OM3L 5KSUA 1T1WB 5J57B 2A6IA 1MCWM 4WUKH 4G7YL 4U6YB 5L9DL 2ZUVA 4XI5D 3KWWB 5GRXG 4ETQB 3QQ4B 3MRKB 4P9HL 4U1KB 1J0ZA 3O3DA 4JO2H 5FFLA 4KK9D 3CFKB 1RUML 3GSUB 3KXFB 4LBEB 5DMYA 4R0LA 5B39B 3CFJB 4MJ6A 4A6YA 2EDDA 1FZMA 2E9IA 4PUBL 4UI2A 5DYOB 2DDQH 4P2RA 3Q3GB 4PBVC 2I9TA 3QRGH 4P4RB 5DD1L 1MPAH 4K3GA 2QBWA 4MJ2A 4K7FB 5CD3B 1OF2A 5BO1L 3MLXL 1WFTA 5HGBA 4HGWA 2JJTA 2PTVA 4HIJA 4RA3A 1UB5A 2BNQE 3S35L 4LLAA 1TJHL 3NCJL 4GUPA 2AJ3A 3VGGA 1UFUA 1QBBA 2GW5A 2RCSL 3WUZA 3ZT5A 4L3EE 2ERJB 1P7KB 4NWTH 5DK2A 4X6DE 4LPXA 3T0EA 5L2JB 2QHRH 3NACH 4HUVA 2XTJB 2WZPD 1FSKC 2FECI 3R0NA 1TQCB 4OSUL 4L1HA 2ADIB 2P8MB 1H5BB 4DN4H 3IXAA 3TBVB 1HDMB 5GZND 5GRUL 4OD3L 4GKOA 2G75B 4Y4FC 4U1HA 1WK0A 5E5UB 5E1AB 3OXRB 3O0RL 5E8PB 4FQQA 4FQHB 3BKCH 4K3HA 3AU1B 3E3QE 4WI3A 5BMFL 4FQLH 4LOUC 4MD4B 3TZVC 3V6FB 5CKGA 3X3GH 4WRLA 3PABA 1QHPA 4ZS6C 5F6HJ 1I7RA 4K8RC 2P43B 2B2XL 3STZB 3MLTB 5TQ2L 1MCWW 1FVEA 4RGNE 1DQTA 5C0DB 5I16B 1CE1L 2BJML 4NQSB 5EUOB 2DQFA 4XVSL 4Y4KD 2CDGB 4ONFH 4NZDA 3OAZH 3WFBL 2D7MA 1DANU 2HLAA 4KJWC 4R4FL 3MV7A 4XC1L 2LVCA 1YEKH 1UADC 2R4RL 2VQUA 3LV3B 4FXLA 1NGZA 5FKPA 3VWJA 4H0GA 4P9HC 2BVUA 1OHQA 2X40A 2HRPL 4TUKL 1BEYH 4HK0A 4JRYA 2YPKB 4Y5VB 3HS0B 3QHZL 3CH1A 1K6QH 2C3GA 3CX5K 5KOVC 4PGEB 3TJHC 4G6KL 1T5WB 2H1PH 3QIWC 4YHIA 1UJ3A 4TUJB 3UJTL 4MQ7B 3MREB 5ISZD 1UVQA 5EBLB 4YXLH 4XVTH 4BYHA 1YEJH 4JPIA 1BOYA 1GL4B 3AVEA 3OJMB 4KHTH 2FATH 5JLZA 5I1DB 5I1GL 3FQUB 5C6TL 3S36L 3TIEB 2PTUA 1AXTH 3HI6H 2DBLH 5JOPE 4QXWA 2EDWA 4HKBB 1W0VA 5JXEA 3GSVA 3HPLB 3MBXH 1IGCH 2DQEH 2HJFB 1RHHA 1MFDL 2X4QA 3DVGB 4HPYH 1LEIB 4XAWH 4NNXA 3SDCA 1KOAA 3UYOD 3G9AB 1D9KA 3I9GH 1HHJA 2C26A 5JDSA 2F58L 1J11A 4I18A 4R4BB 3G6DH 3BKYL 1E6OH 1EXUA 1NFIA 3B5HA 4Y4KB 1FNHA 3P4NB 3R0MA 4G3YH 4X4YA 3LQZB 5JIPA 4YNYA 4HK3N 2DWEA 4EXKA 3MLWL 3IFNL 4OBRA 4PJEB 4NFDA 1GGTA 2G60L 1J5OH 2J88H 3L9RA 4Z7WB 4QHUA 4M5ZH 3ULUH 4U1JA 1KC5L 1ZEAL 2RB8A 2Z92A 3U0TA 3WJLC 5JHDB 1LEKB 1CDBA 5ISZB 4HS8L 4PB9L 4U1LA 4LHUD 4AEIH 1IEAB 1B2WH 1KB5L 1QNZL 3I3BA 3SE8L 5JO5A 3O6LL 4KU1A 5C08D 5T5FH 1PZUB 5EBMB 3QDMD 1KIUA 3N50A 2VLRD 2W07A 4OM1H 1XR9B 1CGSL 3U7WH 3O45A 1R24A 4Y8AA 4RFNB 5ALCH 2I9LB 2EYTA 3HUJB 1N3NA 4GAJH 4G9FA 1ZVSB 1HHGA 1MJ8H 1ZHKA 4PG9B 1UQSB 1BFSA 3BJLA 5CJQH 4ZUSA 5JQ6H 1CBVH 3MC0A 5EO9B 1EA9C 2VB5A 1S5HA 3IJSA 5DC4B 3ZL4L 5I66A 1YECL 1XR8B 5IWLC 3RHWK 4Z5RB 3H9SA 2YK1H 4FOMA 5KTEL 2VAJA 5FK9A 4LSSH 3UJIL 4TSAL 3HKFA 4PJAB 4LU5L 2V2WB 3IDXH 4WWKC 3X3FH 5GZOD 4U1NA 1FFPA 1AGEA 4Y19A 1T0NB 3QQ3B 4S2SB 3PWNA 4LKCA 2A6JA 1RUAL 4X6EB 1MWAB 4X5WA 4NQDA 4L29A 4MDJA 4IIQB 4PBWD 5AAMA 4OFVA 1YMME 2ZUUA 3QEGH 1IFHH 5D7KD 5DMKB 4NSKB 3TJEL 4NQED 3LEVL 4MVBD 2ZJSL 5JXAL 4LHUB 1G7QA 3K4ZA 4X7EC 5DRXA 5TPWL 1KJ2H 4XCYB 3NA4A 3E6HA 4LHQB 1CFQA 1PW3A 3IXTA 4QY8B 5HJ3A 2IH3A 5C08B 4ZD3H 5L2KE 3QDMB 3KPNA 2VLRB 4EQ3A 1U3JA 3BQUC 2A2QT 3EJZC 2O61B 3RGVB 3WIIL 1A7RH 4KKBD 3IYLW 4Y16D 3IF1B 3VJ6A 1NCTA 1MI5B 3FT3A 1EEYB 3QQ9C 5GGQH 5C9KA 4RGMB 4LCIL 1R3LA 3QUZA 3QI9A 4F37F 4OTXH 2R4SL 5T1MB 1C1EL 4DGYH 3OKKA 3P4MA 4PJBB 2EICA 3G08B 4X7CC 4GRWB 3V8CA 1I85C 1T4KA 4UILH 5D1QA 1R5VB 2QQKH 1J0YA 5IUSA 3ARBA 4QRPD 3MNZB 3O11A 5ALBL 3MA9H 4QOKA 1YN6A 1Q72H 4LF3B 3DMMD 4UV4H 4NZUL 2B1AL 1HN1A 5MHSD 3HB3D 5IT2L 2MOVA 4UDUB 4C59B 1ZS8A 1YDPA 1YUHB 3FN0L 2C5DC 3I50L 4NQEB 3F7RA 1U3YA 4JREB 4OT1L 3KLHC 3Q48A 2GSIA 4PB0H 4PJFB 4AIOA 1VCAA 2Z93A 3NPSB 1MFCH 2NY5H 1P4IL 1S7WA 1UZ8B 2ZOLA 1GOHA 5E2VH 5ICZA 4G8GE 5CMAA 3NZHH 1CF8L 3VXUA 1JPFB 3RU8H 2X09A 2PR4H 1FO0B 1X9QA 5DD3H 3GUTA 1FFOA 3NFNA 3DX6B 1G0YR 4N0UB 3WFEH 3UTTA 3ARFD 5FF6B 4JPVH 4ONHB 3THMH 3G6AB 2XKUA 1MVFA 1G1YA 1VFUA 4NKMB 4KHXL 3GRWL 1QBML 1HOCB 2JELL 2R2HA 4Y16B 5EPMB 2EDJA 5ILTL 4A2MA 2OL3L 5I73B 3BYYA 3QHFH 4J3XA 4Z78A 5HGHB 3ZT6A 1IAMA 2FO4B 1N5AA 4P59L 1FGVH 1FNGB 4R7NA 4X7SL 4M3JA 2WINA 5J6HA 2YN3A 5ETUA 5T1KD 1EO8H 2X44D 5IVZA 3C6SA 3O2VL 3VFUA 4JFFD 5JUEH 1JNHA 4QRPB 4OIIL 3GGWB 3QDAA 2AJUH 3MJ7A 4X7DC 5E99H 2GK2A 4EEEA 4OIAA 3OB8A 3OB0K 3B9AA 1JHTA 3TCLA 1CFVL 3UTQB 3DMMB 4LSTL 3CMOH 4Z7VF 3TM6A 2JCCF 3MCKB 4M48L 1G9NL 3ALXA 3MRBB 4NQCD 1WIOA 2RGSA 1S7QB 3C60A 5GGSB 4M1CD 4RWYH 1OCWL 5FO9B 3GMQA 1IC7H 1QVOA 3PIQA 4PGJA 1I9RL 5I1AA 3HCVA 4HFUH 1DN0B 5JMRA 1I8IA 5SX5K 1S9WA 1OD9A 1ETZB 5I1KH 4JN1H 1XH3B 3KAAA 4OZFH 5I1HH 1ITCA 5FA4B 1IQDB 3HC0B 3ARFB 3V6BR 4PJCB 2E27H 4IHOB 1OP3K 3UTSA 2OJEB 3RPIA 4G9DB 3EJYC 5E2UH 1F4HA 4O4YL 4NT6B 2XNAA 4NNPH 3VE0B 3PNWB 2FJHA 1XGYL 4AQ1B 1QLFB 1I8KA 3GSOB 3FOLA 1U58B 5FOBB 3GBNL 5IVOA 3LS5L 2ICEA 3BAEL 5F88A 5I8EB 2W65B 4F7EA 1T1ZB 4HWBL 5T1KB 2X1OA 3UBXI 3IKCA 2DQDH 3MRHB 5LGJB 4CJ1A 1XGUB 1BM3L 4JFFB 5J1AB 3L95A 3VFRB 4P2QA 3S3PA 1SEBB 1NCDL 1T2QH 2HFGL 3KJ6H 2D31A 2GI7A 4GKZB 3MXVH 3ROOA 4H26A 1DFBH 4JFEA 4ZNCD 4NQCB 1YNLL 1S7SA 1RZJL 4G6AC 3DUSA 4DTGL 1UXWB 2ZSVA 2OLDA 2J6EL 4LGPB 3L5WB 3QWOA 3EHBD 1JF1A 1NKRA 1YNKL 4JG0L 5LGHL 1I9EA 1JGVL 4JFDD 3DARA 1CXEA 5GRWA 5MI0B 1WTGT 1I1CA 5ANMA 3QZWB 4ZFGH 3SKNA 4L3CA 4M93B 5DQJB 3DBXB 1EJ6A 1G9NC 2QSCH 1HNGA 1BFOA 4L8SC 5IP4A 1N8ZA 2NZ9C 3LPGA 2DD8L 4FFZL 4Y5YC 15C8L 2FB4H 4EI6B 4FMFA 3NTCH 4JCMA 3P0GB 4LRIA 5DRNB 2HN7B 2MNUA 1RVFH 1TZHA 1S5IH 4L8BB 2YPLA 1F4YL 2BXZA 2R0KL 4JFYB 4YDIL 3UPRB 1OGAE 2ATPA 4KY1H 5F1IA 1CD0A 4PGZA 4NWUH 4LQ1A 5HVHC 5GGVY 4PRNB 5I74B 4EOWH 1RD6A 4XPTL 3DV4A 3M07A 1G0XA 1ZT7A 4KV5F 5D71H 4I77L 4HDIA 2JCCA 3KPTA 4N8VB 4M1DL 4JO3H 1F2QA 2G9HB 2YA2A 4NRYA 1L4IA 4GSDL 3V7MA 1FC1A 2CLZA 1EO5A 2PF6A 1X5ZA 3PDGA 1F11A 3R4DA 3ULVE 5DRWA 2KDGA 2DIBA 2VLJA 4XCCH 5EU6E 5HD8C 4LCWE 3AS1A 3Q6FB 1EFQA 1TQBC 1Q1JL 3QNYB 4FFYL 4NO3B 2DQJL 4ZXBC 4N9GA 4GW5B 1SMOA 4JGMA 4S11A 3AMKA 4JFDB 4ZAKD 3BIAX 3TN0D 4E42A 4ZFZA 2X7LA 5T3XH 2Q1EA 3RVUC 3AC0A 5DHYA 5TE4H 2CLRB 1FYTD 5HGAA 1BECA 3O9WD 2DQCL 1WCQA 5EU5B 1YEFL 5GISL 5I9QB 4L4VA 5BCAA 2YC1B 1EAPA 1NBVL 3E6FB 5CP3A 1BF2A 1RZJC 3F58L 4GW1B 4JB9L 2CGRH 3RL1A 4E0RB 1HINH 3CC5A 5GGTH 1NCWL 2UWEF 35C8L 1J0HA 4J3VA 3BSZL 5EUOE 4YIQA 1Z3GL 4ZTPL 4NM8H 3D39A 3E8UH 1F97A 2F5BH 4O5LL 3B2VH 4LLYB 2ZSWB 4QCIB 3D3VA 4NHUA 1L0QA 5DUML 1DLFH 5IB3A 4LKXB 1NUGA 4BSVB 1E4WL 4XMLH 2X9YA 2IBZX 4OGXL 1TZGH 4GW4B 1ZT1B 5F97E 1YQVL 2FX9L 4D3CH 1NAML 1F5WA 5LQBL 3U9PH 5IOPB 1UWGH 2OR9L 4AYFA 3NCBB 3NOIA 1HQRB 4IJ3B 4IM8A 5JR1L 5F9OL 1P7QA 2GTZA 3G5VB 4GKNB 4I4WA 1NJ9A 1JGEB 1TTFA 2UZIL 4F7CB 1DBBH 4ZUWA 4YGVB 3AUVA 1SJEB 3EUUA 4NCDA 1JVKA 3WEXB 1RU9H 1CIUA 4HXAL 3QUYD 3O2WL 4JPWL 4QXGL 4NO0D 5CUSH 4H88H 3C8KB 5ADOH 3ZO0A 5GGRB 3JWOH 4PD4K 4RFEA 3TN0B 1BBDH 3PV6A 4H25B 1FYTB 2MKLC 3JWDC 3O9WB 5E00B 3QUXA 2BOBA 2B4CC 2X4NA 1CD1A 4YHOL 3S5LG 4HFWB 3UTZA 4MJIA 1C12B 1R5WB 4YDJB 3EOTH 2GAZB 1MY7A 3QUKB 2B7DT 3OKLA 3GIZL 3QPQD 4YHMH 3H9HB 3UC0L 5C7XH 4HC1L 3MLZH 5A40E 5D9SB 2C7UA 1RJZB 3FT2B 3VXQB 1IAIM 1DBJH 1V7MH 1FFRA 1BBJA 3L3KB 2O5YL 2BVOB 1I3UA 1ACYH 3CFEA 1LMKA 2IANA 2BCKA 2IH1B 3MNVB 4HZLB 2Q86B 1F90L 2DAVA 1FH5L 3QG7H 4Z7WE 5KVEH 3VFWA 5DZNA 3ILPB 2CD0A 3KPPB 1B0WA 3F8UB 3T0XA 1CLZH 5JHDE 1AHWB 1ZK9A 5ISZE 4X6BB 3BRDA 2OZ4A 3MV8A 3OGOE 4MNQD 4F33B 5CLTA 2AJVH 1ZLUH 3N1MC 3TBYB 4NRZA 5H35B 3HFMH 3OKYA 5EORL 4MSWB 3EYUH 3SKMB 4BQBA 5JW3H 3CZJA 3BP4A 3SKOB 4LNRB 3QUYB 3T65A 4NO0B 4DN3L 2P8PA 3CVIL 2BSTA 3QA3A 5FGBA 4DW2L 2FIKB 3RVTD 4DKEL 3QYCA 1WEJL 4K8RH 1RUQH 3DLQR 4FQJH 4JZNB 4WHYG 5IW1B 4S0TD 4NQVB 5E6IA 4FQCH 3HUJE 3SY0A 1FN4B 4S1SL 2VDNL 4K9EL 5IVXB 4G7YH 3C5ZD 3MBED 1HKLL 1Q9KA 5IQ9B 3V6OE 4RSVA 4XZUA 3OX8A 4YXHH 3QR2A 3VCLA 2QKIA 1PZ5A 3NPZB 2BSRB 3K4DA 4YFDB 1F3DJ 4DKAA 2CUMA 3H6JA 4K3JH 2C1PB 5C0AD 4HLZG 2WBJA 3DRQA 3QPXL 4CN1A 5ELIA 5ACMA 3OQ3B 3N9GL 3MJ8B 1UZ6E 3S36X 1ZLVK 1TPXB 4YDVA 2V5RA 3HC3H 1T3FA 2F53D 2H3NA 4JGUA 3ZSSA 1X5IA 3U0PA 2A1WL 4ODVH 1AFVL 3S35H 4BQ9A 2H41A 5HHVH 1KENL 1YYLH 8FABA 2DWDB 3EFFA 1QQDB 2RCSH 1OT1A 3B43A 3RDTC 2AXJA 5MENA 2VE6A 5DFTA 5C08E 1WITA 4MJ5A 1ZOXA 4GAGL 4JFOB 3QDME 3FZUC 2VLRE 2V5MA 3PHOA 2VWEE 1CGVA 1RFDH 2NY7H 4AG4L 1KGCD 4JN2A 1YPZA 5CHNB 3F7YA 4JVUA 3MPCA 2DQHH 3GMLB 1KNOA 1MI5E 1QFOA 4NFBA 1EHNA 5FO8B 4MA1B 4OD3H 4UDTB 4CVUA 3MBEB 3O0RH 1YEGL 5TF0A 1YC7A 3DYPA 4KKCC 4W70A 3LMJH 5GS1C 1DL7L 2I5YL 3H9ZA 3WE6A 1KFAL 4PJBE 3LCYA 1U8QB 4U1GB 1A0QL 4HHAA 1WT5A 4LGSB 4YO0A 1VADB 4D0BB 5C0AB 1D5IL 1S7RB 1XF3B 1FJ1A 3RY5A 2EDXA 3I6KA 4YGAB 1MCNA 2X70A 4F7PB 2X1XR 1CICA 4MCZA 1KLGA 2DYPD 4H1LB 3CSYB 4C56D 4ELMA 4FQPA 4K9EC 3FCTA 4XRCB 1UWXK 3VFSA 4ZFFB 4R4FH 1VENA 1A02N 1TVHA 2ENSA 5D7KE 5FYKU 3SBWC 3SDYL 4NQEE 3OSKA 3RVXC 5TJWK 3GI9L 3MFFB 4PJFE 4JM2F 5IB1A 3NH7H 1NMCB 5TDNB 3FAWA 4ZTOL 3V4UH 1QTYT 4RNRA 4N5ED 3BOVA 2VKWA 4OQTL 2DF3A 2E9JA 3UJTH 4N0UE 5CEXA 3W81A 1C7SA 3BP7A 4JGJA 4EJ1C 1U8PA 3QXAA 5DJXB 4M4PA 2GK0B 2IPKB 4P2OA 5GS0D 4Y4FD 5C6TH 4RA0C 5CIPB 3S36H 5A43C 1YY9C 5EZIH 2R2EB 5DMIL 3HTLX 4QHMA 4EBQL 4XB8A 3WFDL 4XP5L 3S5LA 1Y0LA 5HHQA 1MFDH 1QFWM 5EZOH 2UYLA 2HLFC 4NO5A 3ARUA 1ED3B 2DTML 1IM9D 1C5DB 5EOCJ 2H8PB 5FECA 2HTLD 2F58H 5ESAB 1S78D 1PX3A 5JNYA 2Z35A 3A67L 1G6RB 1AGFB 3BUYB 2DYPB 5J12B 2DRUA 4C56B 4ELKB 3MUGB 5IB2A 4EDXA 5T3ZD 5MHSE 3MQIA 1HYSD 4S1DC 1PKQB 2PW2B 1KCUL 3MLWH 1NCBL 3CK0L 3MLYH 4XGZB 4IRJC 1KCKA 1QEWA 3QWRA 4RAUA 4L4TA 4BUGA 4JFQB 3UP1A 2N1KA 2V7HA 1XGRB 4M9PA 4X5XB 5IEHB 4M61B 3VI4F 3DXAE 5KZCD 2NQCA 3FMGL 4I3RH 1RUPH 4OZHA 3EOAA 5E0QA 3NABL 4JFZL 3QP3A 3ULSB 3EAKA 3MODH 1XGTB 1YEEL 3CUPA 5F21B 5D7IA 4KROC 1JPGA 3RVVD 4IMLB 2GTWA 3U7AA 2VDKH 3HZVA 4Y4FB 3KHQA 3O6LH 4YHKL 1JRHL 1UM6L 4YE4H 4PG2A 3RWDB 3CPLB 4H5SB 4WFHD 3P9MA 3VFMB 3ARXA 3JSSA 3U1SH 1XF4B 2XKNA 2EDBA 5IVNA 2D7TL 4M6OH 3SE9L 1E28A 4LGRB 1MEXL 3DOSA 5F6HI 1C08B 5EO0B 4I5BA 4R90L 5KVMC 4W4OA 3AAZB 4P3CL 3W0WD 4X7TB 3KYAA 3PQYD 4QHLA 1HHKB 1N6VA 5LWYH 4NQCE 4HJGA 4Y8DC 4Z7UB 2NXZB 5B3JE 2JB6A 3A0OA 3H2WA 2EIBA 2A9NL 2E6PA 4JM2A 5SX5H 1RUAH 2EYSB 5L8KB 1RK0B 3BPLB 1HXYA 3QUML 4IOIB 5H2BA 5F70A 3MR9A 4YHYC 4H0IA 1OP3H 3VXRE 5EO1A 3CDFA 1TVBB 1PEZA 3LSOA 3FTGA 3EYSH 5HXMA 3D0VB 3D5OF 1MRDL 2VISB 4HS6A 1DBKL 1CFSB 1Y18B 1FZOB 2DBJA 4FFWD 4PYGA 5KSBB 1PKOA 1TCRA 3RNQB 4GMSL 3GMOA 1MF2H 2LE9A 4WI9A 1RI8A 3C2AH 3WIIH 4GG8A 4D9LH 2W0LA 2MWCA 4XNYL 2XTLA 4MXQC 5C1MB 1NBZB 1OW0C 3DECA 5EU3A 2JJUA 1CLYL 5DJYB 1RIHL 4RDQG 4OUUA 2XZCL 4PRAA 3K7UA 3EOYG 5CILH 2JLLA 1KJVB 5JTWA 3W0WB 4J1UB 1FRGL 2BHZA 1BOGB 2AV7B 2QADC 2B1HH 1LVEA 4HH9B 2JJSA 2EZ0C 5FUZL 3PQYB 5F6IC 5KSVB 4WWKD 1YZZA 5KN5A 1NFDA 1JHKH 2XRAH 3VFTB 4M1GL 5ECJE 3IDJB 3WHXA 5DEGA 5EN2A 3C8DA 1SMAA 4D9QD 2XQBH 1I9IH 3GJFA 4O2CA 5F8RC 3RIAF 4P5TC 1DP0A 1U6AL 4U0RC 5SV3A 3X12A 1OGTB 4HUWA 2WIIB 5C6WH 3U6RA 1Y6MR 2YD5A 2OCFD 3QWQB 3AY4C 2A74B 1N2RA 4OT1H 3ARGC 2D7OA 1S3KL 1TMCB 3DRTA 4TSBL 5CEZL 2B0SL 4JY6A 3MJ9L 2P48B 4OGAC 1U2CA 3ECBA 1A7OH 2KL6A 5EULV 1KUMA 4ODBD 1KPUB 3IB4A 5I1IH 2X1QA 5CJOL 3L1OL 2XN9E 3RUGE 2BVYA 4GBXA 3L3IB 1AI1L 5FYKL 1B9ZA 2VXUL 4XWOC 1DEEA 1QFHA 3ZE2E 3X14B 3QO1A 4P46C 1I4FB 4N0RA 2DI7A 2VAAB 3QQ9D 3FB7A 4UIKL 5D2NA 4PP2B 1JYXA 2VDPH 3W9DA 1ZHBB 1WBXA 4IBLT 3CXDH 4OD2B 4X6CA 5DJ6A 2OL3H 1SEQH 4G42B 1LE9B 4ORGA 3FO2A 5D93C 2HFFB 4POUB 2FWOA 3JV6B 4S0SD 5F9WC 4P59H 4NP4L 3SE4C 5KSUB 4XPHL 2A6IB 2CKBL 4U7KA 1UH4A 4WWKB 2YHGA 4UNUA 4DFIA 2VZVA 2YS4A 3KPSD 2J8OA 5CEYA 1INQA 4YDKL 5C0IB 4OAWA 3GJEB 1T1YA 2AJZB 5HYIA 4WJ5A 4YHPA 3N85L 4OZGB 2A6KA 1UA6H 3ZTJG 1G9NH 2VDML 4OIBA 4R0LB 4RISL 3CDGA 4UT9L 3SOBH 3MXWH 4MJ6B 1AD0B 1FZMB 4KDTA 1OCWH 4JM4H 4P23A 1SJHB 4JLRA 4KUZL 3CZFA 1FYTE 3KNBB 4MZ3A 2I9TB 3DGGA 5DHVB 1X6NA 3FO1B 1OF2B 5IR1B 1YEIL 3O8XD 3QO0B 1EGJL 4YAQA 1UB5B 1V3JA 4MAYC 1N64H 4AL8L 2BC4A 2VNCA 5IKCA 5L0QC 4GUPB 3VMNA 3OAUH 2R9HD 4DZ8A 4OCRL 32C2B 3AREA 3V8OA 5E08H 1J18A 3FB8A 3TA3A 2XWJA 4DQOL 1BWMA 3SEPA 4MNGA 5DDHA 5DK2B 3BEVA 3QCUL 3Q6GH 4LDEB 1U3HA 3LRSA 3BWAA 1KB5B 4HUVB 1M6OB 3MMEA 5A3ID 2CIIA 4PIRF 4N1EA 4ERSH 1F4XL 5CSZB 1S7XA 1OTTD 2HKFL 4NN5C 3MLVL 2CQVA 3GBNH 3IXAB 5FM4A 4NJ9L 3S3SA 5FYJE 1K4DA 4JDZB 4U1HB 5IHBA 1BM3H 5C0JA 2EDNA 5JXED 4ODUB 1A7NL 1NCDH 3M45A 3UZEA 3O3AB 1PLGL 1MHHA 4XC3L 2WWKT 1HH6B 3OZ9L 2HFTA 4RRPA 2ZCLL 3BHBB 2BNRA 1I7RB 4KRPD 1FVEB 1JUFA 3K2UL 1QKZL 5EOQH 3PWJB 1I7UB 5D7LA 1XCQB 1U95B 3MLUL 2VZTA 2GJ6A 12E8H 3L3GB 3C9NA 5I2IA 3O8XB 1UT9A 4FP8H 3MRQA 5I17B 1DDHA 4V1DA 1OAKH 5K33A 2PW1A 4OZIE 3WUWG 5HHNB 4UUJA 1DEDA 2WP3O 2MKWA 4HK0B 3WN5C 1M05A 3CH1B 3RJQB 1AC0A 3KDMB 4LPWA 4MD0B 1I3GH 4YHIB 4RFOL 4MA3A 1UVQB 4X5LA 1VFBA 1F2XK 3C08L 4JR9L 1WCBA 3RTQA 3T0DA 3RZWA 4I3GA 4MMZC 5F1NA 4TTDC 5JLZB 2R0KH 3C8HA 1S9VB 4OF6A 3MRGB 2JJVA 4EVNA 3N1PC 4MX7A 2ESVD 3VG9C 4KTDH 2DLFL 4MA8L 5BV7L 3REWA 1DBMH 2FLBT 1I75A 1UH3A 1W0VB 3QJHA 5B38G 1UCBL 2J5LC 1QHOA 2Y5TA 5T5NG 5CSGA 1INDH 3JWDH 3V5DB 3WLWC 2B4CH 4NHCL 4WFEE 1HHJB 2Y9RT 5BRZA 5EIIB 4LLMA 2CR6A 1ES0A 2FX7H 4KRPB 4TVPE 4I18B 5J6GA 1A7BA 1WAAA 4JFHD 3TP4A 1EXUB 1QLRB 1NFIB 2HH0L 4FTVA 2H6PB 4ZDHA 3H9SD 4J4PA 3ZMRA 1FNLA 3LKPA 4CNIA 4HLJA 2JJTC 3NAAH 4WTZG 1HSAB 1TETH 1IC1A 3ARSA 1Q38A 1ITBB 3VU2A 3CVHA 4HG4J 2H45A 2AK4A 3GSNL 4X8JA 5C0CA 4U1JB 2YA1A 5C0AE 3RWCA 3VRJB 2NMSA 5DR5H 3U0TB 3F58H 4JB9H 1BZQK 2KQNA 3WS6A 4X9BA 5F3BB 4KQ3H 4U1LB 3T0EC 25C8L 4RCAA 4G43B 1ZLVH 5DI8A 2Q8AL 4TPRH 1K4CB 1Z3GH 2XG5A 4NKIH 1CDYA 4L8DA 5I8CB 5M7QA 1AO7D 4O5LH 3LEXA 3VD9A 3QIBA 4PJ8C 4YPGA 2HJLB 5BVJB 2ESVB 1EEZA 1GPOH 2PYEA 4EI5A 2WLYA 4XVJL 1R24B 5J06A 5I19L 4LVHB 4DZBA 1YJDC 1KCSL 2FX9H 5EA0L 3MZGB 3HNSL 4IRSA 2EYTB 2J2ZA 3BUTA 3K8KA 4XBGA 1HHGB 1ZHKB 5FHAH 2I26N 1UM4L 4W6YB 4XX1G 3RWHA 1IBGH 2Y6SC 2YMXH 1AE6L 2DI9A 3IJSB 2UZIH 3QUZD 4WHTA 4H0HB 4ZXBD 5ENWB 1LK3L 4N1HB 3H9SB 3HR5A 3NCMA 3MLPA 3CFCL 3BD4A 4OFYA 3ULVF 1FGNL 2DQUL 3RVUD 1E4XL 5FK9B 3B3IA 4JPWH 5EU4A 3W39A 4QXGH 3ARBD 2RAMA 3BEWA 1D5XA 5BV7C 3FONA 1NGWA 4U1NB 1FFPB 1AGEB 3VWJC 5JPMA 3PWNB 4LKCB 4YDLC 3T4YB 3ZKXC 1CG9B 3T2NL 4F58L 4NGHL 4NQDB 1XGQB 4MDJB 4L8SB 2BVQA 2H32A 5CJ8A 1T7ZA 5E9DA 4XNZC 1BFTA 4Y5YB 1KIRA 3LKRA 4I2XB 4Y2OA 2UUDH 3GSRB 1DSFL 5K9QI 2AEQL 4DUVA 2GT9B 1PG7W 1SJVA 2X4RA 3FQTA 1SM3H 2YWYA 4LQFL 1UWXH 4KQ4L 5C3TA 1G7QB 1RULL 5SWZE 4C56E 2J3SA 1AO7B 1HCFX 1CFQB 1IQWL 3IXTB 1UYWH 3VGBA 1UACH 4L8CB 3P9WB 5EUOF 1GC1L 1PKQE 3KPNB 1T04B 2ZOKB 3UTTD 1NLDL 2VDOH 3BZFA 3GZKA 3U36B 5L8LB 4PGCB 4XCNA 1KPRA 3MRDA 3SDCC 3VJ6B 2IFFL 3FT3B 2NZIA 1D9KC 4HPOL 1LDPL 5DLML 4WY7H 3FQNB 1I9JH 1A4KA 1LP9B 1BIIA 1R3LB 3QUZB 2MPAH 4ZXBB 1NL0L 4PS4L 1KG0B 4QHKJ 2RFXB 2ICES 3NFSL 4EUPG 2G5BA 5EORH 3O6ML 4L3AA 2X4OB 1T4KB 5D1QB 2NY3C 3FOMA 3ARBB 3O11B 1RMFH 4HCRL 4P4KD 4WVRA 4DKEH 3PWLB 3W5MA 2BSED 4U6YA 5DD6A 3M17B 3KWWA 5TE6H 4I9WD 5HHOD 4UT7L 4QNPE 4JO4L 5HI4C 4ETQA 2H2SD 4LLUA 3MRKA 3C60D 3QFJE 3WFHA 4U1KA 1CYGA 1ZS8B 3WUWA 1JPTL 4H20L 3S8WA 4XXDB 5FYJH 2GYSA 2VDQH 1A1OB 3PG2A 2GSIB 1HHHA 3CFKA 3GSUA 3KXFA 4LBEA 2OTPA 3KYKH 5B39A 3TVMC 4M43L 2ZOLB 5ICZB 2NY2C 5T3ZE 3CU1A 5CMAB 4Z7UE 3Q3GA 1B3JA 1FFOB 1BJ8A 3NFNB 4F3FB 4K7FA 1NCUA 3KR3L 3UTTB 1LHZA 4OLWH 3U4AA 5E24E 4LVOB 1KULA 3CLEL 3IAQA 3KPOB 3NGBC 4JEGB 4PJEF 4WI8A 1P9MA 5H94A 5JIKA 5HYSG 5I1CL 4KZEL 4Z6AT 3IETA 4O00A 2QTEA 4Z78B 3ESVF 1RJLA 2YPVL 4DVBA 4Z7WF 3QDGA 5TDPA 3PP3K 1A7QH 1P7KA 1KENH 4LSQL 4YHZH 4XPAL 3GHEH 2DQTH 5ETUB 3SCMD 1ACZA 2ZNXA 1MRFL 2HTKC 5KSBE 2HFEB 1JNHB 2D7QA 2AGJH 2PKDA 4P48A 5C0RL 3HHRB 4P4KB 3MJ7B 3EJJX 1H5BA 4UU9B 4WFHE 2IWGA 1J0JA 3TBVA 1JHTB 1HDMA 1CT8B 2CK0H 3TCLB 1DZBA 4QT5A 4HJJL 3VGAB 5HHOB 5E1AA 1KPVB 3D1MC 5A2IH 5E8PA 2NR6C 3C60B 1FCGA 4FQHA 2CXKA 3AU1A 4WTZA 1NC4D 4GKSB 4AIZA 3HUJF 4HUXB 4I13B 2ZKHH 3FRUA 2LVEA 4YHLL 1CS6A 2DJUA 4XP1H 4XH2B 2Y07H 1VGEH 3PIQB 4R97C 4XNUH 5BVPL 1X7QA 5IQ7H 1RSFA 3STZA 1T89C 3MLTA 3RBGA 1F4WL 3U4BL 3PQYE 1I8IB 4J8RA 2YD1A 2JK5A 5C0DA 1KEMH 1AD9B 4XPBH 4HWEL 2EO1A 2FYYA 4R96B 3MLSL 2CDGA 3WFCL 3GK8L 5FGSA 4FNLH 2OI9C 4XP6H 4TVPH 3ALPA 1A21A 3LV3A 4S1RL 2KUTA 1IGJB 1QSVA 3P9LA 3FT4A 2YPKA 1JMXA 3HS0A 2KKQA 2FJHB 1UZ6F 3F7PC 3LZFL 3VI3E 1NC2A 1I8KB 2DLTA 1IT9H 2YPLD 2AI0H 1JWSB 3QCVH 3QI9C 2ICEB 4QXTA 4TUJA 3SCMB 3MREA 4QRSA 5BXFB 5EBLA 3UDWC 4M03A 3IKCB 5MP6H 1CDJA 1OAQH 4PJGB 1U8LB 5AUMB 3OJ2C 1NAMB 4P2QB 4LP5A 3OV6A 4JO1L 5AD0B 3FQUA 6CGTA 2OJZH 4WW2A 4NKOA 2R29H 3QCTH 2D31B 1XZ0A 4UTBH 2SEBA 3ROOB 1QA9A 4JFEB 4I3SH 43C9B 3D85A 2R56L 5JOEA 2JF1A 5E8DH 4YEFA 4HKBA 3HPLA 3DUSB 2YZ8A 2HJFA 4PJIE 1NDMB 1NC4B 1LEIA 1AQKH 4HIIA 5IFAL 5DFWH 3RY6A 2EDHA 4IRZL 1N0XL 4P3DB 4R4BA 5I8OL 1NSNL 4WTWA 2ED7A 3PDOA 1H8OA 5AYUH 1E6JH 4Y4KA 3NFPA 1JPSL 2DQIL 4QYOB 5IGXH 3LQZA 2EDRA 3EZ8A 1IE5A 3SKNB 4PJBF 4GRWF 4D9QE 1MJJB 1RQ5A 2NY4C 3SKJH 4QGYA 4OZGE 2L7JA 1ZSDB 1BFOB 4HMCA 4TULH 4F15B 4PJEA 1T1XB 4U1MA 1N8ZB 2AJYH 3TPUB 3RVXD 2WUCL 2YUZA 3HMXL 4P2RE 1KN2H 2DTSA 5DJ0B 1NCBH 2DM4A 1TZHB 3D18A 4Z7WA 2YPLB 3D39D 2Q7NA 3DWTA 3FFDA 1H3PL 5F1IB 2DJ4A 5I1JL 4XP9L 4UOJA 5FM5O 4NM4H 2LTQB 4YH6A 4PJFF 1FQ9C 4YUEL 4HKXB 3BW9B 1A7PL 1KXTB 3NABH 4N8CL 3H8NA 1WSST 4EUPA 2DL2A 3KYNB 3MFGB 1TJIH 2FBJL 2ZWLT 1P7QD 1IL1B 1KCRL 2GSGA 2J4WL 1C5CL 3T0EE 3VW3L 4KKAC 4HF5H 4YHKH 2I9LA 1LO0H 3FKUS 2EKSB 1F3RB 4CVWA 1ZVSA 4K7PY 4PG9A 3WXWH 3UTPE 2IAMC 5EO9A 3QXUA 4R26H 2ADJA 4WO4A 3TWCL 4MDIA 5LBSL 3SE9H 1DQDL 4ZFZB 2X7LB 4OF0A 2QLVB 1FVCA 3QEHB 4Y4HD 4Z5RA 1MHPH 5IK3B 1EMTH 1PAMA 3BH8B 5HGAB 3I6GB 4G5ZL 3ZKMC 2GIYA 4PJAA 2MCPL 4NC2B 1EAPB 1QR4A 5FV2A 4MJID 3QQ3A 3CC5B 3JZ7A 1MWAA 4HQQH 1K5NB 3L5XL 5GS0H 4X80L 3K80A 4KDWA 5EG6C 4YIQB 4M7ZC 4KMTH 1PG7L 2L0DA 3K8MA 3D39B 4TUOB 4H8WC 3U79A 1GIGH 4KJPC 4Y2DA 3LH2L 1KBGL 5HYSA 4NSKA 3QNZB 2WUBL 3LN4A 2YD2A 4JFPB 2WMPA 1CDHA 5KSAD 2EDQA 4XCYA 2LFGA 1NMAL 3U82B 4JRYE 4QY8A 1PVHA 1X4ZA 1L7TL 1W72H 5D70L 3LEYL 1MFAH 1P7QB 2GTZB 3H3KA 4I4WB 2DLEA 2O61A 2CKNA 3MV8D 4LPCA 1VGKA 2FL5B 3I84A 4F8TA 5DD0L 2CPCA 3TPKA 3IF1A 1RY7B 2V17L 1MAKA 1FFNB 4UBDC 5EOTB 3MRLA 5L7XL 2MTPA 3JXAA 4RFEB 4MCYB 4NO2A 1ZHNB 4KI1A 4TOYL 4Y4HB 5T1MA 1A6AB 1UJTA 3G08A 4LSDA 4M6ML 5GRVK 4UOW1 3QUXB 2BOBB 4M00A 4WIQA 3GI8L 3QXDB 1FRGH 1L6XA 5TQ0L 3L7EA 3MNZA 5TFSL 4DKFL 3UTZB 2ORBH 5D6CA 3ZSTA 2DKMA 4MJIB 4LF3A 1MCPL 2Z0BA 4RGOH 1I7ZA 1RZ7L 4XNQB 1N6QH 4JKPH 3WIHL 3TYGH 1X5GA 2BRRH 4UDUA 4O2FA 2D0FA 2IFGA 1IGTA 1MRCL 9CGTA 1J1XL 5B3JF 1U6AH 3ARPA 5TF1L 1A3QA 4PJDA 1BBJB 5KSAB 5FUOL 3LIZL 2M8XA 3JVGA 1RK1B 5F7EL 4KZDH 5A2LH 4TSBH 3B5TA 4DUXA 1BHGA 3VFWB 4NZTH 3DX6A 1XFPA 3PWPD 4W81A 2VZOA 2EIZB 1GH7A 1BQSA 3MV8B 3BP5A 3HI1A 4WCYH 1T5XB 4NKMA 3TV3H 4Z7QE 4YC2C 4FXKA 4ZFOA 1N4XL 3BP4B 2OTUA 2N4IA 4PGBB 2BSTB 5ICYA 1BQHG 2R39A 2FO4A 1I3RB 1FG9C 2ZZUT 1FNGA 2QADD 2VLKD 2YBRB 2QJDA 2P49B 2EZ0D 2Q3ZA 4NKQB 3GMPA 4JJ5B 3SY0B 3BESR 2J8HA 3VD5A 3RQ3A 1XGPB 1MJUH 4G9FE 4NP4H 4QRPA 4X83A 3DURB 3SDXA 1YN7A 1F13A 3UTQA 2HRLA 3MRFA 3MCKA 4JFHE 4NYLB 3OX8B 3MRBA 2HWZH 1OOAA 3H9SE 1S7QA 5DEFB 1BX2A 1R3IH 4QF1B 4KKLC 5GGSA 3MGAA 4JKWA 3QXWA 5FO9A 3IDGA 2P5WA 4RISH 1MPAL 5ITBH 2AJSH 4KJYA 1DN0A 4Y19E 5DWUL 1CICD 3DRQB 4JDTH 4NQDE 5BZWA 4ORZC 4XAKE 1MCEA 1XH3A 3ROLB 5FA4A 4LPUA 1T3FB 1IQDA 3HC0A 4K3EH 4PR5B 3PWPB 1FAIH 3SGJC 5GS2H 5IMLA 4PJCA 4XWOD 4IHOA 3IDMB 2OJEA 4J3SA 2OS7A 4NWTL 5FYLD 3DUUB 2P7TB 5DO2C 2QHRL 2A0LC 4I0PC 3NACL 1AO7E 3VE0A 5IW6B 4LL9A 4OCRH 4K3DH 2VE6B 2R0WL 4AM0A 4DQOH 4M9OA 4MJ5B 4N68A 2OP4H 4DN4L 5D72H 5I8EA 2W65A 2JKXA 3NZ8B 3SJVA 2VLKB 4QGTA 4A6YH 1B88A 3O6FD 4JFFA 2YD7A 5CWSA 3MLVH 5CFHA 4OLYH 1YPZB 5GHWH 3DYMA 3BKCL 4Z95H 3P11H 4FQLL 1PDKA 3X3GL 1ZWIA 3MRPA 1XT5A 4XMPH 3IJYA 3E2HC 2BMKB 4RMTA 3WE6B 4XC3H 3OZ9H 2HT3C 1Q9OB 5C8JB 4XPGH 4U6XA 2BRQA 2VKXA 1UXWA 3S34H 4F9PC 3WFZA 1ZE3C 1MAML 3L5WA 1FJ1B 4ONFL 4Q6YA 3I6KB 1MQ8A 2PN5A 2X70B 1LO5A 1O7SA 1YEKL 1CICB 2EIEA 4LSUH 3UX9B 3BPCB 5D1XD 4JRXD 4D9RD 2R0LH 3VFSB 4MAYD 3QZWA 2C3WA 1BEYL 1AXIB 3MUHL 5DQJA 3DBXA 3Q5YA 4WDIA 3NCEB 2E6QA 5K59F 3QUMB 1BZ7B 4MQTB 4IMKA 4OBSA 2H1PL 5L6YH 2NY6C 4L4TD 2BY2A 5IB1B 2QL1A 4JAMA 1KJ2A 4XTRC 3OKOB 1WZMA 4YXLL 1YJDH 1S9YA 3AMLA 3BZDA 4XVTL 4JQXC 1YEJL 4RNRB 5DRNA 4KHTL 3VXUE 2IPUK 2YN5A 2FATL 3VGDA 4L8BA 4B5EA 4DK3A 5CEZD 1DQML 4JFYA 4RFOH 3UTTE 5F9WB 3BP7B 4XWGH 3MRNB 4J12A 1AXTL 3HI6L 2DBLL 3O6FB 2FEEI 4P2OB 5IJKC 5E6IC 4WHCA 5FYKD 4KGLA 3MBXL 1IGCL 1FNEA 2DQEL 4HPYL 1CFTA 4HV8B 1SYSA 2F9BT 3G04B 1T7XA 4CADA 3GIVB 2VDRH 1WWWX 1GGUA 3I9GL 3IU3B 3S5LB 5HHQB 2UYLB 4MYWB 1EUUA 3G6DL 4DWHA 2EDYA 1YEHH 3ZYJA 3VXOA 1CL7I 1LGVA 4G3YL 5B4MC 2FSEA 5F9DC 2EDEA 2IQ9H 5JNYB 2WBJC 4GW5A 4JFDA 1A4JA 1SQ2N 4POZC 3UTOA 4I48B 5D1XB 4JRXB 5HHOE 5D96C 5IB2B 4AT6A 4DJMA 4MAYB 4LPYA 3UZVB 1J5OL 5J11C 2CLRA 2J88L 5L0QB 1A6PA 2XFXA 1WZ1H 5DGRA 4KK6C 1NBQA 5EU5A 4M5ZL 5EZJA 3ULUL 2YC1A 3E6FA 2CR3A 4GW1A 5IVXF 4PYHA 3AB0C 3FQXA 4L4TB 4OZ4A 1AY1L 2DN7A 4PJ7A 4OZIF 2EXWC 2V7HB 1O5DT 3GSNH 1MCQA 4YXKL 4AEIL 5C2BL 2E7BA 1B2WL 3H7LA 4OZHB 4MZ2A 1R0AH 1AGDB 4TTDD 4CMMB 4QCIA 4KH2A 4ZODA 5T5FL 3CUPB 2MJWA 2QQNH 5D7IB 1JPGB 3IGAA 4LKXA 3V9FA 3HZVB 3U7WL 1BQHA 4PRIA 1LO4H 4JZJC 5ALCL 3PP3H 4J3WA 4GAJL 5IOPA 1I1AA 2OTWB 3U0WH 2AJXH 1HQRA 5JQ6L 1CBVL 5CJQL 3WJJC 5EA0H 4GKNA 1A9BA 4WI6A 2XKNB 5IFHL 2UY6A 4QRUA 4F7CA 2ENYA 2FHCA 4YGVA 1OLLA 2W9EH 3C5SB 4PJGE 1JP5A 5IJVA 5J7CC 3BRGC 3B8YA 2V2TA 2OK0H 2YK1L 1FZKB 1TXKA 4P2QE 5GGSY 2DMBA 4I5BB 4JZOA 3KJ4C 2FDBP 1F3DH 4CW1B 4LSSL 3C8KA 4ZAKA 4D2NA 3TN0A 3LKQB 3IDXL 1FDLH 3X3FL 4QHLB 4JFEE 4HG4K 1U3ZA 2BOCB 4OV6F 4MMXC 4AZ8A 1T2JA 1DQLH 3EDFA 1MCHA 5E8NA 3O9WA 1CVRA 4HIEB 5E00A 3WN5B 1X5AA 1CFBA 3QEGL 4D94A 3SDDC 1IFHL 1N7MH 4F58H 4NGHH 1R5WA 1T03L 4YDJA 2Y4SA 1OAZL 2GAZA 2V7NB 5FUCC 5H2BB 3QUKA 4NN6C 3MR9B 1KJ2L 5ANME 1QR1A 2P47B 5J1TC 2VERN 3EKCA 1DSFH 4WFGE 1OAXH 2CUHA 5EO1B 4KWUA 4PJ8D 5IEKA 3LSOB 5JA8B 1HQ4B 4HS6B 2CDEA 3FT2A 1U8IB 4IOSD 5KVFH 1KCVH 3HZKA 3L3KA 5GJSH 1IQWH 3GM0A 1I8LC 4MB3A 4XPFH 1A7RL 1TCRB 4XXCC 3MNVA 4HZLA 1LNUA 5IBTH 4DUWA 3ULUC 3GMOB 3CXHJ 1MLBB 3U48A 1G1CA 3B9EA 1B0GA 1IJ9A 1LD9B 2YPLE 2EXYD 3KPPA 5CZXC 4R8WH 5GGQL 3LRGA 3V0AC 1CLOH 4O2EB 4X6BA 3X11B 4OTXL 4PREA 5DFVC 4DGYL 2JE8A 4CN4A 1M1SA 4OUUB 5H35A 2XY2A 5KS9A 1K2DB 1LDPH 4MSWA 4PRAB 3QIUB 3SKMA 5DK0A 4UILL 4LNRA 3ZYZA 3OKDA 4NO0A 2AEPH 3MA9L 3WKMH 2FIKA 4QRQB 2FX8H 3RKDD 3BN9C 1Q72L 5KN5B 1NFDB 5J56B 4JZNA 5IW1A 3RWGB 4UV4L 4UTAH 4NQVA 2VLJE 5EN2B 1FVDB 5DF0A 3WIFA 4CVXA 4O2CB 3I85A 5IVXA 3VD7A 5GQBA 4JY5H 3X12B 1UKSA 4HUWB 4UT7H 4F7TB 5EB9A 1NANI 4PB0L 5HHMD 3U6RB 2NY5L 3RNKA 3RWFB 5E2VL 3WMSA 2QQLL 3EIFA 3NZHL 4PJ8B 2ZCHH 2C1PA 2KZ1B 3OPZH 5J9PA 1CTOA 4M6NH 3RU8L 2PR4L 4P5MA 3HAEH 4L4VE 3WFEL 2EDLA 1HYRC 4JPVL 5GGVH 5EUKA 3THML 1HKFA 4K2UH 2W59A 3VWKD 2GHWB 5I1LB 2VITA 3KR3H 1DEEB 3VMPA 5I71C 3D39E 3QO1B 3QEQA 1V8HA 3KYOA 3D3VE 3DVIA 3QHFL 3CLEH 2XPGB 4R7DA 3FB7B 5D2NB 1U3HD 1HEZB 4MNQA 3W9DB 1FGVL 1WBXB 3DSNA 1VEPA 2DWDA 3TH2T 1QQDA 5I1CH 5KAQG 4EN3C 4X6CB 3T2OA 1EO8L 4CMHB 1RZGB 2K1MA 3T3PE 5C07D 2FWOB 1Z9LA 5JUEL 4NDMB 1DQQA 2NY3D 2AJUL 5EOCH 2XY1A 2IMMA 5BV7B 2MFNA 2N7BA 4YBLC 3CMOL 5IF0A 4ONOA 1INQB 3HC4H 3OR7B 4EIGB 4CGTA 2XWTB 2AXHA 5C0RH 5HI4D 4OAWB 5CHNA 5I8KH 1BJMA 3GMLA 5F3HA 4RWYL 2EYRB 4WJ5B 2VO5A 4OJFL 4YHPB 3MV9D 1V7NL 4JM2C 2A6KB 1T22A 4WU5A 1J86A 5BOZG 4N5UA 3F7VB 4UDTA 1UKTA 3C5ZA 3MBEA 4HJJH 5A2FA 1NUDA 5HHMB 4HFUL 2YR3A 3K2MC 5H37H 5D7LD 4JLRB 4LCCA 2B20A 3CZFB 3TVMD 2XQYK 4ZOBA 2GJ6D 2X4SB 3X13B 2G2RA 5I1KL 4JN1L 1VADA 5C0AA 1S7RA 3C6LA 4BJLA 5I1HL 1X4XA 3PHQA 4YAQB 1JPST 2P8LA 4MJIE 1KB9K 2E27L 4V1DD 5DEZA 4YBQC 1MNUL 4MJ4A 4H1LA 1M7IB 4HWEH 5IKCB 3VWKB 2DKUA 4R4NC 4XRCA 3GB7B 5E2UL 4D0CB 3IFLH 3HE6C 4HMEA 4NNPL 4Z7UF 2HMID 1A6UH 2Z9TA 2F53A 4N0FB 4QRRD 2XWBA 3FB8B 3TA3B 5DDHB 5IFJA 2NY5C 3BEVB 3EDEA 1U3HB 3BWAB 3MFFA 5LJYH 3EO1B 2HVKA 4LVEA 4YBHA 5JW4R 4WGVB 3MMEB 2DQDL 5C07B 3K8LA 3IU4H 2GQHA 1RURL 1T2QL 3IAGC 1I7TA 3KJ6L 5IG7A 4QHKI 4RGNC 4MLIA 5C0GA 1AGBA 3MXVL 3W2DH 3TFKC 1JZ6A 5D4QA 1CLCA 1QRNA 1DFBL 3MV8E 2CXGA 1OTUC 1MHHB 3QG6A 4ZSOA 1TTGA 5KSBF 3RAJH 3MV9B 2R2EA 4Z7OF 1XIWC 4P49A 4EZMA 5BRZD 5ERWA 3S96A 3SE3C 4Z77A 3NN8A 3VH8G 5D7LB 4PV9B 5D7JC 2EKJA 3UZQA 3VFPB 2GJ6B 3CMGA 4X4MA 2H8PA 4WNQB 4Q2ZB 4ZFGL 5I2IB 4H8WH 2YRZA 3MRQB 4ODXB 1JGUH 4X99A 4I0CC 5E4IA 1DDHB 4WI7A 4W6XB 4YQXH 2X1PA 4V1DB 1R3HB 1G6RA 1AGFA 3BUYA 4N90E 5IV2B 4LVNC 2QSCL 2P24A 1ND0A 4UUJB 1FZJA 4ELKA 1U92A 3WLBA 1NEZG 4KUCD 3NGBB 2A9MH 1H0DA 2PW2A 2FB4L 1BAFH 3NTCL 1KXQE 4XGZA 1JF6A 1IAII 2WUCH 4X6FA 1VFBB 2IADB 4KY1L 1F3JA 3RTQB 2FECL 3DX9A 4O02H 1XGRA 5F1NB 4M61A 3QIBD 4EOWL 1MY5A 5MEQB 4JY4A 4EVNB 4MX7B 5D71L 4RMSA 4QKXB 5IROC 3GJFK 4JO3L 3REWB 3ARQA 2DM3A 3QJHB 1A7PH 4Y4FA 3KPLA 2Y5TB 3UBXG 5MENE 3RWDA 3PL6C 1U42A 4M4RA 3CPLA 4H5SA 4XCCL 4BSWB 3VFMA 4ZQKB 5BRZB 2AW2A 1XF4A 3D0LB 1ADQL 2WNGA 4FTVB 2BX5A 4P23C 4YEEA 3WNOA 3PGFH 4MHHI 4HBQA 5DZLA 4QXUH 1IM9A 2Z31C 4J3OC 5TE4L 1YPZE 1C08A 3LKPB 1ZMYA 1U8HA 3WYRA 4WV1C 5JHLH 2WBKA 3UAJC 1ORQB 2NY4D 4R2GC 3T8XA 1VPOH 4U1SA 5BJTA 2BVTA 1HHKA 4HT1H 2CGRL 1HINL 5GGTL 4Z7UA 1D5BA 5E9DD 3WS3B 4JQVC 3CVHB 5CZKA 3AREC 4X8JB 4NM8L 4GXVH 3E8UL 2F5BL 4GRMA 3IDYC 3B2VL 2EYSA 4OZGF 1WWBX 3C5JA 5LKNA 5DI8B 4X80H 1DLFL 4L8DB 3KGRA 4Q0XH 4ELME 4OFIA 4WUUD 3OWEA 4XMLL 3MOQA 3LEXB 3I02B 3QIBB 4YPGB 1TZGL 3BMVA 4M7LH 3PF2A 3LKOA 1TITA 5DRZB 4D3CL 5JA9A 1CDUA 5HI3C 3EGSB 1UWGL 1HHIB 4XNXH 3WNKA 1KEGL 1G9ML 2VISA 3A6BH 1Y18A 1FZOA 5FYLE 5HPMB 5FUCE 1DBBL 5KSBA 5HDQH 4XBGB 3RNQA 1KT2A 3V4PL 4KKAD 5IMOA 1OT2A 1L7TH 5HVFB 4Z0XA 1A22B 1RJYA 1RU9L 5CP3H 2OX5A 5JPNB 5CUSL 1KTLB 1CL7H 4H88L 5ADOL 3JWOL 4GFTB 1NBZA 1BBDL 2GFBB 3BO8B 5DJYA 4Y0GA 4LDOB 1ODAA 4OFKA 4PRHD 1FAKT 3B3IB 1EH9A 5EU4B 5AWNH 3W39B 2ADFH 3W0WA 3FONB 1NGWB 4J1UA 5FGCB 1BOGA 2WBWB 2YUXA 3DI2B 3PQYA 1MCSA 5ID1B 1OAUH 5F7DB 4OCSH 3WNNA 2ZUYA 3EOTL 2H32B 5E9DB 3DYOA 3GMNB 1JNJA 1KYOJ 3LKRB 5TQ0H 4DKFH 3IDJA 3ELAT 2NYYC 3WXVH 4YHML 5ACZB 5C7XL 1JHLH 2X4RB 1RZ7H 4PRPD 3FFCA 3TC9A 3WJLA 4LSRH 1OGTA 3L6FA 1C7TA 5FDYA 4YFLF 5HI5C 1DBJL 1V7ML 1L7IH 3M1BB 2HT2C 1J1XH 2A74A 4NOFA 2YD9A 5KVEL 1DUZB 3RIAK 2W9DH 2BSSB 4N1CA 1DQJB 2W38A 1CLZL 2DLIA 2ADGB 3VDBA 5F7EH 4L4TE 3T08A 2ZG1A 4XCNB 1KPRB 5DVNA 3KPRD 6FABH 4YX2H 2AJVL 2C4FT 2VXTH 4C4KT 3HNTH 3HFML 3DV6B 4OZHE 3EYUL 5CEZE 1I4FA 4OI8A 4G6JH 4QO1A 4Z7NF 2NTSP 3CIQA 3EYVB 5D7IE 1EUTA 1G7LB 4J4PC 1ZHBA 1RUQL 4ZUUB 1N4XH 2HG5B 5IWLA 4RMWA 4G42A 5FYKE 4BA8A 2VSDA 1LE9A 3FOMB 2HFFA 4FQCL 1G9MC 4NOBA 1HILA 5F1KC 1JI2A 3QIUC 4WWKA 2VXSH 5DD6B 5TGBA 1KF9B 2V5YA 1QFWI 2VLLB 4LLUB 4Q7DA 3J7HA 1MFNA 4KC3B 3WFHB 4YXHL 4LIQE 3WUWB 5C0IA 2QR0A 4U3XA 3GJEA 2R2CA 4M7ZB 3BGMB 2AJZA 3RZCD 4K3JL 4OZGA 3JWOC 4U6TA 1HHHB 4PRPB 3V0VB 1AD0A 3A6CL 1NMBL 2OZ4H 3BKMH 3M8OH 4ZO8A 1SJHA 5E7BA 3KNBA 5DHVA 1W8OA 3H0TA 2FZ3B 3FO1A 3DROA 4FFVC 2E7LC 5IR1A 3HC3L 4BK4A 3RP1A 2VQ1A 4KRMB 5DWUH 3QO0A 4NRXA 4ODVL 1TENA 3BQUA 3FJTA 4OKVB 4IRSC 1NCCH 5HHVL 5H94B 1YYLL 3KPRB 5D5MA 3IETB 5B38B 1NC2D 32C2A 1M4KA 1RJLB 4DVBB 1ZGLM 1JN6B 3QDGB 5TDPB 3NBNA 3DHMA 5DS8A 4TSCH 5FOJA 2W0PA 5CGYC 1KB5A 1M6OA 1RFDL 2R0WH 3G6JB 2BNUA 4BUHA 2NY7L 5CSZA 1JJUA 4Z7QF 2R1WB 3T77B 2IBZY 3CLFH 1I85A 2DQHL 2PO6C 2GITA 2COQA 3PUCA 4QT5B 4JDZA 4RQQB 3KPSA 3D85D 3O4LD 4Q6IC 4OCXH 4ODUA 3LMJL 4GRLC 3O3AA 2VL5B 3FL7A 3RWJA 4AIZB 4PY8J 1HH6A 2I25N 3JUZA 3RZCB 3FRUB 5EWIH 5L8JB 4KKLD 1H8SA 1NANH 1VEOA 2DIAA 1ZLSH 3BHBA 3VXTA 1X7QB 2Z8WC 2AQ3A 3EYFA 1CGTA 4J8RB 2JK5B 3RWEB 1NFDE 1I7UA 3PWJA 5INDB 5KJRH 1XCQA 5I75C 1U95A 2FYYB 3MX0A 1MAMH 3O4OB 4M7JH 3K1DA 3L3GA 1EEQA 4FN0A 3O8XA 1U8KB 5I17A 1CGUA 4YJZL 5HHNA 1NGQH 5D2LB 2E8ZA 3FT4B 3P9LB 3VI4E 1OQXA 1ZVHA 3NH7L 5CD5D 1BQUA 1NC2B 3KDMA 4YC2B 4B41A 1DTUA 4MD0A 3V4UL 3GMRB 4BM7A 3VXSD 1IGIL 5L88H 4QXTB 2Q76B 4P5KA 4QRSB 1ZANH 5K93A 3PP4H 2VUOA 1ZA6A 4GAFB 1CCZA 2HJKB 5LGKA 4CVZB 1DQMH 2JB5H 4KTYA 1S9VA 4WW2B 3MRGA 1JTTA 4NKOB 5DVLA 1UM5L 5EZIL 1XZ0B 2SEBB 3HE7C 1QA9B 2X10A 5HHPB 2Z8SA 3D85B 3O4LB 3ES6A 5D2NE 3GHBH 4X6CE 3QXVA 5EZOL 1SBBA 4HIIB 3V5DA 1ZHLA 1H3GA 2DIJA 3BPOC 5EIIA 3E0GA 4WO4D 5CJXC 1LP9F 1BGXH 3PDOB 1QLRA 1FIGL 2H6PA 3NFPB 2KQMA 1PSKH 1TIUA 5F71A 4NQXB 3U9UB 5B8CC 1HIML 1CXKA 1DJSA 2WWMC 1KJMA 4HWUA 3MLYL 2XYCA 2BY1A 4NCC1 4U1MB 1HSAA 3TO2B 1UB6B 5HHME 4Q9RH 1P9MC 3MGOA 3HRZA 5IBUB 2FGWL 5HVWA 3WO4C 3SO3B 4MNHB 3D18B 4E9LA 1II4E 3LY6A 3VRJA 4I3RL 3VXSB 1RUPL 2ERJC 3FFDB 3I2CH 4Y2DD 2VXQL 1JNNL 1J9CT 1BVKB 1AY1H 3MODL 4KI5D 5F3BA 3AFLA 5DJ8B 1T21A 4G43A 3MRMA 4YXKH 1K4CA 3ULVC 1QSED 4LEOB 5C2BH 5I8CA 1TQCC 2VDKL 1RIVH 1JIBA 3REVB 4EUPB 1H5BC 2HJLA 3V0WH 4JRWA 3SPVB 5BVJA 2OSLA 4YE4L 2ESVA 2EH7H 4MNGE 1MQKL 2GSGB 3F62A 1CI5A 3GRWA 1A6TB 1BJ1J 3NCFB 3U1SL 1OP5K 4M6OL 2OL3A 3RWIB 5F89A 3MROA 1WJ3A 4QWWC 4WO4B 2ADJB 3MRIA 2EEDA 2JJWA 4MDIB 5B4MD 1MCBA 5IFHH 1I8MA 2CRMA 3V5HB 4ZOCA 3BDYH 3EDJA 4G8IB 2R0ZL 1FVCB 5ENWA 4YZFE 5LWYL 4KVCL 1TVDA 2APBA 5BS0D 4LPVA 4W6WB 2BNRE 3I3EA 2FHFA 3EO9H 5T1LD 1A6ZB 3T4YA 1CG9A 1OPGH 2VSCA 2R1YB 3EFDH 5FCUH 1XGQA 5IESH 4L8SA 2VMFA 4Y5VC 3ISWA 5D7LE 5C09A 4Y5YA 5DMGC 5E2TH 1F45A 2EXWD 2GJ6E 1IAIH 4I2XA 3GSRA 4Y2DB 5HYSB 1RUKH 1T03H 3LN4B 2BFVH 1OAZH 5ITFB 2GT9A 4AMKH 4V1DE 1LO3H 3EYSL 4D0DB 1QSEB 2M2DA 1AO7A 5IB4A 4LIQH 1UC6A 1F02I 2WQRA 3OJDA 1DLHA 4L8CA 3V7AE 1U93A 3LB6C 1W8NA 5GZNC 1T04A 2ZOKA 1MF2L 2ED8A 3I3DA 3P4OA 5GRJH 3BIBX 3C2AL 3VRIA 4RIRA 3U36A 4D9LL 2XOTA 1GXEA 1X5JA 2E6JA 1VGKB 3GSQB 4PGCA 3OG6B 5GGUB 4U7SA 1WC7B 2A83A 3GBMH 4UIMA 4F7MA 3PWUB 4NZJA 3SGKC 5CILL 3FQNA 3MRLB 1LP9A 4HWBA 4NO2B 4WENB 5HBBA 1J8HD 4ZXBA 1JYNA 2B1HL 4KTEH 1KG0A 2RFXA 5B21A 1JHKL 2X4OA 4PJGF 5BS0B 1J1OL 2XRAL 5IBLD 5J11B 3L7EB 2KZWA 5D6CB 1OLZA 1XMWA 5FM8A 5TH2A 2XQBL 1I9IL 3PWLA 5BRZE 5T1LB 3N06B 1Z0NA 3SN6N 1I7ZB 4ZNEA 2A6DB 3SDDD 1WAAE 3M17A 1IGFH 5E70A 4FTVE 3AB0B 2WM0A 2AQ1A 4R3SA 3N1QC 4HUKB 4O2FB 2J6EA 3Q1SH 1IGTB 3PHSA 5A2JH 4LRNH 1JFQH 5I18L 2DLHA 3LVEA 2P5WD 4XXDA 1A1OA 2APWA 1P4BH 3P73B 4ODWB 4PJDB 4RMUA 4BH7A 3CXHK 1A7OL 1VFOA 1IAKA 2QQLH 5I1IL 1MCLA 2XICA 1G7JB 4JZJB 2AK4E 4QTHA 5C0CE 3TO4C 4F3FA 2LV4A 1FL5B 3ULUD 5H8DA 1U36A 4DCQA 3ZLQC 3H3PH 5CZXD 2O93L 3EDKA 5E6ZA 1CD8A 1VA9A 3BP5B 1L9MA 3HI1B 4RFNC 5D1ZD 4DGVH 3KPOA 4LSVH 2VDPL 2NLJA 4JHZA 4FXKB 1WZLA 1ZTXL 3CXDL 4N0YH 4ZFOB 1SEQL 2OTUB 5DFVD 1X3DA 3GJFH 4DOHB 1C16A 5ICYB 3V6OC 1J8HB 3O3EA 2PYEE 1UKQA 2BDNL 5EBWB 4ZO6A 5TE7H 2FJGB 3SJVD 4UINH 2YD3A 3GMPB 3CNKA 1BZ9A 2HFEA 4U33A 1VDGA 4DEPC 3B9KC 4TYUA 4P4KA 3SDXB 4UU9A 1YN7B 1FO0L 1CT8A 1S7VB 2YRPA 1UA6L 3MRFB 3WD5H 5HHOA 1G0DA 4PJ5A 1KPVA 4IIQC 3SOBL 3MXWL 2PYFA 4AH2A 1BX2B 3LAFA 1IM3A 4JM4L 4OJFH 1V7NH 4GKSA 3VA2C 5T1DH 3IDGB 4HUXA 2P5WB 4MS8D 4KK8D 5M95B 3OF6A 3FAXA 5CZVH 4XH2A 1JWUB 2VC2L 4KJYB 5FGCE 3GSXB 4RBPK 3QNXA 3MOBL 5BZWB 3QEUA 1AD9A 3MUZ1 5E9DE 1N64L 4R96A 1QSFA 2ZUWA 3OAUL 4Y5XC 3U2SA 1QLEL 1CZ8H 5IMLB 2YSSB 2VWEC 1MNUH 3BGAA 3RGVC 5E08L 3RL2B 5D1ZB 5AG9A 3Q6GL 1IGJA 1WVZA 4ZO9A 3C2SA 4S1QH 3WBDA 3D25B 4HD9A 4AM0B 4ERSL 1NBYB 4RGMC 2AV1A 1JWSA 5SX4H 3SJVB 1A9EB 3D9AH 3SCMA 3BE1L 5BXFA 2YXFA 4PJGA 1U8LA 5CWSB 5AUMA 1NAMA 1RURH 1F8TH 2ITCA 3T3PF 5AD0A 1QFWH 4ENED 5F1OB 4OM0L 1ZWIB 3MRPB 1P6FA 3O2DL 3IJYB 2D03H 2BNQD 3FN9A 5EOQL 4JPKL 1NDMA 1NC4A 3JUYA 4FG6D 4LLQB 4U6XB 1AKJA 1GZPA 1KELH 4JREC 12E8L 1IRAY 1DVFC 4MVBC 5FA3B 3BZ4B 1LO5B 3ARDC 3NPSC 4FP8L 4P3DA 4FQXD 1D5MA 1QYGL 4O58L 1OAKL 3NIGF 3P4LA 3MA7A 5DVMA 4QYOA 1MJJA 4EQ2A 4WDIB 1ZSDA 3KXFE 4KKBC 2DKSA 4DAGH 1I3GL 1T1XA 3P30H 3TPUA 2CMRH 4JAMB 1KJ2B 5JQHC 4Y16C 1S9YB 1YNTB 4K07A 1N5YL 4OF3A 5I73C 5DJ0A 4ALAH 4HC1A 1T66C 3RDTA 1SJXA 3OKNA 5I76B 4Q58C 3U46A 3BZEA 43CAA 2AAVA 1CVSC 4KTDL 4RGND 1EERB 2JTDA 4G8EB 4HKXA 1AQDA 4PRID 1DBML 3BW9A 4F9LA 4U05A 1FNEB 4Z18A 4X4XB 2OYPA 1CFTB 1EZVX 1SYSB 1OTUD 1INDL 4CADB 1XEDA 3JWDL 1I1AD 3KYNA 3QDGE 3DMMC 2B4CL 4GQ9H 3B8SA 1IL1A 2FX7L 4HK3J 2BNQB 3QULB 1AGCA 1CK0L 3GO1H 3VGHA 2XTJE 3VXOB 4E41A 2EKSA 5GS1A 5D7JD 3IVKB 3K81A 2FSEB 4ZO7A 1RPQA 2HT4C 5E8EA 1VESA 4FQ1L 4FQXB 1J05A 1ADQH 1G6VK 4X6DB 4X9FA 1A4JB 1QFUH 4PJXA 1ZXQA 3NAAL 3QEHA 4LLWB 4AT6B 1TETL 3QAZB 5IK3A 2XFXB 2L4OA 3BH8A 3HMWH 3PGCA 4PRDA 3KS0J 3QJFA 3I6GA 2X4TA 3ARFC 1QPXA 1ONQA 5EZJB 1AP2B 5DR5L 3SBWA 3CFIC 2BVEA 4HIXH 3VGFA 4QLRA 3FQXB 4OZ4B 2K3TA 1H3XA 5IIEB 4KQ3L 4PJ7B 2H9GA 1K5NA 4TPRL 1EHAA 4NKIL 3BT2L 5LCVL 5FXCH 4TUOA 4CL7A 5HYQA 2XIDA 2ZUXA 3QNZA 4N8PA 5C70A 5F7KC 1GPOL 3IGAB 4JFPA 1F42A 3JV0A 5JORB 3MUJA 4LCUA 1BQHB 3NA9H 4PRIB 4AENB 4L5FH 3LS4H 3S7GA 1MELA 1KEGH 5FHAL 1G9MH 1I1AB 4ZYKB 1F58L 1MH5B 2PXYC 3ZKQD 3VD4A 1IBGL 1A9BB 2YMXL 3MRCB 4QRUB 1IKNC 1MLCB 2GJZB 2DICA 4M1CC 4OGZA 3V4PH 5IJVB 4NNYA 2FL5A 4HULB 2V2TB 3CVHH 1VFMA 1R5IB 4JZOB 2Z31D 4A2LA 3U30B 1FFNA 5EOTA 5ESQB 2JIXD 4ZAKB 1HNFA 2ICWB 4MCYA 1ZHNA 4Y4HA 3UAJD 5MI0C 1VSCA 1A6AA 4LVNB 3V6ZB 5DA4A 3QFDA 4OCNC 5C71A 2EE9A 4Y89A 1IVLA 5E8NB 4RAHA 4M93C 3QXDA 1FL3B 1YPZF 4HWZB 5ESVA 1OB1A 1MFEH 2B5IB 4IRJA 4K71B 3AM8C 1SM3L 5IF0B 3MOAH 4XNQA 3MUY1 5JW4N 2VDLH 4K7PX 1ZA3A 2W0FA 3VXMA 1QR1B 3JV4A 3BIKA 1UYWL 4KK5C 1OSPL 1UACL 2XT1B 3DGCR 5IEKB 2AK1H 3SDAD 2CDEB 1LILA 2ZUQB 4UNVA 2LU7A 2NY1C 2C4XA 1R3KB 3HZKB 4PJEE 5KSAA 2NW2B 2VDOL 2WWKO 1G7IA 3MGTA 4G6MH 1RK1A 4ELMF 3INUL 1IZJA 1LNUB 1LK2B 5FV1L 4J3UA 4YHNA 1IGMH 1B0GB 1EBPA 3QEQD 3VXSE 3OJVC 2EIZA 4L9LC 1I9JL 1JV5B 4WY7L 1LQSR 4PJHA 5BOPA 4MQXD 3HR6A 4JKLA 3OHXB 4PREB 4UT6H 2ITDA 2MPAL 4PJ9D 1T5XA 5K9KA 2H32H 3CSBA 5KS9B 3EHBC 2Z31B 3IJHB 4OQTA 5DK0B 4GXUM 3OKDB 3WHE1 4PGBA 2JIXB 1RMFL 3KVQA 1I3RA 4F80A 3ILQC 1KYOK 5HGGS 2YBRA 1IARB 2WK2A 3OKEB 4TNWK 5TE6L 2Z8VC 4JJ5A 5DT1H 4HJ0D 1XGPA 1LO2H 3I75A 5F7WC 3WIFB 3FO9B 3DURA 3G5ZA 4CVXB 5I9QC 3ZE0E 1TLKA 3DVNB 1LEGA 1IEBB 1AR1C 3QDJA 4XCEA 2E9BA 1OTSD 5FYJL 1D6VH 2VDQL 3IDYB 1BMGA 2BK8A 2EIDA 1URLA 1H8NA 3KYKL 1BREA 2BP3A 4NYLA 1S9XB 3RNKB 2VR5A 4FABH 3HG1D 5DEFA 4FZEL 4QF1A 5T3XD 5JW5A 5KW9H 5C86A 5I6XB 5A16B 3WDHA 1F6FB 1H3WM 3SDAB 2HT2D 3C6LD 5J9PB 4P5MB 4PJAE 3A6CH 4P57B 1NMBH 4ZPTA 4OLWL 4F2MB 5EUKB 1DR9A 4LAQH 4RX4D 2O5XH 2VUYA 1EHXA 2VITB 2AS5M 3ROLA 2Y23A 3QEQB 4MQSB 4PR5A 3PWPA 3KYOB 1QZ1A 5EC2B 4R7DB 1P84J 4KI5E 4BSJA 3IDMA 5KG9B 3U7YL 1A7QL 4MNQB 4V2CB 4YHZL 4PJ9B 4ISVA 3DUUA 3GHEL 2DQTL 2NXYD 2P7TA 2VQTA 4JE4B 1RIUH 1OW0A 4K7PH 2F54A 5IW6A 4XMKH 2AGJL 1DQQB 4LCYB 5DD5H 4OZHF 4UAOB 3TN0C 3TT1H 3B6SA 3NZ8A 1OP5H 2CK0L 2VLKA 3UJJH 5D7IF 2HP4A 1GGYA 3QIUD 1QRND 1QUNA 3B5GA 5DJZB 1UCTA 3O9WC 4G8GD 4DVRH 5F3HB 3BDBA 5EIVA 5BZDB 1T22B 4WU5B 3C5ZB 2ZKHL 2CRIA 4XP1L 2YXMA 2Y07L 1VGEL 4XNUL 4P5TA 5IQ7L 1IC4H 2BMKA 2X6MA 3HG1B 4LCCB 4YK4C 1Q9OA 1KEML 4GRWE 5C8JA 2G2RB 4XPBL 3C6LB 5T33H 1V5JA 3PHQB 3ARGA 2P8LB 4FNLL 3IDNB 4XP6L 4TVPL 2X1WL 1OVZA 1TZIA 3BPCA 3ULVH 2MSPA 4Z9KB 2F53B 1F00I 2XWBB 3EYOA 3D2UA 1IT9L 5IFJB 1S7UB 2AI0L 3QUMA 1AHWC 1BZ7A 1CGYA 3QCVL 2HVKB 4PJDE 5MEPA 1SY6L 2NXYB 4LSPL 5FKAB 2Q6WB 5KOMC 3OKOA 5MP6L 1OAQL 1H9VA 1QACA 5CGYD 3QUYC 4GG6B 4S10A 1IGIH 1FV1B 4OF7A 1DE4A 3TBSB 4OUOA 1I7TB 4MB5A 5IG7B 2OJZL 4K94L 3MRNA 5C0GB 2R29L 3FQRB 1N0LA 1AGBB 3QCTL 2PO6D 4UTBL 1ORSB 1T6WA 1FE8H 4UOW0 1QRNB 3O6FA 4I3SL 2D9QB 3FO0L 5TDOA 5E8DL 4G8GB 4Z8FH 5CP7B 4Q9QH 3QG6B 4ZSOB 2GCYB 1UM5H 1ZT4A 4HV8A 3G04A 1AQKL 2YWZA 4LOUD 4HUUB 3GIVA 4DOHE 4JKMA 3TZVD 1EVUA 5ERWB 3S96B 1A3RH 4Z77B 1J1PL 3V5KA 4ZS6D 3IU3A 3QQNA 3NN8B 4TQEL 4TVSa 4K8RD 5ICXB 5F7YC 5AEAA 1JZ3A 4FA8A 1ZKAA 4NJAL 5AYUL 1E6JL 2RR3A 4CDHA 4EDWL 1A3LH 5IGXL 4QRPE 4X99B 5DHXB 3P2TA 3SDXE 3SKJL 4KJWD 2C1OB 1CQYA 2P24B 1FIGH 1ND0B 1FZJB 4TULL 4I48A 5D1XA 4JRXA 2J1KA 1U92B 3WLBB 2AJYL 4MAYA 1NFDF 1HXMA 1TPXC 1HIMH 1H0DB 2AXFB 1AJ7H 3CX2A 4NC1E 3T3ME 1KN2L 1HI6B 3BPNC 2P5WE 4NC0B 4X6FB 3TJHD 2FGWH 1F3JB 3QIWD 3DX9B 3L3HB 4NM4L 1SBSH 1B90A 3D69B 3IRPX 1FSKB 2VXQH 1JNNH 4JY4B 2GEEA 1AGDA 4CMMA 1J87A 3MJ9A 3RVTC 5E1HB 4BK5A 1U8JB 1A5FH 4PJCE 2PO6B 3LOWA 4L1DA 1TJIL 3PDDA 2AKRB 3HE7D 3KPLB 4GT7A 3QB7C 4Q6IB 2AQ2A 4HF5L 4NIKB 3DSFH 1EX0A 1GGCL 3MLRH 1LO0L 3DNKA 2NY0C 4MA1C 5GS3A 3MBEC 3TZVB 2OTWA 1MQKH 3WXWL 4PY7A 4R26L 1JZ7A 2OQJB 3DJ9A 3SJVE 4PY8I 3C5SA 3T0VA 1IM9B 4U1GC 4JFFE 1MHPL 5DJAA 3R1GH 4X6CF 3OB0H 1FZKA 4K94C 1EMTL 1WFNA 1U8HB 4HKZB 4CW1A 2CKBA 1OGAD 2YUWA 4OLXH 2R0ZH 5SWSD 3T8XB 5CJ5A 3D48R 3LKQA 4U1SB 5BJTB 5K9JH 4KVCH 2BOCA 2XZAH 2GJJA 3PGDA 1D5BB 3V52H 4HQQL 3LHPH 2RBLA 3FQWB 5GSVB 5GS0L 3WN5A 4HIEA 2B39A 4KMTL 5DC9B 4RBPH 4Q9BA 3DIFB 4GRMB 3TESA 3IFPB 5IM7A 4DK6A 3OKMB 1GIGL 1TJGH 4BZYA 3C5JB 1FNSH 2X2YA 3FFCD 3QIWB 3BYTA 4APQC 2V7NA 1NMCC 2P5ED 4UV7H 2FD6H 3HA0A 3WCYA 4WTXA 3TBTB 5DQDH 5KZCB 5EFIB 2BVPA 3LKOB 3PXHA 3VXNB 5EU6D 2GUOB 5E5MB 1A14H 4LCWD 5DA0B 1EGJA 1KTDA 1HQ4A 1L9NA 1U8IA 1CFNB 1W72L 1JCKA 3HE7B 1MFAL 1SYVA 1JF5A 1U9KA 3VA6A 2HAZA 1J8KA 1CE6A 1GAFH 5KBNC 1KT2B 2CLVB 5IHUH 5IMOB 5T3ZL 4ODHH 5D6DC 1MLBA 3IFOB 1QD0A 4Z0XB 5BQ7A 3RBSA 1LD9A 1RJYB 4EKXA 2XZQH 2CRZA 5CGTA 2XXMB 3BPOB 4QWWD 3ZDXE 2J8UA 3MCLL 1MWAH 4O2EA 3X11A 1K8DA 5LXGH 3BFOA 4PLJC 2O5ZH 1K2DA 4W68A 3GM8A 4MXVE 1OGAB 5B8CB 5SWSB 5K9OA 2ORBL 5AZEH 1H3VA 4QRQA 5J12C 3CFDB 4CU6A 3L3JB 4RGOL 1J1OH 3RWGA 5J0BA 4YZFF 4KKNA 1N6QL 4JKPL 3TYGL 4E5XB 1OY3B 2BRRL 3WO4B 1FVDA 1G7HB 4MA7H 5DMGD 2R23A 1BD2A 3FFCB 3L6FB 4U6VL 4JFDE 4Y1AD 4F7TA 5B3NA 2P5EB 4NQTA 1FPTL 1FLTX 3RWFA 4HEPG 1V3LA 4N5EC 5I18H 5EU6B 4KZDL 3FB6B 4LCWB 1BF8A 4PJ8A 1MFBL 3HNVH 4NZTL 3LB6D 2D4FA 3BQUD 5GS0C 2VXVH 4JHWH 3EJZD 4PJ7E 1FHGA 1MIEH 2Q20A 4GRWH 4WCYL 3S88H 3TV3L 3HAEG 5I1LA 4KGJA 1NGXB 5MEOA 4XHJC 5GJTH 4HX1A 1B6DA 1GHFH 2XPGA 4HBCH 1HEZA 1ZTXH 2WV3A 4PRIE 1RZGA 3VH8B 2HTLC 4V2BA 4QHNB 1S78C 4NDMA 1MJUL 2R69H 1HILB 2P44B 2BDNH 4WU7B 4RDQF 4KPHH 3SKUD 5TGBB 5BW7A 1NAKH 3QDHA 3OR7A 5HY9B 1HYSC 3N1GC 2XWTA 2HWZL 2NXZC 5EIQA 2QR0B 1XF2A 1R3IL 4WEBH 3VFGH 2EYRA 2UV3A 2R1XA 1FO0H 1NEZB 3U4EB 3RX7A 3ALWA 3F7VA 1EJOL 5EC1A 3BPLC 4Y1AB 5ITBL 5JHDD 4MXWH 3KLHD 2AJSL 2Q7YA 1MIMH 1WAAF 4JDTL 1C8PA 4GXUN 4ACPA 2X4SA 3L7FB 3X13A 4BQ6A 3H0TB 3DROB 2OXGA 2VC2H 2CRYA 1ZLUK 2VQ1B 5K59E 2OXHA 4MWFB 4K3EL 4NRXB 5H37G 3RVVC 3TO4D 1FAIL 3MOBH 3SQBA 3B9VA 3BQUB 2IBBA 1M7IA 3VWKA 2MHAA 5D5MB 3GB7A 4D0CA 3GSNA 4KUCF 1QLEH 4N0FA 4K3DL 5CINH 1T83C 3UBXB 3BVNA 3UPAA 1P2CB 3BXNA 5DS8B 5IHZA 4IOFC 5EU7E 2OP4L 5D72L 3EO1A 1EDQA 4WFFD 2BNUB 4A6YL 5ID0B 2NNAB 2V9TA 5HTSA 1UGNA 5CSBA 1RZKL 5C07A 1G7PB 2NW3B 3ZHKA 4OLYL 5GHWL 3GSWA 4Z95L 2GITB 3RKPA 3P11L 3B9KD 3BE1H 2C3XA 1RZFL 5I1EL 3KPSB 4PPTA 1Z6JT 1MAJA 1FP5A 2DLGA 4XMPL 3WNPA 3J8F7 3P77A 3RWJB 2Y36L 5KS9E 1MCOH 4XPGL 3MV9A 3S34L 4OM0H 3S37L 3VXTB 1Q9LB 3O2DH 3RY4A 3TBWB 2VYRE 3EYFB 2Y06H 4BFBD 4JPKH 3T1FB 3TYFA 4OCLC 5HPOA 2XACC 4PV9A 3TVMA 4LSUL 3VFPA 4JHAH 4OCWL 1PYWB 2R0LL 5EBGA 5FEBA 2I07A 1BFVH 2XA8H 4Q2ZA 3EW3B 4JANB 4WNQA 2CJUH 5HHXH 4ODXA 5IVXE 1QYGH 3PE9A 1QO3B 4O58H 3TO4B 5IV2A 1R3HA 4FFWC 4F57L 2VTFA 3KLDA 4GMTH 3RGVD 4LP4A 1NGPH 5L6YL 4G8FA 1P6AB 3EJYD 5ADPH 1YJDL 4QRRA 5ABDE 2XXCB 1MI5D 4M3KB 2DM2A 3UO1H 3C09C 3QT2A 4P5KB 1NDGA 1I1FA 2IADA 2W91A 4XWGL 1U8MB 4LFHG 3S6CA 1ZA6B 1N5YH 4KRNA 5HGDA 1MHEA 3HZYA 5MEQA 2BY3A