1IC5L

Crystal structure of hyhel-10 fv mutant(hd99a)-hen lysozyme complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/hydrolase
molecule keywords LYSOZYME BINDING IG KAPPA CHAIN
publication title Structural evidence for entropic contribution of salt bridge formation to a protein antigen-antibody interaction: the case of hen lysozyme-HyHEL-10 Fv complex.
pubmed doi rcsb
source organism Mus musculus
total genus 23
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2001-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ic5L00
2ID5A 3S35X 2F5AH 1FL3A 5J1AA 4HQQL 2PXYC 3SE9H 2CJUH 3K46A 4OBSA 3NCMA 3KS0H 1I1YB 3BT2L 4IS6A 4OJFL 1F58L 3LN4B 4PJIE 4K7PY 4C55A 1S8DA 4OGYL 1NGWB 5IBLC 3TYFA 4KJPD 4P4RA 2V9QA 2Q3AA 3BISA 1IGYA 1HYSD 5TE6H 1A3RL 3PXHA 4MCYA 3WN5B 1W72B 4W4OC 2E7CA 3CSBA 2B1HL 4P5TC 4OCRL 4UQ2A 4GW5B 5I1HH 4L3ED 2C1PA 3VFOA 3VD9A 4OLYL 4NQED 3OPZL 2R1YA 4P3WA 2VLRA 5KJRH 5E2TH 1H5BA 4NT6B 3HHRB 4NQDB 1WFNA 1RV6X 4PJ7E 4HIIB 4LRIC 3RVUD 4GXUN 3T4YA 3LKOA 5J6GA 4XCYB 1BX2B 3DX8B 1N0XH 3I02A 3BXNA 4S1RH 4M5ZH 2RFXB 3G6DH 5KVEL 5DD6A 3GRWA 2HRLA 3VH8G 3GMRB 4EKXA 1DQDH 2X70A 3HC3L 3HB3D 4DOHB 4PRPA 3MRCB 2ICWJ 5BOZG 4MJ2A 1JN6A 4JANB 2PYFB 5CGYC 5TDOA 3EYSL 5JQHC 2A6KA 3MNWA 3X3GL 2V9TA 1JGEB 5FA4A 1YEDB 2F9BT 4IDLA 1ZTXH 3VFVB 3EGSA 1JHLL 2D4FA 4JFEA 4NP4L 4XH2A 1E28B 1VADB 3VW3L 3IJSB 5GJSL 3VFMA 1MNUL 3F6IA 2R1WA 4YHML 4F33A 3B9AA 1ZA6A 1JPTL 3UTPD 5JUEH 4LOUC 1TQBC 5MEPA 2O5YL 1N3NA 3U46B 2ENSA 3ILQC 3ARUA 3B3IB 1QRNA 3HUJA 2ZOKA 4NO0B 2GITB 3NPSB 4Y1AB 5IBTH 1IZKA 4HXAL 2ESVD 3BP6A 1LP9F 4NRZB 4BQ8A 1MWAA 2DOCA 3UAJD 4TNWK 4IOFD 4F57L 4NQDE 4QOKA 1TJGH 4NRYB 1JPSH 4XNYH 3TVMA 3BVNA 4PG2C 1U8IA 3IJYA 5CSZB 1KJ2H 1I85C 1M7IA 2XFXA 4YDIH 1D9KD 3H0TB 4JQIH 3RWGA 1MAKA 4DOHE 2IMNA 2W0FB 4TQEL 1KJ3L 4NC1C 1WAAE 3MRKA 3SOBH 4XCEB 2X1QA 2CD0A 3ROLA 4IRSA 4JPIB 4ACPA 3FFCA 4OT1L 2NNAA 3S3SA 4JM2D 4OCMC 2NXYC 3QFJA 3H8NA 4H8WH 4R7NB 4UOJA 4KK9D 1HYSC 1KG0A 1OB1B 1Q94A 5CCKH 4OCYH 5TQ0L 3JWOC 3FT3A 3WKNA 4B0MM 2BNQA 1FIGH 5M95B 3RZCB 4ERSH 2OI9B 1QFOA 3MJ7A 5I19L 3B83A 4FQCH 4UDTA 5EBLA 5EOCJ 1OSZB 4HGKC 3VD4A 4X80L 2V7HA 3C6LB 1FZJB 2BFVH 3BI9X 5DEZA 3KLSA 3X14A 5JPNB 4G80A 3SGKC 2EDTA 1OAZL 3RVUC 5C1MB 5E5MB 4OZGF 5EZOH 3K2UL 3F7YA 2OP4L 15C8H 1J7VR 1F2QA 1F8TL 4U1JA 3O4OC 5C8JA 1BOGB 1RJZB 3HB3C 4XVSH 3TBTB 4LBEB 3HS0B 1XH3B 1DN2A 3C08H 1T22A 1ZV5A 1I9EA 2VLJB 3UTTE 3K4ZA 3MODL 4JO3L 2DLTA 1TZHA 2IPKB 4OZ4B 3MRDA 4HBCH 4PJBA 1YNLH 2ITDB 2BY0A 5J1SC 5EIVA 4WFFE 1RZ7L 4QXUH 5GQBA 5T3ZE 1P7KA 3HPJB 3T4AB 2OR7A 2IQ9H 5BVJB 4HK0A 5IBUB 5E2WH 1EUTA 3MV7A 1FPTH 4XWOD 5JW3H 5CILL 3WS6C 3RIAK 2CH8A 1BD2D 3QAZC 5DGQA 4K8RC 4H1LH 3WIHA 2DLEA 5IGXH 4XC3L 1BIIB 3UAJC 3MLZL 4IOFC 5GS3A 1ZT4A 3M8OH 1NMAH 5E94A 2ZOLA 4P2RB 2VN7A 1F42A 1NFDA 4I9WE 1JBJA 4IM8A 3VA2C 1MIMH 3KPRA 1UACH 2LU3A 1D9KC 4NN7B 1UWXK 3KPOA 2R2BB 2L7UA 3WJJC 4M3KB 4KHXH 3S96B 4M6OL 2CMRH 3C5ZB 1MHCA 1NLBH 2VLJE 2C3HA 5CKGA 2A6DB 1YQVL 2ICWB 5DMGC 5DJXA 5IROC 1Q9OB 4EQ3A 2ADFL 2DQEH 3JZ7A 3OKKB 4JDTH 4KK9C 4KGLA 5GGQL 4BSWA 1T04A 1WUNT 3BO8B 3CZFB 4FABL 3FJTA 1A7OL 3MGTA 1ES0B 4YDVA 4FFZH 4O2FA 5HHPA 4RGNB 1DUYB 3LH2H 1YDPA 3I6GB 3LRSA 1FFOB 2VWEC 4JFZH 4YO0B 2PXYB 4D9QD 2NW2A 2FIKB 1RIVH 1RZ8B 1NEZA 5IMMA 2P49B 5FYJL 4JO4H 1PKQA 1V3LA 3IDIB 4ZO9A 4U1IB 2RR3A 4D3CL 1CLYL 5KN5A 4PR5A 5DI8A 3GJEB 1LP9B 5I17A 1KN2H 1X9QA 1GOFA 4WV1C 4CVZA 3HTLX 1R5IB 1VCAA 3WIIL 4CN4A 2NY3D 25C8L 4C83A 1X5IA 1TENA 3FQWB 4G8FB 3H42L 4GW1A 4P5TB 5K9OB 2XWBB 2E27L 2QR0B 5EOCL 5I1IH 5J9PA 2IPTH 4HS8H 1RI8A 1OWWA 1DANT 4JQXC 1L0QA 1BLNA 1G7JB 3EYOB 4K7FA 1KCSH 4XWOC 2JJSC 3WDHA 3DOSA 4MNHB 1UWGL 3KPNA 3JV0A 3QWOB 4RSVA 1FO0H 4YXHH 1IAOB 4X5XA 2DD8H 3T3PF 5D6CB 4IJ3C 4RGNE 4ZTPH 2CQVA 3IDYC 3MRRA 5JW4M 5GZND 4JM2F 1KBGL 2P1YA 2QQLL 1QPXA 1LK3L 1KLUA 4Q6IC 4PGDB 4H20L 3DV4A 3FB5A 1CTNA 3GI8L 7FABL 3U82B 5I1KH 5IVXB 5LGHH 2FHBA 2EDLA 4ODVL 4KDWA 1JNNL 3GIVA 1KPUB 4MJ5B 3BWAA 2EYRA 1S9XA 2EDBA 1TQBB 3GSWA 2DLIA 4M1GL 1AGCA 1B9ZA 5KVDL 4J3VA 1V3MA 2CLZB 5F7UA 4U6VH 1S7WA 4JZOA 4PRAA 5KAQG 1K4DA 4KROD 3N0PB 5BV7H 1PD6A 1D5ZA 1YEHH 3JBG7 5FK9B 5B21A 3V2AR 3LCYA 3AU1B 5IVNA 4Z7VE 2X1OA 1SYVB 5D5MB 5T1LB 4MJIA 4WWKA 4QNPF 2XYCA 4RAUB 1XGTA 4NBZB 1EGJL 2BHUA 4KDTC 4J1UA 3JWOL 8FABA 3HE7A 3OXRB 1FZOB 3KLAB 5DURD 1CQKA 4ZG1A 4CL7A 2F8XC 3JWDH 3VFRA 3H7LA 1KNOB 5A2KH 1AD0A 4LCYA 4QHMA 5K9KB 4TUKL 5EN2A 5IVXE 4JVWA 3P11H 4PTTA 4P5KA 2QQQA 1FHGA 2NZ9D 1FSKB 2EIDA 1R3HA 1E4WL 2ATPA 1S5HB 2NXYB 3GSXA 5E8OB 2ADJB 4H5SB 4OI9A 4PB0H 4GSDL 1NL0L 2FH6A 5F3HA 3TM6A 1ZWIB 2NY3C 4OSUL 5GRUL 3GM8A 5H8DA 3ZTNL 1HH6B 1E6OH 3EO0B 2B39A 4IRZH 1NCBH 5DXWA 2R8SL 1JGDB 3HNSH 4NQEB 1FFQA 2DIAA 1XF2A 2OL3A 4E41B 4YQXL 2IALA 3AY4C 1IL1B 4BFBD 2ICWI 5D5ME 3G5XA 3GBNL 3NFSH 2OBGA 5JTWA 1CGSH 5TF1H 4DK6A 4X6EA 3O4OB 4NNYB 1AC6A 2BC4B 3QXAB 4NM4H 3REWA 4C58B 1TFHA 5GZNC 4JFXA 5D71L 3BUTA 1I75A 2XG4A 4J8RA 2DJSA 1KT2B 4K8RL 1KB5B 5KZCB 3STLB 4TSBH 3CFEB 5EZIL 5AYUH 5I16B 1A8JH 4N9GB 3VFSA 2FJFB 3U0TB 2DQGL 1MQKL 4N1EA 3U36B 4I3SH 5FUCE 5ADPH 2AK1L 2C1OA 4PGBB 5INDB 4JDVB 3QCTH 4FN0A 1AR2A 2I9TA 3GEWB 1MFCL 4GQPH 3OX8A 3DVFA 4FQLL 3DX7B 2NX5E 3SCMA 4UT7H 2YPKB 3NH7L 4NKMA 4KVCL 2H26B 2WW8A 3T08A 3MRPB 2AAVA 2FSEA 1IBGH 2P24A 4XP6L 2VKWA 4KROC 4M62L 2XA8L 1G7MB 1RZFH 4TUOB 4NKQB 4ZPTA 3QAZB 5BMFH 1SHMA 2P5EB 4MCZA 5CBAB 4RDQG 3A0OA 1W72H 3PQYE 4NQEE 3W0WA 3ULUD 1KGCE 4E41E 5C2BL 4M03A 2AVGA 1C12A 2I9LB 1Y18A 4G9FE 3SDXF 5BCAA 1VKXA 4HQQH 4PJCA 5GJTL 4F9PA 3UXFA 2NMSA 2P8MA 4PRHA 2KQNA 3EBAA 5DFTA 3RUGE 3O3AB 1D9KB 3K80A 4J3TA 2Q8BL 4OJFH 4PRBA 1CGTA 1T89C 3QYCA 4LHUG 4OGYH 1VFMA 4OGXL 4PJ5A 3WSQL 1CDGA 3E6HB 1XGRB 2ZKHL 3V95A 3SKOA 1G6RL 1RIHL 4BQ6A 1UCTA 3MA9L 1HHHA 1QR4A 5C08D 4NQUA 5DZNA 2VOTA 4OCRH 3IS0X 3UTPE 4MNGE 4ZS7L 4G5ZL 5H94B 4N5ED 4G6FB 4OLYH 2YWZA 5TDPA 3OPZH 5KVGL 3VXUD 1U3ZA 2GTWA 5FKPA 3CIQA 5E8NB 5I1AA 4MHHG 4BH8B 4Z76B 5C0FA 2EDJA 2FNBA 4QCIA 4RMSA 2P5EE 2AV7A 4PG9B 2FHFA 3DETD 1G6RB 3HC3H 2EC8A 1F4XL 1ONQA 2VE6B 2ZZUT 5JMRA 4WW1A 3OB0H 5F1IB 2R23A 3EYSH 4Z7UE 3LY6A 1CXHA 3X3GH 3GJFB 4NP4H 1JHLH 3GDBA 1W0WB 3DECA 4M48L 1ND0A 4K23L 4WV1B 1A1MB 5GJSH 3C60A 4YGAB 5DGRA 4NKIL 5LAXB 4YHMH 2WIMA 1C1EL 1WFOA 3HAEG 1JPGB 2OLDA 3OAZH 2IH1B 1JPTH 4KTEH 4MQSB 4RZCB 5BXFA 5DQJB 2V5YA 4OF7A 4YFEA 1NAKL 3MCKB 3WNNA 2BY3A 2AK4A 4OIIL 4PP1C 1YPZF 3M1BB 5KS9F 4HXAH 3SQOL 1O0VA 3SY0B 4XNZC 4KI5D 1BD2B 5EC2A 5BZDB 5SV3A 3SBWA 5B3JE 4LLYA 3QUML 5D7LB 4F57H 4IJ3B 1LO0L 3M07A 2AEWA 3T1WA 4J3WA 3ULUC 1CDJA 2I26N 2VWEE 1ZHBA 5I8EA 4WI7A 4L1DA 4CN1A 5IM7A 1NCCL 3S35H 4TQEH 1KJ3H 5BS0D 1CBVH 1ZAGA 1DBBL 4PYGA 1EBPA 1CD1B 3IDMA 4PD4K 1B88A 1A6WL 1FG2B 4OT1H 1EX0A 4KJWD 2VDML 1ZS8B 1NC2B 3EOYG 1NBQA 4QNPE 1NMCC 2ICEB 1BECA 1EERB 2DTSA 5TQ0H 4HDIA 4BFIA 5KTEL 1I7ZB 5DJYB 5FOBA 3L9RA 3UC0L 4NNXB 5ANMB 4IOIB 4N5EC 4I4WB 4LGPB 4X80H 1JV5B 5I8CA 1FFNB 1RZJC 1OAZH 1AD9A 5KSAB 1QBAA 1KXQE 1T5XA 3K2UH 4G42A 4HEPG 2OP4H 5D7LE 5GGUA 3LKRA 5DD5H 3DO7A 3CFDB 4ONGL 4H26B 5E1AB 3DETC 5L2KD 2Y72A 1AIFA 3DROB 3LV3B 4JPVH 4W70A 2N56A 1YEKL 4ODUB 1DQJB 1DLFH 2XG5A 1C5BL 4FXGB 4U1LB 3H9SA 1VEMA 5IVZA 5IEHB 2UWEA 3MODH 4JO3H 4Y19D 2WINB 1RZ7H 5HGHA 2R2EA 3SDXB 2UUDH 3ULUF 2NY3B 4YX2H 1BFOB 3GB7B 3UPCA 5CILH 2DM7A 5BRZA 3QFDB 1MI5A 5J4MA 2WQRA 1NGXB 4V2CB 5AUMB 4KZDL 2ZCKL 3HMXA 1S7TA 5ANME 1L9NA 3L3IB 1AGEB 4ZYKA 1K2DA 4P57B 3D85D 2QKIA 1DQLL 2EEAA 3MLZH 1KTDB 1I4FA 1QFWH 1X5GA 1QO3A 4MYWB 4IRJD 3W2DL 4NKDB 2H1PH 3HC4L 2FYYB 4AH2B 2EC9T 1JGUL 4WDIA 1OTSD 3GMOA 3HPLB 1QBML 1VGKA 3EAKA 4MMXC 4M6OH 4P2QA 4NUGL 4LDLB 3GSNB 4OZHA 4I5BB 3F7RA 3AAZB 4UV4L 2IH3A 3EIFA 1OVZA 5C6PB 2O93L 4KJWC 1KPVB 2LV4A 2ADFH 1TDQA 5GGQH 2X4UA 3HRZA 1HQ4B 2MQ3A 1NAML 4RX4A 4FABH 1OD9A 3DSFL 1QG3A 3VFPA 4KROB 3DUSB 3TWCL 1XF4A 5HGDB 1N8ZB 4WVRA 3HR5B 2CSPA 5JLZA 2EH8L 1NC4D 3Q6GL 5JHDA 5JDSB 1RJYA 1W0VA 3O6ML 4L5FL 1YQ2A 3L3GA 5DUML 5GRVL 1FNSH 2ZUVA 1U8KA 2BVPB 4UQ3A 3J7HA 2UZIL 4Y5XC 5TGBA 5J56B 4OFDA 1JI2A 2FJGB 4D3CH 4I48B 3S4SB 1CLYH 1RUML 2A83B 4O4YL 2V5MA 1NAMB 2WP3O 1MJ8H 1MCJA 3I50L 1T0MB 3X12A 3PV6A 3CMOL 3VDBA 4KI5F 2IANB 3WIIH 2WUBL 25C8H 5DRNA 2R56L 3D0LA 3O2WL 5SWZA 4J4PD 5EOCH 1OT2A 2HJKA 3DI2B 3DVGA 4QT5A 4HS6B 4XPGL 1OGAD 4MA3A 1WCBB 4WNQB 1UWGH 4X6DF 3UTQB 3P40A 3U0WL 1T1ZA 4OM1L 5F7NC 3QO1A 1I8KB 1EFXA 4ISVA 3ZYOA 5KVMC 1KBGH 3GM0A 1GYAA 2QQLH 4KMTH 5SX5K 1LK3H 5F7HA 4S1SL 1UWEL 1R24A 4H20H 3MXVL 1R5VB 4IRJC 2FX7L 2QBWA 5JOEA 3GI8H 4ONFL 7FABH 2CKNA 1ZHKA 1D6VL 1OTSC 4JAMA 5C0EB 4UIMB 3W11D 1JNNH 1TZIB 3ULUL 1UEMA 3MUJA 2BXZA 4X7FC 1DQQA 1SBBA 2PTTA 3TIEB 4ZO6A 2IANE 4M1GH 5KVDH 1ODAA 1FGVL 3DRQB 1IGJA 3I3DA 3L3KB 3MRGB 4XBEL 3RVTD 1OSPL 5EC1A 1FJ1A 1J05B 3WEXB 1F00I 4XNZB 1C5DA 3O81A 4RFEA 3U4EB 4LLDA 4RAHA 4HAFA 1I7RB 4EZMA 1EGJH 4R3SB 3JWOH 1T6VN 4KH2A 2PTUA 1B4RA 3RVWD 1I8LA 1ADQL 2FWOA 3QIUC 2VLMD 4JHZA 3MRMB 5DMIL 1AHWC 4N8CH 2I25N 4BKLA 3TPKA 1RZJL 4MAYD 4PS4H 3RJDA 3D69A 1G7HA 3V0WL 2X10A 1E4WH 2Z35B 5CHNB 3U7WL 4GAYB 1NMCB 1J8HB 1IC1A 4OZIF 1KEGL 4GSDH 2WP3T 3AS3A 4OSUH 5GRUH 1JRHL 1DCLA 1U92A 2V9RA 5C08B 1MLBB 3M17B 3ZTNH 3QUXD 4C56E 1KB5H 2VSCA 5F7DB 4X7SH 4U0RC 3VXNA 3VXPA 4J4PC 2R8SH 1JIBA 3O3UN 1XZ0A 5JHLL 3KPMA 3VXTB 3FOMB 1JNJA 5I1LB 4YQXH 1BQHA 4JY6B 5HBBA 4X8JB 3L6FB 2C4XA 2G75A 5ESVB 3G5VA 5DRZB 3GBNH 3R4DA 3T8XA 1A7BA 4MNQB 4LQ1A 1OP5H 4NQCD 4HBQA 3Q5YA 5DRWB 4KDVA 3MV9D 5D71H 4IMLA 1TVHA 3ZLQC 2DJ4A 3IDNB 4K8RH 1Y6MR 3VFWB 2BVUA 5ESAA 1Q0XL 3MOAL 2A2QT 5C86A 4XAWL 1CGVA 1PX4A 4Z77B 1D5IH 2DQGH 1MQKH 4LKXB 1G7LB 1XFPA 3W11C 4FZEL 4X83A 1ZHLA 2AK1H 1LD9A 5I66A 4HS3B 4X5WB 1MFCH 3ARFD 1VFAB 4FQLH 4HV8B 1J8HE 2XZCL 3NH7H 4HG4K 1QBLL 3MA7A 5E8PA 5ITBL 4HWZB 2YOCA 5C08E 2H2PC 5E8EB 5J12C 3TESA 3RVTC 3TFKD 2E7LA 2AS5M 4M62H 2XA8H 2VZUA 4POYA 3MJ8B 4R26L 4YZFF 2FHCA 3KHOA 3QXTA 5TE7L 1HKLL 5CEYB 5C2BH 4R4ND 4WI2A 1UH4A 5DHVB 5DVKA 4AENA 3QEHA 5C07A 2CO7B 5IESL 4MNQE 5GJTH 1GZPA 5DZLA 4HMDA 3RVWC 1CFSB 4PJHF 2PN5A 1HHKA 2Q8BH 5BS0B 1GXEA 4WFEE 5IK3A 3OHXA 2FL5A 1LO3L 3AMKA 2C5DC 4HCRA 5FCSH 3WSQH 1ORSB 3IXTB 3TN0D 2X44D 3EJYC 4MD5A 2Q86A 2ZKHH 2LTQC 1G6RH 1RIHH 3DX9A 3OR6A 5F1KC 4XBGA 3MA9H 4P3DA 3MGOB 3QQNA 3MUY1 5D2NE 5E08L 4PLJD 3RVXD 4PY7A 5A2LH 3CFBB 2X4TA 4TTDD 1R3KA 4NFBA 3GJFH 3PGCB 4GH7B 5K9JL 4JVPA 5ACLA 4G5ZH 5I1JL 3N1MC 3QUXC 3OKNA 3WUWG 4ZXBD 3TO4D 3V6OA 5A1AA 3G6JB 1B0RA 2OZ4L 4NDMB 2OTWB 4XC1L 3F65A 2IAMD 3DXAD 2DQHL 2X89D 5DDHB 3LN5A 5DD3L 1JNHA 3SKJL 4ODXB 5IB1B 4J7RA 3TBSA 1CU4L 5H2BA 4P2OA 1F4XH 1F11B 1CFTA 3OV6A 4Y5XB 1WEJH 3FO9A 1G7PA 4EDXB 3IGAA 5L2KB 4CNIB 5CJQL 1CICA 4M48H 3FL7A 4K23H 1HSBB 1LNUB 1F6AB 4U05A 5BS0E 1CI5A 4NKIH 3LMJL 1C1EH 4JN2B 1U8JB 1M6OA 2OXGA 1G7IA 5H37G 4KK8D 3LEVL 5HSFA 4K94H 4AMKH 1RK0A 4Y19B 1QFUL 1NAKH 1ZVHA 3ZSTA 4M5YH 4XCFL 1I8IB 1SJXA 1WICA 3RFZC 3ARFC 2HT3D 1WVZA 3GGWB 1UVQA 4L29A 1PQZA 1BGXL 3SQOH 1SYSB 5HPOA 1GVIA 5T33L 1M1SA 2PO6D 3H9YA 2DWEA 3G6JE 1BZQK 3BHBA 4OQTL 3FQXB 4QY8A 3OWEA 2HVKA 3O2DA 1LO0H 3EZ8A 2CLVA 1FLRL 4ZFOB 1Q72L 1OWRM 3TA3B 4M61B 3EDDA 4POZC 4R4NC 4ZOEA 3O41A 2DMKA 5DC4B 4Z95L 1QSFE 1NCCH 1T1XA 4IRJB 4Y5YA 1UKSA 2B4CC 1DBBH 2VJXA 1I1AB 4AIOA 1WGOA 3QI9D 3SDCA 3NCJL 4U1HA 1WWAX 4YJZL 1P5UA 2ZG1A 2BXYA 2P42B 1HH9B 3MLRL 1F3JA 3EFFA 3VWKD 2VDMH 3Q3GB 4GRMB 3GMMB 3CX5J 3TN0C 4LSQL 1KJMA 2R1XA 1FO0A 1LDSA 4GXVH 1JRHI 3BEVB 3TZVA 4XPAL 1N6UA 1A21A 1JHTA 5KTEH 3EO1B 4PLJC 3RVXC 1DL7L 9CGTA 1NUGA 2Z91B 1R3IL 4TTDC 2HLFD 2HFEB 4TRPL 4PRIA 3UC0H 2VR5A 5EZLA 3WNPA 1P1ZB 1U8OA 2C3XA 3TO4C 4HK3J 3MFFA 4XRCA 1MHEB 4Z8FH 4O2EA 5CJOL 3GSQA 1IGIH 1J5OH 1NC4B 2IAMC 5EU4B 2IEPA 1JUFB 4JDZB 5ERWB 1P2CA 3MREB 4ONGH 2WZPD 3QIUB 3IVKB 1AHWB 1JWMB 3WYRA 5IMLA 4LIQL 4KVNL 4L9LA 3GSVB 2QQNH 1R3LA 3W9DA 1PAMA 1UXSA 1ZT7A 3BGAA 3TP4A 3BOVA 4NO3A 2GIYA 3OSKA 1YN7A 5DJDB 1HHGA 2Z8SA 3TPUB 2V2WB 1MIEL 3I6KA 4MX7B 4XPFL 1BEYH 4U0RB 3CSYB 4X0KA 2D9CA 5IP4A 5E70A 4JFYB 4PJHB 4M7LL 2XT1B 1FL5A 3D39A 4FMFA 5HJ3B 3NN8B 2HT3C 2I5YH 3GSNH 1OGAB 4KZDH 1MCOH 2E7MA 4HJJH 2CLRB 3IETA 3DUUA 1KTLB 3V8CA 1S9YA 3BEWA 1DQLH 5CEZE 1RFDH 4DQOL 3K1KC 2PO6C 1JGVL 3FB8B 3KYNB 3OQ3B 2Q7NA 1MOEA 2AV1A 5T1KA 3H9ZA 1H15B 3W2DH 3MV01 3VXSD 2YBRB 5E8DL 5HPMB 4JFPB 4JRXA 1JGUH 1Z5LB 2N7AA 3L3OB 5FCUL 1FIEA 2X41A 1QBMH 1P7HL 1MRFL 1PX3A 3MLXL 1QTYT 2HJFB 4NUGH 3SDAD 4UV4H 4FQPA 4X7CC 3MLUL 3QH3A 2HKFH 3VWKC 5IJVB 3BPNB 4HZAA 1TCRA 1OARL 1YUHB 2C4FU 3P73A 3U7YL 4XWGL 1SEBB 4P99A 5B38B 4UBDD 1NAMH 5J12B 5CKAA 3DSFH 4OBRA 5GGSB 3W9EB 1SJEA 2HLFC 3VI4F 3O3EB 4PY8J 3BFOA 5HTSA 3FKUS 2EH8H 3Q6GH 4LIQE 5FHBL 3ARZA 5IR1B 4RMUA 3TH4T 2Y07L 5DUMH 4CW1A 1JYXA 1TNMA 5DVLA 1A6VL 3JV6A 5B22A 3KPRD 3SE3A 3SN6N 1ORQA 3KPSD 3LN4A 2C7UA 2Y1VA 4YHIB 3BYTA 2NXZD 2DB8A 1HHIA 3I50H 1U0QA 3VXMD 4MXQD 5JPMA 2GSIA 2LTQB 3CMOH 3MROB 1IEBB 3VU2A 1MRCL 2WUBH 3AMLA 3U0PA 3MSPA 5FECA 3O2WH 5DHYB 4MVBD 1A3QA 1SJHB 2VQUA 5F97E 3VG0L 2IBZY 1D7FA 3EOAA 2DLFL 3MXWL 4XPGH 1N2RA 2Y5EA 4KJYA 4PTUA 4R90L 5C9JB 2VC2L 5HDBF 5E0QA 2Q3ZA 5I2IB 2WMPA 4M4PA 4NZJA 4OM1H 1ZLVK 4DZ8A 3UCRA 4FQHA 4U6XA 4MDJB 3RWIB 4EN3A 3CSGA 5DMYA 4PREA 4JANA 2BNUB 4S1SH 2VDNL 4LF3A 3MXVH 4HX1A 1KCVL 2FX7H 4M02A 4KTDL 4ONFH 3VFVA 1CE6B 3QP3A 5EWIL 1D6VH 4O5LL 3F12B 5D7SL 2D4DA 4PJ8D 4O51B 1HDMA 3S6CA 2AEQL 1UT9A 4HIEB 4EUPB 5KSBA 4ZUWA 3VH8B 1WT5A 2D31A 1QZ1A 1EAPB 2BSTB 3VMPA 2R0LL 4ZNEA 3SDAC 1OTTD 1CD0A 2APXA 4C57C 2B4CL 3ARFB 1OSPH 4G8GA 1X5KA 3BUYA 3PWPA 5K59E 1YMMB 4NO0A 1S7VA 4Y1AA 1BIHA 1OAUL 4UBDC 4DUWA 1Q1JL 3UBXA 5K33A 2FR4B 5SWQA 4H0GA 3MOQA 4JGMA 3C5JA 1JZ6A 5EU5A 3RWDA 3WIFB 4D0BB 2F53D 4E9LA 2EXWD 5HYJA 3RBSA 5IW6A 2RAMA 5AYQA 4J3XA 1I8MA 4FRWA 5EPMA 4QHUB 4FQIL 3GMPB 4Y4FD 3NVQA 3A67L 3QNXB 2BVOB 2W0LA 1ADQH 5SWSE 2W38A 4O02L 4Y88A 5DMIH 3MLTB 3OAYH 2VQ1B 4PJFF 2BRRL 4TNWF 4XCEA 1IGML 1RZJH 4J23A 1OM3H 5C0DA 4JPIA 1UZ6E 3V5KB 4I2XB 3I6LE 3V0WH 3T0DA 3IS1X 1CIUA 2NXZC 3U7WH 2VDLH 5JOFB 2PW1B 3TN0B 4MXQC 3CD4A 1KEGH 5A16A 4YBLC 1JRHH 4HFWB 3QO0B 1IGCH 3CPLB 3LAFA 4HFUH 4LMQE 3BWUC 4OLEA 4MVBC 4LHUD 5E9DD 4D9RE 4DW2H 3KJ4C 1CCZA 3ALXA 5JW5B 5HVHC 5JHLH 3S5LA 1U8LA 2AABL 3JWNC 4NCDA 1OSZA 1YMME 3FTGA 3KPPA 4WWKD 4YK4C 5F3BB 3C6LA 5DJ8B 1VPOH 4HLZH 4MJ6B 5C0BE 2W9DH 1CD8A 1EXUB 4I18A 4KRPD 1C7SA 2P8LB 1I3RB 1ZKAA 2UY6A 4OD3L 2X7LA 1S9VB 1S7RA 3F7VB 3FQRA 2IAMB 3DXAB 4WEBL 4X8XA 3HE7D 1FL3B 3GUTA 1II4E 5J1AB 5ISZA 1CS6A 1RJZA 4GBXD 1VEOA 2MCG1 1QSED 1D3CA 3MOAH 4IS6B 4LQFL 4XAWH 3QDGD 1AP2A 3QEQD 1S8DB 1VACA 5DHVH 4JPWH 3S37X 2ITDA 4U7SA 4JQVA 3TYFB 4PJ8C 3TCLB 4P4RB 3GRWL 2Y36L 4FZEH 3RWHA 1IGYB 3RKPA 3T4AA 3MBED 3UTZA 4MCYB 2MTPA 2XZCH 3MRQA 5KAQF 1KFAL 1QBLH 1WZKA 3OG6B 1OTTC 2BCKA 5ITBH 4UQ2B 1HZHL 5IHLB 2CXGA 2F8VA 5KANG 1LDPH 2C1PB 4I77L 3VFOB 5IV2A 1PGRB 3VI3E 1NJ9A 3DO3A 5JO5B 2E6JA 4IHOA 2R1YB 2VLRB 2OR8A 1H5BB 4EI6A 4N90D 3N9GL 3OKMA 4O00A 1HKLH 4JKWA 4OLZL 3DMMD 4ZFZA 1FYHB 3LKOB 5J6GB 2PO6B 1LQSR 3I02B 3BXNB 4OIAA 4AL8L 2YRLA 5DD6B 1LE9A 4GRLA 2EXWC 3RIAF 1S7SA 5IESH 2X70B 1QLEL 4PRPB 1FG9C 4UAOC 1JN6B 4HXBH 4Y4FC 5TDOB 1NUNB 2A6KB 3MNWB 4V1DA 5FA4B 3W39A 1UM4L 3UJJL 3EGSB 4JFEB 4XH2B 1LO3H 2PF6A 1PLGL 3G9AB 3VFMB 1NCNA 2YD4A 2R1WB 4F33B 1ZA6B 1XGPA 4S0SD 4LSPL 1FYTA 3Q5OA 3RIFK 3SCMD 2YD1A 5MEPB 2CUIA 2JIXD 1N3NB 1J0HA 4LVEA 1LO5B 2VAJA 5FV1L 5I1JH 2HRPL 3CDCA 3HUJB 4JVUA 2ZOKB 1QPPA 1QHOA 3MLSL 3L1OH 3BP6B 2OZ4H 3W0WD 1MWAB 1CVSC 1RHHA 3LZFL 2DQHH 2VLRE 4WWKC 5DD3H 1F4WL 2IMMA 2YUZA 3SKJH 5LVEA 4NCC2 1CU4H 3ARTA 3V4VL 2PYEE 35C8L 3HE7C 1YEGL 1U8IB 3IJYB 1WISA 4YBHA 1M7IB 2XFXB 2WLYA 3OXSA 3G9VA 3OKLA 4PRPE 2BSED 1KTKE 2NR6D 3PP3K 3OMZA 5CJQH 5FFLA 3GJEA 1X5JA 4TN9A 1B0GA 1LP9A 3MRKB 3MZGB 5HYEA 3ROLB 3LMJH 4WENB 3BN3B 3ZDXF 1A6ZB 4JFEE 1NGZA 3FFCB 1F4HA 4UINH 1J87A 2A74A 2NNAB 3FQWA 1HEZA 4X6FA 1ZLSL 4XCFH 2EDNA 3RL1A 4DUXA 1KG0B 1Q94B 2VLKA 3V0VA 4C4KO 1MAJA 3UYRL 4X6BA 1U3HD 2BNQB 3QEUA 3V5HA 4OD2A 1BGXH 3MMEA 3MJ7B 4FQJL 5T33H 4RDQF 1QRNE 3HUJE 4M7JH 4UDTB 5EBLB 2V7HB 5F93C 4OQTH 3X14B 1B3JA 5J6HA 4G80B 1FLRH 3GKZA 1Q72H 3DMMC 1HIML 3F7YB 4U1JB 4QOKE 5C8JB 4X5LA 3RNQA 5L8KB 2GJ6A 2X4SA 3O4LD 3V6ZA 1DEEA 3VXSB 1JYNA 3QG6A 3NCJH 5C6TH 1T22B 4XP9H 2XY2A 3WIHL 3CH1A 3MLRH 4R97C 4Q6YA 1TZHB 43CAA 1QEWA 3MRDB 4GJTB 4OZGA 4JO2L 4PJBB 4RGMC 1VA9A 1U91A 2XWTA 3FFCE 2RBLA 4ZAKA 1P7KB 4MSWB 3VJ6A 1MCIA 3IDXL 1Z9OA 4XPAH 3ZYIA 5IUSA 3QFJE 3BZEA 1LE5A 4PY8I 3SCMC 2R29L 3K0WA 3MV7B 3K8LA 4TRPH 1A4KA 2YZ1A 2V17L 4NYLA 4WTWA 2BNRD 2BNQE 4NN5B 3TV3L 4OFIA 2H9GA 1FLTX 1VESA 1SMAA 4FTVD 2ZCHH 2EYSB 4PG2A 2DQDL 1ZT4B 2ZG3A 4WU5A 5IHZA 1ZGLA 4NBXB 4XCNB 2ZOLB 4F9PC 3D18A 3QULA 1NFDB 4G7YL 4LIQH 4KVNH 3KPRB 5K9KA 3EKCA 3THML 3KPOB 2NR6C 3FN0L 3S3JA 3UDWC 5IEKB 2GSGA 2IGFL 3MO1A 1MHCB 1ROWA 2OSLA 4I8DA 4YBLB 3QDAA 1EGJA 1U42A 3PDDA 4PJBE 4XPFH 5HI4C 4ZSOA 5GSRA 5JR1L 1EDQA 2W0PA 2C3VA 4BSWB 1T04B 4M7LH 2Y06L 1JP5A 4X6CE 5HVHB 4GG6F 4L3EA 1NFIA 4XVTL 4LHJB 5CSGA 3MV7E 3MGTB 4YK4B 4X7TA 4BYHA 4YDVB 3PWUA 1U3HC 4O2FB 5HHPB 4QHLA 1MCPL 1B6UA 1YDPB 1OLZA 3LRSB 1A2YA 3UTSD 2AJYL 4IDJL 2NW2B 4YIQA 1NEZB 5E8DH 4RGOL 5IMMB 1PKQB 4KKAC 5FCUH 3FQNA 1P84K 3CFEA 5D7KE 1NLDL 3MCLL 3H9SD 2MQ0A 1NFDE 4PR5B 5C0CD 2EXYC 5DI8B 5DC0A 1MRFH 3MLXH 1WBZB 3KPRE 5I17B 43C9B 4ODSL 4CVZB 2GUOB 1A0QL 4S0TD 3T2NL 1MF2L 4MMZC 3MLUH 2NTSP 4WWID 4C83B 2AJSL 1INDH 5JIHA 4GW1B 1NSNL 1OARH 4M00A 5D4QA 3P4NB 1T66D 3WS6A 1X4ZA 4BUGA 3LB6D 2DYPA 5J9PB 4WUUE 4JKPL 1MI5D 1GJIA 3PIQA 1BLNB 5HYFA 2CRZA 4K7FB 3HC0A 5IG7A 2HT4C 1I9JL 3SDDD 2ESVA 3KPNB 1AC0A 5E6YA 1KIRB 2EE2A 2DQUL 1RPQA 5FHBH 3SBWC 3SQBA 1S5IL 1G6VK 4X5XB 5FB8A 4K3HA 4L4TD 2XTJE 4HKBA 4BZYA 2Y07H 3MRRB 4UAOB 4H88L 4Y4FB 1A6VH 1KLUB 2BY1A 5GS0D 2ENYA 4WI8A 2APVA 3DV4B 2NY7H 3FB5B 3N85H 4H25A 2NLJA 1I1RA 3E6HA 2LFGA 4AZ8A 1IJ9A 1FCCA 1RUPL 1MRCH 3BGMA 3GIVB 5ITFA 4MGXA 3T1FA 2EYRB 4JM2A 1S9XB 5FO9A 3GSWB 2ZPKL 4WGVB 1AGCB 3VG0H 1KYOK 4JB9H 2DLFH 1NUFA 1S7WB 2M2DA 3MXWH 1CDHA 2DI7A 4JZOB 4PRAB 5CLTA 5SX4I 1K4DB 1QP1A 2VC2H 4QHKJ 1D5ZB 3TT1H 3L7EA 5GRZA 4EUPH 4EOWL 4DGVL 4Z7NE 2CIIA 1DQTA 5E6IA 2ATKB 1OAXL 4MJIB 4WWKB 5JHDD 3KXFE 4LPXA 5BOPA 1XGTB 1G0DA 4PJ9D 4EDWL 4J1UB 1CQYA 5F7EL 5CZVL 3HE7B 2AI0L 3T09A 2Q7YA 2YKLL 2XOTA 1RK1B 3VFRB 4NBYB 5EWIH 2L7JA 1WWWX 1AD0B 4O5LH 5D7SH 4QHMB 1IQWL 4XMKL 4ZTOL 2AEQH 5LAXA 3ZT6A 1GZQA 5EN2B 4XVJL 5FA3B 4PTTB 3QEQB 1R3HB 4LAQL 2ATPB 5DQJA 3GSXB 2R0LH 4LLVA 2R0WL 3MRJA 1J86A 2P45B 2DKMA 1JFQL 1VDGA 2B4CH 5F3HB 5C7XH 2H45A 1KB9J 2CKBL 1MCDA 3BX7C 1T66C 5E2UL 4DFHA 4RCAA 2GT9A 3LB6C 2IBGA 5MHSD 1Q1JH 3X13A 1BD2A 1GGUA 1RU9L 4HMCA 1XF2B 2OL3B 1DANU 1IAIL 2ILLA 5F89A 4MJIE 4X7EC 4FQIH 2L0DA 4HGMA 2AXGA 4Q6IA 3MTRA 4OZFG 4O02H 4K7PL 3REWB 1CL7L 2RB8A 4JFXB 2QHRL 5GPRA 1RVFH 4J8RB 1IGMH 1KSRA 5GS0C 5L6YL 5F70A 4HWBL 4R97B 2BHZA 4WW2F 1FORL 3VFSB 2YEZA 3O3DA 3QJHA 2Y9RT 4RGMB 3WMSA 3QUMA 4L3CA 5J57B 5DJ0B 5CBEA 2C1OB 4U6YA 2I9TB 1JJUA 3OX8B 3ILPB 4OGAC 3QDMA 1YA5A 3SCMB 1I7ZA 4JFHD 1TQCC 4NKMB 5E7FA 4PV8A 2NY6D 3RZWA 2FSEB 1SQ2N 3T3MF 2P24B 3GBLA 2VXVH 4N9OB 4N8VA 4ZPTB 1ZGLM 4KDTA 4MCZB 4GKNA 5FYKD 4JO1H 1Q9LA 3W0WB 3WLBA 4WEBH 4LLWA 5IVOA 1C12B 2W59A 5FYKU 1Y18B 3U83A 2FEEL 4H26A 4PJ9C 1VKXB 2P47B 4PJCB 3OJDB 4B7IA 3LKQA 3WNKA 2P8MB 3FRPA 4PRHB 3MLVL 4MQXD 4LQFH 4PRBB 4U1LA 3VGDA 2OTPA 3KYMA 2IPUK 4YXKL 2ITCA 6FABH 3GRWH 3FMGL 2WK2A 2Y36H 2Q76A 3SKOB 3ULSA 2DWDB 3KPTA 3BAEL 3QCUL 4FQQA 4LK4A 2QHLA 1BFOA 4MAUL 1KFAH 1K6QH 2YZ8A 3NZHL 1HZHH 2BJML 3ZKND 3L3HA 3QFDA 4YHYC 5ILTH 4I77H 5C3LD 5D9SA 1HQRA 4ALAL 5I73C 2GTWB 3AY4A 5FKPB 3KG5A 5I1AB 4NJAL 1SVCP 4K3GA 3ZL4H 3CXHK 4OLZH 5C0FB 3TBVA 2PETA 4QCIB 3ZDZE 1WBXB 3MRBA 4AL8H 4TTGA 2AV7B 1F3RB 1MCFA 4JGUA 1QLEH 4NKDA 3QPQD 1ONQB 2DLHA 4AH2A 5AD0A 1NCAL 4WW1B 2R23B 5MERA 4PJCE 1QVOA 5IFHL 1UM4H 3HPLA 1MWAH 3NA9H 1IGTA 4PRHE 5GGRY 5TF0A 1JK8A 3NIDE 1ND0B 4PJ5E 1CZ8L 1GIGL 4LSPH 5BXFB 4GMTL 3ULVD 2HVJA 1H3GA 3WL9A 2ERJC 1L7TL 2AK4B 5B3NA 4F8QA 4HLJA 1H3PL 5CMAA 2HRPH 4ZPVA 3DUSA 4M7KL 1CXLA 3S97C 3MLSH 2NY6C 4XNMA 5HGDA 3MYJA 3SGEH 2R15A 3CAFA 3F5WA 3LZFH 4FQ1L 5EC2B 3WE6A 2ORBL 1F4WH 4WHYG 4LLYB 2G2RA 3IDJA 4LLQB 2EE9A 3LIZL 35C8H 3QQ4A 3BDYL 1ZHBB 4YDLC 5EU6E 5IM7B 4Z7QF 1YPZA 1I8LC 1OPGL 5KS9A 1T89A 2D0HA 4I0PD 3OJ2C 2J8HA 4EVNA 1YY8A 2QQKH 3IDMB 1INQA 2B7DT 4MQXC 4M9OA 3AXLA 4MQ7A 5IMOB 2KPNA 3HI1A 5I6XC 2EDFA 4P46D 2EO1A 2ZNWA 1ZLSH 4F37K 3S37H 4PLKD 5I75C 3IFNL 3GMNA 3UYRH 4HDIB 4BFIB 2WIIA 5SX4H 2J8OA 2AK4E 3QHZH 1IM3A 4YHOL 3FRPG 2AJZA 4PUBH 4KRMB 3RU8L 2Z0BA 1NGYA 4LCWD 2EDYA 5EORL 1IAII 3B4NA 5I8CB 1P53A 1AD9B 4P2OD 4HKJA 1HIMH 1T5XB 4G42B 5GGUB 2F19L 4U3CA 4D0DA 3DO7B 1JMZA 3T0EA 1YMHA 1CL7I 4LLMA 4WJ5A 1V3KA 1W8NA 2HFFB 3RY4A 1AIFB 5FM5O 2VZTA 1CICD 5EO1A 5I8OL 5C0EA 3WIHH 5AZEH 1S7UA 4UIMA 1CR9L 2R39A 3H9SB 3SEPA 4RFNB 5IVZB 2UWEB 1BZ7A 1FZMA 4JO2H 3QXDA 3ALWA 4OKDA 5HGHB 2R2EB 4PJAA 5F9OH 1DR9A 3IDXH 4A2LA 1LGVA 4P9ML 3C8KA 5GS0L 4CDGC 2R29H 1ZT1A 5DUBA 2V17H 4K2UL 5BRZB 2E9IA 1MI5B 2IPUG 5D7IF 1QFHA 2YWYA 5DJ6A 2E7LC 1S7TB 3Q0HA 2VITA 4GO6B 4R3SA 1J18A 4CDHA 4NGHH 4ZYKB 4LFHG 1K2DB 1JNLL 2QKIB 4PFEA 3K4AA 2FEEI 1I4FB 4AIXA 1QO3B 5IMKA 5L7XH 1CFBA 3U48A 5TH2A 4LSDA 4WDIB 4LGSB 4OF0A 3OJVC 3THMH 4EQ2A 1SM3L 4Z5RA 3IFPA 1VGKB 1GC1C 3DLQR 3MNVB 2IGFH 2X1WL 3O6KH 1EZVX 4OZHB 4JY4A 3H9SE 1E4JA 3UJTH 2UWEE 2IH3B 4O2CB 3GBMH 4NOBA 2ZCLL 5D1ZD 1LHZA 3BGFC 3DIFA 1LEKA 3SKNB 4Z7OF 4QHKI 2QLVB 5JR1H 4ZOCA 3HRZB 4MWFA 4PRID 1UB6A 2Y06H 4HUVA 4XVTH 3VXTA 3ARBD 4QXWA 3VXUA 4PJEA 2C26A 5BRZE 4JY6A 3V6OC 4NQSA 5JW4N 4X8JA 5J11C 3S7GA 1XF4B 2VMFA 2AP2A 1QA9A 1RUQL 1EEYA 2YPLD 3TNMA 4Z0BL 2OMBA 5JLZB 5JHDB 1A6TA 5HHMD 1RJYB 1W0VB 1OQOA 4PJ9B 4Q0XL 5DRWA 5JXED 3L3GB 4IDJH 1A22B 1V05A 4P2OC 4TVPD 5H35A 3ULVF 1U8KB 5DT1H 4UQ3B 5TGBB 1S7XA 3IDNA 2FATL 3IRPX 3OZ9L 3NGBB 3MCLH 4F2MA 1CICC 2BHYA 4ODSH 4H1LG 4TUJA 4Y4KD 3X12B 3T2NH 1G7LA 3PV6B 1MF2H 4HS3A 4P2QE 5DRNB 5E2VL 3FHAA 4YHLL 4XMLL 5DUPH 1YEFH 1AO7D 4OZHE 4I1NB 3T77A 1NSNH 3GZKA 3D0LB 5J13C 3QZWA 3TEUA 5FGCB 5SWZB 2N1KA 4OLVL 1S78D 1JMXA 1MEXL 4YHYB 4LCUA 3DVGB 5I0DA 5L88L 4JKPH 3D39D 1JWSB 3QB7C 4CU8A 2M1KA 4XTRD 4MA3B 2EIZA 5I73B 2Z8VC 4FQXA 1I9JH 3VFUA 5DQ9A 3VWJD 2DQUH 4G8EA 5DHVA 2QSTA 1S5IH 3SE4A 1DUZA 4Q7DA 5T1KD 3QO1B 1EFXB 4ISVB 4H88H 1P4LA 4HULB 1ACZA 3UX9B 4G6KL 1R24B 4GRWF 3ZE1F 1FVDA 1G7QA 4JFQA 4JJHA 4FP8L 3WFEL 4X6DA 4ZO7A 1ZHKB 5EDXA 4JAMB 4U6TA 2EC9U 5EOQL 5LKNA 4K9EC 1RUPH 2ZWLT 4KKBD 2D0FA 1MCRA 1MUJB 3MGOA 3VFGL 1DQQB 2PTTB 2ZPKH 3CFBA 4KMQA 4ENEC 3NABL 5T1DL 1IGJB 5D93C 1A7NL 3NAAH 2P4AB 5D2LF 5L9DL 5EC1B 5FGCE 4U33A 5SWZE 1FJ1B 5E99H 4EOWH 1C5DB 4OLWL 2X9YA 1ZLWK 4UIKL 3ARBC 4RFEB 4N8PA 4ONHB 3RTQA 5DDHA 4LLDB 3EDKA 3RVVD 1A1NA 4EDWH 1NUDA 3HN3A 5CZVH 1F11A 5F7EH 2NYYD 3RBGA 1SY6L 4WI9A 4YDLB 4IIQC 2FWOB 5L2KA 5JXEC 1WZ1L 4OLXL 4UTBH 3TIDA 1U95A 3EHBD 2OL3H 2JJWA 4FXLA 4BKLB 1IQWH 3W82A 4XX1G 4ZTOH 4HIXH 4L9LC 4JN2A 4XVJH 3MUGA 5I6XB 3D69B 1G7HB 5ESQA 1W8OA 2OYPA 3TCXA 1ZA3A 3QBTB 2R0WH 2H6PA 4LDOB 2BX5A 5I75B 2VB5A 2VTFA 1U92B 3V9FA 2DDQL 4U1NA 3BKML 3VXNB 3VXPB 2VXTL 2W65B 3E1F1 1S78C 4OFYA 1U9KA 3ZDYE 1XZ0B 1OQXA 2VXUL 3KPMB 4ZDHA 5F9WC 3BJ91 1RU9H 2NCMA 4XTRC 3GSRA 1BQHB 4K07A 4EIZC 2R9HD 2G75B 5IIEA 3C8HA 3G5VB 4OZIA 5HYSA 3T8XB 3VWJC 3D85A 2RCSL 4LLUA 4EN3D 2YSSA 3RP1A 2XKUA 1FV1A 1XF3B 3Q6FA 4HUMB 5FDYA 4OLUL 4K7PH 5CZXD 1AY1L 3K3QA 4OV5A 4IRJA 3G6AA 4IMLB 2VLLA 1TVHB 1BJ8A 2A6IA 5L6YH 1EV2E 4OM0L 1UYWL 4HWBH 4NCC1 1NCDH 1JWUA 1FORH 3ARDD 1AI1L 2C4FT 5GS2H 2UVFA 1FVEB 2OXHA 3PL6A 1A14L 3QHTC 1ZHLB 3WO4C 5L8JB 1LD9B 5I66B 4KKBC 2Z91A 3PWPD 5E8PB 2HFEA 4LPTA 1GC1L 5HGGS 3DURA 1WBYA 1IC4L 2BMKB 2PCPA 4RWYL 5HYJD 2J8UF 4NC2B 1NC4A 3ROOA 1OCWL 2GAZA 2YD7A 4R7DB 3RVVC 4AENB 5DJCA 3QEHB 3RA7L 5C07B 3EFDL 2XWJA 1GZPB 2DS4A 2NYYC 3AS2A 3BRDA 3TF7C 1AXIB 3BD4A 3L5JA 1KENL 3SE3C 5DEGA 1HHKB 4BK4A 4M3JA 4UUJA 3NTCL 2UVEA 5IK3B 3EHBC 3OHXB 2FL5B 3DX6A 4PJDF 5JOPE 3FMGH 5C3TA 4J12A 4M1DL 4MD5B 2Q86B 3PWNA 2FIRT 2YD8A 4PGEA 3BGFB 3TPUA 4MZ2A 3QCUH 4P3DB 3UTTA 1X5LA 4V2BA 1A6AA 4MX7A 3AFLA 4PY7B 2J12B 3CSYA 4CU6A 2X4TB 1R3KB 4J4PA 2DICA 3NZHH 1TTUA 4PJHA 5GGRA 5CD3A 4GRWB 4Z7WA 2VZOA 3OKNB 2V5TA 1OGAA 2X4QA 1E4KA 3FFDB 4ALAH 2YD9A 4XVUC 1A1OA 5J11B 3R0NA 3C09C 4NJAH 1KTLA 4JM4L 1R5WA 4E42A 4LCWB 3LN5B 1JNHB 1VFOA 1A7QL 1G1CA 3TBSB 2R9HC 5H2BB 1WTGT 5ISZD 4P2OB 4EN3C 1CFTB 3FO9B 1G7PB 1NCAH 3UZQA 4JFPA 3CLEL 1Z5LA 5C07E 2R69L 2KQMA 3IGAB 5CZXC 1GH7A 2Y4SA 5KSUA 5IFHH 5T5NG 4L9DA 1CICB 1NBZA 4DVBB 5CS7A 1LMKA 1XGYH 2B0SL 4PGCA 3O2DL 5FUOL 2W9LA 3TGXA 1M6OB 1RSFA 3QT2A 1CZ8H 3ARDC 5TE4L 1GIGH 4ZUSA 2A38A 4GMTH 1WT5C 1ZANH 1RK0B 2XNAA 1NBYA 5J13B 5HDQL 2UUDK 4GKSA 4Q9BA 5HHNA 5DEFB 3UJIL 1L7TH 1WF5A 4RISH 3QUZD 4ELKA 5GRWA 5DO2D 1JTTA 1H3PH 4MA1C 4M7KH 1MCSA 4U1KA 1UVQB 4K9EL 1PQZB 4L29B 4QRQA 5I15H 2P7TA 3O9WD 4WFHD 4YDJA 1ZVSA 5J89A 4K3JL 2D9QB 3V6OE 2DWEB 5CP7B 1TZGL 3BHBB 2YD6A 1BJ1J 4QY8B 4LCCA 2HVKB 2HTKD 3QJFB 2CLVB 4GRLD 1PZ5A 1BQLH 5A43C 2EECA 3O41B 3TH2T 3N1PC 5AWNL 1OPGH 4NHCL 4HWUA 4V1DD 4ZUUB 1TJHL 2G5RA 3VXOB 4Y5YB 3SJVE 3O0RL 1T1YA 4F15C 3QIWA 4JHBA 3SDCB 4FQ2H 1L7IL 4PRDA 2H32A 3FO1A 4MAYA 3IAGC 1PY9A 3F7QA 1F3JB 3EFFB 5HHOD 3RWFA 5FYLD 5B39A 5C9KA 3LQZA 4U2YA 1KJMB 2R1XB 2PW2A 3MLYH 4TVPL 4DGIL 3IFNH 3TZVB 1CFNB 2DQFA 3ZKMC 5D93B 3QUXA 1JHTB 4Q74A 1F90L 3CH8A 4I0CC 2HT2D 4A6YA 4PRIB 1ZK9A 4YHOH 3RU8H 1KIQA 3ARBB 2NPLX 5EZLB 4RAVA 1U8OB 5EORH 1RHFA 1MVUB 3NFNB 4LSTL 3MFFB 4XRCB 3VXRD 4O2EB 1YNTA 3GSQB 5T3XD 4LNVA 5FGBA 2F19H 1UJTA 4DCQA 1GGIL 4NQCA 4XAKD 4IIQB 3VFTA 3DHMA 3MV9A 3F7PC 3TJEL 5IMLB 2XKNA 2APTA 5T1MA 3GHBL 5I8OH 5J1TC 1QSVA 1KOAA 1CR9H 4L9LB 2VDRH 4R2GB 1R3LB 4BELD 1AH1A 3W9DB 1C5CL 1ZT7B 5HYQA 3M45A 1E0OB 4NO3B 4GAJL 3HZMA 4O58L 3D6GA 1HHGB 3B6SA 2VDQL 3H9HB 2VLKD 1N0LA 1REIA 3I6KB 1JPFA 4P9MH 5FM8A 4KY1L 1EPFA 4ODHL 5CFHA 5HVWA 3HE6D 1LVEA 2R0ZL 4UMGA 1FL5B 3QUZC 3D39B 5DO2C 3V4PL 1IKNA 1FNEA 4JZJC 4FHBD 1J10A 3IETB 5DMJB 2DQTH 1DN0A 2H8PA 3DUUB 3TO2B 1DE4A 4Z0XA 1JNLH 1S9YB 3L5IA 3BEWB 4HF5L 5CJ8A 4WFGE 4LSVL 1NCWL 4BFEA 3QNXA 2BVOA 2AV1B 2HTKC 5T1KB 4GRLC 2GJ6D 2O61A 2KL6A 3MLTA 3MRIA 3CFKA 1YJDC 4JRXB 3BRFA 5JXAL 1SM3H 2EEDA 3J8F7 1C16A 4LPWA 4XNXL 3E3QC 3HNTL 2J6EA 3TN0A 4NUJA 3ARED 4KGJA 3WO4B 4ZAKD 1PSKH 2ZCLH 3QH3B 4HFWA 4D2NA 3INUL 1TCRB 3P73B 4ORGB 3C5SB 5D7JD 1J0YA 2D2OA 4L4VD 4M9PA 4M93C 4ZXBA 3TO4A 1SJEB 2HT2C 5DJ8A 4ZQKA 1EXUA 3QXUA 4Z0BH 4PJXF 1X5XA 5DWUL 1T3FA 3X11B 4F58L 3NA4A 4QRSB 5E7BA 4Q0XH 5B39G 4TOYL 2QSQA 3E6FB 2WBJA 4CW1B 3CK0L 2RJMA 3JV6B 3DUHA 3OZ9H 1ORQB 5F1OB 1J0JA 4LSUL 2C7UB 1AGDA 2E7BA 4JRXE 1HHIB 5JPMB 1OAYH 3TCLA 2GSIB 1NANI 5I1CH 1IC7H 1JF5A 4BA8A 1WLHA 1MFBH 1S9WA 3IFLH 4YHLH 4XMLH 3QSKB 1N4XL 3U0PB 4QXTA 1ZVYA 5ACZA 5FECB 5E03A 2GK2A 4OLVH 2WUCL 1MEXH 2ED7A 4YAQA 3EOAB 5L88H 3VD5A 1SBSH 3KR3L 1N2RB 5JO5A 2NX5A 4KJYB 4PTUB 5IOPB 4J3UA 3C09B 3HE6C 1EK3A 4OI7A 3HZVA 4HAGA 2PO6A 2J1KA 4OAWA 1YN6A 1T7ZA 2VL4A 3RX7A 3VRLE 4DZ8B 4FQHB 4U6XB 1BJMA 4Y0GA 3PQYA 4EN3B 3FT2A 5JQ6L 5D70L 1QKZL 4NRXA 1OP5K 4PREB 4GQ9L 4G6KH 4CN6A 4MB5A 4G9FA 1I9IL 4LF3B 4HX1B 2ZUSA 4FP8H 3WFEH 5DK0B 3OB8A 3QI9A 5C0AA 1X5YA 1HDMB 5EOQH 3RUGA 1AJ7L 3VWKA 3RY5A 5KSBB 3K2MC 4ZUWB 3FHQA 1ZSDB 2D31B 3DWTA 2XY1A 4ZAKC 5AAWA 1LO5A 2DYPD 2EE6A 1A7NH 2Z8WC 4G8GB 3BUYB 2D3VA 3PWPB 1S7VB 2LABA 4B53A 3GK8L 1YECL 2DM4A 5D7JC 1Z6JT 4MB3A 1A6PA 3K1DA 4OLWH 4UIKH 3UBXB 5SWQB 1WK0A 2AJVL 3RIFF 3C5JB 5GIRB 5EU5B 3RWDB 5DC9B 5HYJB 5IW6B 1BVZA 3FRUA 1I8MB 5EPMB 1QR1A 1SY6H 1CDCA 1SJVA 2QJDA 2OM5A 4S1QL 4P59L 1WZ1H 2MOVA 4UNVA 4F15B 2BY2A 1F2XK 3K8KA 2XACC 5C0DB 4FZ8L 4Z7UA 1A6ZA 3ZTJG 1CGXA 4X4MA 2HTLD 1A64A 4KJPC 3LN9A 4W81A 3H3BC 5A16B 5KSBE 1FH5H 4ZNEE 5A2JH 3BKMH 2ED9A 3GJFK 4PJFA 5IB4A 5IHBA 3E8UL 2VXUH 3S5LB 1U8LB 4G8GE 5E6ID 3PWPE 4AM0B 3FTGB 3KPPB 3LS5L 4Y1AE 4M8QA 5C0GA 4I18B 2B1AL 2HKHL 2X7LB 3FQRB 1S7RB 1XEDA 2P5WD 2RCSH 3H2WA 5HYJE 3GUTB 4S2SA 4OLUH 1AY1H 1UXWA 3PGDA 5ISZB 1BFTA 4D94A 3BD3A 3VXSA 1A3LL 2AKRA 4P48A 4OM0H 1UYWH 1JYWA 1AP2B 1FFPA 4DUVA 1BF8A 1VACB 1D6EB 5LGKA 4PJXB 4NHUA 3WFCL 5LXGH 3SDAA 1BM3H 1A14H 3BDBA 3RWHB 2AXFA 4MSWA 3UTZB 4MLSA 1YJDL 3MRQB 1YYML 1Y0LA 1MH5A 1MCLA 2APWA 3T2PA 2BCKB 1GC1H 3QUZB 5IV2B 3K81A 1L6XA 1FN4A 2OQJA 1NJ9B 4HCRH 1IC4H 4IHOB 2NW3A 4JZJB 4DKFL 1AXTL 4WEUD 4EI6B 3STZB 3OKMB 1KULA 4K3EH 1I1FA 4ZFZB 1L6ZA 5ICZA 2EYSA 3HLAB 3CDYA 2XRAL 3RA7H 4GRWH 1LE9B 4GRLB 3EFDH 1NGQL 1S7SB 5EULV 4XCNA 4YGVA 5HGAB 3BQUA 1FGNL 1KENH 2EE3A 1LEIA 1CLCA 1PYWA 4V1DB 1RZIA 4QRUA 4N1HB 3W39B 3KPSA 2MKWA 5CAYB 3NTCH 5A3ID 5IEKA 3CCHA 3VXMA 4WHTA 5HDLA 1EJOH 5T3XL 4GMSL 2VZ3A 5HHOB 1XGPB 5KANI 2HTLC 4QRTA 1FYTB 3HR6A 5EO0A 3LKNA 4JM2C 3QDMD 1X6NA 4QHNA 1IM9D 2DMCA 1U8HA 1HSAA 4ELMF 3B5TA 1R3JA 4OB5L 4M93B 4AJ0A 5AEAA 1T20A 4I3RL 2SEBA 4D8PA 4MXVF 4WTZG 5EIIA 3SDYL 5E6IC 1RHHB 3P9MA 5HY9A 2JJTA 2ARJQ 1OAKL 3P9LA 5HDOA 1UC6A 4RMVA 3BKYH 1A7QH 1GL4B 1RMFL 1ZLUH 3VXQA 1XGQA 3G08A 3CLEH 5EU7C 2R69H 4X9BA 3PP4L 3OXSB 4P2RE 3OKLB 3UBXI 4G9DB 2X4RA 1A6UL 1B0GB 1KC5L 1WBZA 2WAHA 3QUYD 5FM5M 43C9A 1GHFL 4V1DE 2GUOA 4PJ8A 1JZ3A 3O2DH 3B9KD 2BP3A 3PJSA 1NANH 3E3QE 1VFUA 3GMQB 1NGZB 4WI4A 2KDGA 4NC0B 3ZE0F 1ED3A 2A74B 3EJZD 4JFDD 1HEZB 4NOFA 4X6FB 5HDQH 3P4NA 3BW9B 2QSCL 3RL1B 2BZDA 1FYTE 2VLKB 3V0VB 4ZS6D 3UYOD 2FH8A 4X6BB 5DK3A 3LPGA 3QEUB 5F96L 2I60H 1J9CT 3V5HB 4OD2B 1AGBA 3HE6B 3MMEB 1INEL 1NQBA 2DMBA 3BZFA 4K3JH 2F15A 1U8QB 1KIRA 5EUOF 5MI0C 3UP1A 4U1SA 2VXQL 2X4PA 1TZGH 3ZKQD 2VUYA 4MXWL 2F53A 2VDPL 5J6HB 1JZ2A 2PKDA 1K8IA 4Y4FA 3DRTA 1MFEL 1ITBB 4NHCH 3RNQB 2GJ6B 2X4SB 5HVFB 3V6ZB 1DEEB 3ZSSA 3K74B 3QG6B 3LEYL 1KJVA 1L7IH 4LFHD 32C2A 4BH7A 3GI9L 4K3DL 5FUZH 4B5EA 3WJLA 5JW4Q 3CH1B 1LP9E 1EEUA 5A3IC 43CAB 1QEWB 5MP6L 4OZGB 3IXAA 1Z9SA 1U91B 3RGVD 2XWTB 1I9RL 4ZAKB 4TVPH 4DGIH 3VJ6B 5CGMA 1YNKL 3GSOA 3O6FA 2BOBA 2AJ3A 3BZEB 2ARWA 1LE5B 3BP7A 4WUKL 4LHUA 4RA0C 4RRPG 5DJAA 5E9DA 1BAFH 2VLKE 1A4KB 4Y4HA 4NYLB 3LS4L 3NPZB 4L4VB 2ATKA 5FYJE 4JFFA 3OGCA 5EFIA 1A9EA 3JTTA 2QADD 4EXPX 1BHGA 2A6JA 4YHPA 5D1XD 3FOLA 4NWUL 2H9GB 4KU1A 3UPRA 1GPOL 5EG6C 3P0GB 1GGIH 4WU5B 5IHZB 1ZGLB 1RK1A 3NCEB 2FLBT 4B41A 4GBXA 4HPOL 1S3KL 3TJEH 3D18B 3QULB 1QOKA 2YD5A 1Y6NR 1QSEA 1T5WA 4N0UA 3GHBH 1QYGL 1V7NH 2GJ6E 3LKSA 4WCYL 1MHPL 3MNZB 3FONA 3UPAA 2CK0L 5FA3A 4OV6F 3QDGA 1KEML 3QRGL 1C5CH 1KIPA 2GSGB 3QEQA 3IDUA 2DTML 3MO1B 1AGFA 1BZ9A 3QUYC 3B9KC 4GAJH 5FHAH 4B7LA 2ZUUA 2OSLB 1P7QA 2IG2L 4O58H 2VDQH 3MBEA 4QRRD 4OZGE 3EJZC 1XIWD 4KY1H 4ZSOB 5GSRB 4ODHH 1PG7W 4YR6A 4R8WH 3R8QA 3IU4H 2C3VB 1S7QA 4UT9L 2HN7A 3P77A 1F4AA 4L3EB 4ZS6C 1NFIB 3ALPA 4JKMA 5D1QD 3HAEA 4X7TB 1QSZA 3O6LH 1KLGA 3PWUB 1DTUA 3DHJA 4QHLB 3BYYA 4GG8B 2ICES 3O45A 3DMMA 4HF5H 3WHXA 1NCWH 3OR7A 3QWRD 1A2YB 4QGTA 3U30C 1CDUA 5C09D 2IADA 3T0ED 1T7VA 3O11A 5CP3A 3U1SH 3NOIA 4YIQB 4GG6A 4U4BA 2CKBA 1UZ8A 3FQNB 4NC1E 1WWBX 4HJGA 4JG0L 1EEQA 3N1FC 4HIHA 4XNXH 3HNTH 3WXWH 4H8WC 5DJ0A 3LEXA 2V7NA 1NMBH 3QEGH 2OTUA 4OZFB 2FO4A 3NCBB 3ILPA 3RGVC 2JIXA 3VRIA 1C8PA 1K3ZA 1MSPA 2HMID 2DYPB 4XNQA 5ENWA 2MNUA 4ZSOE 3PIQB 1BJ1H 3FQTA 4C56A 3GFUA 3HC0B 5IG7B 5FOJA 2YD3A 4L3EE 2ESVB 4HWBA 2K7QA 1NGPL 2F54A 3PHQA 2FEDD 5I18L 2YK1L 3UROR 4URTB 3E0GA 5DWUH 4F58H 5FB8B 4HEME 4HKBB 3GHEL 3R8BB 1D5MA 4TOYH 1LO2L 3OJDA 2VXSL 3CVHA 2LVEA 3CK0H 4Y8AA 2VERN 1TIUA 4X99A 1HXYA 4APQD 3BT2H 1F58H 3OAYK 3UDWA 4H25B 4P49A 2NLJB 2KZ1B 1EO8L 4LVOC 3ZE2F 1UJ3A 4MXVE 4Y2OA 4F7PA 2DWDA 5ITFB 3BGMB 1A3RH 3KPQA 2K9UA 2NZ9C 3T1FB 4JM2B 5FO9B 3QG7L 2B1HH 1UQSA 4XBPA 2WUCH 1C08A 1ULVA 4UV7L 1XIWC 3KR3H 1U3HA 3HG1A 3V7AE 1TMCB 3L7EB 1WV7T 2CIIB 2MJWA 5E6IB 2OR9L 3T0XA 1WBXA 1MCBA 4XT1C 3OGOE 2ESVE 4PV9A 5KVEH 3N1QC 1OT1A 5EUKA 2P5WB 5A2IH 5JQ6H 3HI5L 3QISA 4MDIB 1QKZH 3H7BA 4GQ9H 4HHAA 2Q7YB 1KCRL 4YHZL 3T0EC 4KK5D 3O4LA 2DN7A 5LQBL 2E6QA 3IF1B 3VW3H 1MNUH 5D96C 1GZQB 2YRPA 1MCWM 3JSSA 3V5DA 1AJ7H 2VAAA 4LLVB 3MRJB 2V6HA 2DM3A 2O5YH 3T3PE 1MJJA 1V5JA 4PIRF 3IRZA 3C2AL 1J12A 3BIKA 3MLPA 3SKUD 2E9WA 4QO1A 4AIZA 5D2NA 2HJLA 1CVRA 2GT9B 1IFHL 1YECH 3GK8H 3PUCA 2ZSVA 4FQXD 2HMIC 4WO4D 2BNRA 5MI0B 3X13B 3PWJA 4WTXA 4JG1L 4ZUTA 1F97A 3FN3A 3IDYB 2DI9A 4LLQA 5F89B 2AEPL 4FTVA 2FEDC 2ZNXA 3QQ3A 4QWWD 1MFAL 5KJRL 5M7QA 2AXGB 4Q6IB 3RNKB 1HWHB 3VGEA 4YXLL 4P59H 1Z9LA 5F9AC 3HMWL 3WFBL 2Y7QA 4S1RL 1T03L 1KN4L 3G6DL 1X44A 5F88B 4FZ8H 3K4DA 4QLRA 4CBPA 2CDGA 5IMOA 1CXEA 2YEZB 3O3DB 3QJHB 1NBVL 2X4NA 3QUMB 4L3CB 5MEQA 2WANA 5CBEB 4U6YB 4XB7A 2EIBA 5LG1A 3QDMB 5JIKA 3E8UH 1UFUA 4PV8B 4ZUVA 3V6FA 5D8JL 5I19H 4WW2A 1IQDA 3RTQD 5DJZA 4N8VB 3TBYA 4F37F 4L8CA 3RI5K 4GKNB 1Q9LB 1BD2E 5JNYA 2HKHH 3WLBB 4LLWB 4KRLB 4Z6AT 2G60L 1F8TH 3Q1SL 4PJAF 3PABA 3UTSA 2UV3A 2EZ0D 3LD8C 2HFFA 3LKQB 2BOCA 2EDHA 3UZEA 2WNGA 4HGWA 1QSFA 4KK5C 5CIPA 5C0CA 3KYMB 3BZDA 5FAAA 2ITCB 2MCPL 3WFCH 3B9KB 4JQIL 2Q76B 3TNNA 2EDKA 3ULSB 3VCLB 5F44A 5FDWA 5TDNA 5I1DA 1YJDH 4FQQB 1YYMH 4U1GC 2X2YA 3MPCA 3BPLC 3R1GL 1BFSA 3PF2A 4OFYD 3L3HB 3QDME 5D9SB 4H8WL 1HQRB 4UOW0 4DKFH 4LU5L 1AXTH 3SDDA 4FQXC 4HKXA 4WO4C 2FBOJ 4KI5C 3TBVB 4XC3H 4TSAL 4P2YA 1PDKA 3MRBB 4DEPC 3U30B 2XRAH 3SE4C 1A02N 4L4TA 4GAGL 5IB2A 3JWDC 1NGQH 3HI6L 1J0KA 1XF5B 1EHNA 5CZKA 3RPIA 5AD0B 1FGNH 1NDGA 3W81A 4NQXA 4D9QE 5MERB 1QVOB 3LPWA 2CXKA 1RULL 1IAIM 3NIFF 4Y16D 2JCCF 1IGTB 3KPLA 1JK8B 3MNVA 3SE8L 15C8L 4PJEF 2GI7A 3PL6D 3JTSB 4O2CA 2F5BL 4NN6C 4GMSH 1GCFA 2E7HA 1YQVH 3SKNA 4Q2ZA 1WCQA 2A73A 2FD6L 2HVJB 5I30L 3REVA 3RGVB 3SDXE 3WL9B 2EKSA 1TCMA 3X17A 5EOTA 3WFDL 5CMAB 4OB5H 1A7OH 4ZPVB 4IBLT 1HOCA 4I3RH 1BVLB 3EYUL 1DVFA 1T0NA 4HUWA 1SVZA 4XNMB 3MYJB 3F5WB 3P0VL 3WE6B 3RTQC 1OAKH 4KV5F 2YMXL 2G2RB 3IDJB 1G1YA 2IC2A 3CFIC 4PJ9A 3NIGF 5GGVY 3QQ4B 4X4ZA 3KDMA 5DURB 5FYJH 4GS7C 4Y8DC 4OGZA 1YPZB 5KS9B 1E27B 3S36X 2EZ0C 1K4CA 2BDNL 1A6UH 4ZFGL 5E4IA 1HYRC 5J7CC 4EVNB 2OK0L 1YY8B 1INQB 1U93A 3AXLB 4KKNA 4MQ7B 3HI1B 2COQA 4PJGF 3ELAT 3UTTD 3RKDD 1X4YA 3H42H 2HG5A 3BESR 1IT9L 1P5VA 3NCYP 4WFFD 4LKCB 5T3ZD 2E27H 4KHXL 3GMNB 1NDMA 2CMRL 1JWSA 1XIWB 1Q9KA 2WIIB 3F6LA 4G3YL 4O9HL 5D72L 4M43L 3S88L 4YNYA 5F96H 2VKXA 1IM3B 1INEH 1HXMA 3VDCA 2AJZB 3WN5C 5FM4A 3CDGA 5B8CA 3CFCL 1NGYB 3RZCD 2NZIA 4MXWH 2VDPH 4HIJA 1H3UA 4PJIF 4NQVA 4HKJB 5LJYH 1OW0A 2YD2A 1MFEH 1J8KA 4D0DB 3T0EB 1YMHB 4KJQD 4LLMB 4TYUA 4WJ5B 1I7UA 4XXCC 4GKOA 3B9DA 2BVYA 5EO1B 1YPZE 4I9WD 5KS9E 3GI9H 4K3DH 1S7UB 4ODVH 4Y16C 1RIVL 3AUVA 1MUJA 4JO4L 1BZ7B 1FZMB 1DBKL 3WHE1 3QXDB 1X6LA 4Q9QL 3OKOA 3KYKL 3PL6C 1XT5A 2VLJD 4PJAB 4PJ7F 4X4YA 1KN2L 2CUHA 3C8KB 4WUKH 1ZT1B 5DUBB 5E00A 1XCQA 4JLRA 4MJ4A 4YPGA 3C9NA 5DJ6B 4ONHA 1CK0L 5GSVA 2VITB 4NWUH 4F7EA 1PEWA 2C3GA 1GPOH 5GISL 4M6AA 2ADGB 2E5EA 3I2CL 3WUWA 2VRAA 5IMKB 5JIPA 4HPOH 1S3KH 1AE6L 5T5NF 3EW3B 3ORJA 5E95B 5D7IA 3QIWD 5DVOA 5TH2B 4OUUA 4WCYH 3L7FA 1MHPH 4ZTPL 4TUKH 1HKFA 3CX5K 1X5AA 4Z5RB 1KEMH 3QRGH 1XR9A 3IFPB 5BQ7A 4JR9L 3S98A 3S36L 4JY4B 4KUZL 2JJUA 2IG2H 2Y6SD 3MV8A 1FNHA 1NL0H 1LEKB 3DIFB 4ODBD 3MLWL 1SY6A 1DFBL 2JELL 5KBNC 4MWFB 1BOYA 2W65A 2AERT 1UB6B 1ZXQA 3MR9A 1MJ7L 3BH8B 4HUVB 5DR5L 4NFCA 4BJLA 1FAIL 3VXUB 1E4KC 4PJEB 1FC2D 4NQSB 4WHDA 3CVIL 4OZFH 1WAAF 1QA9B 1EEYB 3D9AL 3TNMB 5T5FL 1A6TB 2GTZB 4HZLB 1YEHL 1XF3A 3RZCC 3LSOA 3ULUE 3LD8B 2QSVA 4UOW1 3KYOA 5H35B 4JZNA 1S7XB 5EZIH 2VN4A 4KJQC 4HH9A 4OCSL 4F2MB 3K8MA 1U8PA 4TUJB 1JZ7A 1FVEA 3JWDL 4MB4A 2AGJL 5J3HD 1LEGB 1NKRA 4CVXA 2F58L 3T77B 3BPLB 3QZWB 4DK3A 4KVCH 1UH3A 3OJMB 2ZUXA 3VE0A 2UZYB 2VISA 4LCUB 3PNWB 4J3SA 4P5TD 4XP6H 4CVUA 1AXSA 4PB0L 2BMKA 4KXZI 1T21A 2EIZB 2OS7A 4FQXB 4CMMA 1NCTA 3VFUB 3EUUA 3MACL 4WO4B 5DQ9B 1NGPH 5I18H 3VXUE 4G8EB 4R7DA 2QEJA 4DEPB 4YHNA 3VA6A 1NCBL 1DUZB 4LCCC 5C0BA 3GHEH 1B4JL 2FGWL 1LO2H 2VXSH 2O5XL 1P4LB 4HWNA 4JRYA 4RFOL 1UENA 3DBXA 2D7PA 2YUWA 1FVDB 3L95A 3CU7A 1G7QB 2HH0L 4Z7WF 4JFQB 3TH3T 4I0PA 4X6DB 4OGXH 4NO2A 3ZYJA 3QIWC 2WBKA 1EO8H 4LHQB 2H3NA 1WWCA 4MAYC 4NN6B 4QTIL 5ICYA 4ODTL 5FF6A 5B38G 4P46A 5D6DA 2B5IC 5AYUL 3P0YL 1ACYL 3RDTA 2D7OA 2Y6SC 4UV7H 4ZS7H 1I3GL 3FFDA 5KVGH 3BH9A 1IEHA 2WLZA 3V79C 3BN9D 3I84A 4OF3A 4CADA 3ZYZA 4XCCL 3ARRA 3RTQB 4LCWA 2OR9H 3B9EA 1UADC 1A1NB 4KI5E 4NQTA 4PJ7B 5KSVB 5T1LD 2WBJD 1WQVT 2H2SD 5FGBC 2XTLA 4GS7B 5BMFL 5D2LA 1KCRH 4YHZH 2I24N 3VG9C 3WFHA 3TIDB 1U95B 5LQBH 2BVTA 4NO5A 4DVBA 1FNGA 1CXFA 1OTUD 4X6DE 3MUGB 3H3PL 5ESQB 1ZA3B 3TBWA 2H6PB 2XA3A 1CN4A 1K8DB 5DEFA 3C2AH 5J3HC 1WITA 4OIIH 2YA0A 2NXYD 3CJJA 4U1NB 5DRXA 4ZFFA 2NX5D 3RX8A 4WHYH 1IFHH 1CDBA 2QL1A 4P5MA 3DJ9A 4ZDHB 2FGZA 2W60A 4JG1H 3TFKC 3U7AA 3X3FL 1IKNC 5EZJA 3GSRB 5CP7A 3QUMH 1G9MC 3QJFA 5IIEB 4OZIB 2WQ8A 5HYSB 2HAZA 2AEPH 3D85B 4IOSD 3PQYD 4LLUB 4M6ML 1MFAH 1KGCD 4E41D 2YSSB 1FV1B 2JB6B 2P44B 4G9FD 3Q6FB 4YXLH 4ZUUA 3VXOA 3ZHLA 4OV5B 3G6AB 1U8NA 2CDEA 5C6WH 3HMWH 3WFBH 2PYEA 1RUKL 2VLLB 1T03H 2A6IB 1KN4H 5C0AD 3EDEA 1FL6A 4EUPG 4PLOB 5L2KE 3ESVF 3U9PL 3CDFA 1JWUB 4Y16B 1A6WH 4DKEL 4G7VL 5F9DC 3NFPA 1NBVH 5KZCD 4MA8L 2BVQB 4U1MA 3PL6B 4L8SA 5D1ZA 1CFNA 2Q20A 3RWEA 4Y19E 2X1PA 1JTPA 4LVHC 1L4IA 1HCVA 3HNVL 5HGBB 3ESUF 4KTEL 5D8JH 3DURB 4U31A 3ARBA 1WBYB 4Y2DD 5CEXA 4ZXBC 4J2XA 1MVUA 3NFNA 2HFTA 2VH5L 1HNGA 3BN9C 2PCPB 3ABZA 3MC0A 2LU4A 2YPLA 3ROOB 2GAZB 2G60H 2J3SA 3Q1SH 5DJCB 4HUNB 4K8RD 1BBJA 2P5ED 5T3ZL 4IIQA 4OZIE 5JXEA 2XWJB 4LEXL 2WBJC 2H2SC 3FCTA 2X05A 3AC0A 5IKCA 1YEKH 5DEGB 1C5BH 4UUJB 1F3DJ 4M6NL 3QHFL 2J8UA 2YC1A 4Y4KA 3DX6B 2MCPH 4GLRI 2R4RL 3RWJB 3PWNB 1PW3A 1OTUC 3O8XD 4Z7VF 3S35L 1CBVL 4PGEB 3H9HA 4KK8C 3UTTB 1AO7A 1A6AB 3PHOA 2YA1A 3R1GH 3SKMA 4QXGL 5CD3B 2EYTA 5FUCC 5GGRB 5DMGD 1YEEL 1FSKC 4Z7WB 3A6CL 5F9JA 2X4QB 2ZCKH 1RIUL 4LU5H 4PJDA 1A1OB 4RQQA 3TO2A 1R5WB 3VWJA 2B8OT 4G6FD 3EYVA 3LPFA 4E42B 4TSAH 4FS0A 5IWLA 4Y5VC 4GAGH 5F7KC 5IVXF 3HI6H 1X3DA 3P4OA 1CT8A 5L2JA 1FRGL 3HC4H 1MCHA 3WUZA 4CAGA 4F3FA 2VABB 5INCA 4JKKA 4P0DA 4RBPH 1RULH 5KSUB 4C59B 3SE8H 4ZOAA 1NBZB 4GW4A 1T2JA 3QI9C 2XICA 5DD5L 4PGCB 2DIJA 4YZFE 3NMEA 5JA8B 2F5BH 3I85A 4JPVL 2EEBA 4ZUSB 3BMWA 2XNAB 2WWKO 2FD6H 1NBYB 5I30H 4ORGA 1JHKL 3C5SA 1DLFL 3EYFA 2LAGB 4GKSB 5HHNB 5D5MF 3UTOA 3B8SA 3T2QA 4Z9KB 2FB4L 4ELKB 3WFDH 5ETUB 1YEIL 3FAXA 3EYUH 4PJHE 4U1KB 1IAKA 4KXZH 4QRQB 5F7WC 2P7TB 3TWCH 4YDJB 4ZMAT 4Z7WE 4X6CA 1ZVSB 1EO7A 1FNLA 1OGAE 3P0VH 4YX2L 4Y2DC 3X11A 2YMXH 3O6MH 4QRSA 4LCCB 4L5FH 3DNKA 2GJZA 3SPVA 5DSCA 1PZ5B 3E6FA 2Z93B 3MRLA 2UZIH 5GGTA 5D7LD 4A6YL 3BQUD 3VMNA 1MLCA 5IQ7L 4M8VA 4X98A 1RUMH 2BDNH 4O4YH 4ZFGH 1T1YB 2Z92B 3QIWB 4KMLB 3EOBA 2OK0H 3VGHA 1QFWL 4PRDB 2H32B 3FO1B 1IEAB 4MAYB 3PGFL 2Y5TA 2H1PL 5BW7C 5FEBA 1CYGA 2EDXA 3RWFB 2R56H 2NY1D 5B39B 4RMQA 3LQZB 2B5IB 5LGJA 1IT9H 1IARB 2XV6B 3O8XC 2PW2B 5ACMA 4AEIL 2DQFB 1NC2D 3QUXB 1VERA 4WRLA 4O9HH 12E8L 2GCYA 4G3YH 5D72H 4M43H 5IOPA 4A6YB 3S88H 1H3XA 3DGGA 1TETL 1KIQB 4WUUA 3U0WH 4RAVB 3CFCH 1M7DA 3MRFA 2PR4L 3RUGF 5L0QC 4WI6A 1YNTB 1G0YR 3QPXL 1QRKA 5C0RL 4FFWD 1MJUL 1A9BA 4LRNL 4DCQB 4NQCB 1UWEH 3JUZA 4Y7MA 3VFTB 3MV9B 3VG9B 5IQ9A 1T83C 5KSAD 5DK0A 3IAPA 2VO5A 1DSFL 1G9ML 2XKNB 2EKJA 5T1MB 1P4BL 2K7PA 2VLME 1GGTA 1FNSL 3ULUH 3ARDA 5HYQB 4IMKA 1ZSDA 1DBKH 3BE1L 4Q9QH 3KYKH 5IJKA 3HZMB 4LP5A 3B6SB 4OF8A 1FGVH 2AXJA 2KKQA 5MENA 1MJ8L 4HKZA 4XBEH 1JPFB 5DZOA 1CD9B 4G6JL 1V8HA 5K93A 1OOAA 2J6EL 2WWKT 4NKOA 1FNEB 1QNZL 4Z7UF 5GIRA 1CK0H 3DVNA 1RZKC 2V2XA 4P4KD 1DN0B 2H8PB 1DE4B 4Z0XB 4Z7VB 4N0YL 3C6SA 5GISH 3SGDI 3KXFA 3UO1L 3I2CH 2D03L 4W4NA 1AE6H 2O61B 3BKJL 3ARVA 3C2SA 3MRIB 3CFKB 4NQCE 3BQUC 3MV9E 3ZHKA 3MYZA 2YUVA 1C16B 4AYFA 5GS1C 4JR9H 2X4OB 3PXJA 4KMTL 3S36H 4K94C 5HXMA 4CJ1A 4NUJB 4KUZH 2ADIA 4YHKL 4BZ1L 1EBAA 3MLWH 3O6FD 5B3JF 2NY1C 4LVHB 1DFBH 2JELH 2G9HA 1MJ7H 4Y4HD 4LASL 4LAJH 2RQ8A 3MJ9L 5DR5H 3EDJA 4AM0A 4JFFD 1FAIH 4ZXBB 3D1MC 3TO4B 4ZQKB 5IW1A 4UILL 3CVIH 5MEOB 1K9TA 3D9AH 5T5FH 1GAFL 1T3FB 2JJTC 1Z9MA 2MPAL 2X5PA 4WU7A 1ZGLP 1U58A 2FO1A 2WBJB 4FFWC 5F7MC 3V8OA 5ADOL 2GY7B 3A6BL 1CDYA 1Q0XH 2D7NA 4JRWA 4OCSH 2JKXA 2A9NL 1OLLA 1N5AB 3ZZ1A 5KSAC 1AGDB 1D6EA 5GRYA 1QACA 4PJXA 3TYGL 4GLRH 4JHAL 1P7QD 4I2XE 2AGJH 5DLML 1S9WB 4N8CL 2JTDA 4JREC 4HC1A 5F1NA 2F58H 4QXTB 1TVBB 2YA2A 1EJ6A 2E6PA 4RIRB 5ACZB 1MVFA 4PS4L 2IAND 5IFJA 3QUZA 4YAQB 3ARXA 2EICA 1MHHA 3KVQA 2NX5B 4JZJA 4R96A 1JZ4A 1DEDA 1Q38A 4R26H 3O9WA 1JPST 3MACH 3STZA 4EI5A 5TE7H 3HZVB 1KB5L 3L5HA 3U9UA 4X7SL 3HLAA 3MV11 4OAWB 1YN6B 3OG4B 5I74C 1MRDL 4Y5VB 2OCFD 4JN1L 1NEZG 2Q87A 4P4KC 1GGBL 1VFBA 1B4JH 1EZVY 2FGWH 3D0VA 3DXAE 4FNLL 3PQYB 2O5XH 3FT2B 4PP2A 4N0CD 4DJMA 4NRXB 4RFOH 5HGAA 2GEEA 2XZZA 4K71C 4G9FB 3CNKA 3LQAC 4CU7A 2HH0H 1Z0MA 5KOMC 4RA3A 3CC5B 3QI9B 1DDHA 3MX0A 5C0AB 1QFWI 1QLFA 3U6RA 1K85A 3VI4E 3RUGB 3WJLC 4QTIH 1U6AL 4HUXB 5HHOA 2XQBL 4ODTH 3VWKB 5IFAL 5E08H 1MY7A 3P0YH 1ACYH 5K9JH 1D5IL 5IW3A 4PBWD 3O6FC 1ZHNB 2A9ML 1I3GH 4C56D 1L0XA 5FO8A 2BSRA 5C2UB 4P9HC 4Y4HC 5CGTA 4MNGB 4XC1H 4PP1D 2F54D 4XCCH 5TFSL