2H3NB

Crystal structure of a surrogate light chain (lambda5 and vpreb) homodimer
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
116
structure length
116
Chain Sequence
b'VTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VpreB protein
publication title Structural insight into pre-B cell receptor function
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 18
structure length 116
sequence length 116
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h3nB01
3KXFE 1R5WA 5DJZB 4UIKH 1U8PA 3LKNB 4NQTA 5B38B 4IMLB 4PBVC 5IB4A 2DQUL 3H9HB 3FZUC 1MFEH 5AG9A 4OFIA 2IALA 5EIIB 2V17L 1VKXA 2CKNA 3C5JA 1JZ3A 1BREA 4ACPA 1E28A 2B0SH 4N0FB 4XXDB 1FH5L 1MHCA 2PXYD 1NMCC 4I3SH 4JKMA 4K3DH 1P7QD 2ZG2A 5F9OH 4KHXL 3BEWB 1QUNA 3TF7C 1NEZB 4R96A 1A3LH 5T3XD 1FSKB 4JR9L 4IS6B 2EDJA 2Q76A 4R4FL 4ZPVB 3OL2A 4J4PA 1KC5L 1NFIB 5C0IB 5F3HA 3ARBD 3FKUS 5K9OA 1KGCD 2OTWA 5TGBB 1DTUA 1GGYA 1RK0A 2QV2A 5EBLA 5C1MB 4HIHB 4XPGL 1NAKH 1XCQB 5CZXC 2IC2A 1FNGB 4M3JA 2Y06L 1TQCB 4MMZC 2Q8BH 3UMTA 4XNQA 5DYOA 3ARZA 5EUKB 1IEBA 2NLJA 3ZDYF 4Z7WA 1RHHA 4Y19D 1UWEL 5I1AA 2HG5B 3RL2B 5LAXB 5L9DL 2H3NA 3MRMB 5IJVA 5E56A 5JOPE 1FZOB 3TBSA 1JPSH 3L5JA 4CKVX 2GJ6A 4XPAH 5I19L 3B6SA 4LSPL 2EE3A 3I50L 1MQKL 4F7PA 1FNHA 1DEDA 1FNEA 4EUPG 2J88H 1S9XB 4G9DA 5C7XL 1AO7A 3FAXA 4P5TC 2DQIL 5DC4B 1S7XA 3GIVA 4R4NC 1XGYL 4GW1B 1CGSH 3QULA 5DRXB 2VAJA 3FO0L 2EDXA 2DQCL 4OGAC 4XCEB 3DROB 5I18L 1U8IA 3RY5A 5I2IB 3X3FH 3O6FC 4Y5VB 2J5LC 4PJCB 2JJVA 1DLFL 3PHOB 4PJCE 3HC0B 2P5WA 5BV7H 3ZKND 3RKPA 3RDTA 4JDZA 3D0VB 2OZ4H 3LRSA 5HBBA 3NABL 2A74B 4M00A 3FQRB 3VH8A 3VRLF 2X1XR 3UAJC 3ZL4L 4WDIA 5FEBA 5IMOB 2AEIT 4I4WA 4H8WL 2DLEA 3DX9B 5DJCB 5DSCB 4KVNH 2XN9E 4PREB 1CBVL 3KPOB 2FHFA 1ZLWH 3TBWB 3G5YB 1VGEH 1VDGA 4RMWA 1JYVA 3O2DL 2DWDB 1AJ7H 1REIA 5DS8A 5E8OB 5DLML 2AVGA 3O9WC 3HUJA 5I8CB 1KCSH 2VH5L 4LLVB 1PW3A 4LSRL 1HHIA 3M17B 3UZEA 3O4LB 1KCVL 4JPWH 3O4LE 1I9JH 4H8WC 4JN2B 4E0RA 1KELH 2LAGB 1FL3B 5DVNA 5JLZA 3BE1L 4YHPA 1YNLH 4AEFA 1OTSC 4G9FB 4G9FE 3MOAL 2UVEA 5K9QG 4G7YL 3L3HB 3PHQA 1Q0XH 3CFDA 4JDTL 2VABA 1A6WH 3HZYA 4ZDHA 4QRUA 3BH9A 4QRRD 4WW1A 5GIRB 5BZDB 3UJIH 5D8JH 3PHSA 5BO1H 1QBLL 3FOLB 5IFJA 2H1PL 4M8QB 1BVLB 1MHPL 4JG1H 1ZLSH 5DR5H 3GMMB 4U1KA 4ZXBD 1NLBL 2AK4E 4TVPH 3C8HA 1T89A 4ODUB 2FBOJ 3FN0L 5DK0B 2GI7A 3HNVL 4Q0XH 1UM5H 4LKCB 2DMBA 5B4MD 4UB0L 2FR4A 1WK0A 3MJ6A 1FG2B 4G3YH 1IM9A 5F8QC 3UJJH 5BVPL 3TJEH 2PW1B 5MEPA 3FO9B 2OR9L 4Z78A 3BVNA 1ZA3B 4OGYL 4LPYA 4Q2ZA 3GMOA 3BIKA 4LDEB 4M1CD 1CFVH 3VI3E 4DOHE 5FDWA 5K59F 4PGDB 1HOCA 2AXGB 4APQC 1A6TB 4HW6A 1U2CA 3L3JB 5CWSA 4PJAA 4KZDH 1PAMA 2MJWA 4MJ5B 4X7EC 2D9QB 2X4PB 5GS0H 3BQUC 3EDKA 3HE6B 4M4RA 3UTQA 4ENEC 5IFAH 1WGOA 3QJHA 3PP4L 3F6LA 2RGSA 4U49A 2Z93B 3L5XL 3CVIH 2A73B 3K8LA 4RDQF 5TE7H 5GGUB 4JZJC 3BDYL 1DVFB 3O3DB 1KJVB 4MQ7A 2WLZA 3IKCA 5DMKB 2C3HA 4MJIB 4MJIE 3ILQD 3KS0H 5IEKA 3TFKC 4NO3B 1CT8A 4I2XA 2NY4B 1NAMH 4XP6H 1VESA 3VXRA 5EOQH 5CBEB 4X6DF 1WJ3A 1MCPH 1RIHH 2EYRA 4U3XA 4F58H 5B3JF 1JCKA 4I18A 5CIPA 2VR5A 1XGTB 4MA3A 3G08A 2E3VA 1PD6A 1C12A 1YPZF 3TM6A 1ZS8A 4P57A 1KEMH 3S5LA 5DMIL 5IJKA 1MLBA 1FFRA 2R2EB 2ESVB 4X9IA 2ESVE 3L9RA 3EAKA 5H94B 2EDWA 4JHZA 2XNAA 2BVYA 3CAFA 3RIAK 3IETB 4X98A 1FGNH 1QSFE 4LSQH 4JKPH 1FGVL 4MHHG 4U4BA 4M48H 4NZDA 4M3KB 3SCMD 3JWOL 3F7QA 3IDMB 4GH7B 4F57L 1AXSA 2DIJA 5CJXC 3NACL 3TZVD 2QHLA 1KCRL 3LQZA 3F12B 4GRMA 4NFCA 1GGCH 1CFQB 3GFUA 1NBVL 4GRLD 1EJOH 2DB8A 4UV4H 3RWFB 5D7IA 4ZO8A 3AY4C 3TA3D 1GCFA 4V2CB 3EJZC 1F00I 1IC4H 1YEDA 3MRPB 1T0PB 1D5XA 1Z6JT 5K9JL 4P3CH 3G9AB 4KQ4H 3LPGA 4LCIH 4KY1L 3MLWL 4ZUTA 4PP1C 3MA9H 2FL5B 1P9MA 1D5MA 1NCDL 4NBZB 3UTZA 1CXIA 2NZIA 4U3HA 3CXDL 1WT5C 1HWHB 2NY3D 1INEH 3MBXH 43C9A 3MBED 4G6FD 5FA3B 3LSOB 2HRPL 3IS1X 2P8LB 5HI3C 4OZFH 5TQ2L 2UY6A 2JB5L 4ZG1A 2J4WH 4NP4H 3EDEA 3GNML 4U1SA 4HLZH 1P4LB 1TCRB 1H3UA 2HWZL 4RMRA 3ABZA 2DS4A 4X6BB 5F89A 2GTZA 4LCUA 3MO1B 1YEIH 1ORQA 1BBDH 3VDCA 1AGEB 1BBJA 1H15A 1OGAB 2PNDA 1OGAE 2W9DH 4QNPF 3IF1A 3RUGF 4XCCH 5I0DA 4Z0BL 5IVXB 4U6VL 5IVXE 3V9FA 1EEQA 3OF6D 4UT6L 3T0ED 1XT5A 3TBYA 5DDHB 1XGUB 4WI6A 4OD2A 1HI6B 3H3BC 3NTCH 4ZUSA 2R1YA 3LEVL 3BH8A 1X5GA 3MX0A 3GBML 1IKNA 3RVTC 4OZHF 4NQUA 4TULL 3RBSA 5C0JA 1Q9OA 2PTUA 4MAUH 4TPRH 2AQ3A 3BP7A 4LVOB 1D5ZB 3P4OB 1EAJA 4J3SA 1PZ5B 3BRDA 3F6IA 5AAMA 3RWEA 1XCTA 2QSCH 4G6MH 1H8SA 3C6SB 4WI7A 2I27N 4TOYH 2A83A 5JIPA 4YHYB 2GFBA 1QACA 5JXAL 4P3DB 1G1YA 2I60L 4HF5L 3PWVA 3QDMA 1UB6A 5HY9B 4JY5L 3DIFA 2APFA 2E27H 5MEQA 4PJFB 1SJHB 2AQ2A 2HRLA 3ESVF 1XAUA 4M7ZC 3BISA 3J8F7 3RVUD 4XCNA 1EEYA 5F44A 1ZWIA 5FO8A 2Z92A 3KYNA 3U7AA 5IQ9A 5FDYA 2DQDH 3ZKXC 2DQFB 3BYYA 1RJZA 2CJUH 2OSLA 1CG9A 1BQUA 2HJFB 1YMMB 3TT1H 1YMME 2IG2L 3FT4A 5HDQL 2PYFB 1I1YB 3KPLB 4NRZA 4R3SA 4BJLA 5IIEA 5ETUB 2VQ1B 1RZGB 5J1TC 4ZAKB 1E27A 2GEEA 2ITCB 2VZ3A 1JV5B 4WI9A 3LRGA 4CU7A 3S6CA 3MR9B 4U1IB 3ZE2E 4JFDB 3MSPA 4HIIB 4JFDE 5E5MB 2VR9A 4F9PA 1T66D 1GIGH 3DX6B 4N8VB 4PJBA 4C4KT 3KPQA 5A16A 5I1LA 4YHZL 1ZLUK 3L3KA 5IK3A 2VLJB 4RBPK 3PDDA 1CXLA 5I66A 1D5BB 4JREB 5TDOB 1ACYL 3K2UH 1HHKA 3V4PH 4AM0A 2VIRA 3CSYB 1DQJA 3MRIB 1R5VA 4L9LB 2WNGA 3TPUB 2NNAB 2OL3A 3VXSD 4TYUA 2E8YA 1HDMA 2ARJB 1YEEL 3W0WD 3HNTH 3W9EA 2YEZB 2IADA 2IBZY 1YDPA 3DRTA 4Y2DB 1V7NH 1QBBA 2GSGA 4OIAA 3NZ8A 3L3DA 3MA7B 5JNYA 1T03L 1ERNA 1K4CB 2ZCHH 4BFEA 1D9KA 3KYAA 4F37F 3GKZA 3TVMB 3MLVH 3LQAL 3INUH 5E2TL 4D0DA 1QKZH 3QHFL 4U1NB 1LO4H 2YZ1A 3X14B 4MD4A 5CKAA 3TO4D 1DBKH 4XH2B 1FFNB 3K1KC 3QI9C 4RGND 3KJ6H 5DEFA 1FYTA 4GKZA 4R2GC 4W6YB 3MJ8B 4O2EB 3WFEH 4MLSA 4YR6A 1F6FB 4NKOB 3NGBC 4YGVA 3V7AG 4AEEA 4G6JL 5IWLA 3PL6B 4XT1C 3LH2L 4PRID 3WEXA 2QLVB 5FHAH 3SO3C 1EA9C 1SY6H 4CNIB 4J23A 1U8QA 2GYSA 3SN6N 4YFDB 1DFBL 4TUOB 3C6LC 4HPYH 1FH5H 1QO3A 3CX2A 5SX5K 1M71B 4EQ3A 5L8LB 3LB6C 4OFPA 4KHXH 2CIKB 4NM4L 3ARED 1Q9LB 1A4JB 4H1LA 3C2AL 4HS6A 2ILLA 4KK5D 1CE1L 1G9NL 3H9SD 3WKML 1GVIA 4PLJD 1TZGL 4LCWA 4JRXB 3VFGL 3HUJF 4JRXE 1TJHH 1NBYA 3MRFB 4ODVL 4XNZC 5DC9B 1MSPA 4MNGA 1GJIA 3WJLA 1UJTA 3L3GA 5J1AB 1T7XA 3B9KB 4WO4B 1JHLH 4UINL 1WAAA 3ULVC 3O2WH 2Y06H 1JNLL 2XKSA 3S9DB 3ME0A 1PLGL 5HYJB 4LSSL 2P24A 2V5SA 3ARDC 3H0TB 1UWEH 2J6EA 5CEYA 2J8HA 1VGKA 3OXSA 3GUTB 1G0DA 5D1ZB 5BV7B 2MHAB 3EO0A 3RGHA 1NANI 5L9DH 2YD2A 5A3IC 5D6CA 4G8EA 1YY8A 4TN9A 1BZ9B 4U31A 4YPGB 1BIHA 3SDCB 4F33B 3OX8A 3I50H 1MQKH 4POUB 2BFVL 2X9YA 2D7MA 3B2VL 1U95B 3QUYD 1LE9A 2EDTA 1R3KA 5SWSA 4PRPB 1NDGA 3VXUE 3CU7A 4XC1L 3LKOA 4OLEA 4WHTA 4LLWA 4DZBB 4F7CA 2X5PA 3QNXB 1IFHL 1X5FA 3FO0H 2XZAH 2DQCH 5F9DC 5I18H 3Q3GA 2WMPA 1HQ4A 2R69H 1FL6A 1XGQB 2ZPKL 1ZT4B 1DLFH 1W0WB 2FHBA 2YWYA 1N6UA 3RL1B 4XVSL 3O0RH 1CCZA 1X5LA 2VSCA 1J5OL 2VDLH 4OLYL 3BKCH 2IBGA 4PJAF 4Q9BA 2IAMC 1QLFB 4H26B 4H8WH 3GRWL 4O9HH 3QIWB 1CBVH 1A7QH 1MLCA 1QVOA 2I5YL 1G7MB 2Q7YB 1AC0A 4MX7A 4OD1H 4IMKC 1BQHA 4RWHA 4JPKL 4FZEH 5E4EC 4GAJL 2SEBA 2VMFA 3GSUB 1BZQK 4LSRH 1EO7A 4C58B 2EIEA 1KCVH 4ZNEA 3I3BA 4POZC 4YDIL 2AS5M 5GSRA 5FO7B 4UDTB 5FGRA 1MJUH 5GRJL 3LS5L 3BE1H 1A47A 4OFYD 3DETC 1G0XA 1RZIB 4LCCC 2IGFL 4LU5L 3V6ZB 5EUOB 2BSTA 4G7YH 1MPAH 1FAKT 4JDTH 4LP5A 4QWWD 3MJ9H 3BZEA 5EO9B 1QBLH 2A2QT 3ZE1F 3VFPB 1U3HD 1WCBB 1MHPH 4IHOB 1NLBH 4F7MA 4L8DA 5ID1B 2D03H 5GS1B 5GGSB 4WHYG 2I25N 4YXHL 1WFOA 1F3DJ 2R0WH 4QHUA 1RJCA 2VXTL 3MLZH 1KLUB 1A7RL 4S11A 5C70A 1WTLA 3DYMA 4ZFZA 5BMFL 1FZKA 1KXQE 3C60A 1A1OB 3FN3A 5ALCL 4N5EC 1MEXL 1QA9B 3MCLL 5DMGC 3VFSB 3EYOB 4DAGL 4N68A 5HGAA 2VO5A 1MCWW 4G7VL 3BAEL 1I3RA 2CD0A 2G2RB 4NWTH 1K3ZA 1B2WL 4YIQA 2ARWA 2CXKA 4UT7H 5D7IF 4X6FB 1CDCA 2B1AL 2FH6A 1KEGL 1FJ1B 3QCVL 2XWBA 3WXVL 1T6VN 5E6IB 1QR1B 4HDIA 1LVEA 1I1AD 3RWCA 3NCEB 4M1DH 2XXCB 3RU8L 1JGDA 4LLYB 3BKML 3IAQA 4FQXA 2OZ4A 4WW2F 1BF8A 3U0TA 3RNKB 3BMVA 1K8DA 2AQ1A 1YNKL 5GS3A 3OKKB 4LEXH 2YA2A 1BWMA 4DWHA 3UTTA 3KNBB 3AAZA 5LWYH 1A4KB 2AJVH 4XI5D 3VWJA 2I9LB 3KPRB 3MV8A 1XF2A 1RZJL 3KPRE 4X4YA 4IRSD 1LO0L 2KDGA 4BSVA 4P2QA 2PKDA 2NY0D 3BUYB 4X7DC 4W81A 2FX8L 3W82A 1ZXQA 1KJ2L 3C09C 1J7VR 1CDJA 1MJ7L 1A1NA 3C9NA 2CDGB 1WCQA 3ZDZF 4MB5A 1B90A 1IGCL 5EFIB 1FGVH 1GGBL 2A6KA 4GUPA 5FA4A 1UH2A 4KH2A 2Y7QB 1NJ9A 5IP4A 1OAKL 3E2HC 4R7DB 4QRTA 1Y18A 4DEPB 1KB5H 4F57H 4D9RD 1MWAL 1LDPH 3S8WA 3V0VB 3WHXB 2F53B 4NKDB 3IU4L 5FM4A 2F53E 4X6EA 2NXZC 1KCRH 2X4RA 4G8GE 4H0HB 5IKCA 2R2HA 4MCYA 3PV6A 5C0AB 3JV5A 1C08A 1AP2A 1L6ZA 5JW4N 3IU3B 4M62H 3NIDE 5L0QB 4PD4K 5I8KL 4XNYL 3LD8B 4NQDB 3MNZA 3MLUL 1C5CH 3MLWH 2WWMD 1ZEAH 4DQOL 5AD0B 1RIVH 4U7KA 5C9JB 1NCDH 3GMQA 1U3YA 4Q6IC 5EU5B 4OM0H 3QIUD 4RZCB 4WTZG 3DPBA 4Y16D 5IF0A 1UB5B 3RIAF 3KJ4B 5AUMB 4NKMB 4JHBA 5FM8A 5C0CA 3R06B 1T2XA 2HKFL 1J05B 2NY2B 3RVWD 4G8IA 5ISZD 2JB5H 3F62A 5HHME 1MFBH 4I0PC 1C1EH 4D0CA 4C56E 1Z5LA 5FOBA 4HXAH 5DZOA 1FZMA 5CFHA 5SWZD 3R4DA 2UUDH 5KVFL 1MCIA 1M7XA 1AGCB 2BNQB 3P4NB 2YPKB 2BNQE 2A77L 4G80B 1GSMA 1UEMA 4KMLB 2YUVA 1U8KB 3TCLB 5DJ0A 5KSAA 4JM2A 5D7SH 4XZUB 4U6VH 3RKDC 3GBNL 4HS8L 3VJ6A 4UT6H 1AGDB 4QT5A 2PO6B 2VXSL 5EZIL 1KFAL 4ELMB 1DN0A 4ELME 1BD2B 5D6DA 1BD2E 5HDBE 1J87A 3T1FA 5DJYB 1UCBL 2HTLC 2VC2L 2KKQA 4HFUL 3MREB 3MRLB 2AJZB 3UTPD 3QBTB 3IGAA 3MUJA 2QKIB 3ZT6A 1WC7A 1T0NA 3O4OC 4EI5C 2F5BL 4F2MA 3EOTH 3P3YA 4Y0GA 1R3HA 4PJGA 3AVEA 3MV9A 3V4UH 4HPOL 5IQ7L 1FN4B 3GSVB 1AHWC 2GTWA 5I1IH 2BNRD 1J0ZA 4OCSL 4NNPL 3VI4F 4JB9L 3QUKA 1INQB 2A9ML 3SE3C 1SBBA 3QP3A 3CH8A 3OWEA 3G6DH 5FKPB 1G9ML 2DDQL 4UILL 4JO3H 4HF5H 4PJHA 3S3PA 1SYSA 4P99A 5HVHB 4JY5H 5CGMA 3DV6A 4UV7L 5TF1L 3D2UB 5GRUL 4GQ9H 5BXFA 4ODBD 1JPTL 2P8PA 1KNOA 1NUGA 5DHVH 2OYPA 2KL6A 4MAYA 2ZNWA 2OBGA 5FV1L 3RGVD 5J9PB 5HGBB 1AKJD 4HC1H 5HPOA 5FYKD 3CLFH 3ALWA 2ADIB 4CVZB 1G9MC 1HHJA 4YHNB 2YXFA 2HFGH 1S9YA 5I73C 3GI8L 3S36L 4AK1A 1XH3A 3W5MA 5I16B 3F7VB 4V1DB 3PG2A 2IG2H 2HJKA 4V1DE 1ZVSA 1FLTX 5DJDA 4N8VG 1OQOA 2Q3AA 4WEBL 4HWEL 1DBBL 1MH5B 4QHMA 4L4VB 4L4VE 4OZGA 1Q72L 2HT3C 5F1NB 4IEFB 4UMGA 1SEQH 3BP5B 4J12A 1BVKB 3QIBA 4JHWH 4PG9A 5I30L 3WNNA 2XPGA 3B5GA 3L5IA 3ROOA 5EC2B 1OOAA 1ACYH 3P73B 4XNMB 5I1KH 1JF1B 2VZOA 4Q7DA 4XPHH 1I3VA 4HIJA 4QRPA 2R39A 3UBXI 5IFHL 5ACMA 1FHGA 4U6XB 1CFTB 1VACA 2CKBB 5E2UL 3WLBB 3U36A 4JY4A 5GRWA 5BS0B 4OZ4B 5E00A 2JJSA 1JUFA 3NH7H 5HYSB 1P4BL 3D0LA 4PTTB 1EZVY 4HGMA 4BA8A 2MCPL 1WAAF 1YEEH 2PW2B 1JGUL 3O6ML 3D85A 1CYGA 5KVEH 1YEKH 2CRYA 4WTXA 3D3VE 3U6RA 4Z9KB 2J8OA 1KIRA 3QWQB 5I8OL 4NM8L 3IDGB 1H9VA 1T03H 1BX2A 2CKBL 3VWKD 2E7HA 4X4ME 2F19L 1XIWD 5DZLA 5I75C 2V6HA 4KUCD 4KROD 2K9UA 5GQBA 2J7LA 2ENSA 4GMSH 2OJZL 1P1ZB 1IQWL 4DCQB 3QFJA 1P4IH 3MUZ1 3U83A 2PXYB 2XWTB 2DLTA 1JGLL 3TBTB 1P7QB 3E6FB 2W38A 4F9LA 1D7FA 5GGVL 3I6GB 4W70A 2ICWI 1EGJL 1YMHB 3ZHLA 2KZ1B 1IGTA 1DBAH 5T3XE 4EKXA 1QBAA 3WIHA 3WO3B 2YRZA 3BX7C 4G6JH 3KS0J 3ARBB 2OK0L 3E8UL 4P23A 1CXFA 1KGCE 1UWGL 1FL5A 3QEQA 4MNQD 4NQCA 3LEYH 3MJ7B 5DK2B 4P2RD 5KSVB 5EC1B 4WUUB 4GKSB 2JB6A 2V2WA 4AENB 4FXKA 1G7QA 4ZPTB 5T3XL 4XC3H 4GJTB 3TYFA 4NQXA 1YUHB 4C83A 3O8XC 4NM4H 2J2ZA 5FB8B 4Z8FL 4Y19B 3MLTB 5FOJA 4Y19E 2BDNH 1CE1H 1T0MB 3K8MA 3UJTH 3WKMH 1IAII 4FS0A 2VDML 2J5LB 1I8LC 5JMRA 4ODVH 2GT9B 4YDJA 4MD5B 4DTGL 5F1IB 4GXVL 1MF2H 1R24A 4WV1C 4D0BA 4UINH 4XCFL 2VAAA 3RPIB 4NHUA 3UTSA 1OD9A 4IOIB 5DJXA 3WS3B 3ULUF 3CK0H 1JNLH 3DNKA 4JZNA 2F5AL 2XRAL 5FYJD 4LSSH 4U7SA 4GRWH 2FJFB 4E41A 5I1CH 4KXZH 3L3OB 4U6YB 4XBPB 2MKWA 3SDDA 1I7UA 4M7LH 4EVNA 4PR5B 3EZJB 3DYOA 4GT7A 4AH2A 4G6AD 1MY5A 4LAQL 1DQLL 3VRLE 3MRRB 3STZB 2AV1A 5A2FA 3K0WA 1WZLA 2BFVH 4FFYH 3C5ZA 1HILA 2OQJA 5ESVA 5JQ6L 4R7NB 4BFGA 1RFDL 3RZCA 2NY5C 4Q6YA 3BN9D 4PJDA 3WS6C 5HD8C 1J8HA 1IGFL 3B83A 2BZDA 2BRQA 1IFHH 4P0DA 4G43B 3IXAA 5JXED 1F45A 1OM3L 4RAVB 4YUEL 1YEHH 4MWFA 2DAVA 5EU6A 4K3EL 1FZJB 3WFCH 1AR2A 4HJJL 2BSRA 4OLYH 3T8XA 5MEOA 3TNNB 3VFNB 4YXKL 5CEZD 1Y0LA 2FLRT 2HT2D 4PJEF 1WBXA 2VQUA 4MDIB 4CW1B 2D4DA 3VFUB 2MQCA 5I76B 5DJ2B 1G7JB 2GUOA 4JM4H 4ZNCD 4QRRB 4WWID 4QRRE 1C5BL 1NC2D 3GKWL 4OLZL 2V7NA 4HSQA 2R9HC 1H3XA 3LKPB 2PTTA 4GAJH 1JZ5A 1EAPA 3DSNA 4ZXBB 3QPXL 1NANH 2GY5A 3QUXC 5EOTB 2C7UB 5HHXH 4K3GA 4L8CA 2X70B 3BKYH 1E6OL 4WWKA 2F58H 4YDIH 4ZUWB 3RWDA 4APQB 4X80L 4YBLB 3G5XB 3PP3H 1VEPA 4LEOA 1N64L 2Q86A 3MODL 1LO5B 2F8OA 3QHZH 1TTGA 4I13B 5GGQL 1WISA 5BVJB 3KXFA 3HHRB 5DJZA 1EUTA 5DTFB 3DI3B 1ONQB 2LTQC 3LKNA 3H3PL 5B38A 2G5RA 1CXEA 3H9HA 2EH7L 5EIIA 5HHOD 4YE4L 5E03A 1CLOL 4I3RL 3SE8H 4GBXD 4N0FA 4XXDA 3NCMA 3E0GA 5MI0B 3VRJB 2ED7A 4WGWB 2AERT 3BEWA 3BD4A 4MA1C 4IRJA 2IH3B 1NEZA 3NA9L 1J0KA 4F3FB 2VXTH 4IS6A 3OKNA 3QCUH 1A7RH 1EUUA 1NCNA 4RAHA 4ZPVA 4LVHB 2Q87A 1NFIA 5BMFH 3DUHA 5C0IA 3EYSL 3O81A 2VE6B 5LGJB 5ALCH 4BKLB 5TGBA 4DAGH 1QHPA 4G7VH 3BAEH 5DK3A 1FNGA 4Y4HD 1B2WH 2NPLX 5J4MA 1QPXA 5EUKA 2B1AH 5B3JE 1RUKL 1KEGH 4JY6B 1MIEL 1BLNB 1N3NB 3RL2A 1F2XK 3NVQA 1YEGH 5FM5O 5LAXA 3WXVH 4XP9L 3MRMA 3ROLB 3JVGA 2XA3A 5J11C 1CF8H 4YZFF 5FCUL 2B1HL 2AJXL 3RU8H 3P0GB 4OGXL 3BKMH 2ZZUT 3IVKB 2XKNB 4NN7C 1K85A 4X4XB 2YK1H 4M6OL 1OLZA 3P77B 4YEEA 5DRXA 2PETA 4XCEA 4ERSH 3DROA 4XAWL 1YYML 2CRMA 3JTTB 5I2IA 3S37L 2OP4L 4Y5VA 4PJCA 3PHOA 1RZJH 4JQVC 2VXUH 3HC0A 3O2DA 1LO0H 1RMFL 1HYSC 4NC2B 1JGVH 3D0VA 2NYYD 5KSAD 3GJFB 2BY3A 3T3PF 3TZVB 2A74A 1NSNL 2FX8H 1MCJA 3FQRA 3SGJC 4Y4FD 5IMOA 2E9JA 1KJ2H 4JM2F 1KG0B 1YYLH 4CRPA 2VLKB 1MJ7H 3DX9A 3MXVL 5DSCA 2XN9A 4L4JA 3T3MF 2XTJC 1T2QL 2Q1EA 4PREA 3HAEB 5I1JH 3KPOA 4LDOB 3TBWA 3G5YA 1IQDB 1GGBH 3TA3B 3U4AA 2DWDA 4LLUB 4PRHB 5E8OA 3WV0A 5FFLA 3TWCL 1F6AB 2W9EH 2BX5A 3NN8B 4OFVA 4OZFG 5T1MA 5I8CA 1T1YB 4LLVA 2BOCB 1MWAH 4A6YB 1GXEA 3K80A 4HLZG 3EIFA 3BP4B 3O4LA 3VRIB 3IU4H 4JN2A 3EO1B 3MNWB 5EIQA 2D0FA 5ICXB 3QRGL 3MGOB 3ZTJG 4HK3N 2VXQL 1L7IL 1CS6A 1G6VK 2NY3B 1MFCH 4PJGF 3LIZL 3MBEB 3B2UC 2I24N 2H9GB 4G6FB 3OQ3B 1U41A 2VDOH 3ARVA 3QA3B 2XTLA 4G9FA 5JIIA 3P0YL 3IFNH 1KBGL 3CSGA 3L3HA 3HG1D 4XNXL 3ARYA 5GIRA 2VL4A 1B6DA 5BZDA 3DYPA 4GW4B 3FOLA 1RQ5A 3MLUH 1X5IA 3OKYA 4PJHF 1KLGB 4GRLC 1BVLA 2AK4A 3GMMA 3FQNB 4X99B 4K8RC 4ODUA 4Y4KD 5DK0A 4QNPE 4MMXC 4UZGA 5F1SA 4LKCA 4LPXA 3A67L 5F6HJ 4OF8A 2UUDK 3CIQA 1FG2A 2HKFH 5EORL 3T0EB 3QQNA 3T0EE 2JLLA 4U0QB 4OLWH 5FM5M 4HUWB 3FO9A 2VLRD 1I8MB 1E0OB 1ZA3A 5KSBB 4NUGH 4H5SB 4D9LH 4FZ8H 5IR1B 1TJIL 3BDXA 4FQHB 2ORBL 3NIGF 3T65B 5KVFH 4PGDA 3AB0B 1A2YB 1QSED 5K9KA 3BOVA 2AXGA 1A6TA 4P5MB 4RFOH 3BPOC 3QJFB 3L3JA 5D96B 2O5YL 5AZ2L 4KDTA 3R1GH 1AD0B 2R8SL 4MJ5A 4OZGF 3SKMA 4L3CB 5IVNA 2O5ZH 4WUKL 3GBNH 4GS7C 3N1GC 2VXSH 1KFAH 2Z93A 2Z31C 2BHZA 3KPSD 3CXHJ 5GGUA 2VWEE 3O3DA 1KJVA 1NUDA 1GZPB 4Y1AB 2VC2H 4P5KB 5DMKA 4KKCD 4MJIA 3CUPA 4ZFFB 4JVPA 4NO3A 3KYMB 2F5BH 2WIMA 1U8JA 4KRMB 4HPOH 5IQ7H 5CBEA 1H3PH 2ZWLT 4M5ZL 4PB9L 3TN0D 1OD7A 5DMYA 4OCSH 4NNPH 2R56L 4JB9H 1R0AL 2A9MH 1XGTA 2DJ4A 2NX5D 1G9MH 3PWNB 2DDQH 1DBMH 4UILH 3CJJA 3HZVB 4LLMB 4OF6A 2YBRB 3RPKA 2JJWA 4K3JL 4YX2L 3N1QC 2R2EA 2ESVA 4JRYD 4UV7H 4ZFOB 4PGJA 5GRUH 4X7SL 5C3TA 2VZSA 5H94A 2QQNL 1FIGL 3G5ZB 1JPTH 1T21B 3LY6A 1QSFA 1R3JB 3IETA 3H7LA 3FFDB 3BSZL 3L7EB 1FP5A 3QUZD 1LEIB 4HWBL 3OHXB 2QQLL 3IDMA 3S36H 1JI1A 4ZFOL 5BRZD 4U3CA 4GMTH 2GK0A 5EO0A 1J10A 3Q6GL 4FNLL 3F12A 2FB4L 3GSQA 1JZ2A 4WEBH 4D2NA 1A14L 1DBBH 4PY8J 4P46D 4P2CG 4FQ2L 3RWFA 3CFJB 2P5EB 3ISWA 4LLAA 1DANT 4QXGL 2P5EE 3VXSB 3VXSE 2HFFB 2XIDA 4CU8A 2A6JB 2YMXL 4FG6D 3DX7B 3ARGB 3MRPA 4AQ1B 2RCSL 4XHJC 1K6QL 3W0WB 4PJ8D 4ONGH 3W0WE 3BPNB 3W9DB 3ULSB 2FL5A 3BZFB 4UU9B 4NYLB 5E4IA 1UC6A 2CPCA 5FO9A 2NW3B 1LEGA 1CGUA 1IBGL 5FA3A 3NGBB 2P8LA 2DLFL 3LKRB 4XWOC 4ZTPL 2VN7A 2DLGA 2C4XA 1P4LA 1TCRA 4J4PC 4NRXB 2RB8A 3SO3B 3TO4B 2R2BB 4X6BA 4RCAA 3PNWA 5ITBH 1FE8H 3MO1A 4RGNE 1M7IB 4U2ZA 1AGEA 3MRDB 5FUOH 3C6LB 4YO0B 4NM8H 5I8OH 1OGAA 3QG7L 2FZ3B 2FEEI 1VERA 5A2KH 2EDEA 3WD5L 3FTGA 3HMXH 5IVXA 3MFFB 3QXTA 4FMFA 2DBJA 2YD1A 3SDYL 3HZMB 3HKFA 2M26A 1XGUA 4PRIE 4GSDL 5F9WB 3V0AC 2OJZH 4I48B 4YPJA 2EZ0C 1IQWH 2YXMA 1J1XL 2AJYH 4NO5B 3VFMB 2CDFB 4PJDF 5ADPL 3ARQA 5D1XA 1D5ZA 5FGSA 3KR3H 3PWPD 1UJ3B 3P4OA 1TETH 2EDLA 2E9IA 1PZ5A 2A6DB 2DQGL 1EBPA 1TPXB 3QO1B 3H9SB 1A02N 3H9SE 2EO9A 2YA1A 3C6SA 1T80A 2Q7NA 2JELL 3F58H 3S36X 2OK0H 3BPLC 5DHVA 2WW8A 4P3DA 4DGIL 4GG6B 4GG6E 4DKAA 4MNHB 3RDTC 1LO3L 4XP4L 3QXAB 3V5HB 5HY9A 5TH2A 5T3XH 5DMJB 2QADC 4PLNC 4TTGA 2GSIB 3IDUA 3WL9B 3QWRD 1FQ9C 4GW5B 4OQTL 2VNCA 3MYZA 3N1FC 1FNAA 3U30C 5IB2B 1U92B 2FEEL 4AT6B 3GSWB 2Z4QB 4NWUH 5F1KC 2VDMH 3HE7D 1MFDH 4GXVH 2MQ0A 2DQFA 3QT2A 4FFWC 2IAND 4NN6B 3HZKA 4MQXC 4KJYA 4CVXA 1YMMA 1QG3A 1I1YA 3KPLA 1JYWA 1IGMH 1WIOA 5ETUA 4ZD3L 2VQ1A 3BI9X 4ZAKA 2XRAH 2ITCA 1PEZA 4XBEL 1JV5A 1U3ZA 5DD1L 2BMKB 5GJSL 3UPRB 4KUZH 4LP4A 43CAB 2NY5H 2CO6B 3I2CL 3QUMB 1V8HA 5IW3A 2CLZB 4CDGC 4JFDA 4HIIA 2LQRA 3FB6B 3QXVA 3DHJA 3BKJL 3TT3L 4N0YL 4N0CC 2HYMA 1DQLH 3DX6A 4LAQH 4TSCL 1DZBA 2EDFA 5D7JB 3OGOE 2H32B 1Q0YH 4ORZC 2AP2A 1T89C 1D5BA 3HS0B 5IBLD 4V2BA 1ZGLB 3CGTA 1RFDH 3DUUB 1UM6L 4OI9A 1IGFH 3QUML 4P4KD 4EIZC 3MRIA 2E7BA 4R4BB 5J6HB 2ID5A 1CL7L 1E4KA 5ALBH 4L9LA 1R6VA 1RUAH 3TPUA 2NNAA 2EDQA 3L7FB 4YHML 4A2LA 4YUEH 1KN2L 3JTSB 3RFZC 1IAIH 2ARJA 2DQHL 3KYKL 4E5XB 4HJJH 4JFFD 1S7QB 1M4KA 4YXKH 3IFPB 1A22B 4YDLC 3FQWB 3L95B 2X4NB 3MA7A 2G75B 4K55A 3R0NA 2BHYA 1K4CA 1RULL 2AEQL 3SKOB 3QXDB 5IT2H 4NUJB 1YEJL 3TVMA 2ZOKB 3QEGL 4RFEB 1L9MA 1EK3A 1Q9WB 1C5BH 1XEDA 3V79C 4U1NA 3WKNA 1U3HB 5I1GL 2GY7B 1PBYA 2I9TB 3X14A 3GO1L 3TH4T 1NGQL 2FECL 3QDHA 1FFNA 2V5MA 5CJ5A 1H5BB 4OTXL 2WINB 4X80H 5IHUL 2AABL 1N64H 2YWZA 1TQBC 2NTSP 4O2EA 3HI5L 3CH1B 2YD5A 5GGQH 4TTDC 5CMAB 2XYCA 5GS2D 5JW5A 4OUUB 5T1DL 3PL6A 1BQLL 1FVCB 2MFNA 5IB3A 4I18C 4XMLL 1T7YA 3QQ9D 1YQ2A 4YE4H 3PWJB 1ZAGA 4DVBB 2P8MB 5INDB 5T3ZH 1NBZA 1CLOH 4I3RH 4CNIA 2W60A 3WE6B 4M6ML 4TUOA 1T1WB 4KKLD 2BY2A 1M71A 5IJKC 4X5XB 3SE9L 4B5EA 2CIKA 2PN5A 3NA9H 2AI0L 3A6OA 1Q9LA 1A4JA 1JFQL 2HVKB 4I9WE 1CFBA 3GJEB 4KK9C 2DM7A 4JRXA 4LF3B 3VXNB 3CX5K 5J1AA 3B9KA 3HPJB 1FIEA 4WO4A 4X8XA 5E8DL 3LS4L 4NDMB 4KAQL 3C09B 4FFZL 3SQOL 5ECJE 1HE7A 4Z7OF 4LBEA 1RUKH 3GSOB 4M7JH 1MIEH 3H0TA 2LAAA 3GUTA 2UYLA 3ZT7A 2MHAA 4IRSB 3THML 1NCTA 3QQ4B 3PXHA 1BZ9A 1MI5D 4YPGA 4F33A 3SDCA 2ADGA 2AJXH 5DRZB 3ZMRA 1RJYB 2DQJL 3GGWA 1CLZL 1U95A 2QJDA 4BFIB 5GJTH 1P9MC 3VXUA 1IMHC 2WSKA 4M6OH 4PGZA 3GB7B 3WHE1 4GQPH 3QNXA 1KIQB 2DI9A 3V5DB 4WW2C 3GRWA 1KYOJ 5D7LD 5ABDE 3EYVB 1XGQA 4HT1L 1KCUL 1X4YA 1X5AA 1W0WA 1ZT4A 3WO4C 5KJRL 3QQ3B 4GO6B 5F7EL 4D9RE 3EFFB 1MJ8H 4EDWL 1A7NH 3B8SA 1RUQL 1RIUH 1ZGLM 4DZ8B 3HE6D 1ZMYA 1P7KB 3LMJL 4WI8A 3HA0A 1MCQA 1QLFA 4H26A 5E6ZA 3MXVH 1RK1B 3D39D 2DI7A 5DUPH 3QIWA 5E08H 2NY0C 1DVFD 2H2PC 2R29L 4KK6D 2ZKHL 1G7MA 3WUWB 2Q7YA 1CZ8L 3O11A 2JIXB 2NZ9C 3DVNB 5E70A 2AK1L 3FQXB 5EULV 1KPUB 4YBQD 2VUOA 35C8H 3ZHKA 3QIUB 5LCVH 4Q58C 4ISVB 1IC5L 1IKNC 3VXPB 1DQDL 1L7IH 3WDIA 1J8KA 2EC8A 1RZIA 1OAYL 1OPGL 2V5TA 4K9EL 2ZOLB 3W2DL 5ISZB 5ISZE 1NEUA 2E7LA 3MYJB 3P0YH 1WQVT 1X5JA 1KBGH 1A7BA 2C1OB 2GCYB 4XNXH 3VGAC 4BQ9A 2W0PA 3OAZH 2A38A 5EO9A 4JO1H 3VD5A 3IJSB 1WCBA 5SWZB 5SWZE 1UVQA 3ORJA 4XCYB 3V4VL 2BVTA 5ID1A 1OAXL 2NY1D 4CJ0A 2PR4L 5GS1A 2EKSB 5GGSA 1NL0L 4K7FB 3LHPH 2MSPA 4KTDL 1A1MB 3O4OB 5EORH 4FQPA 1GAFL 1DBJH 1KLUA 2UWEB 3CMOL 5D71H 1AHWB 2VDRL 4J8RB 3F5WB 4AY0A 2OM5A 2ZCLL 5ESAA 1QA9A 1TJIH 2ORBH 7FABL 2FYYB 3EYOA 3MUHL 3GMNB 4HJGB 3UTPE 3U9UB 5ESQB 4G5ZH 4F7EA 3H7BB 1T1XB 3S37X 3ZKSD 4X6FA 4MA8H 4WJ5B 3V6FB 3OZ9L 1YC8A 2VDPH 4WUKH 4NN5C 4LGPB 1FJ1A 2BNRB 3OR7B 2BNRE 5E6IA 4J1UB 2E6PA 3PJSB 1AC6A 2R4SL 4MB4A 2ZCKL 1Z9SA 4F9PC 2EDOA 2XQYK 2Q6WA 4ALAL 4LLYA 1CD1B 3MMEB 4X9HA 4LKXA 3RNKA 3M8OL 2X40A 1IC7L 3N50A 3OKKA 3DV4B 4JFYB 4Z0XB 4MVBD 3DLQR 1A6VH 4FXGB 3RGVB 1XF1A 3KNBA 2WAHA 2DKUA 2Q8AH 3SKJL 1A4KA 2FATH 5FYKE 2B2XL 5BJTB 2R0KL 2I9LA 4FFVC 3KPRA 4CN4A 5BQ7B 4FQQB 1ZHLA 2R56H 2Y6SD 1R0AH 2FSEB 3FRUB 4RMSA 1OGAD 3BUYA 4HLJA 1CFNB 4K71B 3HMWH 1J11A 4K3JH 2CGRL 3QDJD 1CU4L 3EYQD 5IVXF 4X7SH 3BO8B 1FIGH 3EO9L 5FYKL 2DKSA 1LK2B 5CZVH 1HHHB 3RHWK 4PYGA 5EFIA 4Q6IA 4ZFGL 5HYFA 5J12C 4HCRA 5JO5A 3BHBB 2M1KA 3BSZH 4XPBH 1D9KC 3P4MB 4XVTH 4Z18A 1JYNA 3STBA 2BXYA 3MQIA 4X8JB 3TC9A 2CQVA 3U82B 4Z7UB 4NCC1 3GMRB 4Z7UE 2QQLH 5M94B 4QHKI 3BGFC 3HC4L 3V0VA 3WHXA 1VFUA 2F53A 1G9EA 2APTA 1L6XA 4NKDA 3ETBF 2L7JA 4OZIF 5ADOL 1JTTA 4G8GA 1MIMH 2VLLB 1ED3B 3FHQA 4FNLH 2HTKC 2UY7A 4A2MA 1JI2A 1FORL 2EECA 1IARB 1T4KB 3TCXA 4S0SD 4O58L 4FQ2H 3IU3A 1FNFA 3GI9H 2HAZA 2DD8L 4XNUH 2Y23A 1BGXL 2YMXH 4HIXL 5IWLC 3MGTB 2RCSH 4ELKB 4HUVB 1K6QH 8CGTA 2DL2A 5AD0A 2BXZA 2HMIC 5C9JA 1HEZB 4PJFF 1K4DB 5EU5A 4Y8DC 1FFOB 1QNZL 1U42A 2P48B 3DO7A 3RI5K 3VWKB 4NKMA 3MC0A 3OXRB 4UQ3B 3S3JA 1CK0L 1XIWB 3ZSSA 1NFKA 1F4XL 3R06A 1IBGH 1I7RB 1NCBH 1J05A 1RZ8B 1SVZA 1Z3GH 4CVWA 1MCOL 2CSPA 5C0RL 4OF5A 3VG9B 3QPQC 3WIFA 2GJJA 1MAJA 3WJLC 2DYPA 2DQEH 3P4NA 2BNQA 2YPKA 5D7KD 4G80A 1A8JH 3QG7H 4OM1H 3WD5H 1A3QA 2WZPD 1U91B 4XZUA 1S7TB 3SDYH 5L7XL 1INDH 1L7TL 1AGDA 3QAZB 2PO6A 2VLJD 2V2TA 4GSDH 3ZT5A 4MNQE 4ELMA 2HVJB 1BD2A 1YJDC 2Y36H 2YUZA 4P2RE 4HG4K 5DJYA 4Q9RL 4B0MM 2AJZA 3MRLA 1F8TL 4MXVE 3CDFA 5J56B 4CADA 2QKIA 2PCPB 3BGMB 4HKZB 4RRPG 5GRZA 3LQMA 3SDAD 2V9TA 1FN4A 1BFTA 4TSAL 1WZ1L 1LP9B 1LP9E 4Y2DD 5KVDL 5ICZA 1INQA 5DJ8B 1ND0B 3EHBD 4DGIH 3CFKB 5FKPA 5C0FB 5AEAA 5I74B 4XP4H 4GFTB 3T77B 4P4RB 5E9DD 5DVOA 4LRNL 3KG5A 2D0HA 3D2UA 3WIIL 4OCRH 1HXMB 2WIIB 5FYJE 5F7UA 5JPMB 2RHEA 4URTB 5SWQB 1X6NA 2ERJB 3TV3H 1B4JL 4IOFD 2JK5A 5DD6B 1XF5B 2Y4SA 4Q9QH 1P69B 4JQIH 4UOW0 3U48A 5D93C 9CGTA 1Q94B 4YHNA 1OTTD 2GJZB 4YHKH 5HJ3B 1ZANH 2IPTL 1MUJB 4FQCL 5FYJL 5I16A 3F7VA 5J06A 4V1DA 3DRQA 3KPPB 5IMLB 3CSPA 1KACB 2YD3A 4G42A 3TO2B 1BFSA 4ZD3H 3OAUH 3MCG1 4XBEH 1FO0B 3K46A 5GJSH 2LABA 4PRNB 3I2CH 1MH5A 4LGSB 5HHVH 4CL7A 4L4VA 5C2BH 3TESA 3ULUC 1W72L 1S5IL 2DI8A 5F1NA 4Z95L 4AIOA 4XVJL 3BP5A 3BKJH 3TT3H 4N0YH 1BVKA 3G6AB 1UM4L 1BM3L 1FRGL 1OSPH 4PJ9D 2QQKH 4X83A 4PJEE 1BIIB 5CEZE 1JWMA 3VDAA 5EC2A 1JZ8A 4S1DC 1UM6H 5F88A 4FABL 4XNMA 4CN1A 2IFFH 5CBAB 1JF1A 1T7ZA 1Z0MA 3EBAA 4YWGL 1CFTA 2CKBA 2X1QA 3WLBA 1NC2B 1QRKA 4YHMH 1FAIH 4OZ4A 4WO4D 5B3NA 1KN2H 5HYSA 4PTTA 5DVMA 5CEZL 4RX4D 2H8PB 3C60C 5D72L 3KYKH 2EXYD 3LCYA 2PW2A 2XFXA 4JO4L 3IDIB 4R26H 5HYJD 1HKLH 3D3VA 4K23L 4PS4L 5JXEC 3IDXL 4QY8B 3KYOB 5D1ZD 1RULH 4X4MA 3IFOB 3CFBB 4OSUH 5E24E 1EGJA 3QEGH 4K3HA 5KTEH 4ZS6C 5EU7C 2CLRB 2O5XH 1P53A 5I1GH 1P1ZA 3I02B 3ILPB 2ZUWA 5HHOB 5HHOE 4PRPD 3UBXA 1CVSC 1UCTA 4DUVA 5CIPH 4GBXB 1U8OB 4OTXH 3SJVD 1VSCA 2PXYA 2XWTA 4YHOH 2OCFD 4LHJB 5MERB 3TBTA 1P7QA 5FHBL 3WDHA 3S34L 4FQXC 4O2CB 4IDLA 1YMHA 3HI5H 3SKNB 1H8NA 1T5XB 2VERN 4NOBA 4KI5C 1CLYL 4IJ3B 4JZOB 1BQLH 3ARBA 1UH3A 2D7PA 4FQIL 4JQXA 4FQLL 4DJMA 1JVKA 5TPWL 3VWJC 5CUSH 5J11B 3DMMD 1NMBH 4XMLH 3MJ7A 5KSVA 3NFSH 5EC1A 4AENA 3VFVB 3QIWD 4Y4HB 4NQED 4U6TA 1GOGA 1NGZB 4M6MH 4QLRA 5DVKA 5FUZL 5J13C 2A0LD 3O3AB 3SE9H 1YUHA 5E8EB 5FB8A 4Y19A 3MLTA 5EWIL 2ITDB 1HSAA 4L4TD 4TVPD 1T0MA 2NR6D 1JYXA 2EICA 3K81A 3HC3H 4MD5A 1FBIL 5F1IA 4PBXA 2HKHL 1AE6L 4QOKD 3PV7A 5E8DH 3LN4B 5GRXG 3RPIA 1S8DB 5JW4Q 3WS3A 2CIIB 1BF2A 5I15L 5EUOF 4FFZH 3SQOH 4NO0B 2XTJB 2FJFA 4RFNB 3L3OA 2Y07L 4XBPA 2L4OA 1LHZA 1LE5B 1BEYL 4G6KL 4HKXB 4Q97A 4PR5A 3THMH 2CMRH 4UIMB 3V5KB 3T3PE 1GHFH 1CICD 4PRAB 1B0RB 3MRRA 3STZA 5GS0D 3HB3C 3RVVD 1CLZH 2AXFB 3LVEA 4HWNA 4R7NA 2EDYA 3FHAA 1JHKL 1JL8A 1QBMH 5GRVL 4HUMB 1W0YT 2EC9T 3BZDA 4G43A 1YN6B 3KAAA 2F74B 5DFVD 2WUBL 2HFEB 4HT1H 3MLXH 1KCUH 3WXWL 5KJRH 3GM8A 2G5BB 3UTOA 1GGUA 3D48R 4HKBB 1FZJA 1MJJB 1TNMA 4X5WA 3GJFK 2UZIL 3DURB 3TNNA 3VFNA 1S7UB 1IAOB 3SOBH 3QISA 3MOBL 3CNKA 2A6IB 2CK2A 4MHHI 4MDIA 2EE9A 3K4DA 5I6XC 4CW1A 2FX9L 4HGWA 4NC0B 3VFUA 2NYYC 5I76A 5KSAC 1MVFA 1G7JA 4JM2C 2ZKHH 1WZMA 4EN3D 3HG1B 3BJLA 3JWNC 4R90H 5GGRB 3HG1E 3FJTA 4QRRA 2V7HB 1VFAB 1F4YL 3FL7A 5LG1A 3WJJA 3VCLB 4KJWD 3LZFL 1PSKH 4KKAD 4ZXBA 3OAZK 1C7TA 2C7UA 3X17A 4Y4KB 4JFXB 4KGJA 4U1LB 2X70A 5D6DC 4ZUWA 4HH9A 3G5XA 1WWWX 3BPOB 1CE6B 1DQDH 1HZHL 3IRPX 1RVFL 5LBSH 5E1AB 1LO5A 3X12A 1OPGH 5C6PB 3W2DH 2VDQL 2ZSVB 2QBWA 4DKDC 5BVJA 3G04B 4OKDA 2VLRB 5IBUG 5DTFA 2VLRE 2W0KA 1ONQA 4U1MA 3HCVB 3CVHB 3NIGE 1DCLA 3DXAD 1H3TA 1OGTB 3I9GH 3EGSA 1IL1B 4OV6F 3U0WL 3V4VH 1QSEE 1E4XI 1RPQA 1SJEB 1P7HL 25C8H 4ODXA 4PGCB 3QNYB 4OLXL 3VRJA 2YC1A 2VDKH 5AWNH 5IB5B 5LQBL 2IH3A 4F3FA 1OTUD 2VOTA 4TNVK 4RQQA 1GAFH 3DUSA 5CD5D 3CMOH 5KG9B 1B0WA 1ES0B 4LPWA 4MAYC 3KPSB 2F53D 4KFZC 3KPSE 4N5UA 5IW6A 2VDRH 2VE6A 1U8LA 3QXUA 5LGJA 1SMAA 2OS7A 4BKLA 3VGGA 5C0AD 1TZHB 4KQ3L 3QWOA 4KJQC 2P7TB 1T22B 3OKDA 1JRHI 5E5UB 1TLKA 2NXYC 3ZE0E 4QXTB 2DTML 4ZUVB 4U0RC 4NQDD 1DUYB 2L7UA 4JY6A 5EBWB 1N3NA 4M93C 1G6RB 3TN0B 3JXAA 1WLHA 2FEDC 2NX5B 3FFCB 5C6WH 2R4SH 2NX5E 2VZUA 3FFCE 5KAQG 2ICWJ 1YY9D 3QIBC 5DQDL 2OL3H 3MRQB 2ZUYA 4JRYB 1D6VL 4RAUB 2NY2D 2XKNA 5FUCE 4JRYE 3IVKA 4X4XA 1EDQA 3M8OH 1T20B 1N2RB 1E4XL 1IC7H 1AQKH 2WLYA 1XGPA 2VZVA 1W0VB 3P77A 4LSUH 2EDRA 3T2NL 3SKJH 2B2XH 3JTTA 4KKCC 1CLCA 3SCMA 3QUZB 3ZTNH 1P6FA 4NZUH 3DHMA 1GL4B 2WQ8A 1S3KL 1U8PB 2JJSC 5BRZB 5BRZE 3GJFA 3TZVA 4LK4A 4LMQE 2JJUA 1FFPB 3PWUA 5ITFB 2CGRH 1NCAL 4L9DA 1TENA 3U4EA 1M7DB 1HHGB 3EO9H 5FYKH 1E28B 3T0VA 4QYOA 1SVCP 3HAEA 1S78D 4ZFGH 1IQDA 2BC4B 3B3IB 2VZ1A 3TA3A 1N5AB 3QNZB 4LLUA 3VFTA 4U1GC 5HDBF 3EFDL 3PDGA 1F6AA 4PJ8B 1V7ML 3NN8A 1CDIA 5INCB 3FT2B 1T1YA 4XXCA 2H2SC 2BOCA 4R97B 3HC4H 1VFMA 3BP4A 3VRIA 3MACL 3EO1A 3MNWA 5IG7B 3MGOA 1S9WB 4KKBD 5EBLB 5BOPA 5HTSA 4Z7VB 3MBEA 3NCBB 1FORH 2H9GA 3Q0HA 1CDYA 3M45A 4KTEL 4Z7VE 4F9LC 3QA3A 2Y5EA 3BFOA 4RMUA 4HQQH 5D70L 3S98A 1RZFL 3ALXA 2YA0A 1IEBB 2C3VB 2DD8H 2NLJB 3HN3A 4Z7WB 1ZLVK 4HIXH 4U1HA 4X7TB 5I1AB 4H1LH 3B9AA 4P23C 1KLGA 3AFLA 3SY0B 1ZT1B 3HPLB 3FQNA 4X99A 3WLWC 5EZOL 1P84K 1EO8L 2GJ6B 4UAOB 1QEWB 3A6BL 3B6SB 3RHWF 2CR3A 1CK0H 3D69B 3OF6A 3E1F1 3RWGA 5H35A 1F4XH 5I1HL 3T0EA 5C07D 1RZKC 2EH8L 1UQSB 5EZJB 4HUWA 5D1QD 4ZUUB 2P1YA 1H3WM 1QHOA 2ENYA 4H5SA 5IR1A 2J6EH 4P2OD 1X3DA 5FECB 4FQHA 1XF3B 3T65A 1JWUB 3MLRL 1A2YA 3GEWB 4Z7QE 4P5MA 4KRPB 3LRSB 2XICA 4PP2A 3PWPE 3VH8B 1CDHA 4S1QL 4POYA 1AD0A 4XP1L 3HI6L 4L3CA 4WY7H 4NJ9H 2Y25A 3EDFA 5L7XH 5E7BA 1J1OL 3CZJA 5TQ0L 3N06B 2QTEA 3SDDC 4KPHH 4AIZB 4JFZL 1RSFA 4NGHL 15C8H 3L1OL 3AROA 3G5VA 2FJGB 2JE8A 4DN3L 4Q9RH 3QSKB 1S5HA 1GZPA 3RVXC 4MQSB 4P5KA 2YZ8A 3RI5F 5TE6L 1F8TH 4X4ZA 3C5ZC 1V3JA 4LQFH 5C0ND 5F7NC 4ZFFA 5BS0D 4E0RB 3KYMA 3RZCC 1ZT7B 2NW2B 4YHPB 2AJSH 3P40A 4HZLB 3FZUD 3HE7B 3NZHL 4LARH 4WNQB 4N90D 3L5WA 1MQ8A 1WZKA 1NLDL 3CFDB 2IANB 1ZTXH 3PWNA 4D9QD 2IANE 4U1JB 3VXMD 1E4JA 4HWBA 3HZVA 5IFJB 2YBRA 3AGVA 2G60L 4JG0H 3DBXB 4ZFOA 1F90L 3WIIH 1CDUA 3G5ZA 4UQ2B 5I71C 4Z7NE 1WWAX 1R3JA 3VMOA 1HSBB 1VENA 2P44B 5KVGL 3L7EA 1LNUB 2DMCA 3V7AE 3ULUH 2DWEB 2Y72A 5CZXD 1LEIA 2BVPA 1RU9L 1N59B 4Z78B 3OHXA 1ETZB 1QLRA 5FYJH 4I0KA 2CUIA 3V8OA 4IDJL 4WWKC 4LNRB 4P4KB 2R23B 5CJQL 3WMSA 5F93C 1K2DA 4LRIA 2APXA 3ELAT 1W72H 1YQVH 3CFJA 2P5EA 5SX5H 4CU6A 3VXSA 4WUUD 1MREL 5JPNB 4Z95H 2HFFA 2CH8A 3F7RA 4ZOCA 4BH8A 3ARGA 1ZHNA 4JFFB 3QJHB 1UM4H 1BM3H 4P5TD 3W0WA 1TXKA 3OG6B 3OBAA 4JFFE 5GRYA 1UACH 2EXWC 3W9DA 2N56A 4R4ND 3ULSA 4U6HB 1TNNA 1OCWL 4UU9A 1A3RL 4NYLA 4OGAD 5FKAB 4FABH 1KPVB 1DSFL 2WV3A 3O6FD 2NW3A 4S0TD 4ORGB 5IEKB 5ID0A 4IRJC 4E42B 3LKRA 1FSKC 1DDHB 5C6TL 3EKCA 5SV3A 3VXRB 3BWAB 3UAJD 1FV1B 2O93L 1G7PB 2WUCH 4NRXA 5H2BB 5IUSA 3TO4A 3SE4A 3VXOB 4DGVH 4JO4H 1JPFB 2ZP0T 1V3KA 1J1PH 4WFHD 3G08B 5FGBA 1ZS8B 1CQKA 4P57B 3TYGH 1MLBB 5JHLH 2FZ3A 3UZVB 1I85A 2AGJL 5B8CB 3O9WD 3HZMA 4LAJH 2QSTA 2M8XA 3GDBA 4PRIA 4EDXB 3P11L 4O02L 2J3SA 3TJHC 3L6FB 4I48A 4LDLB 2D4FA 1TDQA 3JVGC 3MFGB 1QSVA 4NO5A 4XBGA 4K2UH 4EUPH 5KZCB 1OTSD 1WFTA 2R4RH 3S34H 1UJ3A 5DO2C 4QHLB 3AREA 2ICEB 3AMLA 2A6DA 1NUNB 4NIKB 3QO1A 3H9SA 3MRCA 4NZJA 1CLYH 4RDQG 3LOWA 4PGBB 4WFFD 3SDXB 4OQTA 3K2MC 5DA0B 5DUBB 3SDXE 4HUKB 3DVGA 3J7HA 5TPWH 2E6QA 4Y5VC 5ENWB 1ZOXA 4GG6A 1YEDB 4RRPA 4MNHA 4HD9A 3V5HA 4OCYL 4R8WL 3EJYC 3LDBB 4Z7OE 3JUYA 2CDEB 3LPWA 5KW9L 3WL9A 4HEME 4GAGH 2MQ3A 2Z0BA 4JFPB 5D9SA 3MCKB 3RP1A 1SBSH 5EWIH 1QSZA 4IOSD 2X09A 1SEBB 1U92A 1VADB 3GSWA 1HCVA 2Z4QA 4JRWA 5TFSH 4PBWD 5SX4I 3MLSH 1B6UA 5CP3A 1G84A 1MI5B 4APQD 1FBIH 1MI5E 2LVCA 1ZVYA 2HKHH 3PE9A 1X9QA 5E2VL 3QUYA 1J88A 3MLYH 4XMKL 3BQUD 1OAUL 4JKLA 4DUXA 2GTZB 4WEMB 5IM7B 3DI2B 5C0DA 3BRGC 3WHE0 1ROWA 2BMKA 43CAA 5D7LB 1T04A 4RMQA 5D7LE 2Y07H 3QUMA 3JSSA 4NZRL 2CLZA 2BNUB 1BEYH 3FB6A 1AI1H 1ACZA 4JO2H 1BOYA 1B0GB 3TBYB 4FOMA 4QEGA 1IE5A 4LFHG 1NCWL 5IMKA 2EEDA 4LPVA 5AYQA 3TFKD 5D7JA 3ZYJA 2R1YB 2H32A 3HS0A 3D39B 1ZGLA 4JN1L 3DUUA 1Q9OB 2EE6A 1JHKH 3D39E 1IILE 4UTBL 2YKLL 1Q38A 4K94L 4R4BA 5J6HA 5DQJA 2DKMA 3S97C 1H0DB 2ED9A 4Q74A 4NOFA 4XVUC 3WXWH 3EOAB 1MCKA 4QHNB 3JTSA 1GPOL 1DQML 1PX3A 4YQXL 4OUOA 1J9CT 2WM0A 3IFPA 2D9CA 4LOUD 4OFYA 3FT3B 3FQWA 3MOBH 1U6AL 3Q5TA 1I3UA 2X4NA 2EIDA 2G75A 2FX9H 5DHYA 3GHEH 4KDTC 3H6JA 3RJDA 3SKOA 3QXDA 2D7QA 4HK3J 4NUJA 2D31A 3RX8A 2ATPB 2ZOKA 4RFEA 4S1RL 4Z76A 1Q9WA 1VB9A 2BSSA 4OF3A 1KN4L 3B5TA 4KI1A 1U3HA 4NFDA 3ARFB 2V5RA 3GSNB 5DVLA 2I9TA 4XTRC 5FO8B 2NY1B 2Z92B 4U33A 4XHQA 4AMKL 1H5BA 3W39B 2XZQH 1DUZB 2WINA 1DJSA 1RJZB 3W11C 5C0EB 1GZQB 2XQBH 1HZHH 5AYUH 3BEVB 4KMTH 5CAYB 1BOGB 4FRWA 4NRZB 1YN7B 3EJZD 3S4SG 3BW9B 5J3HD 4EJ1C 2V9QA 3DX8B 2NY4C 4QCIA 4OFDA 2FWOB 4PP1D 1UA6L 1UG9A 2ZUQB 4LVNC 3ZDXF 1ORSB 1FVCA 1I9RH 4NKQB 2IQAB 1LQSR 5F96L 1AD9B 2AEPH 5GISL 2VLKD 2D3VA 3F7PC 4FQ1H 2EYSB 3PWJA 4DVBA 2P8MA 4O51B 5INDA 4PJBB 4P59L 3WE6A 3TIEB 4XPFL 3JWOC 1T1WA 3OJDB 5MP6H 5HI3D 4OLXH 4X5XA 4PRHD 4TQEL 5B39G 2HVKA 4NRYB 5AG8A 3GJEA 1HHKB 3IXTB 1A7PH 2VIRB 3QZWG 1F3RB 4KVCL 5JQHC 4YAQB 1I1AA 4LF3A 5GGTL 2E5EA 3U1SL 1UZ8A 1E6JL 2YD7A 4WW2A 1T6WA 4XRCA 2HLFC 3HPJA 4KQ3H 2IPUK 1MCBA 1LDSA 4EI6B 3WFBL 1QFUL 1N7ML 2X4UB 4FQJL 1BFVL 2DQTL 4C57C 4YC2B 2JCCB 4MQTB 3GSOA 3MV11 2Q20A 3NZ8B 4P9ML 1UGNA 5T5FL 2X4QB 4EQ2A 1D9KB 5AZEH 3RVTD 4ZOAA 1QFPA 4IRSA 1QZ1A 4DFIA 4ZO9A 3QQ4A 4Z77B 1WIPA 5DUML 1MCCA 2C9AA 2FX7H 4N0RA 1RJYA 5KBNC 3QDJB 4N1CA 3QDJE 4BFIA 2X4TB 4MA7L 1E4XH 4TNVF 4QXWA 5F70A 4J2XA 3GB7A 4XWGL 3WNOA 5F71A 1NGYB 5EO1B 3V5DA 1UXSB 4AG4L 3T2NH 3U46B 1Z2KA 5GHWL 5KSBF 3PGFL 5I9QB 4PB0L 2FGWL 3EYVA 4YR6B 3KDMB 5LGHL 1JF6A 4AL8L 3BT2L 4OZIB 3QQ3A 4OZIE 3EFFA 5CKGA 1AR1C 1UWXH 4DVRL 1A0QL 2XZCL 1EEZB 4Y8AA 4LCYB 2Z8WC 3T4AA 4DZ8A 3BIBX 1Q1JL 3Q6FB 1RK1A 3JZ7A 5C09D 4TRPH 1JRHH 1E4WL 4UNUA 3WUWA 3O2VH 3DVNA 4Y1AD 3EFDH 2BJML 4HS6B 1KSRA 2PUQT 3K74B 3FQXA 3WIHH 5TJWK 5HGHA 3ARWA 1V7MH 4XMPL 1KPUA 4PJFE 1NMAL 4ZOEA 4MNGB 4Z5RB 3MACH 1EERB 3QIUA 1EHLL 4Y16A 3BESR 4ISVA 2AJ3B 3VXPA 1KPRB 4K7PL 1CGWA 4KTEH 2ZOLA 2P43B 5D1XC 4TSBL 4LVOC 5FYLH 5ISZA 2ZUTA 5D70H 4M6NH 1RZFH 4L3AA 2C1OA 2P24B 2IMMA 1OSZB 1UADC 1RZKH 4KK8C 3IJSA 5SWZA 3U7WL 4OB5H 4YHYC 5T33H 4JPIB 4B41A 4FMKA 4G8FB 1N4XL 2VISB 4XCYA 3ZKMC 4WCYL 2EKSA 2VITA 5D7KE 4K7FA 1LWRA 1QLEL 2IH1B 1LE9B 5I1HH 2BCKB 1NDGB 2EH8H 4LLWB 2VLJE 3VH8G 3RTQB 1NC4D 5EPMA 1I1RA 3Q3GB 5C92A 4J8RA 3F5WA 2WBJB 4OFKA 4CJ1A 1X5KA 5CSBA 2AV7B 2LVEA 3FRPA 2FYYA 4RGOL 4OLUH 4BSWB 4HJGA 3U9UA 2A1WL 2VR4A 1T1ZB 2P5ED 3H7BA 4S1QH 5L2JB 1T1XA 5DGRA 4XP1H 5L88L 3SDAB 3V6FA 4WJ5A 3ARGD 4ZAKC 5L8JB 3NIFE 4LPCA 1EMTL 1J1OH 1Q9KB 3RJQB 5EBMA 2BNRA 1EJ6A 3OR7A 5TQ0H 5I17B 4J1UA 1QVOB 1GOFA 5IBTL 3PJSA 3QI9D 4JFZH 2PYED 4OLVH 2JKXA 4ODSL 5CSZB 1QPPA 1HINL 4R2GD 3REVB 4Y89A 4NJAL 4S10A 5E9DB 1CD1A 3MMEA 5DD3L 5E9DE 2MCG1 4RNRB 1YZZA 5GSRB 5JZ7C 4JREC 4XX1G 3X13B 3DV4A 4JFYA 4Z0XA 4FXGA 3RGVA 1RV6X 4XP5L 1TTFA 1AKJA 3PDOB 3QHTC 5F7DB 4O4YL 5BJTA 4U2YA 1E4KC 2OTPA 1KIPB 4L9LC 5BQ7A 4FQQA 4I77H 3N9GL 1OP3H 1NLDH 2FSEA 4D3CH 4UIKL 2A9NH 3C6LD 5CEXB 3NFNA 5FAAA 3LQAC 3RWHA 1AGFA 3LB6D 4YK4B 1LO2H 2FGZA 2I60H 3A0OA 1JF5A 2G60H 1A6ZB 2DBLL 4M02A 2W0FA 2IWGA 3BO8A 3ES6B 3EHBC 1LK2A 2DQUH 5AAWA 1HHHA 1HCFX 4K3DL 2V17H 5KVGH 5F9OL 4J3UA 1A3LL 3P4MA 3TVMC 4X8JA 4PJ9B 3P4LA 3ULVD 4Z7UA 3GMRA 1FZKB 3C60B 2RFXB 3ULVF 2ATKA 4JR9H 4PUBL 1AY1L 3VGHA 4R4FH 2HT4C 1N8ZB 1KC5H 2VLLA 4IDJH 5GZOC 1ED3A 1NAKL 5CJQH 1JHTB 3CC5A 5A3ID 3B9EA 2VXVL 1T4KA 3IFLL 2Q8BL 2QL1A 3M1BA 3OTTA 4XPGH 1MREH 3AXLB 4GG6F 3MGTA 3PL6C 4ELKA 4EBQL 4I8DA 4HUVA 1S7VB 1FG9C 1G9NC 2OI9B 5EOCL 4HDIB 5HYJE 1PY9A 2W91A 1CD9B 1FFOA 1OCWH 1YNTB 1A3RH 1Y6NR 2OLDA 3D25B 3VWKA 3C8KB 2J88L 1DSFH 3OXRA 2DIAA 1XIWA 3F7YB 4R0LB 1I7RA 1R5IB 1RZ8A 5I19H 4LSPH 3T04D 1CGSL 5DFWH 5C6TH 3S5LG 3JBG7 5C7XH 2R0LL 1F11B 2DQIH 4PRDB 5FXCH 5K33A 3FQUB 3X3FL 1XGYH 4PRPE 2IAMD 1IRAY 4ONHB 3SJVB 5BV7L 5IHZB 3SJVE 1X5YA 4P2QB 3B9KC 5HVGB 1P2CB 4WO4C 4HJ0C 5JORA 4ZSOB 4ZSOE 1U91A 1S7TA 3MUGB 4HULB 4MXQC 3NABH 4N9GB 3ZL4H 5D7JD 2H26A 3OG4B 3P11H 1VGEL 4KV5F 3DMMB 4MNQA 4POZD 1PFCA 4P2RA 1AJ7L 1KULA 1Z0NA 1G7LB 3AC0A 3DETD 4NQEB 4LVEA 4NQEE 1Y18B 5DRWB 1KCSL 4PGEB 3SDCC 3O2DH 3MZGB 1JWSB 5JTWA 3KHQA 1EHXA 1GRWA 4JPWL 1I9JL 2HJLB 5DLMH 2XOTA 2X4RB 4OCWL 4L4TB 4TVPE 2VH5H 4L4TE 4MCYB 1O0VA 4HWZA 3IT8D 4P48A 1LP9A 4BQBA 2X89D 3FB5B 5DT1L 4KJPC 1TIUA 5DJ8A 4QOKB 1Q0XL 1ND0A 4QOKE 4L8SB 5C0FA 5DEGB 3UPAA 1KB9K 3UJIL 1JPGA 5D8JL 5BO1L 3MOAH 5EUOE 4P4RA 3T77A 4R8WH 1U9KA 4JG1L 1ZLSL 4JFQB 4TVPL 3V6OE 3RZWA 1HXMA 5JPMA 5KW9H 3QH3B 4OBSA 1UM5L 4LQ1A 5SWQA 4PJ5D 2H1PH 5GZND 4N5ED 3QIWC 1XF5A 5DD6A 5I0ZA 3FN0H 5DMGD 2C4FT 3KLHC 3HNVH 1CICB 5A2JH 1BZ7B 1NKRA 1UH4A 1DLHB 1Q94A 1W72A 4XGZB 1J0JA 3TJEL 2GJZA 4UB0H 4BQCA 5HJ3A 2BSED 3JV6A 1MUJA 5CILL 2AAVA 2BHUA 1CFVL 4L3EB 5BVPH 3NCCB 5IMLA 2OR9H 4LPTA 3T4YB 3TO2A 4OGYH 2DLHA 3GMPB 5J1SC 3U2SA 4PRNA 5T5NG 1K5NB 1Z9LA 5GRVK 5JXEA 1FLRL 5GS0L 2E7LC 3QEHB 1BMGA 4I0CC 1NAMB 2N7AA 5DJ6B 3WN5B 4PJEA 3CVIL 5JA9A 5TE7L 2EDBA 5I1DB 4I9WD 2X44D 4JGMA 3E3QE 3PP4H 4JN1H 1FNSL 3L5XH 5GS1C 4UTBH 5CBAA 2YKLH 3BDYH 4EN3B 2IQ9L 1WC7B 4X9BA 4GKNB 1A6AA 1NC2A 1NAML 1TTUA 1X5HA 3T09A 4XP6L 32C2B 4O5LL 5EOQL 1RIHL 2H8PA 1DQMH 5SX4H 2EYTB 4YQXH 1ZK9A 4JCMA 3IDIA 2Z91B 1QRNB 1MRCL 1QRNE 2W59A 4PLKC 1U6AH 2GAZA 4QY8A 1KEML 4EUPA 1LD9B 3OKLA 5FGCB 5FGCE 5GGVY 3OKMB 3IFOA 4M9PA 3CFBA 3QDGD 4KRNA 4S1RH 4EZMA 1JNHB 5TDPB 2FO4B 4KTYA 5DMIH 2P8PB 1FGNL 2CLRA 3DXAB 4MAYB 4LSQL 4JKPL 3DXAE 3MROB 5CLTA 3CDCA 2NXZD 4X7FC 4YFLF 1MCNA 3ILPA 5E6IC 4JE4B 5HHOA 4WI4A 1HHJB 1S9YB 2NY6C 4GBXA 1RZJC 1U8OA 5KS9B 3BWUC 5KS9E 3TNMB 3DGGB 2ZJSL 4BUHA 1FPTL 4O2CA 3JWOH 3SKNA 1I8KA 3KWWA 3AM8A 4NCC2 1JGEB 3NACH 4JZOA 4UV4L 1UA6H 4ONFL 3VU2A 1WITA 4RSVA 3OAYK 4J7RA 1RUPL 2XA8L 5FF6B 5C8JB 4HCRL 1MCDA 1NBVH 1TJGL 3NCYS 5C0AE 1IC4L 4OZFB 3WNMA 3VFVA 4Y4HA 4HEPG 3DGCR 1NGZA 1GC1L 3B8YA 2VDNL 1I7TA 4OV5B 3O3AA 1EFXD 2JIXD 2V5YA 5K9JH 4I0PD 4NQDE 3QFDA 4KY1H 2ITDA 5E5RB 5HI5C 1INEL 4KVCH 4QRPB 3RX7A 3RWJB 1X44A 4JY4B 3CXDH 4BZ1L 5E00B 1GC1C 3H9YA 5IEHB 4DEPC 2HRPH 5MHSD 5TQ2H 5D2NB 3LN4A 2D7OA 4NC1E 5D2NE 3RKDD 1OVZA 5F7LB 1QFUH 4UNTA 4F15B 1YEIL 3GNMH 4Y88A 4FQJH 1BBDL 1BFVH 2DQTH 2HWZH 1AIFB 1S9VB 2XV6B 4P9MH 1S7WB 3B43A 5E99L 4XCCL 2DM2A 1FVEB 3MRGB 1LE5A 4HKXA 2HTLD 4UIMA 4MXWL 3V5KA 4PRAA 5IMMB 5L0QC 1B0RA 3KLAA 2C1PB 1MVUA 3LD8C 4MLIA 4Z0BH 2OJEA 4Y4FA 1H8OA 2B4CL 2EEBA 4S2SA 4LLQB 4EI5D 2YRLA 2AXFA 2CR6A 4ZMAT 1UWXK 4W68A 1IAKB 1RURL 2LV4A 3NCJL 4OCNC 3UX9B 4MAUL 5HGDB 4XWGH 5C3LD 2UWEF 4RA3A 3LEVH 1IM3B 3KJ4C 1YN6A 3GBMH 4TULH 2F74A 3FONB 4PB0H 2FGWH 2HFEA 2NY2C 4AL8H 3BT2H 1PGRB 2F9BT 1QQDB 2G5BA 3I6KB 2Y1VA 4J3WA 3CZFB 4S1SL 4HKBA 1CGVA 4JJHA 4DVRH 1A0QH 3DURA 1FL5B 4H1LG 1S7UA 4BFBD 1IAOA 1Q1JH 2V2WB 4OIBA 2A6IA 4RIRB 3PF2A 2H41A 5JXAH 4TUJB 1E4WH 3HG1A 5GGRA 4FTVB 4XB8A 4FTVE 2V7HA 4M5YL 1VFAA 4MJ4A 2F54B 2F54E 2PO6C 4Y5XB 3VCLA 4XMPH 2EDNA 1VFOA 3I6LD 1VHPA 4QRSB 3VD7A 2BP3A 4Y4KA 4JFXA 4RGMB 4U1LA 1EHLH 1QFOA 3MNVA 5JHDD 4D0BB 5C0BB 5KAQF 4HHAB 4K7PH 1MHEB 2HT3D 2VAAB 5C0BE 3TT1L 3L3IA 5MEND 1V05A 3ZLQC 4TSBH 5DJXB 5C07B 5C07E 5D1QB 2VLRA 4NPYB 2ZUUA 5HDQH 4E41B 2YD6A 3HCVA 4KKBC 1PQZB 1PKOA 4P2OB 3SDDB 1I7UB 4JJ5B 1OGTA 4NBYB 2R15A 5EU3B 1IL1A 1QSEA 1N4XH 1JMZA 1GIGL 4WCYH 2J1KA 1SJEA 2J8UB 3RA7L 2J8UE 3T0BA 1GYAA 1BVZA 4PGCA 1QLEH 4ODHL 3C5ZB 5E7FA 5HVHC 5FK9B 3U0PB 3QNYA 2OQJB 4H25A 4Y5YB 4YHZH 1PKQB 1PKQE 3X3GL 1J8HB 5KG9A 1ES0A 4Z7UF 3REWA 2CXGA 4LHUB 3KPSA 2K7PA 4YDKL 1BWWA 4ZS7L 2AEWA 3Q1SL 3RAJL 1CXKA 2VQTA 2BRRL 4MWFB 4RGOH 1TZHA 4NNXB 1VFBB 2P7TA 4XAKD 1KB9J 3HNTL 3T0AA 3T8XB 5MEOB 5BS0E 3F65A 1BQHG 1V7NL 4YDVB 3RNQB 1T7VA 4LLDB 4QXTA 2E6JA 5I71B 3O3UN 1WBXB 5CGYC 4KWUA 1D6EB 5EBWA 2ZCHL 3OKOB 3TN0A 5T1LD 5J89A 4N90E 2NX5A 3FFCA 3OB8A 5H37H 1NMCB 4D9QE 3VXMB 5E94B 3VXME 5LXGL 4LHQB 1LO4L 1T3FA 4ODSH 3CFCL 1OP3K 1JBJA 4KHTL 3PGDB 3MRQA 3QG6A 2MWCA 4JRYA 3LQAH 4YLQT 1T20A 1DBKL 1N2RA 5E2TH 3QHFH 4KUCF 3RWDB 3KJ6L 3NFPB 3P9MB 5EDXA 1W0VA 3C87A 3MV7D 3K8KA 3WFHB 1LK3L 4B7IA 3QUZA 5HI4C 3NBNA 3RQ3A 2FIKB 1JJUA 1KTKE 2I07B 5EB9A 5BRZA 4WEUD 4H20L 4K7PX 5FHAL 3UYPA 1L4IA 3O8XD 1FFPA 5ITFA 1EEUA 1CDBA 3T2OA 3RX5A 1SY6L 1M7DA 2DBLH 1HHGA 3LH2H 3FQTB 4P46A 3KPNB 4HPYL 2YUXA 2BC4A 3B3IA 3VFRA 4WUUE 3KVQA 1N5AA 1QYGL 3QNZA 4IRJB 1HXYB 5CZKA 1DFBH 1A5FL 2ADJB 3BPCB 3OKNB 4P5TB 4PJ8A 3T08A 4E9LA 4HZAA 3HR5B 1RUML 5INCA 3FT2A 4MXVF 3PWLB 5IB1B 1TJHL 5B22A 3JV0A 3C2AH 4PUBH 1AY1H 5F3BB 1G9NH 5IG7A 1TZGH 4IIQA 3VFGH 1S9WA 4UNVA 2NMSA 1DEEB 2OR8A 3O6FB 1JHLL 2PXYC 3EDJA 4Z7VA 3O2WL 2AKRB 5EU4B 2VXVH 1LP9F 1HWGB 3IFLH 1UENA 3I75B 3LN5A 4CN6A 2JF1A 2C3VA 4X7TA 5ICYB 5F7KC 2HH0L 3ARBC 4EBQH 4N1EA 4JQXC 1PLGH 1U58A 5EOCH 1ZT1A 3SY0A 3HPLA 1O5DT 4PY8I 4HH8A 4WFHE 5HD8D 5DRNB 1ADQL 4HUUA 1QEWA 4YXLL 1CGTA 4HK0A 3D69A 2VTFA 4JAMB 3O9WB 5CJ8A 1UQSA 5EZJA 2G9HB 3B2VH 4ZUUA 2XZAL 2C4FU 2R0LH 1JN6B 2IEPA 4JLRB 2R69L 3S35L 4XC1H 5FECA 3QCTL 4NNYA 1XF3A 3MRHB 3O0RL 1UYWL 1JWUA 4ODTL 2VDLL 3ET9F 3PWPA 2ZPKH 3BKCL 3H8NA 4IBLT 4JFOA 4XVSH 3GK8L 5CHNB 2QR0A 4PD4J 1J5OH 2R9HD 2XN9B 4O9HL 4WFFE 3QUXD 1A7QL 1II4E 5KOVC 4AIZA 4C55A 3NMEA 3GRWH 4OD1L 3ZKNC 1MFAL 1EPFA 2FJGA 3TBVB 4EEEA 4DUWA 1A9BA 4FZEL 4PV9B 5T1MB 2I5YH 2WWKT 2IPKB 5GSVB 3QWRA 4JPKH 4WU7B 4OCWH 1F4HA 2YD4A 1MJUL 1ZT7A 3BD5A 2NW2A 2NTFB 4HZLA 3IAGC 5L2KD 3HE7A 1M1SA 1WVZA 2N1KA 4WNQA 5DT1H 5GRJH 3LS5H 4MS8D 1MPAL 1D5IL 2IANA 4LSVL 4U1JA 2IGFH 3MJ9L 4LU5H 4J3OC 4WRLA 3BQUB 1U2HA 3DJ9A 2AK4B 4X6CF 3DBXA 1PDKA 3OJVC 4O00A 2D03L 4UQ2A 4IMLA 4JZJB 4ZQKB 1HSBA 5T3ZD 1LNUA 5KANG 2R0WL 3MLZL 2DWEA 3N1MC 1HQRB 3Q5OA 3JV4B 1N59A 4YXHH 3WJJC 1WFNA 4P2YA 3FB7B 1ETZA 1N0LA 1F58L 5CILH 4F80A 4ZXBC 1IT9L 2BVEA 4HGKC 2X6MA 5HHPB 4DOHB 1UKSA 5J0BA 5DD0L 4LNRA 4P4KA 5K9KB 2R23A 4YBLC 5B4MC 1MEXH 4FN0A 4NWTL 4N0UB 3K4AA 3MCLH 2ZSWB 4N0UE 4UT7L 3KPMB 3SKMB 1FLRH 4HIHA 4F8TA 1XCQA 5JPNA 4AQOA 4W4OA 2D2OA 1TITA 3KGRA 2C3XA 4JFFA 4M1CC 2EIZB 4MGXA 1UZ6E 3HI1B 4FHBD 4U6HA 2HG5A 3QCVH 2VUYA 4M1DL 3NPZB 3G6JB 1FNSH 1MRFL 3G6JE 2EIBA 5FKAA 5E8PB 4DKFL 1KPVA 1FZOA 3CUPB 5MI0C 2IQ9H 3E6HB 4ORGA 2NQCA 5I1EL 1IGYB 4Z6AT 1HYSD 4LEXL 1CI5A 4E42A 1DDHA 1U8JB 1S9XA 4OD3L 4O5LH 4LVNB 5LWYL 3BWAA 2X7LB 3FN9A 2AJVL 4LVHC 1FV1A 1G7PA 5H2BA 1N26A 1YNKH 3DTXB 4YNYB 4GW1A 4JFED 6FABL 3VXOA 4Q9CA 4NO0D 1JPFA 2XTJD 5HYQB 4RMTA 1MRCH 4CMMB 5IW1B 3ILQC 1KB5B 2EDDA 2BVOB 3AU1B 2DM4A 5DJAB 3ZDXE 5B8CA 3M07A 3N1PC 4EDXA 1QSFB 4LOUC 1CGXA 1KIUA 3MRKB 3ECBB 3L6FA 1KENL 1GGTA 5DJCA 1U8HB 2VLKE 1ZV5A 2W0LA 5ACZB 1A9EB 1IGCH 1F02I 3B2UD 1WEJL 3I3DA 4KC3B 1KB5L 4L1DA 1MAKA 3TP4A 4LFHD 4ODWB 1LDPL 2ZJSH 4PRHE 1FPTH 2XG5A 4PJXB 1OAKH 3PQYD 4PJXE 4QHLA 2GK0B 4MSWB 2ICEA 5EO0B 3GSQB 1URLA 3M17A 2FH8A 3HLAB 3UPCA 1I3GL 2VLMD 4QGTA 4PGBA 3SDXA 4ONFH 5DUBA 3ZSTA 4K8RD 1FL3A 1RUPH 4M62L 3OR6B 4WFED 3P0VL 2XA8H 3SCMC 5ENWA 4HCRH 5SV4A 1TJGH 3VFOB 1WBYB 5J3HC 1QR4A 1C5CL 4PIRF 3TZVC 1GC1H 1ZEAL 2VDNH 1RIVL 1F3JB 2CDEA 5I8KH 3MRNB 2COQA 4XNYH 4A6YL 4OM0L 4JFPA 4YJZL 3MCKA 4M8QA 4JFHD 4DQOH 5FO9B 1SEBA 1VADA 1LEGB 3VA6A 5CD3B 3TA3C 5EG6C 1MI5A 1KJMB 1MFBL 4BZ1H 1C1EL 4I5BB 1F97A 1DQQB 3BDBA 3GSXB 4HXAL 4XXCC 3QR2A 3R8QA 4RMVA 2PW1A 3ZTJH 2EDKA 2DOCA 5IM7A 3PNWB 3P9LB 5KSBE 2NY3C 2Z31D 5D7LA 3MBEC 3IKKA 2Z35B 5E99H 1XGRB 3FTGB 2BNUA 5D7SL 3X11B 4MXWH 2A77H 4M6AA 1R3IL 4N1HB 1B0GA 1Q8MA 1QFHA 2X4PA 2B4CH 3HE6A 4HS8H 4M7ZB 5EZIH 4H88L 3D39A 1RURH 5C09B 3G9VA 3NCJH 5C09E 2A73A 2W07A 1DVFA 5D1XB 3HTLX 2B8OT 3ZKXB 1UCBH 2MPAL 1H0DA 3BN3B 4Y1AE 5HDOA 3T0EC 3EOTL 4HFUH 1MCFA 3EOAA 5HGGS 3V4UL 4QHNA 3TPKA 4S1SH 3QO0B 5DHVB 5I1IL 4HS3B 3G6DL 3ZE0F 2V2XB 4OIIL 3FT3A 4JO3L 3AB0C 4NQSB 5TDNB 5TH2B 2BOBB 2YPLD 3BGAA 5D96C 2APWA 3RIFF 3FFCD 3S88L 4GQ9L 2ATPA 2P46B 1QD0A 4M5YH 1CIDA 2I26N 4YFEA 5CP7B 5T1KD 5TF1H 2X41A 2ADFL 5FYKU 4HC1L 3ARFA 3GSNA 3CLFL 1RD6A 2VWEC 2HFGL 4AIXA 3W39A 5E95B 1DUZA 5JOEA 5HDLA 5C0EA 1GZQA 3P2TA 3HZKB 4KJYB 4CVXB 3BEVA 1BOGA 1YN7A 3NPSC 3BW9A 3GI8H 3FAWA 4XHJD 3DX8A 1NC4B 1M05B 2FWOA 3RVUC 1ORSA 2FJHB 2IQAA 5J8OA 5F72S 1YC7A 3ARPA 1AD9A 2P45B 1CFQA 1JK8B 1SEQL 4WIQA 5GGTA 4HWEH 2EYSA 4O51A 4LHUG 2N7BA 4JHWL 1X4XA 1HH6B 3RA7H 3TIEA 1Q72H 1IGJB 3OJDA 3JWDL 4ODHH 4XWOD 1K8IB 1TVHB 3D5OF 1N6QL 3ARUA 1ZSDB 4NRYA