2D9CA

Solution structure of the first ig-like domain of signal-regulatory protein beta-1 (sirp-beta-1)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
136
structure length
136
Chain Sequence
b'GSSGSSGELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal-regulatory protein beta-1
publication title Solution structure of the first ig-like domain of signal-regulatory protein beta-1 ( SIRP-beta-1)
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 16
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d9cA01
2D7TL 1J0IA 1JPGB 4JRXD 5FK9B 1IFHL 2DQJH 1S8DA 4MXVE 3Q3GB 5IB1A 2F19L 2PR4H 2FL5B 2HTLC 4K07A 2O61A 1BGXL 4P9HL 2Y72A 1AE6L 2PTTB 5HHNA 1LEGB 3CX2A 3QSKB 1BZQK 5D93C 4PLJC 5FGCE 2NY6C 5J89A 2WWKT 3KPSA 3S4SA 2HWZL 3C60D 4ZQKA 2DDQH 2I27N 5E7BA 1MQ8A 1CICA 2X4TB 4M5ZH 2ADFH 3B9KA 1UACH 4Y2DA 3GSOB 3EOTH 4UILH 1EEQA 3ARQA 3MRMA 3CK0H 4EDXB 2W9LA 3ESUF 4GKOA 3VGEA 3MLRL 1HKLH 2NQCA 1FNEA 2Z92B 2YA0A 4XHJD 1PEWA 1ZANH 1AD0A 4D0BB 5FF6A 2FD6H 3OXSA 4JRWA 3VFOA 1O7VA 3QB7C 1J1XL 4BJLA 4PJFE 1XCQA 4JQXA 4TYUA 2X7LB 4NPYB 4ZXBA 2AP2A 2V2WA 1WEJL 5EOQL 1U8MA 1ES0B 3RWDA 1T2XA 5ACMA 3L5XH 5E6ID 2YOCA 4NFCA 3MJ8A 2B2XL 3BT2L 4K3DH 3ECBB 3K46A 4HPYH 4YXKL 5F9JB 1GYAA 1TVHB 3DWTA 5DJYB 1QBBA 3PL6B 2E7BA 5CGYC 1T2QH 3VD7A 1CDCA 2XACC 4MWFA 3O3UN 3LKPB 5IKCB 5DRZB 5K9OA 4MA1C 1A21A 3D39B 5DMKB 3JV0A 5EG6C 1PZ5A 3IDIB 4OLWH 1BD2B 4WW2C 4W68A 4ONGL 4ZNCD 1I7ZB 3BN9D 1QSFB 1KV3A 4KK5C 2X4NA 5DJAA 1CDYA 3D0VA 4EN3B 3T77B 5JW5B 1ZSDB 5HYQA 4NN7C 2W9DL 2O5XH 3O2WL 2VDPL 3GSVA 4LVNB 3F12A 4QYOB 3BUYB 4HW6A 5EBMA 4L4TD 2X4SA 5EUKB 3CFKB 4UDTB 5DJ2A 2E6QA 3FAWA 2BOCA 1NCWL 4XNQB 1OW0C 2X1XR 3O3BB 2BJML 2FYYB 5EIVA 1AKJB 4OZHB 4UV4L 1OGAB 4WUKH 5HJ3B 1EO7A 3RVXC 2HJFB 1S7QB 1JHTA 3LEYL 1E6OH 4AEHH 3SPVB 5TF1H 3RWJB 1YEFH 4BFEA 1HYSC 4JHWH 4LSTL 5I6XC 3L3HA 1P53A 3W0WE 1SMOA 4G9FD 4UUJA 4XC1L 1CLZH 1T7ZA 2ICES 3TN0A 1FCCA 3IKCB 4CVZA 2J5LB 1R5WA 1MCOH 2H1PH 4WY7H 3GSWB 3BAEL 5EWIH 2I9LB 3DGCR 4MJIA 3OG4B 4H0HB 2P24A 3F62A 5KSBE 2AJZB 4KTDH 4JFDA 4NC1E 4LL9A 3E2HC 2CLRA 1KB9J 4KAQL 4PRPA 1CK0L 2R23A 3BPNB 4HUVB 3TYGH 3WNKA 5F88A 3O9WC 1MCNA 5C0EB 1VPOL 4L4VB 4FTVE 5ELIA 3PWLA 2XWTA 5EPMA 2E7CA 1I1AB 4LU5L 2PUQT 1HIMH 1QEWB 5T5FL 4CNIA 2Z35B 4CJ1A 1J5OL 5C0BE 2D31B 3J7HA 4XCCH 4KKNA 3TIEA 3U2SB 2CLVB 1T7WA 2QSVA 2CLZA 5L2JA 1RVFH 4DKFL 3P9MA 3EO1B 4OQTL 4UU9A 1DANU 4PJIB 1A1NA 1CDGA 1G7MB 4GKSA 5JPMA 1IAIH 4X7SH 1DE4A 3X14B 4PJCB 2ZJSH 5M7QA 4F7TB 4J2XA 3BH9A 4JY6A 1QKZH 3U36B 4G6FB 4RQQB 5ESQB 2QKIA 1RJYA 4APQD 1MI5B 3HG1B 4YQXL 1F2XK 4UIKL 3AREA 5E1HB 1DJSA 4P46A 3E6FA 4CU8A 2YD3A 1BVKA 4N1CA 5DGRA 5DJ8B 4IRSC 2EYTB 4DN3L 1IAII 4PJ8B 5BQ7B 1QBLH 4WNQA 3T8XA 1YY8A 3BH8B 2PO6D 1C16B 1GGTA 4JPWL 1A2YB 4MHHG 4EBQL 3RX8A 1MJ7H 1GPOH 2AW2A 4PJGE 4V1DB 3MJ9A 4GMSL 1NDMA 3PDOA 1UCBH 4HK0B 1D9KD 2BVOA 2VLRA 3E8UL 4H25B 4PJXF 4QHMB 4Y19E 5FCUL 3BRDA 5IB5A 2H2PC 3GBNL 1MFEL 2VR5A 3FFDB 4G6ML 1T0MA 2Y5TB 1S7SA 5I8OH 3VXUA 2VLKD 2DM4A 3RBSA 4J1UA 4YIQA 2FB4L 4YNYA 4OJFL 1UB6B 5IHBA 1GGYA 3I3DA 1TJGL 2UZIL 5CJOH 3VDAA 1OY3B 4RFOH 4NQXA 3BW9A 2F58L 5JPNA 3TC9A 4TSBH 5LGJB 3MRNA 3WUWB 5J1TC 2Z91B 4K8RL 1OTSD 4ODWB 1SJEA 5IGXL 4MNHB 2NTFB 4I8DA 3PHSA 5DK3A 5IQ7L 2CR3A 3HMXL 3MV01 4YE4H 3EOBB 4I0PD 5GRZA 5CMAA 2Q7YB 5F93C 4P2QA 4U1SB 1IC4H 2OSLA 4JVPA 2FATL 3I6KB 4D9RD 3ULVE 3PL6C 1B6UA 1QRND 5E2UL 2ZUUA 3D2UD 1LO0H 4O2CB 3MBEB 4B53A 2YA1A 3DX9B 1KLFA 2BFVL 1R3LB 2CUMA 5FCSH 1H8NA 4DVBA 3UO1L 2EDYA 3VH8B 1U8KA 5BZDB 4NRXB 2CDFA 4G3YL 4IRJB 2OQJA 2W65B 4U1IA 5EU6E 2X4UB 3IB4A 4EN3C 4G8FA 3WYRA 5CEXB 1KN2L 4QOKA 5GS0C 2BNRA 1X7QB 2YKLH 2KBGA 2P8LA 1OW0A 5GIRA 1K2DB 2H26A 5F7NC 4OCWL 1NUDA 5FHBH 1UZ6F 5CSBA 3SKUD 5IJVA 3D85D 1N8ZA 4H88L 1G7JB 3G6JB 5TDPB 3C87A 2NTSP 1IM9B 2DAVA 3GGWA 4TOYH 3BO8B 2HLFD 3GM0A 5E2WH 3MLYH 4F7MB 1VADA 4HBCH 4K94H 3VFWA 3GBML 4I0KA 4C83A 2XTJD 1NC4B 3MSPA 5C0GA 1P2CB 3PWNA 1MJJB 5EBWB 4LNRA 3I50L 2J5LC 5IVXE 5HYJE 3NN8A 4YPJA 3T0BA 1RJZA 2DN7A 4WUUB 4PY8I 5FO9B 1MUJB 15C8H 4L3CA 4R6UA 1HCVA 2A0LD 2YPKB 4XAKE 2VXSL 2J2ZA 3RVVD 5T1LD 5T33L 1OT2A 3L3DA 4R7DB 4I18A 3FCTA 3MOAH 4HJGB 4OFIA 4LCWD 4QLRA 4TNWK 2J12B 3IDJB 4IOIB 4ORZC 5IBLD 3BPNC 2CDGB 5C0CB 4OGAD 5TDNA 3O9WA 3GHEL 5DEGB 1J8KA 1REIA 4ZS6C 1P4IL 1I1AC 1MIEH 3BMWA 4KK6D 1UFUA 4AEIH 5CBAA 3F8UB 1CXIA 4JFEA 4NOFA 3T04D 3U0PA 1YEHL 4F58L 4Z7VB 4UT9H 5D70H 4XPHL 5INCA 3QCUL 2GSGA 4AENB 1FG9C 1V5JA 4QRSA 1MCPH 2R1YB 4IHOB 5DD3L 4E41A 3S37X 1B4JH 1X6NA 4QRRE 3FO1B 5I1KL 2FJFA 4F7EB 2OL3A 2J6EA 4PRNA 3P3YA 1BQLL 1EEZB 3NBNA 2UY6A 1YUHA 3MUGB 5EZJA 4WHTB 3PIQA 3KYMB 5L7XH 1QLRB 4A2LA 2XWBB 1MY7A 4IRSA 1WWAX 4Y1AB 1JPGA 5IMKA 4MNGB 2ZUQB 4NQDB 4Z5RA 4GRWB 3Q3GA 4PJ8C 1GGIL 2PTTA 1BPVA 1LEGA 2VDML 3DJ9A 4TQEL 1IGMH 2VLJD 3MJ9H 3V6FB 2G75B 1TCRB 3CZFB 3GMQA 1TCMA 5GS1B 1XR9A 5JXAH 3IDMB 1UJ3B 4U6HA 3TESA 1FORH 1HHKA 2FLRT 3MCLL 5ENWB 1DZBA 4NO5A 4QRUB 4XP4L 3MA9H 4MQ7B 1J18A 1DLHA 1XR8B 4LOUC 5C9JA 2VR9A 4LFHD 5FV2A 4PD4J 4EDXA 1IE5A 3D6GA 3ZMRA 4R26L 3RQ3A 5B3JF 4KVCH 5T1KB 4FFWD 2Z92A 2GW5A 2F8VA 4K23L 5IFAL 3JZ7A 3RU8L 1CDBA 1CFVH 3IFLH 2IFGA 3DURA 1K85A 1NQBA 5JW4N 2X7LA 1D5MB 2PYEA 3QUYD 3MXWH 3PGFL 1UZ8A 4TNVK 1ES0A 3QJHB 4NN6B 3JWDC 5CZXD 2HT4C 1KLUB 3RNKA 3TBWB 2ZSVA 1TTGA 5L9DL 5TH2B 4D0CB 5C92A 3U7WH 2NYYD 3ECBA 2OP4H 5F9JA 5DJYA 2QL1A 5F9WB 1R5IB 1A6AA 5T3XD 4QRTB 4Q0XH 1OARL 4IS6B 4O5LL 3LKPA 5IKCA 4O4YL 3MBEC 5F6HJ 2NW2B 2G5BA 3D39A 5DMKA 3GNML 4G7VH 4NJAH 1BD2A 1PAMA 3CDFA 3STLB 4M5YH 1DN0A 4X7CC 5IVZB 5F1SA 3NIGE 4HKXA 3T08A 1T5XA 1QSFA 1CXFA 1E4WL 4LQFH 1A3QA 1NFDE 4JLRB 3V52H 1G6RL 4IRJC 1G7PA 32C2A 1OB1B 2G60L 2OJEA 4EN3A 2V2XB 3T77A 5JW5A 5BOPA 4JCMA 4N90D 2GHWB 4QYOA 4XMKH 4HIXL 5EORH 3DMMB 3KNBB 1FL5B 5EUKA 1G7LB 3CFKA 3UPRB 4R90L 3PJSB 2IFFH 3O3BA 3UTTE 3FB6A 1T89C 3FQWB 2FYYA 3V4UL 2EE3A 1AXSB 4FP8H 1OGAA 2YD6A 2MHAA 2AK4E 2DQUH 2IMNA 3OF6D 2EH7L 3QPQC 1B3JA 4UT7H 7CGTA 3RWJA 1OP5K 4YBQC 4NO0B 2DBJA 5D1QB 4MS8D 3FQNB 1MVUA 6FABH 2YD2A 2RCSH 1JJUA 1DUYA 3IKCA 3CLFH 3VXMB 3Q6FB 5E94B 2VLLB 4G7YH 5J13B 4ZUUB 2W0LA 5JIKA 3GSWA 1QA9B 4QTHA 5FUCE 2CIIB 1CF8L 3QR2A 2O5ZL 1W72L 2AJZA 3QYCA 3P0GB 5E2TL 1LD9B 1S9WB 3WIHL 1N6QH 4AZ8A 1DQDH 5GRJH 4JREB 4H8WC 3SGDH 1Q0YH 4WRLA 2VC2L 5CD5C 1ED3B 4L4VA 1CDJA 1NDGA 3S37H 3TVMB 1QEWA 43C9A 2PN5A 3EO9L 5KZCD 3UJIH 4LSUH 1RZFL 3DXAE 4E5XA 4IOFC 3R8BB 3QHFH 4OKVA 1IGJB 1YY9C 3IDNB 1NKOA 4IRZH 3EO1A 4NQEB 1G7MA 4DKEL 1FZJB 2OL3H 2ZUVA 4PJCA 3EFFB 4LCYB 4XGZA 1U8HA 4GQ9L 4HEME 5F7WC 5J12B 1F11B 5HGHB 1EGJA 4TSAH 5J4MA 1TZGL 5C6TL 5DVMA 4X9IA 3HG1A 2OTUB 5ADOH 3NCEB 4M4RA 3CAFA 4Q9QL 4JFHE 3SEPA 1JYXA 4PJ8A 4H26B 2HJKA 4G8GE 5D7LB 2ZUQC 1F90H 4WI6A 1RUML 4KC3B 2R2HA 2UWEB 1SEQH 3W82A 1UT9A 1FDLL 5FKPB 1A2YA 1XGQB 3RNQB 5GS1C 3GJFK 4HK0A 1UJ3C 3DHJA 3ZKXB 4OV6F 4H25A 4Y8DC 4QHMA 4LLDB 3VG0L 1CLOH 1N2RB 1Z9MA 2QADB 4E42B 1MPAH 1F6LL 2HA1A 5HGBB 4LFHG 2Y5TA 2X42A 2KKQA 3R0MA 4JFFA 4HLZG 1RZJC 4GG6E 4PJ5D 3ULUD 3F6IA 3VE0B 5GJSH 1V05A 1ZHNB 4PP2A 1U3HD 5IFJB 1UB6A 2AI0L 3TIDB 1VEOA 1CE1L 4Z9KB 1OWRM 4NNPH 2WANA 5KOVC 3TV3L 4L29A 2Z8VC 4BUGA 5KVDL 3T3ME 3MV9B 4KKAD 3D5OF 1T66C 1GOFA 3WUWA 5LGJA 1S9KC 2Z91A 2Y1VA 2F53B 3K2MC 5A3IC 4ODWA 3UPAA 4NN6C 3S9DB 3MLSL 1KEGH 1JZ3A 3ZSSA 3EOBA 3HCVB 4UMGA 3RAJL 4Z0XB 5KANG 3F65A 4NM4H 2Q7YA 4YXHL 3STBA 2Y07H 1IGTA 5F9WC 3QO0B 2IAMB 4U1GB 4G42A 1Z0NA 1ZT1A 3VU2A 3MBEA 4G80B 4I3GA 3HC0B 3V8OA 3DX9A 3P40A 4YO0B 3QUKA 4RRPA 3V5DB 1NCNA 2YPLA 3VH8A 5CLTA 2X41A 2Y7QA 3O4LB 3QQ3A 5BZDA 3UYRL 3KJ4B 3TCLA 3C5SA 5LGHL 1CS6A 3ORJA 4OAWA 4IRJA 5GS0H 4EEEA 4I77L 1PY4A 1U8NB 3MV8E 4HCRA 1MWAA 3L9RB 5CZVL 5CEXA 4NM8L 4ENED 2XT1B 2YZ1A 3B5GA 4H20L 1FNFA 1SEBA 4OI7A 4EUPA 4I9WD 1FO0A 3DMMC 4XTRD 4HIIB 5F7MC 4FNLL 3ARGA 3D3VA 3WCYA 4JRXB 1K2DA 4KRPB 3QUZD 4J3TA 2H32B 1G7JA 5I19L 3G6JA 1CGSH 4RIRA 1IM9A 5KS9B 3BO8A 3FT4A 3VFVA 3HMWH 5B8CB 5ID1B 5C09E 3L7EB 4F7MA 3C60B 3WNPA 5EUOB 3IAQA 2XFXA 3HNSH 3SDCA 3MV7E 1HSAB 3QXVA 3CVIH 1EX0A 2IPKB 5D1QC 3QHZH 4I2XA 3E0GA 1EJOH 2FJHB 4YHMH 2DQJL 2KQMA 5EBWA 1T83A 2QHLA 3AU1A 3C2AH 3PWUB 1MCLA 5ALBH 1V7MH 1YA5A 1T21B 1ZWIB 4P59H 4WUUA 4TPRH 4ZPTB 5FO9A 3OJDA 5J13C 5CWSA 4RAUA 1WICA 1MUJA 1F4WH 1N6UA 4K3GA 4G9DA 5GRXG 4QRPD 2DDQL 1YEEH 2GIYA 1DVFB 3BEVA 3VGFA 3P4NA 2DQTH 5T3ZD 4QGTA 2ILLA 1JGUH 4M5ZL 2ADFL 4R7DA 1UACL 2B8OT 2H45A 3UAJD 3EOTL 3IDJA 1CG9A 3NAAH 4UILL 2CDGA 1AR2A 5C0CA 4JREC 4M7LT 2DQCH 3OL2A 3U0TA 2JIXD 3F5WB 2XIDA 5E6IB 3IVKB 1HKLL 1MHEB 3FB8B 1CGYA 3TVMC 1ZANL 2FD6L 3LPGA 4Z7VA 4JZJB 4TTDD 2G9HA 4HLJA 4ODTH 1EPFA 4CMMA 2R1YA 1JZ7A 4PYGA 2YRPA 1GGCH 3WKNA 3WXVH 1KNOB 3MMEA 3L5XL 4PYHA 3LQAH 4XWOC 1EGJH 5AZ2H 1FJ1A 2LU7A 1NBQA 5J12C 4K3DL 4HPYL 3EHBD 3MUGA 1W8OA 3VI4E 3VXSE 1ODAA 4G6AC 1T2QL 3QFJA 3MXVH 4P2CG 4Y1AA 2IGFH 3D48R 2X70A 1N7MH 4NQDA 4MQTB 2FSEB 4DAGH 3ARFD 3BP4B 4OLWL 3S88H 1N5YH 2P5EE 2ICEA 4JQIH 3CPLA 3AB0B 2G75A 1TCRA 3CZFA 5GS1A 5I1DA 4MAYA 3RUGE 2MWCA 3PP3H 1UJ3A 3BE1H 5DEZA 4H5SA 3KJ6H 5CJQH 4Z77B 2DLEA 4ONFH 2B1AH 3ZKXC 4UNVA 3NA9H 4GJTB 2Z8RA 3KG5A 2O5XL 5DRNA 5ENWA 4M4PA 4QHLB 1L9MA 3SOBH 2QADC 5A1AA 1XR8A 4R96B 5DMIH 3DNKA 1T6VN 4G9FB 4LHUD 4OBSA 5JHDE 4B0MM 5F7KC 2SEBB 5M94B 3RDTD 5T1KA 4WI5A 4R4NC 3ZYIA 4AEHL 1E6OL 3AROA 1JUFB 5TF1L 1YEFL 5FKAA 2J1KA 4JHWL 3JWDH 3QULB 1T5WA 3V5HA 1XAUA 2RAMA 3QWRD 4LSSH 5HXMA 2DLIA 1YEGH 1NCUA 1CLZL 3TBWA 3UROR 3RTQD 4D0CA 4HWZB 1N59A 4C56B 3X3GH 1MCOL 3ZDYE 4NOBA 3VMOA 3RVUC 4YGVB 4WY7L 3CMOH 2A6JA 1R5IA 3LV3A 4J6RH 5EWIL 2IAMC 1KIUA 4U1GC 5BRZB 2NW2A 3B2UC 1TQCB 1ADQA 1A7BA 2Y36H 3STLA 2HLAB 3GUTB 3TYGL 2XZAH 2R1WB 4R3SB 3ARZA 2XG4A 4XNZB 4JDTH 1LDPH 3T0EE 3KJ4C 3ROOA 4NT6A 4HCRH 4OIBA 5B4MD 3QIBD 2J3SA 3ZYJA 1WQVT 3LKQA 5DVNA 5F89B 4EUPH 5D2LF 2MQ0A 2FRGP 1FO0H 2C1OA 4WEUD 4XCCL 1JHKH 4DCQB 3VWKA 3RKPA 4APQB 3WL9A 2BX5A 3DMMA 3KNBA 2J4WH 4YX2H 1FL5A 1G7LA 3TH3T 1RVFL 4PP1D 3JV4B 2GTWA 4KPHH 3SQBA 4KI5D 5JUEH 4X7SL 3SGEI 1AXSA 5ETUA 4KRPC 2ZJSL 1U8QA 3L3GA 4XBEH 1QKZL 1QHOA 4Z7UE 5K9QG 2PO6B 5CP3A 3VI3F 5B8CC 3QIUD 3LCYA 4LLQB 2LAGB 4NO0A 4NZJA 3C60C 2FHBA 3KPOB 2IANA 1HQ4B 2H41A 4N8PA 3LIZH 5IHUH 1D9KB 1YNKL 2CKNA 2EXWD 2R29L 3ALWA 2H3NA 3T0XA 1VGEH 3IJSB 3Q6GH 2A6KA 5TDOA 5ICYB 3U9UA 2VLLA 1G7IB 4ELMA 1A3LH 4ZUUA 3HUJE 2VLKB 1BBJA 4ODUA 2XOTA 2BOBB 1WFOA 1MJ7L 2AV7B 2CIIA 1GPOL 2GJ6E 5I75B 4XHJC 1DVFC 1UCBL 2CKBB 4GAYB 3ZHKA 2H2SC 3GZKA 2VOTA 1S7TB 3K4ZA 1I7TB 4KJPD 1C7TA 3CFEA 2A6IA 5F3BA 4CBPA 4X9HA 1KJVA 5I8OL 3HZYB 1S5HB 1YPZE 5E6IC 4PY7B 3PV7A 2X05A 3TVMA 4I0PB 3VXTB 2XYCA 3H7BA 5JW4R 1F3JB 2DD8H 1N3NB 4XNYH 5FECA 4JZJC 4RFOL 1YMHB 3M8OH 4U33A 4HIEB 1MCJA 4TSBL 4NQEA 1FZJA 3MRIB 3FKUS 3CH1B 1QSZA 3VXRA 2OTPA 3MCKA 3H6JA 3C6LB 2OX5A 4YE4L 2BHYA 1F11A 5AZEH 2C4FT 4NFDA 1IC4L 1U2HA 4Y89A 4QNPF 3BN9C 1FIEA 3OAUL 1CD9B 3PWJA 4GRWH 3ARDD 5FAAA 1KTLA 5DK0B 4JRYA 1LO0L 1TMCB 5HYSG 3WFHB 4H26A 1ZA3B 3MRKB 3HI1B 4JN2B 1V8HA 2UWEA 4PRBB 4HS8H 1RZGB 5FKPA 3AB0C 4TVSa 2C7UA 5AYUH 1XGQA 3SDXB 2Y5EA 5C2BH 4JANB 4UV7H 4HG4J 4LLDA 5F7LB 4PJAB 1N2RA 1LILA 2YWZA 4LPVA 4TNWF 1JIBA 1RZJH 3RA7H 1CDUA 1T7VA 2YKLL 4E42A 5HGBA 4M7KH 4LHUG 5EIQA 2XTJB 3NFPB 5F9OH 4RNRA 2OS7A 5FHBL 3VJ6B 5HI4C 4J8RB 2RGSA 1RHFA 5D7KE 3TIDA 5IFJA 3DRTB 3MRGB 4TOYL 2WUBH 3VXPB 5E2WL 1WBYB 3MLYL 2B0SH 3AY4C 3V7AG 5D7IB 3MV9A 3TM6A 4HBCL 5HGGS 4K94L 3NCJH 1FNHA 3SE8H 4PR5B 4HMDA 5IEHB 3OAZH 4L3ED 1UEYA 4LCWB 3HCVA 4Z0XA 2ZCLH 5EU3A 2FHFA 2R0WH 5EZLB 1MCRA 1FV1B 3OKNB 15C8L 3GJEB 4YHPA 2YZ8A 5D6CB 1WWBX 5A2FA 4NQCE 3MCG1 1ZGLM 4OV5B 2EC8A 4G80A 1FN4B 3LKRA 3MOAL 1MCQA 3I6GB 4BQ8A 4NKOB 4HIHA 1TQCC 2HFEA 3ARVA 4MA8H 5FYJH 3WHE1 2FGWH 3GBLA 1L9NA 3O4LA 5DZNA 4XNZC 4M62H 4RMRA 1LDSA 3IDGB 3B5HA 1MIEL 1QLFA 1SY6A 4AEIL 4KV5F 1U8NA 4LLMB 5JOPE 1XZ0B 3L9RA 2FZ3B 4UT9L 5D70L 4M9PA 5BMFH 4APQC 2C1PB 1BJMA 2LFGA 4N0FB 3V6BR 1MCPL 4NBXB 1TIUA 4JRXA 5FA3B 2H8PB 2HRPH 1B4JL 3QHTC 5CP3H 3GHBH 2OXHA 4N0UE 3WIIL 1OP9A 1ND0A 2PO6C 2VLJB 3O45B 3UYPA 3B9DA 3C60A 4Q74A 1OTUD 2R0KH 5L7XL 3QDJD 2IPKA 5HI3D 4TNVF 1D9KC 4M7LL 3EZJB 2FJHA 3T65B 4O58H 1N26A 1LO5B 4RAHA 4JKPH 1MRFH 5E24E 4ZPTA 1IGML 3MJ9L 3LN4B 5IMLA 2NCMA 2WBWB 3G5XB 4OCSH 2VUYA 4PV9A 4LHQB 4S0TD 5I75C 5JXAL 4Z7WF 1A6ZB 4XMLH 4OQ1A 1FORL 3MA9L 3IFOB 5D7JD 4OLZH 1RULH 1KXQE 1WWWX 4PJDF 5DO2D 3F5WA 3MODH 4X7DC 4WHYG 5E6IA 3IVKA 2VISB 1MHEA 5DJZB 3NCFB 1T1WB 4ZMAT 2HVKA 4I0PC 1QNZH 3LKNB 2ADIB 1CFVL 2MCPH 4ODHH 1J0KA 2ATPB 3IFLL 2HFGH 1KENH 3TPUB 1X5YA 2VWEC 4X6BA 1ZLVH 2I9TA 3SDDA 4M61B 3MXWL 3RGHA 4IIQC 2VDRH 1JZ5A 2P47B 1M71B 4DFHA 1AQKH 3C6LC 2CDEB 4IJ3B 1VFOA 5E4EB 1ZLWH 4OIIH 4L4JA 3HB3D 1IZJA 1F6AA 3U7WL 5KJRH 2H9GB 3CJJA 2OP4L 1EK3A 1TETH 2W0FB 2YS4A 4HT1H 1TPXB 4BA8A 2JCCF 3THMH 1XF2B 1IZKA 1YN7B 1GC1C 4Q0XL 1QLEH 1F58H 1A9BA 4WCYH 1GHFL 2FSEA 4G7VL 3BP4A 4FMFA 4IOSD 4L4TA 1Q9LB 2Y23A 4NJAL 5HVGB 3BIKB 4M5YL 4UQ3B 1A1OB 4EDWH 4Y5VB 4Z7NF 1U8OB 1BZ9B 1BLNB 4WFHD 5SWSE 3UTZB 1JP5A 4LQFL 3SKMA 2XKSA 1YYMH 3V52L 3RJDA 2IG2H 1QFPA 4FQXD 5C08E 4Z77A 1KB9K 4GUPB 2GTZA 3PQYB 2AEIT 3PUCA 2HLFC 2BSED 5SWQB 4MNQD 5C07D 3GB7B 4QHLA 4XMKL 5EORL 3B83A 4R96A 1WIOA 1HNGA 3TEUA 4G9FA 3VMPA 5E03A 4OT1H 2IFFL 2XTJC 5MEPB 2SEBA 2CRYA 2CRIA 4BSVB 4FP8L 3RZWA 1OTTD 3ZDZE 3IJYA 1B88A 2DQUL 1U8PB 4F2MB 4ZUTB 1JUFA 4K3EH 5HTSA 4UT7L 3HTLX 4LARH 4FQ1H 1NC2A 3OJ2C 3RHWK 3SQOH 2A0LC 1P6AB 3MGTA 3RVVC 1Y18A 2EH8L 1I9EA 1H8SA 3G04B 6FABL 3TJHD 2RCSL 3RGVD 3PP3K 4KY1L 3MR9B 1K4DB 2GFBB 4NYLB 4HWZA 4AT6B 4G7YL 4KMLB 2VR4A 5D1XB 2HTKD 4KK6C 5KZCB 3O0RH 3DX7B 3BMVA 1J1OH 1X5AA 3DSFH 3TF7C 2E27H 5KS9E 1XF4B 1Q0XL 1DQDL 5AWNH 2HLAA 4U6TA 5GRJL 4CN1A 3GUTA 2AAVA 3UEZA 1Q0YL 4R3SA 3DVIA 1SY6H 1YNLH 2EIDA 3HE7D 4X6FA 1LWRA 1D5BB 4I3SH 3S37L 1J7VR 2ICWJ 2IJ0C 3GSRB 4Z76A 4BH7B 5I8CB 1KTDA 1UB5B 3O2DA 3UJIL 4LSUL 4XP5H 2VMFA 4DCQA 4APQA 1PG7W 1L6ZA 3QHFL 4PRPE 1Q8MA 2DWDB 5EB9A 1NAMB 2QLVB 4IRZL 4OCLC 2OL3L 2VABB 2XQYK 2J6EL 3ZT7A 3S6CA 4BFIB 4KHXH 4UT6H 1EUTA 4EI6B 4WGVB 4YHKH 2M26A 1A9EB 2PO6A 1ORSB 3SKNA 4TSAL 5F1IA 4LLQA 4U1KA 3TNNA 4I5BA 5J7CC 1NH6A 4YHNB 5ADOL 3T4YA 1D9KA 4HIJB 3VCLB 2ICWB 4XVUD 5ITBH 4PJBB 2OXGA 3L95B 1KCRL 4LVHB 3GMOA 1TTFA 4X6DB 3TYFA 1F90L 3BKCH 1C08B 1CLCA 1PQZB 1SEQL 4MHHI 4OZIF 4KROD 1G7IA 4NO3A 4PJ5B 1LP9F 1QSEE 2DYPD 3X12B 4FFWC 5H2BB 1X5HA 4WWKD 4KMTH 1FFNB 4YWGL 2CKBA 4URTB 4GAYA 1JWSB 1DBMH 4WW1B 3BYYA 1OF2B 1FH5H 1WBXA 2M1KA 2VKWA 5E9DB 1CLOL 1I7TA 4KUCD 2EZ0D 5CSGA 1EBAA 1EMTH 3QUYC 3DLQR 4OD3H 1MPAL 1JNJA 3W0WD 5EU7E 4NO2B 3HZYA 2FECI 3WFBH 1S5HA 3SY0B 5CZXC 4WTWA 2NY2D 1HILB 2JKXA 3UBXG 2NYYC 2VLRE 2Z9TA 1FPTH 1J1PH 1YMHA 5DJ0A 1Z9OA 4IIQA 1QRNA 3D2UA 2VH5H 1ZEAH 3VXUE 5JIIA 2A6DB 1KEGL 1HXYB 4Z0BH 4IJ3C 5E4EC 4OCNC 3QNZB 1KYOJ 3H8NA 4NM4L 4JFYA 3CCHB 4W4NA 1FSKB 1TPXC 3PWVA 3RKDD 1FVDA 2Y07L 2CUIA 3FFCE 4YBLB 4FFYH 5DJCB 1Z3GH 5C0BD 5DK0A 4LMQE 4CDGC 5DF0A 3MRKA 3MACH 2EDQA 4JN2A 1SVZA 3O3EA 3RL1B 2AXFB 2P5WA 1H3PH 4RWYL 4Y5VC 4P2QE 3GSQA 4HUMB 4YGAB 3QBTB 3QUZB 3D85A 4PJXA 2IH1B 4Z78B 4C57C 5GS0L 4JANA 5EU5B 2VXUL 4PV8B 4NNYA 1JF5A 5DUPL 1IBGH 5GRUH 5LQBH 1HQRB 2C26A 4OLXL 4MS8C 1TVDA 3MPCA 1S7UA 3V95A 4ORGB 4YC2B 3LKSB 1CGSL 3DRTA 3OMZA 3MRGA 2AEQL 3R4DA 1TNNA 3HMWL 1XIWD 2EDLA 4JVWA 4QOKE 4NRYB 4QRPB 5GS2D 3GRWA 3NCMA 2BNRE 2VDNL 4RMTA 1JGLH 3RIFK 3CVIL 5T1LA 3FAXA 2FWOB 3QHZL 4Y19D 1CBVH 2GCYB 1EJOL 1ZS8A 1SYSB 4ZAKB 3RL2B 4YHML 4LCWA 3C2AL 3IT8D 5ALBL 1V7ML 5HDBF 2C4FU 2HH0L 1AC6A 4P59L 4I4WB 1LO3H 5EZLA 2JIXB 4TPRL 4L9LB 1F4WL 1KCKA 3T1FB 5DQ9B 1YEEL 5D1XC 4TN9A 4LGSB 4OI9A 1JGUL 1NMBH 2QSCH 2DQHH 2QJDA 3LEXB 3NFSH 5C0RH 4NKOA 4PJHB 4U05A 3NAAL 4N1EA 2ZPKH 4RISH 3TH2T 2DQCL 1AHWA 3O2DH 2J8UA 2DKSA 5GGQH 5C0JB 3D25B 4KMQA 4LLMA 4LEOA 2GSIB 3BP5A 2VAJA 2FZ3A 5GRYA 3GEWB 3WJJC 3RWCA 2EE9A 4PD4K 3ULVD 4ODTL 4N0FA 1K8DB 3BD4A 5HYSB 1GGCL 2H8PA 3WXVL 3OGCA 2Q86B 1NMAH 3LQAL 3IRZA 5AZ2L 5GZND 4G43B 4HFWB 4JFEE 4Y4HD 4EOWL 4U1MB 1A7QH 2D4DA 4BQBA 5J1SC 1GIGH 5EU6D 4FABH 3MXVL 4XCEB 3BDYL 2IGFL 4KGLA 3QXAA 2VE6A 4LVHC 4ZUVB 4DAGL 1LO5A 2EDDA 4UB0H 3S88L 3D0LB 1N5YL 3BYTA 2OZ4A 4LHUB 4JQIL 1QFWI 3ULUC 2CKBH 3RDTB 3ME0A 3HS0B 3G5XA 1NGYB 4HJJH 3TA3B 3BE1L 3KJ6L 3QQ9D 4ONFL 1RUAH 5D6DC 2B1AL 2X4OA 1DCLA 3D18A 5KVMC 3RWGA 3QUYA 4KKAC 4XC3L 2YPVH 4X7EC 3SOBL 1RJLB 5DMIL 4TUJB 4U1JB 4ZFOB 4JPVH 1F13A 1G1CA 1T1WA 2V5TA 3LKNA 5HYJD 2ADIA 3BWAB 1G9EA 1BREA 4KK9C 3EOAB 2AJUH 2AJ3A 1J8HB 3DX8B 3I2CH 3TPUA 4HUWB 5IR1B 4XAKD 3JWDL 5BVJA 1F4YH 5IBTH 4LSSL 1YEGL 1M71A 1SQ2N 2VL5B 1T04B 2WQRA 4UI2A 4CDHA 4WW2F 2F74B 3NABL 2OCFD 3TBTB 3X3GL 2H9GA 1ZLSL 3SE3C 3O6MH 1FSKC 3SE9H 3CSGA 4XPBL 5DQDH 3CMOL 2PYEE 4J6RL 4YBLC 4S1RH 2BRQA 1SMAA 2HTLD 4WO4B 4BQ9A 3QA3B 1ZT7B 2NXZD 4M3JA 4ENEC 4GS7B 4PLJD 2Y36L 1ZT4B 1Q9LA 1CD8A 4P23D 5D2NB 4UQ3A 4Y5VA 1CGUA 4XTRC 2XZAL 1BZ9A 4Y16D 1BLNA 1MLCB 4QRRD 4JDTL 1LDPL 4Q97A 3UTZA 3QUZC 4HCRL 1MWAL 4LLUB 3MRBB 5CHNA 1MF2H 2PNDA 5E8EB 3CDYA 1FO0L 4DZBB 5IBUG 1JHKL 3QIUB 5SWQA 1EZVY 3GB7A 5IHZB 3RWEB 2W9EH 4JFOA 2GYSA 1TVBB 2J4WL 4YX2L 5EO9A 1NBVH 5JIPA 4KPHL 5MEPA 3VFTB 2ED7A 4F37K 4K2UL 1I4FB 5KW9H 5EIIB 1R3HB 3AMLA 4XBEL 4YC2C 4NZTL 5TQ0H 1U8PA 3GRWH 2QEJA 4ZUTA 1NBZB 3R8QA 1I1FA 5GZOD 3O4OB 1IKFH 4HUKB 5D5ME 5FYKE 4POYA 2UYLB 1KUMA 2CR6A 3LIZL 5IHUL 3G04A 1H3UA 1ZMYA 1XGRB 3LH2H 4ZAKC 1VGEL 3UAJC 1Z5LB 3Q6GL 1FFQA 2COQA 2GFBA 2YD1A 1T20B 4AT6A 5CAYB 3RWIB 1FNSH 4MXQD 1A3LL 3QDAA 4L9LC 5KSVA 4M9OA 3OPZH 1KB5B 1UC6A 3WO4B 3PNWB 3DX7A 1DBKH 3GMMB 2VQ1B 4ZSOB 1BX2B 4TTDC 2AJYH 4WV1B 3TO2A 1XF4A 3ARPA 4AK1A 1OAZH 3VFPB 5INDB 2YEZB 1Q9KB 4KU1A 3GSRA 4OZGE 4BH7A 1EEYA 5I8CA 1UB5A 2F54D 4N5UA 2DD8L 4XNYL 1J05B 3WJJA 3EHBC 5JLZB 2DWDA 3GKWH 4X6EA 3ARDB 3K8LA 3RVXD 1X44A 1UXWB 1BHGA 1F42A 1LVEA 1KBGL 3MRCB 3TFKC 4XVTH 4QY8B 3ARFC 4EI6A 3HZMA 1QG3A 2GITA 1A9EA 1II4E 2RQ8A 5AZEL 3DO3A 4XWGL 4HS3B 5E8NB 5GGVY 4JFPB 3MJ7B 2VAAB 3RY6A 4U1NA 1KXVC 4YHNA 4PJEB 5IK3A 3MBXH 1Y6NR 3VCLA 5DI8A 1BQUA 1JRHH 2K7PA 4FXGB 5ISZD 4K9EH 2OZ4H 3C8KA 2WINA 5C0FB 2KZWA 1C08A 3B9EA 1B0GB 4XCNB 4KJWD 2AEPH 5HYFA 1IKNC 4P49A 2FIKB 3UTTD 4HS8L 1K5NB 4HHAA 2CO7B 3RDTC 1SYVB 5AYUL 2XNAA 2LE9A 4O2FA 5CGMA 1U3HA 2AK4D 5C2BL 1JWSA 4WW1A 4PLNC 4UV7L 4ZPVB 1OF2A 3S8WA 1C5DB 1JRHI 1X4XA 3RA7L 3VD5A 3FO0H 2XPGB 3U9PH 4M7KL 4NO2A 4LLWB 3SY0A 1A7RH 5LBSL 2I5YH 2F5BH 3DECA 2L4OA 1SJVA 1FL3A 1XH3B 4AH2A 1FNLA 1IEAB 2WUBL 5T3XH 1H3WM 2XN9A 2HFTA 4Y5XB 4MJ4A 3FONA 3MRDA 4JG1H 3NCJL 3SE8L 2X1WL 1ZKAA 4LVOB 5EN2B 3EDKA 2A6DA 3JV6A 1HXYA 2EECA 3PQYE 5DRXB 1NCDH 2ZCLL 4JQVC 2R0WL 1ZOXA 1CFTB 4HULB 3SE3A 4YAQB 3LRSB 5IW6A 2EDBA 2E6JA 5SX4I 5A43C 4J23A 5B4MC 1OAXH 5DJCA 3S35X 1QO3B 4X8XA 1ADQL 3WD5H 5C2UB 1KCSH 4MA8L 3WN5B 3CUPB 4GS7C 5FYJL 2BCKB 2FGWL 4JM4H 5F96H 5D2NC 2DL2A 3V0AC 1EV2E 4QRQA 2ZCKH 1INQB 2OTWA 4KI5C 3QUZA 4X0KB 4M62L 4ZO7A 4Z78A 2MPAH 4RZCB 5ANMB 1OOAA 2H2PD 5EU5A 4X4XB 2D0HA 2NW3A 5GSRA 5BMFL 3QIUC 3AM8C 3PHQB 1VFAB 2YPLE 5IESH 3QDJB 2OK0H 4M7JH 3RIAK 2EXWC 5AG9A 4BZ1L 4JFHD 3MO1B 4FG6D 2HRPL 3ARXA 4G8GD 4GBXD 3L3IB 3N85L 4ORGA 3IU3B 5A16B 3GHBL 3LKSA 3OKMA 1MEXH 1NGZB 3O4OC 4ZFFB 1ROWA 3KR3H 4X6CB 4ESKA 2R0KL 2FWOA 1PKQE 1BVZA 4PRIE 2J8OA 2ZSWB 3D3VE 5L2KA 3RL2A 2EDFA 2VZVA 4O58L 4ZYKB 5EOCJ 4JY4A 3UTSA 4JKPL 5CBEB 5D7JB 1MRFL 4I4WA 3BGMB 2JIXA 3PL6D 4L9LA 2AJSH 3RX7A 1AY1H 3SKJH 3T1FA 4OCSL 4EZMA 3WO4C 1MCSA 3KPMB 1RZIB 3UBXB 1QFHA 4ZOCA 1X9QA 3NACH 4I2XE 3LRGA 3EYFB 4PB0H 3LEXA 4XPFH 3AS2A 1NL0H 2WSKA 1JYVA 4WV1C 4PJHA 1PG7H 5IF0B 4MJ5B 4F7CB 4TUKH 3BZDA 3EZ8A 4OLZL 2HMID 4PJIF 1RULL 2ADGB 4NUJA 1U58A 3MODL 1FL6B 4QGYA 4PJCF 1I3GL 4OCRH 3DI3B 3NOIA 1I8IA 2DMKA 2ZWLT 3D25A 4I48B 1QNZL 1MHCA 4Q9BA 2MCPL 4ODHL 1KENL 1N64H 3QCVH 1MFNA 2PW1B 3NZ8B 4LSPH 4W4OC 3DVNB 1U92A 1NGQH 1AKJD 4MLIA 1PYWB 4QHNA 2VDRL 3ARDC 3L5HA 2MFNA 5HYSA 4P5TA 4FQPA 1QR1B 5FYJU 2D03H 2A38A 1I1RA 3ARFA 4JHAH 4OLUH 1AQKL 4RMVA 4N1HB 3WNMA 5DD6A 2R56L 4G43A 4HFWA 4OIIL 3C6SB 1I7RB 5KJRL 2IALA 1TETL 4U1MA 5F7UA 3JXAA 3RHWF 1HK6A 3THML 2XWJB 4JM2B 1F3RB 2YD4A 4NKDB 4FQXB 3MV8D 4XCEA 1QLEL 1F58L 3ZDXF 1XF3B 4ELKB 4WCYL 4MNQB 5C86A 5C07B 4ZUVA 1AR1D 4WU5A 3ULUH 4QCIB 3QJFB 3D0LA 1MCFA 4EDWL 4LHUA 1FZKB 1XMWA 1EHAA 1BEYH 1NGYA 4GOSA 1S7VB 3QFJE 3WJLC 5FGCB 5C09D 1YQ2A 1W0VB 1B0RB 2YWYA 3MV7D 4ZS6D 1RJLA 2EIBA 3QWRA 1AJ7H 1FC2D 4OI8A 4TUJA 5MEQA 4U1JA 4OT1L 1JNHB 3LQMA 4ZFOA 4PFEA 35C8H 1Q9WA 1UENA 3F7VB 2Z8WC 4XVSH 3RTQA 3MRQA 2CXKA 3BWAA 1PSKH 2A1WH 3G5VB 2HT2D 2VDLH 1DTUA 1MFCH 3U4AA 4F80A 4LARL 4NIKB 4FQ1L 4YHLL 3BIBX 3SQOL 3P4LA 4Y5XC 4R7NB 4PRDB 3T0WA 1VEPA 5E1AA 3S35H 4PJFB 1QSVA 3LHPH 1DL7H 4LVOC 5HPMB 1T04A 4G6FD 3HR6A 1ZVHA 3MFFA 5FGBC 4FQLH 2F74A 3KPQB 3OKLA 3VMNA 1G0YR 3TBTA 4Y4FB 2QQKL 1P5UA 3K1KC 3MYZA 3TBYB 4MLSA 1QRKA 1S9XB 4AQOA 1DEDA 1AP2B 3QIBA 4HUXB 1ZVSA 4POUB 5MEOA 3O0RL 5CJBA 4O51A 1J1OL 3I3EA 3DSFL 3A0OA 1ZAGA 1JYWA 4A2MA 2E27L 3WN5C 5AWNL 5D2NA 2FR4B 2Y4SA 2QR0B 1G9NC 4V1DD 3GSXB 4XP9H 1AXTH 2FGZA 1SY6L 1YNLL 2EYSB 4U7SA 3FOMB 3B2VH 1IM3A 4I3SL 5DHVB 2NY3D 1EAJA 3G6JF 1WISA 2EO1A 5E8EA 3B6SB 3EW3B 4XP5L 3EGSA 4JHZA 3QIUA 5JNYB 3VXSD 2EDNA 3AM8A 2CUHA 4X4MA 3RWEA 2NY1D 1Z9LA 4HX1B 1JPST 3HC4H 1AQDA 1OAUH 2QV2A 3VGAB 5K9KB 2MNUA 3Q1SH 5HI3C 1G6VK 5CD3A 1RZ8B 3AMKA 1KULA 1U2CA 3FRUA 5FYJE 4CU7A 2EICA 1XCTB 5IUSA 5EIIA 1FBIH 2R2EA 4UIMA 4UT6L 5K9QI 4NZRH 3FQUB 4YHKL 2P5ED 3MGOA 1GAFH 5CIPB 1NBZA 1QHPA 1XGUB 1NAKL 5T3ZH 5D8JL 3UZVB 5DD5H 3AS3A 4WWKB 2FBJH 5DFTA 4NDMB 2UYLA 1Q94A 2HT4D 1DUZB 3S3SA 5ITBL 3VWJD 1EUUA 1XGRA 1Z5LA 3BKCL 3SKOA 1OGTA 1T20A 2WIIB 3W0WB 3LDBB 5JHDD 4Z8FH 5D7JC 1IT9H 2FECL 1J87A 3LKOB 5DO2C 1A6TB 1B9ZA 2NY2B 4KMTL 4PRAB 2IANE 1WAAA 4PLKC 3JSSA 1DBML 2VQ1A 2C9AA 3C2SA 1BX2A 4ZSOA 1FH5L 4Z7VF 1R0AH 4FQHB 2BSTB 4WV1A 4DKAA 1EMTL 5KSBB 2V9QA 4LKCB 3ZTNH 5I73B 1MIMH 1NGPH 3PXHA 3GJFB 1HEZA 1G7QB 2YEZA 4ELME 2V17H 3WFBL 2YD7A 4Y88A 4LAQH 5I66B 3HA0A 3DV4A 4HG4K 1YEDA 4XX1E 5F7DB 1DQTA 3HB3C 2GAZB 5J6GB 4JDZB 4FTVB 1FPTL 1CXEA 1J1PL 5JLZA 2J8HA 2AGJH 3HRPA 5DVKA 1EFXD 4FQJH 3ARDA 4MXWH 5DXWA 5C0BB 2VH5L 1UXWA 1ZEAL 2VLME 5I74B 4GRWF 4Z0BL 3V4VH 1KACB 1VHPA 2ZNWA 4ODVH 3MNWA 5HY9B 1YC8A 3QUXD 1HHIB 4GRMA 4RA0C 3N50A 1S9YA 1EZVX 3T3PE 3RIFF 5FM5M 4PJEA 3G6DH 1NCCH 1JPTL 4JM2C 4FFYL 5C7XH 1EO8L 4FQXC 3FO2A 1UQSA 3QRGH 3HNVH 2V5SA 2Y9RT 4FXGA 4HH9A 3VXRE 4OB5H 3I02B 1R3KA 3L5WA 3MACL 5C0FA 4XCNA 4WGWB 1I9IH 2FIKA 2DJ4A 1K5NA 3B43A 2BY2A 2Q8AH 4FMKA 4WFGE 1TNMA 3RY4A 3S5LG 3C09B 1CE6B 3BPOB 1FYTE 3H9ZA 2OR7A 5DQJB 3VFUB 4HWEH 1FVEB 5F8QC 3WJLA 3ZE0E 4YHYB 2PXYB 3BWUC 2W60B 1IBGL 5GRUL 4PJGB 3UTOA 4L9DA 5IM7B 4LCUA 4B7IA 1I8LC 4LRNH 3TZVD 3ILQD 4Y19B 3EYSH 4L3EA 5DK2A 4CAGA 5MI0B 2ZOKB 1IEAA 1NCAH 1OT1A 3IF1B 3MYJB 1I1YB 4S1DD 2GJ6D 1A4KB 1JGLL 4QXTB 1V7NH 2HTKC 3FOLB 4JPKH 3RVWD 1ACYH 3LQZB 1M05B 5EN2A 2EO9A 1CBVL 3P9WB 4CMHB 3JTSB 2E7LC 3U7AA 5DRXA 4ZOAA 5JDSB 1LO3L 1CFTA 4Y4FC 4YAQA 3LRSA 2MKLC 5E8DH 2LV4A 2GY7B 4PJ7E 4FA8A 4WI7A 12E8H 1QO3A 4LLVB 1J88A 2DQFA 1NMBL 2QSCL 2DQHL 2RIKA 3NFSL 5C0RL 2UZYB 3WN5A 3KDMA 5CSZB 1DBJH 3CGTA 2VZUA 2P7TB 4Y2OA 1UVQA 3O6FB 5I9QB 4RISL 4Y4KA 2DQGH 5J11B 1MNUL 3O2DL 4Z95L 1KCVH 2CMRH 5GGQL 2BNQE 4M6AA 1QTYT 5EBGA 1INEH 2VUOA 4X4XA 2P8MB 5I1EH 3IETB 4OCYH 5KVGH 3O6LH 5I1AB 1MREH 2FEEI 3X3FL 5EU6B 3QDJA 1EAPB 2ENYA 5EOCL 4KTYA 4XVUC 1YNTB 3L3IA 3SGKC 1NMAL 3UX9B 5A16A 3VRLF 5I8KL 5EULV 4NNXB 3VXOA 1W0WA 1F4AA 5C3TA 4YZFE 4JKLA 4XXCA 3P73A 1A7QL 4X6CA 5DS8A 4WWKC 5SWZE 3GKZA 4FABL 3QCTL 3BX7C 4FQIH 3VD9A 2P42B 4XBPB 3U7YL 1HN1A 2EZ0C 3KYKH 3NPZB 4UB0L 4WHYH 5CBEA 3KVQA 5D7JA 5J9PB 3BGMA 3HR5B 5E4IA 3ZTJG 4IEFB 3RX5A 2CKBL 2VQTA 3EFDH 2XQYG 3MLTB 4NRZB 3ZE1E 3T09A 1DQJA 2NY2C 5D7KD 5HYJB 5IVXB 2YMXL 1F4XH 3UBXA 4BQ6A 1RUAL 1LE9B 1D6EB 2YPVL 1TJIH 3RBGA 5E99H 5I73C 4NC1C 5HGAB 2Q1EA 4JFQB 1FL6A 4ONHB 5EBLB 2ZOLA 3DROB 3K80A 4JPVL 1CI5A 1WIPA 2CRZA 3ARUA 3O11B 3TO4D 1NJ9B 2ORBH 4EIGB 5F1NB 1CL7H 2AJUL 3EAKA 3I2CL 4LCIH 4HMCA 3NZ8A 4KTEH 4NQCD 3RKDC 2NX5E 7FABH 5ID0B 3DVNA 1F4YL 5ICXB 5IBTL 1QR1A 2NXZB 1DQMH 4ZUWB 2AQ2A 4P23B 5I76A 3U4BH 2UWEF 1BECA 4LBEB 4TSCH 4Y16B 1FFPB 1CL7I 5D1QD 1EXUA 2JJSA 4U7KA 4NZUH 5DQDL 3BP7B 5HHPA 4NKDA 4S1RL 5JOPD 5C0IA 2Q20A 1XF3A 2X6MA 4G8IB 4MNQA 2BVTA 3DV6B 3QT2A 5C07A 1H3TA 1S78D 3MLUH 4QCIA 4RGNE 5BO1H 5KAQF 1FZKA 5KSAD 4PRHA 4UQ2B 2UV3A 3OR7B 3BPOC 3IU4H 1MF2L 1MRDH 1S7VA 2Y06H 3SJVB 3MRHB 1DBAH 4KDTC 4YHYC 2PXYC 2VXQH 3QXWA 1W0VA 3OKOB 2W07A 3GIVA 1YN6B 2W9EL 4WTXA 1I8LA 1NBVL 3IGAA 2EIEA 1OSZB 3RGVA 4FZ8H 1MAJA 2YBRA 4CKVX 4DGIH 2ATKA 2F15A 3PWPB 4MSWB 3X13A 5MI0C 2WP3O 3GRWL 4XPAH 3SCMD 1R3JB 4P9HC 2JJTC 4QHUB 3BPCB 4BZYA 1I3VA 2BHUA 1IKFL 1A7NH 2JJVA 4R7NA 2D7QA 3HE6B 5IWLC 4H1LG 4N68A 1OLLA 4PJFA 5E0QA 3KPPA 3EO0B 4P4KD 4K7PH 3LH2L 3BXNA 4CMHC 4C4KO 5LAXB 2JCCA 4WU7B 2O26U 2WAHA 3HE7A 3C08H 1MVFA 3OPZL 2ICCA 4M03A 1AP2A 4HUXA 5GGVH 1JPSL 4YDLB 5D7LD 2X4QA 3B9KD 1DBKL 1G9NH 5L8KB 2AERT 2AJYL 4S1SH 2BMKB 1IEBA 3ULVC 1A6WH 1OAQH 1OAZL 3O6FC 3GSXA 5I9QC 5IROC 3GMNB 1MJUH 3OJMB 1NFKA 4PJ9D 1WVZA 5EH1A 5E00A 5J11C 3FOMA 4MB4A 4DQOH 4KKBC 5GZNC 1JF1B 3B6SA 4QXGH 4Y4HC 3ZKND 3PF2A 5JNYA 4M6MH 1YMMA 3QEQE 1NFDB 1T1ZB 5EUOF 1DQLH 3GKWL 5K9KA 1NLDH 3WEXA 4YDJB 1RZ8A 3QZWG 4Z7QF 2M8XA 4BKLB 4XVTL 4GXUN 4JB9L 5FA4A 2Q76B 3UTTB 5IVOA 1XGUA 5SWSD 4OZ4B 4D94A 2NNAB 2DYPA 2F53D 3MUJA 1JZ8A 4WWKA 2AK4B 2DBLH 5C08D 4DGYH 3MBXL 1FAKT 1J12A 1JRHL 2XZZA 4F57L 3S36X 1KYOK 4K9EL 2OZ4L 2WIIA 3OB0K 3W0WA 2AEPL 3WMSA 1WC7A 3LKOA 3VFMB 5JMRA 4N5ED 1AI1H 1Q9OB 1BJ1J 1HH9B 4LIQH 1HINH 5I1IH 3W39B 2X9YA 4Q2ZA 2X4PA 4FQHA 5MHSE 4MDIA 5BXFB 2BSTA 4MJ6B 1T0NB 3LD8B 3FO0L 3DPBA 2HVJB 1RD6A 2XY1A 3OTTA 4LLYB 3U9PL 3GJFA 5CEZE 1G7QA 1IQDB 1T22B 1A7RL 1QUNA 5I66A 4DN4L 4JKKA 3UBXI 2F5BL 3MJGX 4OGYH 1UCTA 4PLOB 5BS0B 2GAZA 1HHJB 4JDZA 1UA6H 4U1HB 5T3XL 1R24B 2C3VA 4UAOB 1RHHB 2HAZA 1JV5A 1W8NA 2DWEB 4KRPD 4JG1L 1EHNA 3OKEA 5C0BA 2XICA 3P4MB 4LRIC 3DXAB 4WEBH 5B39B 4JPIA 2BK8A 2NXZC 5H94A 1CDHA 4LGPB 5D9SB 1L7IH 3DYPA 4P23C 4R2GB 1NCDL 2B4CC 4Y16C 1KFAH 3JBG7 3JTTB 4OSUH 1HHIA 3QG6B 4GSDL 4KRMB 1FIGL 2AXJA 2NXYD 1GZQA 1FVCB 4LKXA 1OAXL 3RWFB 4XNXL 2R69H 1QRNE 3K8KA 3CFBA 5E8PB 1W0YT 4OZIA 3I02A 1KCSL 1X5ZA 1UYWH 1LP9A 4BH8B 4TULH 5F96L 5DLMH 2HJLB 1MCHA 2ZCKL 1DVFD 3H3PH 4G8GB 4GBXB 2H2SD 1XFPA 1ZHKB 1CE6A 2MPAL 1ZGLB 4G6KH 5DQJA 3VFUA 4KDTA 2P8PA 3P30H 3GM8A 1XIWA 1A8JH 2W60A 5GZOC 1E6JH 2V7HB 4CW1B 4C55A 1FE8H 3W9DA 2P5WE 2OK0L 4QT5B 4M7JL 4Y19A 1A1MB 5FUZH 3D69A 3B9AA 5F9AC 5I1CH 1KGCE 1P4LB 4PJXE 43CAA 4ZO6A 1XGTA 4FQQB 4GG6B 1U8IB 3MYJA 4MXQC 4HGWB 1I1YA 1QSED 3JWOH 3FRPG 3KR3L 1CCZA 4P46D 3FOLA 3T2PA 1G1YA 5CINH 3VXNA 3HE6C 1OP5H 4XCFL 3GMPB 4P9MH 1ETZA 3JTSA 3F58H 2D3VA 5JDSA 3N1PC 1CFSA 4JO1H 1P5VA 4DOHE 2AJSL 2LVCA 1AY1L 2X10A 4UOW1 3SKJL 4J3SA 4L3AA 3T4AB 3IAGC 3CXDH 2V5MA 4YDLC 4M48L 5D72H 2VYRE 4WI8A 3NACL 4X83A 2I26N 2XRAH 4PB0L 4XPFL 3WV0A 1NL0L 1PG7L 2GT9B 5CSZA 4KJQD 4YPGA 3BRGC 4XPTH 4TUKL 1NGXB 1HHHB 1XF5A 4YHZH 2VNCA 3NIFF 5AUMA 4OCRL 1JVKA 4EVNB 4MB5A 1F3DJ 2P8MA 1S7XB 4Y4HA 4ZFGL 2VZTA 3SDAD 3IETA 3QCVL 1N64L 5KAQG 1I9JH 5I1AA 1WCQA 3FFCD 4LSPL 1QPPA 5HI4D 3PHOA 1NGQL 3MV8B 3CC5B 4NWTH 1CTOA 3GSNA 1IC1A 2D03L 3UDWC 1C7SA 4JHAL 1VKXA 3N06B 3O3AB 3SN6N 1I8MA 5TGBB 4KJWC 4YEEA 3DUSB 4U1LA 1DFBL 1F5WA 4MCYB 3S5LB 4RAVA 4NKMB 1UZ6E 5C09B 2ZUXA 3FT2B 3ZZ1A 3OHXA 1IGIL 3L7FB 4XBPA 5CJXC 4GKZB 4C56D 3MV7B 3ULUL 3UZQA 2GK0B 3HR5A 1MAML 5FYLE 3VD3A 3KXFE 1L4IA 4JGJA 1BEYL 4NRZA 5BRZD 5GQBA 3QDME 5HYJA 5IVXA 4UTAH 4M02A 2BSSB 2R4RL 1QOKA 2E8YA 4BK4A 3ABZA 4QOKD 3H9YA 3GJFH 2BNRD 3V6OE 1HI6B 3QFDA 5FUCC 1HSBB 3LD8C 2DQEH 1U95A 3BZEA 5DJ6B 3DROA 35C8L 3BKJL 4XVSL 3O11A 4TVPD 1E27A 2F5AH 2YUXA 3UJJH 5F1NA 5F8RC 1KJ2A 2VDLL 1MFCL 2R9HD 3MLXL 4KUZH 1DLFH 1UXSA 4UAOC 3ARSA 3WE6B 1RIVH 5ICXA 3V5KA 3S35L 3HPLB 1T80A 1RPQA 3LHPL 1DL7L 5I30H 2YXMA 1W72B 4ZUWA 4P23A 5D96B 5HYEA 1U3JA 1BQHB 1IL1B 1LGVA 2FX8H 2R4SH 1FFPA 4FQLL 4R2GC 4Y16A 2BC4B 3LY6A 4QRRA 5CCKH 3QPXH 1WIUA 3SDXF 2NY3B 4XI5D 5IW1A 2Z4QB 5T3XE 4S2SB 1FYHB 2YK1H 4YR6B 4Q6YA 1S5IH 2AABH 4ISVA 3VXSB 3DV6A 3B9VA 2NY1B 5D4QA 3KYOA 4AQ1B 3NGBB 1OWWA 4XP9L 1AXTL 4FG6C 1LK2B 5DUMH 4GBXC 3BHBB 2DI9A 3B2VL 5SV4A 3QG7L 2P5EB 1X5IA 5HDOA 5GS2H 1KPUB 1NFIA 2W0KA 2EC9T 3OX8B 4OFVA 2C5DC 5D7IF 3RUGB 2IBZY 4OF0A 4CVXA 5A2LH 1HOCA 3HC4L 4FFVD 1OAUL 3Q1SL 1VFBA 2DIBA 1OSZA 3VWJB 1VB9A 4HH8A 4QTIH 2R2BA 2ZG2A 1S7WB 1FBIL 4WFEE 4XBGB 3FO9A 1CFQB 4LPXA 4NZRL 4MSWA 3V9FA 4S1QH 3QNYA 1DP0A 5JHDB 3BEWA 4L8BB 1U41A 4Z7OF 4DZ8B 1BOGB 3BZ4A 3P4OB 3BPCA 4OM0L 1DR9A 3G6AA 5DD5L 1UJTA 5FUOH 2FBJL 4DKDC 5B3JE 1KIRB 3C6LD 4WW2A 3EO0A 3ZLQC 3ULSB 5EZIH 2ITDB 3T0AA 4FRWA 2FH6A 3H9SE 4Z8FL 2HMIC 4WU7A 4G8EB 2FJGB 1OPGL 1X5JA 4K3JH 5AG8A 2J8UF 3U6RB 3K8MA 4M6OL 4WENB 1UKSA 2F54A 3ULVH 4QWWD 4LVNC 4W70A 1R0AL 1J1XH 4RMUA 2BMKA 1A5FH 4X4YB 1EFXB 1FZMB 5FV1L 3ZTNL 1MIML 1NGPL 4H0IA 5J8OA 3GMNA 3MROA 3OKKA 4LAQL 5DVLA 4NWUL 5GRVK 1JF1A 3QUXB 2DLTA 3M1BB 4PGEB 3T0EB 4L8DA 1NFDA 5K93A 1T1ZA 2PYED 2AGJL 2XXCB 3GSNH 2X5PA 1T4KA 2AJVL 4FQJL 1BVLA 1WBZB 4MXWL 1BFOB 4YDJA 1HKFA 5ISZA 4BKLA 4X9BA 1AR1C 1BF2A 2VZ1A 3V4VL 2L7JA 1KTKE 1AO7E 2Q76A 3UTTA 3DIFA 4OZ4A 1CXKA 3ESVF 2I25N 2NNAA 5DYOB 2AK4A 4Z7UB 3G6DL 1NCCL 1M7DB 5DFWH 5C7XL 4F33A 3QRGL 3HNVL 4OUUA 5ESVB 1CFNB 5CJXA 4XH2B 1KJ3H 3QWQB 4OB5L 3FJTA 3QISA 4KDVA 3D9AH 3QXUA 1I9IL 4X8JA 6CGTA 5CGTA 3TZVB 5JZ7D 3VFMA 3W9EB 4ALAH 2A9NH 2Q8AL 3QEUB 4EIZC 5E08H 5HHVL 1HH9A 4LAJH 3EDFA 3TJEH 4HWEL 4LPCA 1AGCB 3HUJB 3S7GA 2HT2C 2AV1B 2GJ6B 4FZEH 5FYKD 2Z31D 2HVJA 4LLYA 4U6YB 4H1LB 4ZFOL 1SVCP 4LRNL 1KC5H 2PW2B 1IQDA 3EYSL 3FN0H 4HZLB 4KVNH 3CLEH 4K55A 1KJ2H 1KG0A 2XY2A 1MH5B 5DZLA 4WJ5A 3QXDB 5FM4A 1WWCA 1HHJA 4U1HA 3X11B 1NCAL 5F70A 1YPZB 1BIIB 1R24A 4NUGH 4R0LB 5JR1H 5IT2H 5FK9A 2DWEA 2W92A 1V7NL 3P4MA 1ACYL 2FL5A 2WW8A 2B4CH 2FO4B 2YSSB 3SJVE 1KPRB 3ARRA 1A47A 5D96C 2CK0H 4ETQB 4PREB 4J7RA 2APBA 3QG6A 4DEPB 4F8TA 5E8DL 2X4TA 2XN9E 4FQCL 12E8L 2NY3C 3GSOA 3K1DA 5I1LB 4HF5L 1GGUA 3PWPE 5E8PA 3U4EB 3F7YB 3O41B 2NY1C 1DBJL 4BH8A 1ZTXH 4OQTH 1OSPH 2HJLA 5C6PB 4BZ2H 2DLFH 3QZWB 1IRAY 2RFXB 3TBSB 2DQGL 4GBXA 4D0BA 1KCVL 2CMRL 3TWCL 4LPWA 2KUTA 4NPYA 1INEL 2ZG3A 2GJJA 3DX6B 4F7PB 1BP3B 3KWWB 5I1EL 4OCYL 5KVGL 2V7HA 2XZCH 3O6LL 4YQXH 4CW1A 5MERB 1MREL 1ACZA 4M43H 3FN9A 1FFOB 4DN3H 5JOFB 3VWJC 3HI6H 3BDXA 2LU3A 3BJLA 1ORQB 3HC3H 5ADPH 1TVHA 4H0GA 4GG6A 3PL6A 3IJHB 8FABB 2HN7B 4JR9H 5C0DB 3NMEA 3AFLA 3WFEH 4PG9B 5DRZA 5A2KH 3LPFA 3KS0H 3SDYH 3E8UH 3IDIA 4KQ4H 1AIFB 4YDIH 3HPJB 3GMPA 4NKQB 4NZDA 2JELH 2DIJA 5ERWB 1I7ZA 1JWUB 1FLTX 1EHLH 1WLHA 5FEBA 3EFDL 1ZSDA 3T4AA 4OJFH 3HZVB 3TO4B 1F4XL 3BUYA 3T2NH 4PBXA 5FO8B 4UDTA 5L2KE 4NQCB 4XNQA 2Q6WB 1HE7A 2GT9A 3UTSE 4BFBD 1TJIL 1AKJA 4OZHA 1O5DT 5J0BA 5E99L 1NGXA 1HHHA 5HJ3A 2HJFA 3MC0A 1S7QA 4ACPA 1QYGH 4LF3B 5LCVH 3RY5A 3SPVA 2YN5A 3W2DL 3PQYD 4EVNA 4OLVL 2BVQB 1ZHBB 1PGRB 1OQOA 2ORBL 1IAKB 4LK4A 3QUXC 1S7XA 2BNUB 5F21B 3WS3B 1CL7L 3T0EC 5JIHA 4LCIL 4HXAL 7FABL 3NCYP 5C0AE 1NKRA 4M1GH 3CC5A 1JFQH 3EUUA 4PJBF 1T1YB 4PGJA 1DQML 4X6DF 4IMLB 3KLHD 4E0RB 3U4BL 3SBWC 4MD0B 5KSAB 2I9LA 3V2AR 1AGBB 3ULUF 2B7DT 2ED9A 3IDYB 3S5LA 2BXYA 2APXA 4N0UB 2JB6B 2Z93B 1DEEB 2X4RB 2HT3D 5C09A 4HUVA 3FT2A 4N8VG 3L7FA 3EJYD 3WIFB 4HAFA 4GKZA 1B6DA 4Q6IB 5BS0E 3VD4A 2RJMA 3MV7A 5C0EA 3S96B 3MLUL 5J3HD 3QNXB 4EXKA 5BO1L 1I1AA 5FB8B 1J9CT 3TZVC 3ILQC 3C5ZD 5D1XD 3GMLB 2Z35A 3AUVA 2D31A 3U2SA 2CLVA 4WI2A 3IU4L 1MRDL 1P69B 2Y06L 3EBAA 3SCMB 1DBAL 1U8LB 2VXQL 3LS5H 1A6PA 4PJIA 4S1DC 1N0LA 1HSBA 3X14A 3HFML 4F7TA 1NGWB 4PRID 3RVWC 4A6YL 4P4KB 4FZ8L 1LMKA 4RQQA 3U36A 3F7PC 5ESQA 5IB1B 3BPLB 4DGIL 4YDVB 1WITA 2O61B 1EERB 5F7EL 4J3XA 2P45B 1MI5A 1QFUH 2HYMA 5EOTB 4DWHA 1JCKA 2R0LH 4XPAL 2D0FA 4HUUB 3LSOB 4ZQKB 4R0LC 5DJ8A 5E95B 2EYTA 1A7NL 3RZCD 3WE6A 1P1ZB 5BQ7A 3WFCH 3B9KB 4KFZC 3NFNB 4K7PL 3E3QE 1W72A 3BH8A 1C16A 2A9MH 3KLSA 1IL1A 3MRMB 4V1DA 2BC4A 4WIQA 2WM0A 4PJ9B 4DEPC 4LGRB 3C08L 1FNEB 1MLBB 1A4JB 5GGVL 1AD0B 2Z4QA 5ILTH 5I8EB 5FF6B 3HI5H 1YEHH 3DGGB 3OXSB 4F58H 3FFDA 1O7SA 3VXSA 4Q58C 5IV2B 4R4BB 4ZXBB 1G9MC 4S1SL 4R8WH 4BYHA 1A6WL 1OAQL 2DJSA 5CJ8A 3RWDB 1MJUL 2ZKHH 3BHBA 5E9DD 4DQOL 2P5EA 4P2OD 3OAYK 3G9AB 1BQLH 3K3QA 4QXGL 5SWSB 3OX8A 4M6ML 1IARB 4MNHA 2NTFA 2CXGA 3VA6A 1DQLL 5C08B 4XB7A 1NLDL 4MWFB 3VWJA 3NIDF 4KK9D 1S7WA 4U1SA 2FH8A 1CFQA 2IQ9H 4R97B 5JHDA 1GVIA 3I6KA 2PETA 1OLZA 4DZ8A 4YJZL 3WDJA 3P4OA 4O2CA 2X4NB 4X4ME 1MSPA 3F7QA 5DJAB 2DI8A 2QQNH 1AGFB 3D0VB 4PBVC 2DBLL 1KIRA 4DGYL 3QFJD 2BVPB 1R3LA 2OLDA 4OD2B 3JV5A 5HYQB 3EDDA 2IPUK 4IDJH 4XP4H 3Q5OA 3F12B 4NRXA 4OCXH 4PJHF 5KVFH 4ZTPH 3N1MC 3AXLB 4TTGA 2XI9A 3I3BA 3JUZA 2W65A 1N0XL 4M00A 1AI1L 2X4UA 3CVHB 1MY5A 3PV6B 5IFAH 4LIQL 1HINL 4JY5H 5I1IL 2ZP0T 3U6RA 3TO4C 1X7QA 1JHTB 2DJUA 4TRPH 2N7AA 1HNFA 1RUQH 3ARBD 4MYWB 1U6AH 3BUTA 1T89A 3G5YB 3L3HB 2WUCH 3LZFH 5DMJB 3V4PH 1NSNH 4OM1H 4GW4B 1JTPA 5TDPA 2N7BA 3INUH 4NC2B 1KEMH 1L6XA 1R5WB 5EC2B 4RX4D 3QUXA 2R2CA 4OGYL 2EC9U 3M1BA 4CGTA 2ZUYA 2EDOA 1A3RH 1NC4A 2N56A 2NXYB 1P2CA 5D1ZD 2GUOB 1MJJA 5CP7B 1WBZA 2PR4L 3G9VA 4WEBL 3OGOE 4PRPB 5D2LE 1S78C 1L7IL 5C0NC 3SBWA 2P44B 1IGCH 2QQLH 1UKQA 3HRZB 5F88B 3TT1H 2YPKA 4OSUL 5KSAC 2FEDD 3PWLB 5EPMB 5AAMA 3IDYC 2IBZX 4ZAKD 2AEWA 4Z7UA 3MJ6A 1M7DA 4HJGA 4L5FH 1FNGB 2R69L 1I7UB 4IOIA 3TIEB 2WBKA 3CK0L 1PZUB 5DEGA 4Q6IC 2CLZB 1UYWL 1WV7T 5L2JB 3VI3E 4TULL 3P9MB 3PP4H 3TZVA 1CQYA 1A1NB 4GKSB 5JPMB 2VKXA 5I1JH 1DE4B 3H3PL 1RUPH 3TH4T 4G6KL 4JY6B 5JA8B 1HDMB 3M45A 3CXHJ 1AGCA 3P30L 4AENA 2ESVE 3SCMC 4NSKB 1QSEB 4PS4H 1RJYB 1EBPA 4IHOA 1E6JL 3KLDA 2GJ6A 1TQBB 2IF7A 4P46B 4JAMB 3QDGE 1FE8L 3FO1A 4U6YA 4H1LA 1RIUH 1BVKB 3BKYH 4JZNB 4F7EA 3ELAT 4I13B 1PD6A 4RBPK 4W6YB 5FUZL 5HVWA 4P4KC 1EEZA 3H3BC 1OP3K 5I1CL 3BPLC 1YY8B 2EDWA 3QXDA 4WHTA 1UM5H 2EEAA 5JO5B 3KYMA 1QLRA 1YPZA 2XWBA 1BIIA 3ES6B 3JWOL 5MENE 1IILE 2IAND 4MNGA 3VGHA 3PDOB 3TFKD 1W72H 5CINL 1ZGLP 4X80H 2BVOB 2VLRB 3B9KC 1Y0LB 4P9ML 3Q2CA 4HK3N 1A6UH 4L3EE 2YSSA 1PEZA 5IB5B 4Z6AT 3V6FA 3F58L 1CLYH 1S7SB 1CZ8H 3VXUB 4JO1L 3IDMA 4KI5F 1QVOB 3Q5TA 4J1UB 4PJ9C 3BIAX 4YIQB 5F97E 4YNYB 3CXDL 4JO3H 5J56B 3K7UA 5I1LA 4QRUA 4MQ7A 5D72L 5C6WH 3SDAB 2XRAL 3ZKNC 5AYQA 4NQXB 4P4RB 4QKXB 3U4EA 3CFJB 3FFCB 3O41A 4X4ZA 4ZXBC 2AXHA 3ISWA 4NHCH 4QNPE 2V6HA 4XPTL 4WUKL 3QZWA 2VLMD 4YHZL 3TA3D 5EZOH 4P48A 4GQ9H 2XXMB 2JE8A 5DC4B 1GZPB 1D5MA 1ZLUK 4DK6A 2EDRA 4P2QB 5BVPH 4F7PA 1QBMH 5C6TH 1RQ5A 1CN4A 1MCIA 5MERA 3QJHA 1MOEA 1KLUA 3H3KA 4NWTL 3VXRD 4ETYA 5JOFA 2K9UA 3U1SH 5TH2A 1VESA 3LMJH 3DUUB 5FXCH 3ZTJH 2YC1B 2H1PL 1MCDA 1J8HD 4R97C 2EDKA 1FDLH 4U2ZA 3IJHA 2QQQA 8FABA 2HN7A 4WFGD 4N5EC 4QRTA 4KTDL 4IS6A 4PBWD 4PG9A 1FYTD 5CKGA 4U1IB 1WAAF 5GGRY 1RU9H 1AIFA 4G8FB 4QOKB 5IVZA 1LHZA 2BNRB 3SGEH 3KPRE 4JLRA 5GIRB 1HIML 1B90A 1OB1A 4DUVA 2O93L 5HGDB 2V2XA 5IJVB 4WO4D 4LP5A 4M8QB 2X09A 4U0RB 4J4PD 3HZVA 3TO4A 4HEPG 4UTAL 3MUY1 4RWHA 2JJWA 4ZDHB 2OYPA 4HJ0D 3TV3H 3O81A 5FO8A 4P2RE 3ZYZA 3UPRA 5HHOE 2GJZB 4NQCA 3PJSA 4QO1A 2Q6WA 1VADB 2E8ZA 3FQWA 1IAIL 4GLRI 5TE7H 2X9WA 4C83B 5GGSY 5C0GB 3PWNB 1PVHA 2VTFA 4HMEA 4LF3A 3ZE2F 2BVQA 1WGOA 2OR9H 3NN8B 1IAKA 1RJZB 2F5AL 4MZ3A 1FRGH 3WS3A 3UJJL 4YXHH 5D1QA 1GOHA 3FQNA 4L3CB 4KUZL 1DLFL 2B5IB 2NXYC 4PJEF 3MLZH 1RIVL 4XVJH 1QBLL 4I18B 1B4RA 3VXMA 3Q6FA 5JW3H 5E94A 4KV5E 4IMLA 4XNMB 3NTCH 4E0RA 3BI9X 4MDJB 2AJXH 4CN4A 1QA9A 2FX8L 2R4SL 4P57B 4X7TB 5TDNB 5KSAA 1AGBA 5CCKL 2BSRB 3QPXL 1VFMA 4N0UA 4H8WH 2BNQD 2JB6A 2Z93A 3P77B 3T0VA 1DEEA 5CBAB 4JFEB 1LD9A 1S9WA 5IFHH 5B38G 2YK1L 3T0DA 2AABL 4Q6IA 1ED3A 5GGRB 1OD7A 2VSCA 5FB8A 1WT5C 4WFHE 1UM6H 5DUML 5AEAA 1WCBB 3GMRB 3P9LB 5CJOL 3ALPA 4PRNB 5KN5B 1IGJA 3IDNA 1NCBH 5JQ6H 3SCMA 4I1NB 2IPTH 1BAFH 1YUHB 4H1LH 3PIQB 3FRPA 1MCWM 1TQBC 3DARA 5SWZD 4P46C 1NGWA 4BELD 1BWWA 4ODXB 3EFFA 4LCYA 5IMKB 2IBBA 4P4KA 2C4XA 4PRHE 4QTIL 4YFLI 4Z5RB 3D87B 4Z7WE 5HGHA 4YDVA 4J3VA 4S1QL 1ONQB 5EU7C 5EOTA 5GGSB 4PGZA 2OTUA 2YD9A 5IQ9B 3OB8A 4L8SB 1N4XH 3GMQB 1VENA 4HUUA 3LSOA 4PJDE 1XR9B 5FUOL 1P1ZA 2EDTA 5D7LA 4U6HB 5T1MB 1K3IA 1HHKB 2V9TA 3NFNA 4HKBB 2CGRH 2UUDK 5DR5H 1T2JA 4NO5B 1TZIB 3LN5B 1DLHB 5EZIL 4KJQC 4IDLA 5TE6H 5C9JB 3RNQA 4GT7A 1T7YA 4PJ9A 1RZKC 1RFDH 4K3JL 1A7PH 2VXVH 3FHQA 1MLBA 1A4JA 4XT1C 4XX1G 3L3OB 5DUBB 2Q7NA 5I8EA 3DGGA 1G9MH 2BDNH 1MHHB 3IXTB 3LOWA 4FXKB 4MJ2A 3DURB 3ULVL 3SDAC 5E5MB 1BM3H 5IV2A 2NX5D 2DM3A 2PYEB 2QTEA 4R4BA 4Q9CA 5K59F 2E6PA 4HK3J 3MUHL 1A5FL 1MFBH 1UZ8B 4PTUB 3VE0A 4M93B 5I0ZA 2JCCE 1ZHNA 2KZ1B 4N8CH 4GH7B 3RNKB 2ZSVB 2FCBA 2ZUWA 2C3XA 1TZHB 2EDEA 5SWSA 4GAGH 2RR3A 1XF1A 2CIKB 4Z7NE 2F53A 3WUZA 3TCXA 4X6CF 5DMGD 1A6AB 5C08A 3GSNL 3SDDD 2Q87A 5HHQB 4N8VB 5GSVB 2G5BB 3ROLB 2X89D 3KYNB 4LCCB 4RGND 4C54A 1DN0B 2WWMD 3QO0A 2EEBA 2IAMA 4HKXB 1T5XB 2HKFH 1K8IB 5HHXH 1ZVYA 1YMME 3HC0A 1AGFA 5IVNA 1JNLH 1G7PB 32C2B 1PKOA 2BVPA 2OJEB 1A0QH 4OD2A 4YO0A 3V5DA 2D7MA 2W0PA 1KJ3L 5D5MB 3QIWD 3REWB 4NKIH 2Z31B 3AXLA 3D9AL 3U46B 1E4JA 1DDHB 3FB6B 5IB4B 5ACZB 4ALAL 2A9NL 4ZNEE 3CVHA 5F7YC 3PV6A 5E08L 3DYOA 3TJEL 2FDBP 4U0RC 1RIHH 2MHAB 3VW3H 3K0WA 2EDXA 3V79C 3IFNH 4HIIA 1FQ9C 3N0PB 2R9HC 4MQSB 4D9QE 4FZEL 1WZLA 3G5YA 1EHXA 1JBJA 1MVUB 2H32A 4I3RH 1KC5L 1NANH 4GW4A 3FN0L 4KVNL 2APWA 3CLEL 5KS9A 1DUYB 2PCPB 3NZHH 5B8CA 1KJ2L 5ID1A 5EC2A 3L7EA 5EUOA 3RJQB 1MELA 4NCC1 1HSAA 4L8CB 3WLBB 4KH2A 4NUGL 1NC2D 4OZGB 4QTHB 1CGWA 4F9LC 5IT2L 5JR1L 2GUOA 4XI5C 3DVGB 2B5IC 3IYLW 4JM2F 5CP7A 5DD1H 5F6HI 3EDJA 3PWUA 1RZ7H 2DS4A 4G5ZH 3MREB 5CZKA 1T21A 1ZWIA 2ZZUT 4I18C 1NANI 2B4CL 1T3FB 4ZS7H 1MCKA 3HRZA 2CK0L 1NEZG 2LTQB 1DVFA 3OKYA 1NDGB 4MXVF 4QEGA 3HHRB 43C9B 3ZKSD 3V7MA 1TJHH 1FNGA 1I7UA 5IB2B 4N9GB 4UINH 3BSZH 5SX5K 4E5XB 2F9BT 5I16B 3QEQD 4OKVB 2ENSA 4N0YH 3EDEA 2BY3A 1CD0A 1F2QA 1LEKB 1ZTXL 4MD4B 1WT5A 1OSPL 4FFVC 4KVCL 3FB8A 3KPSE 4BZ2L 2WBJD 3OSKA 2DLFL 4PLKD 3V6ZB 2ED8A 4XGZB 2YXFA 4JZJA 1U8HB 1HDMA 1FLRH 1V3KA 4NSKA 1QSEA 4OZIE 2G2RB 2XZCL 1A14H 4GMTH 1OAYH 4JAMA 1KNOA 2DI7A 1LP9E 1UGNA 1YNKH 4M43L 3E1F1 4JZNA 2R29H 3S3JA 2L7UA 4PJFF 3WFDH 2IH3B 2HJKB 3HI6L 2WNGA 4RDQF 1H3GA 5AAWA 1BF8A 2R2HB 3G08B 1BOYA 3HC3L 4S11A 4V2BA 5ADPL 1XGPB 2K1MA 5JO5A 3EIFA 4JR9L 4L8SC 3ES6A 4UTBH 3WFEL 3SDYL 3GIZH 4KQ4L 1IVLA 1Y0LA 4QWWC 4YDIL 1KOAA 5MHSD 2JELL 2AVGA 1A22B 2P4AB 1MCCA 3R06B 4HAGA 4GO6B 5CEZD 1Y6MR 1EHLL 2MOVA 4JFFB 3A67H 1I75A 1QVOA 4JM2D 3BP6B 5SV3A 2C3HA 1MRCH 2VSDA 4PP2B 2RB8A 5JXED 5I1GH 3O2VH 3ZHDA 3SDAA 4GXUM 5HHME 3T2NL 3FZUC 4L29B 4MVBC 4P4RA 2ITCB 3VFSB 3BZFB 3CFJA 3FFCA 3QQNA 4JEGB 4LSQH 3AGVA 2PTVA 4M93C 4UOJA 4FOMA 1U0QA 3K4AA 1QYGL 5LCVL 1H5BB 3AY4A 1GZPA 1UWXK 3VFNB 3ARYA 3QULA 4JDVB 3RI5K 1IGTB 3OAUH 4G42B 3P0YH 3SO5A 4M1GL 1ZT1B 1JMXA 1E4XH 1JFQL 3CLFL 2UY7A 5F72S 4KUCF 4OF3A 4C56A 3DUUA 3QUKB 2YC1A 2YPLB 5CKAA 4LCCC 4YGVA 2Y7QB 5JZ7C 3QQ3B 4RMWA 3C5ZB 5H8DA 5E5RB 5BRZA 1OVZA 2NZIA 2OJZH 3C5SB 3TCLB 4OAWB 3KPLB 4AIZB 3LB6C 1NMCB 5DT1H 1N6QL 1MWAB 1E4XI 1I8KB 5DC0A 1SEBB 2R1WA 4EUPB 4Y4FD 1FO0B 2WZPD 1WTLA 5KSBF 2WIMA 1N6VA 1TITA 1B2WH 1PKQB 2P5WD 2Z31C 4PRIB 3CVHH 3ARGB 3D3VB 1T03H 3KHQA 4GAJH 4XMPH 4MJIE 5HGDA 5F89A 1KGCD 1YJDC 5ABDE 4M8QA 4JFDE 2D9QB 1VA9A 4RIRB 3REVB 4ZDHA 3FT4B 3VFVB 5HDBE 4AYFA 1CTNA 3JV4A 3LS5L 2GJZA 2H32H 1SHMA 2ID5A 2XFXB 3SDCB 3RZCB 3MLPA 4I2XB 1RURH 4WHDA 2IQAB 3AU1B 3BQUD 4X7FC 4GFTB 4EKXA 5K9JH 2D0GA 1QFUL 3KPOA 1HQ4A 3OJDB 2R0LL 1LO2H 5CWSB 4RAUB 1JTTA 4G9DB 4F9LA 4X5XB 1PX4A 3BEVB 3P4NB 5ALCH 3WFCL 3IJSA 5ICYA 5CUSH 4OD1H 4XNMA 4XP6H 1CG9B 2VLKA 4MDJA 2A9ML 1J11A 2BOBA 4P57A 4X7TA 2AV7A 3U0TB 1CGVA 2LTQC 2BSRA 4NN5B 1P84J 4D8PB 2OI9B 4CADB 1SJXA 5DEFB 4F15B 4OFKA 1S7TA 1CVSC 3P77A 4P2OB 5ILTL 3HI5L 3ZL4H 5FGSA 2VN4A 1SBSH 3LEVH 5FO7B 1WF5A 4PJGF 2G9HB 1JPFB 5GGRA 4R8WL 4CMMB 5TE4H 4PY7A 5GJSL 4I0PA 3VXTA 1JI2A 3MMEB 2NMSA 4HKJB 3ZSTA 2ZKHL 1WCBA 3GMRA 1F3JA 1N3NA 3P9LA 1FJ1B 1O0VA 4N0CD 4NNPL 3WIIH 4LASH 5KN5A 5JQHC 4AL8H 2EKJA 5ACLA 4HIEA 3LQAC 2QSTA 4JN1H 2PF6A 2RBLA 3MRIA 3CH1A 4DUWA 3C6LA 3QFJB 2OM5A 4ODXA 4M7LH 1CIUA 3RWHB 1GGBH 2X70B 1VFUA 1C5BH 1H0DB 2IQ9L 4FTVD 4K7FB 1I85C 1L0QA 4ERSH 1ONQA 3QUMB 4M7ZB 5GGSA 2ICEB 5FYLD 5IQ9A 2Q3ZA 3CPLB 3KXFD 4L8SA 4LDLB 4BSWB 3WDHA 2B39A 2P46B 1TXKA 3QDMD 5E6YA 5I1DB 4MAYB 3WFHA 1JMZA 2QQNL 1ZA3A 2QHRH 3FB7B 1I3UA 4H5SB 5T1MA 1SM3H 3HI1A 1Q1JH 3QH3B 2CK2A 4HKBA 5DRNB 4PRBA 3ARBB 4IDJL 1TZIA 3LN5A 1RZGA 4LSRH 1RZKH 4OCXL 5A2IH 5KVFL 3ULVF 4ZTPL 3S97C 3OXRB 3SDXA 5A2JH 5DA4A 3LAFA 5K33A 4YXLH 3UTQB 3L3OA 5DUBA 4PJAA 3L5IA 3MRLB 2X44D 4JY5L 4DGVH 5H37G 1MHHA 3IXTA 4FXKA 5CILH 1T0PB 4TRPL 5E5MA 4NGHH 5IW3A 2Y6SD 1RUQL 5FKAB 3NFPA 1U6AL 3WNOA 3ZYOA 5D1ZB 2VDQH 1T5WB 3V5HB 2BY1A 4PTUA 3FQRB 2WUCL 3VJ6A 3LZFL 3IXAB 4J8RA 3V4PL 1NSNL 1BWMA 4OM1L 5DFVC 3AAZB 1TLKA 3INUL 4M1DH 3KLHC 2PXYD 1KEML 3VXPA 1BQSA 1WBYA 1H5BC 5D7IA