2D9CA

Solution structure of the first ig-like domain of signal-regulatory protein beta-1 (sirp-beta-1)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
136
structure length
136
Chain Sequence
GSSGSSGELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Signal-regulatory protein beta-1
publication title Solution structure of the first ig-like domain of signal-regulatory protein beta-1 ( SIRP-beta-1)
rcsb
source organism Homo sapiens
total genus 16
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d9cA01
3BZ4A 4BQ6A 1O7VA 5L2JA 5IUSA 3ARED 2CO6B 4N1CA 5KJRL 1NCDL 5KVDH 5MHSE 4RFOH 2BVQB 3HB3C 4LMQE 4M48H 2XQYG 2AKRB 3AXLB 3C2AL 4XTRD 5I1JH 1N7MH 3DURB 1EVTC 3VFNA 3SDDA 3MLYL 4Z7WF 1UA6L 3QCTL 4G43A 3ZHDA 3B2UD 4FNLL 5IB2A 3W11D 3T3PE 1D5XB 5EZOL 1JFQH 4M7ZC 1CVRA 3RWDB 4WU5B 1YNLH 3PWNB 5E5UB 3TV3L 4LVNC 1MPAH 3ARGD 3VWKB 2VSDA 4Y5VC 4AT6B 5A16A 1ZLSH 5B39G 1M7DB 1OTTC 1F3DH 5HHPA 4LCUA 2EICA 2EXYD 3K46A 3KYOA 4RGNB 3RWGB 3D0VA 3O6LL 3OB0H 4UU9A 4NNXA 5LKNA 2IFGA 5MHSD 1NDGB 4HFWB 4LQFH 5A2IH 4PBWD 3C6LD 3MROA 1EAJA 4D9QD 3CXHJ 4F9LA 1A6AB 4D9RE 4ONHA 2GEEA 3TO2A 2G75A 3EOYG 1LO2L 2D4FA 3SQOL 4K7PL 1JWUA 1KJ2B 2GFBA 3A6CH 5HHOE 4XVSH 3C60D 1EIBA 5SWZA 5C0RL 4PLNC 1DZBA 3BPNB 1H15B 4YDVA 5L9DL 1N5YH 1JCKA 3QJHB 2M1KA 3VGGA 5FGBC 1F13A 3RNKA 2D31B 4QRSB 4M3JA 2DM3A 3ZZ1A 2PTTA 4ZFGL 4XBEL 2NXYB 2WWMD 3LIZL 2DLGA 5JTWA 1T2QL 2ERJC 1MHPH 3GMQB 3QULA 3DVIA 3MV9A 3I02A 1OD7A 1QBLH 3PP4H 1G6VK 3K8LA 1GGUA 1J0YA 1ZE3C 3FOMA 4M3KB 2A1WL 3P9LA 1IARB 5DO2C 3JWDC 1HSBA 1AR1C 2R1XA 2Z31D 1I9RL 4QT5A 1TZGL 3D3VD 5JOPE 4NQSB 1JUFB 2P5EA 5CP7A 1F6FB 3OWEA 2W65B 3V52H 4WO4B 2V5TA 4V1DB 2J6EH 5C0CB 1NMCC 3FQUA 3VG9B 5IHUH 5C0AA 4OZHB 2DI7A 4N90D 1T66D 1U6AH 2A9NH 1RUAH 1K8DA 2AJSH 3WFCH 4YHPA 1YY8A 4PTUB 4JE4B 5EBGA 1A7NL 2PO6A 5FYJH 4AL8H 3X3FL 5JOPD 4HH9B 1JHTA 1DDHB 5T3ZH 3SDDD 1I7ZA 4KZDL 4U1GB 2D7QA 2NNAB 4CMHB 5D7JB 3OKMB 4KKNA 4RFEB 2EEAA 5E2WL 3OB0K 1TFHA 4G6JH 5M95B 2EYRB 4K3GA 4QHMB 1TCRA 1XCQA 2WW8A 5SWZE 5L6YH 2N1KA 4X9GA 5DD6B 4Z77A 5EU3A 4B53A 3BSZL 5JUEH 5DRWB 2VUYA 3C5ZB 3RI5F 3BO8B 4IRZL 4Y0GA 1WSST 2BK8A 5J1AB 4X6CF 4FQIH 4AH2A 1F4AA 5FDWA 2YRZA 1OY3B 2ZSWA 4Z0XB 4XNUL 4FTVB 2QADC 4G8FA 3QIBC 4ZG1A 4XNZB 3RHWK 4DW2H 3OR6A 5BS0A 3VG0L 5JA9A 1UJ3B 1S7UA 4HS3A 3MPCA 1A6VH 5CKGA 2AJYH 4WW2B 1AHWC 5DUMH 1AP2B 3IDXL 3KVQA 1YQ2A 2VAAB 4Q97A 1TQBC 5EA0L 1F42A 5SWZD 1QD0A 2P5EE 1GGCH 1FFPB 1A6TB 4OF5A 5ADOH 1WGOA 4JO1H 2FX8H 2LFGA 1XFPA 4KJPC 4M1GL 4NJ9H 1GSMA 4MAYB 4H26A 2WBKA 3MJ8A 5M7QA 5C71A 1J8KA 5DJ8A 4JFEA 5C0AE 5FXCH 2A74A 5MEPB 2V7HB 3MV9D 1CQYA 3E6FB 4M6NH 4CDHA 5ICXA 1ORSA 1P2CB 5C6WH 1XCTB 3C08L 1VERA 3C5JA 5LWYH 1JE6A 2PYFB 2EE9A 4RISL 4AMKH 5B3JF 3TCLA 1EZVY 1LP9A 4P2CG 4PBVC 5IG7B 1JNHA 1B6DA 4NYLA 4PJGA 2RCSH 4JM4H 3WLWC 5IGXH 3VXQB 4OB5L 1CFTA 4F3FB 3LS4L 3MV7A 4PYHA 5JMRA 5TE7L 3TYFA 3U4EA 2OI9C 5C0AD 4XCEB 3MRCB 3GNML 3HMWL 1SVZA 2BNRA 1G7LB 2Q86A 3HLAA 1QFWH 3P9WB 3OKLB 5EU7C 3VGFA 3CH8A 4O2EA 1W0VB 4Y4KB 1CLZL 2UV3A 5KVEL 3QWQB 2GK2A 2ZPKH 2NY1B 5DK0A 4PPTA 3W82A 4R96A 1NQBA 2C1PB 1F3JB 4G5ZL 2ZUTA 1ZA3A 3PJSA 3Q3GA 1J1PL 4OD1H 2R8SH 4IOIA 2F8VA 3TJHD 2YBRA 3DO3A 5I73B 1LEGA 1OOAA 4R90H 1X5GA 4CVUA 4GW5B 5BJTB 2Y7QA 1F4XL 2RB8A 3TVMB 2XWTA 4KJQC 1GL4B 1CXIA 1KN4H 2FB4H 2E7MA 2Y5TA 4EEEA 4OIIH 4JFEE 1CDHA 5A40E 1RZ7L 5IMOA 3MGAA 1WWCA 1MF2L 1G9MH 3ORJA 3FB7A 1UC6A 3MODL 3FB5A 1S5IL 5BS0D 3SDAD 5I17A 1NBZA 5EC2B 1D5ZA 3IFLH 2AV1B 3A67H 5E8NB 1HILA 4RAUB 1ZT4B 2AI0H 1CI5A 5FB8B 5DUPL 1I8MB 5E2VL 2DQHL 1ADQA 3VXOB 1WF5A 1LP9E 3KDMB 2GQHA 1SY6L 4P2QA 2ZUVA 5DJDA 5J9PA 1BAFH 5ALBL 3MACH 3AREC 3WN5B 3ROLA 3QUKA 2HAZA 4GKSA 4GAJH 5ESAB 1CCZA 4UUJB 4HBQA 3CUPB 4FQJH 3FO1B 3MV7E 4QHNB 3RPKA 1I7TB 4JFED 3EYFA 1T21A 4MJ2A 2YPKA 3B2UC 3W11C 2BNRE 4GH7B 4LLWA 2VDMH 4L5FH 5EU6A 5T1DH 5CCKL 1GCFA 2H2SD 4ZDHB 1EHNA 1YNKL 1CD9B 4F7MA 1UKQA 2BRQA 3WIFB 5D1QA 4EXPX 1E6JH 2IQ9L 1QBBA 1OP5H 4W6WB 5D2NA 3HA0A 3NFSH 1TNMA 1N4XL 2CR6A 4TTGA 1AY1L 5DQDH 2EXYC 4HMEA 1EUUA 2BP3A 4O2CA 3ZYIA 5H35A 1U42A 4D0CA 1ZXQA 4HUMB 5DLML 5EPMB 1T04B 3V6BR 1CGTA 5J06A 1C5BH 1KJVA 4NWUH 3G08B 2NPLX 3C6LC 5EBWB 1C8PA 3QEUB 3MV7D 3VFPA 2VZSA 1J5OL 5IM7A 1BLNA 1MLCA 4CVZA 2L0DA 4XCYA 2BNRD 4MLSA 3GIZH 1AFVH 1JRHI 5ESQB 3FTGB 2AEIT 1KC5H 3C60C 2QSCH 2QJDA 3VXRB 1H3GA 1IAKA 1MCSA 3C6SB 1SYSA 3DTXB 3WYRA 1SYVB 4HUVB 1MCFA 4L4VB 5D6CB 2P5WA 1B0GB 4HF5L 3CC5A 3QO0A 2A6DA 3KR3H 2OR9L 4S1RL 2WWMC 2GCYB 2CUHA 4L3AA 3L3OB 2KQNA 1GPOH 1Z2KA 3B2VH 4DAGH 5E8OA 2OTUA 4P2QE 1ZT7A 1QYGH 4BSWB 2NY7L 4B5EA 1NBVH 3LOWA 4LKXB 2XTJB 5K9QG 4G42A 4BQ8A 3P2TA 2A6KA 2Z31C 1ZANL 4W4OA 2H32B 3BGAA 1Q9LB 2C4FT 5SV4A 3MO1B 3IDIB 4A6YH 5IB3A 2MPAH 4OFYD 4QRUB 4JFYA 1IC7H 2D03L 1KTLA 4YHKH 1RZFL 5I1CL 4YZFE 1FYTB 5ICZB 1JHKL 3NFPB 4PJFB 5DJXA 4JPVH 4XXDB 1QHPA 4YHLL 3ROOA 5D2NE 1G9NL 3KPMA 1FCGA 5ILTL 1RMFL 4I18A 4P2QD 4F57L 4OLVL 1YEKL 2X4TB 1G7IA 2UZIH 3GKWH 1G9MC 2N7BA 3SDXB 3HI6H 3VFOA 5EO9A 3V5KB 2BJML 1OP5K 3FQTA 3T0AA 4PJ9B 1CXFA 2AABH 3UJJL 3SDDC 4JHBA 3TBYB 5DEGB 5L0QC 5BV7L 1MWAA 3L9RB 4NP4L 3IETB 5EU6D 3UTZA 1RZ8B 2F15A 1IVLA 2WBJC 4GG8A 4IM8A 1DQML 1BZ9A 5I1DA 2R23B 4U7MA 1X5ZA 3R1GH 1NSNL 1B0RB 1HH6B 3FCTB 1AQKL 5D1QD 2MKLC 5IBLD 1NCCL 5GZND 1EVUA 3WSQL 3FHAA 2VOTA 4GUPB 2E7HA 3HNVH 4R0LC 2FECI 5ANMA 5D1XA 5C86A 4MSWB 3V6ZB 3FZUD 5IK3B 2FX9H 4OLYH 3FO0L 2AS5M 1ITCA 1LO0L 3S6CA 3ARGB 4F9LC 4HUKB 3VXSA 1K85A 1CFBA 3RZCB 2CK0L 1KB5B 1GGYA 4Z76A 3BE1H 1R5WB 1J87A 4XPFL 3RY5A 1MCIA 4NZRH 4MMZC 2AJZB 4NFDA 4HAFA 1BVLB 1HZHH 4Y1AE 3DX7B 4S0TD 4LVEA 1FJ1B 1A6ZA 2P5WD 5DQ9B 1PYWA 1IM9B 2O5ZH 1KCSH 1MFNA 2C4XA 3VXMA 5D2LE 1INQB 1N3NA 4OBSA 1FVCA 2EDHA 3SGDH 5HYFA 4BH7B 5DJCA 5JHLL 1O7SA 4OLUH 4GW4B 2DOCA 3IDGA 4YFLI 3GSNB 1NGXB 5D96C 5JR1L 2O61A 1FN4B 3RWIA 1JPTL 1MHCA 4P2RE 5KSUA 1RURL 3LKQA 4ODHH 5F7YC 3VDCA 1A22B 3EHBD 1KPUB 4G6MH 5IHZA 2R2EB 2ZCHL 1JYVA 3CVHB 4MB4A 4F58H 1XZ0B 4OM1L 5T3XE 4EUPB 3ZKQD 4LF3B 1A0QH 4IS6B 4H5SB 1TLKA 25C8H 3F8UB 2DWDB 4LSRH 5I74C 1FNFA 5HHOB 4EVNA 4JFZL 2YD7A 4UIMB 4MA1C 2PXYA 3BIAX 1A1MA 1SJEB 1UM6L 5TFSL 4QXUH 3VI3F 3O2DA 4YBLC 3ETBF 3N0PB 2XPGA 2ITDB 3UBXA 1AD9A 3IXAB 4J8RA 2CUIA 5F9OL 5T1MB 3VXSE 5KOVC 5KSBA 3IDUA 4MNQB 3MXVL 2BDNH 1G7JA 4DVRH 3OQ3B 1I7UA 3LB6D 3QEQA 4Q9QH 4LAJH 3TJHC 1A4KB 4HIXL 4I5BB 2GK0A 3PF2A 5JW5A 1WLHA 2Q8AL 1JGUL 3TN0A 2ZG1A 2E9BA 3BPLC 2F5AH 3NMEA 1RUMH 1OM3H 3GMNB 3DNKA 1ADQH 2LAGB 4PD4K 4TUOA 8CGTA 1LK2A 5D1XD 4F33B 1TENA 2DLFL 3STLA 2PETA 3VXME 4XPTL 5E6ZA 3S7GA 3IXTB 5DMGD 3SDAC 2ICWB 3VXSD 4XMLH 5DZOA 3FT2A 3TF7C 5CUSL 1X5YA 4U6HB 1IEAB 2GSIB 2VZ1A 3ECBA 4ODWB 3OMZA 1A1OA 2VC2L 4OQTL 4YE4L 3D0VB 2ZUWA 4YXHH 1NEZA 1W0YT 4EUPG 1KIPA 4LAQH 5FIEA 1RIUL 1A2YA 1A9EA 2YD3A 5ITBL 1U8JB 4Y88A 4X98B 3HRPA 3NAAH 1CZ8L 1MJUL 4Z7NF 3CZJA 2D9QB 4ONOA 4XP5H 2CDGB 3S3JA 3LQMA 3WFDL 4JY6B 3VXMD 3FOLA 5TE4H 7FABL 4PGBB 2V9TA 1T03H 2H2SC 3W39A 1CFNA 1DSFL 1QPPA 3BKML 3WFBL 1UACL 2GY7B 3DUHA 1HSAA 1R3KB 2ED9A 5HSFA 5D7LE 2R2BB 4X6BA 3KPQB 4XBGA 3N1GC 3ARFA 2IGFL 4P5KA 4V2CB 3QEQE 4HW6A 4CW1A 2FR4A 5F7WC 2GTZB 3T1FB 3DSFH 1RI8A 3MRBA 5GGQL 1PLGL 4WENB 4Z0BL 1NC2A 2DQFB 2R1XB 3QUYA 3KLHD 2VDLH 4U1SA 5GRZA 3CXDL 3PV6B 3LKNA 4Q9RH 2NY5L 3BP4A 2EE6A 1HCVA 1I9JH 1L4IA 2FIRT 2YZ1A 4LCIH 1F4YL 2P5EB 2PXYD 4RA0C 4GXVL 4WV1A 4NKMB 3I50H 4XX1E 1D6VH 1IGMH 2HFFA 3HCVA 4WFGD 5HJ3B 5E24E 4NC2B 1R5IA 2IBBA 5I8EA 1S3KH 5GGVH 4I1NB 3ZE2E 2AGJH 1A3QA 1U92A 2BMKA 3ZDYF 4DGIL 3ULVD 4QGYA 2GHWB 2PUQT 4YFLF 4LPTA 3RL1A 2CJUL 3LN4B 3OJ2C 1A3LH 4P3DA 1X44A 5JDSA 5JW4R 5FM5O 3TN0D 2EYSA 1CU4L 1I8KB 2PO6B 4YR6A 4U3CA 1I7ZB 1Z0MA 1HXYB 2WUCH 4MCYB 4UNTA 4R4BA 4H88H 1TCRB 1L6ZA 5T1LB 1SQ2N 1NKRA 2V7NB 3DX6A 1QKZL 4RAVB 3RWJA 3EO0A 4WFHD 1OAYL 2AJXH 1FNEA 1VB9A 3H3KA 4Q0XH 3OR7A 1NCWL 5HYQA 5IESH 1PSKL 4PRBB 5IHLB 2CKBB 4CJ1A 4AH2B 3DETD 4GS7B 1MWAH 3MGTB 1QEWB 4NN5B 3NACH 3IDMA 3MCLH 4PIRF 1BHGA 1U8HA 1UB5A 2BVTA 1RULL 5BCAA 5J6GA 2M8XA 2VE6B 4LLYA 1I1YA 3OR6B 1VPOL 3S35X 2XKUA 2AVGA 3I85A 7CGTA 1S7UB 4GXUN 1T1YA 1EGJA 5D8JL 1LE5A 2XQYK 2J1KA 3E2HC 5IWLA 4NZUH 1IGIL 2AERT 5IB5A 1WFUA 4D9LL 1VEOA 1QPXA 4YEFA 3AM8A 4BUGA 2DRUA 2DMCA 4NZJA 5CJQL 4U0QB 3ZKXB 4LBEA 3NPSC 4X5XB 1Y18A 5D1QC 2M2DA 4JN1L 4ELME 2XYCA 5IBLC 1JBJA 2P24A 5GZNC 2XZCH 4PUBH 1P6FA 5C2BH 3ARFD 1RZIA 2VITA 3MFFB 4FQQA 5DD3H 3EYSL 4FQHB 5F7EH 5BVJA 4QCIB 4QO1A 1JGLH 3G04B 4XP9H 5EZLA 5FCUH 3FZUC 3MRNB 3SKUD 4FMFA 3WHXA 4LGSB 2YK1L 3ARPA 3P77A 1NC2D 5TH2B 4MNGB 3QUYD 3L5JA 2BNUB 3MRFA 3TCLB 5JPNB 4M62H 3EBAA 1LP9B 1GGBL 3TIDB 1MCNA 3O2WH 2NCMA 2E6PA 4NO0D 1PX3A 3BQUA 1YA5A 1QSED 4KDTA 1TDQA 4OKVA 4GQ9H 2HLFD 3ALXA 4YPGA 2AJVH 3MLSH 4K8RL 3V0WL 1JZ2A 4LFHG 1SJHB 4NQEA 3U4EB 2EDFA 5JHDA 2X4QA 3EOBB 4HLZH 5FV2A 4URTB 1C08A 3G9AB 4JPWH 3MA9H 2DIBA 3AROA 3SKJL 3UPCA 3GBNL 3P11L 1S7TB 1IL1B 5GHWH 3NIDF 2HH0L 3HPJB 4MA8L 1HNGA 4ZTPL 1FL3A 2J4WH 1BQHA 3OPZL 1IGYB 3PJSB 4MWFA 3T4YB 4W4OC 3GSQB 1MFEL 1VFBA 3PDOA 5C09A 3U30C 2H26A 5DMYA 1RIVH 1NCBH 5FYKL 4ENED 3EHBC 1EO8L 1HKLH 1OL0A 4QRQB 4N5ED 5E8PA 3CMGA 3O2DH 4JHAH 4E42A 5KSVA 1LEGB 5F3BA 5ENWA 4UINH 3MRHA 1A1NB 1NBQA 2GKIA 2Y7QB 4NBXB 5F6IB 1X9QA 3PIQB 4DJMA 4EIZC 1OGTA 3HUJF 5JPMB 3CVIH 2CLZA 3ULVH 1NBYB 3C5SA 4U1MB 1RQ5A 4PV8A 5JQ6L 1SEBB 5L88L 1YEEH 2L7UA 3WIIL 1ITBB 5E9DE 3T0BA 2LTQC 1NAKL 4W81A 3DRQA 3GI9L 2BVPB 3FB5B 4XP1L 4NC1E 3RL2B 1U8LB 1UZ8A 1D5ZB 1ZMYA 4P4RB 5F8RC 3MBXL 1U91A 1BQSA 1L0XA 2FEEI 3I6GB 5J6HB 1NANH 1ZSDA 1FDLL 2X10A 3LB6C 4P2QB 4XWGL 2AJUH 1MCWW 5J9PB 4L8CB 1YEGH 4XPAH 3BESR 3ROLB 1BIHA 4TVPE 4FZEH 1BPVA 2NY3B 3UTTA 3QUXC 4MHHI 3WLBB 5GJSL 3V6FA 1OSPH 5E2TH 5J0BA 4NQEE 4CVXA 1T21B 4NWTL 5JHDE 3OX8B 1GRWA 3FQNA 3DLQR 4CU7A 2YWYA 3G6AA 2YD2A 3LEVL 1DCLA 1KIQA 1KPVA 3G9VA 3U7YH 2VSCA 1IGTB 5GGRB 4Z95H 3OF6A 5HGHA 3BD3A 5DMGC 3JV6B 1QLEH 3DVGA 4U1LB 5D2NB 1DBML 1DQJB 2P1YA 3ULUL 1HEZB 3QQ3A 2VDQH 5C09E 1K4CB 1CFVL 3MLWL 3U0PA 3BQUD 1TPXB 4TVPD 4YFEA 4QY8B 4JY4B 4X4YA 1UB6A 4LKCA 1S5HA 4YNYB 2B1AL 3VFPB 4ODUB 1DANT 3B43A 4NQED 4HBCH 4Z7WA 1U3HD 1BLNB 1MLCB 3KHQA 1KLGB 2VAJA 4LU5L 1NGZB 4OFPA 3TYGL 4ZQKB 4O9HL 2EE2A 2IH1B 5HD8C 3INUL 4OZFB 2E27H 4UT7L 4J3WA 5C0DA 1IAKB 4RMWA 1HINH 3KJ6L 4XP4L 3ILQD 4OZGE 1XF4B 3QO1A 3DUUB 1JZ8A 3WFEH 4QXGL 2XG5A 3QO0B 2A6DB 4PB9L 5C09D 2R4SL 5K33A 4XWOD 4GSDL 3QWOA 4XH2A 2H1PL 2XA8L 1EJOL 1MVUA 1M6OA 3WDIA 5E8OB 1ZT7B 4NZTL 1KIRB 5CINH 4IHOA 5JW4N 1CE1H 2AP2A 3JTSB 1KXTB 2VL4A 4XPHL 5FOJA 5HDQL 1ZT1B 4QNPE 1TETL 3UTTE 1IAOB 3KLHC 3PP3H 1CD1A 5CD3B 4HWBL 4KU1A 3BWAA 4HWZB 2IBZX 1NL0L 4Y1AB 3GJEB 5IB3B 4MCZA 4FP8L 3CFEA 1CYGA 5EIVA 3IS1X 5A2FA 5KZCD 1NMBH 5FUCE 3BEVB 5I30H 1IGCL 3NCBB 4EQ3A 1D7FA 3VGHA 3ULVC 4LVHC 4RNRA 3ROOB 2HFEB 4XCFH 4WRLA 2VLLB 1D5IH 2FGWH 5D2LB 4I18B 5IOPA 4KRPB 5IT2H 3KWWA 5JXAL 1NC4B 1K2DB 1KCRH 3UEZA 2JCCF 4M5ZL 1DBBL 1DQTA 3QG6A 1AXSA 3QPXL 3FRPA 1HQ4B 1QA9B 1AI1H 3TN0C 1NUGA 3UTTD 4UBDD 4P5MB 3DBXA 4XVJH 3KPOB 4PS4H 4RDQG 3FFDA 3QXAA 3C5ZC 4P2RB 5GRUH 4XNMA 3GHBH 4Z7WE 4GG6F 1MWAB 3DRTA 4UAOB 2BVUA 5C7XH 1YYLH 3NCCB 3AC0A 1WAAF 4OZFG 3UTZB 4GG8B 3QIWA 2VLME 5FM5M 4YAQA 3GMOB 3GIVB 4NQDA 4P23A 1C7SA 3OF6D 2X70A 3RUGB 3D0LB 3VFSA 2CLRB 3VXUE 1EGJH 4LHQB 3HC0B 4NRXB 5EN2A 3MRJA 4JO3L 2QLVB 3DETC 1URLA 2ADFL 1GGIL 2P47B 4JZJA 5IW6B 4GMTL 5D1XB 4XCNA 4XMKL 3A0OA 2WAHA 5SWSA 2P42B 4XC3L 1JWMA 1NFDF 4N8VA 3PXJA 5EFIB 5EBMA 1I85A 4MXVE 4OV5B 5DGRA 4JPIA 4MB5A 4OTXH 3ZTJG 4JHWH 4HG4K 4RMUA 1SBSL 3UYRH 2AW2A 1UWEH 5EOQL 3QHZH 3OKKA 2EKSA 5DJAA 4MAUL 1Y0LA 4M5YH 2CMRL 5E00A 3CZFA 3PQYA 4WHTA 4HHAA 5DQJB 5I18H 3BKYH 5ID1A 2E9IA 4NN6B 1IKFH 3GUTA 3MYJB 2OP4H 1PYWB 3LKOB 5I1AA 1RJZA 4X6CA 5IW3A 4JO2H 3LQAH 4XVTH 3ARFC 1A9BA 3HNSL 3O0RL 1MQKL 4OCWH 3VXMB 5KG9A 1WZ1H 1FVCB 4TVPH 3KPNB 4ZTOL 3NCJH 4NCDA 3KNBA 2AK1L 2KKQA 2C1OA 4WU7A 3DO7B 2V5YA 4ZSOA 4TULL 1KYOK 3IDGB 3P9MA 3QUYC 4PJIF 4OI7A 3CLFL 5DGQA 3V5DA 4M93C 4ZPVB 5IHZB 2WINA 1CQKA 2QHRL 3NCFB 5DJZA 5TQ0L 3IU3A 4WV1C 5E1AA 5AYQA 5LAXA 3SE4C 2HJLB 3AAZA 2X4OA 1GXEA 5EU5A 3GMMB 2XY2A 3O9WB 3OXSB 4FA8A 2RGSA 4IDLA 4DZ8B 1LDPL 3IFOB 4YDKL 4NQTA 5IMKA 3SCMA 1Q0XH 3GSVB 1KLUA 3LRGA 1CWVA 2PXYB 5T1KA 1F00I 1I9EA 2HFGH 2YD1A 3VFRB 4FFVD 4NPYA 2O26U 2DMBA 3X17A 1HHGA 4ZO8A 3OGOE 3CGTA 5D7LB 2OK0H 1VGKA 1BZ7A 2BY1A 3QEQB 1YJDH 4EIGB 4OD3L 4ENEC 4U1KA 4Y16A 2DI9A 4HQQL 4N5EC 5CIPB 3ZL4L 4NQDD 4P23D 3ARRA 4LSVH 1QR4A 3MR9B 4OUUB 1S7WB 4Q2ZB 5DD5L 4ACPA 1EFXA 2FO1A 2CDFA 3VU2A 1UM5H 5I1KL 1P7QB 4X6CE 4G9DA 1LK2B 3UXFA 3U9PL 5SWSD 3E8UH 3LKPA 3Q0HA 2B20A 4FZ8H 5J12C 1X5KA 3QT2A 4NNYA 3V0VA 3GO1H 4R26L 4LEOA 4IRSB 4OLZL 2YEZA 5FA4A 4ZSOE 4K3DL 5FUZL 4TRPH 3M07A 3N9GH 4HT1L 4K7PY 3ECBB 4Z6AT 1A1OB 5CZXC 4N0UA 5F7NC 4TOYL 2X4SB 5FM4A 5T5NF 1KIPB 3PQYD 1A2YB 1FH5L 1AXTH 3CFKA 1S9YA 4QF1A 1X6LA 5D71L 1HN1A 1VADB 3B5TA 5GRXG 3DROA 2IPKA 3ZT6A 4M6OL 3IVKA 3U82B 3BP6A 2GT9A 3PGCB 1UWXK 1T0PB 3HE7D 1MRCH 3W39B 5BVPL 4AIZB 5DJYB 2VDNL 3U9UA 4JKPL 3B9VA 2X42A 5TF1H 5EO1A 1GJIA 3VWJB 1DFBH 3D9AL 1TITA 3S5LA 5B8CB 2KDGA 2VDRH 5B3JE 2OTWA 1PEWA 3LQAC 3MRQA 3H9HA 2ZCLL 1KXVC 3C9NA 2MKWA 5FOBB 2EC9U 5H94A 3BQUC 2FR4B 5I6XC 4KDTC 2VQUA 1JPFB 4FQCH 2Q76B 3MRBB 5TDOB 4N0CD 1LD9B 4NUGH 2IWGA 3O4OB 3QXWA 5EUOF 1F8TL 4IRJA 5DR5H 5K9JL 1N8ZB 4M48L 3IJHA 5LQBL 1U3HC 5D7KD 1FLRL 3QA3B 3BP4B 4JN2B 2EDQA 1DLFL 3MUJA 4U0RB 3SCMD 2QQKH 5D1ZD 3NH7H 4JFFB 1I3RA 1ZA6A 3QH3B 3QRGH 4WUUE 4XX1G 5SX5H 5T1KD 3TA3B 4YJZL 4PFEA 5AZ2H 1A14H 3E3QE 3HCVB 1S7RB 1R5IB 5DMIH 3O3DB 2EDNA 4ELMB 5I8EB 1RHHB 1CXKA 2XTJC 5I1IL 3PXHA 3GM0A 2MWCA 4EZMA 4W6YB 3FQRB 2ITCB 3O6FA 4S1DD 4YHZH 5IKCA 2ZKHH 4ODSH 4Y16D 2C3VA 2F5BH 3QSKB 4ZO6A 4KI5E 4OCYL 3HI5H 4LQFL 4KUCD 1QSFA 4ORGB 5EZJA 4LCCA 4LLMB 5MI0B 2ZOKA 1EFXD 2OZ4L 3DPBA 3LKSA 1F90H 2O5YL 4XVSL 1YJDC 1KCUH 3LVEA 1FBIL 4M8VA 1VKXA 4IJ3C 4R4BB 3OV6A 1RFDH 1FAKT 1RJLA 4KTEH 5IIEA 3RGVC 4KKCD 1JN6B 4UT6H 3DGCR 1A5FL 2V5SA 3OR7B 4NJAH 3WEXB 4P49A 5GRWA 2OL3H 4DKFL 4YWGH 3WMSA 1WWAX 3RDTA 5JORA 4PJ8B 2P44B 4GO6B 4PGCA 3M17A 4LLYB 3RRQA 4ZFOA 1I1YB 2ZUSA 5KS9F 2R2HA 3DV6B 4O5LL 5BZWB 4UBDC 2GYSA 5C3LD 5ERWB 3VFUB 3H9SB 4WWKA 2XKNA 1LO3H 3LPFA 2ENSA 3B9KA 5C0ND 4JKLA 1BBJA 1A6WH 4ZOAA 2IAMA 1EPFA 5D70H 4HUWA 4KDWA 1A6UL 1VHPA 5DUBA 3KPRE 3MRDA 4QOKD 5GISL 4YQXH 2FATL 4WW1B 4GMSL 5CEZE 1WFTA 3MSPA 4P3CH 3QUZA 2B8OT 4U6XA 4X4ME 3B8SA 1UYWH 1EEQA 3O2VH 5E9DB 3VD4A 1RUAL 1AKJA 3TJEH 1H0DB 2CSPA 3WHXB 5JLZA 5DRNA 2DQJH 2OJZH 32C2A 4I3RH 4IRJD 2FWOB 2H6PB 2DJ4A 1CE6B 3BMWA 3MZTA 1SEQH 3UJIH 2DQCH 4B41A 5C8JB 2DI8A 4ODXA 3A6BL 5C0BE 4HLJA 4U1JA 2VXVH 4MJIA 4G9FE 3GJFB 3ZYOA 4DN3L 4JGMA 3REWA 4YPGB 2DTML 1QNZL 1V3JA 4HIEB 1II4E 1MIEL 4YC2C 3NABH 4PREA 5JHDB 3QDMA 2Z9TA 4Z7QF 3O6FD 1G7HA 4DFIA 4ZNEA 5DRZB 2H8PB 3VD7A 4K71B 4AG4L 2YA2A 2AEPL 3QDAA 1EDQA 4WFED 1QSFD 3EYOB 3KHOA 3WO3B 4U6TA 1MCOL 2AJYL 1JNJA 5DUML 2PYEA 5C09B 2H26B 5F7DA 3O3EA 2V2XB 1B90A 5BMFH 4D0DB 3O8XB 5E8PB 3RHWF 4BKLB 1U8MA 4HJGA 2ED8A 1T1ZB 4OT1H 5ITFA 1KGCD 4OD2B 3HFML 2FYYA 3TH3T 3ZYZA 1KB5L 3C5SB 1YEJH 2HJFA 4PV8B 1K3ZA 3AS1A 4KK8D 4NC0B 5DA4A 4ZFFB 2BXYA 3TT1H 3QB7C 4I0PA 4WCYH 3L95B 4OZGB 3DRQB 5CWSB 4FFVC 1ND0A 3FB8B 5F1SA 3VXPB 4C56A 1F5WA 1FL5A 3W9DB 1UZ8B 1YDPA 4WWKD 4GRMA 5BQ7A 3B9KD 5CGYD 1MAKA 4L3EE 4RMVA 2MHAA 2GY5A 4UV4L 2J5LB 1CGSH 1SJVA 2FD6L 2IAMD 5EG6C 2RCSL 4UOJA 1QRNA 4JR9H 4MJIE 3NGBB 4MDJB 1QR1A 1Q0YH 1TJHH 1RK1A 4P23C 3U0TB 4R3SA 4EQ2A 4AIXA 2H3NB 2ZJSH 3QCVH 4ONGL 5IV2B 1J8HA 1MFDH 4WFFD 3KPLB 3UTTB 2X4NA 1FZJA 2WZPD 2GUOA 1X5JA 5IB4B 4PTTA 5HPMA 3GSNL 3QUZD 4GAYA 1XF2A 1OD9A 2NTFA 5D9SA 1T0MA 4ZAKA 2DQIH 4BQ9A 4D8PB 4TPRH 3G6AB 1AKJD 4ZNEE 3CVHL 4KVNL 3O3UN 1KPVB 1S7XA 1IGJA 3V4UH 3BUTA 3DVGB 1MJJB 1FNAA 4Q7DA 2BOCA 3CDFA 1U8QA 1NCAL 3CX5J 3QQ3B 2VISB 5FGSA 2PYEE 4MJID 5GQBA 5C70A 2AK4A 3FO2A 1RAMA 5IW1B 5DJ6A 1KTDA 3AMKA 3T0DA 4AY0A 4UOW1 1E4WL 4JJ5B 4PJBF 3MREA 2XQBL 1FIGH 1T20A 3AB0C 4WHCA 1NH6A 3O11A 3OZ9H 2QSTA 4WHYG 2X44D 4PV9A 5CJ8A 3QDMD 3SJVE 1FE8L 4GBXB 3MJ7B 1MCLA 2VIRA 3FONA 4MJ5B 3T2QA 2XI9A 1PVHA 5C3TA 4P2OB 5C0DB 5I0DA 3CFIC 3CFJB 3HE7C 1JK8B 4WUKH 4HUXB 1FNSH 2XY1A 1C12A 3TIEA 3CDYA 4ELKA 3VXUB 1CIUA 1EXUB 3FN0H 3S37L 3FFCA 2BVEA 3RGHA 3S4SA 4WEBL 3BPOB 2NX5A 1K5NA 5K9KA 3MRKA 1JNNH 5M94B 4UTBL 4ZUWA 1BAFL 2BNQA 2P8MB 4U1IB 3MLUL 5FK9A 3GSOA 4Z5RA 4GAJL 5CKAA 4LLDB 5CEZH 1IEBB 4N0CC 5BO1H 5E2UL 3VFWB 1J8HE 1FORH 1N64H 3EDFA 4POYA 3OXRB 5LBSH 5TDNA 5BOZG 3SCMC 3QG7L 1NGQH 5D1ZC 4I0PD 5IJKA 2D7OA 1CR9H 3T08A 4L5FL 3HC4L 4MCZB 3VI3E 2VL5A 2YUXA 3CFEB 4GXUM 4C56D 1B2WL 1DJSA 4N0YH 5DVMA 1IFHH 5F9WC 1Z3GH 3ARDB 3EDKA 4RNRB 4OCMC 1J86A 3CFCL 3CK0H 3SGEH 5F21B 4S1DC 5DQDL 3MRRA 4KGLA 5IOPB 3WS3B 1QRND 3QHFH 4Y16C 1PQZA 3FL7A 4WY7H 5FF6A 4R97C 1AXSB 5EIQA 5GGSB 4CN1A 3FO9B 4OCRL 3DBXB 4RRPA 1T7VA 3FFDB 2EH7H 5HY9A 2B4CL 2P8PA 1KBGH 5ICYA 2R0LH 1S9XA 3T2NL 1F3RB 1MNUL 3MBEA 2Z8WC 3GBMH 3GIZL 1G9EA 2HVJB 1Z6JT 3FKUS 3QCUH 3QIWB 2X41A 4NKQB 2F74A 1K9TA 4E0RA 1E27A 4ZS7H 4KROD 3OAYK 2X70B 2CIIA 4LIQE 1K8IB 3U6RB 3PGDB 1Q9OB 3U2SA 1LNUB 5DURD 3THML 4NKOA 5GGTA 2WUBL 3IAGC 4JZJB 2NX5E 1GPOL 1OAXH 4M61B 2AK4D 2JJUA 3PWVA 4PJEA 4CDGC 5HHQB 1NLDH 1UXWB 2FX7L 3HRZB 4M7KL 3QQ4B 4MX7B 4C58B 2G5BB 4JPIB 3F62A 5MENA 4KHXH 5A2KH 1CICA 4Z7NE 5C0NC 5TDPB 5I2IA 4J3SA 1MCCA 1Y0LB 3BP7A 4NN7C 5IEKA 4QTHA 5E7BA 4HHAB 2FNBA 3TESA 4YHKL 2CXGA 1FGNH 3O41A 3FFCD 2AQ3A 4KK6D 5HI5D 3FN3A 3MC0A 4O00A 1Z9SA 4JPVL 4X6CB 1DEDA 3UZQA 2BRRL 3RBSA 1P7KA 1ZTXH 3WO4C 3OHXB 5KG9B 5JW4Q 2BNQD 2UZIL 3EYUL 3H9YA 4UILL 4CMMA 1QVOA 5F7MC 2HYMA 5SX4I 4QWWD 3MYZA 2UYLB 4JFXA 2XZAH 4ZSOB 4IRJC 1FO0A 1TVHA 3L3JA 2CKBL 3BHBB 2D7TH 3D6GA 3V5DB 3TFKD 4POUB 3QAZB 2IFFH 2QKIA 1F11A 5AEAA 5HYSA 3AAZB 2X4OB 5IVXF 3WXVL 1DUZB 1O5DT 1EHAA 1VFAA 5EU5B 5CSZA 3BP5A 3Q6FA 2NW2A 3IDJB 1DE4A 1WT5A 3QXTA 1HQRB 4L8SA 3ZSSA 3O6FC 3HNVL 2B2XL 1ZGLB 2SEBB 1KLUB 3F58L 4NM4H 3D39A 2UY7A 4HKZA 2IADA 3IB4A 3VXTB 4OLXH 1ES0B 2FX9L 3T0WA 4L9LB 4LCCC 5IBTH 1QLFA 4DTGL 5I76A 1BOGB 1YEHH 5EH1A 3AU1B 3DX9B 3LHPL 1X7QA 4G8EB 5IHBA 1FQ9C 5MENE 3HKFA 4ZXBA 1I1FA 4FXGA 1J1XH 2FO4B 5F88A 1EFQA 4NZRL 3U83A 4OM0H 5I1LB 5CJXA 1GH7A 2EE3A 1MUJA 2W0FB 4X4ZA 4JQVA 4LNRA 1UWGH 2VABB 1EFXB 2I9TA 1A7QH 3I6KB 2HG5A 1OAZH 4KQ3H 4KK8C 2XRAH 4WUUB 1IC1A 4G9DB 3EDEA 1INEH 1JTTA 4XNYL 2ZWLT 1JRHH 2C3WA 3LKPB 1ROWA 3W9EA 2YD6A 3X12A 4HEPG 3BXNB 3EO9H 3QJFA 4JG1H 4LEOB 3WD5L 2LV4A 1AGEA 4U2ZA 2X1WL 3DMMB 2YEZB 4LSSL 5MEND 3LMJH 4WWKC 2Y07H 1CICD 3B9KC 5CGYC 2GJJA 3BDYL 3IGAB 3WXWL 5JMOC 4ZFZB 1QRKA 2FDBP 2IAMC 3W2DH 3RBGA 1U8KA 1EERB 4JANB 4U7KA 4Z7VF 1KJMB 4NO5B 1S9YB 5HHVH 1A0QL 5DJ2A 25C8L 5CGTA 1DBKH 1OAUL 2V17H 3DHMA 5GS0D 1S9VA 3EAKA 5JW4M 1IC5L 1KJ3H 2ZNWA 2BY0A 1ZLVH 4H8WL 4OSUH 4YXKH 5KN5B 1MI5E 4M7LH 4OZ4A 2NY0B 3D39E 3U9UB 2P49B 1U3ZA 5JW3H 3CH1A 2HTKD 1UCBH 2ESVA 1AO7A 3SKNA 3RWFA 3ARBC 3DV4B 3V4PH 3VW3H 1U2CA 4OCXL 2BDNL 4DVRL 4XNQA 1J12A 1JYWA 3WCYA 4Q9QL 1UFUA 1YC8A 5H94B 4F8TA 1OAQL 3L5WB 1BX2A 1T3FA 4UB0L 3P73B 2Z0BA 4U1HA 1LGVA 4LIQH 5HGBA 4R2GD 2F5AL 4HS8H 1QFUL 4PG2A 1AJ7H 2AQ2A 2VXTL 4K07A 4RBPH 1WBYA 1RUML 3UTPD 1OM3L 1CL7L 1KT2B 1J18A 2X4RA 1ZA6B 1OB1B 2ADGB 3D39D 1MFCH 1DQQA 3KPRB 2B0SL 2VZVA 1MH5A 3LV3B 2ORBH 5TE6H 3LRHA 4M4RA 1F4HA 5EZIL 1JV5A 5JA8B 5C0EB 3R4DA 2R1YA 2F53E 4ZXBD 4YDJB 4LHUA 3CXHK 1BBDL 1R3IH 4YXHL 2Z4QA 1KOAA 3KPSA 5IJVB 3WJJA 3P4OA 5FGRA 1WVZA 1HDMA 1FNGB 4DZBA 1BM3H 2VLKD 2WWKT 1QFHA 1RIHH 3HUJE 1CGVA 3TCXA 4RFNB 3NAAL 4PJGF 3BN9D 3HMXA 3BN3B 3LKSB 5C0BB 3B3IB 4NCC1 3BZEB 3VGAC 4G9FB 2HA1A 4H20H 4I0PC 5I8CA 1VKXB 2YRPA 1RJLB 3SDYH 5IIEB 4EN3B 4F2MB 5CBAA 1MOEA 3CDGA 2R0WL 1L0QA 1ZVHA 4ZUTA 1WJ3A 2ESVE 4F7EB 1AO7E 3PWPA 3PG2A 2LVEA 15C8L 3U4BH 3RDTB 4CVWA 3FT3A 4D94A 3SN6N 1OTSC 4FQPA 1HHJA 4Y19A 4PGCB 5IMMA 35C8H 4DVBB 1F58H 1E4JA 2YPLD 2OQJB 3ARYA 3OJMB 3EOTH 1HKFA 4MDIA 2VDLL 4P9ML 2AV7A 3ARWA 3BGFC 4ZUVB 5GGTH 1MFBH 3Q1SH 3MMEB 4LCIL 4OGXL 3BH9A 5DWUH 1BBJB 4P46A 2JF1A 4LCWD 4HXAH 2EDRA 5KANI 4I48A 4DUWA 3I50L 5DUBB 1H5BA 4LVOC 2AXFB 2WIMA 4MA3B 4KVCH 4KROC 1H8NA 5GGVL 3LZFH 2ESVD 4AEHL 3VE0B 2AGJL 1AO7D 2ZOLB 4RBPK 4NHCH 2W9DH 3QUZB 3O6KH 5CFHA 5A43C 5I8OL 3X13B 5FA3B 1A7PH 4PJ7A 4MQTB 4Z7UA 1JTOA 1EEZA 1T6WA 2EIZA 4P4KB 5I75C 4KZEL 2JCCA 3HZVA 3QDJA 1MJ8H 2DD8L 4HXBH 1BIIA 3PHOB 4TSCL 4X6EA 2QBWA 3CJJA 1IM3B 4YXLL 3KPSE 5AWNH 2PW1B 5DRNB 3RVTC 5ACZA 1XR8B 5EIIB 2NY2D 4L3EB 4YFDB 5GS0H 4I0KA 3RX5A 5CZVH 2AXHA 4OGYH 4GG6A 4P0DA 3S34H 3T2PA 2WUCL 4K23H 5KSAB 1WAAA 3U36A 4U1JB 4QRRA 5D6DA 1FFOB 3HE6D 4HPOL 4PJCB 2EDOA 3RIAK 1RZJL 5JOFB 1KTKE 1G6RA 1PG7X 4M43H 3FN9A 3HG1A 4Q0XL 5HI5C 3M1BA 4KK6C 1FO0H 5FHAH 4CGTA 4PREB 5E0QA 4GAGH 4ODVL 3C8KA 4LHUD 4ZUUA 1NAMA 2V2TA 1MWAL 3PWPE 4YHOH 4M1DH 3P4MA 3OJVC 3NACL 5T3XL 3REVA 2F54A 4QWWC 1DEEB 3QNYB 5GIRB 2AJ3A 4Y5YB 4OGZA 3VCLB 1A3RH 5CEYA 3CD4A 5GSVB 3QUMA 1Q72H 4HIHB 5TJWK 4K7FA 1NGPH 3TFKC 2PYEB 4R9HA 3P0VH 5F7DB 1YEIL 5IJKC 4PGZA 4JDVB 4LK4A 5L8JB 1PG7W 3LRSB 3VGBA 2YKLH 1U8MB 5C08E 4NM8L 3U7WL 4JB9H 3SJVB 2YA1A 2A73A 4X7TA 4JEGB 3OKEA 3PWPD 4F7TA 2EDBA 2HJFB 2G60H 2E8ZA 5C2BL 2BOBA 5DD3L 2VDKH 2VLRA 4R7NB 3PWJA 4NGHL 1JGLL 3W5MA 1CK0H 2JCCE 4XP6H 2Z92A 1E4KA 4Y19D 3ZO0A 3FQWB 1JHLL 1L7IH 2H2PD 1DN0A 5FO8A 4FQ2L 5GS1A 1I9IH 2FSEA 3EOAB 5FECA 1V3LA 3O2WL 4P46D 4GG6E 2E7CA 3KJ4C 5IQ9B 1WAAE 4UQ3A 4QRRE 1QR1B 1ACYH 1OCWL 2XN9A 1J8HB 1UADC 1KN2H 2X4NB 3BDXA 1R3JA 4DEPC 3K2UL 1U3JA 3PGFL 4GAYB 2A77H 4OJFH 5GRVL 2NTFB 5E56A 4S0SD 4XAKE 4ZAKB 1QBML 5F96L 3QDJD 1QSZA 2X4PB 4OF0A 5GHWL 2J8UE 2IC2A 3TBVA 1PZUB 2F54E 1I8IA 1NFDE 5IF0A 3LH2L 1MAMH 2JIXB 1KULA 1C5CL 3RY4A 4HSQA 4KJWD 2DKMA 1Q9KA 5ID0B 2PCPA 5EC1A 3IDYB 4BFEA 1T6VN 1CICC 2JELL 1ZVSA 3L3KB 4N1EA 4F37K 1JZ6A 4QRRD 5D5MB 4UTAH 3QNXA 4P5TB 1HKLL 2NXZD 1KENL 4JHAL 3H3PH 3MNVB 1MEXL 4UINL 5I9QB 1AGBA 4CN6A 3HG1D 3O11B 2YUVA 5GS0C 1IT9L 1PKOA 1ZGLM 2F58H 2K9UA 3H42H 5CHNA 5T33H 1G7QA 1FGVH 2ID5A 1YEEL 3UJTH 1EMTH 5DHYA 2FJGB 2F54D 3PNWA 4XAWL 1R0AH 3P30H 1A64A 3DYOA 5INCB 4NFCA 4RMRA 4MVBD 2YPVL 4O58H 2HTKC 5E8DH 4F80A 4HEME 1MY5A 1GYAA 4PJIE 1I7RA 2K7QA 2NX5B 1K5NB 3BT2H 4WGWB 3MRKB 4KHTL 1LWRA 2FJFA 1ONQA 4ZUWB 3F7YA 1NMAH 2HN7A 3RWCB 5IMLA 2J8OA 3Q6GH 1JMZA 3MV11 5F6HJ 2YUWA 5H37H 2DM4A 1F4WL 1M05B 5DZNA 1RUPH 4D3CL 5EO0B 3OKNA 4BZ1H 1RUKL 4I2XA 1Y6MR 4R2GC 4AEEA 1T1WB 1CBVH 1HH9A 5E2TL 5EOTA 3TO4B 2ZUYA 2ZUQC 4L8BB 5TDNB 2A83A 2VLRD 3RVVD 2VJXA 5AYUH 1ZHBA 4KQ4L 3RA7L 1D9KB 4NO3A 1LDSA 5HYJA 1HXMA 3U46B 2HRPH 2PR4H 1U8PB 3L3GB 2OXGA 3HMXH 1CXHA 1OAKH 3E6HB 1U2HA 4YDLC 4EOWL 2DQUL 4HZAA 5E6IB 2VR5A 4ZXBC 2VDQL 3MRRB 3QZWA 2XIDA 3TPUA 5C0FB 3MCKB 2GSGA 5CJXC 3EZ8A 2NMSA 4K2UL 4C4KT 5KAQG 5BXFB 2XN9D 4M4PA 3BX7C 3WKML 4MZ2A 4TN9A 5D93B 3CMOH 4HBCL 5MEOB 4LP5A 3BN9C 3G6DL 4PRPE 5J56B 2HFTA 4FABH 3MBEB 1KNOA 1YQVH 1EO7A 2CDEB 1KFAH 3WHE0 3ZDXF 3D1MC 5C0IA 4X8JB 1HINL 2DDQH 4N5UA 4FXKA 4IIQA 2MCG1 3FQXB 4N0FB 4NKDB 4P59H 5E08L 4OZHF 4RGOH 5DSCA 2FZ3B 1FVEB 2YD4A 2WV3A 3V8OA 3VFTA 2FHFA 2Z35A 5IROA 5HGDB 3ARQA 1DQLL 3PWVB 2FGZA 3GSWA 1PDKA 1WC7B 1YMHB 3QP3A 1XR9B 3ULVF 1XIWA 1DBAH 1JIBA 4WI3A 2EDEA 4I2XE 3CSYA 3EGSA 4NO2B 2Y36L 5I2IB 1W72A 2Q87A 2EZ0D 4ZOCA 3I9GH 3GI8L 1UM4H 2RR3A 3ZLQC 4APQB 5HHME 5I30L 3I3EA 5HYJE 3ULSA 2GIYA 4ZD3L 1MCPH 5E7FA 1HHKA 4L3CA 5DMJB 1JL8A 3UTSA 1TJGL 3RTQC 2HLAA 4OCLC 1KEGL 1LO4H 2XNAA 1MREH 5KS9A 1G6RH 1AI1L 4TVSa 4JFXB 5EUOE 3D85A 3L3IB 4NUJB 4WW2F 4PG2C 1MHEA 2AEQL 4YIQA 4LRNL 2K1MA 5DK2A 1NAMH 4UOW0 3MV8A 5FKAA 1OVZA 2MQ0A 1FFNA 1IAIM 5E94A 3SOBH 3HB3D 3HE6C 2CLVA 1G7MB 3O6ML 4JQXC 5GZOD 4TSAH 4MD0A 3LQZA 5HI4D 5HYJD 2HKFH 2X9YA 1MRFH 3N85H 2MOVA 4GKZA 1GAFL 3MQIA 5CSZB 1XF3A 1JZ5A 2WP3T 1EGJL 2AXGA 4M6ML 3NTCL 3EFFB 3QUMH 5DTFA 2QQNL 3VH8G 2IG2H 4L8SB 1HHIB 1XH3A 1MI5B 3VRLF 2EECA 3EJYD 2DB8A 1V3KA 3WJJC 3BMVA 4DCQB 4PJXE 1JGVL 2OXHA 4FFYH 2KPNA 4HGWA 1MJ7H 1PBYA 3M8OL 1N2RB 1TCMA 5JO5B 4U6YA 1YMME 1NJ9B 1F2XK 1CF8H 5EOCL 1U8OB 4K3EH 1U8NA 5FKPA 1T4KA 4XNXH 4X7SL 5AZEH 1R6VA 5I18L 3Q5TA 3TNNB 1QLRA 3TNMA 3HAEA 2YRLA 4MLIA 1ED3A 1C1EH 4R8WH 2I9TB 5LCVH 1BEYL 4DKEL 3UTSE 4I8DA 5HHXL 1JPGB 1EBPA 1EX0A 4AENB 4MQSB 4X7CC 1REIA 3TT3H 1XIWD 4PRNA 1EO5A 5KS9E 3QJFB 5C07A 3GSUA 1RJYA 1N0LA 1PJ9A 1WBXA 4FQLL 4R7DA 2F53B 3VFGH 5F7LB 3K4DA 5DVOA 1I75A 4P46C 1JNLL 2OMBA 4WTZA 1AGCA 1NCDH 2FBJL 3MV8E 4Y4HB 5GSRA 4J3TA 1FV1B 1G1YA 3F7PC 4AZ8A 1C7TA 3DVNA 4G8GE 2VQTA 5E8EB 3C2AH 3HUJB 5EORL 4HK3N 3MLYH 5CSBA 4OLWH 2JK5A 3QCTH 4FNLH 1SY6A 3UTSD 2UZYB 1P4BL 2LQRA 4AM0B 5EZOH 2BVOA 4Q9CA 4OAWA 2MFNA 4LSUL 1MHHB 5DRXA 1TVDA 4HIJA 4PRHB 1G1CA 1S7QA 2XXMB 2E6JA 1ORQA 3D85D 3MXWL 3NIFF 4Q6IB 1AO7B 4KJWC 3SKNB 5JXEA 5TGBA 5F89B 4HUUB 3O6LH 4L29A 1EUTA 4ZUSB 1CGWA 3MV8D 3BIKB 2EH8L 5BRZA 2DWEB 4HFUL 2J6EA 4KAQH 5D6DC 4HKXA 2NXZC 2YMXH 4LRIC 4WEMB 1G0XA 4E41E 4YHYB 4I4WB 3AS2A 4LSVL 2VZTA 2Y06L 1LO2H 3G5VA 4G6AD 3SQOH 4K7PH 5DYOA 2Z91A 4N8CL 2NY2B 4RAHA 1WBZB 3BW9B 1UM5L 1GIGL 5C0RH 3TBWB 1YEDA 4LQ1A 1AQDA 3KYNA 2X4RB 4PJ5A 5L9DH 1KCVL 4I0CC 3BGMB 4JREB 2B5IC 4KTDL 5GGUA 3PL6D 4FZ8L 4HCRL 4QHLA 3QXUA 1LEIB 5KBNC 3CCHA 4JRYA 5SWQA 3UC0L 1N26A 4MVBC 4QRPA 4ZFGH 1INDH 5C07E 4XBEH 1JGDA 3LIZH 2BCKA 2DJSA 1Q38A 1T2QH 2BSRB 2IANA 1YEFL 2R1YB 1FVDB 3T0EA 4LHUB 2XZQL 2VKXA 3D18B 4L8DB 2JLLA 1JI1A 2A1WH 2Z4QB 4MD4B 4JDZA 1IBGL 3L5HA 3KPSB 4HGKC 1MIML 1UVQA 4G6KL 4DZBB 4PJBA 1I9RH 1TZGH 1S8DA 1N5AB 1S7VA 4UDUA 1ZLWK 3KXFB 1GGTA 3HC3L 5I71B 3SE9L 3GMLA 4KJYA 3SPVB 2XFXA 1KXQE 3AREA 3SDCB 1HIML 3P4NB 2WK2A 3GRWA 1E4KC 4JFDB 1DR9A 3HI1A 2YD9A 5K9OB 4I3SL 2EDXA 4NRZB 3RKDD 1ZLUH 5CBAB 4LEXL 4KWUA 5TF1L 4PLKD 1NUNB 3CDGB 5GS1C 4JRXA 1DFBL 1BMGA 3QBTB 2APWA 4LHJB 4IEFB 4EDWL 4LARL 4ZUTB 5D72L 2VDRL 2ICEB 4UDTB 2YSSB 3DWTA 3D2UB 1PY4A 4JHZA 4JLRA 5EU7E 5BRZE 2CH8A 5ALCL 4LNVA 3EO1A 4XB7A 1A7NH 3X3FH 5IMMB 4PJHB 3QRFM 3F7RA 3BISA 4KZDH 5DD0L 1G7PB 4NHUA 8FABA 5E2WH 3WLWD 2AV7B 1OGAA 4HDIA 1LE9A 1TVBB 5KVFL 2BSED 3BH9B 5B38A 1K6QL 4AYFA 3S96A 5C08B 1CGUA 1XGTA 1PY9A 1H5BB 2Y4SA 3BSZH 5FYJE 1GZPA 4PY8I 4PJFF 1BD2B 2A6JB 4IRZH 4KKLD 5T3ZE 5A2JH 1BP3B 3GMPB 4HV8B 1FSKC 4QRPE 5JXED 5C0GA 2XWBA 2I60L 4XNUH 5C6TH 5F1IA 2IANE 3B4NA 5BRZD 1YPZF 1W72H 5DDHA 5IR1A 2JCCB 4HC1L 4ODSL 4ZYKA 4YDIL 2ICWI 3VG0H 2L4OA 1YECL 2ICCA 4LSTH 3IFPB 4E5XA 5HDBF 2PW2B 4NQCE 3SHSA 4C4KO 3BZFA 3IDXH 3NA4A 1JZ4A 3GB7B 4YO0A 4I9WE 5EA0H 4GG6B 3QFJA 5I1HH 3RVXD 4PJ5D 4LLQA 4I77L 2EZ0C 5LGHL 4KJQD 1KB9J 4M1GH 2ENYA 4JRYD 3WUWB 4JO4H 1SVCP 1S78D 5FO9A 3BFOA 4JRXE 2XWJA 4J2XA 1A7RH 4GRLB 3T0ED 1ERNA 4ZUUB 2V2TB 4BK4A 1U95A 2IQAA 3V5HB 1HNFA 3R0NA 1ZS8A 2J8UB 3C08H 1NFDB 2VYRE 3RPIA 1ZV5A 1AD0A 1MRDH 1C5DB 4RISH 4I13B 3N1PC 5F8QC 1EZVX 5CMAA 4Y4FA 4NQVA 3VRJA 3AY4A 2DYPB 3KYMA 3CFDA 3UO1L 1PKQA 2WSKA 2W07A 3RWEB 4ETQA 1HYRC 2QR0A 2P46B 2I07A 2ZCKL 2R1WA 3MOBL 4D9QE 5GZOC 2EDDA 5TE7H 5HI4C 2DM2A 4M8QA 3GNMH 4JRXD 3HMWH 4UIKL 2ZSVA 5FGCE 3T3PF 5HVGB 3OKEB 5IQ7H 2WBJA 1Q8MA 2O5XH 2FHCA 5JNYA 3EYVA 4LPUA 3EJYC 5KVEH 3ZE0F 1LK3H 1WZMA 5HVFB 2Z92B 3BOVA 3OJDB 2R0ZH 3HAEH 5FO8B 4XPGL 4PJIB 4CU8A 4R0LA 4HIIA 1J1PH 1OGAD 1GC1H 4J12A 4JG0L 5FEBA 4C57C 2VXQL 4J1UA 3VFMB 3G5XB 1X5HA 5IEHB 5IVXA 4IIQC 3WUWG 5DEFB 4U1NA 4GW1B 1T22B 2V2WA 1R3JB 3D3VE 4OI9A 4CADB 1XGQB 3E0GA 4RQQA 5IBUB 3MRPA 4X7DC 1RZ7H 1GOGA 1HWGB 1MF2H 3K74B 2WP3O 1OARL 4ORZC 2VLJB 3MODH 5IROC 1S5IH 2GTWB 4K3HA 2LU4A 5IF0B 1XIWC 1CLCA 3R0MA 5DUPH 3G5YB 5E2VH 4S2SA 2DQHH 3BUYB 1Q9KB 3QNZA 4FG6D 5F7FA 1SY6H 1G0YR 3QFJD 4KKBD 4XGZA 4N90E 3TBSB 1RK0B 5ALBH 4CU6A 4J6RL 3ZYJA 4MQ7A 1YYML 4QKXB 4JFPB 3OL2A 3CPLA 3IRPX 4L4JA 4OT1L 1I1AB 1E6OH 5CJOL 1A8JH 4PRPB 3MA7B 4O51A 4OQTA 1MLBA 5CCKH 3TT1L 4W70A 1EAPB 2UZXB 1YNKH 5DMKB 1X4YA 4G7YL 3PNWB 2ATKB 4WI8A 3L3DA 1AE6L 3MV01 1F02I 4JZOB 3AVEA 1CG9A 4Y4FD 1N4XH 1AY1H 1I7RB 3BD4A 4A6YA 5KW9L 3WV0A 4FQXA 5DLMH 2ARJA 1D5BA 1I8LA 2EC8A 3FT4A 3GZKA 4JGJA 4Z7VA 1XGRA 2P8LB 2ADIA 1E4XL 3MRGB 1SHMA 4JY5L 5IVZB 3WS6A 3ZE1F 5IVXE 2VN4A 3QIUB 3T65B 4G6AC 4RIRB 1VCAA 5IBUG 2WBJD 2A83B 2Q7YA 3K2MC 3E1F1 1ZHLB 3WFZA 5LGKA 2VZ3A 4DKAA 2CIKB 5J11C 3G6JB 1FRGH 1Q94A 5DT1L 3PL6C 5HHMB 4B7IA 4ERSL 5HYJB 1HXMB 4HF5H 3V4UL 1J0IA 1R24A 2OR9H 2Y6SD 4JQIH 1H3PL 4ODTL 4EI5C 5F7UA 3CSGA 4M7ZB 3MV9E 4S11A 4PLJD 5GXBB 4LVNB 4CUCA 2NY7H 3UPRA 4Y5VB 3SDAA 3LD8C 1CDYA 3GRWH 3FB6A 2HT3D 3O3BA 5EUOB 1ZANH 1FIGL 1SM3H 2BC4B 3OZ9L 5KVGH 1GC1C 3TP4A 1T7ZA 1KNOB 4X6FB 4LPYA 3K80A 3RKPA 1D3CA 1NDMB 2D03H 4IDJL 2VQ1B 1FC1A 1JPSH 1RZFH 5I1CH 3OKOB 3EZJB 1JHKH 4MZ3A 1RSFA 3SGEI 5EBLB 1FNSL 2Z8VC 3RKDC 1FZOB 4YHLH 5HGAB 3IKCA 4PLKC 1G9NH 2BXZA 5IFJB 2NY6D 1ZWIA 1LEKA 1RMFH 5ILTH 4NOFA 4F57H 4RZCA 4WIQA 1YEKH 2IPUG 1OF2A 4WNQB 1P9MC 5T5NG 4K55A 3X14B 2Z35B 4Y5XC 4PJXB 2BJMH 4Y2DA 4Z7VE 3QEHB 3GMRB 4L4TA 3S36X 5CEZL 1CL7I 5BO1L 5IB1A 1N64L 5IP4A 4QGTA 5BV7H 4JCMA 3SKMA 1CLYL 2ERJB 3OGCB 5CSGA 1YMMB 2R69L 4PY7B 1RVFH 4NP4H 3MRIA 4KK9D 3RAJL 3LEXA 5ADPL 1DQMH 1W72B 1RZKL 3H3BC 2G9HA 1NSNH 4KUCF 3JTTB 4DQOL 2A6IA 1AQKH 4Q6YA 4X99A 4N9OB 3P4LA 4LDLB 2EEBA 4N0YL 4RGMC 4KKLC 5DFWH 1IFHL 2KL6A 1LILA 5JXEC 2LU3A 1MFAH 1NFIA 3K1KC 4S10A 4FQXD 4A2MA 5EU4B 2GJ6B 3FO0H 2H9GA 3QI9A 4OZIF 1NMCB 1LO0H 2CGRL 2XNAB 5DA0B 3FRUA 3IF1A 5BS0E 5KS9B 1IAIL 2YWZA 2W0KA 2CK0H 3S3SA 5CGMA 3X11A 4EI6A 3NZHH 4YHIA 5ISZA 2JJVA 1KBGL 3T04D 5DHVB 2R0LL 4YIQB 3EFDH 1U8IA 1OW0A 3OKDA 3AMLA 3GBML 3MV8B 3RVXC 1LO5B 4XBPA 4S1SH 4KRLB 1FFNB 4G8GB 4QHKJ 3QCUL 2MJWA 2I27N 4IMLA 3KG5A 3T8XA 4HX1A 2BSSA 1CFQB 5INDB 4GRWF 1I3UA 1S78C 2AXGB 5EUKA 5DTFB 3HS0A 3NCEB 2C3XA 3T0EC 4OFYA 1U36A 2XZZA 3SY0B 3L3HA 2VERN 3JV0A 4HULB 3D25A 4Y8AA 5JHLH 2ADJA 4KUZL 2NW3B 4X80L 1TXKA 2OM5A 2IJ0C 4L4TE 3WL9B 1JPTH 5FYLE 1RURH 2MMXA 5J13C 1VENA 4PJGE 4U6YB 2QADB 4OM1H 2XACC 1KYOJ 3ES6A 3QIBB 4P2YA 4E41B 1MCKA 3GSXA 5FKPB 1IKNC 5I1GL 3I75A 4I3GA 1UZ6F 5ACLA 2GITB 5E4EC 5IFHL 1FZKA 1QLRB 1NUFA 3TNMB 1AHWB 5MEQA 3SO3C 3BAEL 4JFQB 1ED3B 4NRYA 2B39A 3F12A 3NBNA 3NCMA 1TQBB 4OF6A 4JVWA 1M71A 2Q6WA 5TFSH 1BGXL 1UEYA 3NFNA 4O2FA 4YX2L 3JWOL 2UY6A 4Y2DD 1JWSA 1FL6B 3LS5L 3GSRA 4O02L 4L4TD 3JBG7 5FYLD 5F9OH 3MRMA 5C07B 4AJ0A 1G9NC 3MXVH 4RX4A 5F1NA 4R7DB 3IDNA 3AS0A 5D7SL 2FIKA 1BVKA 3WIHL 3V6OA 2UVEA 1I3GL 3V4VL 4HKBA 4YPJA 2I9LB 2P7TB 1AGDA 2Q8AH 1JGUH 1UXSB 5HTSA 1S7SB 5FYKU 4HJJH 5BV7C 2JK5B 2DIAA 2W9EH 4LPVA 1ETZA 2DLFH 3WFHA 4XPTH 2BVOB 4P57A 1LHZA 2R56L 1YUHA 3QI9D 4NM4L 2NY4D 1X5FA 3K3QA 3T4AA 4HIJB 1QBAA 3W0WA 1CFSA 3WE6A 2OI9B 5EOCJ 4PRAB 1D6EB 1YN7B 5B39A 2VR4A 1ORQB 5CUSH 5IBTL 2YUZA 4J4PA 5E5MA 4PG9B 2UVFA 5I16A 5ISZD 5LXGL 3KLAA 1YEHL 5TGBB 2X1OA 2VC2H 4FG6C 4OQTH 4YE4H 1CTOA 1NKOA 4KKBC 4ZOEA 4QRTA 1JP5A 1RIUH 2X1PA 2FJHB 2VH5L 1OWWA 4HKXB 5ITBH 4PRIA 4ISVA 3CSBA 1CZ8H 1TJIL 1MJUH 1RJCA 3EKCA 1OP9A 2DL2A 3WFDH 4CJ0A 1IZJA 4KGJA 3LSOA 1A7QL 2QQLL 3HZMA 3QXDA 2VXSL 3L6FB 7FABH 2I5YL 5EU6E 3KYNB 4JM2A 1UQSA 1DSFH 3BKMH 3VRIB 1JRHL 1UACH 3ET9F 2DQEL 4K8RD 1FNLA 3STZB 5DJ0A 5H2BA 2WIIB 3MRLA 5GGRY 4QYOB 3SKOA 3CCHB 5SWQB 4QRPB 1J05B 3PABA 4Y4FC 1JGDB 3AY4C 1T89A 1N0XL 2IGFH 3FAWA 2BCKB 4EDXB 3TC9A 2IANB 2Y07L 1NPUA 1SJXA 1S9KC 3W2DL 4WDIB 2ICES 1PLGH 2BVQA 1UVQB 4NQCB 4Z0BH 4QTIL 2AKRA 3CXDH 3DURA 4RDQF 1S7VB 2NY5H 5FYKD 1F4YH 1D5XA 4KJYB 3RX8A 1KJ3L 4GXVH 4M02A 1E28B 2OS7A 3AREB 3RWDA 5I19L 4YXKL 3HZKB 3PWNA 2FCBA 4LSDA 3QUXA 4M7LL 1FG2B 4AT6A 1EEYA 1H3VA 4DGIH 2NYYC 2P5WE 3QPQD 3MNZA 4OF7A 4UQ2B 4HWBA 3P3YA 4RX4D 2RFXB 1I1CA 1EJ6A 2QTEA 2F19L 2Y6SC 3WNOA 3RWGA 2CJUH 2MCPL 4TNWK 3MTRA 2R4RL 4JZNA 2X7LA 3VA2C 1NDGA 4HFWA 1M7IA 4PLJC 3RFZC 4WWID 1CU4H 3EO1B 2DQGL 1A6AA 2D2OA 1UGNA 2HT3C 4N9GB 1JZ3A 5SX4H 3T3MF 2Z8SA 1KJ2A 3MLXL 1LE9B 1ZAGA 4N0RA 1H15A 3EW3B 2PN5A 3KS0H 3C6LB 1QKZH 2YXMA 3LDBC 1OAYH 2YS4A 3W0WD 1KPRB 2D31A 2DJUA 1WFNA 4QRSA 1W0WB 4LLAA 5FYLH 1NCWH 4J4PD 1PSKH 3ARSA 3VFVB 5FGCB 3J7HA 2NY6C 3C60B 2XWBB 2X5PA 1DVFD 3P0YL 4OI8A 4NOBA 3ZT7A 1ZHNB 1RULH 1Q1JH 4PRDA 1BF8A 4ZYKB 2FECL 4PRID 2GJZB 1VPOH 2DQTH 1P6AB 4BYHA 2OX5A 3IJSB 4E5XB 1BM3L 5D8JH 2HP4A 3ULUD 3OAZH 2EDLA 1JUFA 4D9LH 4YO0B 1KG0B 2XOTA 2CK2A 4KK9C 5CJQH 4JM2D 4WO4A 3OTTA 3VXNB 5CEXB 2Z31B 3RUGF 4JN1H 3U1SH 3D3VB 1TZIB 4OZHA 4UI2A 1P4LB 1QHOA 3EYSH 5ANME 2A2QT 4FQXC 4RGNE 4D2NA 4JPKH 4G8IB 4BFGA 3B6SB 1I8LC 4KMLB 3D69B 4OQ1A 2YK1H 1R3HB 2P45B 3RPIB 3GHEH 1QTYT 2OSLA 3WS6C 4WI9A 1DDHA 4LLVB 3DGGA 4LPCA 4TUJB 1GGBH 5CMAB 2NNAA 4NQVB 5D7JA 3BZ4B 3BRDA 5L2JB 2EYRA 4QHMA 3MLPA 5E99L 4YGVA 2JE8A 2QR0B 5DD6A 3VWKD 2I07B 3QUXD 3KLSA 1MCEA 3TZVC 1BQLL 2D0FA 2R1WB 2D0GA 4K8RH 5DRWA 5F70A 3C5ZA 3V0WH 2QSQA 3VFNB 2VDPL 3SDDB 3BO8A 3S8WA 5J1AA 5L0QB 2NY5C 4G43B 1DQDH 3RU8H 3EIFA 5IB2B 4NHCL 2W9DL 4R4ND 4RGND 4Z0XA 3GBNH 3P11H 2WBJB 1BFVL 4FTVA 1NGWA 4H1LH 3UYPA 2IH3A 2HH0H 4MA8H 4ZTPH 3NZ8A 2WLZA 4NBZB 4RWYL 5A16B 3ZKNC 3OPZH 1UJ3A 3TLRA 5AWNL 5HHPB 4WW2A 1QO3A 4LCUB 1MFEH 1AP2A 3KYOB 2VAAA 5FYKH 5CZVL 3BWUC 4UU9B 4NNXB 3JVGC 1EO8H 2J8HA 1A6TA 2QQQA 2DAVA 3ZDXE 3MROB 4GOSA 4FQ1H 5IVXB 3NCYS 4ONHB 1M4KA 3TO2B 1HHHA 2G75B 3OAZK 1JWUB 2GFBB 5JQ6H 2NXYD 4OBRA 3F5WA 4EKXA 5HD8D 4OZHE 5L88H 5FHAL 5SWZB 5MEPA 2V7HA 4RQQB 2QEJA 3E6FA 3WIIH 4YDVB 1P2CA 4YHOL 4J23A 4M1DL 3GI9H 4XP1H 1XCTA 4WFGE 3RIAF 4Y2DC 3RNKB 1V8HA 3MBXH 2PTTB 2ZUXA 3VD3A 3ULVE 4F15B 5KSBE 3QULB 4KY1L 1FDLH 3TWCH 3MV9B 4XWGH 3I02B 3B9EA 3C09C 3VXQA 3FOMB 4PB0L 4ZOBA 4WO4D 4V1DD 3P9LB 5C0CD 5BZDA 1HSBB 4LDEB 2HT2D 2VXUL 4F3FA 1FPTH 4N8PA 4QT5B 1ZGLP 5GJSH 5D96B 3MRCA 4EJ1C 2BHUA 1WTGT 1RZGA 4NO0A 5CP7B 2IBGA 4O51B 3I6LD 3MJ9L 3OKLA 3LEVH 1XF1A 1QSEA 3SE4A 4YK4C 3QI9C 4UNUA 2NY4C 1N6UA 4HMCA 3FQUB 4WFHE 5I74B 1BJ1H 2C1PA 5DHXB 1F3JA 4NQUA 5C0AB 1N6QH 1CG9B 4YUEH 5D7JD 3ULUH 1T80A 4MA1B 4A6YB 1OW0C 1CFVH 1K8DB 3MLWH 4XRCA 4YHPB 4YBLB 5FAAA 1YY8B 1QFOA 2ARJB 4PJEF 1D5BB 4GW5A 5BJTA 4LPXA 4Z7VB 3TVMA 2B1AH 1VEMA 3C5ZD 2ADIB 5C9JA 1JHTB 1EEUA 4F7PA 1KN2L 4LU5H 2W38A 4G7VL 4C59B 4O9HH 2IMMA 3INUH 2A77L 4HWUA 4FTVD 1XCQB 4UT7H 3RJDA 4Z77B 3VRLE 3KJ6H 4XP4H 5EU3B 3BPLB 1NCUA 3B8YA 5EC2A 1EHLL 4K8RC 3CX5K 1IC4L 3IFNL 4OFVA 5E8NA 4QXGH 1ZT4A 3KLDA 5FB8A 1I8MA 5FDWB 1CTNA 4PB9H 2R4SH 2ZSWB 3KDMA 3BJLA 1T0NA 2H1PH 2XA8H 4G6FD 1MCDA 2IEPA 4FS0A 4NZTH 4G8FB 1O0VA 2A38A 2VMFA 3H9ZA 4UUJA 3SDAB 5BS0B 4XPHH 1U58A 5HDQH 1NUDA 1P4IL 3CUPA 1TETH 2HWZH 4HS3B 1FZMA 4MAYD 2DLTA 4QHNA 3MUY1 1I7TA 4HWBH 4K94L 3H42L 4F37F 1NL0H 2CD0A 4X6DF 1H8OA 4DOHE 2E9WA 4UMGA 2D4DA 1QSEE 2RJMA 4WHDA 1IGCH 4S1QL 4ELMF 4H26B 3MJ8B 3QPQC 2OZ4A 3A6OA 5DJ8B 4JFEB 1KJ2H 2UUDK 2A74B 3IU4L 5ICXB 1ORSB 5JXAH 4R4FL 5EPMA 3V6OC 4M5ZH 1DBBH 3C5JB 3QPXH 4EBQL 5JIIA 5T5FL 5EBWA 1JJUA 3NA9L 3QEUA 1UH4A 4L4TB 2I26N 5AG8A 1JNHB 4NYLB 4PJGB 3CU7A 5ESQA 3WNKA 4J3XA 4U49A 1OQXA 2W92A 3LEXB 3VXRA 1CFTB 3C6SA 3DTXA 2HMID 3MV7B 1SYVA 2NY1D 4HUVA 4L4VA 5D6CA 3TYFB 3MLVL 1U3HA 1B0GA 3NVQA 4J4PC 2YC1A 2BNRB 4DN4L 2Q86B 3NIFE 3HLAB 4M00A 2PR4L 2GCYA 2ADFH 4YH6A 4GMTH 1DVFC 4O2EB 4XC3H 1JZ7A 1PG7H 4BSWA 2H9GB 1XGUA 1IQWL 5DK0B 3TVMD 3QEGL 3IF1B 4R96B 5TQ2L 1ZA3B 4BSJA 3Q3GB 1SBSH 5EOQH 2H32A 3ULUC 3V9FA 4IOIB 5HVHC 1KELL 4HWEL 1Q9LA 2YBRB 1QZ1A 1U8IB 4O4YH 3MO1A 3IDIA 5DD1L 2CMRH 3PHQA 1YQVL 4MS8D 4QRUA 4XBPB 4JM2C 3S35L 1FFRA 2XWTB 5KTEL 5ICZA 4N1HB 4JFHD 2DDQL 3CLEH 3NFPA 4PJFA 4XXDA 1VSCA 2Y5TB 1T89C 3HNSH 2AEWA 5EUKB 4Z9KB 2BZDA 3VGDA 5IMOB 1MQKH 1YPZA 2X4TA 5A3ID 1ZEAL 2W60A 3FB7B 5DK3A 2V9QA 3RGVA 3L3HB 4ZTOH 3SDXA 5L7XH 5I17B 2AK1H 1NBZB 4HZLA 3V5KA 4TULH 1HILB 5DF0A 3GK8H 5J3HD 5CZXD 3TBYA 5DEGA 3BZDA 3L9RA 1J10A 5DJDB 1DUYA 1QUNA 5ABDE 3IETA 1RZ8A 2QHRH 1ZOXA 1GOFA 5TQ0H 3ES6B 3QUKB 4GKSB 2R23A 4XC1H 3I9GL 3GSXB 3VWKC 43C9A 1B0RA 1HH6A 4UV7L 3FCTA 6FABL 5MEQB 3E2HB 4PLOB 3EYFB 2DBJA 4LSQL 4GUPA 2YPKB 4YDKH 1UKTA 2PF6A 4RGNC 4R4NC 1MCPL 4LLWB 5EU6B 4HMDA 3GDBA 4MSWA 5IK3A 1MELA 3NFNB 4F7MB 2CRMA 3NPSB 3SE8L 43CAA 1LQSR 2KQMA 1NFKA 5D1QB 4LL9A 4WEUD 2R29L 1QFWM 1KB5A 2XTJE 4X0KA 5K59F 3I2CL 3NIGE 1R5WA 5F1NB 5H35B 4O2CB 4HKJA 4OD3H 4D0CB 2FIKB 1BVKB 3LEYL 3CFBA 1RUQH 1K3IA 2AJZA 1VFOA 3VXRD 1BVLA 2FEEL 3BPNC 1KJVB 4AEIL 1JYXA 3DX7A 3ZL4H 1B4JL 3SOBL 4DGYH 1FJ1A 4L4VD 3L5XL 4LCYA 5DD5H 5IM7B 2VO5A 5DQ9A 3ZTNH 4CVZB 4XCYB 1MRFL 5HHNA 5I1KH 2VRAA 1A21A 2NXYC 1M7XA 3U9PH 1INQA 4P9HL 2CXKA 2IPUK 4DGVL 1YPZE 1SYSB 2X4UA 4P57B 5ECJE 4RMTA 4BH7A 1WUNT 4OLZH 2XTJD 2P5WB 2FL5A 4GW4A 2CRIA 4FXLA 3CC5B 5HDBE 3GSNA 1NGXA 4K3DH 5FUZH 1FN4A 1MJ7L 4K7PX 4K9EL 4MXWL 1TMCB 1KPUA 3I84A 4U6VL 5F97E 3STBA 2OTUB 3CVHA 3QDGA 4OGAD 2D3VA 4QRTB 3WKNA 1XZ0A 2Y72A 4EUPA 3F65A 1FH5H 4WO4C 3TPKA 4H5SA 1FYTD 5D71H 2HT2C 4G42B 4XNXL 2DWDA 4AQ1B 3VG9C 2A6KB 1B0WA 3F6IA 2Y23A 4M6OH 5CILH 3U30B 1C1EL 4JRWA 1FFQA 4R8WL 1PZ5A 3JUYA 4UIMA 3HZMB 1SJEA 4JFYB 4WJ5A 3RGVD 3UPAA 1KTLB 2VDNH 1P7HL 4JKPH 3IXAA 5HYEA 1A4JA 3D9AH 5DJXB 1Z0NA 4PJ9D 3TT3L 5T1MA 2O93L 2D7NA 5FUOL 1CDGA 1P53A 4U1GC 3KPMB 2ZCLH 2ZUUA 4MNQA 5D7JC 4CMHC 4PJ7F 4Z7UF 4JAMA 2RAMA 1G7IB 3MJ6A 2LTQB 4U2YA 1A4KA 4I5BA 3VFOB 3LN9A 5EO9B 1F8TH 3FQTB 4BZYA 5K9JH 3ELAT 1CDJA 5LQBH 3GMNA 1FLRH 4OLWL 4GKNA 1DLFH 2OL3A 4F33A 1GOHA 1BZ9B 3EUUA 4H0IA 5I1DB 4XNZC 3VA6A 3IXTA 4XHJD 3P0GB 3QUXB 3ZE0E 2ICWA 1UJ3C 1EEYB 4AK1A 3RZCD 5I1IH 3PWLA 2E7LA 3MNZB 4WW2C 4RWHA 4U6HA 1IEAA 2GSIA 2AXJA 4ODWA 5ANMB 5GS2D 4JZNB 2X7LB 1HI6A 1M7IB 3QDGE 4KAQL 4OCYH 4ETYA 2YMXL 3VXSB 1U8JA 4MXVF 4X98A 4MAYC 4XCCL 4Z76B 2OZ4H 1IM9D 1IGFL 2CDGA 2O5YH 5J7CC 2Q1EA 4JY6A 3O3AA 1GHFL 1FBIH 2IMNA 4PGBA 4PJDF 3QDHA 1OLLA 2APBA 4AEFA 1A6ZB 1RU9H 1R3KA 1A5FH 2R2BA 2DN7A 4ZPTA 3UAJD 3KPQA 4FFZL 3UX9B 1INDL 5I1EH 4C83A 1N3NB 2B1HH 4MNQE 4DKFH 1NGYA 3QDGD 3HE7A 1E4XI 2GTZA 4PRDB 3T1FA 5DJCB 4HPYL 1KEML 4D9RD 1X4ZA 5KANG 1KLFA 5FHBL 4O5LH 2HVKA 2N7AA 2DQFA 5GGSY 2O61B 3RWIB 1MHCB 1WEJL 3PV6A 5HHOD 2Q8BH 5KSUB 3LKQB 5FM8A 2VDOL 1V7ML 3AFLA 2NR6D 1UWXH 1A6UH 4NKMA 4Y4KC 4NQDE 5HJ3A 2HMIC 4BZ2L 5GISH 1WZLA 2FATH 2NY1C 4GMSH 5D7IF 3KYKH 4Y2OA 4KV5F 4EVNB 2H32H 4L1HA 4MNQD 3VMPA 5D1ZA 1A1MB 3LN4A 5I73C 2XPGB 5SWSE 3UBXB 5C92A 1AD9B 1P5UA 4J8RB 3ZDZF 1I8KA 3WNNA 4TQEH 3TVMC 3GFUA 1BFTA 4LVHB 4PGDA 2OSLB 3ZE1E 3QYCA 5KSBB 3DGGB 3WNMA 1G7JB 4PP2A 1HXYA 1I7UB 2MNUA 5DFTA 3A6BH 4MCYA 5JW5B 2GK0B 4MS8C 5T1LA 5GJTL 4YGVB 1A7OL 5SV3A 3PQYE 3X3GL 3DI2B 2V7NA 1BFSA 3TN0B 4DN3H 4RAVA 2OCFD 1WWWX 2OTPA 2DTMH 1QNZH 5JIHA 2JJSC 5TPWL 3FHQA 1MIEH 4NZDA 4PRBA 2CKBA 1XGYL 4TUOB 4FFWC 3MGTA 1QEWA 3STLB 5C6TL 5A3IC 1NGWB 4OF3A 4AG4H 2IH3B 1P84K 1W72L 2AEPH 2C4FU 2CRYA 3WN5C 4OZIA 3NZ8B 2VE6A 3JWDL 3MLZH 5AAMA 1NLBH 3FT2B 5I8KL 4OIAA 4LSTL 2DLEA 3AS3A 4OCSH 4HLZG 2YD8A 3GEWB 1MCOH 1QO3B 2R0KH 3DIFA 5J3HC 2DBLH 5FCSH 1NEZB 4G6FB 5I1HL 1CS6A 1A9EB 2JTDA 4KFZC 5A2LH 3ZHKA 4X5XA 1P5VA 3HFMH 1HHHB 2XKSA 5HYIA 1KB5H 3HNTL 4JO4L 3EDDA 5D7KE 3F5WB 3MFFA 4FQHA 3FOLB 4QCIA 3G04A 1A7RL 2XV6B 4P3WA 5GS2H 2OR8A 3UBXG 1IAII 3CSPA 3MRNA 1CFNB 4QLRA 2X89A 1HSAB 4QOKA 3LPWA 4G3YL 1MRDL 5TH2A 4MNGA 4X6BB 2BNUA 4HJ0D 5JPNA 4XBGB 3ARFB 3TIDA 1L7TH 4UV4H 4P5KB 2P5ED 2FD6H 2CRZA 4CW1B 4KC3B 3ALWA 3BD5A 5KVDL 3UYOD 4PYGA 5KOMC 4RFOL 4ONGH 5BZDB 1NC2B 1H9VA 2APTA 3QUYB 4U1SB 5I1JL 1N7ML 1SJHA 3GSNH 3LKNB 2VZUA 3MOAH 3L1OH 4KMQA 4BA8A 3EOBA 4Z8FH 4M93B 1RZGB 4NO0B 2OBGA 4DOHB 5IQ7L 1BZQK 1S7TA 2O5XL 1JFQL 3CVHH 4WV1B 3BEWA 1YNLL 1IL1A 1QSEB 4KVNH 2HFFB 4EUPH 3HPJA 3PHSA 1MPAL 4OZIE 1ZVYA 1LK3L 1ZLSL 3ARTA 2PO6D 1U92B 2BMKB 1IGYA 2APVA 4LP4A 2R0ZL 3T4YA 2OJEA 3GSQA 1K4DA 1NEZG 3RL1B 1NCAH 4N0UE 1GC1L 4P3DB 4XRCB 5JDSB 4QRQA 4OGAC 5T1LD 1F97A 1WFOA 2H41A 4KI5F 2EYSB 4XI5D 1A1NA 3PIQA 1E4WH 4YR6B 2XQBH 5JPMA 3D87B 5C9JB 4F7PB 4LFHD 1NBYA 4U1MA 2VWEC 1QG3A 1EBAA 3A6CL 4GRWE 1FE8H 1SEBA 3SGKA 1CGXA 1V7NH 4TYUA 4QEGA 2C5DC 1N5YL 4BUHA 3DX6B 3RWJB 3EO0B 2BVPA 12E8H 3RL2A 1U8LA 1FNEB 3PWUA 4QOKE 4P4RA 5F9JA 3MUZ1 2W9LA 3S37H 5HYQB 4KKAD 4PJ9C 4CBPA 1L9MA 4MNGE 3I6GA 4WEBH 5J6HA 2NLJA 4MNHA 5IVOA 1MHPL 4UTBH 3IDMB 4GT7A 1T0NB 1U8HB 1UB5B 4L8CA 1QBLL 2XA3A 3PP4L 3KYAA 5J6GB 5J12B 3MLUH 1U58B 5E2UH 1UZ6E 1T1YB 1FZMB 1LE5B 3WLBA 1JYNA 4XTRC 1PAMA 1E6OL 5IB5B 3OX8A 3QG7H 3U48A 5HDLA 3HC4H 3V52L 2J6EL 4B0MM 2X89D 4LBEB 1B2WH 1IGTA 5GGRA 4XHJC 3ARGC 1Y18B 4NBYB 1CLOH 3JV6A 4NT6A 3RZCC 2P24B 4U1LA 5IHUL 2DM7A 1DQJA 2JKXA 5AAWA 3CFCH 3BIBX 4X4XA 1RZIB 2VITB 4FQQB 5BVJB 4D0BA 1HEZA 1U6AL 2A9NL 5EZLB 1K4CA 2V9RA 2AJSL 3WFCL 4MA7H 4QY8A 4JY4A 2J88H 3P77B 4WFEE 4OCRH 1QSFE 4YNYA 5FYJL 4AL8L 4ODUA 1WTLA 3MRFB 3ARBA 3OSKA 3QHTC 2B4CH 5T3ZL 4WTXA 1KLGA 1NGZA 3T2NH 5JDJA 1MNUH 4ZQKA 4G6JL 1YZZA 2PNDA 2IH1A 5F9AC 3BQUB 4OZFA 5L6YL 5I6XB 4JCLA 4MGXA 4OKVB 3WJLC 1XF4A 3BKJH 1FRGL 5JUEL 3DUUA 4NQEB 1KGCE 1U3HB 4YHMH 2X4QB 3UAJC 2YC1B 3B9DA 4FQIL 3THMH 1R5VA 1C08B 2WUBH 3ZMRA 4JQIL 5DVLA 1KSRA 1KIRA 4DW2L 1FL3B 1BQHB 3JTSA 2FX7H 1XGUB 4M7KH 3GRWL 1MVFA 1ZT1A 1T1XA 1A6VL 4MWFB 1IAOA 1VFBB 3PDOB 3LAFA 5CD3A 1RV6X 1SM3L 1KCLA 1J0HA 4HWZA