1GW0A

Crystal structure of laccase from melanocarpus albomyces in four copper form
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
559
structure length
559
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords LACCASE-1
publication title Crystal Structure of a Laccase from Melanocarpus Albomyces with an Intact Trinuclear Copper Site
pubmed doi rcsb
total genus 174
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gw0A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gw0A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gw0A03
4F2FA 3UAEA 3OQRA 1BYPA 4E9QA 4BWTA 3AG4B 2JKWA 2NRDA 1ILSA 1PLBA 1WS8A 2R7EA 1CUOA 1AANA 3NSYA 2DY2A 4N8UA 2IWFA 4DPAX 5I6NA 3TBBA 1B3IA 5B7FA 3GXUB 1MZYA 4UF7C 9PCYA 1KDJA 3AG3B 1X9UA 4CSZA 1GS7A 5PAZA 1SF3A 3FQ2A 1E65A 1OE1A 2BWDA 1YLBB 4AKPA 4FA7B 2HXAA 1W6LA 1OCZB 1J5DA 4A68A 2FT7A 3ZBMA 3FQYA 3TU6A 2FQEA 2EIJB 5I6PA 2OV0A 2BP0B 1J9SA 1JVOA 1SF5A 1BQRA 4YSQA 2BHFA 4P5SA 1AZCA 1ILUA 3FSWA 4HCFA 1BXUA 3FSVA 1XB6A 3T71A 4G7SB 1WA2X 3QQXA 5TK2A 4G7QB 2DYRB 3CVCA 2JFCA 4NERA 2QPDB 1OE3A 3NT0A 5FC9A 1AG0A 3ASOB 1AG6A 4BXVA 3D12B 2TSAA 3T6WA 3SQRA 3TA4D 1BQ5A 4KO5A 7PAZA 1DZ0A 2YAFA 3H4HA 2FT6A 2PP7A 1AZNA 1M9WA 3ZDWA 1NIBA 2IH8A 3NP3A 1JXGA 1L9TA 3S3CB 3UACA 1L9OA 2YAHA 1V10A 1XB8A 1ZDQA 2J56A 3U25A 2IDSA 2PP9A 1ETJA 4WTQA 4CSPA 4YSEA 1FWXA 1JVLA 1ZPUA 2PPDA 4YSOA 1ET5A 2DWSA 2Y69B 4K9JA 4HHWA 1QNIA 2UXVA 1NTDA 4E9YA 3QJQB 4UAHA 2Y1AA 1CYXA 5D4JA 1JZHA 2XYBA 4G72B 3UABA 3T6XA 2DWTA 1A8ZA 2XX0A 1TKWA 1JZEA 4ZK8A 2UX7A 3WNJA 1HAUA 1IKOP 2QT6A 2H47C 1AS8A 2XU9A 4Q89A 2ZWNA 4HALA 3X1EA 1JERA 3AY2A 2B3IA 3FSAA 4KO7A 3SBRA 4W9ZA 1OCCB 1NIAA 1GS6X 1GY2A 2IDUA 4KNTA 3NJIA 1OV8A 2FQGA 1EHKB 3NJNA 1NINA 2CAKA 3X1GA 4DP5X 2HX8A 1IUZA 1PMYA 1M56B 1N70A 2GSMB 2Q9OA 2OCCB 3X2QB 4AX3A 4YSPA 2EILB 3CG8A 1A4BA 2IWKA 4GYBA 2PPCA 3X1NA 4F2EA 3EF4A 3HEIB 4YVUA 3ERXA 4A2HA 1GS8A 2HX7A 3IN0A 4E9XA 3ABKB 4AI7A 1CURA 2FQFA 3ABMB 2VM4A 2AFNA 4KNUA 2VSKB 2J55A 1SHWA 3FPXA 3N55A 5IY5B 1BEXA 4BK5C 5I6KA 2XUWA 4DP9X 1NWOA 3TBCA 1GR7A 1TU2A 3SBPA 2YQBA 1URIA 1AIZA 3JT2A 5I28A 3FU7A 3EHBB 3WI9A 2XX1A 5I26A 4BWWA 2CALA 3IEAA 1W8EA 2X87A 2YAEA 4FAAB 5I5MA 2WSDA 1PF3A 1NICA 1SHXA 4G71B 5AFAA 2BP8A 1WA0X 1NIFA 3FYEB 4QKTA 3UAAA 3KW8A 4JHUA 1RCYA 1ASPA 4DPBX 3S8GB 2E86A 3CZUB 3FS9A 2QPEB 2VMJA 1AR1B 4NB7A 2XWZA 2TSBA 5LDUA 2FWLB 2BWIA 4JKNA 4P5RA 2A3TA 3QJUB 4A67A 1QLEB 2VM3A 1MG2C 2GIMA 1BXAA 4E9RA 2FNWA 5E9NA 2J57A 2W88A 3PAVA 3PXLA 3OMNB 1KCWA 4DP7X 1AOZA 2YAQA 1AACA 1V55B 1L9PA 2GC7C 2PPFA 2YAMA 3ASNB 2JXMA 3T9WA 3GDCA 1PNCA 2XLLA 2UXTA 4E9WA 4DP1X 1IBYA 1ASOA 1JZIA 1KCBA 1GY1A 1V54B 2IDFA 2YAOA 2PCFA 3BQVA 1KYAA 2J5WA 5B1KA 5I5IA 4G7RB 1DYZA 3CVBA 3IBOA 3DKHA 3MX0B 4AZUA 1SNRA 1L9QA 2FJSA 1F56A 1GYCA 2IH9A 4YVNA 3X1BA 3CDZA 1KBVA 3H4FA 4GY4A 1A4CA 2AZUA 5I6MA 1JXFA 2ZOOA 2BZ7A 5I5JA 4BDVA 1NZRA 4MFHA 1E5ZA 4KO6A 3T6VA 1SDDB 1N68A 1JOIA 1MZZA 1NWPA 2BW4A 3PAUA 1PLAA 1WAEA 5D4IA 5F7AA 1ZV2A 2PPAA 4M4RB 2VW4A 2RACA 3FQ1A 4GP4B 1ZIBA 3EH5B 3EH4B 1KBWA 3WIAA 3PAZA 4E9SA 3X1FA 4HHGA 1BYOA 2XV2A 4AKQA 4BXSV 2R7EB 2Q5BA 3UGEA 3C75A 4HZ1A 2N0MA 3S8FB 3FT0A 3NSFA 3FU9A 1L9SA 2XV0A 1PAZA 1AAJA 2EINB 3AG1B 2GBAA 1HAWA 3BVDB 1JZGA 4DP8X 2HRGA 5B1BB 2PP8A 4YSCA 1M57B 3SBQA 2BP0A 1R1CA 3NJMA 2UXFA 1ZDSA 3CVDA 4AKOA 2LLNA 1IBZA 1CC3A 1FA4A 1JZFA 3QPKA 3DIVA 3V9CA 1NPNA 1PZAA 5ANHA 4W1TA 1A3ZA 4YSSA 5A7EA 3FU8A 5PCYA 5I6LA 4NAJA 1AZUA 4KNSA 6PCYA 2XXGA 5TK4A 3DTUB 3ABGA 2H5UA 1MDAA 1GW0A 4PCYA 2WO2B 4M3HA 3ABLB 5I6OA 3PLYA 4PAZA 2AZAA 1I53A 5B7EA 1OF0A 2I7OA 2X88A 2DYSB 1E5YA 2I7SA 4A2DA 4HCIA 2VW7A 1HFUA 4L0PB 4WKXA 2ZXWB 4YSDA 5EHFA 3JTBA 3FSZA 1RZPA 3QJVB 5F7BA 2CUAA 2YXVA 2VSMB 4HAKA 2IDTA 2MRYA 3AG2B 5AKRA 4DP0X 1OCRB 2PPEA 2I85A 3H56A 3NJLA 3PCYA 4TXVB 4A66A 1J9RA 4G70B 3RYMA 4BWUA 4RH4A 3TASA 4X4KA 1KV7A 3NYKA 4HCGA 1OE2A 3NJHA 1BXVA 3OM3B 1NIEA 2DV6A 2GHZA 2CJ3A 1RKRA 4GP8B 1T5KA 4HIPA 3G5WA 4QLWA 1NIDA 1AZRA 1TEGA 4YSAA 3QJSB 2FT8A 1A65A 1PZCA 1VLXA 1WA1X 1EZLA 3ZIYA 1PNDA 3NSCA 5AZUA 3FYIB 1PLCA 8PAZA 1AS6A 1PY0A 1XB3A 1ET8A 4ENZA 1SJMA 1KDIA 1E67A 4EF3A 2B08A 1CYWA 4DP4X 3AW5A 2HRHA 2P80A 4A2GA 3OD3A 1IC0A 3WNIA 2FTAA 2CCWA 4YSRA 2XVBA 1ET7A 3QJRB 4KO9A 3NP4A 5B7MA 1J9TA 1NDTA 4JHVA 4F7KA 1UATA 3S3BB 1GSKA 3L45A 1J9QA 2XV3A 2IAAC 3ZX1A 4GXFA 5B1JA 2FQDA 1KGYE 3NSDA 4KOBA 2WO3B 2BO0A 3QJTB 3HB3B 2IWEA 1OOWA 1XMEB 2GB2A 5D4HA 3WKQA 7PCYA 2MTAA 3FU7B 3PPSA 3S3DB 3NJJA 2UX6A 1E30A 3FPYA 4N4YB 2HX9A 3IE9A 4YSUA 2BW5A 2UXGA 2YARA 1RZQA 1BQKA 4UANA 1J5CA 2OJ1A 1ADWA 2YXWA 3NJGA 2BP8B 2QDVA 2BZCA 4GP5B 1BAWA 1ZIAA 5B1AB 3N2JA 2HZHA 3OMAB 2EIMB 1AQ8A 2YAPA 2VW6A 3MBWB 2PLTA 3KW7A 2GI0A 2P80D 4YL4A 1L9RA 3V9EA 1OCOB 1W6WA 2IDQA 4A2EA 1AZBA 3GYRA 2H3XC 3AZUA 4DPCX 5B1JC 4Q8BA 1MG3C 2HLEB 2ZONA 4YSTA 3WG7B 3WKPA 1AS7A 3OMIB 1JXDA 2CBPA 1PZBA 2PCYA 1JZJA 2VN3A 5B3SB 3UADA 3IN2A 4A2FA 1A4AA 2EIKB 2W8CA 3NJFA 3T6ZA 1SFHA 6PAZA 1FFTB 1ID2A 4E9VA 1X9RA 1PCSA 1QHQA 4DP2X 2QDWA 2AVFA 1NPJA 3NJKA 1SFDA 3CDZB 1SDDA 2GC4C 3EH3B 1TEFA 4DP6X 1ASQA 1WS7A 4BDVB 2AANA 4KOCA 2XXFA 4E9TA
chains in the Genus database with same CATH superfamily
1CFNA 2QADC 4LKCB 4Z7VE 3HI5H 1PBYA 1W16A 1YYML 3MROA 1QG3A 2G3XA 2X0WA 1XEDA 4KK5D 1W72H 2XY2A 4LP4A 5I6NA 1HZHL 5BS0D 4ONGL 1ZKAA 3W0WA 1ODUA 3OKKA 1EAQA 1FFOA 4NN7B 2OX5A 3GXUB 4PJDE 5TDOB 2AJSL 3C8KA 5EUKA 3GHEL 3UBXA 3UTSA 4GUOA 1IEBB 1E4KA 3FU3A 3NFSH 1LD9A 3MGTA 4UNUA 2A9CA 3GSQB 1MCHA 4WTZG 4RQQB 1K8IA 5DRNB 1ZLWK 2KYIA 3I6LD 3FQ2A 4FP8L 5GHWL 3QG7H 3NAAH 2GYSA 1YLBB 1E7UA 2EIZA 5CHNB 5DS8A 1ZVNA 5JO5A 1TZAA 4K73A 1YEWA 4OLVL 1HI6B 3BZ5A 3DGCR 4XWGH 4HPYL 5AEAA 3V95A 1TZIB 4PHXA 2BP0B 4Y5XB 2FX8L 3MRKA 3QQ3B 3RVWD 1HOCA 2ESVB 3WFCH 3F62A 1ILUA 1GPOL 2W95A 5F1OB 2LQRA 4KH9A 4LEXH 5DURD 3RWEA 2J8UB 1FIGL 1U33A 1YA5A 2FZ3B 3MLWH 4TVSa 4U05A 4UT9L 5JHDE 3W2DH 1P6FA 3N91A 2AABH 2CDFB 3NT0A 2LU7A 4X7TB 4Z95H 1EJ6A 3FU5A 5CIPB 1AG0A 3S0PA 3T8XB 3SB3A 1V7NH 3L3OC 4UBDD 1HHJA 1SLUA 5F2FA 2WINB 3U9UA 3T1WA 3WHXB 3KWTA 1J8HB 1PD6A 1AD0B 1MWAA 1F4XL 4FTDA 5D70H 3QXWA 4CJ1A 1GGIH 4I3RH 4NEHB 3WKYA 4DOHB 4OY9A 4NIKB 3BVXA 5C2BH 1GOFA 3KYKL 1KCUL 4NQEA 2Z91A 4YR6A 5CEYA 1GIGH 3U25A 4M3KB 5ENWA 4R4BB 1TFHA 4IU2B 3CSPA 1KJ2A 1JVLA 4FE9A 2ROXA 1RZJC 2YK1L 5K9JL 4DK5A 3EUUA 4P5TA 4UQ2B 1QNIA 3O4LB 4FNTA 4K3EH 5C7ZA 1BAFL 4FC3E 4HIJB 4U1MB 2C8NA 4WI3A 3CFBB 4FZEH 2EIDA 3IMSA 4AMWA 3OB0K 4JPVH 3SDAD 1A5FH 1MF2H 4RRPM 1X5XA 1BOYA 2VAAB 1M53A 1YMME 3VG0L 3FU6A 4PTUB 2X1PA 3FUJA 3US9A 3N43F 4QHKI 3CCHA 4OZFA 1X6NA 1FZJA 5E94B 4DGVL 1OSEA 2X1QA 3TVMB 2XZAL 5FGRA 3E8VA 2R0WL 4W9CC 3EAKA 4X4MA 1NJ9B 1ID5I 3QUKB 1EZUA 1MCIA 1SEBB 1JK9A 2FCBA 2MNWA 1SVBA 2VLJA 2E0PA 1IUZA 1EGJL 1DSYA 1RZGA 4L4VD 2AS5M 4JFZH 3WJLC 3QEHB 2HJLB 4WEUD 4YSPA 1CN4A 4ZO9A 4GYBA 4V33A 1T4KB 4PJ5E 2XXMB 2YUZA 4L4JA 1SJHB 5I30H 1HHGA 2NY1B 3MXWH 3U36A 2IO5A 5DUBB 2X4NA 3WGUB 1PZ5A 1D6EA 1RL1A 1MVUA 4FXGA 5FO7B 4BSWA 1A1MA 2EKSA 5F1SA 4KJWC 4BGLA 4DP9X 4XMPL 4LHQB 3QIWA 5LQBL 2V3FA 2OK0L 5CMAA 3ZGHA 3CFCH 3CXDL 3UERA 2X44D 2Y7MA 1H15B 2ENPA 4AIZB 2XX1A 3C08L 3LXUX 2MFNA 4JKKA 1E6OL 4KZDL 3FT1A 3WUWA 3KHOA 2H2SC 4ZMTA 5TDNA 1N4XL 3U7WL 2FH8A 2KDYA 1IGMH 4AJYV 3V5KB 2R2EA 3TEXA 3FYEB 2CKBL 3P9LB 2Q7YB 3OX8B 3KW8A 2W0PA 1OXYA 1DANT 2Y3NA 2Q86A 1UGKA 1LJMA 2Q76A 2Y1VA 4YHPB 5C6WH 4BZ2L 2XWZA 2X4RB 1M71B 3MV9D 1PW3A 1LDSA 1QEWA 1Q0YL 3BKYL 3MOAH 4OCRL 4MCZA 2P8LA 3JVGC 3U0PB 4L1BA 1L0PA 1NFIB 2ARJB 2QSQA 5E9NA 4G6KH 3OHXC 2J44A 1BVLB 3SPGA 4NN5C 1DJYA 2YAQA 1T1ZB 1H6EA 5HVHB 1N8OE 1WCQA 1D9KD 1YUHA 1JIBA 3HB3C 1XR8B 4YFLF 5DJ6B 3C5ZB 2PPFA 4L8CA 1N6UA 1MW2A 3ASNB 2YGNA 3QQ9C 2F8XC 2MNJB 3TNMA 4Q52A 1V54B 4U1GC 2HVJA 5GISH 4FNUA 1K5WA 2DLIA 3V4VH 4K3HA 2QLYA 5IVXE 5T3ZL 4B6ZA 1DBBH 1DYZA 3EJZC 5C0AB 3ZHDA 3D30A 5JIMA 1XGYH 4Z7VF 5LAPA 3IMWA 3X1BA 4Y9BA 5E70A 4HXBH 1DP0A 3WDJA 3H4FA 4LT7A 3ZTJG 2IH1A 3EBAA 5FM8A 3VAEA 4F7MB 4JM2A 2PXYB 4PP1C 4XPTH 1E9OB 2NXYC 5F89A 3H6AA 1UH2A 4NJAH 3VQ2C 1A3LH 1IC4L 3PWLA 5BS0E 2ZX8A 3P0VH 4APXB 2BIOA 4PJDF 1Q1JL 5IG7A 1IFHL 2CLRB 2VW4A 3HRZA 1OGPA 5LBSA 1QO3A 3AU0A 2D7TL 4MZIA 4XHJC 2XTJE 4OCYL 4WTZA 3DMMD 1BM3H 2HT2D 4GXVH 5IJBC 4Y4KD 4KJYB 1E42A 4L4TD 3X12A 1S7UA 3V4LA 1CDYA 1JPSH 3ZIMA 4XPHL 3HFFA 3DXAE 3NSFA 3F7LA 4RAHA 5DHVB 3VFNA 4I1PA 1AAJA 1NEPA 5FECB 3K8MA 4AGMA 1E4XL 1VGEH 3VXRE 2WQVA 5FGCE 4O58H 5GGSB 3V4PA 3UTQB 5D7IE 2RD0A 2X6VA 3BUDA 2A4CA 2IBGA 4GG8B 4BV1A 1JJUA 3FQWB 4CADA 3NGBB 1G7QB 2ZOTA 5EFIB 5ESVB 1KTBA 2FWOB 3ARGC 5FEBA 3KYOB 1FA4A 4PW4A 3EGDA 4NO0A 3IPEA 4Z78B 1CDCA 1BF2A 4N28A 5IBLC 4APQB 1AGDB 3PIQA 5C0RL 5C86A 4ORZC 2BSDA 1Z6JT 1SZNA 1IC7L 3VE0B 2ICWJ 4XCNA 2R4RL 5ID1A 1MDAA 4FQQB 2R2BB 1I9JL 3SYOA 1JZ4A 5HGAB 3RPKA 1IL1B 5I6OA 3ZKXC 4KK8C 1MCKA 3SCMC 1LO5A 4MTMA 4V1DD 3KPSD 3GSRB 4L0ZA 5F96L 1MELA 4ZSOB 4K7FB 4ADIA 1TXKA 1E5YA 2B4CC 4M8VA 3WFDH 4J8QA 3MRQB 1HFUA 1FL6A 2LW3A 2VZVA 2ZOKB 4N8VG 2WQ8A 4P46B 1EH9A 2ENQA 4OV5B 2VO8A 5HJ3A 4UNVA 2JCCE 3WS3A 4R97C 2LTQC 1AXSB 3HA0A 1MXGA 1GVIA 1SY6A 5JW4M 1HCYA 3D05A 5I9QC 2BX5A 4B96A 1L7IL 3NJLA 4LLWA 3EJUA 4RH4A 5EOCH 4WO4A 1P5VB 5DFTA 2NT0A 1A3RH 1BD2D 1TT6A 1OE2A 1FCCA 2NY3C 3EYQD 2IPTL 5IZ7A 2DQCL 2DYPD 2CCVA 3EDJA 4NZJA 4XZUA 3VFTA 3ARSA 2EDEA 2BC4B 3QJHA 3KGRA 3VXNB 4I77L 1PIGA 3RHWK 1SN0A 3RTQD 4JGNA 1JCKA 2P9RA 4QLWA 5BMFL 2W0LA 5H94B 4JCLA 2Q1EA 3MYJA 5GGTH 2OXHB 4FI8A 4ELKA 3KLHD 4NN6B 2Z1KA 3LD8B 3B7SA 1EQWA 2R39A 3KCPB 4JUTA 4NO5A 4PY7A 2P5WD 3GSWA 4M8RA 4Y4FA 3SE8L 5JNYB 4G6MH 3MV7D 4B3EA 1CFSB 2VM9A 4NAQA 1FCGA 5BRPA 5CJQL 5D6DC 1KDIA 1QFWI 2VQ4A 3SKNB 4XH2B 4JDVB 3M7OA 4NJ9L 3TNNB 3BN9D 1A7QL 3BZFA 1ETZA 3X13A 2W91A 1QBAA 1R4XA 4TTDC 4W9HC 4W4OA 1MEXH 2ZUYA 4XC1L 2CR3A 3TCTA 2W0KA 1K85A 1S7VB 4RMRA 3VMOA 4MCYA 4CNIA 3NFPA 3CZFA 4K7PY 1XV8A 1VGKA 2ZSVA 4MCMA 1ZSHA 3FOMA 3GXMA 4HIEA 1U8MA 4P2QA 2V7NA 3BWAA 5IOPB 1FG9C 4FTVD 5JUEH 2IOIA 1DBML 4RMVA 1R5VB 1KB5L 2BS9A 1LWJA 1CQYA 2ITEA 3LAFA 4AWJC 4MQXD 4LSPL 2UY7A 3ARDB 1RSFA 5DJXA 5CR8A 1CDHA 3IXAA 3UZQA 1BM7A 1EO8L 1K4CA 4FL4B 2X89D 5TDPA 4AYBA 3WTUA 1KIRB 4LNRB 5DD6A 3PHOA 5IQNA 5LGJA 3EADA 2HKHH 5F7UA 1WBYB 1RZQA 2RFXA 2IANE 5IFHH 3MV9E 3LQAC 1RERA 4PJIA 4AH2B 2BZCA 4DNLA 3WXVH 5E1GA 1AE6L 2YQGA 3NZSA 4IRJC 5EU6D 1KCKA 4FG0A 5KYNA 2DQTH 1FC1A 3L1OL 2GFBB 1T0MA 1WCBB 2APSA 1GZPB 4JFDD 2HFFB 3VXSE 5B4MC 5AWNL 1E3ZA 1TZGH 2V17H 2HJKA 2X4OA 4JG0H 2HG5B 1DQLL 1Z1WA 1T4WA 4PSRA 3HVDA 3QEQB 3L48A 2H41A 4IOIA 2BIIA 3TN0B 2BSED 4P3DB 4PJFE 2KUTA 1NLBL 3NIGB 1A4AA 3VG9C 4A2FA 2C1PB 1HHKB 5C0CD 5DC4B 2Y2TA 5DLMH 3MX0A 5DU7A 4GAGL 2CRMA 3G5VB 1OKEA 2P26A 2UVFA 5BZWA 3SIKA 3VI4E 4BSVB 1KYDA 4EJ1C 1R0AL 3VWJC 1AHMA 1S5HB 1D5ZB 4X4YB 1TEFA 3ZR5A 5E5MB 2J72A 1CTOA 1U8JA 1D5XA 1SYVB 2V9TA 3WAJA 4WKZB 4KZCA 5DS1A 1YZZA 4P9HL 5C0GA 1DUYB 1PG7H 4U6XB 1AR1D 1S7WA 1S9YA 4R7XA 4XTRD 3DO7A 4IBLT 3QXAB 3OPZL 3ZL2A 4R83A 4PJBF 5DJ8A 3K6NA 3RWJA 3KPRA 2LAAA 4ODXA 2A6IB 4QOKA 4XO3A 1CUOA 1AANA 4YHKL 5KSUA 5AVWB 1QWNA 2A2QT 4UT6L 2AV7A 5F8RC 1NCBH 1QKZL 3B3BA 3AY4C 3CFKA 2QELA 5DD5H 2EADA 4NBZB 5E2UH 2KLTA 1RZIA 2Y6SD 4HYTB 3W9EA 4RVBA 1OZTG 3NIDE 4FXLA 1XGQB 3VD0A 4KVNH 1U41A 2HXAA 5I8EA 3H9SA 1CMOA 3FFCB 1J5DA 1L6PA 1TQSA 3QULA 4X2UA 3S5YA 3HZVA 4DESA 1BBDH 2VR5A 5AW4B 3ZKND 3Q48A 3FT3A 3KPNA 5H37H 2LLGA 3HHMA 4R2GD 2ZWSA 5TPWL 2FX7L 3UTPD 2IV8A 1RZ8B 3PV6B 2EE0A 1MFCL 3GPSA 3BZ4B 3PDDA 4XVTL 3KNBA 2AXFB 2W60B 1UFUA 1WA2X 2CU9A 2JKLA 3DX3A 3EZJB 3FN9A 3L3JB 3RAJL 1HIML 2ENJA 5GGUB 5DVKA 3CLEH 2ADFH 2OMUA 4C56A 1WF5A 5ESQA 4XBPB 1NUDA 2DM2A 4G11A 4M1CC 5D1QB 1THAA 1VFBA 2PP7A 1I1AD 4N6QA 1HYSC 1X5LA 1PKQB 2ADJA 3PHAA 5MEQA 3RE0A 1TMQA 3CZNA 4P23B 5E6RB 2A74B 1DCEA 1U95B 3GJFH 4G6JL 1Q38A 3MGOA 1L9OA 4JO4L 4KHXH 1V10A 3FUIA 3HI1A 2QVMA 4K8RH 4MBOA 5FUOL 3TGXA 3V4UH 3MJ7A 4PG2C 1BD2E 2ITCA 4X5RA 1YUKB 2R0ZL 2GSIA 2QZQA 3SPJA 4MGXA 4JR9L 4ZTPL 3VYOA 3RU8L 5C0NC 4KQ3L 4FYSA 4KFMA 5TQ0H 2PYFA 3P4OA 3G5ZB 4A63A 1A6ZB 4KXCA 3EO9L 4R3SA 4DGIL 4XBGA 1XO8A 2WGXA 1MJJA 3UCRA 3EOAB 4IEFB 4GRMB 3WAKA 1AQHA 5CJOL 3LSOB 3ILPA 1CYXA 5D4JA 2OJEA 2AEWA 4OCSL 1YEDA 2NX5E 4NYLB 3T2QA 3ZQXA 1NCGA 1A1NB 3BAIA 3K0YA 4MXVE 1UADC 2R1YB 2HP4A 4P99A 4YEEA 5D2LA 2L8AA 1CWVA 5DD1L 5CUSH 3FAXA 2MCG1 3VXOB 2GITA 4P57A 3B2DC 4RAVA 3EFFA 4MKTA 4Z7IA 2F7OA 2X9ZA 3S88H 4UTAL 1JHKL 2QTVA 2E47A 1R3KB 3SJVD 1S7TB 5FKAA 1HH6B 2NPLX 4PRHD 1A4KB 2EILB 2ZOUA 5HGBB 5FFGA 3X1NA 1G7HB 3OLDA 5IT2L 3IDMB 3CVIL 3AGWA 4GIAA 4XNZC 1BQUA 2DLGA 2G2PA 3DBXA 1UQSB 3D39A 1L0YA 2X38A 4PGEB 4JJ5A 1BBJB 2A77L 4KKBD 3HZKA 3WUZA 1UT1A 3GBNH 3KGSA 5DT1H 3WY3A 2G75B 1QOKA 1IAKA 1UM6H 4JE0A 1U92B 4HC1A 1FL5A 2AP2A 3IPFA 4X6DF 3WFBH 3MCLL 1AZZC 1ZLWH 3RJOA 1RIUL 1HNYA 1ZXQA 3FU7A 3EHBB 3Q9QA 1YC7A 1G43A 5L7XH 4J3VA 3Q8CA 3OC8A 1R47A 2HH0H 2VR4A 2E27L 3GUFA 4KJWD 3IGLA 2CALA 5D6DA 3MO1B 3PJSA 5I5MA 4R0LB 4FMKA 4ZFQA 1CGYA 3B7TA 3WKMH 5I0DA 5T3XD 4HH9A 1XGZA 1MREL 3FB7B 2WYIA 3KGUA 4IW4C 5ITFB 4J4PC 2GAZA 1WYJA 2BP3A 2VKWA 3TIEB 4ODVH 2YUWA 2H2SD 1BV8A 1NAKL 1TJXA 2NSXA 4B0MB 5JIDA 4NHUB 4YHZH 4Q0XH 4YHIA 5GJSH 1H8OA 4MCNA 3QUYB 4PJFF 2VQUA 4X9BA 1ZA6B 1JGUL 5JLZA 2OP4L 2QGEA 1BXAA 3JWDH 1EANA 3DI2B 3C6LB 3DPBB 3FULA 3ZZ1A 5C0CE 5C09A 2JTDA 2VRQA 4WWKA 3QC5X 4NPYA 5KBPA 1M6UA 1S46A 4FYRA 2Q6WB 3T4AB 2Q87A 1E2VA 4JRLA 3JTTA 4M61B 2OMTA 4WUUE 3VI4F 3DHPA 5IHLB 2VDQL 1I9IH 2X4PB 3EFOA 2XLLA 2CIIA 4S11A 1YN6A 4HIXL 1GY1A 4YPGA 2FD6L 2EEBA 2CG9X 4XAWH 3HB3D 3JUZA 3MBEA 1JRHH 2Y3AA 4MD4A 5J12B 1S78D 2P49B 5EORH 1SDAB 3GSVB 3UYRH 3QXTA 3GRWA 4YDVB 5C6TL 2ODIA 4EDXB 1YMHB 1MUJB 2XBTA 3EJZD 1GC1L 4C57C 1N26A 1QSEA 5HSFA 3U6RA 4P2YA 3VWKD 4Z3IA 3ULUF 4LLYB 1JOIA 5IEKB 4Q2ZB 5F7AA 4YQXH 3U9WA 4M4RB 2J1KA 2DLFL 1SVCP 4JKMA 1UC6A 1UM4L 4AM0A 3I6GA 4EE2A 3WIAA 1W8NA 3NIDF 3T1FB 4K8RC 4N24A 3HC2A 1PAMA 3DJSA 4N1HB 2R1WA 4UOQA 1KENH 5GZOC 2CSPA 2B1AH 5F3FA 2ESVE 4HZ1A 4QHLA 4XHJD 2ALWA 1OAYH 3OXRA 1O7SA 3BD4A 3FT0A 5I74B 3HS0B 4I48A 3IFPA 4LNVA 5CCGE 5EN2B 2J8UE 3SDXA 3AG1B 3VM5A 5C3LD 5JPMB 2ED6A 2O61B 1A6TB 2ATAA 2X4QB 2DQIH 2G5RA 3WEAA 3GHBL 5IGXL 2ISDA 1TJHH 4EN3D 3P77A 4PJ9C 3ZTNL 1HQRA 1JWUB 4HCRL 3ZN6A 1FVCB 1QTSA 2UZIH 2UXFA 5KSBA 4NQXA 2R69H 3CVDA 3HZ3A 4ERSL 5F1KC 4EXKA 5CAYB 2YHGA 3L9YA 2WKOA 3LH8A 2AJ3B 2EIEA 5JW4Q 3IT8D 3M8OL 4DOHE 1DL7L 1JGLH 4YFLI 3HE7B 1Z32X 4UMSA 1RVFL 2XHNA 1I1YB 4OIAA 4L8DA 4LOEA 5DUPL 4F37F 2IWGA 5ID0B 3Q1SL 1ZLUH 3MAWA 3GRGA 3H42L 3QCTL 3B43A 5AAWC 4P2OC 2UUDH 4PJEE 5INCB 5TGBA 2AZAA 1A0QL 3O4LE 3QORA 2FATL 1CCZA 4NM4L 4XNXL 4ZUVA 2K9UA 3QSKB 4JDZB 3SBWC 2K1MA 3SPIA 1RZKH 5LBSL 2PWDA 2XWTB 3FO1A 3TS8A 1LMIA 2UZXA 1DVQA 1PDKB 3BAEH 3SCMD 5DRXA 2O6CA 1TNMA 2F7IA 3HLKA 3QUXB 1BAGA 3VYNA 4J3TA 2GW5A 4JAMA 3AQXA 5L9DL 43C9A 1XQ4A 4KY2A 1TG8A 5JQ6L 3QUZA 3HUJB 1JFHA 1QBLL 1VRSA 3HHSB 2F54A 1Y1DA 3CBKB 4YS4A 1NCDL 5M7QA 1QFUH 1N19A 1F6AA 3LPPA 3PS6A 3MRNB 4P5KA 4MA3A 4MXVF 4FQXA 5AOLA 4A66A 4CN6A 2E76C 1USZA 1PYWA 1Q9LA 1BYNA 2O6DA 2ED9A 1TQCB 1RKRA 5EWIL 2WBWB 2AJVL 4IKKA 1JGDB 4JFPA 4DVBA 1X4XA 4Q97A 3P69A 5AOJA 2PO6B 3IWUA 1TCRA 1BQLH 3CLFH 1HEZB 2ZUUA 4ZUTA 1YDPA 4B7LA 4KXBA 1PY0A 3TT1L 4PRNA 3U9PL 4ZAKB 5AB1A 3RGVD 4ODWB 3RI5K 1BZDA 2DWEA 4U2YA 3T8VA 4YAQA 1YNTA 1MCPH 2OSLB 3KBEA 4FXKC 4KKNA 5DFVC 5GRUH 1HEJC 3UC2A 3GMNB 1A64A 2X2HA 4XRCB 4EI5A 5DHDA 3QDHA 5BUPA 2HRHA 3C60B 1IC0A 3MRCB 3BPCB 3RWDA 4CU7A 2JIXA 4FADA 3V0JA 1CLOH 4TV3A 4A37A 3QJRB 4EZLA 2DQUH 4QRUA 2Z31D 3ULUH 3CX5K 1KELL 4WHTA 2P46B 3IS0X 5AW9B 3ZX1A 2IVFC 4YN3A 4PLKC 2V8LA 1XL6A 2WBKA 5T3XE 1CU4L 3K2IA 4WWID 2AJZA 4XBEH 5SWZD 5JHDA 1VERA 1CK0H 4XP9L 2L0DA 4TUUA 1FDLL 1B0WA 1P9MC 4Y5VB 1QSZA 3NJJA 5CCKL 3TXAA 1WWCA 5AB2A 5KYYA 5I5RA 2EACA 1JYWA 5CP7B 2JQMA 3LKQA 3U30B 2DJMA 2W5PA 5E95B 1H0DB 4JO8A 5JHLH 2BHYA 2X7LA 3N5AA 4JDTH 5C0DB 1HT6A 3JTSA 4AZ8A 3FOLB 4OGZA 1JPST 5L0QC 3MBWB 3FQXA 1JHTA 3DGGA 3ES6A 4RBPH 1EEZB 4UDTB 2PTTA 5C0AE 3VFOA 1X9LA 4L3CA 2XN0A 3FB6B 1RZ7H 3SDCB 4N8CH 4L1SA 2DTSA 4QRRB 4GXUN 4NZRL 1U3NA 4P2CG 1UB5A 1BW8A 2OMNA 3AFLA 4WW2A 3T2OA 2Y07L 4FLOA 2HKFL 4GH7B 2AKRB 4JY4A 4WFGD 5B3NA 1FLRH 5ERWB 1KJVA 2H1PL 3KD4A 2WIIB 1ZS2A 4Y1AE 5HDWA 1YMMA 3L3GB 1NCJA 4BFOA 6PAZA 4HEPA 1CGWA 4X0NA 3UTTB 1BXXA 2SEBB 2VABB 1DQJA 3K72B 1ID2A 2NDFA 2QSVA 4HWBA 2OMZA 1U3HB 5ACZB 2EVFA 1L0XA 4P2RB 2DKSA 3O3EA 3AUWB 3VH8A 3GC3A 3WL9B 3FUMA 1F11B 4I4WA 1N3NA 4OIBA 5AVUB 1LWHA 3D3VB 1I8IB 3B3IB 3X11A 4BZ1H 1AI1H 3VFMB 4ZXBA 5EU3B 4NM8L 4FP8H 1SXSA 1W9XA 4CKQA 2IALA 3D07A 3MRMA 3Q6FA 4TVUA 3REWB 4PREB 1E5UI 4EMZA 4OLVH 1XR9A 5D5MB 1HXMB 2B20A 3MZGB 3TA3C 1C9SA 1Z3GH 5L4FA 2NLJA 1YEHH 3CZSA 4AMKL 4G9DA 4PRPD 2EDKA 4GSXA 5HGDA 5DMKA 5T1LA 5IMLA 2BWDA 4HJ0C 4AEIH 4QAMB 4IIQB 3U4AA 5C0BA 4D0BB 4J1UB 2NUPB 5FO2A 3ZBMA 1RUAH 4NUPA 2ZWKA 3GQFA 4CMMB 1A9BB 4R7NB 1SF5A 1AR2A 3R19A 1BQRA 4OLYL 4OF7A 1N9PA 3TWCL 3FF7A 5GS1B 5ITBL 4ZSOE 1Z9PA 3PL6B 1UWEL 1XB6A 2Y72A 3OR7A 4D9RE 4BINA 1F4XH 3G6AA 3J7HA 4M48L 1NH6A 4LBEA 4LSTL 2DYRB 5BZZA 4C4UA 2BSTA 5I1LB 2VXSH 1P1VA 2DI9A 2ICWI 3N40F 4LLVB 3PWJB 5IQOA 2VZUA 2Z64C 3ASOB 3CBJB 1QZNA 2NQCA 3BCFA 1CE6B 3UEZA 3VXUD 5DJ0A 5ISZB 5KW9H 1S4IA 3KWWB 1U8QB 2DQFB 4RGNB 5DSCB 2VLKB 4Y5YC 1MFDL 1M9WA 4M43L 2W65A 1CD1B 5IF0A 3E3QE 4OCXL 3EJYC 1L9TA 3CUPA 3NSJA 4AVIA 1XB8A 3ULUC 1HYSD 3ROOB 4MA7L 2WNXA 4RMBA 2Y5EA 2BMKA 1QLFA 3KDMA 5DGQA 5A40E 3A6CL 1KIQA 4JKWA 5IVXA 1ET5A 4HOZA 4GW5A 1WBXB 4LCIL 3G7TA 5I73C 4E9YA 3DX2A 3LZPA 3BKJL 3C5JA 2BHUA 3V6OE 4QRBA 3RP1A 3FB5A 4K23L 3LEYL 4OGXH 3DX9A 4KFZC 4OFPA 5DF0A 5BS0A 3QZMA 4JFED 3UROR 4EOWL 4ELME 5HYJA 1IKOP 4L9DA 1TITA 1KT2A 2AHIA 3RVUD 2ZWNA 4PV8B 1CGUA 3SBRA 3BO8B 3PFUA 3APCA 5DZVA 2VC2B 4FCHA 1CLVA 1GY2A 3BAXA 4XCYB 3NVQA 1UD4A 1HEHC 5D7LD 4LVHC 3L3HB 4ALAH 3RFZC 1XF4B 3CFUA 2EO9A 3DXAA 4GAJL 4H1LB 4JFFB 3MCG1 3BW9B 1QRNB 4I3GA 2M8XA 1NOFA 1PQZA 3FQRB 3FTYA 2WVVA 5K59F 3FO2B 3B37A 1JF1A 3TLRA 4KX7A 4XMPH 3X3GL 2EDTA 3VXRA 5DZNA 3WOVA 1P5UB 4YVUA 3KXFB 4OJAA 5E8DH 3MJ8A 1A6AA 2DEWX 2YQ2A 5D7IA 1GGBL 3S96A 4AI7A 4G1MA 1BWWA 1O75A 1UD8A 2OMXA 4I3SH 4HUCA 1OAKL 1FFQA 2AFNA 2K7PA 2PABA 2GTZA 3AJ7A 4K3DH 4W9IC 3W39B 3OAWA 4BKSC 5B3JF 1BGXL 3GMOA 1B4RA 3VM7A 3EGSA 3WJJC 1ZLSH 4NI6A 5KVDH 2G2NA 3LJ3A 1FZOA 4FNSA 3QP3A 3HNTL 4BFBD 3DJTA 3TO4B 2Y25A 3AXLA 3WEXB 1E3XA 5MERA 4JFWA 2HRPH 5DHEA 3VNZA 5ICYA 2H32A 5I1JH 3FT2A 1KGXA 2UV3A 2HUEA 5T1KB 1E4JA 3TV8A 4XAKD 1AYRA 1L4IA 1NDMA 1U8KB 3LVTA 3NCMA 1RCYA 2VE6A 3QEQE 3DUUA 3GDBA 2CR6A 2HN7B 1U3YA 4IYKA 4BA8A 4EO5A 1RV6X 3NIGE 3GMLB 2ERJB 4IKJA 1TJGH 5F7LB 1ACYH 5I76A 1KTLA 1VDGA 3SDAA 5HHOB 2JCCA 2OYPA 4UM8A 1K2DA 4MAYB 3LZFH 4C47A 2CO2A 4H8VA 3HN5A 5I66A 3ZVVA 4ZS7L 3MRHB 4GG6B 2JXMA 2W9EL 3LHPL 4UQEA 5DTFB 3D9AH 3TX4A 3QIUB 3WD5L 3BDYL 1KCBA 2IDFA 3II2A 1VZIA 2FIKB 3QR1A 1Q94B 3NFNA 1BIIB 5C97A 3GMQA 1L3WA 2CRYA 4TNEA 1IFHH 1ZGLM 1D2PA 1SNRA 1RAMA 2RBLA 2BCMA 1KV3A 4J3OH 1ZSDB 3Q8EA 1KBVA 3VA6A 2AZUA 1WFTA 4BDVA 3MNZB 2XC8A 2EXTA 4YHYB 4Z3JA 4WTWA 4RIRB 3ILEA 2A4ZA 1KTCA 1FQ9C 4HZLB 4WI7A 1NM4A 1DBAL 1MHHB 5DHYA 3ZT7A 1UACL 4IGBC 3DUSB 3PRZA 5MHSE 2VLRB 3S4SG 5CSBA 3UGXA 4EQ3A 1BZ9B 3P73A 4UU9A 3QUML 2NZ1A 3ELQA 5BUGA 5T1JA 3UH8A 3VO0A 1J88A 4A7UA 1WC7B 1BQHA 3WTSA 3ESUF 4K8RD 4P3CL 3LXCA 1V3MA 5F6IC 5FLUA 3ZE1B 2NTSP 3WYRA 1TJIL 1HAWA 3VD2A 1YEEL 2DI7A 4H26A 4JG1H 4B97A 1KGCD 4DP8X 4XPAH 5C0RH 3F12B 3OLIA 5FM4A 4YSCA 5FB8B 1AFVH 2J6EL 1MW0A 1TIUA 4LCCB 3SY0B 1UXSB 1USQA 1BFTA 5D1QE 1I9JH 1QZ1A 1FLTX 2ZXCA 4GKSB 3BAWA 4F8NA 1OGAD 3MV9A 1BZ7B 4ZUUA 4DZBB 2OTUB 1AXTH 5JA8B 1XIWD 3V9CA 3IFNH 3A4DA 3EJQA 5GRYA 2BY0A 4WI9A 4F9PA 1E8YA 1NGYB 4CDHA 4O4YL 1ZOXA 4NAJA 4HBQA 5AKVA 3VFWA 3WBDA 4B5EA 1D9KA 4P4KD 5AVVB 4F7PB 4JY6A 4XNMB 2YD5A 3TESA 1I3VA 4WCYH 1GW0A 1LO3H 4NN7C 1OGTB 5LCVL 2Y5TA 4ALAC 3FUHA 4ZZKA 4X99A 2X41A 4NKDA 4OIFA 5HI4D 1I53A 4XNQB 3DSNB 4AY0A 5F7KC 2CUHA 3MBXH 3QIBB 2DYSB 4QMEA 1YJDH 5CZVL 1FHNA 1DQQA 1L7IH 1OB1B 3CFJB 4NRYA 4LRIA 1WJ3A 3E0GA 4TSCL 2I5YL 2YC1B 3A67L 3ULVL 3EYFB 2DQCH 4MDJB 4Y5XC 4L8BB 2H45A 5J3HC 2ADGA 2GBTA 4CVWA 4LOUD 3J8F7 2O5XL 1IM3D 1KZQA 2NY5C 5AKRA 5T33L 3TPUB 4UTCA 3ARRA 5BMFH 4HX1A 1T1YA 2I85A 1FO0H 2PPEA 2Z4QA 3A21A 3O9WA 1RZFL 3PCYA 1G6VK 2I26N 4X8JA 1OM3H 3V8CA 2JLLA 1A6UL 3GZPA 3VQMA 3NJHA 1XD1A 2EDHA 4HUXA 1FZKA 1VZGA 5F7DB 3S7GA 3OKOA 3DMMA 2XOTA 1KG0A 3U4EA 1MLBB 1IGTB 2O4EA 2WYTA 1KLUB 1QATA 4Y5YA 3V52H 5B38B 2CKBB 1A65A 3V79C 4F5CE 3DYPA 1QPKA 35C8H 1ZVHA 1CFVL 2P8MA 1MCQA 4EUPA 1K9TA 3CXHJ 3D85D 5AVZB 4O2FA 3FYIB 1BF5A 3QQ4B 1E5CA 3IJHB 5DZAA 2YUVA 2DLEA 2WW8A 4G5AA 2DF3A 4QD2E 1HE8A 2I32A 4OF5A 3U7YL 3WN6A 3INOA 2WJ5A 3HIZA 2JWYA 4LB8A 3WLBA 2I60L 2QPFA 2QKIB 3QI9D 4NUJB 3HHRB 5DA0B 1HKFA 3FK3A 4LSPH 4O51B 4KO9A 5K9OA 1T2QL 4QXVA 4UINL 5FYKH 2VXUH 3ME0A 4XXCA 1SJEA 3V5HA 1T66C 1HH9B 3CHQA 1ZAGA 4PRBB 4ZMNA 5IB5B 1OP4A 5KJ4A 4LPXA 3WE6A 2BVQA 2BO0A 2WLLB 2WO3B 5AVTB 2AI0L 5SX4H 4A7TA 5CD5C 4HUUB 3I3DA 1TTFA 3KPSA 1UCBL 2W0FA 3HZMA 3D06A 4H88L 4M5YL 4OCMC 3US0A 1Y18B 1XF2A 2BHZA 4M8QA 1AE6H 2EYSA 1CXFA 3H8NA 3VTTA 2R2HB 2WANA 3IE9A 1CR9H 4JG9A 3VU1A 4WNSA 5IW1B 4D7BA 3S37X 4NNPL 4QJ5B 4PR5A 4HG4J 3DOSA 4TOYL 1K3IA 1FFNA 3N44F 4TVPE 3FCBA 4ABQA 2NY1C 4H8PA 4N0FB 4KK6C 2OSXA 3FCTB 4F2MB 1UB6A 5EN3A 5B22A 3D6GA 1X5JA 1BD2A 2XKUA 4QYOB 2CD0A 2DYPA 2KPNA 4TULH 3BP7A 3T0EE 2K45A 4UDUB 4NFCA 3RTQA 5JYMA 1IFRA 1D5IL 3HFML 3AZUA 5FYLL 5GSRA 3WJJA 4F24A 4Q8BA 2ZONA 1WTLA 2VDRL 4WFHE 4GUPA 2XKSA 1KLGA 1XF5B 1JXDA 3QRBA 5A6IA 4YHLL 3JYBA 1IAMA 4A6YL 1CL7L 2J1WA 1JP5A 25C8L 2DKMA 1OF2B 1N2RA 4PUBL 2EDLA 4S1RL 5E6IB 3GLDA 4RFOL 2NX5A 4TNVF 3T77A 4BH7B 4HISA 4E5XB 3MPCA 4TUJA 4E9VA 1X5MA 3AMKA 4BYHA 2MHAB 1KTJA 1C5CH 5J0BA 4MDIB 2C3GA 5A2JH 3QFDA 2JMRA 5EOTB 2AK4B 2NY2B 3PWPD 4UYPA 1WITA 4PG9A 5B8CB 2WP3O 2YXFA 4UT6H 1HC1A 1QKZH 4HOXA 2JJTC 4WI6A 4JO3L 4LRNL 4PBXA 3QWRD 5HVHC 1I7RA 4E9QA 5KVGL 5AOMA 1WT5A 3JV0A 5DMGD 3HI6H 3C5ZC 3ET9F 3GSXA 3MCKB 1DDHB 5J1AA 4Z7AA 3GT6A 1BG1A 1YC8A 3MRDB 3I9AA 1M6OA 3QDGD 4NCC2 3KPOB 1KN2H 1TQWA 3QO1B 4WI4A 2BJML 5L2KD 4I87A 1GW6A 5DDHB 1M7IA 4G1EB 4UIMA 3VQ1C 3HAEB 4FQ1H 4PRDA 2X2IA 5CP3H 1S7RA 4YPJA 4FG2A 5T5FH 3EGXB 1A6WL 2DRUA 2CUIA 4ETYA 4KXZI 3TJEL 2C3WA 3RL1B 1G87A 1T89A 2ATKB 4QNPF 4LCUB 1OTUD 2PXYC 3IM1A 1EHXA 3GGWB 2WZAA 2R0KL 2FQEA 4I0PB 4ONHA 3N3EA 4NQCD 3GZQA 4C83A 2CO1A 4JZOA 3VA2C 3GS0A 5BZDA 3MR9B 2XG4A 1NUGA 3P4NB 1A6VL 2CGZA 4AQ8A 3DWTA 1ZHLA 5A16A 2YSSB 3D2UB 3ZE2B 3LIZA 5FC9A 3U82B 4PGDA 3NEEA 2H1XA 1OSZB 3IDGA 3P3SA 4PMEA 3DVGB 4X9HA 1FZMB 5H35B 3EDEA 1KN4L 5MEPB 5K93A 3R8QA 5CWSB 2XT1B 2AMUA 1EZVY 4MZRA 5CGBA 2DQDH 3H4HA 2G9HB 5C0CA 1JWSA 2J2ZB 4G6FB 5KSAD 4KQ3H 4MMZA 3RBSA 3KVQA 4PI0A 1JXGA 2OMWA 1II4E 3AS2A 3IDJB 3LRSB 5F21B 2ZICA 3GIZH 4LHUB 4ONFL 4Z76A 5CJOH 5CEXB 3ZDZF 2VDPL 3BHBB 3CFNA 2DJ4A 3A6BH 4LAJH 3QO0A 1KBGL 4IIZA 5F3HB 1KB5B 1E27B 2ICEA 5JHBA 3ULUD 4TSAL 4APQC 3ULSA 4Y2DB 1BEYH 1WH0A 1S3KL 1LEKB 2D2OA 4JY5L 4MX7B 2YA2A 1IGCL 1EMTL 3CSFA 3OKEA 3S5ZA 1A9VA 4OQTL 5TDOA 4G72B 4G8EB 4S1SL 4DTGL 3ML9A 1IEBA 2ALAA 3ZQ9A 1YRKA 3DETD 2DTML 4UTAH 2FR4B 4KPHH 4NDMB 5JR1H 3MC0A 4HUNB 1ZVYA 3IFOA 3BVNA 3I2CL 3VFSB 5CEZL 2B1HH 4FQJL 2YRPA 4JPKH 5F9OL 2J3SA 4PVMA 2PW1B 4HS8H 1GS6X 5I8CB 4YHOH 5FOJA 4OCLC 4GKZB 5GS0L 1EJOL 3MVSA 2ESVA 4NKQB 1EHLL 1PX8A 2OR8A 3KVPA 4KC3B 2ZKWA 3QPXH 5SX5H 3CQFA 2BFVH 1NC2D 2Q9OA 1W8OA 5IBUB 2GEEA 3KH3A 2GUYA 4Z7UF 3E3QC 2EEXA 2QPUA 1R3LA 1P1ZA 3ETTA 3LXAA 3RIAF 3SGJA 1CB4A 3ZL1A 1PGRB 1IC5H 2D3LA 2H6OA 3KYNB 2CK0L 4JHBA 3G6JA 4P9MH 2XBDA 3K4AA 1Z9NA 1AD0A 2CM5A 2JB6A 1BEXA 4AOFA 3O0RH 5DD3L 4RA3A 4PJHB 4G7YL 5E8PA 1TU2A 1HWWA 3OV6A 3F83A 4XO5A 3LD8C 3O3DA 1I1AA 1G9MH 2BNQB 3DJRA 3S98A 1SM3L 4JRFA 4XNYL 5DJZA 5INDB 2CJTA 4BWWA 5B39B 1DQDH 3V6OC 3BFOA 4OGAC 1TZOA 2BS8A 1IAIL 2KS0A 2AEOA 3CZKA 1QLEL 4PJEA 2YGOA 2A9AA 4Y89A 1GJUA 1KJ3L 3ZE0B 1JGUH 5AFAA 3O4LA 5I1EH 4QRRE 4BH8B 3V0FA 4WEBH 5DVNA 4HIJA 1PZ3A 2E3VA 2VQ1A 1ZEAH 3IMRA 2YRLA 1UFGA 3A3YB 4U6YB 3TT3L 3H2QA 4KKAC 4R4NC 3WHE0 4PTUA 5GS0D 4FF9A 1G5AA 4ISVB 1RUQH 5F71A 1KPVB 5E23A 2FL5A 5ALBH 1CVRA 1KCWA 4PIRF 1Y6KR 3TVMA 2J1YA 4WO0A 2F7RA 3F7YB 5HHXL 3LB6C 4AL8H 1GYVA 1DQTA 3IETB 3HLAA 2JSFA 3MRRB 5BO0D 5E1HB 3ARDC 3BEWB 1E4WH 2YAMA 2JF1A 3B1UA 1NCIA 1WEJH 3V6ZB 5E00B 3S2CA 1H3VA 1M7DB 3MRBB 4FL4C 1P7QD 3T2NH 5LXVA 1SEBA 1GC1H 2PCFA 4QLRA 1P4BH 3IJEB 3PWPE 3FONB 4YNYA 4YBLB 1RP9A 3MLTB 3CVBA 4QRSB 1DE4B 2XWBB 3WLWD 3CVHL 3SJVA 4L48A 4U1IB 5ETUB 1CDJA 2DAVA 3PP3H 4OM1L 4PRHA 1UM4H 1NC4A 4N0UE 4KDVA 1AO7B 3K46A 1MFNA 3WMPA 3RA7L 2W81C 2A6JB 5KOVC 2CBOA 4QAWA 5FO7A 4LCYA 3EOTH 1WAEA 4LASH 4UTBA 2AEIT 3QDGE 1AH1A 2FDBP 2H0EA 1SLWA 4KX8A 5L2KE 3FF8A 5CGYD 2G5BA 4Y16D 2OZ4A 4QRPD 1OSPL 3MROB 4AIZA 4CUCA 2OL3H 4MA8H 5E6UB 4FG4A 3TN0C 1WQVT 2AXWA 2A9MH 1IILE 1VB9A 1WE5A 3T08A 5IGXH 3QR2A 3BLPX 2DBJA 2ORBH 4G8FB 3OKKB 2YD7A 2DBLH 5MI0B 7CGTA 4HLZH 2OX5B 4CVUA 5EUKB 3UBXB 4N87A 5FO8A 1XCTA 4ZFGL 1N6QL 1LD9B 3MGTB 2GBAA 4XN1A 5IMMA 1K8IB 1F00I 3MJ9A 4S1QL 2EIZB 3OB8A 5DS8B 1M57B 5JO5B 4WY7H 1FFRA 1R1CA 3GBDA 4HJGA 2AF2A 5ISZE 3ISWA 2YS4A 2ARJA 2JJTA 4RGNE 4H8UA 5IR1B 1YN7A 3HUJF 5HHMB 5JQHC 5MEOA 4MAUH 1T1ZA 1IM9D 3O6FD 1HOCB 4N1CA 1A0QH 2EEFA 4QRTA 2PF6A 3DIVA 1W72A 3K74B 5ANHA 3VTAA 1A25A 4TSBH 1K5NB 1A3ZA 3C5ZA 4XNXH 5DJ6A 3RWEB 5KVEL 1DVXA 2HLAB 4WFFE 3CFDA 3A4AA 2HFEA 1BJMA 5J9PA 4KKCD 32C2A 1FNSL 1GKEA 3AQZA 1N64L 1J1XL 4FXTA 1HHJB 4X8GA 4ZPVA 5C0AA 3U9UB 4DF9A 5J5EA 5JHAA 4DFHA 3OVUB 3UBGA 1QBLH 4K0OA 2F19L 3A4EA 2R15A 3B9DA 3F6JA 1NCDH 5D1XD 3B5HA 4PJGA 2QJDA 1MAMH 4LPTA 5CKAA 2CO7A 2XJKA 4HJ1A 1E9OA 1EJ8A 2QZ5A 3H3PH 1IFGA 2G60L 2ZF8A 3ATAA 4P05A 1FGVH 3P1VA 4Y1AA 1ED3A 2Y7NA 4XWOD 4NQEB 1ZXKA 2Z91B 4YR6B 5CEYB 5C9KA 5ENWB 3GS7A 1SEQH 3E6HA 1KJ2B 3VWKA 4DP0X 5F9JB 4TQHA 4Y19D 3OZ9L 4J7RA 3S9DB 4P5TB 2FB4H 1KBPA 3LS5L 5KVFE 1OTSD 4M6AA 4NXSA 5DCCA 1F2XK 2NZ9D 4HKZA 1XVSA 3WHE1 2RAMA 1KV7A 2XN2A 4K94H 1J1OH 1DSFL 3AABA 3TZVD 4AE0A 4GP8B 4HIPA 5C08D 1SOKA 4JFFE 3VDBA 5D1QC 1QRNE 2CDEB 3E1F1 3OG4B 5DHVA 1ADQA 3CCHB 1S6NA 5FECA 1BF8A 4OFQA 1PZCA 2X6MA 3B2XA 1FZJB 3QPQC 1HHIA 4P23C 3MLYL 2A74C 2PR9A 5SWSD 1NGQL 4KTGA 2YGQA 4PYHA 3TF7C 1V3JA 1M3JA 2I07A 5JIKA 1ET8A 4XNUL 3FQWA 4GBXD 4POZD 4X5XA 5D71H 3QG6A 4DK6A 4EN3A 2OJZL 2D4FA 5ESVA 4MXWL 1I9RH 5LXGL 3K2UL 2RTTA 4Z78A 4UB0L 1I8UA 1RZGB 2P80A 4PSPA 5IHHA 2VDQB 5HDBF 2WC7A 5CCJA 3DUHA 1U8NA 3VE0A 1NCCL 2QEJA 3BVWA 4K71B 4XPGL 3K91A 4KVPA 5GRXG 3U36B 4JHVA 3HG1D 5HGAA 2X4NB 1AZVA 5TH2B 5CCKH 1SYSA 3FHAA 2ZKHH 1D6EB 3L45A 1MVUB 4FXGB 3GI8H 4BSWB 5DQDL 1A1MB 3GXPA 4WTXA 4ZSOA 4HJIA 2D03L 4LPYA 1J18A 2EKSB 2KBGA 3RIFK 1MAKA 4DEUA 5DEZA 4P46A 3MRQA 1H3UA 1TQUA 5I1KH 5CMAB 4RDQG 1K6QL 3QDJD 4OJYA 5D1ZC 2YIHA 4J3OD 4IRSD 3ZTCC 5L8JB 3AB0B 5FHAL 1UXMA 2YD1A 3WUWB 2ZTBA 5TDNB 3CMOL 5TQ2H 1INEH 1U0QA 3ARYA 1TTGA 2N7BA 2R2EB 5JMRA 1ZHNA 3WY2A 4UIKL 2R29H 1P5VA 2IDCA 4GG6E 4XB3A 2IXQA 4B3VA 1DJHA 1V3LA 4ODTH 4ATWA 2HKFH 2Q86B 2Q76B 4NO2A 5C2UB 3PU7A 2ZCLL 2JI2A 1RFDL 3LRLA 4Z5RA 2E7LC 1QEWB 2VR8A 4TTGA 3CN2A 5SV4A 2P8LB 1SLVA 1E8XA 4DN3L 1IKFL 1Q9WA 2WQAA 1PLGL 3UTOA 4LE8A 3L5HA 3O8XB 4YZWA 1MOEA 2QV2A 1I75A 1I1CA 3EHBC 4QXUL 4CL7A 1YUHB 3OMIB 2YPVL 1JZJA 2Z7UA 4L8CB 5FXCH 3UADA 5BUAA 2DZEA 5D5MF 4R0LC 5CXPA 3TNMB 1KXVA 1LVEA 4QO1B 2DM4A 3TNNA 2HVJB 1RK0A 3GI9L 3RGVA 1BJ1H 4X9GA 3EBGA 3MLZH 1WG3A 4ELMA 4ZNEE 3EO1A 2O26U 2QDWA 5CZXD 5D7EA 5MP6L 2VLRE 2G2RA 2W1NA 5E7FA 9CGTA 4ZQKA 1LYQA 3N42B 2YEQA 4HEMA 3QUYC 1TOXA 2IH1B 3BD5A 1MRDL 1T83A 4UOW0 1H6TA 4JM2B 3GBML 2A0LC 2WZPA 1TZ8A 4OZIE 5F89B 3C87A 4PS4L 3C6LC 3ZE1E 1NA8A 1MQKH 1R5VA 4F2FA 2EDNA 2Z31A 1G9NH 5IG7B 1IQWH 1FF5A 1X5YA 3T4AC 3HRZB 3FTSA 3B2PA 3APDA 1QO3B 5D7KE 1X5IA 4DERA 5GS3A 3O2DL 1JFQH 3L4UA 4LNRA 1UD6A 4CVXA 3JVFC 1WBYA 1VHPA 5KZCD 4A04A 2ZX6A 3EJCA 4LZKA 4ABVA 1S7UB 2JELL 4RFNB 2GPZA 4WK0B 2O6FA 1ACXA 1KNOA 1IGJA 3TWCH 2B14A 2CO3A 3SGKC 1FNFA 1M2OA 1MRFL 1E65A 4KROD 2WUCH 4K94C 3D08A 2X1OA 4XX5A 1ML0A 2GFBA 5EULV 1T80A 1ZD6A 4LSSL 1WP6A 2KDGA 1WCBA 4RZKA 4X5QA 2AXHA 2HFFA 5J06A 2A9BA 2AK1L 2OV0A 4OF6A 1F86A 4N2EA 3QR0A 4OCNC 4QRAA 4CC4C 4LQFL 1FNAA 3VW3L 5JMOC 1GAFL 2OXGA 2RGSA 3EGDB 1FN4A 1U58B 3QEQA 4NKMA 4KZEL 2UYLA 4HAFA 3CQQA 1OE3A 2XBZA 1NBQA 1IBHA 5C7XL 3PIQB 5G55A 2EXWC 1AG6A 5D1XE 3TYGH 5I71B 3DDGA 1W15A 4XR8C 2GCYA 4XCNB 5ID1B 5I74C 3HS0C 5L88H 4NIYE 1DVFA 1CBJA 4M3JA 3R4DA 3AS0A 4AQOA 5JPMC 4JQXC 4LU5L 2CHWA 3KEHA 1OAUL 4K5OA 2FLBT 3ZK0A 1S5HA 3V7AG 5CR1A 1A21A 4HJSA 5D7SH 3B2UC 1SYVA 1FL6B 1ZDQA 2AEQH 4WKZA 2IDSA 4LF3B 4CSPA 1H3WM 4H2AA 3RKPA 3SOBH 1FWXA 3IRCA 3QFGA 4D0CA 1ZPUA 1FORH 4RLDA 1A8JH 1XH1A 2AJXL 4HQQL 3OGOE 4OFYA 5C08E 3WS3B 4AW7A 5IBTL 1RU9L 1NTDA 3B2VL 2WWOA 3C2SA 1RURL 3HE7C 2JH2A 2EECA 2A6IA 5E0QA 4H0LC 4AYDC 4UILL 3WNMA 5F9WB 3MOBL 1IX2A 4LLWB 2WCSA 1ZTMA 4FFZA 4WO4B 3VGEA 1W0VA 4OKVA 4AXWB 2XYBA 4GW1B 4XZUB 3VFTB 1JZ3A 3QJHB 4DQOL 3CK0L 4GO9A 1NMAH 3WV0A 4QWWC 1A4JA 2UX7A 1HAUA 4U4BA 5F93C 1XGQA 4Z0BH 5EIVA 3SPVB 1ROWA 3EH1A 6FABH 3AY2A 5E56A 4N90D 2HT3D 2YQ3A 4GIOA 4XE5B 4PRPA 5JXAH 1CICB 4IS6A 3QUXC 4NO5B 4PY7B 4Y4FB 3GSWB 4PRAA 5BVJB 5A1AA 3L1FA 2WQXA 1GGBH 5T3ZE 1R6VA 1RZ8A 3PV6A 2HX8A 1YPZE 4X6CF 5HXMA 4LP8A 3QEGH 2XVLA 3HG1E 1XT5A 2AJYL 2W60A 3ALPA 4BA0A 1CZ8L 3L3JA 3VD7A 1U8LA 3BZFB 1J9CT 1ETZB 2L3BA 2QQKH 5K39B 5GGUA 4UOW1 4ZDHA 3T3MF 1QI3A 1YY8A 1TQCC 5IV2A 4CNIB 4MCYB 1YAIA 2WQUA 3CZFB 3LQMA 3MMEA 5HI5C 2ZSVB 2Z3FA 4LIQL 3HG0A 3FOMB 4I5BA 1J86A 5D1QA 4HIEB 1U8MB 2JKSA 4DN4L 1E6JL 2V7NB 3BWAB 4JHAL 2XUWA 1EAJA 3VXUA 2PO6C 3SBPA 1MNUH 5FHBH 3HR5A 4PBWD 4AYSA 2R56L 3UC0L 4KDTC 3WI9A 2UY7B 3MLXH 4GG6F 1N7ML 2K6YA 4IMLB 4OFDA 2CWRA 4OLUL 4ZAKC 4XPFL 4F2ME 2WB1A 3IXAB 3L3IB 4JN2A 3T2LA 3UZQB 1KCVL 2WSDA 4Y4HD 4U1LA 1RSYA 5DD6B 1U8OB 3ML8A 5LGJB 1G9NC 1WD9A 5A43C 1RK7A 2N3JA 4XO8A 3FRPA 2RFXB 3C60C 4PJIB 4DPBX 2FGZA 1F45A 2B39A 4JANA 2QPEB 4KV5F 3D33A 3LSOA 3LKPA 1ROCA 4ZS7H 2YD0A 5KJRL 1REIA 1YEKL 1X5KA 3KYMA 5CJ5A 2OZNA 4WNQA 5FW7A 1T0MB 3AQYA 2P8PA 4MRCA 2N4IA 3Q5OA 3MLUL 4KU1A 5JYLA 1LO4H 4R4ND 3WS6A 4KAQL 1IVLA 2GC7C 4Z6AT 4I1RA 2HJKB 4NAMA 1LK2A 2AK4E 1I31A 2GK2A 3QWNA 3MFGB 4Y5VC 1I82A 3CZGA 5DQ9A 4IOIB 5DWPA 4JL2A 4A2MA 3RB5A 3MCYA 1IBYA 3LB6D 3EYSH 4R90L 1KGWA 1R3KA 1HH6A 3U30C 3PABA 5B1KA 1NFKA 1G7LA 4G7RB 1JPGA 2F8OA 3DKHA 3MX0B 3SE4C 1OQOA 4AZUA 5HGBA 4F5CA 1BECA 2OMVA 2XNAA 5BZWB 4O02A 3H3KA 4KTEL 4D9QE 4B9CA 5E0FA 2CNYA 2FIRT 4PGEA 1BBJA 4O5LH 4PI2A 1OY3B 4JO2L 5CILL 4FFYA 3PAUA 1D5XB 5D4IA 1ZWIA 2PPAA 5AG8A 1ULVA 5C0GB 3SDCC 2KHAA 1NM9A 3DO7B 1S9YB 3LZRA 1H5BA 3P3UA 5DJ8B 5SWQA 3RWJB 3KPRB 2IF7A 1TFPA 1NPUA 4ODXB 4QOKB 2VR9A 2IV9A 1NCOA 5KSUB 4R0LA 3FO0L 1B4JH 1ZHKA 2AV7B 3CFKB 1BVKA 4IKIA 1JNLH 3EYUL 1G0XA 1VADA 1YEJL 3FU9A 5ITFA 2DWXA 1G1KA 3TIEA 2K0RA 1RZIB 4TNFA 4JZNA 1A9EA 3LCYA 3ZE2E 3W9EB 3BE1L 1HESA 5BRZD 3HMXH 1U3HC 2XI9A 3UDWA 1NCAL 2FLRT 4TLUA 1AQKH 2PP8A 2Y5QA 3PQYE 5I8EB 3H9SB 4O4YH 3M1OA 4X5WB 3ARFD 3SBQA 4FNPA 3QULB 3HZVB 4FERA 4PD4K 3C6LA 3FT3B 3KPNB 4FJ6A 4PLOB 3VFRA 4U49A 3OLEA 2SODB 3HNVL 4TQEH 1PZAA 3HE6C 4M61A 2CUMA 2XN9E 3DX4A 1U2HA 3UMNA 2YFNA 5GSVA 3KS0H 4C56B 4OB5L 2WLKA 4M3HA 4GIPD 4FA6A 3OAYH 3PLYA 4WJKB 5ESQB 2ZUWA 1ES0A 3T0EA 5LGKA 2YJQA 1TVDA 2I7OA 1VFBB 3KLQA 3IRZA 3N1GC 4HCIA 3EBHA 4IIQC 2ADJB 5MEQB 1RZFH 4B27A 4M5ZH 4OD3L 5H37A 3WXWH 5EHFA 5A3IC 3PJNA 5GS1C 4LHJB 4F57L 1GSMA 5HYJD 2ITCB 4R4FH 3VXTA 3AG2B 3PL6C 1S9WA 2PYFB 3E8UH 4I18A 4WI2A 4Z7QB 2HA1A 3JQOB 4R3SB 2C3VA 4XBGB 1CFVH 1T22A 5GZNC 3IYLW 4MKMA 5HGHA 5IROD 2JV6A 3ARVA 4ZW7A 3ILPB 5E1AA 1MH5A 2A4EA 4JFOA 2JJSA 1G0DA 2OJEB 2UZYA 3QZOA 3VFVA 3HS0A 1YEDB 3HI5L 1FPTH 2VJ8A 4FULA 3QB7C 2X4QA 3ZYZA 4X0KA 2D7NA 5D2LB 1DJZA 5T1DH 1TLKA 3JWOC 4HIHA 2K3HA 2GITB 1MW1A 4P57B 2EQDA 3P2TA 3HR6A 4RAVB 3EFFB 3QXDA 2O93L 1I8MA 5EBGA 3NFSL 1SQMA 5JQIB 2NY7H 2JK5A 5LHDA 5BOJA 1I9EA 1VEPA 5FKAB 2C9UA 3QG7L 3NAAL 2BNQE 1OB0A 4I88A 3W9DA 1A7OH 1DJXA 5KYXA 2IOOA 3VD4A 2AI0H 1XIWA 2XQBH 1UCBH 3F6IA 5GJTH 4HT1H 4QYAA 1NDTA 3WFCL 3DBXB 3D39B 3DIDA 1UATA 2DEYX 3BPOB 3S3BB 3ZE0E 4JJ5B 4P4KA 5FDYA 1J9QA 5HYSA 2VDLL 1T21B 1F97A 4LEXL 4G59C 3CDCA 1IAKB 3W2DL 2YRZA 2XA8H 3AXIA 4UV4H 1FL5B 3PXJA 3KCWA 4Z95L 2JE8A 1H3GA 1PDKA 1OOWA 1XMEB 5E2VH 5JPNC 1V7NL 2FYYA 3FU7B 3STZB 2YO3A 3H2PA 4GRWB 4H20L 1F42A 1GKOA 1RP8A 3UYOD 5D70L 5DYFA 1GGIL 3MRNA 4I3RL 1ADWA 4HS6A 1CTNA 3C8DA 3ABZA 4HH9B 5D1ZD 4GP5B 1CTMA 2D31B 1D5IH 4YFDB 3SYAA 3WTYA 1P5UC 5C2BL 3DBSA 5B1AB 1OCWL 1W0YT 5ABDE 1GIGL 1G6RH 3DX7A 2BM3A 5C3IA 4OLZL 3QUMB 4JRXE 4JVUA 4YHIB 1F6FB 4YHLH 4S1RH 4Q6IA 4MB3A 5JLZB 2F61A 1TO5A 4K3EL 2CJUH 2NY4B 5E9DD 1Q9KA 4P5MA 1NCWH 3T0WA 4NPYB 1AO7E 4FZEL 4GUQA 3TIDA 4JPVL 4FOMA 4L37A 1A5FL 2PCYA 1DSWA 1MF2L 1CXKA 1NOLA 1QYGL 2IOMA 3NN8A 3TO4C 4Z3HA 3EFOB 3D85A 2LHAA 2CIIB 1YN6B 1FFTB 1TENA 3BLKA 2XWJA 4K5PA 4MMYA 4NLHA 4PJ8D 5LGHH 1QTPA 3MBEB 4JO3H 4MD4B 5DVLA 4ZW3A 5IFAH 3K7UA 5BPPA 2A9DA 1JI1A 1KCLA 3QI9A 2Q20A 2DL9A 3GZKA 4H1LG 2ERJC 3SQOH 7FABL 4PM1A 3VRLE 2Y24A 4TL4A 1WS7A 4B53A 3QNYA 3F5WA 4HSQA 1QSEB 3U6RB 4JNXA 2NZIA 3M86A 4JFZL 2VOTA 4K55A 4L9LC 4X9FA 3BP4A 2GJJA 4ZQTA 1E40A 3OTTA 4GLRH 1I85C 2XWDA 5I30L 4AM0B 2Z0UA 4X8XA 3TJEH 3MXWL 1SOSA 2C9QA 3QIUC 2R1WB 4AQ1A 5IB4A 4G8AC 4PJCF 5HHME 2R0KH 3MLSH 3OKYA 4QRQA 4LDCA 3OXRB 4WK2B 4TQ8A 2NNFA 3IFPB 3CFCL 4LSDA 5EC2A 2FYVA 1OLZA 3SDXB 2ZX9A 4BK8A 3FOLA 4M62H 3MI6A 4WHCA 3B5GA 4YHYC 3L5XH 3FQYA 5C0IA 3P77B 2OMBA 2QVTA 1HQRB 1BQSA 4LSRH 5I75B 1VEOA 5KSBB 4BKLA 3UPRA 1W91A 2YXMA 2Y9RT 1UZ6F 2YOCA 5GIRB 4Y9EA 3LRMA 2AKRA 4CGTA 2ZYHA 5A2KH 4GS7B 3S37H 5AYUH 1U9KA 3UOAB 3MOAL 3T8MA 3STLB 1UJ3C 5LG1A 2WTOA 4YC2C 4KO5A 3SGEH 1JNJA 4G6KL 4NPJA 5FOBA 3TV3H 1L0QA 1NCUA 2YAFA 5TGBB 3QORB 1Y07A 1T5XB 3FN0H 4J6RH 5CGMA 3L95A 4ACTA 1PKOA 3ARUA 3FCUB 3GBEA 1E50A 4Z7NB 2YKLH 3FO1B 2R69A 1F11A 3NK3A 3KBFA 3L2NA 4LCCC 3KWVA 3V4VL 4LKXB 1ND0A 4GFTB 3PWPA 1DBBL 4JAMB 2MPVA 3IJ8A 1I8IA 4YSOA 43C9B 2Z35A 3TO2A 3ZR6A 3QUZB 4UUJA 1XGYL 5KTEH 1CDIA 4WV1A 4HXBL 3WIHH 4P5KB 1F6AB 4MA3B 4XZ4A 3F65A 4N0UA 1WHOA 4FQJH 2FAUA 5KS9B 4XPTL 4AT6A 4XE0A 4X4ME 1PYWB 2OS7A 1UD2A 1ZTXH 3QW9A 1NBVL 3P0VL 1J0JA 2V9QA 1A8ZA 4FRWA 3QDGA 1EHLH 4YH6A 5AOIA 1MHCB 1DLFH 4JFPB 5BVPH 3S6CA 3EO0B 1KIUA 2XU9A 4Q89A 5L2KA 4FG6D 4OSUH 4PJHF 4DVBB 3QIBC 2P42B 4GXVL 1BM3L 1GZQA 4D0BA 1GCFA 3VXMD 4AIEA 3MV8D 4A38A 2WXGA 4KNTA 1EBAA 1LWRA 1YDPB 3AT8A 3PWNA 4KJQD 3ASWA 3D4YA 4FYQA 3W11C 3GSUA 4AENA 1KOAA 1D5RA 1JPSL 4PRNB 3WNLA 2YD9A 2CK0H 3L5IA 1P84K 2ZIDA 3ZE0F 1YNTB 3QUXD 1P4LA 3O4OB 3X2QB 3UP1A 4PN6A 5DD3H 1VGEL 4EI5B 1AGFB 4PHZA 3A24A 4O58L 4OGYH 1BZQK 3RWDB 1CYGA 1PY4A 2ZUXA 3DGDA 3FH8A 4A6YB 4JKPL 4A7GA 3KBHE 2NR6D 2VB5A 2VITB 4QRUB 4RSVA 1LP9F 1XL4A 2XPZA 4P07A 4WWNA 5EUOE 1IAIH 1CFTA 2D3NA 4C8XA 4WHTB 2HUHA 3L5JA 5I6KA 2A5UA 1KJ3H 4MD5A 4U1HA 3ESPA 2FJGA 5HI5D 2VMEA 2J7LA 4G8GD 4F8QA 2OCFD 2LU5A 3PDOB 2AJZB 5KSAA 1TLMA 3ROOA 2WGNB 3CDFA 4W6WB 2E74C 2PO6D 3IE4A 4FAAB 4MJID 1EO7A 4PJAB 3BKMH 3BSGA 4GSUA 2FBOJ 1OP3K 2OLDA 3ISRA 3EG9A 2OSWA 3LKQB 1OLLA 2QKIC 3AS3A 1X3DA 2WVTA 3WFDL 1G9EA 3PNRB 4HWEH 2VDOH 2E86A 4UQ3A 1Z5HA 4ZFZB 1A14H 1L3NA 1XF1A 2C1OA 4WU7A 4DGWC 4AZ8B 5EO0A 5L4IA 4FFVD 4XI5D 4A67A 2VM3A 3FQXB 1JHTB 5IP4A 3ES6B 1DN2A 1MFBH 2V3DA 3GSNH 5AAPA 4DP7X 4ZO7A 3ZO0A 3VFOB 4L3CB 5KG9B 3TEUA 4DUXA 1U36A 3PAYA 1WLHA 5EOCL 4IK7A 3CVHH 4XVJH 2WLJA 3AMLA 2C4XA 3FQUA 1YO4A 4WW2B 4RISH 2P45B 3P30H 5B38G 4JY4B 2DIAA 1KJVB 2D3VA 1YMMB 2R23A 5FIEA 4JFFA 2VR3A 5I15H 3O45A 1QRNA 4L8SB 4JK0D 2VMCA 3GMMA 1HKLH 5GGTL 4LCWD 1DQJB 4PWKA 1F56A 1GYCA 2BOCA 2APWA 3LPWA 1NC2A 5I6MA 2QQLH 1HZKA 4G6ML 2C4FU 2OMZB 3K1DA 4KKRA 4MFHA 1ODAA 2EDWA 4UM9B 3M45A 3O3EB 5JXEC 3VH8B 2NNCA 1XDTT 4I4WB 1LGVA 1VACA 1N3NB 2J4WH 3NCFB 4NHCL 4J5VA 4AIOA 3NA9L 2Y2YA 1Z2KA 2I9TB 3X11B 4QTIL 3FU0A 4ZXBB 2C7UB 1NUNB 2VXVH 4JRWA 3SQBA 3WEXA 5J13B 1XFPA 5E6IC 2WNWA 2I9LB 4LBAA 3MRMB 4UMGA 5ECGA 3Q6FB 3RFRA 4D8PA 5JUEL 5MENE 2VDPB 1XR9B 4XP6H 5T1KA 4J12A 1QA9A 2XV0A 1PAZA 1UWXH 2NLJB 2DQJH 2YD3A 1A7NH 3EH2A 3P9MB 3VB9A 3VQLA 2NY2C 5IMLB 1ZGLB 4RCAA 1MLCA 4ZX5A 5B8CC 5C0BB 5IWLC 2Z7ZA 3JUYA 3NZHH 3BYTA 4R7VA 1CLYH 5IFHL 1U3HD 1CE1H 4AKOA 4MAYA 3W57A 1N64H 2V33A 4P2RD 2WCPA 5EIIA 1T7YA 2CMRH 4N2DA 3WXVL 3VI3E 3OR7B 2AAVA 4HULB 3CZLA 3MRHA 1BSIA 3G6AB 1QW8A 5I6LA 4LBEB 2BSTB 5DTFA 5DRWA 5TK4A 5A2FA 2FIKA 4PJ7E 1UCTA 3HE6D 1BIIA 1NAMH 1DHKA 1P7QA 3MLVH 1DUZA 4ABWA 1BDYA 2F53B 5DJ0B 2GABA 1TZGL 2V17L 4JG0L 4UT9A 1TETH 2IIJA 4GRLD 5E4IA 2F7QA 5IF0B 3NG5A 4HHAA 1UOKA 1DN0A 1X7QA 4XMKH 2IPUG 4E5XG 2RA1A 3CUPB 3KPLA 3QJZA 3QK0A 3LS4H 4I0PC 4RIRA 5FW8A 4B9IA 5DLML 4X6FA 5I1HH 3BQUA 2BMKB 1QLFB 3KDMB 4EAEA 4HZLA 1HXKA 1HSBA 1KIQB 4ZNEA 4LLDA 4K5NA 3U1SH 3J2PA 5A3ID 4GW5B 1A7RL 2Y36H 3TFKD 1EUUA 4TXVB 3V9FA 1J9RA 4HK3J 4BELD 2VLRA 3GJEA 2N0KA 1EBPA 3ILQC 3C5JB 4Y16A 1YSOA 4QRPA 5CM1A 3G5WA 1I1RA 3MV8E 4GQPH 4HSCX 4JQVA 4TN9A 1PG7L 2Q3AA 3L4WA 5EIQA 4OZIA 1N8ZA 5BS0B 2JJUA 5GZND 4GMSH 4OFKA 3UX9B 1FNEA 2FT8A 5IJKA 1OWWA 2BSRA 2V7HA 3HBPA 5HYJB 5LXGH 3NSCA 1KT2B 1MN4A 4MJJA 15C8H 2P1YA 2VLKD 4XMZA 2XTJB 3FUDA 3HAEG 3SPHA 3V0DA 5DK2B 1NCBL 4KI5D 5DD5L 1J5IA 1BFSA 4GKSA 5E2UL 4OIIH 4EF3A 1DBKH 4MB5A 2OTUA 1S5IH 2MSPA 5IW6B 3DXAB 3B9AA 1T0NA 2CK2A 2B7DT 4KVNL 3U0WH 1PQZB 3K4DA 1NGYA 2WVVB 1IM9A 3O6FA 4HF5L 3CFQA 1JF1B 5F97E 3B5TA 5LO7A 1BBDL 1C5BH 3DX6A 2QMJA 5F7NC 5FGCB 3H2WA 1K6QH 4G8GE 3MJ8B 1A6AB 3BUQA 5DURB 5D7IB 3SHSA 4G1MB 4XMLH 2OKMA 2OMXB 1RUMH 3CX2A 4UQDA 3SO5A 3R7RA 4MJIE 2GTZB 2M2DA 2WTPA 1IT9H 5L2JA 2JKRM 4UWQB 3EGSB 4OCWH 2ADFL 1AGEA 1M1SA 5JOFA 1FZOB 2ZP8A 3FMGH 2Q3XA 1R3HA 5D1XA 1N0XH 5CU5A 2EYRA 2DIEA 3ZDYE 5MERB 4XVUC 3AXLB 1LEIA 3VRIA 3QXVA 4XVSH 2H32B 1BQKA 2LR4A 3FT2B 3D4CA 5HHPA 4PTTB 1O5DT 2ZYSA 4GLRI 2DMGA 5F88A 1MWAH 4LHUG 2J6WA 1NDMB 4DN3H 6TAAA 1QX1A 4KHXL 4Y19A 1W0WB 3V4UL 4K8RL 3DUUB 2F18A 5F7DA 4M6NH 4QXUH 3OMAB 3N42F 1G7PB 3HBGA 2WZ5A 5D93B 4QHUA 4JM2F 2IPKA 1MLBA 5IHZA 3VSTA 3TZVA 2C3XA 3KXFD 2CKBA 1KJMB 5TQ0L 1KTLB 1GA2A 3SDAB 1P4UA 3ECBA 3TFBA 5FLVA 2JCCB 4PWGA 1AZBA 4HH8A 4UM8B 1IGIL 5C08A 1K2DB 4Z7OB 5HBBA 4GQQA 3ZOAA 3BESR 3CFIC 4LCWE 4BZ2A 3F7QA 5I66B 3I85A 3O2VH 5MP6H 3ZKQD 4MNGE 2JXMB 3H9ZA 5SWSA 4I9WD 2EE6A 2WZ0A 2ZG1A 5G5DA 3NFNB 3RVTC 2QSTA 5TF1H 2QKIA 4GBXA 1YHPA 3ENEA 4NUJA 5CUSL 4OZFH 3GMQB 4TMPA 4C4KT 5IW3A 4QOKE 4KRPD 1DQIA 2F7PA 3ZY7A 2ZJSH 5DA4A 3S88L 3H85A 4BDVB 3O2DH 1DEEA 5IBUG 3AUVA 1RHHB 1J8SA 1VENA 5AZEH 3KM2A 3L17A 2XXFA 1YPZA 4PRBA 4M4PA 1LK3H 3HG1A 3SDYL 3HG5A 2MWCA 3VFUA 5KYUB 2WLLA 2DN7A 1E4XI 4HUUA 2FJFB 4JPWH 2R7EA 2IC2A 3H9SE 3GMRA 1O7DC 4RRPG 2IWFA 3FHQA 3I9GH 3BH8B 3BGAA 4XMTA 1WWBX 3P73B 4UU9B 3GBNL 4UF7C 3RDTD 3D0AA 1T1WB 2DQGH 4YBLC 1KXHA 4TUOA 3CN0A 4IRSA 4J6IA 1BQHB 3WFBL 5B39G 5PAZA 1BIHA 1MVFA 2G4GA 1E7VA 2NT1A 3K71A 4PV1C 4Y2LA 4UAOB 2B16A 4DKFH 1WWWX 2HH0L 1IEAA 3IGUA 4H26B 1BVNT 2FT7A 4BCZA 2BVOA 4F2MA 5DJYA 5F70A 2P24A 4QYOA 1T5WA 2YZ1A 5EU5A 2BVEA 3WKML 2EICA 2WXHA 3EKCA 1JF5A 4UDUA 5CN1A 4XOEA 1HVXA 4N2CA 1TVHA 4ODVL 1BZEA 3MV9B 4N2MA 4X5PA 4NQVA 5TK2A 1RHFA 4LU5H 3GKWH 2Y7QA 4XMVA 4YHZL 1HSAB 4Q0XL 4KGJA 1I8LA 5GJSL 4HK0A 4HGWA 2KMWA 5E6IA 1T3FA 3KAAA 3VFWB 1OO2A 4FFWD 1D9KB 5EG6C 3TA4D 5F9AC 4POUB 1FYTD 4NQSB 2IMNA 1G4RA 1Q90A 2Y5TB 4I85A 4N9GB 1E4KC 1RH8A 4NKDB 4ZFOL 1N10A 2I27N 3ZDWA 2AJXH 4HQQH 4Z7QE 4G9FE 3G6DH 1I9IL 3HBQA 4N0CD 2VO5A 1DQQB 5HD8C 2VR7A 4NRYB 4LFHG 4XAWL 2Y4SA 4OZGE 1ANUA 3BUYB 3EUDA 5I82A 5EORL 4K9JA 4PJXA 1PSKH 3CK0H 2ADGB 2AERT 3UEQA 3UYRL 1DFBL 3CU7A 4YHMH 2G9KA 3MCKA 2AV1A 5D2LE 5EZOH 2H9GA 1DDHA 4HX1B 1PJ9A 1T1YB 3GBLA 4B9PA 1UUNA 4IJTA 2Z4QB 4IBUA 1MFEH 3O9WB 2WXIA 1MIML 4X8JB 1VA9A 3KPOA 2Y1AA 4XCEA 1JZHA 4YUEH 1FZKB 5K1JA 4L5FH 4YQXL 3OKOB 4G1EA 3HTLX 2IAMD 3DMMB 4KI5E 1KCRH 1NGWB 4L4TB 4FLHA 2UWEE 1AD9A 4LCUA 4U3HA 2X12A 4W9ZA 1B2WH 1OCCB 2D7PA 2P8MB 3F64A 4EUPB 1KENL 3GGWA 1J0ZA 4RMUA 4R5XA 5GRWA 4BK4A 2B1AL 3K6SA 2FQGA 2QLVB 4Q9BA 2CAKA 4Y8DC 4BBWA 1OAYL 1Y6NR 3X1GA 3NRFA 2YD4A 1KIPA 1FO0A 4G7VH 2WTRA 2PWGA 3KPQA 4L3EE 3P4NA 5DUJA 2LVCA 2FEEL 4P5TC 4K9EC 3W11D 4JHAH 4CA4A 1CGXA 3ARED 2DQIL 4PJIF 2VLMD 5A2AA 2VIRA 1TJHL 1TCMA 3FQNB 1UA7A 3UC0H 2R4SL 3PQYA 1TZHA 3DO4A 4GRWE 2UZIL 5K9OB 1BPLB 4OLUH 1NKOA 1QUNA 2R69L 3V4PH 4HUKB 1YYLH 3L1GA 3N55A 3G5YA 3V5HB 4M7LH 4KKLD 3AAZB 3N0AA 2CLVA 2WKGA 5K5YA 1JZ7A 1X4ZA 5EOQH 1CD9B 2BOBA 2CGYA 3WE6B 3ECUA 2BVQB 2CO6A 2F08A 3LRSA 3Q44A 2XN9A 5EF0A 3KPSB 5JW4N 4PVLA 3W82A 2W0FB 1XF2B 2EYSB 2JTYA 3BHBA 3UO8B 4Z9KB 1SHXA 5F3HA 1JMXA 1KB5A 4P8QA 1C08A 1RZKL 4Y2DA 4IBVA 1BX2A 2J5LB 4KAQH 1LEKA 3BAEL 3VFPA 3GK8L 4MX7A 2VJ0A 3IMBA 3DOSB 1U4FA 4K71C 1ZLDA 1FFNB 2R2CA 2X2JA 4J3XA 4JKNA 3ATFA 4F9LA 4KXAA 4KTDH 3BGFB 1UB6B 4FXGC 4NDMA 3FTUA 1BD2B 2AQ1A 5ACMA 1IZKA 1QFUL 1VKXA 2DYPB 3SKOA 3BP7B 4X98B 1L9PA 5FGBA 3RTQB 1ORSB 3QRLA 2PW1A </