1GW0A

Crystal structure of laccase from melanocarpus albomyces in four copper form
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
559
structure length
559
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LACCASE-1
publication title Crystal Structure of a Laccase from Melanocarpus Albomyces with an Intact Trinuclear Copper Site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 174
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gw0A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gw0A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gw0A03
3AW5A 1OE3A 3ZBMA 3FU8A 2HRHA 3FPXA 4A2DA 4DP5X 1WA0X 3NJJA 3SBPA 3GXUB 1PCSA 4PCYA 4A67A 2CJ3A 1V54B 2BW5A 1B3IA 2IWEA 1URIA 2ZOOA 3PLYA 4A2GA 1BQ5A 2CAKA 4A2EA 1FA4A 2WO2B 1AS6A 1MG3C 4E9WA 2H3XC 3MX0B 4RH4A 1CC3A 4BWTA 2UX7A 3IE9A 1NIDA 1ASOA 5AFAA 3S3BB 1SF5A 4BXSV 4GP4B 1ASQA 1IBYA 2YAEA 1NICA 1ILUA 1AZUA 2IDTA 2Y1AA 3OMIB 5I5MA 3ERXA 1RCYA 3NP4A 2JKWA 5D4JA 1CURA 3FSWA 3NSDA 1AQ8A 1ZDQA 1AZNA 3AG3B 3NJFA 5I5IA 1WA1X 4DP7X 3FYEB 4N4YB 3V9CA 2GHZA 2FT6A 4UF7C 3WKQA 1MZYA 2QDWA 3ABGA 1BEXA 3KW8A 1VLXA 2BP8A 1PMYA 4HHGA 5TK2A 1OCZB 4YSCA 3GYRA 1WS7A 4DP6X 3IEAA 5FC9A 1OCCB 1WS8A 1W6LA 2N0MA 1GS8A 2FJSA 3CZUB 1SHXA 4A2HA 3NJIA 4BDVA 4JKNA 1ILSA 2XYBA 1JZEA 3T6WA 1HAUA 2HXAA 2J55A 2UXVA 3AG2B 2XWZA 2VM4A 1KCBA 5I6NA 2TSBA 3T6XA 1ASPA 4HIPA 1L9QA 4TXVB 2H5UA 3WI9A 1RKRA 3IN0A 4DPBX 2A3TA 1ZPUA 3N2JA 3X2QB 4KOCA 3DIVA 4E9RA 4HALA 4K9JA 2QPDB 4KNTA 2XX0A 1BQRA 4P5RA 2VW7A 1DYZA 5B1JA 3IN2A 4P5SA 1A4BA 2BHFA 1NZRA 1A3ZA 3C75A 3NJLA 4HCIA 1E67A 4NB7A 2UX6A 4YVUA 2VSMB 3UABA 1A65A 4BDVB 2TSAA 3PAVA 5IY5B 1MG2C 3OM3B 4HAKA 4AKPA 2W8CA 1KBVA 1A4CA 4YSRA 2BWDA 5D4HA 1KBWA 1YLBB 4YSOA 1ETJA 1ET7A 4HCFA 1PZAA 1TEGA 2B08A 2UXTA 2CALA 1JZHA 3WNIA 1E5YA 3QPKA 2YAMA 4AKQA 4F2FA 1ID2A 5B3SB 2X88A 2VSKB 3FU7B 1BXAA 2GI0A 1AS8A 4WKXA 4EF3A 3BVDB 1SNRA 2J56A 1JERA 1JXGA 4BK5C 9PCYA 3IBOA 4W1TA 4ZK8A 2QPEB 3WNJA 4GY4A 2PCFA 1HFUA 5LDUA 1AG0A 1L9SA 2IAAC 3DKHA 5I26A 1V55B 3WIAA 3QJVB 1XB8A 3OQRA 4GP8B 4FA7B 3SBQA 6PAZA 6PCYA 5I28A 3EF4A 2GBAA 2BO0A 2I7SA 2XXFA 1JXFA 2IDFA 3FT0A 1GS7A 3NSCA 2PCYA 1AZCA 5F7AA 2AVFA 7PAZA 1J5DA 2VW6A 2DV6A 4KO9A 3H4HA 2DWSA 1PLBA 5D4IA 1AR1B 4YSTA 4BWUA 1TKWA 4E9VA 1F56A 2E86A 2I7OA 2VMJA 3FYIB 4DP0X 3TBCA 3JTBA 4AI7A 5TK4A 2IDQA 4G7RB 3HB3B 5I6OA 5F7BA 3QJSB 2VM3A 1MZZA 3EH5B 2B3IA 3ABMB 1E30A 1SJMA 2MTAA 2PPFA 1QLEB 3X1GA 1RZQA 1L9OA 2BW4A 3NSYA 3QJUB 4JHUA 3X1NA 2H47C 1M56B 1SF3A 3ZDWA 2JXMA 3EH4B 2PP7A 3SBRA 1BQKA 1GY2A 2ZONA 3TU6A 1BYOA 1IUZA 3S3CB 3GDCA 5B1AB 2RACA 3S8GB 1A4AA 4KOBA 1NWPA 5I6LA 4KO7A 3T71A 2FNWA 1OV8A 3NT0A 4YSEA 4QLWA 1AOZA 3NSFA 2EIMB 1JVLA 4E9QA 2AZAA 1JZIA 2ZXWB 1PLCA 3NJGA 3QJRB 3KW7A 4GP5B 1IC0A 4KNSA 4DP8X 1WA2X 1AANA 1PY0A 1PZCA 1PF3A 2CCWA 3ASNB 2YARA 3FSZA 3QJTB 5E9NA 2YAFA 1J9SA 3CVDA 4E9SA 1PZBA 3FU7A 1J9TA 2FQDA 1J9QA 1GY1A 2NRDA 4KO6A 1GS6X 1BAWA 5I6MA 5B1BB 2DYSB 1GSKA 1OCRB 2IH8A 3FQ2A 5AKRA 5B7FA 2XXGA 5I5JA 5B7EA 3T6ZA 3FSAA 2QDVA 1CYWA 1SDDA 2HZHA 2EILB 1JXDA 4Q89A 2FWLB 1ADWA 1L9TA 2XVBA 1SFDA 1NPJA 4E9TA 1ZIBA 2YAOA 4HCGA 1DZ0A 1L9PA 4N8UA 4F7KA 2PPEA 3N55A 2GC7C 2BWIA 4FAAB 3JT2A 3UAAA 4DPAX 1NIAA 3FQYA 3OMNB 2DY2A 2GIMA 1PAZA 4GYBA 1NPNA 2UXGA 3DTUB 4DPCX 3OD3A 4AX3A 4A66A 4G72B 2IDUA 4YSQA 2PPAA 2OJ1A 1OCOB 3EHBB 2BZ7A 1PLAA 4UANA 1T5KA 3X1FA 4YVNA 2XV3A 2X87A 1W8EA 1BXUA 1PNCA 2OV0A 4YSSA 3NJHA 2IWFA 4KNUA 4M4RB 5B7MA 1X9UA 4ENZA 1OOWA 1SDDB 2JFCA 1E65A 3WKPA 1OE1A 5B1JC 5I6PA 1J9RA 2YAPA 2FTAA 3T9WA 1L9RA 3BQVA 4GXFA 1NDTA 1E5ZA 2R7EB 3H56A 1WAEA 4L0PB 1KCWA 2Q5BA 3UADA 1V10A 4MFHA 1ZDSA 2Y69B 3QQXA 2HX8A 4W9ZA 4CSZA 1KGYE 2PLTA 1CYXA 4PAZA 1SHWA 1M57B 5AZUA 3X1EA 2WO3B 3UAEA 2FQEA 2YXWA 1OE2A 3ABKB 1ZIAA 1GR7A 1QHQA 5B1KA 3RYMA 1ZV2A 1XMEB 4YSPA 2BP0B 3CG8A 1FFTB 5PCYA 4BXVA 2WSDA 1GYCA 3T6VA 3CDZA 3OMAB 4A2FA 3AY2A 1ET8A 1M9WA 4G7QB 1JVOA 2FQGA 1IKOP 2HX7A 4NAJA 2CUAA 2XU9A 3QJQB 3PCYA 1NIEA 1RZPA 2VN3A 3HEIB 3NJMA 2QT6A 2AANA 2EIJB 2DWTA 3ABLB 4QKTA 8PAZA 2YQBA 1FWXA 3S3DB 1JZFA 2BZCA 3CVCA 4M3HA 4HHWA 1TEFA 1A8ZA 2VW4A 1MDAA 3S8FB 4A68A 2UXFA 2XV2A 1NINA 4G71B 1XB6A 4Q8BA 2HX9A 1BXVA 1NIBA 1AACA 1AS7A 3TA4D 1EHKB 2HRGA 2FT7A 2DYRB 4YSAA 1AZRA 2OCCB 3FU9A 1I53A 2W88A 2EIKB 4X4KA 2YXVA 3X1BA 2CBPA 3V9EA 1KV7A 2AZUA 4NERA 2PP9A 2IDSA 1AAJA 1NTDA 3EH3B 3ZIYA 3G5WA 3CDZB 1KYAA 4UAHA 3NJNA 1SFHA 2GC4C 3H4FA 2I85A 3WG7B 5A7EA 1EZLA 1W6WA 2HLEB 3FPYA 5I6KA 2IWKA 2Q9OA 3NP3A 3PXLA 1GW0A 4AZUA 1JZGA 5PAZA 3AZUA 3TBBA 1N68A 3CVBA 4DP1X 1R1CA 1KDJA 4YL4A 3NJKA 2XX1A 1ET5A 3UACA 4DP9X 2R7EA 4KO5A 4F2EA 2FT8A 1AG6A 3FS9A 7PCYA 2P80A 3MBWB 4G70B 2P80D 4JHVA 2EINB 1TU2A 2IH9A 3FSVA 3PAZA 3PAUA 1CUOA 4G7SB 1UATA 1X9RA 4DP4X 2XV0A 2BP8B 3ASOB 3AG1B 1XB3A 1OF0A 2GB2A 1AIZA 2ZWNA 1QNIA 1KDIA 2J57A 4E9XA 4YSUA 2LLNA 2XUWA 2PP8A 4AKOA 2BP0A 3NYKA 1NWOA 3FQ1A 1PNDA 4DP2X 3ZX1A 1IBZA 2YAQA 1AZBA 3PPSA 2AFNA 1JOIA 3UGEA 4CSPA 3D12B 4WTQA 4HZ1A 3U25A 1N70A 1NIFA 2FQFA 1J5CA 2PPCA 3AG4B 2GSMB 4BWWA 3TASA 4E9YA 3SQRA 2PPDA 2MRYA 1BYPA 2J5WA 1HAWA 2YAHA 4YSDA 5ANHA 2XLLA 1JZJA 3L45A 5EHFA
chains in the Genus database with same CATH superfamily
1O5PA 3S9DB 3ZBMA 4N0FA 2PTTB 3E9UA 2YC1B 5F88A 3S97C 1LE5A 4FG6C 4H0GA 4ZAKD 5LNGA 2GFBB 1RUAH 3HZMA 1IILE 3VQ1C 4PRBB 2VNCA 5LXGH 2EDEA 1CVSC 1A4JB 1URIA 4O51A 5FGSA 4M7KH 1N18A 2VO8A 4PY8J 4E9WA 2VLLB 4KNQA 4RH4A 1BZ9B 4N3TA 3VXMA 2Z8SA 3IE9A 5J4MA 2YSSB 1NL0H 4WENB 2I5YL 3ZE2F 5I73B 4MAUL 3A6OA 1DSWA 4S0HA 1KPRB 3O6LH 1AQHA 4IBZA 4Y4FA 4Z78B 1Z9NA 4L4JA 4P23A 4I87A 4M00A 4O2FB 4WHDA 2H45A 5AG8A 3BFOA 4KFZC 3CXFA 1RIHL 4UQDA 2ATKB 4ZD3L 1HWHB 5TDOB 4FA6A 4PHZA 4FHKA 1XSIA 3DBXA 3TWYA 3FO9A 2Y07H 4LSUH 2Q7NA 2UWEB 4DAGH 3MBED 5DJ0A 2VE6A 3HJ0A 2QV2A 1KLGA 2Y5TA 2YMOA 3NABL 1CQKA 3QXWA 4N2AA 3VRLF 1OEZW 1G7JA 4G6JH 5FAAA 5TQ2H 3O8XC 4AIOA 1MWOA 3ARBC 5DJ6B 3S88L 3TX4A 5TK2A 1D2OA 4W9JC 1OTUC 3GYRA 3LN4B 2Z4TA 2A83B 4HK0B 4LQFL 5I18L 1N4XL 3NSJA 1LO3H 1W6LA 3RURA 3QZMA 1WF5A 1E9PA 5D1QC 5D93B 1Z5LB 3MUUA 5DK3A 4ZPVA 1A1NB 3BPOB 4M5SA 5IB5B 3UBXG 3VFOB 4PV9A 1LL1A 1W0WB 1WTLA 3T6WA 3VGAB 4L3EE 4Q6IB 4LDOB 3CE1A 3MCG1 4HT1H 4KXZH 1IVLA 1TZHA 1PSKH 2E5EA 2EYSB 3P73A 3BZ4A 5HYSA 2XVLA 4ZUUA 3KL0A 3ARPA 3MNDA 1FVDB 4WHTB 2QVIA 5C0AB 2H0JA 4U1NB 4TF4A 5L0QC 1UGKA 4GFTB 2FATH 4LE8A 4EI0A 4LHJB 2ZUSA 2ZXQA 4NHUB 2BVEA 4RX4A 2NXZB 5L6YL 4YLBA 1RU9L 2ZX7A 2HWZL 4PLKD 1BZQK 1C8QA 1IEAB 1XL4A 4G1MA 4W4NA 3LPPA 4ZS6C 3HFFA 3SPJA 1DYZA 5M7QA 2FIRT 2CLVB 4ZYKA 2AMGA 5KSBB 1ZTXH 1E67A 4YAQA 5LJYH 2UX6A 4FJYA 4BSVB 5KANG 3ZE2E 3LNIA 3Q2CA 4LFHD 1LP9A 2VSMB 3RVVD 1YQVL 4MZRA 4XC3L 4B50A 1BOGA 3MJ9H 5D7KE 2IANE 4WWNA 2IDCA 2BOCA 1ZLUH 4QRBA 1M42A 2RGSA 1BAGA 4P4RA 4AIZA 3Q05A 2WXIA 1FL6B 3PV6A 4NC1C 1FNGB 3GD1C 4IJ3B 4M1CC 1M6UA 1TO4A 4W9IC 1TEGA 4LPYA 1KN2L 3KLAB 3V4UL 1E5YA 1AXSA 2A9DA 3HC4L 4HH9A 1WUZA 5D1XB 4MKMA 2X1XR 1ID2A 4F2FA 1C1EH 2DJSA 3U0WH 1ZHNB 2VSKB 1MFBH 2Y1ZA 3L48A 3LKOB 4NKIL 4LDEB 3BVDB 3RNQB 1NC4A 1JERA 4RA0C 4TSBH 3VRLE 4XC1H 2JI3A 2KBGA 4OGAC 3M6DA 3OLDA 1TSRA 3LZFH 3QQDA 1XZ0B 1NMBL 3BAJA 3RRQA 4CN4A 2YXFA 3RX7A 4PJEB 3HUJB 4V1DA 3IVKA 4XMKH 4J6IA 3QNZA 4MD0A 2J43A 2R29L 3HI5L 1JZ2A 1XGTA 3MRQB 1G6RL 3RTQD 3EFOB 2J6WA 3NTCL 4TKWA 2F18A 2X4NA 4NOBA 2BVQA 4DT2A 4JE0A 1PJ9A 4G6FD 2ZWYA 4H8HA 1C5DB 2L4OA 3BD4A 5D70L 4QAWA 1S7QA 2X89A 4KXDA 4X7EC 4RMUA 2OMXB 1Y6MR 1BVLB 5EOCJ 2PYEE 1Q1JL 5BOPA 5HJBA 3NZ8B 4E5XA 5IHHA 2ICEC 3FCSB 1NC2B 5F72S 3QUMB 5ALCH 1DVYA 1HI6B 1HNFA 4Q6YA 5C0BA 3S98A 1S7XA 3QDJD 3CFEA 2XBDA 4U6HA 4P4KD 2BM3A 1PYWB 3CQFA 4L5FE 2KZ1B 3JTTA 4U6XB 1YCSA 1DBML 4NM8H 3TBYA 1VGKB 5HY9B 4LB8A 1KBGH 4WHYH 1HIMH 4MMZA 2D0GA 3P0VH 3MRHA 2Z0BA 1FZOB 2ZG2A 1EO8L 4RAVB 3LN5B 3NA9L 1ZAGA 3S3CB 1EGJA 2JKNA 1HQRA 2K45A 1TTFA 2ZPKH 1A4AA 4S1DD 1LD9A 1LO0L 5DVNA 4P3CL 3BUBA 1JNLH 1U91A 3MGOB 3CFIC 1PX8A 1VRSA 3TXAA 3D50A 3P77B 2GK0B 1TCRA 2X6VA 3FH7A 4J3SA 5FW8A 3WE1A 4N2BA 4NRZA 4MWFA 1U6AH 4PRIA 1CFQA 2XIDA 3EUDA 3GLDA 2BPBA 3MRFB 2BZDA 3BYTA 2PWEA 3WXWL 5GRVL 4A38A 3BGMB 2JSFA 4CN6A 4XVSH 4RIRA 3EJSA 3WE6B 4ZO7A 1YEHH 3ZO0A 2AJZB 5DMIL 2W65B 5I1EH 1RZJL 2QPSA 1BF8A 2A2QT 3HG1A 4QRQB 3FU6A 1KLUA 1ES0A 2ADFL 4Z7OF 1NGQL 2K7PA 4R5VA 1JUFB 2SEBA 3TONA 1S7TB 4J3VA 2DB8A 2Z64C 3ARDD 2PPEA 3LTVA 4JQIA 3ULVH 4DPAX 4Y7MA 4JFFD 5J6HA 2CLZB 4IRZA 5EZLB 2DWDA 2QSQA 5DGRA 2AGJL 4NLHA 2DQDL 1SMAA 4AYEC 4HLJA 2UZIL 5CO1A 2VERA 3FU3A 1JJUA 1FLRH 4PD4K 4OCLC 4EOWH 5A43C 4GUOA 1ZGLA 4Y4HA 4XOEA 3SPGA 2R27A 1MHPL 3X1FA 1Q9WB 1DQML 2VDQB 3ES6A 2DMCA 3SCMC 3VG9B 3X3GH 2VSDA 1KIUA 5KOVC 4ENED 3TEZA 4PG2A 5T5FH 3CFDB 3RVTC 3ZE2B 4GRWH 4IIQA 3HE7D 2H9GA 4FQXA 5IOPB 1X9LA 1SDDB 3QO1A 3EH1A 4WO4D 2IO5A 1G7HA 2IANB 2VJ0A 4G8GD 4UM8A 4F3FA 3G04B 1BD2D 1KCRL 4DH2A 2FTAA 3MCKA 2VDLH 3CDFA 3MNZB 5JA8B 1L9RA 1I4FA 3A21A 1T83C 4JM0A 5IEKA 5DS2A 1NDTA 1FO0A 3L3OC 3L9BA 1H8OA 1SHSA 3ZR6A 3MN8A 1RK0A 3IJHA 1R75A 2HX8A 3N85L 4U3XA 2BMKA 3ETTA 1ZT1A 1J5OL 2HKHL 2MNJB 2XWBA 5C08A 2B15A 3X3FL 4PIRF 5ABZA 2EC9U 4JR9H 5E6UB 5FK9B 3UCRA 1MNUL 1T2XA 3MRGB 2C9RA 5EU4A 3FRUA 3K6SB 3WLWC 2CKBH 3LRLA 1CD1A 4Y19D 3HS0A 1ZLSL 3VFWB 2XWDA 5I1DA 1ACCA 4CDGC 2BSSA 4NUGH 3VI3A 1FFQA 1MFNA 3CX2A 2YO3A 1I9IH 3TOPA 5AOMA 4BFKA 2FQGA 4F92B 4K5MA 4Z7OE 4U0QB 4GIAA 4NWTH 1WFIA 2X41A 3KYMB 3R06A 4NQEA 5E0FA 3ME0A 1Q0XL 4Z18A 4FQLL 3HEIB 4PS8A 5GS1A 1HHIB 1EJFA 5ICYA 3V95A 1FWXA 3BP6A 3B2UD 1D5RA 1BZ7B 1MW3A 1A8ZA 3S8FB 5AAMA 4P2YA 3IMTA 5CJXC 2PYEB 5I8CA 4LRNH 5AZEH 2C9PA 1BZ8A 4FYSA 1CVRA 3GUTB 3L3JA 3STLB 3QNXA 5C0IB 3OKLB 4YSAA 4WGKA 4N0CC 3BH8A 4NUQA 2OCCB 1J7VR 1P9MA 3S6CA 3UC2A 4N8PA 2WNGA 2GI7A 3QQ9C 4QYOB 1D5ZB 4AJWA 4HH8A 4JJ5B 5HYQB 2AZUA 2FBJL 3GHBH 4HUVB 4MVBC 5E70A 2CNZA 4MDJA 1J1XH 1QTPA 3DX9B 4HUMB 4Z77B 2EXYD 4OUUA 3VACA 3H9SD 3ZL1A 3CN0A 1Z9OA 2PXYA 1U93B 2M1KA 2WLIA 1PQZB 4LF3B 4F7MB 4D0CB 4FKHA 1E3FA 1S7SA 4XNZB 1LNUA 4AV0A 2D7TL 3MRLB 3NH7L 4UTBA 3HRZC 1SBBA 2Y22A 5G4NA 2YLKA 3QRLA 1SZNA 3AXLB 3LX9A 4GRLD 3VGGA 1S8DB 2OK0H 3AY4A 4IEFB 3I02A 3VRIB 2MHAA 4JHAL 5K9OA 2G0LA 4OLXH 4P06A 3SGDI 4Z0BL 4XOCA 5DR5L 3MBEB 2OR9H 5LGYA 2FJFB 4P57B 2P80D 4OF0A 2E27L 3KJ6L 1DQDH 1H6UA 4ZOBA 3BSHA 5D7JC 3P9LB 3AACA 5KBKA 2BP8B 1RSYA 4GI8A 5IROC 5EEXA 1H3GA 5GGTH 4I1RA 4FQHA 1W72A 2XTJC 4PGBA 3AABA 4APQD 4E9XA 2R56L 1BJ8A 4KK5D 5I8KL 1SJHB 6CGTA 4EVNA 4XN1A 4IRJC 4UAOC 4KJWC 1QFWM 3DX4A 1LEKB 5IBTL 3V52L 2YAQA 5F97E 1SLXA 2VISB 5K9QG 2W59A 3N06B 4LSPH 3REWB 3JWDC 4N1EA 4FKKA 1C5CL 4E68A 2ZYRA 2I25N 5TDPB 3J27A 1C08A 4WV1B 4OLYH 1P4BL 4L4TA 1DHKA 1ZOXA 2BINA 1OO2A 3R8QA 3F7QA 1BYPA 5GJSL 2JJUA 4QJ4B 1QHOA 5DVOA 4LCUB 5ANHA 1U8PB 3K4AA 4HJJL 1T1XB 1RERA 4ES8A 1QZ1A 1MCNA 3HNVL 3ENEA 4AEHH 3KHOA 3WIHH 5IW1B 3B4NA 4JY6A 4FMKA 3EJTA 1RZKC 3IWVA 1B3IA 5EO1A 4L4VD 1OAKL 1KCUL 2XNAA 3K8KA 2XQYK 3VXUA 3QQ3A 2GSGA 2J1KA 4RRPA 3MLRH 3S5LB 4MA3A 4BSJA 1NCBL 5TF1H 1DCLA 5F0MB 2ITDB 4WHCA 1BZDA 4AH2A 1RUMH 1WG3A 2ZUQC 1ZHLB 1Y07A 1MJ7H 1MIML 1DN0A 3FXIC 3U1PA 1LQBC 4J3UA 4KKCC 4PMFA 5FYJH 4GUCA 5AW2B 4EI5C 1DJSA 3BKJL 4YHLL 2CPCA 1WHPA 4KKBD 5IJDC 4F5CA 1ZDQA 2JI2A 3EOTH 1BBDH 4QNPF 4N26A 2Q10A 4WFFE 3KPRD 2CDGB 2F58L 4AUUA 2H8PB 4AYDC 3DHUA 5IB4B 2DQGL 1FNSH 3QS3A 3JTSB 1IGTA 5CLZA 3P4MB 3HG2A 4NJAL 3V5HA 3TEWA 4YBLB 4N0FB 4GH7B 5F88B 1RJCA 2D73A 4AYFA 1LE5B 1BEXA 4TQEL 3UJIH 2ZKHL 3KGUA 5DUML 2CM5A 4QHUA 4WK0B 3V55A 4D94A 5B38A 1XSKA 2FHBA 5FYKD 4HKZA 1Q9LB 3CIQA 5FYLD 1UXWA 2GJPA 1CDIA 2WBJD 4B95C 3IJ9A 4Z7OB 2H1XA 1EUTA 1SHXA 2EDNA 3NJIA 4YBQC 4NO3A 3FZUD 1RULH 3HFMH 3GJEA 2ORBH 3STBA 2F53A 5LN4A 4ANWA 1NJ9A 5AVYB 3X12A 3CMOL 5T3XL 1GTFA 3CN3A 1R3HA 4BFIA 5JMOC 3NIGF 4P23B 3D3VD 4G7YH 3S5ZA 5SWZD 3NRFA 1A9VA 3QDMA 4PGEB 1TJIH 3MJ7A 4B9JA 1XCXA 4GSDL 1YNKH 3DBXB 3BFQG 4RMVA 1FE8H 1CD8A 3OR7A 4B9ZA 4ZO6A 4PN6A 4YXKH 2EE0A 2J6EA 5JQHC 4PRIE 1JF1A 3TBTB 5T33L 4K9JA 3RZCC 3I2CL 5BXFB 2FGZA 4DK6A 1BQRA 1GIGL 1L7IL 4N0RA 2QSVA 1TTCA 4XZ4A 5I71C 4PS4H 4XCCL 1CLOH 1XCTA 3H9SE 1A3ZA 4Y9BA 4QHNA 3VI3F 1HVXA 3DO3A 4CNIA 3B7SA 3DV4B 3S5YA 3V6ZA 5F89B 1VAHA 3DX6A 3P3TA 1E9PB 5DD6B 1QR4A 4AGNA 4ILDA 4ZPVB 2I9LA 2GVYA 5K1JA 1TQVA 3NFSH 3OM3B 4MCMA 3DC0A 1H8SA 4U2YA 4Z8FH 1BFOB 1F4HA 2CXKA 4Q6KA 1A3LL 3PGDA 3QFGA 1YLBB 2BIIA 1CR9H 4LHUA 3Q5YA 5JORA 4ZSOA 4QNPE 5BUAA 2Q1EA 1HSBB 1HKLL 2HT3C 3AROA 2APBA 2NY0C 1XR9B 3BIAX 2YMXH 1FL5A 1R47A 35C8L 3B8YA 5TQ0H 1U2HA 2Y2TA 3EYUL 5A6LA 5B3SB 4KGJA 3KEDA 1BFSA 1I8AA 2J1ZA 2ZD0A 2H7WA 5A16A 3RVUD 1NLDH 4HXAL 1P4LA 2WVTA 3V5KA 1ZLDA 4ZTPH 1DE4B 2IFFL 4U1KA 3I9PA 4N9GA 1X4ZA 1BWMA 2QR0B 1NCHA 2OL3A 5EA0L 4ZYKB 4EN2A 5JZ7C 5C0GA 1IFRA 5I1CL 1ULVA 4XN8A 2XXFA 3ARDB 4IW4C 1NFAA 4JANA 3DVIA 3BP5B 4M1GH 2P9RA 1CBJA 2K0RA 4JREC 4KK9D 4XHQA 1BOGB 3RX5A 2BIQA 2F9BT 4YWGH 3WELA 4M8VA 3TFKC 4DN4L 2DV6A 2BOCB 4FRWA 3X17A 1SBSL 1XIWA 3SYOA 5IUCA 2AXJA 5D4IA 5AW0B 4AIZB 2DQCL 4P4RB 1V7ML 3NIGE 1FHGA 3VTMA 2C34A 4QRRA 4LBEA 4DP0X 3RGVC 4XAKE 4YDLB 1QP1A 1OGSA 4HH9B 3BKCH 5J6GA 1BSIA 2N7SA 4FYTA 4NO0A 4L4VE 1XSOA 4PSPA 4YEFA 2EJ1A 5LNDA 4GKSA 3FDWA 5BOZG 2WCSA 1E8YA 2ZUWA 1G7PB 5GZOD 4MA7H 1S7RA 3FONB 3LN9A 2Q86A 3PNWA 4ZTEA 3QQDB 3DDFA 6TAAA 4WO4B 3VI3E 4QO1B 3SBRA 1BQKA 4HGMA 3TA3A 3MRJA 4N68A 1F41A 1BD2B 4NZRL 4LMQI 5GRVK 3QNZB 4MD0B 2VUKA 1TQSA 1CXKA 1IC7H 1XGTB 4WY7H 1INDH 5KSAA 2WP3O 3EGSA 4PW3A 2X4NB 3KPRE 3U46A 1I9RH 2A9CA 4JPSA 4QLWA 3U2SB 4N1CA 5AYUL 1WSST 1S7QB 3BP7A 4HS3B 1JZIA 1WIOA 1SMDA 2NUTB 3EO1A 3IRCA 5F7EH 5ILTL 1VDGA 5IW6B 3LXCA 1RZ8B 4K94L 4NHCH 2P8PA 1PW3A 4AGLA 4DCQB 5HDLA 1CDJA 3FSZA 1NCOA 4IKIA 5D5MF 3ZT7A 4NDMB 3SEPA 5H4ZA 4U6HB 4O00A 4H8UA 1DQLL 2MCPH 3UG4A 5I19L 3JTTB 5AENA 15C8L 5EMYA 3QUGA 2WZ5A 3FT3B 4P05A 4BV1A 2EEAA 4MMZB 4JZJA 5IFJB 4NLAA 4XAWL 1ZPLA 1Y6NR 1ADQL 3ZE1F 4FG2A 4UWQB 5CJ8A 4DKAA 1XBRA 2YAOA 4BZ2L 4YO0B 1BMGA 3F7VB 1PBYA 1DZ0A 5IMLA 4WI4A 4WI2A 4BKLB 4IYKA 2VN5A 2YEQA 1JPST 1SXCA 5I0VA 1FIGH 2NX5A 3E2HB 4OH2A 4PGDB 1T0NA 3TYGH 1U91B 3BIKB 3FQYA 3FUJA 3QIUC 4HPOL 3CBKB 4XRCA 1TCRB 2ADJA 1GJUA 1PZDA 2YFOA 5GJTH 3MLUL 1IC1A 3D51A 4NRZB 4AX3A 5FKPA 3BDBA 2DBLH 3EGXB 2ICWJ 2O6EA 1IFGA 2OMBA 1DVFD 2VDKH 4PRIB 5IQ9A 5HGBA 3B9KA 5FHAL 1RURH 2VMCA 4ELMA 1EZSA 4ODXB 4OM1H 3O11A 5LG1A 5K69A 5CFHA 3MRNA 2YRZA 5IFHL 4RIRB 1T66D 4EKXA 5IB3B 3H9SB 1TQTA 2LOEA 4HXBH 4PW9A 3MGAA 3V4PL 4IM8A 1UFGA 1I9EA 1JGLH 2R23A 3CFTA 3M1BA 4KJQD 5FUCC 5F3FA 4B6ZA 1KLUB 1YEFL 4A7GF 1E65A 2A4ZA 2B2XL 4GRLB 1AXTL 1KXTB 1NQBA 2X4UB 2NY1C 3F7RA 3IU3A 5ICZA 5MP6L 3GBNH 4X2UA 2VLJD 2ALAA 4JHWL 3TBSB 3GMQA 1KCWA 2ZP0T 1MEXL 3ZT6A 1WC7A 3UYOD 3QDHA 3ZTDC 4IOFD 2OJZL 4LXFA 5J6HB 4O4YL 2BNUB 4QRPD 5JIQA 2DWDB 3EOBB 1J8HD 4XWOC 5IV2B 3BQUC 3UAEA 1SDYA 5HHNA 5DEJA 1ZT4A 2V9RA 3ZO9A 1CLYL 4S11A 5DMGC 4R8WL 5G4MA 3FFOA 5D5ME 1FFTB 2X05A 4OLUL 1TT6A 1MI5A 5DD3L 3MKKA 1LE9A 3VG0L 3PE9A 4LSQL 1E4KA 3VXUE 3ES6B 1GKOA 4L8BA 1ZWIA 2WZAA 4ACPA 2VDNB 4BFRA 4RGOH 4IIQB 3VB8A 1FAKT 2H9GB 4AXWB 4JVUA 3VD5A 1KB5A 1M7IA 3ZE1E 4KZDL 1PY4A 3BT2H 1G7HB 3LKNA 1D7BA 1BWWA 1XCQA 4NJ9L 4UM8B 5FF6A 3S3DB 5JW3H 5KBDA 5HHVH 2X2YA 2JVUA 3NIGB 4PWFA 1CPUA 2OMTB 1I4FB 1KIRB 2JK5B 4ZMYA 1OGAA 4U1LA 4FFZH 1IZKA 3IS1X 4F5CE 2UY7A 4NP4L 3AQDA 1X6LA 4JJHA 3CZKA 1H3UA 1RK0B 3O9WC 3VJ6B 1BXVA 2BMKB 3C6SB 4FZEL 3WSQL 1TFPA 1E0OB 1ZT1B 2UZPA 3E1F1 2DYRB 3VDCA 2CO4A 4L4VB 2R0WL 5DS1A 2RFXA 3M1CA 5EU4B 3I9GL 5HHOA 1G0XA 3V9EA 3FRUB 5F0JB 5IHBA 1KPUB 1EEUA 5HYFA 2ZTBA 4LLYB 2FD6H 3K1KC 3FF8A 3HC0B 1S7UA 2BSSB 1UT9A 4YDKL 3VI3B 2CMRL 1R33A 4ZUVA 3BVVA 2FZ3A 3MNWA 1P7KA 1XMWA 5I6KA 5IB2B 1ED3A 4F20A 1QSEA 5GS1B 3KPRB 3TBBA 4F9PA 2F53E 5T1DL 4I5BB 3VSTA 1RZ7H 4MMXC 4TRPH 2QKIA 4XBGB 1UYWH 4KMTH 5KVDH 2LFEA 3C8HA 4ZPTB 3DVFA 4G70B 4ODVL 3VXQA 2F7PA 1JFQL 3DPDA 3HAEB 4UV4H 3L3HA 3AGWA 3BH4A 1LHZA 4AQEA 5JPNC 2JQAA 4D7PA 3L3JB 2FCBA 3QNXB 4ELKB 3ULUL 5D1ZD 3BH8B 1WCBB 3OXRB 2ZWNA 3EUUA 3QCVL 2WVSA 3H2QA 1VCBC 2WBJB 1VENA 2IGFL 4K3DH 1TTGA 4JFOA 5DC0A 3VGFA 3ZUNC 2EVJA 1VB9A 3CLEH 4MDJB 1TTBA 3L1OH 4RFEB 1ZV5A 4PIBA 4J8QA 1JOIA 3A4DA 5SV4A 3HKZA 5H35B 3FQWB 4CVZA 1IEBA 3C8DA 4KX8A 2PXYB 2O5YL 1N8OE 2KHAA 2WIIA 1T0MB 4P46A 4H8WL 1NCNA 3BKMH 4JCWA 4BKSC 1Z9LA 2YA1A 3VFGL 1UH4A 1FCGA 1YY9D 4HYTB 2JB6A 3RWGB 3HPJA 1HAWA 1UURA 3DNKA 1OP5K 3I02B 4JBSA 4MQSB 1DLHA 3N04A 4NYLB 1T1WA 3CVHA 4BHUI 3UTPD 2Z9TA 3FPXA 5ES4B 2Y9RT 4JG0L 4ADJA 1PZ2A 2G60H 4PWIA 4FDWA 4GPVA 4PJ9D 2C3VB 4A2GA 5I74C 4A2EA 3BRDA 4PGBB 3HZKB 3MNMA 1SYVB 1TR7A 3P4NA 3SGJA 1YECL 2VR3A 2XWXA 1IT9H 4EVNB 4PRPD 1QLRB 4J23A 4JG9A 2OZNA 3DPBB 1M7UA 1UM4H 5CIPB 3OAUL 2CIIA 3OLEA 3BPCA 2VDPB 5GGTA 2HTLD 2OXHA 3O0RH 1EHLL 1G7IA 5AVWB 5KSVA 4FNSA 1B2WH 3APDA 3D85A 4RFOH 1F8TL 5ISZA 1M2VA 2V17H 4QIRA 4MA8L 4R96B 5GHWH 4BIKA 3JV0A 1FG2B 2A4CA 2WWNA 4IDJL 3O6FD 4QRRE 1ZTXE 4WIQA 3V9CA 2XQBH 3DGDA 4IMKA 1AKJA 3JV5A 3WTWA 1NFKA 1FP5A 2KC0A 3GIVB 4UF7C 2DM2A 5C0JA 3ZTCC 3FO2A 1KBKA 4JY6B 5L7XH 5D5MB 3O3AA 2FK9A 4KKAD 4ELMF 3NCFB 4DKTA 1OY3B 3BDYH 3VXUB 3QQ3B 1SXZA 4LARH 3CFUA 4UUJB 4JZOA 1Z5YD 4UNUA 3H9YA 2ZX9A 4MRCA 1E28A 1HL5A 3KLHC 1WFJA 2LABA 4GO6B 4PB9L 4XGZA 1DFBH 4ZQKA 4J7RA 3ZE1B 2KLSA 5HVHC 2YR3A 1JZEA 4OCRL 2XETA 4FJ6A 2X4TA 2P43B 3P40A 3ZYZA 3SGDH 2W0LA 2WN3A 2HG5A 1R0AL 4WCYL 3IF1A 1DANT 1W0YT 3L95B 5F7KC 4LPUA 2H32H 2L7JA 1EX0A 1A9EB 2MFNA 3DJTA 3S5LG 5CAYB 4P9ML 1IGTB 1A6VL 5CD3B 4LFHG 4NFBA 2XA8L 3LRSA 4Y5XB 1C7SA 1MLCB 5CILH 1JG9A 4AYFB 1T20A 2QGBA 4EZKA 5JXAL 1N10A 2XX0A 2I5YH 1IC5L 3BPNB 4MAUH 1G5AA 2E76C 3FCGA 4MJJA 3ULVF 2RBLA 3IN2A 4HKZB 1FBIL 3EJUA 2WP3T 1UXWB 3C75A 1KC5L 3PAYA 2OXGA 2DOCA 3WU1A 4MZIA 2J2ZB 1T89C 3Q8BA 4MCZA 3Q9QA 4NO3B 2P26A 1JD9A 1TVHB 3SDCC 3GJEB 2FJHA 1V3KA 2OMZA 2FO1A 1RIHH 1MG2C 4ZD3H 3QQ4A 1HZKA 4IIZA 3I9IA 1NEZB 2WLJA 3UAJA 1LVEA 5IJKA 2BWDA 3X12B 4K7FB 4AYBA 5J1AB 1IQDA 3FSOA 1YY8A 4C8XA 1ETJA 1S6NA 3ESVF 3DYPA 3QEHA 3NABH 2BS71 4WI7A 3RGHA 4TLUA 2YS4A 5IQOA 1A02N 3LD8B 4MD4A 3MLTB 3U9WA 4GRWF 3MJ7B 3K6DA 3S88H 2Y7QB 1WYJA 3QJOA 1P2CA 1J05B 2NY4D 5I18H 3TPUA 3NGBC 4JRFA 4LGSB 4WKXA 2BVPB 3V8OA 5FB8B 3NQKA 1NCWL 1T1YA 3FW6A 4YFEA 4KK6D 1NUDA 2AQ2A 3V0AC 1GCFA 2X4OA 3HMXL 3F12A 4JMNA 4B9IA 4HFWA 4ELME 4OGZA 4WU5B 1O7DC 2W80C 2WY3B 1R3LB 1V55B 2APTA 3QJVB 1AMYA 3OQRA 4QHNB 5MEOA 3RFZA 4JRYA 1JK9A 3EJJX 3DX6B 1XEDA 2GSIA 5ADOL 1GMEA 1M71B 1T04A 2AVFA 4XX1G 2YKLL 4NP9A 3OGCB 4NBXB 2A99A 1UT1A 3RDTC 3NSXA 3ZKNC 3WKML 3BEVB 1GGYA 4ZO8A 4LHUB 3KPLB 3P11L 3X14A 5L6YH 3UTPE 1RU9H 2HWZH 5DFAA 4FQCL 5HDBF 3DTXA 4N2EA 4UDTA 4NBZB 5F71A 4G7RB 4F2MA 4XX5A 5HXMA 2OM5A 1FH2A 1FL5B 1MZZA 2OMVA 5JO5B 4O02L 4A6YL 4PEEA 4RFNC 5E4EC 2WOBA 1H5BC 4H1LG 4KFMA 4AQZA 3P2TA 5IR1A 4HWEL 3OR6A 5E6YA 2Y7OA 4HC1A 1JYNA 1N8ZB 1BP3B 1YQVH 2GW5A 4YFDB 3ULVE 2XRAH 1ZKAA 5DD0L 2AK1H 5CEZH 4WWPA 2QLYA 3D39A 5DFVD 2OL3B 1KJ2A 4OD3L 4PR5B 2IV9A 3TU6A 4BUHA 4S1RL 3Q01A 5C0GB 3OZ9L 2RCSL 2ZUXA 4XI5D 2OPCA 2VLJB 4GKZB 2B4CL 2A6JA 4P2RD 1KN2H 3DSFL 3V4UH 2AITA 1HWWA 2Z4QA 1B0RA 4Z3IA 1O6SB 4JHZA 5IB1A 3T77A 3V0JA 1E5UI 2NYZA 2FL5B 3QR1A 1PPIA 3SKMA 2J73A 1J8HB 4Q9QL 2EIMB 2HT2C 4QRRB 1OGAE 1PS3A 3G08A 4LBEB 3MUHL 4NKIH 4UQIM 3T8MA 3H2WA 2OSWA 1Z0MA 2P1YA 4GRWE 3U7YH 1H9DA 1UB5A 2ZAGA 1FL3A 5J6GB 5JHLL 1NMBH 2L7QA 5T3ZE 4FXGA 1TNNA 4MCNA 5E6IC 2FQDA 4NO0B 4W6XB 5A2LH 5DMKA 2R29H 1SY6L 3HI5H 4GKSB 4KRNA 5HHOE 4F1ZA 5B7FA 1G6RH 1G84A 4UYPA 3NTCH 1S7RB 2F68X 2H2SD 1KT2A 3QGVA 5GQBA 1JHKH 2OMUA 3UEZA 2YUWA 1F2XK 5C07A 2W9DL 4YHYC 4LVNC 5D70H 3UL4A 4EN3A 3UEQA 4ETYA 5FO2A 3UYRL 4Z95L 1Q1JH 4FAAB 4FG6D 1YPZA 5I75B 4R6UA 2JIXA 3CC5A 2BOBA 3U46B 3VRJA 5L8LB 1F4XH 1NGPL 4XXCA 2AJVH 4M4PA 4PJ5D 3RL2B 1C12A 5E8PA 3J07A 4YSQA 2PPAA 5HDBE 3H3PH 5F7DA 4EPSA 2GT9A 2P8PB 4FLOA 1FV1B 1XF4A 5C0CD 2WYZA 3LCYA 4YLCA 1EO8H 4GG8A 3NA9H 4K8RC 1OK0A 3KNBB 4DVBA 2AERT 3UTTD 3MRIB 4X9YA 3BAEL 3E9TA 3GI8H 3PIQA 4LCVA 4OIBA 4P3CH 3H6AA 2CE6A 2DPKA 2BIPA 2JCWA 3CXDL 5HGGS 5I82A 4F9LC 4JZJB 4XBEL 3WLBA 2CHNA 2E6QA 4YHKL 3D18B 5HBBA 4K3GA 3P9MA 1S7WA 4FCAA 2HVKA 4GXFA 1O6TA 4OQ1A 3UADA 1YA5A 3FTGA 1YEWA 1T0NB 2VWEE 5F6IC 3WXWH 1U21A 5JIDA 3O8XD 4X6BA 3ARBD 3AS1A 3X1EA 3QFDB 1OTUD 1CT8A 5D1ZB 1CCZA 1GW6A 1I1RA 1RIUL 2CU9A 2DQEH 2DJUA 5DMIH 3FT1A 3D0AA 2XJKA 4FD0A 5FKPB 4F8OA 5DUBA 4LSSH 5GSVA 2K4AA 4FP8L 5D6CB 5D1QD 1U8KB 1BQHB 1TQCB 1WIUA 3B9KB 3VM7A 4ZUWA 5CJ5A 1OM3L 4ELMB 1QI5A 4Y2DC 4XP5L 5K9KB 4BXVA 1CGSL 1PZ3A 4XO5A 5DQDL 2H1LM 5IJCC 2ZYSA 5L4JA 1I1AC 1JL8A 1EIBA 5EB9A 4LPWA 3M1BB 1U8QA 3UTQA 1BHGA 4MJHA 3SIKA 2RHEA 3CC1A 1RZGB 4UT6L 4U2ZA 2AGJH 3DUHA 2DQDH 2Q7YA 3IU3B 1ACYL 2UZIH 5FO8A 1BAFL 4KXBA 3UG5A 4D0DA 4HJTA 4A68A 4TSAL 1T22A 4PTUA 1NINA 3C6LD 4ZO9A 4R4NC 2AJSH 3S8WA 1G0DA 1MHPH 2ZUTA 3I6LD 1NIBA 4EZMA 4DUWA 4ZFOL 1N5AA 3TO4A 4ZS6D 3ZDXF 1DQMH 1II4E 5FO7A 1PAMA 4LNVA 4PRDA 2X40A 3S34L 4GBXA 1KULA 5HHNB 3BT0A 3KPQB 4FOMA 2G4GA 4UNIA 1KCLA 3QORC 1QFUL 3BWAA 3ZY7A 5D2NA 1E90A 2WQSA 1M7DA 2FJUB 2ETWA 4PRPB 1AAJA 2Z35A 5E2VL 1NTDA 5DWUH 4HUCA 2EKJA 1E9QA 1KCRH 1E42A 1XAUA 4UAHA 3NJNA 1T7YA 1V7NL 2I85A 1ZWIB 5HPOA 3GB7B 1MW2A 3IJSA 2E47A 2J25A 2XI9A 4CVXA 4M1CD 2EDTA 5EBLA 2NOYA 4XNAA 5AUMB 1KB5B 2Z31C 1EHNA 4BQ8A 3IAPA 3RIAF 1J5OH 2HKHH 4WUKL 2P47B 1T4KB 3PUUA 5FF6B 3ZUCA 3X3FH 1HH9A 1HCZA 2R7EA 4KK8D 4BCYA 4KAQL 1OGAB 2NY5L 5AVTB 3UPAA 1M3IA 2ZOKB 4GRWB 1B6UA 4V2BA 1DBJL 4OGAD 4DP4X 4L8CA 3FQRA 1ZLSH 4TM9A 2VLME 5SWQB 1RJLA 2GB2A 5L4IA 5FYJE 1Q8MA 3VFMB 2BY1A 3ATEA 2VDLB 3MX0A 3NN8A 4OIIL 4R2GC 2HAZA 1TENA 1BX2A 4HIHB 5HHOB 2E9JA 2ZZUT 4Y2NA 1IAKA 4MAYD 1Q0XH 4C4KT 4M02A 1FZMA 4FQLH 4JL1A 4LCYA 3TT3L 4N1HB 5TE4H 1SJVA 2ISDA 4MD5B 3MRPB 4WTQA 3APFA 4FNLL 3WFDL 5EO9B 2L3BA 2R0ZL 1JRHH 1N70A 3MNWB 3PWPD 4X6CA 2AW2A 5A2KH 1NEUA 5IQMA 5DRWA 4S1QL 4X80H 3AUVA 2CKBB 1OAYH 3F7YB 5JA9A 4UOJA 1T21A 4UV7L 5E5RB 3L2MA 2NSMA 4H88L 4XMPL 5D7LA 4TQHA 5HDBB 4U6YA 2FBJH 3ZKXC 1S3KL 3ZDXE 4AQEB 2ZF8A 2IWEA 3TO2B 5C0CE 5KW9L 4XCYB 5FHBL 3LKSA 4BBWA 2EQDA 1U92B 3TVMC 3PXHA 3BW9B 3MV7E 2K7QA 2WCGA 4YLQT 4N2GA 3FTXA 4A1RA 4I18C 3UTTE 4JFOB 4ZQTA 2D7TH 4Y19A 2ODIA 4GAGL 4GUPB 1BF5A 1G6VK 3Q1EA 3HAEG 2PTUA 4CVZB 1IEBB 2NW3B 5E2UL 7FABH 3EG9B 1TZIA 1G1KA 1YVLA 2R2BB 2JKWA 1UOKA 5D4JA 2PCXA 2ID5A 2CKNA 3KJ6H 1F3JA 4ZZKA 3KMDA 5EZIL 3PHQB 2JB6B 3K74B 3GJFK 3S4SG 2G3MA 4LO9A 1MVYA 1WA1X 2Y06H 5ETUA 4P9HL 5F2FA 1T1WB 3CVHB 3IMWA 5I16B 1P5UA 2R56H 3O41B 4G42A 5I8KH 3FO0L 3WKYA 4YC2B 2GHZA 2FT6A 1NGWB 4RMTA 2YD7A 3CHOA 4JY4B 4ZX5A 3FQXA 4FXKC 4F2ME 4KTEL 4LZKA 4ZX6A 4KRMB 5IBTH 4N2MA 4U1SA 4IU2A 3AREC 1BECA 3RPIB 2Y23A 2VN6A 1C5CH 3EF7A 1O9ZA 3UYPB 1P4BH 3SDAC 1CBVL 3B6SA 5CKAA 5IFAL 2ZX6A 4TS6A 3VFVA 1AQDA 3Q9PA 4ICWA 4KKLC 4I0KA 2JKLA 3D39E 5CJOL 3BPCB 4HJJH 5DRNB 4OCWL 2AXGA 5LBSA 5EWIL 1U3YA 4LBAA 3OPZL 5IK3A 1G7IB 3HNVH 3ZHLA 2P5WA 4TNWK 5JOPD 1OPGH 1ZJAA 1R3JA 3D85B 4ALAC 2I26N 4XXDA 4EIUA 3I6LE 3TBWB 3QK0A 2O5NA 4UDUA 1EHXA 1OAKH 1KCUH 2A38A 4M8RA 2V2TA 2QFRA 3SCMD 4IBSA 3MRBA 4GOSA 3HR5B 4AWJC 3RIFK 3WOVA 3ZTEA 1NCBH 1OP5H 4KNTA 3E7JA 1GZPB 3ELAT 3RVTD 5C0JB 3FO2B 4YXHL 1YMMA 4LL4A 4LVHC 1UFUA 4C56D 4YR6A 2DIBA 2NPLX 3RQ3A 2EAEA 4DEWA 3N0PB 3MU3A 5A2JH 5HGDA 3US1A 2O93L 2XWRA 3C2SA 4H13C 4NKOA 4NXKA 1E28B 1IAIL 5FOJA 3GMRB 2MJWA 3B2MA 1BLNA 3UTSA 4HUUB 2EDFA 5C07E 1WRFA 2DQGH 4APXA 3GUFA 3GIZL 1I1YB 5AW7B 1HNYA 2DWEA 4MA1C 4NJAH 4ZXBA 1ET7A 2WV3A 3RJOA 3HCVA 4YDJA 1WEJL 3DLQR 5H37G 2QV4A 2ZKHH 3GNML 3IF1B 3PGFH 2B20A 4OD1L 4BCZA 5FR3A 4XPAL 3HG0A 4HIIB 5I30L 1DVSA 1EHAA 4D7BA 3HLAA 1T7WA 2QPUA 3QG7L 3U30C 2DLGA 2MKLC 1SNRA 2J56A 1MCEA 4PWJA 3KPPB 1A6AA 4HMEA 2F54D 3UJTL 4CC4A 2D4DA 4Y9EA 2HN7A 3HTLX 1FNHA 4UQ2A 3RTLA 1MVUA 4GAAA 1Q9KA 1YEEH 3QHTC 2AXHA 2MQCA 3CMOH 3D9AH 5T3XH 2AJXL 4YHPB 4DEUA 2Z65C 1P84K 5HYEA 4NPKA 1JZDC 3J8F7 3V7MA 3WHE0 4MCZB 3KWTA 3QPQC 2Y25A 2XTLA 5I73C 2LAGB 1V3MA 2VYRE 2FEDC 2EDKA 3QQ4B 4ZMWA 4GSDH 4YQXL 5ESAA 2DWSA 4A7UA 3D07A 5IF0B 4PFEA 2FECL 3AAZA 4PJ5B 4PP2B 4Z3JA 3FT4A 3OAWA 1SYSA 1GZHA 5TE7L 2EXWD 5T33H 1JPSL 3LIZA 1BFVL 1PY9A 4MVBD 5F9OL 3ZDXB 2BVOB 1GIGH 1L7IH 2DQUL 3HB3B 3CH1B 2PYFA 3O2VL 3HZ3A 2VM3A 1VERA 3I6GA 5EBWB 2HRPL 5C0CB 4XCCH 4F80A 1UENA 2YUVA 4LOFA 4UINL 1X7TA 1T1YB 3MV7B 1NEZG 1E8WA 2BW4A 3NSYA 1KXVC 3ARYA 3QJUB 1S78C 3UTTB 5BVJA 4BSWA 2X4OB 1KV3A 1OAQL 5EOTB 4AEEA 3Q6FA 4IBLT 2IEPA 5CSZA 1A3LH 3S4SA 1HOCB 4Z7QF 4XH2A 5MEOB 1B4TA 2RACA 3FU5A 5KVGH 4NSKB 3PWUA 3TJHC 3WNKA 2AMUA 4NNXA 2X53A 1KENL 1W91A 3BPOC 3DRQA 3BN9C 5T1MA 1CDYA 35C8H 2PCPB 1OV8A 3EYUH 4L23A 5BUPA 1XD0A 1PJWA 2O4EA 1SGKA 2XTJD 5ICUA 4NUJA 4DIXA 3W3BA 4G82A 4HXAH 3UO1H 1NCJA 5SWZA 4L1SA 2CLRA 4IRJD 4H25A 2IFFH 4KJWD 5D1QB 1AHWA 1PZ5B 4JFZL 3L9RA 3FB8A 3S48A 3LXUX 1ND0A 3QJTB 4F2MB 4EUPA 4TOYH 4G43B 2OMVB 4HIXL 1Q4NX 3FU7A 1MFAL 5EC2A 4DKFL 5JQ6L 4KO6A 1N19A 4H7VA 5EA0H 3JBG7 1G9HA 3QO0A 5I1CH 1T3FB 2V5YA 2IAMD 4X4MA 3VWJA 5AKRA 5TDNB 2B4CC 3PL6A 3QUYD 5D2NE 3RUGA 4JM4L 3K71A 4E41D 4FNTA 1DJZA 4WDIA 3L4YA 1ZEAL 3MUY1 4M7JL 4QKXB 4DN4H 3D39B 2WPGA 1L9TA 3GQFA 4LLMA 1V7MH 2P5EA 1FYHB 3IMVA 4HCGA 5BQ7A 2W95A 2EACA 5D2LA 4J3OH 4BH8A 2A6JB 1MUJB 3E3QE 3Q13A 5LWYH 2Z4QB 1A6UL 1WAAF 3C6LB 2OSLA 3SN6N 3RP1A 3IS0X 3T77B 1CIUA 5CBEA 5EZJB 5C09A 1A4KB 3FMGH 1SOSA 3SKMB 1MRFL 3V0IA 4TQIA 4DPCX 5C3IA 6FABL 3OG4B 5IHLB 3GS7A 3VWKA 4W68A 3RA7L 4ZNCD 4IJ3C 2ZSVA 3HG3A 4XWGL 4O5LL 3V5DB 1PLAA 4OVUA 1NOFA 4JZNB 3FAWA 5JW5B 3K6OA 5D1XC 3M17A 1OSYA 1HQ4A 5E9DA 4KKCD 1H3PH 3WL9A 3KE0A 4NZRH 4EI5D 3NJHA 2VGLM 4CGTA 1NGXA 1SQ2N 2PWHA 3UDWC 3WY2A 3BAYA 1LK2A 3MDJA 4PREA 1KT2B 4OZIA 4NEHB 2DL2A 5C07B 1UCBH 4DO5A 4Z7QE 2EKSB 4XE5B 1O5DT 2YKKA 5I6PA 2DD8H 2DM7A 5AYUH 1WZ1L 4N2FA 2BRRL 5D8JL 5ILTH 1TDQA 2EC9T 5IEHA 4ZFFA 4JDEA 4PVBA 4K94H 1QQDA 2VM9A 3U9PL 4NENA 1G4MA 5DJYB 5E1HB 4TUJA 4WTXA 2F19L 3TNMB 2JIXB 2BOBB 3FN9A 3TN0A 3ULAB 1M57B 1U8HA 1CE1H 2IBGA 3MV8D 3RWHB 3EFDL 3BO8A 2YXWA 5DHXB 3C6EA 1C12B 3LZQA 3ABKB 1Z3GL 5D7LE 4PV8A 1DQLH 4QTIL 4F27A 5JHMA 3KGRA 5F96L 1VADA 15C8H 2FX8L 2F54E 4YBQD 2XY2A 5CGYC 5ID0A 2B39A 1NM4A 4MAYB 4X9BA 3WFCH 4XAWH 3INUL 1NDMB 2CR0A 4ZOAA 4AQ1B 1IBGL 1KCVL 1UWGL 3OMAB 3FB6B 4JL2A 4G9FA 4BZ2H 4HBCL 4PJBA 5KVDE 2F0CA 3STZB 3D0LA 1HSAB 3PIQB 4KHXL 5I6XC 4HUWB 2BC4A 4QYAA 4TN9A 3PDOB 4HPOH 3MLXL 3MAWA 1IGYA 3RPBA 3VE0A 2CCLA 3O3EA 3MLUH 4H20L 1OAJA 4PLNC 5LGHL 4L05A 2EP6A 3EBHA 1WAAE 1UH2A 3VD9A 4Y2OA 3RZCD 12E8L 3FTGB 5FHAH 5DJDB 3QIWC 2FO4B 5HHXL 3QJHA 3RZWA 4Y4KA 2MTPA 2B1HL 2FT7A 3ECWA 4PRHA 5AKTA 1CT8B 1UA7A 2W88A 2X7LA 5DEZA 2W0FA 4AQAA 5J6SA 3ZK0A 4P59L 2RIKA 3V4PH 4XT1C 4GRMB 3SDYL 1MWAH 3FCTA 1YEFH 2NW2A 3QWRA 3VFRA 4P5TA 5KAQG 2H6PA 2B2XH 3ABZA 2JKTM 1FYTA 1T1ZB 3PP3H 1IX2A 4N86A 4JHWH 5L4FA 2HLEB 4B5EA 1MEXH 2VDKB 2HT3D 4K7PY 3UCQA 4JPKH 2NY0D 2OJZH 1VZHA 4O4YH 1KCKA 5B8CC 2AQ3A 3FB7B 2N59A 2XG5B 1R1CA 1HWGB 3NJKA 1MCWM 3UACA 1QA9B 3OKOA 5FO8B 1B9KA 2P5WE 2XTJE 4D0DB 5KWYC 1CLYH 4LPXA 5ABAA 3CLFL 4R8WH 2NNAA 1A7RL 2LQRA 5CEZD 2XV0A 4N2DA 3TO4B 4MJIA 3VG0H 1JMXA 1OHZA 2Y2YA 3QXAA 4RDQG 4UOQA 4LL1A 5JZ7D 1QNIA 2J1WA 1WFUA 4Z7IA 3EZJB 4U6TA 4JK0D 3AMLA 5BCAA 3I6SA 4R5TA 5D2NB 1A6ZA 2WQVA 5DYFA 1YMME 3TF4A 5HJ3B 1M7DB 4ETQA 1I8KA 2Z35B 5L8JB 1KTKE 4BA8A 1Y18B 3AQYA 3B7RL 3TFKD 4QUOA 4FTVD 3EADA 1E9QB 1GRWA 2D31A 2PN5A 4K7PX 1H15B 3GMPB 3D12B 1VF5C 1DSYA 2Z93A 2BNRA 3OC5A 2H41A 1IARB 1OPOA 1AO7D 2YHGA 2HH0H 2EICA 4H8PA 4NP4H 3RGVD 4L0YA 2VZTA 4G3YL 1AY1L 3UTSE 5MEND 3QXVA 2YZ1A 4FZEH 2H3NA 3WSQH 3CXHJ 2RD0A 1FFOA 3MCYA 1CG9B 4JVPA 3ZTJH 1HH9B 1MCOL 3L45A 1I85A 4ODHH 4BQCA 4IK7A 3SCMB 2CM6A 3I9GH 2ITFA 1UVQA 3ILQC 1DUZB 3H3BC 1MAMH 43C9A 3IXAA 4QRPA 5JIKA 1X44A 2Q8BL 1I7ZA 3CSYA 4S2SA 5CINH 5DZNA 1KZYA 2DMGA 2X42A 3GMOA 1RJLB 3QCTL 4C56B 1BQ5A 4YDKH 3LQZB 5BO0D 4HPYH 5BZZA 3MX0B 4BFGA 3EYOB 1NMAH 3GFUA 4N2IA 5D7EA 2ICES 4R4BA 3DOSB 3RVXC 1FO0L 2UX7A 4IHOA 4TUOA 1IAKB 3RUGF 1FZMB 3S3BB 1U58A 5FM5O 2BP3A 5T1DH 1DO5A 1TOXA 2YPVH 3K2MC 3MJ8A 4Z7QB 1A21A 3L7FB 5E5LA 1S46A 5I1LB 5DS8A 1OARL 1XGPA 3NP4A 4WNSA 5CLYA 2OQJA 1JFQH 3RWCA 2IWGA 1OTTD 5D2LF 1KPVB 2CDEB 4H26A 1J48A 1OK8A 3ULUH 1T21B 4LSVL 1GJWA 3MLVL 5KN5B 2MOQA 5GGUA 4XCEA 1SXNA 3MBWA 3C5SA 2AXFB 2IGFH 4KQ3H 5E2WL 4U6YB 4HV8A 1B88A 2F54B 4Y5VA 2PCFB 1ZLEA 4UM9A 5LN8A 3RNKA 2HKFH 5EU5B 3SDDA 2O5YH 4IGBC 3MC0A 5D72H 1IAII 1QO3B 4H8WH 5CWSA 3GXPA 3VFGH 2FRGP 3IDJB 3OL2A 1GPOH 3L3DB 5DWPA 2YLHA 3QIUD 4LDCA 4GUQA 3GSVA 2UXVA 3LDBB 4WI5A 2XFGB 3LEYL 4K23L 1TZIB 3AADB 3T6XA 4JG0H 4HIPA 4IOSA 4NAMA 1NBYB 4QRTA 5LBVA 5J13C 4X98A 1FH5H 3T4YB 3V0HA 1RKRA 1D5BB 2X1OA 4I2XE 4U6VL 3RY4A 2A6DB 1INEL 4C4UA 4JCLA 2HCZX 2X4PA 1MFEL 1P5UB 1ID5I 1YECH 4G42B 2E6PA 1QFPA 2BSEA 2QBWA 3EGDB 1CXLA 4WSKA 2VXQH 3HOGA 3RPKA 5A7EA 5K9JL 1IAOA 1QRNA 3FQXB 4PGCB 1RJYB 3WJJA 2X70A 4IU2B 1XGRA 1CI3M 3AQXA 3MLZH 4JPQA 5FV1L 2NY1D 2GJ6A 4X4ME 1EHLH 3GSNL 3RUGE 3LJ3A 1F8TH 3B6SB 1MJ8L 4LLUB 4MA8H 2VL5A 3H7LA 4M43H 3QH3A 3ALWA 4IDJH 4ABVA 3E38A 3BQUD 2FECI 2P5EE 4HKXA 3ARGD 4X5QA 3DGGB 5IK3B 1BIHA 2VZVA 1W72L 4IRSA 1YEJH 2P5WB 2XTJB 5D2LE 3F83A 4WV1C 2W91A 4KRPD 1J0IA 5I23A 5DMGD 1HHGA 5KZCD 4XXDB 4JFWA 5C09E 5KYUA 1E43A 4QOKA 1IC4L 3ZTNH 3H6JA 1BXAA 4QHLA 3MA7B 4K5PA 1AGEA 3GSRB 2IAMB 1QX1A 3FT2A 3GJFH 5KBMA 2HPTA 3NEEA 4FQQA 1J18A 4JMXA 4M6NL 2NY3D 3QUYB 3WNOA 1IGML 1YMMB 4X9GA 4PB9H 5F7NC 2XXMB 4ODBD 4X4XB 4OCRH 4WSGA 5E9DE 4FTVE 5ITBL 3WIAA 4HGWA 4X7SH 3OZLA 4FA7B 1IBDA 4DO4A 1K4CA 4WKZB 3HHSA 1X5MA 2AK4D 5HGHB 4B97A 5DK0B 4WCYH 3RVVC 1OGTA 1BLNB 3UTSB 3QJFB 2WJ5A 1RY7B 3O9WD 3UPRA 3ZJAA 1U4EA 4ONOA 2VW6A 4P9MH 4APXB 1GSMA 4U05A 3GZQA 1T6BX 4ADIA 3HCVB 2DH2A 4YDJB 1MCPH 2I60L 4TVSa 1JFHA 4JRWA 1MAKA 3L3KA 1IC5H 2A74B 3MLWL 1JTOA 1T03H 2BVUA 4OV6F 1FBIH 2CUIA 1KC5H 1KCSL 2CJUL 2E4FA 3QI9A 2MTAA 4M48L 1AGCA 4YBLC 4BINA 4MJ6A 1MOEA 4BHUA 1L0PA 4JHUA 3KGSA 3R7QA 3QCUH 1YZZA 3DX8A 2OP4H 4EBQH 1KGXA 1WPCA 1ZHBB 2FX7L 2H32B 2JXMA 2KS0A 1MVUB 2R1XB 1NFIA 4GQQA 4XPFL 1Q9KB 5E1AA 4G9FE 1UM6L 2BSRA 3PF2A 4FLQA 1JPEA 2DQIH 3QZOA 5TE6H 3BISA 4ZTOL 1F4YH 3VNZA 3CPLB 1F4AA 3KBHE 3GKWL 3BFWA 4G59C 5F93C 3T71A 3L4VA 1KG0B 5CN3A 2CBOA 1CDGA 4HJUA 4OFYA 4DK3A 3MV8B 4NKQB 5JHDA 4GKOA 3BP4A 4FZ8H 4HWBH 5AZ2L 3WHXA 1NCWH 2IOOA 4P23C 5DA0B 2IPKA 3II2A 5CSGA 3QNYA 3HMXH 1PZCA 4BRJA 3WS6A 1FN4A 3QBTB 4MLSA 3F6IA 2E6JA 4PRHE 2Y7NA 3IFPA 5I6MA 2J71A 2HLAB 1B0GB 2BFVL 4KUZH 1SMOA 2WC7A 4HJEA 1EXGA 4G80A 3T2NL 2AJ3B 3BRGC 2VQ1A 2EO7A 1M4KA 2G5UA 4BSWB 2VSCA 1CYWA 1DBBL 3MJ6A 2WNXA 2YKLH 4POZC 5GGRB 4N2HA 1FYTE 3KVPA 4IMLA 1WJ3A 5MERA 3KXFA 1CFSA 3WFEH 4LNRB 2BHYA 3ZL4L 3SGKA 5DLMH 1NUGA 2NZIA 5EU7C 2A6IA 2J6EL 1D7DA 4F8LA 1JNJA 4S1DC 5E99L 3DVGA 4A63A 4NNXB 3RZCB 3FOLA 3T0WA 2QGDA 1DQQB 2O72A 3IMRA 4I2XB 1MY5A 5DHVA 3US0A 3W39B 4A6YH 2GIMA 4GYBA 4UIKH 1JHLL 2C3WA 1ZA3B 4JFSA 5I8EA 1ZK5A 1AIFA 4LMQE 4HWEH 5KYXB 4XMZA 2YQ3A 3QEQA 5FUOL 1EVUA 1MCWW 2CLRB 2F7IA 5FA4B 4TNFA 3K46A 4WI3A 1T5KA 4TUKL 1U8MA 5DD0H 4P99A 2EE9A 1ND0B 4MJIE 2B1OA 3W0WD 5GS0C 2A73A 3PHAA 5DT1H 4J4PA 4M3JA 3OZ9H 2M26A 2RCSH 4KTYA 4OZFA 5FYKU 2B4CH 3PL6B 4OGYH 3RUGB 3K71B 3SZ6A 1XTMA 3TH3T 4PPTA 4WDIB 4GEIA 3GSOA 4JPIB 4Y8AA 5TFSL 4BFJA 4PWHA 2ATAA 4Q9QH 3G3LA 3EIFA 3F05A 3F3HA 5EC1A 2P5EB 1I3GH 3ETBF 3T9WA 2LTQB 3UXFA 3V4VA 1R46A 1CLZL 3ARDC 3ZZLA 1E3ZA 5D2LB 2AAAA 2VQ4A 1YEDA 1U8NB 3S2AA 4CKQA 4MB1A 3B56A 5JHLH 1WUNT 3C87A 5C09B 5CBEB 4X6FA 3JV6A 1ECZA 4FC3E 5AZUA 3VXSA 1RQ5A 5KVEL 4G6KH 3DVNA 4GMTL 4PLJC 2DI7A 3FN0H 3NESA 1GR7A 4XP4H 1QHQA 2X6BA 3OKDA 4YIQA 4YDVA 4YDLC 5EZOL 3MYJA 1AD0A 3KLHD 3D25A 5AAWA 3QZWA 1TLMA 2W9DH 1J5HA 1I82A 5DSCB 2WZ6A 3FRPG 4FTVB 4I48A 4A2FA 1GCYA 1JNNL 1YYMH 3WL9B 3BUTA 4XB8A 3FN3A 3TEUA 4M7ZB 1BQUA 3UYRH 4OF3A 4Z95H 4ENEC 4UBDD 2AK4E 5F0LB 3WEXA 1A66A 1TVBA 1LK2B 3C60D 3VGEA 5F9WB 3IDNA 4OW6A 3HIZA 5FUZL 5MENB 2YEVB 5EIVA 4HULB 4WO4C 1U36A 1NGPH 4JKKA 3UBXI 2JWYA 5I9QC 3DX2A 2ZOTA 4Y8DC 3SQOL 2ERJB 3MZGB 4ESKA 1ZVNA 1MDAA 1G6RB 5CZVL 2XVKA 1OSPL 1BV8A 2F7OA 3WGUB 3ROOA 3AVEA 1CU4H 2QLVB 3GXFA 2Y6TE 4J2XA 5T3XD 3KPNA 3X1BA 1SLVA 2YXMA 2CBPA 3VB9A 3QAQA 1M05A 1WITA 5MEQB 2IV8A 3BAEH 2B0SL 3ZHDA 1QBLH 3L1EA 1MF2L 4K73A 3CXDH 1T7VA 5F9JA 4FG0A 2ZICA 3SDCD 3LNHA 3BE1L 2JB5L 4XBEH 1FFPA 4MX7A 1CXEA 1K72A 3LZPA 5B3NA 5EIIA 3WG7B 2W94A 1KOAA 4R26L 4QY8A 5GGRY 3IDIA 4L37B 5HSFA 3D0LB 3Q2LA 5KANI 1GW0A 4WEUD 4MMZC 3AZUA 3QIBA 2X9XA 2CR3A 1SN5A 2EXTA 3CVBA 4JKLA 4P2AA 1ADQA 1L4IA 4UQBA 3O3EB 4RSYA 3I85A 1KGCD 2HPOA 4X5LA 3MRKA 5JIMA 5CS7A 2OYMA 1MQ8A 3DJRA 4EI6B 1KJVA 4Y2OB 3ARWA 3IFOA 4HCRL 3MQIA 3E2HC 1J0JA 5ECJE 1W80A 1AZVA 1CGSH 1QATA 5E56A 1TYRA 4M93C 4PRHB 4XNXH 5B22A 2OSYA 4N6RB 1F3DH 1A3RH 2W0KA 4AQAB 1CGVA 1RP8A 5LUMA 3OJDA 3TTSA 1CF1A 4B3VA 4XE0A 2XG4A 1QRNE 3RVWC 2NW2B 3CFBB 4UT6H 1DL7L 3BKYL 1OHQA 1YYCA 1AZBA 1YMHA 2LR4A 2XN9D 4AL8L 1FYTB 3RDTD 3A47A 3ZKND 3QIUB 2GJRA 5JLZA 1MXDA 4BGDA 5I8OH 2YPLD 1NDGA 3V4PA 5I17A 1J8SA 2HFGL 1YEIL 3D7PA 4CMMB 4TSAH 2PPCA 5INCA 3IFLL 3EYFA 3QULA 1QKZL 3O2DA 1OWRM 3MODL 1JI1A 4OZHA 1GL4B 2RA1A 43CAA 1QTYT 5C0FA 2QHLA 2Y1YA 4YSDA 4DGYL 4TMPA 4GRLC 1MSPA 2XLLA 4NAQA 4AEIL 3S34H 3L9EA 2C4FU 5C6TL 3NZHL 2IH1B 3MV01 3O6MH 4M7LL 3VVVA 4NN6B 4WI9A 4F57H 3DUUA 1QFUH 1GGIL 5GS3A 1MCSA 3APNA 4B7IA 1PCSA 2CJ3A 5E8DH 3VSVA 3MFFA 1J0KA 4QOKE 4HWNA 4MJIB 4U1IA 3EFFA 2WO2B 1LLAA 1YNLH 2D7QA 4NCDA 4QF1B 3D1MC 4YPGB 4WI0A 1A6ZB 3WEOA 2CO7B 3KCWA 4DQOH 5GGVL 4ETQB 1KTLA 4HK3J 5CEYA 2YAEA 3VXRD 3GMLB 4JQVA 2IDTA 2D31B 4IKLA 3CVIL 4OF7A 2DLFH 5IVNA 3ARGB 3QDGA 1O7SA 4KAQH 1ESOA 2NY5H 4PG2C 3LH2L 2DW5A 5FOBA 2QZ5A 4W81A 4IIQC 2ZF9A 4FQXC 4KRPB 5EOQL 2H3NB 2DLEA 1FFOB 3O4LA 2VXTH 5E6ID 4DP7X 4Q0XL 1RFDL 2GJZA 4HUKB 4OQTA 1YC8A 1AGDA 1WZAA 5BV7L 4HP5A 5L2KA 2E9IA 1LO5A 4G5ZH 43C9B 1L0XA 1OL0A 4P5KA 3EJPA 2NY3B 1I7ZB 3CSYB 4HHGA 4KHTL 3W56A 2VDRL 1LEGB 4CADB 2KL6A 4U1JB 4MCYA 2EEXA 3NCJL 4LLVA 1R5WA 3WY4A 3EYVA 5LAXA 2XDHA 3EJQA 3CZUB 3PHSA 2AI0L 4Z7AA 2AK4B 4IHOB 3QJZA 4S1QH 2X4QA 1A7NL 4PI0A 4RLDA 1L5GB 4BFBD 3LPGA 4C83B 1U58B 3MJ8B 2FGWH 1T5XB 4EE2A 4UV7H 2C3XA 5I24A 4XMPH 4H88H 2AEPH 2WZPA 1UADC 2OQJB 3RWCB 1S3KH 3QQNA 3WI9A 5GS1C 3GRWL 2CWRA 1FC1A 2IVFC 4H26B 1DEEB 1WFOA 3ARXA 4WUUA 5FA3B 5FHBH 5T5NG 1V27A 5DYOB 5T3XE 2Y0SA 1G7MB 5GZNA 4K8RD 3WGVB 3ZYJA 5AAMC 1NH6A 2ZOLA 3U6RA 2CH8A 1QBML 4M8QA 4GAGH 4J3OF 3TURA 3TYFB 4NI3A 4PJFA 4YHIA 5BS0D 3H9HA 4KROB 4KUCD 4Y5VB 1RHHA 3SJVA 5LLIC 4UM9B 2CO3A 1DLFL 1A4BA 3N40P 2X0UA 1B4JH 3V0DA 3G6DL 3LPFA 4W9GC 2DQJL 2WBJC 2C9UA 4LCIL 1BFTA 4L5FH 2IPTH 4JRXA 1AC0A 1H3XA 1VEMA 3NFPB 5EZIH 3FZUC 3PAVA 1E4XL 1WH0A 1H3VA 4FJZA 3JYCA 5E95B 3KXFE 5F3BA 4OJCA 2XT1B 1IAIM 2PXYC 4QRAA 3WUWA 1KUMA 1W9XA 3U6XS 3FO0H 4XBMA 4LLWA 5L88H 4FQ2L 3DX7A 3L2NA 4QRTB 1KTDB 3QUML 4KTEH 3RWEA 5DJZA 1KFAL 1NBVL 4G1EA 4Y2DD 2UZXA 3UJJL 3IETB 4KKNA 1HXKA 1ETZB 4X8GA 4ZW6A 4WWKA 3ULSA 2Y36L 3JVFC 1I1AD 1LXMA 3KPSA 3WAJA 1TQUA 4KJPC 4PJ7A 4JFPA 5IVOA 4Z7VA 1TZAA 5EOCL 2Q0ZX 1IGCH 4XB3A 5AW3B 5IFAH 2R4RL 5F0PB 5FGBC 5E5UB 3N40F 2X70B 2IAAC 1UXSA 1XGRB 3N9GL 4E42A 4Z76A 4OCWH 2V33A 1PZUB 5EWIH 3N3EA 3OPZH 2ZCLH 4FL4B 1UKQA 4QJ3B 3O0LA 4B5ZA 2OTWA 3K72B 1GS7A 4LSRL 4R4ND 2BDNL 2XACC 1QUPA 3LIUA 2IH3A 4MXVF 2VL5B 5C0NC 4YS4A 4RMRA 3RB5A 3ILDA 1PLBA 3FC8A 4YSTA 5AVQB 1MHHB 1KTBA 4IRSB 3MROB 2E86A 2WXMA 1FORL 2WMPA 5C2BH 3SPIA 2IMNA 1B3JA 4YXHH 8FABB 4DGVL 4AQOA 1X5IA 4W6WB 4ORZC 2P46B 3MI6A 3VXSE 4UOZA 3X13A 5C0RH 1A25A 4R84A 3G9VA 4KUCF 4GG6F 4NQXB 4QHLB 4DF9A 4MTMA 3LH8A 4U0RB 2ROXA 3BLKA 1IAIH 2ZKYA 4LSTH 2Z31D 4D9RE 1M56B 3ZDWA 4FQIL 1HXYA 2WYTA 3RILA 1N6QL 1X9QA 3FFCD 2PP7A 1K2DA 4DEPB 3GIZH 4HGWB 1VKXB 3N1FC 2F5BL 1K4CB 1YEKH 2WQRA 4MQ7A 5E94B 3ZQWA 1WEJH 3CX5K 1DDHA 1WWWX 3QJXA 1BM3L 2AABL 1R24B 4KO7A 3OKNA 4N0UE 2F5AL 5HI4C 4OD1H 5T1LD 3C08H 3UPRB 1UOVA 2CCVA 2CGRL 5KYYA 4RMSA 5E8OA 5I30H 4I85A 4TPRL 4QMEA 3EYSL 3QG7H 4E9QA 4YNYB 2HMID 3MZTA 3VXNA 4QCIA 4R2GD 4WTZA 1PLCA 2VABA 3JV4A 2NSQA 3JWNH 3Q2VA 5C86A 3GSQB 3UJTH 1WA2X 4OLVL 5CN1A 2BS9A 2ZAIA 1ZLVK 3BUQA 4FULA 2V2XB 4AMKL 1RHFA 4DGWC 3ZSTA 1PZBA 2R9HC 2AJXH 5ANME 2BCKB 3QC6X 1DN2A 5D7SH 1AGCB 1QW8A 4N8VA 4Y5XC 3OSKA 5DTFA 3C9NA 1G0YR 1BREA 4M61A 3BSGA 4JLRB 5I1KL 3BPNC 4PJXB 3C60B 3DX8B 5GZOC 1UQSA 4RA3A 2JXMB 4YQXH 2FWLB 2YD2A 3C2AL 1NFIB 2F6AA 4OB5H 5E1AB 5DVLA 1ZIBA 2PO6A 4JFQA 1QEXA 5K9QI 3AXHA 3UTZA 2GTWA 2JQZA 4XMLL 1MIEH 4HKJA 4W9LC 4YEEA 4MXVE 3SKJL 1XEUA 1HZHL 5CU5A 4XP1H 4D3CL 2HRPH 1WBZB 4BCXA 5A2IH 3DTUB 1PFOA 1ONQA 3BP4B 1A9BA 4UINH 3RJQB 3TTYA 4BEIA 3QNYB 3LD8C 1OAQH 2PW1B 2NY6B 2BSCA 4HZLA 5SWSD 1N5YL 1RP9A 5C97A 3IFPB 5LVEA 5DUPL 3T3PF 1LMKA 5KJRL 1ZA6A 4AIEA 1BMZA 4G80B 3C8KB 1JD7A 4KI5D 1ZHKA 2VQ1B 1YUHB 1HL9A 3EZ8A 1KENH 2V0AA 5HYJA 2GJJA 5I76B 4IMLB 3B2XA 5MERB 3KXFB 3VD1A 3ZMNA 1DBAL 4G8EB 1F4WL 5ENWB 3ARTA 5EU6D 1X4YA 1I8MA 4PRNB 3MV9D 1S9YA 2AEWA 3OQ3B 3BCDA 4KV5F 4Z0XA 2LAAA 4GJTB 1SVBA 1HZLA 4JFZH 4WF7A 1I1FA 3FQUA 3N1GC 2VRQA 4HIXH 5JQ6H 1MFAH 3ARED 2OI9B 5DHVB 4DKFH 3HNTL 2FQEA 1T7ZA 2NTFB 4TNGA 1K85A 3A4AA 3G5VA 1PG7X 1JNHB 1CXFA 2WUCH 3T0BA 1HT6A 2X4RB 1NBCA 2NY7H 3QP3A 4JM4H 1BG1A 2V7HA 3JUYA 5J06A 2AEIT 1U8MB 4LEXL 4M7JH 3Q8EA 4ZNEA 4KKLD 5EEYA 1R19A 2DDQL 2J21A 5GS0H 1CFTA 3F5WA 4O02A 4S10A 3T0EE 1T2QL 4M5YL 3L5HA 2KERA 1JVOA 3PGCB 4KKPA 4LDLB 3ULUF 2I69A 1GGTA 3N1MC 1JF6A 5BRZD 3ZW3A 4DK5A 1NIEA 4AITA 1MLBA 3NJMA 5MI0B 3OAZK 2AANA 2YD3A 3CQPA 4PSRA 2BZCA 2KQMA 3LOWA 5EC1B 2YD8A 1THAA 3BZEB 6FABH 1SRDA 3GTTA 4KGLA 4JFUA 5IREA 3T0DA 1MJJB 4XWGH 2DQHL 4G71B 1YEDB 1IM9D 3EDJA 4HC1L 5D7JA 3RX9A 4F33A 1IGJA 2J4WL 5IROA 4LCCA 1AS7A 3ISWA 2KPWA 4PG9A 1UUSA 4X6FB 3VXSB 4AK1A 5C0EA 4EZLA 1AXIB 1OAUH 1UWEL 2WTRB 4I9WE 5E8NA 1KJ2L 3HVDA 3CSTA 2IBBA 5L2KE 1PU0A 1L0QA 1SJEA 4PJ7F 4JFDE 4Z7VF 3FK3A 4YDVB 1AD0B 1N64L 3D25B 4LAQL 1CDBA 4OFIA 4KI5F 2YBRA 3QZWB 1S2EA 3EH3B 5AKSA 3T3PE 3MA9H 5MHSE 1QSFD 4OJAA 4UQAA 1T4WA 1KYAA 2V2WA 4PY8I 1WZ1H 2GC4C 2DYPD 1PFCA 3H4FA 2BRRH 4HFUL 4H5SA 1DO6A 2DAVA 5D8JH 5HI3D 1SY6A 4PJAA 5I2IA 3S96A 2QVFB 2QTVA 3U9PH 2OTUA 3IDNB 4X99A 2CIKB 4N0UB 2F19H 1H8NA 3TA3C 1JV5A 1QW9A 3EFDH 5LBGA 4DP9X 2A1WL 4KO5A 4KV5E 1Z3GH 4QTIH 3VFSA 5IVXF 5F96H 2ITCB 4PGZA 2FX8H 3CMGA 1WCQA 4HIJB 1DVXA 4X5RA 5I75C 1X9RA 4XZUB 3ROOB 4WUUE 1E4WL 3ASOB 4NQDA 3T4AA 2WO4A 1R3KB 3INUH 1XB3A 1BOYA 1A6PA 1KCVH 1UWGH 5FV2A 1FPTL 4B27A 3KPNB 4X5XA 5I1JL 1QR1B 5ANMB 4A55A 1N26A 5CM1A 3VFTA 3NPZB 2WKOA 3MO1B 3QPQD 5DRZA 5F9JB 3GGWB 3P2BA 2WXHA 3SJVE 4GMSH 4NIKB 3TH4T 2FEDD 1FFPB 3LSOA 3MLXH 4HJIA 3ULUE 1IAMA 1U8IA 3FQNA 4OV5B 2UVEA 2X2HA 4MX7B 5CFAA 2G2RA 2QQLL 2DQMA 1MJUH 2WLLB 5EIIB 3VM5A 4H20H 3ZMEA 5AOZA 5LGHH 2NDGA 4QY8B 4O58H 2NNRA 2X3BA 4JRXE 1KLFA 4YJZL 12E8H 2DKUA 5F7LB 3JWOL 3MBXH 3IFNL 3BH9B 4JZJC 3MRDB 2B1HH 1BCIA 5HD8C 1BVOA 3FH8A 2WAHA 2VH5H 1ZGLM 2NQCA 2DEYX 3MRKB 1AI1L 2ODHA 4GS7B 1S78D 1S7VA 3GXUB 4HJGA 1GZQB 1FZKA 5BZWA 3VI4A 2AF2A 5FFOA 4GG6B 5I5RA 1D5MA 2P7TB 3KPSE 4P2QD 4PJ7E 4Z7VE 3KLQA 3IJEA 4KI5E 1NIDA 3B9KC 1IGFL 1TQCC 3TJHD 4X0KA 5JW4Q 3BN9D 4ZDHB 1YMHB 3TS8A 1IBYA 2GTZA 5F6IB 4YPJA 2IADB 4TNWF 1IRAY 3RI5K 2OJEA 1FVEA 3QUXA 4JG1L 2R83A 3V4PB 3LPWA 3TH2T 5I17B 4Z7WF 3CAFA 3CLFH 3MXWL 4QAMB 1KIPB 3MV9E 1A7RH 1DBKL 3HRPA 5GGQL 4ZMQA 4AENB 2Q8AH 5IHUL 4HDIA 3PWVA 4Y2DB 1F02I 3OKEB 4QRSB 5IVXE 4KJYA 3FYEB 3RIFF 2QKSA 4GEJA 1EZVX 3KLSA 3LV3B 1SUJA 2YUXA 2ZKXA 2X10A 1MZYA 1QASA 2ESVE 3IDGA 3PPEA 4JQIH 4N87A 5JXED 2BIOA 4OJFL 3HG5A 4ZFOA 4L29A 4IRZH 1ZE3C 2W38A 2QADD 1EEZA 3T0EB 3TP4A 1JZ8A 4ICXA 2DKMA 4A2HA 4XMVA 1A14L 2CK0L 3ULVC 1CQYA 4QHKJ 1E4XI 2ZXBA 4WW2F 1FGVL 2NSXA 5AD0A 3Q8CA 2VDOL 1X5AA 3RBGA 4U7KA 5A2CA 2JJSC 3AG2B 1U3HD 4NO2A 1RVFL 1T5WA 4KVCL 2W9LA 3WHE1 5FOBB 3IRPX 4PGJA 4FQJL 2Q8BH 1FIEA 4DPBX 2DQTL 1TLKA 1ZANL 3QCTH 1XZWA 4UTAL 1H0DB 4ACTA 1RZFL 3X2QB 1AGDB 4KOCA 2NLJB 3E8UL 3LZRA 4ZUSB 1FO0H 1WGVA 1UWYA 4JFDB 3ECBA 3FUFA 4P5KB 4YZFF 5B38B 1OOAA 3D8MA 2WN2A 3CBRA 3T3PB 4HKBB 4MCYB 4PV1C 2DJ4A 1QSFE 2F1BA 2BHFA 3F6JA 5DO2D 4LLVB 2UYLA 4JO2L 4HCIA 4UZGA 1KBPA 1OARH 3ESMA 3EYVB 5E00A 5LAXB 4KQ0A 4IOIA 2O5ZL 5IIEB 3WTXA 2IXQA 1A7BA 3LYRA 1A65A 2LE9A 3LHPL 2Z6FA 4LU5L 3ARRA 4PB0L 4PRAA 3VXTB 5EN2B 4FKEA 1SDAB 5I66A 1NAKL 4LSVH 1HOEA 3ZHNA 3SE4A 3MLVH 4YSOA 4Z7WE 3NACL 1AO7A 1SQMA 3Q5OA 4OKVB 3RGVA 5LNEA 3QWOB 1PZAA 5DD1H 1BF2A 1FCCA 4XMWA 4OZGF 4XN4A 1JZHA 3DROA 5CGYD 4JFTA 4D9QE 3L4ZA 4MBRA 3NCCB 1NC2D 4WUUB 4F9PC 2X88A 3G6AB 3KPOA 1F3RB 1FJ1A 1G9ML 5EU3B 4FFWC 4U49A 1OLLA 3VXOA 3BD5A 2MCAA 3NZSA 1ZTMA 2YWZA 2ZUUA 4WRLA 1DFXA 2WTOA 2ZOLB 3GBML 3GZOA 4NQCD 4W1TA 2P49B 4ZK8A 4EMZA 4HAFA 4HJ0C 5KYWB 3COOA 3SJVB 4KVPA 2WINA 3DKHA 5AW8B 2CRIA 3KH3A 3GK8L 1C8PA 4K2UL 1Q0EA 3CDGA 4FXLA 3LEYH 3PUCA 2MPAL 2VITA 2H26B 3IAGC 2ICCA 3DX0A 3FUDA 1DR9A 4JRXB 4PJAF 3T09A 3V0WL 1KTCA 1KTJA 3QIWD 5HYJE 3GTNA 2GITA 4XR8C 4IBWA 1DJXA 4KO9A 1INEH 4HLZH 3H7BB 5F3BB 2VR7A 1B9ZA 5HVFB 1IQWL 4P2OA 4AI7A 1MCBA 4D0BA 5K9JH 5I1HL 1HEZA 4G1EB 2VWEC 3BSZL 5D71L 5SWSB 3B7YA 3IXTB