3AGWA

Crystal structure of the cytoplasmic domain of g-protein-gated inward rectifier potassium channel kir3.2 in the absence of na+
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
199
structure length
196
Chain Sequence
IQRYVRKDGKCNVHHGNVRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural determinant for the control of PIP2 sensitivity in G protein-gated inward rectifier K+ channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords G protein-activated inward rectifier potassium channel 2
total genus 38
structure length 196
sequence length 199
ec nomenclature
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3agwA00
3ATEA 5KUMA 2QKSA 3SYCA 3ATFA 3SYPA 2X6CA 2X6AA 1XL4A 3SPGA 3SYQA 3AT8A 2WLMA 2WLHA 3SYOA 3ATBA 2WLJA 3SPJA 1N9PA 3ATAA 3JYCA 3ZRSA 4KFMA 3SPCA 2WLIB 2WLIA 1P7BA 5KUKA 3K6NA 1XL6A 3SPIA 3SPHA 2E4FA 1U4EA 2WLNA 2X6BA 2WLLA 2WLLB 3AUWB 4LP8A 3VSQA 2WLKA 3ATDA 3SYAA 1U4FA 2GIXA 3AT9A 3AGWA
chains in the Genus database with same CATH superfamily
1NEZG 3DV6A 5IROD 5BW7A 2XA8H 1KPUB 3UJJL 1SDDB 4WJ5B 4M1CD 3UTPD 4D8PB 3FCTB 4ZODA 1CLZH 3L3HB 1AHKA 5T1KA 4QRRE 3FT0A 1MHHA 5D7SL 3ULUE 4WHTA 4JFWA 1BGXL 3VRJB 4UYQA 2J1XA 5J6HB 3U83A 2HTLD 2DJ4A 1KG0A 4PGDB 4X7DC 3KVQA 1UT1A 3HC0B 1KBVA 3KLKA 5DMJB 2FX9H 3MCKB 2BOBB 3GIZH 1H8OA 3MLVL 3VI3E 1HCYA 3B3BA 5E9NA 3QNYA 4GFXA 3SE8H 2W65A 3VGHA 3SYAA 1I8LA 4OUUB 1WCQA 5C0RH 3IDGB 3V4PL 3SBWA 4PJ6A 1MCRA 4GIAA 3DOIA 4QHLA 4CC4C 1MJ8L 5DD0L 3SE6A 3LCYA 4MZIA 2PP7A 2C9AA 4XCFL 2HPOA 4DKEL 4WHTB 3OMIB 4QYAA 1LILA 3RX7A 4FYTA 3TNMA 5DWUL 4FNUA 4HFUL 1W2KT 4FFYA 3FUKA 3CFEA 2EH8H 1A1NB 3CVIL 5IT2H 3AT0A 5DHEA 5H2BA 4BZ1A 1W72H 4FXLA 1RJZA 4ODSH 4X5XB 3O6FD 3WIIH 1P0SE 4JN2A 3RNKB 3HIZA 3SKJH 4ZQKA 2DIEA 4DESA 5JW4N 1ZK5A 4FFVD 3VI4A 3VVWA 4CAGA 1EJ8A 4TOYL 3BAXA 1XCQB 3TCLA 1QUNB 5DQJB 3N42F 4BKLA 1RJYA 2WINA 5D5ME 3KDPB 5BPPA 5LCVH 3V0DA 5AOLA 3TTSA 1EMTH 2DQUL 4HS3B 5JXEC 2CO3A 2VR9A 2K9FB 1R3KA 2IDFA 1AOHA 1GSKA 1PSKH 3PL6A 4AQ8A 4FFVC 3IFLH 5AZEH 4B3EA 3VI4B 1X4ZA 3KBEA 4XP9H 4NO5A 2H9GB 3O2DH 4G7YH 5DFAA 4EO5A 5GISH 5DA0B 3UPCA 5GGRA 1WFTA 4L4VA 3GI9L 3WFHA 2XIBA 3GKWH 4HS8L 4MAYB 1IGTB 4H8UA 2DBLH 3MROA 1RFDL 2YEZA 1CL7H 3LKPA 4LCCB 3VXRE 1B0IA 3G6JA 3X1EA 2VQ1B 3EDDA 4LCWE 4UT9L 3E1F1 3TN0D 2ZUXA 3I6GB 2XHNA 3CN4A 2DEWX 2YSSA 3TPUB 5JLZB 3GZQA 4W4OA 4O5LH 3BW9B 4WCYH 3GMMB 2BCKB 5HHPB 1U95B 2WYZA 3QDJE 4IMLA 43C9B 3FT9A 3MRKB 4NRYB 1JPEA 1ZLWH 2HTLC 2N4IA 4WJG3 2ADGB 3BPOC 4ABWA 3GUTA 3BDXA 4LESA 3F3HA 5DZPA 2X4OA 5MEQB 2Z4TA 1KBPA 3DIFB 3LXAA 3NG5A 1B2WL 4ERSH 4WO0A 4F7MA 1I9EA 4BD4A 3I6GA 1ZTMA 3GXMA 3RX5A 3ARVA 4TUOA 2P42B 4PV1C 3PHOA 5JLZA 4I0PC 4W9DC 1HSAB 3TOPA 4HWZB 4P5MA 4W9LC 1WA1X 1G0YR 1TSHA 2I7OA 4XGZA 2VLKE 2E6QA 1D5ZB 4P2RE 2FX7H 2NRDA 2Z31A 3WN5B 2RAMA 3EDFA 4BH8A 1FGVL 5D2LE 5IF0A 3WTXA 1HYSD 4MSWB 3HPLB 2X41A 3GMPA 4LLYB 5AOZA 5F1NB 3M1CA 2X6VA 3H2WA 1FZOA 4UIKL 4FXGC 2I60H 5D5MF 5I1HH 1HKLH 2HUEA 4M8VA 2B1HL 5IJKA 1L3NA 3EJYC 3BJLA 3BZEA 5KS9A 1DCLA 2X4NB 4QKTA 5DDHB 3V5DA 1CE6A 5AWNL 1NCTA 1IKNC 3FAXA 3WHXB 5L88H 4Y2DA 2BZ7A 1L9RA 4LCIH 5GGTA 1GYUA 4NXKA 4N8PA 1NKOA 3T3MF 1UZ8B 4QIRA 3HE7A 4PRHB 5IVOA 3NJMA 3QXUA 4IRZH 3BPCA 1SMOA 4I1PA 3LJ3A 3MUGB 2IGLA 2PW2A 3M7FB 2NYYD 4S0SD 1QVOB 2JKNA 4YSAA 2CRYA 4CMMA 5JOFA 4YXHL 2XSKA 4BFOA 1ET7A 3MV9B 3EO9L 1UA3A 2Q8BL 3N9GH 4FFYH 3INOA 4K9EL 4KMTH 5JW3L 2OBGA 3DX7B 4OCWH 3QXAB 4LGSB 4PJ5A 1NIFA 3CMOH 3Q8FA 4P05A 1JF6A 2R2EB 1E30A 1SXBA 2CMRH 2YXWA 4HEPA 4BSJA 1PZCA 2LAGB 2F61A 1PZAA 3BPCB 4Y19A 4MZRA 4XZUB 4KKQA 4AE1A 4YHNB 3T0EB 4ZMTA 2RQ8A 2CRIA 1LP9F 4P4KA 2JCCA 4UB0H 5MEOB 2VWEC 2D3JA 2JCCF 1NDTA 3QDMA 5DJAB 3HAEG 2Z0BA 3TVMC 4JHZA 2H8PA 3VXSA 5KUKA 4PLJD 3KWVA 5EDXA 1XF4A 3RWGA 2NW3B 4EBQH 3ABGA 3E8UL 4WTZA 2IOOA 1J05A 5I1IH 4OFDA 3NIFE 2PWEA 5HHVL 3NDZE 3PWVB 1WISA 3L48A 2VW6A 1JNLL 2Y36L 2CLZA 5GRWA 3MRGB 3P2TA 4LSTH 3HR5A 4ALAC 1LE9A 2Y7LA 3O4LD 4W6WB 4YBHA 5IQMA 4JPKL 4TSCL 2XWEA 3MREA 3LZFL 4NEHB 5T8IA 5B1CA 1PYWB 4NC1C 5DR5H 1GRWA 4KJQC 2AJ3B 2JI3A 4IOFC 4G8EA 1ASPA 2WWMD 4MA8H 4YSQA 4YQXL 5CCKL 4UTAA 3ROOA 4NP4H 4Y5XA 5E6IB 4IMLB 1J9TA 2YO3A 1MI5D 4G8GE 3SGKC 1C5CH 5MI0C 1DQJA 2DMGA 1NDGA 5F7AA 3UBXB 5B38G 2P7TB 4KX8A 5MENB 2R0KH 4BK8A 4EKJA 1E9QA 2NR6C 1FVCA 3QWQB 4MAYD 3VX0A 3EJYD 2YPVH 1RUPL 4JGNA 2CO2A 4AKOA 1BA9A 2Y25A 3WJLA 1YEHH 3I9GL 5LG6A 3MRIB 2D3VA 3DUSB 4IBZA 5GRVL 4JLRA 3Q13A 2AJ3A 3GNML 3U6XA 2AF2A 2AP2A 1Q1JH 3CFTA 1F41A 3BUBA 2OFQA 3ROOB 2C34A 1F4WH 1GGBH 1IQDB 1BEXA 2VITB 2VZVA 1AXTL 2YKKA 3RE0A 5E9DB 5C0CE 3UJTH 1KJVA 4BZ2A 4BH8B 4HUWB 4PV9A 5LBSA 4AQEA 3L4TA 4FCHA 2Y07H 2YLHA 1VADB 2VE6B 3QWOA 2ERJB 2OMYA 5CEZH 2R7EA 2XKUA 4LLQB 1YA5A 1ZDQA 4N90D 4MXVE 3TBYA 1NCNA 3ZO0A 2D7TL 1D5RA 3C60D 5BOPA 3T1FA 4JY6A 3WHXA 1R9FA 3HN8A 2P5WA 1J9CT 4TVSa 5KYYB 2VM4A 3UTZA 1HILA 5F0LB 1KEGH 5D2LA 2HLFD 5F9JB 3VWJD 4JFZH 2ZUVA 4ZUTB 5EU3A 4B9YA 1IRAY 2QVKA 4KKZA 5IB5B 3B9DA 1E90A 4BUQA 3VD4A 4TRPH 3SDXB 5JDJA 4X4KA 2OTWA 1KCRL 2O5XH 5GS2D 4J3BA 2DI9A 1E4WH 4Y19D 3K4ZA 1QRNE 4O02L 2XTLA 5GS3A 3QDMD 2RJMA 4OFVA 1KBBA 3T1FB 2IDQA 4JDTH 3N40F 3TZVA 3GSVB 3O6KL 2ZYSA 1IX2A 2FJFB 3HG2A 3VW3L 1TTGA 1J5OH 1FH5H 5GHWL 1DVTA 1W6LA 2BW4A 3Q8CA 4JM2A 2F54D 4DN4L 5C6PB 3W9DB 4Z6AT 1BYOA 3HN5A 5DZOA 3MBXH 5I0WA 2MTAA 1GOGA 1P7KB 3OQ3B 4BQCA 2NXYC 2X70A 1AGCB 3JV6B 3TJPA 3D0AA 4L8BA 5IUSA 3D06A 3QUML 3V5KA 1FH2A 3JZ7A 5I16B 1HHJB 3P02A 5CLYA 1B3JA 1J0ZA 2FNWA 3VSQA 4NWUL 4NZJA 2A6DB 1WWCA 2WWMC 4ZFOL 1U8CB 1JVOA 3AY4A 4V1DE 4AKQA 4KK8D 3L3JA 4HFWA 2FBJH 4XMLH 2FAUA 3IGKA 1N67A 4HCRL 5MEPB 2WLMA 1A4BA 3KPOB 4JO4L 1UKSA 4DGWC 3ZO9A 2WB1A 3HS9A 2DQIL 3HG1A 2N3JA 2Y5TA 5FYLD 2EYRA 1BREA 2WUBH 2ATPB 4FKKA 3APDA 5C0AD 4YDJB 5L8KB 4WTXA 5CIPH 1WGOA 2I69A 1PVHA 3RIAF 3MREB 2VDKH 4QRQB 4RLDA 5K9QG 4CDHA 3NMEA 2OL3H 2WK2A 3DX8A 1HWGB 1N0LA 2UVEA 1UM4L 4WDIA 1A7PH 2L0DA 1WC7B 1AR1C 1FAIH 1I7RA 3DGCR 3QIBA 4WI5A 2FEDD 3RX8A 1D6EA 5CZVH 1F42A 4PMFA 3A21A 4OZIF 1KJ2A 2IAMA 4Z78B 4OT1H 4Q9RH 1DQJB 4OZGB 1S4IA 4DJMA 3VXUD 3ULUD 4HYTB 2ARJB 3QH3B 2EKSB 5DZNA 2NY6D 2UY7A 3UTQB 3S98A 3RAJL 5IB1B 3L2LA 3FO1A 5K9KA 1PTZA 4Y2DD 4OGAC 3SGDH 3WTWA 1PD6A 5CBEA 1H5BB 3C60A 4HWBL 2DWYA 2JV6A 4LK4A 5BMFH 2EKJA 4DQAA 3FT4A 2BIOA 5HHME 1IKFL 3OPZL 2XKNB 3RURA 3VGDA 2NY5H 2A9NL 4N8CL 5AW2B 4LFHG 2A6KA 5IQ7L 3O3EA 2B2XL 2QV2A 2IANE 1KJ2B 4B53A 4GRLA 4S1RL 1P4LA 3ETSA 4W70A 3DC0A 1OW0C 3QO0B 4JO1H 4M03A 1ZMYA 3SPCA 1KXVC 1JZIA 2Q3XA 4UM9B 3QQ4B 2NTFB 3QQDA 3JVGC 4APQD 3F83A 1J8RA 5J11C 3UIZA 4AYSA 1U91B 1Z7JA 2VRQA 3IBOA 4DGVL 2VUOA 2HTKC 2EDHA 1MEXH 2X0VA 3FFCD 2XLLA 3FZUC 1LO2H 3PABA 3R4DA 1YPZF 4G8FA 1E8WA 2A99A 3EUUA 3ZL1A 1G6RL 1WAPA 1Z5LB 5B38A 3RUGF 5EU3B 1BM7A 3U0PB 4YSDA 4LL9A 4PM1A 5AAWC 3VFPA 2Z1KA 4FDWA 4KVCL 3TNMB 3T08A 1RZ8A 2BNRE 4OJDH 2DY2A 3T4AC 3BYYA 2MJWA 3VGAB 1P7QD 4P2YA 1Z0NA 2HYMA 1KB5H 4FQPA 1BQHA 4DQOL 4WUUB 4C56E 4M5TA 4F8TA 1ILSA 4OV5A 2ICWB 2A9MH 1TZHB 5ENWA 2FIRT 2YN3A 5FB8A 1ZXQA 4XPFH 4ZQKB 3EG9B 1BF8A 3H42L 4G8FB 4HHWA 1USZA 2C1OB 5KN5B 3O6FA 2D3NA 4BSVA 3VM5A 3KW8A 3P3YA 3ARDB 5ETUA 3OSKA 4PJFE 4UU9B 2TSBA 3DDGA 5HVWA 1LEIB 3BESR 3VFVB 3VRIB 4Q89A 3RJQB 1W72B 2RQEA 1JPSH 1PS3A 1SJHB 4HMDA 4KI5F 3U4AA 4ZMPA 3KPPB 2BSTA 3OHMB 1SEBB 1BFVL 4LKXA 4TSBL 4GYBA 5B3SB 1JHTA 1NBVL 3J8F7 5T3ZL 2HN7B 4MNQD 1I8KA 4FZ8L 1BQLL 3A6CH 5SV4A 4NLHA 1M3JA 3G5YB 3L1GA 4QF1B 2YC1B 3BH8A 3WI9A 3PWPB 4AVKA 3NFNA 1BQUA 1A14L 1Z3GL 4MBRA 2P8MA 1JVLA 4IBQA 3FB5A 1JRHL 3NQIA 5HJBA 3Q1EA 4U1MA 1THAA 2H9GA 1NUFA 2XV0A 3NCMA 4YBQD 2MCPH 1XBRA 4NJ9L 5HJDA 1TYJA 3ULSA 3U7WH 4IDJH 5ES4B 32C2B 4GSQA 2X6UA 1BQSA 4ZSOE 1DJZA 5HHXH 3JYCA 4AQ1C 2AQQA 4X5LA 1S46A 2WYTA 2E74C 5ESVB 2F8XC 2BOCA 4TNVK 4CN1A 4X6CE 4QLWA 2EIKB 4PRAB 3UBXI 2HG5B 4HLZH 4JY4B 3ZYZA 3EO9H 3KYOB 3GS4A 4OZHB 5DURB 5IG7A 3UH8A 2ZUQC 2XYCA 1NAMA 5MP6L 3IYLW 1AY1H 5C09E 3WU1A 4NRYA 1ZTXH 5I18H 5JQIB 2Q7YB 4X6DB 1T89C 1TJMA 1G7HB 1HH6B 1BZOA 2FZ3A 1KLGA 5DGQA 3FTSA 2UY7B 3UTQA 4IDJL 3GIVB 2QMJA 4AT6A 4ELMB 5DHVB 5J1AA 1BQHG 1IGJB 1H9DA 2BVOA 1UWXH 5DJ8A 1UQSA 4HV8B 2E4FA 4MJHA 4OGXL 4PCYA 4UUJA 5GGSB 5IV2A 1VACA 4LCYA 1EHKB 1N6VA 2I60L 4HCRH 1DVFC 4Y1SA 4JZNA 3K71A 5K9JH 4APXB 4IKIA 1EIBA 2XKNA 1AQ8A 3KPQA 4KVPA 4QKXB 2MPAL 4Z23A 5CLZA 3MUHL 2FATL 2GPZA 2Q7YA 1G7LA 1P5VA 2A6IA 3V4VA 2V6HA 4PRPD 2WBWB 1NL0H 1GGCH 2ED7A 2FWSA 2CKBL 2GC4C 1A8ZA 1MW1A 5EF2A 4G6AD 5TE6L 2EILB 3GRWH 4MLSA 2XZQH 4GSXA 4IRSA 3MTXA 3DROA 4K9EH 1XCTA 3FCUB 3FQUB 3M88A 5B38B 1VFBA 2O5XL 1R5VB 3DXAA 5DI8A 3O6KH 1AHWB 2KDGA 1F3JB 4KNUA 4OQTA 3S3CB 4JE4B 5ID0B 1M3IA 2J6EA 2P46B 4PWGA 5TE7L 4GW4A 4PS3A 5AD0A 3WNJA 5DJ0B 3GK8H 4AMKL 3UEQA 4Z3IA 2H1PH 3QBTB 2LE9A 4IKKA 1G1CA 2EXWC 2EDMA 2VB5A 5BJTB 5ENWB 4B9ZA 1S7QB 3NIDF 2GTZB 2VYRE 4MJIE 3EBHA 4JFXB 1BP3B 1MY5A 2BNRA 3NBNA 3US9A 1ZANH 5DI8B 3C6EA 3OKNA 1BD2E 1LEIA 3TEXA 2OULB 3EFFB 4XMLL 4MJ6B 3UTSB 1AHWC 4EZLA 2QQQA 3S37X 3TCTA 2X9YA 1FGVH 3BD3A 3L9BA 4XX5A 2FWOB 2Y3AA 1ZT4B 4AEEA 1X9LA 3FO2B 4GQ9H 3T8MA 5GZOA 1RURH 3Q44A 4LHUD 1J05B 2DTMH 5F9DC 3L3GA 4G9FE 3BUTA 1UH4A 1DQDL 4U1MB 3C2AL 4YHZH 3LNFA 4H1LG 4M9OA 3T65A 4L4VD 3WY4A 1AP2B 2ADJA 3B56A 4UBDC 5D72H 3IWVA 2PCFB 3MRPB 4MGXA 1K5NB 2B77A 3EFFA 2O5NA 1CUOA 2EIJB 2YGQA 2MFNA 3O4LB 4GT7A 3UG5A 5K69A 4PJ9B 5DJXA 5AUMB 4NO3B 3FH8A 2GFBB 3W0WA 1ZXKA 5C07B 5IHZB 1J5DA 1PX8A 3CCHA 3LKQA 3DX0A 1XWVA 3TONA 5EU4A 4LPVA 3QRGH 4FADA 1FG2A 2VAJA 4G8EB 4HC1A 3NZSA 3L3GB 2YD1A 1I3GL 2VDNB 4JQXC 3RPKA 3ILEA 2YMOA 5E6YA 5DC9B 2AV7A 2B8OT 3GMNA 4ANUA 4OFYA 1C12B 2VXQL 4JDEB 2KZBA 1BD2D 1KB9K 2XWJB 3HHSB 4FTVB 2H5UA 1Q8MA 3BSZH 4LVOC 5AUMA 5DHXB 5I1JL 3H9YA 1FJ1B 5I1IL 1PU0A 5EPMB 3WIFA 1DBJL 3HZMB 4G1EB 1CFTA 5AZ2L 4B41A 4X98A 4NCC2 4OZFB 4KHXH 1VZIA 2ZXAA 3H7LA 5JO5B 4YSEA 1KYOK 1S9VB 4F57L 4LVHC 3P9MA 4EZMA 2Z8WC 2V5TA 5EC2B 4Z7QE 2LFEA 1AR1B 2AQ1A 4BKSC 1P7QA 3VFTA 1FDLL 1D5IH 5F7KC 3UPRB 1UWFA 1E9OB 3EOBA 4N6RB 4YUEH 5ICXA 3NA9L 2A74B 2UZXB 3C6LA 4M61B 1ORSA 1EBAA 4GKNB 5BZDA 4ZUSA 5TDOB 1A9EB 4L29A 4QHNA 3BP6B 2QPEB 4X6BB 4FG2A 2V4LA 2YN5A 1KIPB 1DDHA 1BW8A 1HQ4A 4ORGA 3IJYB 3BGAA 2FWLB 3BWAA 4OJYA 4HU8A 1YEGL 3FQTB 1ZAGA 2F74B 2NNAB 3KBFA 5EN3A 3IAQA 5I6MA 2WN3A 4X5PA 3CIAA 2BHYA 3N9GL 4FFYL 4OZGF 7CGTA 3GHPA 2WVSA 3OKLA 5I5RA 2YK1H 2C7UA 4MA3B 1I1AB 2NTSP 3EJSA 2HPTA 4PVMA 4GKNA 2CGZA 5BZDB 2PO6C 1SXZA 3QXDA 4U6VH 4I2XB 4JFOA 1WIOA 5D7HA 4N2BA 1CD1A 1BQKA 4YHPB 2GTZA 1AGDB 2CR6A 3GHEH 3HMXL 4CGUB 4HCIA 3STZA 3CFIC 2JK5A 4OM0H 2QLYA 3B2MA 4NO0A 3BPNC 5IW6A 1OD7A 4QRPD 3ARBA 4NKDA 4IMKA 3L4VA 4P99A 5TE4L 4L0YA 1MI5E 4BYHA 3T4AB 1U21A 2WXIA 5F0PB 4NBYB 2AJZB 3V7AG 4CADB 4M3JA 2J2ZA 3B8YA 1CD1B 5DHYA 5F44A 5TF0A 5JQ6L 2CNYA 4RMUA 1YPZB 1Q9LA 2ATKB 2XQ0A 5EUOB 1UM6H 1T1YB 1XIWC 4E9TA 1TCRB 2X5PA 1EAOA 1A3RH 1JK9B 4XNAA 1QSVA 1UUNA 4ETQB 2J44A 3ZJAA 4CSSA 2QZ5A 3LZLA 3NCYS 4H0HB 2EECA 2OYPA 4ZD3L 4P06A 4KRPC 4JL2A 2GT9B 4XN5A 3RILA 3CCHB 1QZNA 4DO5A 4NP4L 1HJCA 3PHQB 4LSPH 4QTHB 1PJ9A 1UJ3A 1H9VA 2R9HD 4FA7B 4LHQB 1EQWA 4DKEH 6FABH 4QTIH 5KSAC 1QFWL 4MXWL 2MIZA 4NUJA 1V3LA 4JFPB 3ZGIA 1JIBA 4OH2A 1NJ9B 3ZE0E 1WBYB 4ADIA 4WI0A 2ZCKH 3EXJA 5E9AA 1XIWB 4HF5L 1IGCH 1C12A 1E3FA 4EUPB 5IY5B 2A7BA 3UZEA 1URZA 4XBGB 5BXFA 2EXYD 4BA8A 3RDTA 3GLAA 4LNVA 1Q9WA 3BVUA 1KCUL 4ONHA 3HBPA 1HVXA 4M6OL 2ITDB 4NM8H 4L8SA 5DD1H 5JO5A 1ZVHA 1RXLA 4KO7A 1NMBL 3ZDXF 2OTUB 3KDMA 4BHUI 2PR9A 5B4MC 5GGSY 2ICWI 2DQUH 3NIGB 3QDGB 1A0QL 1DQVA 2JIXB 2A6KB 4A2EA 4AUUA 1SY6L 2EDFA 3P77A 1KYFA 4PIBA 4WWKD 4YK4B 3QNZB 2IBZX 4HQQH 5D8JL 4MQ7B 1LLAA 4TQEL 2VIRB 4EOWH 1XF5A 1JRHI 3FQ4A 5ACLA 1XF1A 3ULUF 3DGGA 1CURA 5EO0A 5GRVK 3FTGB 2ITDA 1RK7A 1HCFX 3B1TA 1U8PB 5F7HA 4WO4B 4LAQH 4PP1C 4LXFA 1INEL 3TBCA 3KWXA 3X12B 2PP8A 3K8KA 3CDYA 1JGVL 4PWJA 3RX9A 5JOEA 1IFHL 3MLYL 2BDNH 4K23H 4WNSA 1PNDA 2JB5L 5AVRB 5INDA 2AXFA 3F58H 3HZYB 1ZV5A 3K4DA 5T3XE 3EGXA 2DQHH 4HIXL 1PDKB 2GJJA 4Y16A 3RWCA 2XN1A 1A3QA 2O6CA 1QPXA 5L0QB 3VDBA 5F7YC 4WI8A 3F7LA 3MRLB 2GIMA 1BHGA 5J56B 2MSPA 5J12B 2EDOA 2ADFL 2ZG2A 1KENL 4X2UA 1AI1H 3WNLA 3FSWA 2X6CA 4IOFD 5CP3A 2R69A 5DJCB 3ZE2F 2IIJA 3RWEA 2WXLA 5HYJA 4HIHB 1BFSA 3TH4T 1T1WA 3HZYA 1MJJA 1MSPA 2OMVA 2APVA 4RDQG 8CGTA 1SEBA 5C1MB 4FA6A 1NCBL 2DKUA 3L3KB 4N22A 1HK6A 2VDRB 1AI1L 1FLTX 1UOVA 2ZKMX 2PF6A 4IK7A 4UT6L 3MX0B 1AGEB 4AI7A 3HKZA 4R3SB 1U2YA 3FB6A 1U8JB 4NQQA 1ZHNB 3QZNA 4PREA 1I9RH 1EMTL 4RMRA 4RGNB 2BWIA 3BAWA 5C08A 3C6SA 4JUTA 4XMTA 3OXRA 4E41D 2NPLX 4N3UA 4NUGH 1CF8H 3V0GA 3ME0B 2COVD 4HEPG 4KUZL 4Q4EA 5C0AA 3C5ZB 3EYSH 2VDRH 5DLLA 4JRXA 2HXAA 2M83A 4H5SB 3X13A 3DMMA 3ZZLA 2QQLL 3IDIA 3WS6A 3ZZQA 3QYCA 5I1KL 4PWIA 4QTHA 4WFHE 1OSEA 2R56L 5E1GA 3UTTB 5ESAA 3M1BA 3QIBD 5T5NG 2YAFA 4M7JH 2EYSB 3SE8L 1OCRB 3K6DA 2FWUA 1DSWA 4HFUH 4PG9B 4JFYB 4U0RB 3D07A 4NPJA 4AIZB 4ZMAT 3SODB 1NGYA 4X0NA 4HQQL 1JZ2A 2DYSB 2KL6A 4TKWA 4KNQA 1QBBA 4X6DA 1RZGA 4GRMB 1RUKH 3IVKB 1OAJA 1JGLH 2ZOOA 4YSTA 2R51A 5FXCH 4R7DB 3PP4H 4E9LA 4P2RD 3OQRA 2ZWLT 2DKMA 3V4LA 1DHKA 4HP5A 2IC2A 4JE0A 4KK6D 1UQSB 3FN0H 4GUOA 3BMWA 3IDIB 1QWNA 3WKPA 1CN4A 3AABA 3QHZL 4NCDA 4MMXB 1MN4A 3VXMB 5BS0E 1EZVX 4M7ZB 4X4YB 3ZYOA 1KTCA 3B6SA 1JL8A 2BVQB 3GPEA 2GK2A 4IHOB 4U1KB 4XXDB 5DD5H 2HH0L 3ULVE 1T03L 1V3MA 4NT6A 5CXPA 2A2QT 4LPYA 4NRZA 4XP1H 5K1JA 3V4VB 4YJZL 1A3LL 5ACZB 2KUTA 3BKYH 2ZCKL 4TQHA 3WUWG 5IEKB 4WW2B 1KN2H 1U3HD 5DSCB 1B2YA 5HPOA 1BYNA 4G6AC 3ZK0A 2VCOA 4ZI8A 3JV4B 4FQIH 1JE6A 3V4VH 4PWFA 2CGRH 5K59F 2HVJA 3CSYB 4MMXA 5IFAH 5HDWA 4HSQA 3VA2C 3BFWA 2QEJA 3O81A 5JORA 1BVLA 3MV9D 2YXVA 1H3TA 1FLRH 3H0TA 4JMNA 1JWUA 4B9GA 3OKDB 3GSXA 4QHKJ 4WGKA 5TFSL 1A1OB 2WCSA 3L9YA 2X2IA 3FO9A 2R2HB 3H9HA 4U1NB 5CN2A 3FH7A 2JKRM 1JTTA 2ZQKA 2FGZA 3HMWL 5D2NB 3JT2A 4XHJD 4XCCH 4L8CA 1Z9NA 1BBDL 5D4HA 4NQSB 4JHBA 1TFHA 3P73B 3L7EB 2DI7A 1OT1A 2Z64C 3QFJB 2NZ1A 1L0XA 4MJID 3DA0A 2OMZB 5JORB 1KLUB 1T4KB 3QEQA 2XPGB 3S36H 3TYGL 3HNVL 4L4TD 3SJVE 2F54E 4HIHA 1U92A 5IR1A 5ANHA 4P5TC 1CBVH 4H2CA 25C8L 1GTFA 3DIFA 5LDSA 2HRPH 2FUTA 3K46A 1BD2B 4L8CB 1WWBX 4P2RB 5HY9B 3LNGA 2XJKA 4QHMB 3QUXC 3ZZ1A 3JZYA 3NN8B 3HFML 4R3SA 4MS8C 1B4JL 1NC2B 2IQAA 2QQLH 4P5MB 1EEYB 4E9SA 4K23L 3TIEA 4AEFA 1F86A 4C56A 2RTTA 3H2PA 3CIQA 1T66D 2ZKHL 4IIQA 1OCWL 3IGFA 1INEH 3NESA 1L6XA 3NZ8A 4GSRA 3QEUB 4XP6H 3FUFA 5TF1L 3MYJB 3P3SA 1O9VA 1PEZA 2YAMA 4R7NB 3SDAA 2Y2WA 3QRGL 2OW6A 2HMID 3HI5L 2B1OA 5DLML 3FTZA 2OMNA 1X3DA 4K15A 4P2RA 5E94B 3MNVA 5I8CB 5F89B 4D0BB 2CKBB 3JWDC 4PJ7E 1XF2A 5FOJA 4I87A 3EF7A 3KH4A 1M57B 2DQFB 1ZT1B 5E4IA 3T6QC 2VDMH 1ROCA 4WV1C 5C0RL 1XGUA 5C9KA 1GYAA 1VKXB 3A6BL 4MNQA 4PJIE 1O6SB 3BQUA 4PVLA 4YFLI 4XRCB 2HFEA 4EJ1C 1GY1A 5HYIA 4HJ0C 3EH1A 4OCSL 4JHWH 3EYUH 3QRBA 1TTBA 4O2FB 1A0QH 2AQ3A 1C5BL 4YPJA 5L9DH 1HESA 4QHKI 2OMBA 5SX5H 3TU6A 4AEIL 3W38A 1HDMB 4ACTA 1GOFA 3U4BL 4Q9QL 3BVVA 2XG5B 2G9KA 2QKIB 3VCLB 2KLTA 4JB9L 3JWNC 4KDTC 3U2IA 4XZUA 3CDZB 2ZOUA 3B7SA 3VXSD 1HEZA 5J13C 1ASOA 1HCZA 3QDMB 5DJAA 3D0VA 5CEXB 2BXYA 1M7XA 2UZXA 5D7IF 1N0XL 3QE5A 4IOSA 1C5DA 4PBWD 3MGOB 2CPUA 1GW0A 3HS8A 1JYXA 5TDOA 4A68A 1VGEH 2OV0A 4TULH 3ZU8A 3FT2B 3AITA 4M1CC 1YEGH 5E00B 5HYQB 2YGNA 3O2VL 4HWUA 4JK0D 4RH4A 3GSQB 1B90A 1HDMA 1OTSC 4WW1B 2CSPA 2PR4L 3FSZA 4PRID 4PUBL 2R4SL 3KE0A 2FX8H 3U36A 4HJJL 1DJGA 2QKIA 3QR2A 3CBRA 3HE6A 4UIMA 5LN8A 3H0TB 2J4WH 5JA9A 1EEZB 4MX7B 2L3BA 3S88H 5JNYA 2EVGA 1F3DJ 4YDVB 3FO9B 1RLBA 3QCVH 2XWTB 5E8DH 3I50H 1TEYA 3NJNA 4FYSA 3LPGA 2FDBP 4ODWB 1Y07A 2AXWA 2H0PA 5G55A 5KVGE 1ZLWK 3SBQA 4POZC 3VU2A 2G5BA 2EE3A 2FQFA 4QO1B 5DC0A 2GTWA 3JWNE 5H37G 4L1DA 3MRBA 4IS6A 5LAXB 2J8HA 1EXUB 1EJOL 1NFKA 4EKXA 3OXSB 4HKXA 5BRZE 3BE1H 2J1KA 2WZPA 2EYTB 1KGXA 5I0ZA 4ABVA 1AZRA 2J1WA 2H3KA 3BP5B 4B9KC 4G72B 3A6OA 2BIQA 5DJDB 1K8DB 1EHNA 3RY4A 4L23A 1KF9B 3E38A 9PCYA 2X1OA 1FZKA 1EFQA 4GXUN 1AGBB 2ZJSH 3IFOB 3K6IA 4N8VA 4P4RA 1AYRA 3X1NA 4W81A 2MMXA 4Z95H 3REWA 4QO1A 4I3SH 3U9PL 3GBML 1P7HL 4WTWA 3MGAA 1HINH 4H8PA 5EUKA 1S7SB 4XOAA 2WVUA 2G4GA 3MUZ1 2R56H 4OLXH 4QMEA 3W9EB 2DQHL 4HIXH 5KVEE 2IVFC 2AK4D 4AQEB 1XT5A 2YD2A 1OAQL 1FSKC 1PF3A 1R46A 1QR1A 3PP3H 4GI8A 5MERA 4FN0A 1NEUA 2IH1A 3V4UH 1AIFA 1DQIA 3T2OA 5IREA 3KPRE 5ECJE 4IW4C 3TO2B 1AMXA 4HKJB 1JNHA 2FHBA 5IVXF 1LD9A 5EZJB 5A6IA 1PKQB 4LSQH 3GLEA 4J6RH 4LCWA 4M7KL 2HJKA 3EO1A 3INUH 2P5WB 1I31A 2Z34A 5KSAD 4ZMOA 3B2VH 3D7PA 4Y4KD 1SNRA 1QBLL 5A2AA 4OQTL 3ZE2B 4EAEA 2APSA 1TCMA 2LV4A 3MMEA 5FCUL 1RUMH 4UINH 4XE0A 2GYSA 4MNQB 1DQMH 3Q2NA 4JZJB 4P46C 4XH2B 1O9WA 3H53A 3PL6C 2OAAA 3SO3C 3VQMA 2Y7OA 4K3JH 5EFIB 1OF2B 4ONHB 1ZA3B 3ZE0F 3QXVA 4PRHE 5DK2B 1T6WA 4GG6E 3S2AA 4XWGH 4ONOA 3GSVA 5IMLB 4PCSA 1DJIA 2CH8A 1RY7B 2X40A 2XNAB 1BZ9A 5CP3H 5I66A 5F2FA 1HL8A 3T3PF 3TJHC 4FG6C 4APQB 1PW3A 4MNGE 3QQ3A 1KXQA 4W9KC 3F12B 4JR9L 3RDJA 3MLWL 3H9ZA 3CDZA 4JO3H 3GUFA 1TJIL 1LO3H 3OWEA 3QJHA 5D4JA 2EDJA 3DBSA 1NINA 4A2HA 1CXFA 1OSPL 5D7JA 4QRBA 1RZ7H 4TTGA 4K9JA 3ILQD 1W9XA 4N0YH 2H0FA 4L3EE 1BVOA 4F15B 4PG2A 1G7JA 3P9WB 1BZQK 5JHDD 5ITFB 4ZDHB 3K2IA 3MXVH 4JVUA 1E4XH 3AT8A 3FH5A 5E0QA 4AYFA 1SM3H 3T4YA 3F12A 4FEMA 2BSEA 1M7IB 2H3NB 2VO8A 2YD5A 3BAYA 3EGXB 3UBFA 2FLRT 5F7LB 2AQTA 2VQ1A 4DKAA 3SJVB 1FC1A 4OLZL 1F6FB 5CJBA 1FL3A 2Y5QA 2EINB 2YGPA 4QXWA 3MU3A 4R0LB 5EZLB 3UO8B 5LBVA 1M71B 5HGGS 5D1XE 2BSDA 4N1CA 4CN4A 3DOSB 3MACH 4HZAA 1HSBB 3CN2A 1G7JB 5JR1H 2Q2LA 3F7PC 1GJUA 5D1QC 5DK0B 4KQ3L 4WWOA 2XVKA 1F11A 1TQUA 3RRQA 5EBMA 4AJVA 1LK2B 43CAA 3TASA 3EYQC 3RJOA 2D31A 1DANU 1NMAH 3KVDD 3L16A 3VMPA 4ELDA 5KG9A 5IVXA 1GS6X 2CO6A 4P4RB 5C7XL 5FHBL 5D2NC 5LBGA 3V6ZB 2KPNA 2SEBA 1Q9OB 1RIUH 3EJZD 1PAMA 3QR0A 1IJNA 1XZ0A 4OT1L 4UNVA 4Q9RL 4JKWA 2FHFA 4XPHL 5DK0A 3E6FB 3ZDYF 3D51A 1MRFL 3W9EA 3BD5A 2ICEA 3P40A 3HI1A 5IESH 3EH2A 4K2UL 4Y4KA 4KKPA 5IF0B 1S2EA 2QHLA 3QUYD 1BWWA 2VISA 1XGPA 4AYBA 2D7QA 1I9IL 4MD4B 2DLFL 4HOMA 1FHGA 1NPJA 2EDKA 4WU7A 2X4NA 5GQBA 4P5RA 3AZUA 4GRWB 5ABDE 1DSFH 3DV6B 4JCMA 4HZLB 1UHVA 2DQIH 2DQCH 4JY5L 4QJ5B 3FCTA 3E6FA 4QXGH 2R59A 1PIFA 4JO1L 1NCAH 2DBJA 1CE1L 1U8IB 2OZNA 3OG6B 4IRJC 4TUUA 5FECA 1A6ZA 3D09A 4GRMA 4PGEB 2OI9B 4V1DA 1S7TB 1NGXB 1DQKA 2IJ0C 3PLYA 4KFMA 3NJJA 4CBZA 2JMRA 4CMMB 1Z9LA 2I9LA 4DEPC 2X1QA 1AO7E 1T5XA 3OHXA 1LO5A 3L5HA 4NENB 2L8AA 2VM3A 4WU7B 3T09A 4IQHA 3CQPA 1MCOL 4YN3A 2EDWA 4C4KO 4IRZA 4BRVA 4JAMA 1DBJH 3MTRA 5CFAA 2EE9A 4IRJD 4WWKC 2GSIB 4N24A 1FYTD 4KVNH 3ARDA 4OCXL 5ETUB 3SGEI 4KZEH 1RHHA 1J5OL 3VRIA 5ACZA 2YR3A 1L9SA 1NGXA 5MEOA 3ZE1B 1MIEL 4HJIA 2NY1D 4PBXA 4GSUA 9CGTA 5KS9F 1MPAL 3P54A 2IMNA 4DP7X 2AC0A 2BP5M 3TN0C 1U3NA 3CLFL 3IN2A 4LSUL 4UQEA 1FNGA 5DZAA 4NQED 2MOGA 2C7FA 3BSGA 4HPYH 3SGKA 1IAMA 1CGYA 2ZXBA 1HJBC 4LBEA 4YDKH 1N2RA 5AB9A 2NR6A 3AADB 4F2MA 4ZUVA 1A7RL 3DRQA 4E5XB 1BSIA 2FHCA 3IU3A 4WK4B 4R7LA 4UTBH 2VLRA 2WQVA 4TF4A 1DBBL 4PJCA 5IHUL 3NZHL 2X0UA 2H6PB 2PYEB 3X1BA 5JXAL 5KVFL 3ZR6A 1H15A 5IMKB 1KULA 5IEHB 5H4YA 5SWZB 4POYA 1O7SA 3BIAX 5I26A 1JMXA 1T4KA 3QEQB 5AKTA 2KH2B 1XSJA 2HT3C 3W81A 3EUDA 3U4EA 1R3IL 4K07A 1FA4A 1KBGH 3RBSA 1NDGB 4OFYD 3UBXA 2VO5A 2XG4B 2JKIS 5I73C 2YEZB 1JP5A 1ED3B 5LVEA 3QB7C 4NZTH 2JI2A 1QEWB 5JXAH 4LCCC 1Z9PA 2FJGB 2DWEB 5FGBA 3FN3A 3MBEC 1CXKA 1ZLDA 4IEFB 1MI5B 5LGYA 2O5YL 4HBCL 5CZVL 3SQBB 1SJEA 2V17H 5EOCJ 1BAFH 4I9WD 4JFSA 5CZXD 1XZ0B 3O2DA 2K78A 5HHPA 3WEXB 3ZSTA 4XPFL 1YNLH 4JDZB 5DD6A 1JHKL 2JJWA 1NH6A 3EKCA 4OBSA 4GI6A 4PJAF 5E4OA 2ODHA 4FQJL 4L9LA 1BWMA 1WWWX 4XI5C 1EANA 2E9IA 4XO3A 5C6TL 3QG6A 2G5RA 1DFBL 1C9SA 3QAQA 2VLKA 3IRPX 3KBHE 4PB9H 4MB4A 3S0PA 3R06B 4G80A 3TZVC 1I1CA 4AITA 3VD1A 2BC4A 1IBBA 4POZD 4FGMA 5IKCA 1I85A 1ES0B 2IANB 3RJDA 2Q20A 3O8XB 4S1RH 1COBA 3MGTB 1GGYA 5GSVA 3WN5A 4JHAL 2VDOB 1I3RA 3MV11 4Y2LA 3L3OC 1YJDC 4X80L 2XBTA 5GS0H 4KXZH 3CFEB 1XTLA 1M2VA 3E8UH 1BFTA 3V0AC 5K9OA 1KEMH 2WO2B 3FHAA 1KTRL 2IWFA 3QJXA 4HX1A 1OAZH 2GUOB 2BFVL 1IBFA 4ZSOA 1NLDL 4XCEA 1OT2A 4J7RA 5F93C 3C09C 1ES0A 4LRIC 5HI3C 1IAII 1YEFL 4WKZB 3C12A 3TBBA 4JRXD 4P04A 5IHBA 1TSRA 1U8HB 2F53B 1FAIL 1P4UA 2YIHA 2PW2B 3LHPH 2ZOLA 5IMMB 2GEQA 2HT4C 4Y7OC 2YRBA 3TJHD 5CEXA 2A9ML 3C5SA 3L3OB 4ZO6A 3OJVC 4B60A 4K8RC 1Z3RA 4ZS7H 1Z5HA 4R4BB 1NGQH 2WXRA 5LBSH 3QUMA 3DX7A 4PQXA 4XN8A 1MJUL 1QSED 2V5SA 3CFKB 4PJ5B 4RGMB 5IJVA 5LG1A 5D2LF 2BS71 4AV5A 1P4BL 3FN9A 1BIHA 1KPVB 1BJ1J 1MFVA 3DX3A 4E9VA 1T83C 2NQDA 5EB9A 4ZO7A 2WTPA 5DVNA 4OFKA 2CQVA 4QOKD 3HG1B 1K9TA 4PWHA 2NNCA 4LLDB 4ZUVB 3RY5A 2Q2EB 3W0WD 4Z3HA 4G9FA 2X4QB 4N28A 3PG2A 5I1AA 1S8DA 1TLMA 4HA1A 2WKOA 1TFPA 2C9XA 3IAPA 4QOKB 1NBCA 1OPGL 2GJZB 1JBJA 3D12B 4OZ4A 4PJCB 3VFNB 1TVHB 1AXTH 2DQDL 4H1LA 1E5YA 5GS0D 5KVGH 1CVSC 2LFGA 3LRKA 2Y6TE 2PPFA 4C55A 4Y2OB 5EMYA 2NY5C 2QR0B 3LEYL 4H4NA 2NSMA 4J27A 3RGHA 4YLBA 3R19A 3T3PB 4XBEH 4O00A 5CM1A 4MCNA 1KXVA 1J0KA 1UB6A 4ILDA 4OZGA 3S34L 2DZEA 2BY3A 4PR5B 1BM3L 2QQKH 1CK0H 3DV4B 1E4KA 4X5WB 4X9IA 2DIAA 4OCLC 3LSOA 3V0FA 1HZLA 1EA9C 4PP1D 2Z93A 4ORZC 3V6OE 4D0DA 4NP9A 4F3FA 4S0HA 4HCGA 1RZJC 1Q94B 3NSXA 5I30H 2Q1EA 4TYUA 4XNUH 5C07D 3E6HA 5C0IB 4OGAD 4OIBA 5I6XC 4X6FB 5JUEH 3U7YH 3SDAD 4UI2A 3MXVL 4GEJA 3C8HA 3HAEB 4ICWA 5FYKE 3S5LA 1VGEL 2DD8L 3G7TA 4PRIE 3MNWB 4U0QB 3N1FC 4BZ2H 2WWKO 4OJFL 3DUSA 4TTDC 4FQQA 3A4AA 2FLMA 3NSYA 4XX1G 3T77A 4HDIB 5I17A 1JGDA 1FYTA 1HEHC 2IALB 4JJ5A 1KIPA 3UC2A 4PWEA 1XGQA 4L4TA 3GB7A 3LZRA 5DCCA 2Y07L 3E6HB 5EH1A 2GCYB 4MYPA 1M9SA 3WFDH 5KYXA 2OR8A 3PU7A 2R29L 4DP5X 1MFDL 1OHZA 4NAJA 3N43F 5EIIG 4OZIA 1VADA 2Y6SC 5D7KE 2YLKA 4G5AA 5I71B 1SDYA 2PKDA 4UOZA 5I6XB 3LVEA 1YEEH 2VMDA 3V0WL 3W2DH 1ZWIB 3K2KA 1DVSA 3GD1C 5I1CH 3EXLA 3UTZB 1O5PA 3S8FB 1F3RB 1WUNT 2F54B 2M1KA 3B7YA 2GCYA 2CUHA 4K55A 5FYLL 5HJGA 1AQKH 4OGYL 3ZDYB 1HL9A 3L5JA 2VLJE 4X7CC 2BNQD 4Q6IB 4AQ1A 4WHCA 4Y19B 3ESOA 2OTWB 4YHYB 3O2WH 4Y2NA 3MRJA 2BSTB 1MHCB 2JQAA 4IOSD 4JDTL 5JTWA 4M6NL 5DS2A 1HU8A 4YL9A 4PJHB 3K5RA 5JDSA 5D7EA 4ZK8A 4WY7H 1A1MB 3FUJA 2X38A 1KNOA 2X87A 2CA3A 5DQDH 2G0LA 1QRKA 1F90H 2MKWA 2FJFA 2OW7A 3O3DA 3OLEA 5E7FA 3MJ9H 2P8PB 3VGGA 2X2YA 4XP4L 3FNKA 2E56A 5HI5C 1EFXD 4G43B 4HKZB 3VO0A 5KVMC 3PXJA 4Q6IA 4HUVB 1BZDA 3MODL 3MRGA 3PHSA 3K6FA 4M1DH 3NCEB 4HS3A 4KHTH 1IGIH 3NJFA 1XSIA 5AENA 1AGCA 3CU7A 1QHPA 3JV6A 3O0LA 4BFNA 2FD6L 2I5YL 2H2SC 1HL5A 3S97C 2ZXEB 4LARL 1HHJA 3PS6A 1DVFA 2ICES 4ZFQA 3MYZA 4XVJL 5G2NA 2C9VA 2VR7A 4GS7B 5ICYA 3HUJB 3EFOA 3X11A 5A2FA 4C83B 1WBYA 4G42B 1EZLA 4GO6B 4XTRC 3LIZA 4XMPH 3D18B 4F7PB 1F4WL 1GZPB 2NXZB 3CN0A 4F8QA 4GKZB 5EOQH 3LV3A 1XHHA 4ZFFB 4WEBL 2EIEA 2M8XA 5E8EA 2C3VB 1S7UB 1E9QB 5L7XL 3X3GL 4N2MA 1MFUA 2Z0UA 5F70A 3TP4A 5IV2B 3VXTB 1OM9A 4F8OA 3L4XA 1KJ2H 2AV1B 1N8ZB 1QSFA 1EBPA 1UCTA 3UZQB 5CLTA 3PFQA 4WEEA 1OTUD 1L7TL 1ECZA 2DIBA 2KI6A 4F8PA 1YYLH 1R33A 1INQB 2CO7B 2IAMB 4S2SA 1UD2A 1X9UA 3QJSB 4UF7C 2R4SH 2VERN 2LLGA 5JW4M 3OB0K 3HS0B 4JPSA 4UZSA 3U46A 1TOXA 5C3IA 3ZDZF 3MCKA 4MD4A 5L88L 4S1DD 2OSLA 5EIVA 2B0SL 1QSEB 4ODXA 4PJ5D 2KPWA 1A3ZA 1HXYA 1E0OB 1FUNA 3WHE1 3APCA 3QUZD 2C8NA 3TT3L 1XGQB 3HHMA 4L4TB 4BFRA 4ES8A 1A7NH 2CK0L 1VZHA 3P0YH 2VXTH 4KTDL 4OB5L 1MCOH 4YSPA 4I0PB 5F3FA 1G9MH 1JYVA 4W9EC 2XZZA 1U93A 2OP4H 1AGFA 1EUTA 2B16A 4J4PC 4GW4B 5AD0B 5B1BB 1H19A 5DUML 4Y4FB 4HSCX 4NGHL 3KLQA 1WSST 3IJSB 1A7QH 5L9DL 4PJFB 1IBHA 5JR1L 2E8ZA 4GEIA 3CMOL 4LCVA 4FXGB 1QSEA 4ODXB 5E8DL 4A2GA 3QJRB 1CFBA 3MKGA 1U8QA 4N2AA 1S7VA 4XR8C 4IBLT 5C09D 1IQWL 1VERA 3AREA 3RUGB 1E2ZA 2GBVA 1KT2B 2JQZA 3AG4B 4HH8A 1P5UB 2AHIA 3TTYA 2X53A 3F7KA 4U7SA 5BZWB 2VZ3A 1E3XA 3BKMH 5C0BD 5JZ7D 3CV5A 4OIFA 2EICA 2QVIA 1WZ1L 1V7ML 4GRWE 4GAGH 4TULL 4HXAL 2OXGB 1DJXA 3LS5L 3PFUA 1CTNA 3HG1E 1KCRH 1A8JH 1LTXA 3LKSA 2WUCL 5C8JB 4JQXA 2AANA 2ICWA 4JL1A 5JPMA 2XN9D 1NBQA 4R8WH 1JJUA 5AVUB 1JGEB 4XNYH 3CZNA 3BP4A 4KROB 4HS8H 5FIEA 2ITEA 3PP3K 2I24N 1EXGA 4UU9A 1E5ZA 5FKPA 1IEHA 1BX2B 4G7YL 4MAYA 4U6HB 4UT9H 5FDYA 1P5UC 1RZKL 1DVYA 1NQBA 1SJHA 4UWQB 1FORH 3ZN6A 4QNPE 3IMBA 1Y1DA 2G2RA 2H26A 4H26A 1JERA 1MAMH 3B9EA 4GW1A 1S78D 1FN4A 3HLAA 2WIIA 3S35H 4HJEA 4F5CA 4LP8A 2B3IA 1ZLSL 2YC1A 3BH8B 4KQ3H 4M48H 5H37A 1LJMA 2CE6A 3AUVA 4MLIA 4N20A 2AS5M 5BO1L 5C0AE 5FK9A 3ZUNC 4K0OA 3LIZL 4D9RE 3MACL 3AJ7A 3PV6A 4F1SA 3D39A 3L54A 3GXUB 5D1QD 1G87A 2DWDB 3VNZA 3LVTA 2DOCA 2CLZB 2JF1A 3VXUB 3WN6A 1JNNL 4JDEA 3KHOA 4ANVA 3LV3B 4ZUWA 3C6LC 4GRLD 1D9KD 4P57B 5IOPB 2X4OB 2FTAA 2I9TA 4A67A 2EC9T 3WGUB 5K9KB 4PJBA 2Z92B 3FQRB 1K2DA 3PQYE 3K6NA 2HTKD 3DTUB 3F04A 3VXTA 1MI5A 2WXHA 3MRRB 4N1HB 1AJ7H 4OLEA 1D7CA 2C4FT 4MA1C 2VR8A 1LP9E 1EK3A 1NCWL 5FFLA 4N0YL 2YRPA 1TQTA 3VYPA 5AAMC 4EDWH 1JDDA 1ZTXE 1ID5I 4IBVA 4JPQA 1JWMB 1MFCL 4OLXL 1T0MB 4A04A 2P7TA 5GZND 5MENA 2GJRA 4AUYA 4LDCA 5DHVA 3DPBB 3GBMH 3DVGB 4EIZC 5D71L 4HS6B 4XP9L 1WPCA 4M8QB 1TKWB 3FQYA 2C9SA 2FX9L 5DD5L 3RKPA 1PX3A 3L4YA 4NO2B 5I23A 1GGIL 3GQFA 5TH2A 3VQLA 3D3VA 3NACH 4C8XA 3OAUL 3AROA 1O75A 2AI0L 1FIGL 2DH3A 2DL2A 4IMKC 3KPLA 4MXVF 4ZTPL 1DBAH 1MXGA 1HHHB 4FQHA 1T20A 4PP2B 1ADQL 3O0RL 1YMHA 3NYKA 3HA0A 1F4YL 3VWJB 4I5BA 2R0WL 1QR4A 1FE8L 1C16A 3VFOB 3E0GA 2J71A 3VFWB 3LZOA 1QRND 3NSDA 1FZJA 4Y4HD 2ADIA 3O6ML 1AZVA 4NQSA 5DFVC 5IIEB 1MWOA 4I0CC 5DMKB 3I6LE 4WU5B 2XOTA 2AKRB 3A3YB 3O6FB 1AXSA 3OAYK 1FLRL 4UNTA 4P9ML 2VDOL 3BAKA 1CFQB 3LMJH 4OKDA 4Q56A 3IT8D 2V3DA 4NFBA 5HGBA 5IBTL 3I9PA 3PDOA 4OF3A 1QFWH 4MXWH 4HVBA 1L9TA 3B4NA 1EFXB 5IQNA 3K6SB 5E08H 4YLCA 1HAUA 3WKMH 2X4UA 4M93C 1W15A 4KAQH 1JXDA 3MJ7B 3WE6B 5FYJL 3N55A 4LKXB 1KN4L 4OGZA 2TRHA 3D2UA 3VFWA 1UJ3C 1VFOA 3RTQC 2Z1PA 1B4JH 3SCMD 1MCFA 1OV8A 4UM8B 2JJUA 3CJJA 3LMJL 1CU4L 3ULUC 4IRZL 3UTSE 1BQ5A 4L8DA 1NC2A 2IDUA 4Y5VA 3O3BA 3B43A 3O6MH 4UT6H 1KGYE 2FEDC 5HYSB 3QFGA 4I7ZC 2V5MA 3HNSH 4S1SL 5KOMC 1CL7L 4OCMC 2ZSVB 3SPGA 1CO1A 1T66C 4A55A 2EVJA 3RDTC 1ZT7B 2MPVA 2B1HH 3WY2A 2G75B 4M5SA 5FKAA 1ZVSA 1CDUA 4BFIB 5TDNB 5DVLA 4XP1L 5KVDE 1S8DB 1YEJL 6CGTA 3EBGA 1L4IA 4Z7NF 2ORBL 2E7LC 5TE4H 1U8CA 2FT7A 3BN3B 4Q14A 3HTLX 3L3DB 3MA7B 4BELD 4MAZA 2PPEA 3O4LE 1QA9B 3TV3H 4BQ9A 1RL1A 4AGNA 1KTDB 3L5IA 1MNNA 2WWNA 1T3FA 2A6JB 3C5JA 3NJIA 1JZFA 2VC2L 1LDSA 4OM1H 3BQUD 3QJFA 2NUPB 4M7JL 1QMUA 1HH6A 2BRQA 4J2QA 1UB6B 2VDML 3NTCH 5HI4C 4TNWF 3U9UB 2BDNL 1E3ZA 4PJBB 4PJ9C 2ATAA 1A7BA 4PJHF 5HPMB 4UUJB 5GGSA 3WJJC 4JLRB 3UL4A 3L3DA 5HVFB 3B2PA 2W80C 4PJIA 2ZG1A 1DO6A 1RULH 1WZKA 2I32A 3F58L 3QUYC 2JTDA 4EZKA 3VD9A 5DT1H 1KYOJ 1KY7A 4JFQB 2VXSL 1PX4A 4ETYA 4Y16C 1ITBB 3X17A 1NZRA 1UFGA 1YRKA 1T03H 4M6MH 4UV7H 4FQCL 5TPWL 4LCUA 1TQBB 4PY7A 4KOBA 5B4MD 3HFMH 1RZFL 1IGMH 5E9DE 5C0CB 4A2DA 3ULAB 3NTCL 3V55A 2EIBA 3IDJA 3BKYL 4GH7B 4WFFE 5D7LE 4DZ8B 2AK1L 4JRXE 4JY6B 3RZCB 3OJMB 2P3YA 4ZPVB 2ENJA 1OSYA 4U1SB 1JFQL 1AH1A 3IWUA 3ZMRA 1OKEA 5F88B 3PGDB 5C0BA 4ZFOA 1FAKT 4JQIA 2VDNH 3HRPA 2UXVA 3KPLB 5J9PA 1P7QB 1I4FB 2HLEB 1YC8A 2J8UF 2VW4A 4NC1E 4LVNC 4Q7DA 3VFTB 2EIZA 4ZYKA 1A4KB 1T0NB 5LKNA 4WRLA 3FFCA 4LF3B 2EDLA 3MLSL 4WWID 4ZMNA 2NSQA 2Z8SA 3ECVA 4OLVH 3BSZA 5T5FL 1WFMA 1SJVA 1DYZA 4KUCF 4ZW7A 1CXLA 1GC1C 1X4XA 1TF4A 4P2QA 3MRBB 5LAXA 1M42A 4IU3A 3CZSA 2CNZA 4Y9GA 3MJ9A 3RZCC 4KV5E 5AOIA 2CM6A 2B4CC 3QORD 2ZYRA 1JAEA 4CA4A 3BUIA 3DO3A 4K8RD 1NDMA 3I6LD 2VLKD 3ETBJ 4I13B 5A2JH 3GT6A 4DGIH 2F7RA 4QRPE 4XN2A 1H3VA 5SX4I 2YUVA 3WFCL 1M1SA 4QXTB 3TA3D 3M46A 4L8BB 3EHBC 4XXCC 4N9OB 2F5BL 4MA3A 3EOYG 5DU7A 4GP5B 3ZDZB 2AQPA 4NXSA 5DRNB 3KWTA 1CLYL 1ADWA 5F6IB 2L7UA 3O6LH 2PPAA 2X9ZA 3CXHK 2E7MA 5BQ7A 3OBAA 2VABA 1FWXA 3QT2A 1U8JA 2LLNA 3C08L 3KPTA 1HOCA 1MCBA 4ONFL 3STZB 1PY9A 2YWYA 2F19L 4N2FA 3S96B 2XUWA 4MCYB 4Q4IA 1DBMH 4KI5C 2J25A 5EWIH 5T3ZE 5IBUB 1OK8A 3DX9A 1XXFC 3VI3A 5I6KA 1TZAA 4MMZC 3JWNG 4AE0A 5FKAB 4FL4C 4MXQD 3TIDA 4RMQA 4Q9BA 3RI5K 1SY6H 5JQ6H 2CHZA 4O2CA 4ZO9A 3HG3A 4PJFF 3IGAB 4ZXBB 4MNGB 1CQKA 1QPKA 4QRQA 3IE9A 5HHOE 3EHBB 5JIKA 5EZIL 4LCWB 3KJ4B 3S2CA 3VSVA 5E5UB 2NW2A 1CFSA 2XN0A 3LZPA 2VABB 3THML 3PPSA 3B2UD 3MXWH 4AIZA 1JK9A 2K7PA 4ISVA 1E4XI 2OSWA 3X1FA 1PFOA 1V8HA 2P52A 4ZBJA 4YZFE 3RHWF 2F9BT 1PEWA 3NGBC 3PCYA 3O3AB 3PQYD 4I88A 1HFUA 2O5ZL 4AJ0A 4HUMB 3GMOA 5T1JA 2DL9A 5FW6A 2BOCB 1IJ9A 4GAGL 4DPCX 1L7TH 2R0LL 4HULB 3TURA 3WJMA 3WLWC 3IGLA 3IFPA 2UWEB 2BNUB 3N50A 1I3VA 4EOWL 1LDPL 1YN6B 2JELL 4I85A 3PHAA 3ET9F 3JUZA 5EC2A 3Q01A 4N0CD 2QGEA 4N8UA 5M94B 1EVTC 2GJ6D 5FFOA 3RVVC 5F7DA 3VJ6A 4D0CA 3C2SA 4ZMYA 4G9DA 4Y4HA 3ABMB 5DHVH 3GI8H 4H88L 5CGTA 3C6LB 4M61A 2QSCH 3DYMA 2YZ1A 3LDBB 4LQFH 4YHOL 4NB7A 2BVOB 5I9QB 3RWFA 5DUMH 2O4EA 4JHVA 1TQSA 4LCYB 1TJHL 1WYJA 2R23A 5AW7B 4QWWC 4OZGE 3CSYA 3W1ZA 2IPUK 3ZDXB 4F33A 4FAAB 5ITFA 4PJDB 1OL0A 3ES6B 5EOQL 5E1IA 3TCXA 4U6YB 1GIGH 3GMRA 3OKDA 3MOQA 3P69A 4L3EA 3FUNA 5CR8A 3D2UD 4NN7C 3BO8A 3L6FA 2IGTA 3SCMA 1I3UA 2A1WH 2JJTC 3CVHL 4YSCA 4LEEA 2WO4A 3FU5A 1IBGL 1DN0B 3RWFB 4E2OA 4K3GA 1DQLL 3OZLA 4ZNEE 4BQ8A 2NZ9C 4ZFGL 3WG7B 5L6YH 1NOFA 2EXYC 4FF9A 4IIQC 3ISWA 4PBDA 1XAKA 3NFPA 1KIUB 3V7MA 2ZYHA 4FYQA 4PJ8A 4R83A 4NKOB 5H8DA 3GMRB 1BCIA 3ABKB 4PJAA 4PLKC 5E8NA 3ARBB 3FUDA 4NKDB 1X6LA 4YFEA 3VFUA 1NGQL 4M00A 8PAZA 3L95B 3T2NL 3KLHC 2G2NA 5C97A 3T0WA 1WBXA 3D52A 4TUKH 5I30L 5TTRA 3QUXB 3IM1A 2G3ZA 1V7MH 3LXCA 4DEUA 4HOWA 2X6BA 3CHXA 4UOQA 5K33A 5EU7C 3V6FA 4CADA 1YCSA 2OQJB 2XU9A 3NFNB 5C7ZA 2FJUB 5AYUL 4OCNC 2ATKA 1XGYL 1OAYH 1VF5C 1KBWA 1QACA 4OF6A 1OAKL 2QGDA 3V9EA 2ZONA 1QI5A 5CUSL 3BC9A 1YYML 5IVNA 2RCSL 3WFEH 2YAPA 3HI1B 1DSYA 2X2HA 4IIQB 1DANT 1N26A 5HYJB 1NCBH 2ENPA 3U25A 4G7VH 1YVLA 5HDQH 3AQDA 1LWJA 1FNSH 3F7QA 3NCCB 3EFDH 5AZ2H 4AYID 5I74C 1DBAL 3NJKA 1MFDH 2QVTA 2FWOA 1V7NH 2EC8A 4MB1A 4WNJA 5CGYD 3VB8A 3W11D 4AK1A 4AVHA 5KJRL 4MNGA 2PTUA 2EQDA 3FTYA 4UNIA 2CKBA 2X1XR 2WQRA 1SEQL 3KG5A 3IXAA 1K5WA 1NBZB 1JZJA 1S9WA 1MCWW 2IH8A 2DV6A 4X5RA 5DS8A 4X6CB 2DWDA 3HZVA 2OJZH 3PRZA 4DOHE 2WBXA 5JOPE 5EU5B 1X7TA 1LWHA 3ZTNL 4XNXH 2HT2D 2I9LB 3QIWC 1Q9WB 3ERXA 4DHLA 4R8WL 1JPST 5C0DB 1FYHB 4B97A 2B59B 4KV5F 3KMDA 2D7OA 4DGUA 3P3UA 1R4XA 1CGTA 1JDCA 4JN2B 5EU4B 3RNKA 3FSVA 1IV8A 3G04A 3CFJA 3IKCB 3LS5H 4KNTA 3UTTA 1YYLL 5LQBH 1U3YA 3ARDD 4HPHA 1MQKH 3MSPA 4APXA 1MLBB 2BK8A 3U7YL 4Z7VB 1NGWB 2XZQL 3LHPL 4R2GD 1CLVA 3J27A 1ZGLA 4ZAKB 3C2AH 3ZT6A 3TH3T 1HL4A 3HHSA 1AS6A 3D34A 4N26A 4MNHA 1R3KB 3MRNA 3CMGA 4HK0B 4QRTA 4MD0A 3WXWH 5DUBB 3GSNH 5IP4A 2BZDA 3VXNA 2OMXB 1CZ8H 3BDYH 3DGGB 4KTEL 5C86A 3DIVA 4I9XA 2HKHH 4DEWA 4F2EA 2Q0ZX 4Z7WF 1I9JL 5C0EB 2Y23A 3W39B 1OLZA 3QORA 1Z2KA 3ARGD 1TVDA 3NSJA 4ECNA 5I8OH 3GSQA 2J5LB 2ZNWA 4TQIA 3ES6A 4I2XE 1FO0L 4NM8L 2VZ1A 3HI6L 4PJGB 3PQYB 4NN6B 3EGDA 5CJXC 1BXXA 5ID0A 1B0GB 2WNGA 4P5TB 1KCUH 4XNQA 4NZUL 2JVUA 5E6ID 3EOBB 3BUQA 1CDIA 4WFGD 2PYEE 1QSFE 2Y5EA 3X3FL 1WG3A 1PDKA 4WW2F 4FD0A 3U1SH 3WO3B 1IC4L 3P4OA 3WLBB 3DBXA 3SPIA 2A74C 5IB4B 2HKFH 5IMOB 2UZPA 3ZL2A 3T6XA 1BV8A 3CVHA 1DE4B 5F7BA 3IRZA 2VNCA 1TZGH 3MRKA 3VM7A 4PJ8B 4KRPB 4N0FB 1ODAA 3SKMA 3IDXH 3FQ2A 4AQOA 4QDGA 5D72L 3WMQA 2PETA 3KYKL 3ECUA 3GSRB 3CC5B 5AW5B 4AH2B 5C0NC 3Q6GL 4H20H 5FO9B 3QXDB 2R83A 4DO6A 2IBGA 5EEZA 4AMXA 2Y7NA 2MCPL 3P73A 1I8IA 2WSDA 3SQBA 1SJEB 2HX9A 2HFFB 2I26N 1FQ9C 1SJXA 4KK8C 3DSFL 4FG6D 2BFVH 5HD8D 4QGYA 3OB0H 3GJEB 3UAJD 3DJ9A 5E8OB 4LSSH 5E0FA 4KKRA 3DURB 5ISZB 2ODIA 4HU2A 4YDIL 4DK6A 2IDSA 2WLJA 4NJ9H 1KB5B 2WXMA 5J06A 3NAAL 4MMYA 3V8OA 2W92A 3C8KB 2EH7L 5GS1C 4L3CA 1QNIA 5K1VA 4LEXL 3TWYA 3VTTA 3X13B 4EI5D 4K3DL 5K1NA 1GGUA 2CK0H 3ZQ9A 1IAIH 1A7OL 2I5YH 2PTTA 5FM4A 1S9WB 2APBA 1EEYA 1OPGH 5GSRA 1FFOA 3DKHA 4A38A 4M1DL 4K4KA 1AD0A 3MRMB 4HJUA 5LNEA 4R7XA 3VTMA 1BMGA 3ULUH 5HVGB 3NIFB 1KPRB 3GMQA 3IVKA 1AS7A 5IZ7A 2NY6C 5HDBF 1SUJA 1FJ1A 2IWEA 2XN9A 2AGJH 2ZUWA 1OP4A 5F8RC 1BG9A 1RLWA 5BQDA 5ID1B 4CU7A 4PG2C 1TQCC 1CFTB 4KJYA 1F6AA 3N44F 4OIAA 3S3SA 1XR9B 2ZXGA 4KKCD 3N5AA 1DLHA 2ROYA 4RBPH 3T0EE 1RIVH 1SN5A 4Y5YB 5HXMA 4JFEB 3QZWA 4NQTA 2W07A 3O2WL 2ESVA 5FEBA 3JBG7 3UABA 4HK3N 2F5AL 3X3GH 4JCWA 2WTRB 3RPIA 4Y16D 4GKOA 4U05A 5FYLH 2W60A 4L1BA 4QYOA 2CALA 3ZTJH 2DIJA 1O7VA 2VUKA 4QR7A 3TEUA 1YAZA 2O5YH 2CBQA 3BISA 2UV3A 4J3XA 1K4CA 5EF0A 1A9EA 5IROC 4H8WC 1R3LA 1BF5A 2E86A 3BEWA 1A47A 3KYMA 4WHYH 5D1QA 4JQVA 5IK3A 3FO0L 3WNNA 4N2GA 5DRWB 4Y5YA 3LQAL 4ICXA 3JVFC 2TRYA 1NGZA 2DMBA 2BSCA 2H6OA 5HYJD 4EI6B 3KPSA 2R27A 5D7LB 4QOKE 3NJXA 4XNQB 2JKXA 1F97A 1KUMA 3EIFA 3GMLB 4J3SA 2CUIA 4EEEA 5B3JF 1WAAF 1YN7B 3BKCH 3IJ8A 2ZE0A 5D2NA 3GXNA 4YDZA 4NQCE 5IB4A 1D6VH 1QNZH 4ATTA 3R8BB 4B6ZA 1HSBA 3WS3B 3N2JA 1BZ7B 5MENE 2ICEC 3H1ZA 2OYLA 4FMVA 4PRPA 4W9CC 3SDCC 2OL3L 2R8SH 2D7MA 5CLWA 3OKMA 1KB5L 3ATBA 1IFRA 1XR8B 1IT9H 5C0JA 5JNYB 4NQEE 1NPUA 2XXFA 3MBED 3RU8H 1D5BB 3GSRA 15C8H 4CU6A 2X0WA 3Q3GA 4BKTC 4FQ2H 4BA0A 1JRHH 1XCWA 1ZY9A 2K45A 5F9WB 4ZZFA 2ZCLL 3RWIA 4XVTH 2BNQB 5TE6H 3FU8A 3LTVA 3L4WA 4NZUH 5F21B 3G08B 1NL0L 1PKQE 5ALBH 1SEQH 4HISA 1YMMD 3UERA 2D0FA 1OHQA 3OKMB 3QIWB 1SLUA 1I75A 3OGCA 4E42B 1MJJB 2R7EB 2QV4A 3K2MC 3OHXC 4B95C 4NZRL 4AYGA 1FV1B 4B3VA 2XC8A 4LOVA 2YAOA 1OTSD 2VLJB 1Q1JL 5HGDB 5JHDA 4AW7A 3N85H 3KGTA 3FDWA 4YSSA 3RWIB 4Y9EA 1GVIA 5ALBL 1N70A 3LQZB 1WO2A 4YDKL 4KTGA 1ZHNA 1X9RA 5F9JA 5GGUB 4KO6A 3B9VA 3CFDA 4ABQA 4XVTL 1GTNA 3VXME 1KB9J 2DYPA 1I9IH 4FFZA 3IS0X 2X4TB 3S3PA 4NNYA 1NKRA 4XBGA 1AY1L 3ZKMD 5BXFB 5EEXA 2YS4A 4KK9D 1LNUB 1SN0A 2EP6A 1GAFL 5TE7H 4HUNB 1LO5B 1PG7L 1BMWA 2HCZX 4PD4J 3E3QC 1MIMH 2NY3C 2DLFH 3QIUC 3SE4A 4LAJH 1CD9B 1FNEB 1M05B 4KMQA 4KI5D 1QFPA 1A6TB 5GGUA 1Y7VA 1U9KA 3EJJX 3LKRB 2BH0A 4RAHA 3DTXA 5D6CA 1NGYB 3U1SL 5B8CA 4BRJA 3ARSA 3FF7A 4EI5B 2X4SA 4G6KL 3F6JA 1TDQA 1Y1UA 1BPLB 1ML0A 2DW5A 2GJ6A 1L6ZA 2UY6A 4XNZC 4IU2B 2BVPA 3TBVA 4LVOB 4KWUA 3RL2B 4Z0BL 3ZE0B 2ZD0A 2WLLA 3DRTB 2YQ3A 4KROD 5IGXL 3KYMB 5D1QB 1KDJA 4G2AA 4DT2A 4XO4A 1YYCA 4FFTA 4WO4A 1UT9A 2X4PA 1AQMA 1DQML 5KEZA 4QHUB 3ECBB 4X6CF 4GMSL 5BRZA 2XRAH 3ISYA 4TN9A 3WFBH 3DRQB 4E5XA 2UWEE 3D85A 4ZUUB 3CD4A 1QTYT 4KO5A 3QHTC 4N2OA 1IKOP 1TPXC 3Q1SL 5FGBC 3MBEA 3CPLB 3KWUA 3G9VA 1JZ5A 1IEBA 3RWDB 4EDXB 4NUQA 1MDAA 4OD2A 3PWJA 4G8AC 4PB9L 4MFHA 1WGVA 2Q86B 2C4FU 4WDIB 5EU6A 2WMPA 4BE6A 4TRPL 2GITA 4XZ4A 5LBSL 2OR9L 4F15C 4G6ML 2IFFL 1Q90A 2VQUA 3KYKH 3BPOB 1A7PL 3D18A 4F7PA 2CDGB 4PRDB 3Q8AA 4U49A 3A0OA 1J11A 1FGNH 5E8NB 2EJ1A 1ZSDA 2DPKA 3VXSE 1TQWA 1PFCA 4PJ8D 4AGPA 5GS1B 4L4TE 3SJVD 1EGJL 2JKSA 3NUKA 3TLRA 3MOBH 2HX8A 5IB1A 1CD0A 5D7KD 3UBGA 1EZVY 2KMWA 4N0RA 4A7QA 2IFGA 4MA8L 1T7WA 3G6DL 1I85C 5F7UA 4AIXA 4OD2B 2FT8A 1SHSA 3SDDC 3LZFH 3QK0A 4LPUA 4AEHL 3QFJA 35C8L 4MKMA 5EU6B 4A6YL 4TPRL 2I27N 4L0ZA 1OAZL 5FLUA 3RG1C 4OGQC 4F37K 4JDZA 2OI9C 2XVLA 4EN2A 4S2SB 3IJHB 3IN0A 1Q0EA 1YQVL 3UROR 2CUAA 3H9SA 1N12A 4OCSH 1TTRA 1F13A 1XTMA 5MERB 1YQ2A 4D9RD 5FCUH 1SOXA 4P2QD 3U6RA 5FV1L 2B5IC 2VDPL 4Z0XA 2HRLA 4UILH 1U91A 1HNFA 2AJSL 2SEBB 4G6JH 1U8LB 4KI1A 5LCVA 4QRPA 3RZCD 4ERSL 3M1BB 3MCLL 4E68A 1U8OB 2GQHA 4IBTA 4PRHA 4OD1L 3VQ1C 1O6TA 3WKQA 4WUUE 4C56B 1QP1A 3D3VD 2HJFB 2Q8AH 4Y4KB 2R69L 3RL1B 3ZUCA 4C57C 4D9QD 4DQOH 5J5EA 4OLUL 1KFGA 4X4XA 3VFMA 1ICTA 1RZ7L 4BZ1H 4HOXA 2V2WB 5I2IA 3GTVA 4JFTA 3K0WA 1QQDA 4ZMLA 4RGNE 5E95B 1ZHLA 2VUYA 4WKXA 1MQKL 1A6PA 5AW1B 2GUOA 3UX9B 4GRWF 1EERB 5I8EA 1N0XH 1JOIA 3TEZA 2FO1A 2OTPA 2YWZA 3NJHA 3RUGA 4HMCA 4N5ED 1AVAA 1K8IB 1UGKA 2AK4B 1RFDH 4Y1TA 4WFHD 5HD8C 1ET5A 2C9UA 2O1AA 3O8XD 4APQA 2Y2TA 3TL5A 1MUJA 3FQNB 4TSCH 4M9PA 3DGDA 1AACA 2NXYD 5CP7A 1O6SA 2XXCB 3WEBA 3C5SB 3FU0A 4YX2H 2P5WE 1LEGA 2NQ3A 1G4RA 5KZCD 2V9RA 2AEPL 2NY2D 2A9NH 4KZCA 4JKPL 3HRZA 3W39A 1P9MA 1IL1A 2KZKA 3MVSA 2Z31D 4QLRA 5AKSA 2WZPD 4P49A 2CK2A 2YKLL 1PLGH 4RA3A 1SQ2N 3DX4A 4QHUA 2YRLA 1G9MC 4FCAA 3OAZK 4L3ED 2FJSA 5EEUA 2KLRA 4UQ3B 3Q6FA 2VN4A 3IETA 3VG0H 4D9QE 4FLSA 2WXPA 2NZ9D 4M7LH 1B3IA 3UJIH 4FHBD 5HDBB 3MBEB 4UQDA 2W59A 3FB8B 1C5DB 1RMFL 2G3MA 1QW8A 2E0PA 4WI9A 4RGOL 3RWDA 4HPYL 5FUZL 3VGEA 4WI7A 3TO4B 1YEDA 2A4EA 4MBOA 1B2WH 3LS4L 4HIPA 2ITCA 1MAJA 4ZOBA 3Q0HA 1E4WL 4U1IA 2HKAA 2OL3A 3HE6B 4UIMB 4JRWA 3V0HA 3L7FB 4G7RB 5EBWB 1TG8A 3VFGH 4UOW0 4ZUWB 4CSTA 2QPDB 4XB7A 1IAIM 5DR5L 2O61B 3MV7A 4U6XB 1S9KC 2A0LD 3ZYJA 1DTUA 4G3YL 2RB8A 1IGJA 3DXAE 3V4PH 4D0DB 2DAVA 2QL1A 2IAAC 3S9DB 1VACB 1S6NA 2HRGA 4XN7A 4E36A 3HVDA 2I7SA 3E2HC 2WXOA 4BE5A 4FQXB 1MW2A 1R0AL 4HPOH 3T8XA 3HZKB 4JZJC 5E8OA 1AIZA 1HZHL 2VKWA 3MOAH 4X6FA 3QUMH 2APFA 4XOBA 4EE2A 3SDAB 2CBTA 4LSSL 5EZIH 3PDDA 2FGWH 4DNLA 5E5MA 4L3CB 2XACC 4DK3A 3L5XH 3QXTA 3HMWH 1F6LL 3HNSL 4HDIA 2C1PA 1Z9OA 4DP0X 3WTTA 4QHLB 3FFOA 3T8XB 1FFNB 5KSUB 4HSAC 2P5ED 3ZHFA 2E9GA 3CFNA 3DVIA 2WZAA 4EVNA 1SMDA 1KPRA 3GMQB 4Q97A 1GY2A 2DICA 3ESPA 2J88H 1ZS8B 2NY0B 5DJ0A 1OP3K 3Q8BA 5JA8B 3RPBA 4FZEL 2JIXD 2ZX6A 4CW1A 3GZPA 3KXFD 4AJYV 2WAQA 4MCZB 3KW7A 1T1ZB 3FUEA 1U2HA 4GAYA 4B5ZA 2R4RL 2WANA 4JAMB 3H85A 4JFEA 3ASOB 2BNRB 2BX5A 3BZFA 5C7XH 4Q6IC 5BRZD 1A3LH 1XF3B 2AQNA 4X8GA 3TBWA 2EXTA 3VCLA 1FFPB 1TPXB 2ESVD 1Q0YL 1I8MA 4PTUB 2CWRA 3MI6A 2W0LA 3PWNB 4QRFA 4QYOB 1UOKA 3T3ME 2GC7C 1TVBA 3L9RB 1JZGA 4WFED 5KTEH 2YBRB 5EFIA 4AENA 4N2DA 3TA3A 3P11L 3CN1A 3FPYA 4PJHA 3FT3B 3JWOL 3GTNA 5JDSB 2WQ8A 2ICWJ 4O58L 5EU6D 1X9QA 5HGHA 3ARGA 1WEJL 2UYLB 1QYGL 1VGKB 1XDTT 2KZWA 4H7VA 2X7LA 4I77H 4M62H 5AVTB 2WZ5A 3TFKD 5I5MA 1KIRB 1UD6A 1TMCB 3MLZH 2BSRB 5J6GB 2BY1A 1NC4A 1JZ7A 2PWGA 2EDBA 2PCFA 5EIIB 1XX9C 4FQCH 5LN4A 4TOYH 5D7JD 1ZE3H 3EJZC 5E6SB 5EC1A 4GQZA 1LE5A 2YPLD 2ZZUT 3JWOC 1DBML 5LLIC 2GAZB 1XO8A 3WL9A 1BLNA 1CU4H 3TA3B 3W0WB 3B9KA 2CBPA 5LWYL 1S5HB 1XF4B 3AQZA 4JFHE 1RZKC 1T7XA 3MPCA 3BH9A 4NHCL 2FT6A 5JMOC 2XTJD 4LQ1A 5BOZG 3L4ZA 3ZW3A 3WTSA 3BW9A 1GH7A 3RTLA 4YBLB 4LASL 2KYIA 1S3RA 3SD2A 5EIIA 2AV7B 2ZKYA 5IVZB 3FTVA 1W6WA 3KH3A 1EVUA 2LU4A 3UADA 2BVTA 4F91B 2X28A 1M4KA 4OLVL 5T5FH 4LHUA 1MCNA 1OB1A 2E4TA 4L05A 4F7EB 1KCSL 5F9AC 2DWEA 2FO4B 1PYWA 4JKNA 3T3PE 4PJCF 1NM4A 1AZNA 1N7ML 1JF5A 1MJ8H 1KJMB 2ROXA 1CCZA 3R0MA 5DD0H 5ESQB 3GPSA 1PSKL 3BFOA 4F8NA 3VG9C 3UC0L 4IJ3B 5D4IA 4GP4B 3MQIA 2BS9A 3UBXG 4HWEL 3MFGB 4X9FA 4Y7MA 4L2YA 5CJQL 4U1JB 1NMBH 3EFDL 4YBLC 4TM9A 5I71C 4KX9A 4L9LB 1VFAB 4XPTH 1VEMA 5EBMB 3SOTA 2HVBA 3PPEA 2E9WA 2DMKA 1ND0B 2JTYA 3PWUA 2DWTA 3O45A 4Z7NE 1N7MH 5MI0B 3QPQC 4J3TA 3NFSL 3CDGB 4HKJA 3BIBX 2CM5A 4QRRA 3SB3A 4Z7QF 3SGDI 4HHGA 1R3HA 3QDJB 4IM8A 3E80A 3IF1A 4P23B 2OMWB 3AREC 3H3BC 4GLRH 1W72L 1DDHB 5LCVL 3QISA 4NBXB 1BBDH 4NPYB 4KKLD 5I1KH 1MCCA 1A6WH 3GGWA 4HUKB 4YHLH 3VI3F 1I4FA 3VFRA 4ELKA 4OTXH 5D2NE 2PMZA 5HHNB 1AR1D 4ODSL 2PWHA 3PXLA 4NQCA 3H8NA 1XMWA 1OANA 2AAVA 5B39A 4YOKA 3ZE2E 1UA6L 5D9SA 1DUYB 3BVTA 3IDYB 1HINL 4G6FD 1ECYA 2HLAB 2O5ZH 3BIKA 3IDMB 3I2CH 1CFMA 2FVNA 3RVXC 4BSVB 4TLSA 1EXHA 4P5KA 4NO0B 4MAYC 4HJGA 1P5UA 4M56A 2PPCA 3TBWB 3WIHA 3VD2A 5FECB 4P9MH 1L3WA 1I8MB 5FGCE 4B7IA 3MV8D 3O9WD 5ITBL 2QPFA 3AG1B 3VXUE 4M48L 4AGQA 1QD0A 1QX1A 2IGFL 1JHTB 4Z77B 3QRLA 4X9YA 4W93A 3VD5A 1RVFH 2LU5A 3MUJA 4V2BA 5EBLA 4Z76B 1C08B 2V5YA 3RVXD 1IARB 1FE8H 2VXVL 5HGHB 2Y2YA 4KNSA 3MDJA 4GMTH 5BQ7B 1DVUA 2AJXL 2W5PA 3HBQA 4CVUA 1N5YL 3AM8C 1KIRA 1CGWA 4KJWC 3AAZA 4OD3H 2E59A 2V9QA 2XQBH 4OAWA 3OJDA 4UV4L 1RJYB 3I2CL 3RVTC 2FEEI 3OKOA 3COOA 3ULSB 5FM5O 3F2LA 2E7BA 1NCHA 1J5CA 3MV7D 3D3VE 1RZFH 2JQMA 5EC1B 4MKTA 3A4DA 5I0XA 1IC0A 1ZOXA 3ZRFC 2A0LC 3LN9A 4FJYA 3CZJA 4L4VE 1TZ8A 4PY8J 4Z76A 1C08A 4PI2A 4FZEH 2VN3A 4LDLB 3U1PA 3PWJB 1XGRA 3CHRA 2AXJA 3V6OA 4NFCA 4EDWL 1IBYA 2JB5H 3ARYA 2PXYB 1LO4L 4L5FE 2YAHA 3OKOB 2B4CH 1H3PL 1UYWL 4J1UB 4ISVB 4NUPA 1U41A 1JD7A 4PU2A 2WLZA 2VLRD 5D7IE 4YE4L 5HYEA 3GSNA 1G7QB 3UYRL 2RBLA 3EJRA 1NA8A 3DUHA 2I9TB 2P9RA 2XZCH 2WKLA 1VLXA 3LN5A 2VERA 2H2SD 1VEOA 3K4AA 5C09A 2CO6B 2ETWA 3FOLA 4PRIA 3MLSH 3BAIA 1ONQB 1I1YB 4F58L 4ODUB 3TO4C 7PCYA 2Z31C 1CR9L 2YQ2A 2H1LM 3L3HA 5T1KB 1A9BB 2OR7A 2J6WA 2MCMA 4HUWA 2VXTL 4KTDH 4L37B 1HKFA 5CSZA 4NWTH 1BJ8A 4OM0L 2JKTM 2OMYB 2UVFA 3PAVA 5IJKC 1NAKH 3F6LA 3LH2L 1QI4A 5ISZE 2BOBA 3MNWA 5DD1L 3U6RB 1ORQB 5I73B 1CFVH 1UACH 4HS6A 4TXVB 1OVZA 4QAWA 4I3GA 2IPKA 2G9HA 2LHAA 3ATDA 4PS7A 2BFGA 4JM4H 4S1SH 4YIQA 4R4FL 4ZTOL 2EZ0D 4GLRI 3BT2L 4FXTA 4AM0B 1T80A 2WLHA 3MUUA 1HHHA 3ULVF 3AVEA 2GIYA 4BWWA 4YSRA 3U46B 1JGVH 3ROLA 2XA3A 4MS8D 3CAFA 4WI4A 3AS0A 2HSIA 3FTWA 3G5XB 3R06A 4G80B 3RVUD 1GHFL 1MHEA 5ILTH 1FZJB 4HMEA 1L9OA 4LAQL 4BEIA 3CH1B 4S0TD 4X7SH 4WU5A 1NC4D 3F6IA 4KUCD 4PIRF 1BF2A 1H3GA 3DHUA 1JCVA 3MNZA 1D5MB 3IPBA 1NAKL 4LLMA 3O8XC 4P4KC 1KXTB 1UB5A 4OD3L 2YKLH 1B0WA 1EFXA 1W0YT 3MLVH 4AV0A 2WO3B 3K6SA 3GS0A 1W8NA 3LRLA 5A2CA 1OPOA 3RTQB 1U6AL 1RK1B 4FXKA 4Y4FA 1DO5A 4XVJH 2MNUA 4Z8FL 3QHZH 4XPTL 1FL5A 1YQVH 5D5MB 1O7DE 4RA0C 3V5KB 3TNNA 4F9PA 5CKAA 1FORL 5ICZB 2VJ0A 1DR9A 2BIMA 1A1MA 3SZ6A 3QCTL 4ZSOB 3MX0A 3P4MB 2C1OA 5KN5A 2AVGA 2QQNL 3UYRH 3W57A 3EYOB 3IJEB 3KL0A 4UV7L 3UAJA 1KXTA 4DZBB 3K72A 1IM9B 2ZT9C 4QGTA 4P4KB 4KRPD 4PJ9A 1NCOA 4OV6F 4XNMA 3VAEA 4G1MA 4A66A 2Q76B 1CGSH 1ANUA 1WZ1H 3LKSB 1UXMA 4ZD3H 2GY7B 3IMSA 1I1AD 4B5EA 4G6MH 4Y5XC 3AW5A 3KLAB 1THCA 5HYFA 1L0YA 3BCDA 3RZWA 3MZTA 3MRQA 2WUCH 4QI3A 1URIA 3BUYB 3Q7JA 1V10A 4AL8C 4MNQE 3QQ9C 4KUZH 3FC8A 2P80A 3OLDA 1P6AB 4GO9A 1HYSC 4H13C 1T21B 1DUZA 1RERA 2PYFB 5F9OH 1LP9B 2B1AL 1NMCB 4PS4L 4Q0XL 4U6XA 3VD3A 4UAHA 1QKZL 2CA4A 2BHFA 5C09B 4G8GA 4BCYA 4CC0A