3AGWA

Crystal structure of the cytoplasmic domain of g-protein-gated inward rectifier potassium channel kir3.2 in the absence of na+
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
199
structure length
196
Chain Sequence
IQRYVRKDGKCNVHHGNVRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G protein-activated inward rectifier potassium channel 2
publication title A structural determinant for the control of PIP2 sensitivity in G protein-gated inward rectifier K+ channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 38
structure length 196
sequence length 199
ec nomenclature
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3agwA00
3SPHA 3SPCA 3SPJA 3AGWA 3ATDA 3SYPA 2WLMA 2E4FA 2WLKA 3SYQA 3VSQA 1XL4A 3ATFA 1U4FA 2X6BA 5KUMA 3AT9A 3ATBA 2WLIB 2WLLB 2WLIA 2WLLA 2WLJA 1P7BA 3ZRSA 1XL6A 3ATEA 1N9PA 3SYCA 2GIXA 2WLNA 3AUWB 3SYOA 2X6AA 3JYCA 2X6CA 2WLHA 3SPIA 4KFMA 2QKSA 3SYAA 4LP8A 1U4EA 5KUKA 3ATAA 3SPGA 3K6NA 3AT8A
chains in the Genus database with same CATH superfamily
3EGXA 5L8JB 3CX5K 5JDSA 2BP8A 1P4IL 3SOBL 1KYUA 2CO6B 3C5ZC 1OAXL 4ZS7L 5IY5B 1B90A 4FHBD 1JZHA 4N5ED 5C6TH 1J1PL 3F62A 2C3GA 3WNMA 1OHQA 3CFQA 4RBPK 1RJYB 3QO0B 1ZLSH 4KTDL 25C8H 4NLAA 4PS4L 3B56A 3BQUA 1CXFA 3F7PC 3L3DB 4J6IA 5I8OL 1W2KT 4AYGA 2VR3A 3MROB 3QISA 3QRGL 2A6JA 3NGBB 5EFIA 4ZS6D 3GMLA 4UNVA 4LLYB 3E3QC 2AV1A 3ZKQD 3LNIA 3LNFA 1E3XA 4HBCH 4IHOA 2AK4D 4M8QA 5I30H 1KV7A 4NQEB 4JJOA 5L2JA 3P11H 4OGYH 2NQ3A 8FABA 2XTJD 3KYKL 1ETZA 3DETC 1CWVA 4ZXBA 4LAJH 3TNMB 3MBXL 4GRMA 4YPJA 4PMEA 2DI8A 5CM1A 1CJYA 1ODAA 4FFYA 3QPKA 1UCBH 3J2PA 4JFFA 3KPSE 4OZHF 3EH1A 3J07A 5DS2A 5D9SA 2A4CA 3C5XA 1RZKH 5CMAB 3H9HA 4P4RB 5IV2A 3AGVA 4L1BA 4H26A 4ODHL 4PJXA 3ARFD 3DX8A 4IMLA 1OLZA 3GMRA 1TJGH 3OM3B 1OGAA 4XVOA 4KXZH 1F97A 2C3VA 2IG2L 3RL1B 5E9DA 4LU5L 3VWJC 4FXKC 4HPHA 2ADGA 2AEOA 3H9ZA 1KTDB 5DWUH 3FW6A 1EXUA 1NTDA 1LEKB 5DD5L 4GSRA 1RPKA 1YPZB 1MCSA 1ETA1 1UXLA 1EEQA 3HZYA 2VAJA 4LDEB 3EIFA 35C8H 1C7TA 4G42B 4S1RH 4UOW1 2Z0BA 5DO2D 5CEYB 1CE6B 1QHOA 2YD6A 3TV3L 4DO5A 2D3NA 5K9OB 4R7LA 1XZ0A 5IJDC 3B5HA 3DECA 1E5CA 4W9DC 1EIBA 1RUPH 2OLDA 3QUXA 5BCAA 2Z4TA 2I60L 3GSRB 5L2KD 2HLAB 3KPRD 2GB2A 4ONHB 2O5YH 4HAFA 3OHXC 1M9WA 3FTZA 5DUMH 1T4KA 2GJZB 4F5CE 2P8LA 2EUVA 2PN5A 2VC2L 4QNPE 2CHZA 3BAEL 4IMKA 5D1ZI 4QOKE 1FF5A 3AG3B 4FL4B 5AENA 2IWGA 1B9ZA 1XGRA 5I66A 2CM6A 4JRYB 3UPRB 4CSSA 2QFRA 3RHWF 1DVQA 1MJJB 3CVHB 1BQRA 4AXWB 3M88A 4F24A 4CMHB 4LEXH 1IC5H 2GBVA 5GJTH 2XQ0A 3EJSA 3VH8G 2VDLH 2XN0A 3OMIB 3W38A 1YCSA 2XWEA 3WTSA 2Q7AA 2I69A 2C7UB 4P23B 5GS0D 1ACCA 2GABA 5CFHA 2JLLA 5B4MC 4F8NA 3OSKA 3RPIB 4WO0A 4EDWH 4NQVB 4DVBB 1WJ3A 3DBSA 1IL1B 2E5EA 4OT1H 1JXKA 2NLJA 3GXDA 3QCVL 2KMWA 4OF7A 3CDZB 4W9ZA 1M7IA 2XOTA 2NW3A 1QA9B 3QDMA 2BO0A 4G9FE 1NUFA 3SCMB 1GTNA 1SYVA 2O61A 2YAHA 5F1NA 5FKPA 1TLMA 3O3UN 3D50A 2UXGA 5D93B 1OB1A 3DX9B 3FUMA 5I9QC 5J0BA 4LKXB 2R56H 4ZW3A 1MIMH 3DBXB 3SYAA 1L0PA 4JJ5A 3STLB 3GQFA 4O02L 3BKYH 1B2WH 4BA0A 3U2SA 1PZSA 5L88H 1EBPA 4MNGB 3EBGA 1P9MC 3SHSA 3KWUA 1KCRH 3CSYB 1RIVH 4NO0A 1TQUA 1M71A 4M6MH 4LLDA 3TNNA 3GEFA 1T6VN 4A7TA 3VQ2C 4QF1B 2M83A 4Y4HD 5FCSH 3MLXH 3LEXB 1CF8H 2WB1A 4WFEE 1D9KB 5ICXA 3RVTC 3UGXA 3LKQB 1MEXL 3HS9A 1A4KA 4B27A 5HGBB 1KCUH 3H0TA 2A4ZA 4UIKL 3RY6C 3QFDB 5FDWB 3B2VH 3OWEA 1NC4B 5E2TL 1UOWA 3IDGB 1JERA 1UM5L 3KJ6H 4OLXL 3ZUNC 3RIAK 3R4DA 3P4NA 2EDBA 4APXB 2E7HA 5ACMA 2YSSB 1PZ2A 4K71B 4MWFB 4TSCH 4TQEH 1JK9A 1UOVA 2AK4A 3CHSA 4KX8A 1HHIA 1RUMH 3D85D 2FT7A 4HJ0C 4ZFZB 5E5MA 1JHTB 2DWXA 3DV6B 1ZLWK 4B9FA 5IVXB 5D2LA 3BD3A 2FATL 5D1ZD 4I3SL 4JHVA 1WFMA 1RAMA 5C0AE 2R51A 2MPAL 2R1WA 2VOTA 3RVVC 1WIUA 3BN3B 2ERJC 5KBLA 3L45A 5H35A 1B88A 3ET9F 3INUL 4LCCB 5AAMC 1J1OL 3GUTA 5DT1L 3IFPB 3ZQ9A 2WUCH 2XA8H 4CN6A 1YMMD 4PJHE 4Y2LA 2ETWA 3Q8BA 2X12A 5GGVY 1QO3A 2AJYH 1XIWB 1DUZB 2X6CA 4HK3N 5DHXB 5D7HA 2GBAA 3E2HB 5DJ6B 2EDNA 2IQ9L 3V6ZB 3FUEA 4ZDHA 2VLLB 3CZKA 3WFCL 1OL0A 1BQLL 1AR1C 3G6JE 1FHNA 1L6PA 5F6HI 1H3XA 4D0DB 3PHAA 4E0RB 2FIKB 2WNXA 2G75A 2VDRH 3NCJL 4G8GE 4N68A 3FQ4A 3HI5L 4S11A 4U6HA 5FYKD 3NSFA 4NQDE 1S5IH 4TULL 4JZJA 3QQXA 4UV7L 5L7XH 3I6KA 2NX5E 3D06A 2DQUH 2PPEA 2VLRB 1E5AA 2YPVA 1BJMA 3VI3A 1ED3B 3KYMA 2VDNH 4U0RC 2EE2A 1U3HD 3LD8B 5K9KA 5L2KA 4S0HA 2CGZA 2CRMA 4LL1A 1VSCA 2D7OA 3RJDA 4DK3A 1PZAA 2FSEB 2IDFA 2QMKA 2J8UE 4BINA 1JTTA 3MOAH 4BUGA 2FO8A 1A9EB 2QSQA 3V0DA 3ZUCA 4DZ8A 1AC0A 1VFBB 1XX9C 1LQBC 4Z7VF 3STZB 2Q87A 4DKEH 1QOKA 3FU8A 4ADJA 1PY9A 4Y4KA 1HS6A 2P7TB 5FA4A 2KLRA 4L3EA 3TJHD 4CW1A 1XL6A 1T1WA 3C2AL 3A23A 3MXWH 3DX4A 4BDVB 4EDXB 1CGXA 4KOBA 3VTMA 3FT4B 4QRQA 3SDDD 2DWEB 5A2AA 4X4YB 4L4TB 4M00A 4HIIA 3TLRA 4XNXH 4LLWB 4LCYB 15C8H 2DJSA 4PGEB 4Q9BA 1NCIA 4B9GA 1EANA 3JWDH 3O9WA 1GS7A 3EOAA 1J5IA 2VC2B 5FO2A 1V5JA 2HX7A 3FO2B 5CINH 4LEEA 3CBRA 2CMRL 4XTRD 5BXFB 4FXGA 4TLUA 5LAXB 3FB8B 5HI5C 3NZUA 4S10A 1VDGA 5T3XD 3K81A 1Y1DA 2WC7A 4IU2B 4U1MB 5F3FA 2MTAA 1F8TH 4JVPA 1NEZA 1I7RB 5AD0B 4OZFB 4AW7A 3SE6A 4PGBB 4HCRH 4YJZL 4KITB 1NDMA 4XNYH 4AT6A 1E9OA 2UXFA 3BIKB 2VDQL 3EYVB 4N4YB 3WS3B 2DDQH 2YA2A 4I3GA 3CXHK 3MR9A 3ZMEA 4KK8D 4UTAL 1MJ7L 1MCPH 1KPVB 3AB0C 3GD1C 5CCKH 2Q10A 1MCJA 1E5BA 1LO3H 1WBXB 4JN1L 4XOEA 2JQAA 1QBLL 3H55A 4XAWH 3ABKB 4UNTA 2WO3B 1G6RL 5H2BA 4K7FA 4EIGB 3I9PA 4OF3A 1X5IA 1ZANL 1UM4L 1FAIH 2XWJB 3NQKA 1XBRA 4GSXA 4LFHG 5MEPB 4Y4HA 4HJSA 5BOPA 1IAOA 4YDIH 1QMUA 2ENQA 1A0QL 2R15A 5FB8A 3FFDB 2XBDA 1C5DA 4O02B 5KVFH 3LH9A 1BGXH 3FU5A 3K0WA 4RLDA 1O9WA 3EGSB 1DHKA 3D39E 4OLEA 4KNUA 4OJDH 1P0SE 1A7QL 4ODUA 1BQHG 3EGDA 1KIUB 1VF5C 4POZC 2PCYA 3EYOA 5ALCL 2H45A 2G2PA 5SV3A 3ZBMA 2G5UA 3MRJA 3DSNA 1TQWA 1G94A 2EDHA 4S1QL 3N06B 5EG6C 3CN4A 2HFFA 2A83B 3D85A 2G3XA 3ZQXA 1WC7A 4BQ6A 3QYNA 4GW1A 4OCLC 2Z7UA 4H13C 4I2XE 3QFGA 1S5HB 3O6FA 5DFVC 1EJOL 3VD3A 3B2PA 3DXAD 3QP3A 5D1ZA 2B0SH 5K9JL 5EBWA 3RDTB 3BZFA 3FOLA 3LEYL 1F2XK 4KVNH 4TLKA 4WSGA 5TDOA 2JJTC 2ZG1A 1U92A 2CD0A 1KEMH 1A6PA 1U0QA 2PMZA 1IFHH 4NKDB 2JJWA 1HN1A 4YQXH 2IQAB 5ICZA 3T71A 4F15B 5C07A 4R3SB 3SODB 4N2LA 4OTXL 1KELL 3EBAA 3EG9B 1T03L 3B2DC 5J11C 5GJSH 3QORD 3WUWB 4JFUA 1XXDC 2E4TA 3MGOB 5FCUL 3C60A 1ACYH 3CLFL 1MHEB 3VTAA 4MQSB 4N2DA 3V0JA 1ZV9A 4P48A 4EEEA 4NDMB 1HL4A 3WENA 1UHVA 5A2LH 2CDGA 3EZ8A 4U6YB 5HHOE 1J0IA 1A2YA 4YHNA 1SM3L 4XVUC 1U8IB 5E99L 3ELAT 4OV5A 3QZLA 4N8CH 2UZIL 1LTXA 3NSXA 3DDFA 3KLKA 3SPCA 1U3HA 1JXFA 3FHQA 5I5RA 2PYEB 2TSAA 3QQ3A 5JO5B 4AGQA 1FH5H 2YBRB 3D52A 5D4HA 4EUPG 3DRTB 5HHXH 4J39A 3CXDL 4H4NA 4LPYA 1XGUA 3VXTB 3WO3B 3M8OH 5C09A 2QR0A 4XP9H 4KUZH 4XNQB 5IMOA 4DF9A 3LDBC 4X99B 2Z35B 3B34A 1FVDA 4AQ8C 2Y36H 2B2XL 1E9PA 3RJQB 4A7GA 3CVBA 5AVTB 4GLRH 3SDDA 4EN2A 4KDVA 5EBLB 5DD6A 5K39B 1ZLSL 2GT9B 4P5KA 25C8L 4ISVB 1EFXD 3V5DA 3DX6A 3ES6B 2I7SA 3DJTA 2DQFA 4EN3D 4V1DA 4R97C 3TH4T 4FLQA 1BAFH 1EH9A 3ARBD 3LN4B 4WUUD 1ZT1B 4GAJH 1JS4A 3D4YA 3PABA 3UYPB 4RWHA 2NY5L 2V2TB 2B39A 4GKOA 4HBCL 4FJ6A 3IDIA 3BKCL 2Y1VA 2X4OB 3UBXB 5FYLD 4BFKA 2HFTA 1Z3GH 4XZUA 4OGYL 2BVYA 4AJVA 3NIDB 2A6KA 3L3JB 4HMDA 5CJBA 1A14H 1WS7A 3SQRA 1HJCA 2CG9X 4NWTH 3NRPA 4DGUA 4PU2A 4ABQA 2APXA 5D7LD 5LUMA 3WEOA 4XE0A 3CZLA 2FEDC 3N44F 5HYJD 3DIFB 1NCNA 2IOMA 3RZCD 1MCCA 1W72A 2HJFA 1AAJA 4BQBA 3VWKB 3GRGA 1F86A 2VN6A 5CP7A 4XN1A 4ZG1A 2BSSB 1M2VB 2ZP8A 1DQQB 3AY4C 1OHZA 2WO2B 1NFIB 4P2OD 3HBGA 1OVZA 4XCYB 3RVXC 1U8NB 2OYKA 1URZA 2BMKB 2P8MA 1TJGL 1SUHA 1UXMA 3EFFB 5IMLA 1I1AD 4OQTA 3VDCA 2V37A 4JFDA 3D69A 4QRPA 3VD5A 4C83A 1NIFA 2FNWA 3P77B 3FCTB 5DJYA 1IKFL 4ELMB 3SBWA 1NBVH 5DWUL 4L3AA 1N5AB 2IJ0C 1IEBB 4IIZA 4AMKL 1E7UA 2VYRE 3K8KA 1OWRM 5FYKU 4DT2A 1P2CB 5J6HB 3LIZH 1Z9OA 4P5RA 1WAAE 4QTIH 3WMQA 35C8L 3T65B 4M7JH 3L3HA 3T8VA 5KVEH 4RA0C 4QXWA 4LP8A 1ORQA 5KSBE 4UQ2B 1GVIA 5BRZA 3FB5A 5JW5A 3RFZB 1G6RB 2WVTA 2I85A 3RX7A 2V6HA 3ZDZF 4WEMB 2KZ1B 3MYJA 4YZFF 5DJXA 5IGXH 4KWUA 3T0EA 1MCRA 1R24B 3G08B 1VADB 2W1NA 5DUML 4Z7AA 4WUKH 4FLRA 3C6LC 1PCSA 5EO0B 4EI0A 1M3IA 1IGJB 2WQXA 4WWKD 4EI6A 4E9YA 3FUKA 3U9UA 2JCWA 1ID2A 3DXAA 3S5YA 1J7VR 3GS7A 5SWZE 1R3LB 4ANXA 1BAGA 1ZTXH 4J2QA 2HN7B 4YHZH 4P3CH 1U58B 1ZS2A 4JJHA 5AB2A 2AXHA 1FL6A 1A7PH 3SDXB 1DN0B 3K1DA 4GQRA 5IB2B 3HE7A 1XF3A 4GQQA 4L29B 2GC4C 1HOCA 1JXGA 4LEXL 3VXNA 5GZOC 5GJTL 1FCCA 2VDLL 2XPGB 1UJ3B 1UKQA 1J1XH 4AVJA 3QEQD 2G2NA 5F9WC 4PRHD 2OS7A 4EDWL 3QORA 4B6ZA 4H8HA 4ES8A 2DLEA 4OT1L 1DVZA 3VUAA 2ZXDA 2WAHA 3X1NA 1KNOA 5A2CA 2OM5A 3MX0A 1OPGH 3UJIH 4I7ZC 4I5BA 1DJWA 5EO9A 5GGUB 2GJ6A 1MRCH 3N85H 4PJGF 4WI4A 5AVVB 5AW5B 2Y5QA 5HYEA 3HB3C 4R5XA 3B6SB 2IDTA 4QTHA 4ONFH 2Z4QA 4P4KC 2R56L 3H3BC 1XGYL 1XO8A 3V52H 5ID1B 5JHLA 3FRPG 4ZPVA 5ACZB 2DM7A 2YEZA 2IDQA 3PJNA 4LOVA 3ZTEA 1OWWA 3BKYL 4L4VE 4J3OG 4FFTA 3HPLB 3JZYA 3TVMD 4E36A 3BWUF 1HXKA 4WFGD 3ARPA 4XBGB 1AD0B 3OXSA 2CLVA 3ILDA 4F3FB 1KTCA 4EBQH 5KWYC 1T04B 4H1LB 4MSWB 2Y7OA 3G7TA 4K5NA 4MXQD 2OZ4A 1RIVL 4R4FL 2EIZB 3FQXB 4M6ML 4OUOA 4RMVA 3HZ3A 4C4UA 3FQRA 4M1GH 3QVAA 3H56A 3AQYA 3LKNB 1GZQB 4N8VB 1ZAGA 1CF8L 1BLNB 4NRYA 4MVBC 3P73B 1R5WA 3ZE0E 1G5AA 1XR8A 1CFQA 4LIQE 2G60H 1A1MB 3IKKA 3U25A 4GG6A 2X3CA 3LSOA 3RNKA 1KCUL 1XH3A 1F1AA 4PBWD 1OCCB 1GGYA 1H9VA 1CT8A 3OD3A 4P3DB 3IRZA 1S7UA 3GSUA 5EOCH 4P46B 4Z7UA 4YBHA 1E4XI 4LL9A 4Y2DC 4WUUA 3PAUA 4OGXH 2ILLA 3HR5A 3SEPA 4TSCL 4HUUB 4TQEL 3DTXA 3LKRA 5DJ2B 3KGSA 3QCTH 5FA3A 1JIBA 1U30A 1RUML 2CH8A 1OANA 3CH1B 4PW3A 2NXZB 1BAWA 2X7LA 4F9PC 3ZE1F 3WY1A 4UQ3A 2C1PA 3IFOB 3VXQA 4IOSD 1G7LB 3BH8B 2IF7A 3C8DA 3L81A 3D5OF 3QI9A 2QKIA 4PJ5A 1YAZA 2C9AA 3C08L 3QWRD 4MAYD 1D5XB 3O3AB 5GIRA 1PTZA 3RHWK 5DJAB 5DMGD 2B7DT 2WLYA 2VSMB 3QDGB 3OLEA 3CMGA 3IN0A 2H2PD 5EC1B 4EQ3A 4GO6B 5GSVA 4R2GB 5I6NA 2D03H 2G3ZA 3BDYH 4YIQB 5GS1C 4E41A 4AIOA 2X4UB 1LEIB 1PZBA 1TKWB 3FTUA 1E9QA 4MLIA 4PJ7B 1KY6A 4GRLD 4PRNA 1FVCA 2ZUQC 2ALAA 2E7MA 2KT6A 5E6ZA 3SJVD 1KCWA 5DZ9A 5BUAA 4P2OA 4K9EC 2XVKA 2WUCL 2XA8L 1TNNA 2CKBH 3T09A 1ZHKB 2AJYL 4RGOH 3C5ZB 3LZNA 5ITBH 3RGHA 4I18C 2BY3A 5E23A 1H3UA 1UFUA 3CDGB 1V10A 4N2AA 4X6CF 3DJZA 2VSCA 1H0DB 2BINA 5F9AC 4OD1H 4N1CA 2EYSA 5E4AA 2DF3A 1KCLA 2DKMA 2VDRL 5DK2B 4CJ1A 1L9QA 2H32A 3A5VA 3AITA 2APVA 3ILPA 1S5IL 3TA3D 5IM7B 4POUB 5L7XL 3K72B 4HUVB 4NYLB 2A0LC 1U36A 2E6QA 3U4BH 1PNDA 1Q8MA 2DQUL 4K8RH 1DR9A 3NIGE 1J05A 3F85A 1IU1A 4UTBH 3H9SB 5E1AB 4PSRA 3ZKXC 2OMYA 3BPLC 1JVLA 1JE6A 1X5AA 1FC1A 1AZVA 1UQSB 4FQQA 1UM6H 4NOBA 5CJOH 3BSZA 3VD9A 4MD5B 3MOAL 4WWKA 5B38B 4RAVB 4KKLD 3ZHFA 3ZMNA 5E08H 5TD4A 3MV8A 4J3OF 1CGVA 4PJ9C 1H8SA 2MKLC 5BO1H 3T1WA 4TQHA 3CK0L 1J87A 2A77L 4IRSD 3KWWB 4NKIL 1P5VB 1EUTA 1TOXA 3LYRA 3NG5A 5C08B 5AYUH 1EO8H 3AFLA 4HZAA 2WZ0A 1F56A 4BRJA 1R34A 2HT3C 4JM2C 3PPEA 1J8HE 4YPGA 4XNXL 1MWAH 3FONB 1TG8A 1O6VA 4HWBH 4YSSA 1SRDA 1S9KC 3JWDL 4XX5A 2AVFA 2X88A 3FC8A 1F1GA 3HNTH 2Z8VC 5KOMC 4N2FA 3F00A 4PRHA 4BH7A 2CRZA 3VXSD 3VWJB 5CINL 4FXKB 2CPUA 2ENJA 2Y5TA 3ESUF 2WVVA 4N25A 4RZKA 4Y16D 4JGNA 4NRXB 3RL2B 1HL5A 2H8PB 1DQKA 5DVLA 5EZLB 4L2YA 1F8TL 8PAZA 1C16A 1XFPA 2VDLB 5LDSA 4NI6A 1G7MB 4HUWA 5ID0A 2VMDA 5IJKC 1NANH 1PQZB 3S36X 1DE4A 3IJYA 1J18A 3GSOB 4HCRL 4G82A 5KVGE 3NA9H 4GKSB 4M3KB 5KANI 3Q6FA 4HGWA 3OX8A 2DDQL 5BUGA 4MJ6A 3OHXB 1L3NA 4JMNA 2C9PA 1MCPL 3D0VA 5CCKL 2DMBA 4NKMA 3WTVA 1K85A 3CFCH 1UWGL 4HH8A 3TFKD 1FNLA 2Y7LA 2EIDA 4XMTA 2W60A 1RULH 1T5WB 5JW4M 3HBZA 1N59A 5INDA 5IB4B 4PWGA 3PIQA 1WZAA 3HAEB 4HS8L 1E2ZA 1DDTA 1FAIL 4TUKH 4JKPH 4PJAB 4CDGC 1AG6A 1F41A 3FBQA 4JKKA 4YSQA 1U95A 3W0WA 5ESAA 2BDNH 3FU6A 5DHDA 1OAQH 2QSVA 4Y8AA 1FNSH 1O7VA 2BSBA 4YDIL 2EC9T 4ZSOA 2Y1YA 3TO4C 4WHTB 4FQHB 4HKBB 3X2QB 3DMMD 2KL6A 3L3IB 1CLVA 3OJVC 5DLLA 2E47A 5DHVA 3FH7A 1MQKH 2AJSL 2HTKC 3PLYA 2ARJA 4CBPA 3ARGD 1RFDH 5HD8D 3TFBA 3RQ3A 1B4TA 4FKEA 3FQNA 3ABLB 3NCYP 4UM8B 4KK5C 4MDIB 2O4EA 2VMFA 3QXTA 3X12B 1AO7D 2DWYA 4IK6A 4DEWA 5HVWA 1AQMA 5I24A 3ZU8A 3TF4A 2ZCZA 3ULVC 2NY6D 5HHPB 3KLQA 2OYMA 3MFFA 3P3TA 2OXHA 3MRGB 1D5BB 2GK2A 1T20B 2VZ3A 4MLSA 3OKMB 2B0SL 4HOXA 2A2QT 3N55A 1OARH 3QWRA 4Y4FD 1WEJH 1Z9NA 5I9QB 4CVZB 4KVNL 3MNVB 1KEML 1KJ2L 3AU1B 3TO2A 1WFIA 1IFHL 4QHLA 4JAMA 4YQXL 5E8EA 4KJYB 3B3IB 1SY6A 3DOHA 4APQC 3APMA 4RZCB 4GRLA 1KGCE 3DVNB 5C0GB 1XSKA 1KIQA 2F5AL 4MCYB 4KZCA 1LGVA 4B9ZA 2VO5A 4JFFE 3C6SB 3GDCA 4PLJC 4HW6A 3DWTA 5GJSL 2B16A 4TMPA 3RNQB 2YOAA 1P7QD 4JGUA 4RMWA 2MQ3A 1M57B 3PWJB 3TWCH 3O0RH 5DMKA 1BVLB 3X3GH 5I0DA 3ULVH 4PJXE 5IW1A 5I1HL 1I8AA 1OGAE 2X89D 4L8SC 1CQYA 1H15B 1KXTB 2IAMA 4U1SB 2IVFC 2EEBA 3REVB 4A6YH 2JXMA 4CA4A 3T3MB 3VFRB 2G4EA 4OD2B 5E9DE 1U3JA 3TA3A 3FB7B 2P9RA 4IRJD 3SQOH 2WYIA 1ZHLB 1MFUA 4QXGH 3DJRA 2OTWB 3VFOA 1VZHA 4NM8H 1N26A 3MNWA 4K7PH 1G87A 3FOMA 5F2FA 4UT7H 2OSYA 5BQ7B 1E6JL 4NIKB 4NRZB 3TCLA 5HHXL 4HH9B 3KL3A 1QBML 1INEL 3L13A 4XVTH 3ZE2B 4D9RD 4FMKA 3AQDA 4ETQB 4GB9A 4NHUA 1DVFC 4RAUB 4MHHI 1S9WA 3M8OL 2Q86A 4XP9L 4KUZL 1WWCA 3MODL 1I7ZA 1UEYA 1XGZA 5BRPA 3OR6B 2GYSA 4FG6D 4AYDC 2ESVD 1TTUA 2H1XA 1EZVY 1UD5A 4G6FD 1PLBA 3K4AA 4DGIL 3BYYA 4Q8BA 2CK0H 4LHUD 2TSBA 2ERJB 3UAJC 3IKCA 1YUHA 4D0BA 3VFTA 4UDUB 1I31A 1BOGB 3BGMB 4JCWA 1QEWA 3CSBA 4ZPTA 4DUWA 3LB6C 4A67A 1PY4A 2VLJD 1WAEA 2R0KH 4LCWD 5A3ID 5T1MA 1NQBA 4Z7QF 5I8KH 1BAFL 4HD9A 3L5WA 2K4WA 4GAJL 4NJAH 4HUXA 3I9GH 1AR1B 5DDHA 2IPTH 4R7NA 1P7KA 3WSQH 3BPNC 1UUSA 3KNBA 2AXJA 1YG9A 4YWGH 4LSQH 3LXCA 3OKEB 4XHJD 3U0TA 3L5XH 4ZUWB 3MTRA 3OPZL 4WW1B 1HFUA 1WISA 4NWTL 3UZVA 3WL9B 3MTXA 4U0RB 1JDCA 3FULA 4OIFA 2GY5A 3QDME 4YSTA 4EO5A 4ABWA 5IW6B 1PIGA 2DQTL 5E6YA 5L8LB 5KG9B 5EC2B 2JELH 3MKKA 1D5MB 3IXAB 5IESH 2WVUA 1MW2A 1K72A 2EXSA 2WLJA 5DYFA 1G7IB 1KTBA 4PWFA 1W9XA 3BAXA 3HMWL 4G71B 3HE6C 5TDNB 4KY1H 4ABUA 1IC1A 3ZPDA 4F93B 1AHWA 5EZOH 2NY2D 1B3IA 1I8IA 4U6XA 4XPAL 1NBVL 4JVUA 3PP3K 3Q1SH 3VGHA 5DUPL 1YN7B 2FVNA 4E9QA 1JZIA 3DMMA 5JOFA 1DP0A 4Q2ZA 3IMSA 1KN4H 4AMXA 5JOEA 4M7JL 3CBKB 5B3NA 5KVEL 1RH8A 5FGCE 1ADQH 3APDA 4KKCD 4MCMA 1A7RL 2YQ2A 1N9PA 1KF9B 2PO6C 1IVTA 2CBQA 5KSUB 3FRUB 2JSFA 4WJKB 5IGXL 5LKNA 4M5SA 1AO7A 3F01A 4Z5RA 1R5VA 4OZGF 3S37H 1MHHA 2PR4H 2WYHA 1QASA 1RZGB 4G8AC 4PJEF 2O6EA 2R4SH 2NY4C 4P07A 3PWVB 2PR9A 4X2UA 2BSCA 4ACTA 3VM5A 3KPSB 2LAGB 4L05A 1E4KA 1UZ6F 3PXHA 4HIXL 5CR8A 2AK4E 2Q3AA 1T89A 1ZTXL 5D7EA 2BRQA 4L8DB 5FDYA 2ZXEB 4YHZL 4QYOB 1A7PL 4XVJH 3HHSA 3ILEA 4KHXH 1TU2B 3FQTB 4UDTB 4Y5XA 5D2LE 3K2UH 3ZDWA 2AHIA 4NO5B 3KPLA 3G9AB 3AB0B 3QIUD 1FL5A 5BMFH 1NOLA 2OQJA 1MXGA 4XX1G 1J1XL 4Q14A 4PWKA 3FZUD 4U1LA 3CHQA 3GMNB 4WI0A 1RP8A 4JRXD 5E6ID 4FQLL 2PXYC 1P7QA 3NJMA 3OKKB 1WHPA 1DO5A 5BJTB 3EXJA 4RRPA 4M1CC 2LLLA 5FV2A 3QPQC 4N26A 5DC2A 3T2QA 3OKNA 3VVVA 1KJ2B 2AEIT 1X7QA 4Q7DA 2V33A 5KS9F 3UJIL 1C1EL 4HXAH 3W39B 3FH5A 1KUMA 1SEQH 4NKOA 1MRCL 3N85L 4NM4H 2IFGA 3UOAB 3I6SA 2OMUA 3F7RA 3FO1B 3V4UH 2ICWI 1A6TB 2H0PA 4QYAA 1NBZA 4OH2A 1IEAB 1BIHA 3ZR5A 4DKTA 4DTGH 4LSSH 3THMH 5A2JH 3RWFA 1DUYA 3GWJA 3HC0A 1KLFA 2WXPA 3V52L 1N3NA 4QOKB 5C6WH 3QJVB 3OZ9H 3V5HA 1SYSA 5B21A 3GLDA 4AUJA 3MCLH 4QKTA 5DEGB 3VI3E 3WEXA 3VXOA 2EO9A 3L1OH 1IAII 4ORGB 1IC4H 2ZIDA 2MNJB 4Q6KA 2YPKB 4HJEA 4CC4A 5L2KE 3O2VH 2Z0UA 3CFDA 3MLUH 2ZX6A 1MFBH 3CFJB 1CPUA 1MWOA 2F8OA 3KDPB 3KVPA 4UOQA 5D6CB 5FUZH 4UIMB 4B0MM 1JZ7A 3AROA 2EDFA 4N6RA 3ASWA 3U7YH 3F6JA 1D7FA 1JHKH 1X9QA 3N0AA 4LHUA 2A74A 1BDYA 4UU9B 5MP6H 4Y2OA 3EJYD 4KRMB 3QUYD 3T1FA 2G60L 2Y7MA 3P54A 2YGQA 1L9TA 2SODB 4FGMA 3PDOB 4HZLB 4AEFA 4ZX4A 1VFAB 4L3EE 3BQUC 2AXFB 4BSVA 5J11B 4L23A 4MYPA 4R4NC 2VLJA 2WXRA 4PJFA 5EOCL 2OMVB 3WS6A 4KUCD 1PW3A 3MRFA 2BOCB 2HKHL 4G9FB 4OGXL 4EOWL 2X6AA 2BNRD 5SWQB 4KI1A 3QCTL 1KACB 1FNHA 1LO5B 2R4RL 6FABH 5IJVA 4BUHA 3BVDB 3UAEA 2XHNA 4H44C 4BQCA 1B0WA 1PZDA 4ZRGA 1EERB 5LBVA 1JDAA 1KULA 4ZXBC 1HHHB 1CXLA 1BQSA 5IBUB 2R23A 5C6PB 4DJMA 1IAIM 1HH6B 2V2XA 4GSUA 4XODA 4YDVA 2D03L 4TUOB 3BDYL 2AEQH 4BM7A 2JIXA 2N4IA 4GUPB 1U8QB 1IGFH 1FGVH 3DI2B 4N2CA 4JB9H 5T1LD 4DW2L 4YLCA 3OL2A 2CKBL 3GHPA 3H3PL 4EZLA 2GIYA 4RGOL 3SN6N 1K2DB 5ITBL 3LDBB 1KIRA 2C3XA 3VG9C 5ABAA 3JVGA 2ISDA 2N7SA 2PCFA 2DEWX 4MGXA 4HIEB 5B39G 1HTYA 5E8PA 1QTPA 4WW2A 1X9RA 3CAFA 1MCFA 4R97B 3U4BL 4B5EA 4K8RL 1TZ8A 3SGKA 3LQZA 1GY1A 4GPVA 4HXBH 1FRGL 3LV3A 5E0FA 3MJ8B 2AEPH 3QUXC 1OSZA 5I1GH 2FT8A 4YFDB 43CAA 5IF0B 1UM6L 5C0AB 1CU4H 5A1AA 3HG0A 3MRIB 2WHVA 4YXKH 4IMKC 1XD1A 2YMXL 3T0WA 1MREH 3U6RB 2WYZA 1AHKA 2QLVB 2K7QA 3L6FB 3ZK0A 2BVOB 3W9EA 2GSMB 2P52A 3BZEA 1EO8L 4RX4A 2BFVH 4M4PA 1CDGA 3VFMB 4OCSL 4PJHB 4JKNA 5D7JD 3RWEB 1OAJA 2BOBA 1MWAL 4O4YH 3MA7A 4ODVH 5DD0L 3E6HA 4HWBL 1BX2A 1SEBA 2MWCA 4IS6A 4UQCA 4PRDB 1AVAA 3NOIA 4ZAKD 3LPPA 2OP4H 1KLGA 1QFHA 3NJKA 5C07E 3G6JB 1PF3A 5EU7E 3TYFA 1HI6A 3HUJF 5E2UH 2ZWYA 1MCKA 4G8GB 1W0VB 2BERA 1F0LA 4ZFOL 2WGXA 4NQDB 4YBQC 4XMWA 3NZHH 1UXSB 3TA4D 2NX5B 1VFUA 3ZZQA 2DQMA 5ITFA 1JPFB 3PGDA 4X8JB 3F7LA 4XB7A 3CCHB 1DJZA 4LVHC 1RUAH 4KJQC 5KTEH 3QJUB 1HKFA 1FZMB 5DK0A 3BE1H 5BZZA 5DGQA 3B7SA 5K5YA 1KDIA 3MMEA 4DSYA 4XP5H 2XZAH 4JM2F 3L3KB 1Q9WA 5FYKE 5TE7L 3ZT5A 4JUSA 4OBRA 1KBPA 2CJ3A 3PDDA 4FYSA 4Z3IA 2DPKA 1B0RB 3C6LB 4U3HA 3LMJH 3CFCL 2BSED 1EEYA 4OCRH 4ZOEA 4B60A 2EKSB 4E9VA 1NINA 4Z3EA 1RULL 1KWGA 2E75C 1FFPB 1HCVA 1T80A 4TUKL 4JKPL 1R33A 3IPBA 2BDNL 4NKQB 2UWEF 4TNVF 3MFGB 5C09E 1OAQL 1MPAH 1IJ9A 1OD7A 3M7FB 2EDXA 1ZA3A 2Y07H 3DOSA 2RIKA 3HG5A 1PPIA 1T6BX 5CS7A 1UENA 5EN2A 4IDLA 4UQ9A 3Q13A 3M1CA 1Q9OA 2WBJD 2B8OT 1TPXC 1SZNA 2MCMA 1MQKL 2DRUA 2OMTB 3KM1A 4KRPC 4PP2B 1RFDL 5F9WB 1BPVA 2JKRM 4FFWD 4HG4J 5F70A 3IT8D 1MFDL 2UUDK 4W6WB 1NGWA 1YSOA 4ACPA 1T21B 2OJEA 3O11B 1CXEA 2AQ3A 3Q2NA 1A6WL 4MA3A 2DEXX 2BSRA 2VISA 4ANWA 2F68X 4XH2B 3RWHA 2ITEA 3L7EA 3QQNA 4V1DE 3VFWA 3T6QC 1ACZA 1A7NH 3V7MA 4LKCA 3IMBA 4GFTB 5I1LA 5MEND 3O6KH 3HB3B 3A0OA 1QPPA 3REWB 2ZSVA 4YO0B 4P4KB 4PB0H 1P6WA 3LRHA 5DZOA 4QRSA 4LZKA 5CAYB 1WEJL 4GI6A 4IBUA 3A47A 3CZJA 1AD9B 1QLFB 2V5YA 3TBYA 3NFNB 3DBXA 4LPTA 4YNYA 5DJDB 3KXFD 3CN2A 4F8PA 1AI1H 1YN6A 4BWTA 4Z3JA 5DJ0A 4WHDA 3V10A 1FAKT 4PM1A 4NB7A 3CFEB 3BWAB 4U7KA 2BIOA 4C58B 1C9SA 3FN3A 3CSFA 1OV8A 1WYJA 3FK3A 4HHAA 4X98B 2MRYA 4M4RA 4PCSA 1GR7A 1TT6A 2E7LC 1I8KA 1I4FB 2W0FA 1AE6L 2WSKA 2X4SA 3MRPA 4ODWA 1JP5A 4XP1L 4M9OA 5T1KB 4AVIA 2NY0D 4ZTOL 4X5WA 4HD5A 4K94C 2OA9A 3O0RL 4LLVB 4UILH 4XCCH 4QF1A 4XXDB 1HXYB 4LSTH 2YFOA 4AE1A 4XP6H 5J89A 3ULVL 2DJ4A 1PCXA 3UTSD 2XDHA 3ULVF 3CQQA 2D9CA 4WKZB 3WIAA 4UT9L 3D39B 4X7TA 4GIOA 2HKFH 4JFDE 1U33A 1NL0L 4QRPE 2PETA 4MTMA 3V9FA 1MIEL 3U1SL 3QW9A 1CZ8L 4JZJC 5C97A 2I5YL 4Y2DB 4QXGL 5DO2C 2ICWA 1OTUC 4NM8L 1F00I 3IETB 4Q97A 1ZXKA 3VFVA 3GMQB 5DU7A 4I2XB 4UT7L 4X4ME 1YY9C 1SOQA 3QNZA 4XVTL 3DARA 2ADIB 5BRZE 3EOYG 2XZZA 1QFWI 3VRJB 1AC6A 3ZHNA 2F54A 4K94H 2AV7A 2EH7H 3MRDA 3T0EE 1KC5H 3QWOB 5CZKA 5IK3B 2YLHA 2DYRB 1P6AB 1R3JA 2R2HB 1W8NA 3WLBB 2WSDA 1ODUA 4XMPL 5GS1B 4Y4KC 4PY7A 4JUTA 3VCLB 4AI7A 2QVKA 4XN9A 5DRXB 2OI9C 3DXAE 1G7HA 2IFFH 2ZAGA 1H3PH 1XCXA 4L37B 2ZUQB 4WWOA 3RUGF 2LV4A 1JRHH 3RBGA 5LCVL 3VXUD 3CFKB 2A6IA 4KK9D 5I17A 3HLAA 1W6LA 4ZAKA 4ZUSA 2HFEB 3KGTA 2YPVH 5IQ7L 1TEFA 3O9WC 3U9WA 5GS0C 4L3CA 1OQOA 5CEXA 3GEWB 4I18B 1CFBA 4IBTA 5E8OA 1U8CA 4CN1A 1GC1H 3TEYA 4ANUA 3HKZA 4NN7C 1DANU 5EOQH 3I9GL 1PY0A 1BD2D 5HHOB 3BPCB 3ECWA 4OZHA 3LIUA 5EUKA 5EF0A 3CLEH 4FXGC 4QPEA 1TTBA 5C3LD 2F08A 4GMSL 2VDMH 4Y5VA 3WFBH 2Q7YA 3ZDYE 1DJSA 4LSQL 3TZVD 3KDMB 1JOIA 1MWAB 3RWCB 1MW3A 5DUBB 4LIQL 1SQ2N 3C75A 3JWOH 1H6EA 2NYKA 1F1DA 5C0DA 5A43C 5F71A 1OCWH 3ZKXB 4RQQA 1QFWM 3BPLB 5DUJA 2GJ6E 2E7DA 3N3EA 1XGPA 1WGVA 1BXXA 1S7VA 1DEEB 2ATKB 4ZFOB 3ZRSA 5IUSA 5FUOL 2JELL 3BP6A 4KZEH 3IDXH 5IESL 3SZ6A 5GS0H 5T33H 2BSEA 4P2CG 1KXVC 2C26A 3RTQD 1CB4A 4PJ9B 3ULAB 3OJDA 1UZ8A 5HDBF 5LLIC 1HHGB 1FCGA 3FT9A 2EJ1A 4KV5F 4KY1L 4X5XB 2ZSWA 5DHYA 3TEWA 2JB6B 4N8UA 2D8KA 1JYXA 4OF5A 5EZOL 4FG4A 3H4FA 1UA3A 4JM2B 3Q1SL 4Y4HC 2HFGH 4N2BA 2ZUUA 1JNHB 4BV1A 2H6PA 1S7SA 3FH8A 5I23A 1HQRA 5AW2B 1J10A 5J57B 4NNYB 5AW6B 1ADQL 1XSOA 1IBDA 5GSRA 3NCCB 2C9RA 3WLWD 2DI7A 2EIBA 3IFLL 4D94A 5E5RB 3ARQA 4N0CC 4F37F 3FB8A 4HALA 3S37L 1HEZB 4Z7UE 4U2ZA 2PR4L 1ZXQA 2IBZX 4WUUE 1IBYA 5G5DB 3WFHB 3RG1C 4DWHA 3HZKA 3BGFB 3ECBA 3MV9A 5D1QA 4YC2C 1J9TA 2MCPH 3O6FC 4N8VG 2ZOUA 3D3VA 4IRZH 5D1ZC 2B14A 5DFAA 4CL7A 4Q58C 1RK0A 3QQ9D 2QPEB 1E42A 1CYGA 4JPIA 4F8TA 3GHBL 4GW5B 3WS3A 3WIIL 2Z93A 3K2UL 5EEWA 1CLZL 2QGCA 1BJ1J 2I9LA 2DWDB 4K2UH 4PJ5E 4PRIA 5TH2A 3HC2A 4TNWF 3V0WH 2BC4B 1QVOA 3TC9A 1E67A 2OCFD 1RZJC 2XRAH 3O2WL 5EU7C 4WDIA 3MJ7A 4E41E 1R75A 4JANA 4EZMA 1G1KA 2VKWA 3IBEA 2CKNA 1UKSA 3BPOC 4Z7WF 4XPBL 4IDJH 3H54A 1U91B 2OMZA 3X14A 3V79C 2IPUG 3C60C 1F4WH 3VMOA 2QBWA 2OTUA 4GSDH 4M9PA 5SX5H 1S3RA 3TO4B 3V55A 3EJZC 5KSBB 3GZQA 4HXAL 2PPCA 4NM4L 1FJ1A 1RURH 1I9RH 2F58L 1U4FA 2CCLA 3RTLA 3K8LA 3V4UL 5FO7B 3FTWA 2ZF9A 1P5UA 2K45A 4OCXH 4HP5A 4DTGL 3Q01A 5D4JA 3THML 3QNXA 5PCYA 4GI8A 1PJ9A 1EJ6A 3R06A 2XXFA 4FNRA 2AJ3B 3P9WB 4I4WB 4QXTB 4UM9D 1U3HC 2O30A 2KYIA 5F7KC 3VJ6B 2W88A 3GJEB 4MMXA 4U3XA 1JNLH 1SQMA 3MOQA 3IJSA 3MCLL 5SWZB 3UTQA 1ZS8A 3L1OL 4PP1D 1D7BA 1IC4L 5DYOB 5IKCB 2G5BA 4EIUA 3O2VL 3P4MA 3MLUL 3QULA 3WDHA 1IQWH 3F83A 3I2CH 4G7YH 5FUZL 4S1DC 4CSTA 2JLPA 1S7WB 2OULB 3B83A 3S4SB 4DP4X 1G9MC 2C8NA 3U7YL 4NUJB 3KM2A 2P5WA 3ARSA 3WFEH 2A3TA 5MP6L 3MV8E 4APQB 2X40A 3PV6B 4I0PD 3SDDC 4HAGA 4BXSV 2WINB 3VXUA 1T5XB 1NGQH 2DTSA 3UC0H 2FQFA 1RZPA 4L8BB 1MG2C 3VRIB 2UZXB 3UABA 5LNGA 3UO1H 4PTUA 4ALAH 1MHEA 3OLIA 2FT6A 1JBJA 2A6DB 4PJDF 1GKOA 1FHGA 4L8SB 3FO0H 4Q9QH 4AGMA 2IH9A 2VM4A 4XTRC 1GYAA 4PRHE 3I75A 4W9FC 4G1MB 2Y24A 1KFGA 3RWJA 1BM7A 3CN1A 3EYFB 5E5LA 1CLYH 3T0AA 2EDLA 3TZVA 5T3ZD 4MX7B 1USQA 1EMTL 1Z5YD 3BVNB 4KI5D 3GRWA 2GUOA 1U8JA 4L4VB 3OGCB 3QZPA 1H19A 4M61A 3VH8A 4PJ8D 3VGGA 3TESA 4NXKA 3K6SA 3M17B 4NO2B 3RWDA 1CYWA 2AEQL 3OKLA 4JFQA 3FN0H 4LPWA 2L3BA 3B2XA 5BS0D 1CN4A 1CFSA 1IGFL 4ZO9A 1DVFB 1DYZA 4JB9L 4K55A 1S9XB 2X2HA 4YHIA 5M95B 3QEUA 3ZHKA 1T1YA 1JF1B 2WLLA 3K4ZA 3RTQA 5LBGA 1WWAX 1MDAA 2QQNL 3ZE0B 3BW9A 3BJLA 1N10A 1OT4A 1OT2A 3HEIB 3KR3H 5E95B 4CRPA 3K6NA 2GSGA 5T3XH 3WMPA 5I6XC 1TTAA 3SBWC 2GQHA 3SDAA 2AKRA 1Q38A 1TCRA 3X11B 2E76C 3UMNA 5HI4D 3W0WE 1F02I 5HJ3B 1JWUB 4G43B 1QQDA 3ZKNC 1A6AA 1RUKH 2EECA 4ZSOE 1EBAA 2QHRH 3KYNA 4Z7VA 4FFYL 1A1OB 5BVJA 3ARED 3BDXA 2XV0A 1W72H 3VU1A 2AEPL 2VR9A 1FFNA 2FJUB 2XG4A 3L1FA 5BW7A 3T0EC 3BPNB 1EXHA 1GZHA 2VABA 4Z18A 1D6EA 3I3DA 4YXKL 1T0MB 3QQDA 1Q72H 4N2OA 3T8XA 1MREL 4N85A 5C0NC 5FR3A 1JNJA 4GP8B 1JFHA 4U1GC 1FDLH 1NAMB 3CU7A 3LKOB 3EFDH 1IGYB 2BFVL 1O5DT 1QFOA 2IV9A 4NZJA 4D9LH 4D8PB 4TRPH 5I16A 3ESMA 3ZO9A 3QS3A 3ZIMA 2BX5A 5CCHE 2CDEA 2ZOWA 4O4YL 2AK1L 3DV4A 4ODVL 4R5VA 3IM1A 2H3NA 3PGCA 3PNWA 2OP4L 3MJWA 2IDCA 3SOBH 2BNQD 1XF4B 3H1ZA 4X6DF 5E2UL 4K07A 3QORC 4NBXB 3SJVE 2I9TB 5I76B 1ZT7A 2C1OB 4G80B 3QAZC 5CD5D 4PCTA 4F27A 4N2KA 4KKQA 4AITA 5DZAA 2F1AA 2EVHA 2GSIA 1Y0LB 1U2HA 3INOA 4OW6A 1K8IB 1C12A 1R3HA 3C8KB 1INQA 3NIGB 4HK0B 4E68A 3RVUD 1J5CA 1RUAL 3PJSB 5KTEL 1KBGH 3LZPA 1HESA 1NIBA 4UQ2A 2PO6B 3FFCD 2D2CC 5E00A 3L8QA 1DVSA 4PR5B 4XP5L 4PS3A 2XZQH 4UM9A 2JJSA 4GXVH 4UUJB 3NVQA 3KLAA 1U8LB 1NM4A 1KIPA 4PN6A 3MRBA 1OO2A 2NY4B 3FUFA 3LMJL 2AAAA 2VLMD 3FT0A 3AY2A 3BEWB 5GZND 3NFPB 5JNYA 2Q2EB 1T4WA 3S3CB 5F1OB 1J8HB 3VFNB 1N2RA 3WN5A 2MMXA 4JDVB 2EDDA 1NPUA 1I7UA 3F6LA 1J5DA 3CC5B 1NCCH 1MPAL 4NUQA 4FZ8H 2Y07L 4NENA 2GCYA 1Z66A 2YOCA 1IT9L 3H2WA 3IU4L 4XPTH 4JE4B 4I48B 3EYSL 4CJ0A 2X0VA 1HILB 3GPSA 3QXDA 3NFSH 1XL4A 4DPAX 4U1HB 4N0FA 2PXYB 4G9DB 1YNTF 4OLZL 4NN5C 5IEHB 1CD1B 3P4OB 3VA2C 1UJTA 1LE5B 2ITCB 1JN6B 1XTMA 2NUPA 1OM3H 3ROLA 4ETYA 4W9KC 5L8KB 1E2WA 3DGCR 3RGVD 3FN9A 1KT2B 5JIHA 3V0HA 2EVGA 1A7NL 1DBAH 3AT8A 3O6KL 2Y3AA 5E51A 2V2WB 4UYPA 1JHLH 2AQ2A 4PB0L 3UTOA 4DNLA 4GS7C 3IVKA 1H8OA 3ALWA 1LK2A 3Q5OA 3QI9C 2QKIC 3VM7A 2FSDA 2H2SC 5J1AB 3MKGA 1S6NA 1I3GH 2DIEA 4XNZC 1LEGA 1AI1L 3OB0K 3GSNH 5DF0A 5FW7A 2VWEE 1DFXA 5BS0A 1UB5A 3ZKMD 1YNLL 2VB5A 1DQTA 1F58H 4PGZA 1OE3A 5JQIB 4H1LA 2VT0A 4LNVA 4P2OC 1RK7A 3TIEA 3EGXB 2BHZA 4HUNB 4IGBD 3TBTA 5JDSB 4Q52A 2BP8B 4LB8A 4XP6L 1QWNA 1WD8A 3T0DA 4N1HB 2Q5BA 3LN5A 2VJXA 2WTRA 5FYLH 5E9NA 4N22A 4QGTA 1AGEA 3T4AA 4UTCA 2HKFL 3FTYA 1JGLH 3IFNL 3BQUB 1JGVH 4GIPD 5B3JF 1MHPH 3AC0A 4JKMA 4G2AA 2A6JB 5G4OA 1X5LA 2EO7A 5EFIB 5F9JA 5EIIG 3GMLB 4LLAA 5C0JA 3RDJA 2AV1B 4NZUH 3PJLA 1GOHA 4JPWL 4IHOB 3L1EA 4M8QB 5HYQA 2VN3A 2H3XC 5L2JB 1QKZH 4Y5YA 4K94L 2DL2A 8FABB 4GAFB 1AO7E 2EH7L 1ETZB 4WWKC 2K8MA 4ZXBB 4DP8X 3BOVA 4GRMB 5EULV 3X1EA 5ADPH 1U42A 3CZGA 1CD9B 4JFFB 4MZ3A 4W9CC 5DZLA 1KYFA 4XZ4A 3WNLA 5D9SB 5CR1A 1SMDA 3Q9PA 1H3PL 3MJGX 4DEPC 1JRHL 1PMYA 3H9HB 1BQHA 5IV2B 4XC3H 4ZQTA 4H26B 5FGBA 1G9HA 5BZDA 5F7AA 4PJXB 3DX8B 4IMLB 1UOKA 4AV5A 2YPVL 3GMRB 3PWUA 5EDXA 1OGAB 5EU6A 4X5RA 4OSUH 1XEUA 3N43B 2C3VB 2EICA 3ERXA 5ECJE 1GC1L 1GYWA 3WE1A 1GA2A 4WTWA 5E9DB 5EOQL 3X13A 3KLHC 2ADGB 1OE2A 3VD7A 4B96A 1I75A 1WPCA 3CLEL 3BSZH 1MG3C 1EXUB 5DK2A 2VDML 3WFBL 5DZVA 2Q20A 4KJWC 1MNUL 1TUPA 3R19A 1LL1A 3HZYB 3JWNG 5D6DA 3GI8H 4A2DA 5I26A 1OCWL 1XZ0B 3IMUA 4YHMH 3QIBA 3QUXB 4WU7A 1WTLA 2NNFA 2Y7SA 3SQBA 5AOIA 1J5HA 3KLLA 4R4BA 3LZOA 3BVTA 4U3CA 4N2GA 4KZEL 4JHAH 3G5VA 3IDXL 1MRDH 1T4KB 3CFBA 2P8LB 4N8PA 4BA8A 5GS0L 2RQEA 2GAZA 1IBFA 5ALBH 5T33L 3PF2A 2A9NH 2BWIA 3NSJA 2HA1A 1H6FA 3I9AA 1MW1A 4K73A 5I66B 3O8XD 3AS3A 3VG0H 1UOLA 3DTDA 4JREC 2H0JA 1BBJA 5LG1A 1FV1A 1VEPA 4JFED 1MZYA 3SYQA 1Q9KA 2HFGL 3SBQA 2ED8A 2V5MA 2Q8BH 1B3JA 3WJJA 4F2FA 4F91B 4J3OD 4EUPA 4WZ9A 4IYKA 2QMJA 1IMHC 2YAEA 1PFCA 2NLJB 3RX9A 3WKYA 5DVNA 2ZOKA 2VLJE 4G7VL 4H2AA 4PJFE 3RGVA 1WBZA 3N6YA 2O6PA 3OLGA 4LVHB 1M7IB 2NW3B 3QDMB 1KFAH 1RLBA 1AQ8A 4G6JH 1RJCA 1SYVB 2F8XC 2O61B 3DGGA 4UZUA 2MCPL 3EUDA 3ARXA 5F1NB 2EXYC 5FKPB 4BKLA 4IRZL 1OB1B 1B0GA 4MAYC 1MY5A 5C7XH 4I1PA 1I9EA 5DMGC 2E0PA 4JJ5B 2OXGA 2H2PC 4HKXA 4K2UL 3V0WL 3FUHA 1OTTD 4EKJA 3ARDD 2X3BA 4GOSA 3U2SB 1FLRH 3FXIC 2XRAL 4GRLC 2F7QA 4PJGA 5TDPA 2FWUA 1CK0H 1YEHH 5CEZH 1PNCA 4NO0B 1M71B 1YZZA 3LY6A 4LLDB 3TNNB 1Y07A 2NXYD 2P5ED 3MA9H 5GGTH 4AYEC 4Z78A 2WXNA 1F4WL 2V0AA 3ZSTA 5JPNA 4UV4H 4GSDL 4DKFL 1EA9C 1X4ZA 3S34H 5ICXB 12E8H 1UADC 3GS0A 4FQXD 5FGCB 1NOAA 4O51A 1TPXB 2IAMC 2KPWA 1A4KB 1RURL 1I9RL 3H0TB 4KRPB 4NWUL 4HWEL 5EZIH 4P5MA 5F7WC 1MRFL 4NPKA 1O9ZA 3TA3C 3I3EA 2OR9H 3HRZA 2QSCH 1FVEB 4OCXL 4O2CA 5CBAA 4IOIA 4AKPA 3P4NB 3QXUA 4U31A 2XQYK 2ZZUT 4WTXA 2K78A 1RZJL 3CVIH 1HYSC 3R1GH 4MB4A 4PG2A 3TH3T 4CSPA 1JK9B 1MSPA 2AK4B 2WQRA 3SYCA 1HHIB 3RB7A 1CE1L 4JG9A 4PV9A 3MRGA 5E5MB 1D5BA 3M86A 3SDYH 2AJXH 5D2LB 2CJUH 5I6MA 3TN0A 1RZ8A 1PSKH 4XI5D 1IQWL 3I2CL 4KKLC 5EA0H 3ZTDC 3KS0J 1HT6A 4JG1H 2HP4A 1F4YL 2R1WB 2ZPKH 1VAHA 4ZUTA 4QHUA 2YO3A 2A9CA 3KBPA 3WTWA 5FYKL 5H35B 3FYEB 1BP3B 3UC0L 3GUTB 5TQ0H 4TSBH 3VQ1C 1BBDH 5D7SL 2ADFH 4NQCA 2CGYA 4FMFA 1V27A 5T1DL 3VFGH 1QO3B 4ALAL 4NIYE 1IX2A 2YD3A 1AXSA 4ZDHB 4RFOH 4HHWA 4PTTA 3FO0L 2DIBA 2GITA 1ML0A 3SGJA 1IUZA 3DUHA 5EMYA 2YD4A 1CXKA 2G75B 3A4EA 1BXUA 3CSGA 4U6HB 2AFNA 3RWIA 4N90E 3BUQA 1G9ML 4JZJB 5JXAH 3KPPA 2DIJA 2F7RA 3I6KB 4Z7OE 5HP5A 5E8NA 4FEIA 5EDSA 1SMOA 2VWEC 3RX5A 3VI3B 1MFCH 3KYMB 3WEMA 4HKZA 2JKSA 4UNIA 1SJHA 1HEJC 1QPKA 2K1MA 4ODTH 1NH6A 4WO4D 4TNWK 5D7KE 5K9KB 3FN0L 3T2NH 4NRZA 3V0AC 5L2KB 2DLFH 3NTCL 3VACA 4ZW8A 2DM3A 3GXFA 1E30A 5EU3A 2R7EA 5AVXB 5DLMH 3D33A 3WNKA 3QDJD 2VDMB 4WEBH 3TFKC 4DZ8B 4XT1C 1F6FB 4NPYA 1E4XH 2B15A 4Y4KB 3U46A 1J8RA 5FA4B 1YEJH 1HEHC 3FYIB 2GJJA 3MLSH 2CHXA 2G3NA 4L3EB 1T1WB 5AVYB 2VUKA 5K1VA 4ANKA 2LHAA 2OI9B 1AHWC 4JFEA 2VJ8A 5E1GA 1JCVA 2Y06H 4QRQB 4HIIB 3EYUL 1WK0A 2YAFA 3S35H 5HHMD 3A3YB 3DMMC 1WZMA 3FRPA 2JKXA 1OOAA 3OG6B 3O9WB 3EOAB 1RUKL 3A67H 2UYLA 4AGNA 5HD8C 1IQDA 1W72L 2F53D 4LDLB 4LVNC 4AIZA 4RFEA 2YD7A 3ZYOA 4FXGB 4LO9A 1X5FA 3GZOA 4E9XA 3FTSA 3O0LA 5BVPL 4ZT1A 2NY6C 4DP2X 1WWWX 6CGTA 1ONQA 2CO7A 3L7FA 4KNQA 4GMTH 1U6AL 1NEZB 3FCGA 1V3LA 1SN0A 2YUVA 1FDLL 3KBHE 3BZ5A 2CWRA 1E4KC 3HC4H 1OSEA 3EXLA 3EFDL 1T89C 1NDMB 4AT6B 5T5FH 1E9OB 1XH1A 4IU3A 4ATWA 1AKJD 4Y5XC 3MR9B 3CDYA 3MCG1 1MI5D 3CV5A 3BVUA 5KVDH 3GF8A 3HHRB 1TJHH 3ZY7A 5JXED 1FFOA 2XQBH 1PLGH 5EV7A 3U79A 3UCQA 3MXVL 1KYOJ 5H2BB 2HRHA 5H94A 1SN5A 3Q8EA 4X7FC 3UTPD 4K7FB 1F4XH 4BK8A 3ENEA 2EZ0C 1LILA 3D9AH 4HCRA 3GIZH 4Y4HB 3ZLQC 1CD0A 5IZ7A 1IAOB 4DP1X 4YHOL 5FB8B 4CC1A 1C5DB 1OT1A 3MUGA 4NCDA 1K5WA 3QSKB 1BVKA 1OAYH 1QSFD 1OW0A 4E9RA 1VGKA 1E4HA 1AGCA 4WI8A 2YWZA 1SLWA 4E9TA 4ODUB 4AW4A 1ZEAH 1ZD6A 3EGDB 5KSVA 3W56A 3EYOB 4NFBA 1MCEA 3BAWA 4QWWD 4GXVL 1HH9A 1YEFH 3DSNB 4NGHH 1CGUA 4MB3A 5LG6A 2I27N 4NUGH 1RJLA 2EIKB 2HFFB 4Q0XH 2XVLA 3D85B 4NQED 5B7MA 3V9EA 5L0QC 1WC7B 5LGKA 2K8QA 4GW1B 2B4CC 3H9YA 3LEVH 4HJ1A 4NNXA 4YC2B 3O6FB 2NZ9D 4K5PA 5D1ZB 2OCJA 3NCXA 5EBWB 3BZFB 1C08A 1OKEA 3FOLB 5TDOB 3B2UD 1U92B 1KXHA 3MRQA 1PD0A 2F54E 4YSDA 3QJFA 1A47A 5CBEB 5ICZB 2A74C 4W9GC 1F3DJ 2N0MA 3WD5H 5C07B 3Q06A 3A4DA 4XPTL 3O4LA 4GAYA 1LLAA 1BA9A 1ZWIA 4JKWA 2Q7NA 4DEUA 3NFSL 4QHMA 3T5WA 3CFMA 1WA2X 1YO4A 1RK1A 2LVEA 3BPOB 4RDQG 4TM9A 4CMMA 3Q5YA 3OLDA 1I53A 4NOFA 5A3IC 4KMQA 4P9HC 5F88A 2DTMH 3C60B 3WS6C 1OM3L 2NNCA 4HSAC 3BO8A 2WYTA 4J3TA 1CI3M 1DBAL 1KPUA 2XJKA 3KE0A 4HDIA 5DXWA 3NABH 2GIXA 1N8ZA 5JIPA 1BHGA 2OZ4L 3UJJH 1I3VA 2CDGB 4Y19D 5FAAA 1JHLL 4IKJA 1A2YB 4MKTA 4OZHE 1IEAA 4XHJC 4YHNB 2WM0A 4OV5B 1BWMA 5CWSA 3P4LA 3ZDXF 3U7WH 1I3GL 1U3HB 5GRZA 1FN4A 4DQAA 2MTPA 3QQ3B 5KSAA 1IBGH 1JZ4A 3GBDA 3TBSA 4PVBA 4FTVA 4Y1TA 3GPEA 1XGUB 3KPOA 2LTQC 1F58L 2GFBA 5CD3A 2CCVA 4OQ1A 4P9HH 2QR0B 5C09B 4DP0X 2WAQA 2XZCH 3DIDA 4YXLH 1DBMH 4MD0A 4XOCA 1GGTA 2NY1D 3KBEA 4YFLI 4J23A 2NDFA 4GNKB 2YARA 2YMOA 5IMOB 5AL0A 2FLMA 1E2VA 2QGBA 4JRYD 4N5UA 1IGTA 2BY2A 4Z9KB 3DJ9A 1FVDB 4AK2A 3HG4A 1E9PB 1UD2A 1T0NA 4NQSA 3SDDB 3JVGC 4KK6D 4LAQL 1P6FA 4HS3B 1U8OA 5DD6B 1JV5A 4P5KB 1RCYA 1JGLL 3MNDA 4F58H 2OYLA 3GSVA 1JGVL 2Y2TA 3V5DB 2D0GA 1N7MH 2DQFB 4KTYA 4WW2C 2FB4L 3F7YA 4YR6A 1F45A 1W0WA 2BVPA 2GTZA 4P23D 2WXQA 4V1DB 5DVMA 4CVUA 2ZWNA 2FHFA 3SGKC 3PABB 4MQXD 2OL3H 4NZUL 3L2NA 1ID5I 2IH3A 1VB9A 1U2YA 4WV1A 3IDIB 5D5MF 4IEFA 2IWFA 4FJZA 4DP9X 1U9KA 4A37A 3FMGL 4JQIH 4OCWH 1QKZL 4XZUB 5EH1A 4N86A 1TFPA 2N7AA 2A6KB 4WVRA 1XD0A 3X1GA 1IGIL 1W91A 4ZMTA 5EU5A 4W6XB 1TVBA 2CK2A 3DJSA 2BP5M 3BT2H 5ADPL 3I9IA 4TUOA 3MV9E 5FXCH 1W72B 2HJFB 1AKJA 2APSA 3AXHA 5D1QE 1XQ4A 2EP6A 4WFHD 4K3GA 5CP7B 3D3VE 5HDOA 1NZRA 5IVOA 3WE6A 3ML8A 2VDPL 5JXEA 3V4VA 4WK0B 1A4JA 5DQDH 2P8MB 5AW0B 4BZYA 1P84J 5IMLB 2DQJH 2ZOLA 1MJ8H 4OSUL 3MLVL 4PRIE 4PLKC 5B1AB 1N19A 1HZHH 2R29H 1AQKL 3L9EA 4JFDB 3D69B 4QRPB 4C83B 4IIQC 3DO7A 1T1ZA 1UC6A 1UYWH 3MUHL 3RY4A 2PKDA 5DJYB 1GL4B 5I6XB 4RDQF 2J5WA 3TPUA 3BSZL 1WE5A 1BFVH 1AANA 1CICA 2KQMA 2YJLA 2KC0A 2APFA 1RQ5A 4TLTA 1B4JH 5HPOA 5CN1A 1ZGLM 1BFOA 4BFRA 1QSFA 3L3HB 3EJQA 1ORQB 3SB3A 5JW5B 2EDYA 5BRZB 3FB5B 3FDWA 3MJ8A 2JQMA 2K0RA 3B7UX 5HVGB 2EIEA 1H9DA 5FO8A 3MYJB 4TVSa 5DJXB 2Q3XA 3T0EB 4JHAL 4L3FA 5FLUA 2AJUH 5CSGA 3BH9A 1MRDL 4HUMB 3KMDA 5FYJD 3F8UB 4WI5A 2AGJH 4EI6B 3A22A 4U1GB 3U9UB 3LIZA 4FDWA 2J1XA 3DXAB 4LCIH 4WWPA 1EK3A 1DSFH 3SKNA 1Z5HA 3VG0L 2XJLA 2XNAA 5JMOC 2UVEA 3MU3A 1FL6B 3BZDA 4DP7X 3PL6A 2NPLX 2JI2A 3B7RL 1XF3B 1I9IH 1HOCB 1UCTA 3VXNB 3EJYC 4OZGA 3AQXA 2HUHA 2Q8BL 5JW4Q 1L0XA 4FYRA 5ENWA 2ICES 2P5WE 3GB7A 4DPCX 5IVNA 4BKSC 3QORB 3VXMA 1XIWD 5F9OH 3MRRA 3VXUE 3U0PA 2Z31A 3QAZB 3ZDYB 2X0WA 3C5SA 2WN3A 1EX0A 1XSJA 1CD8A 1KNOB 2WQAA 3MX0B 4LLMA 4YE0A 3CCHA 4I5BB 5EO9B 5AVQB 2GJ6B 3NEOA 4G6JL 2J8OA 4TVPD 4AYFA 4KJPD 4AYBA 4J3VA 3B8SA 4QTHB 2Z4QB 2R9HC 5IVZB 2VLRD 2K9FB 3NEXA 3MYZA 5C7XL 2J25A 2PW2A 1EHNA 4ZPVB 1JI1A 3KHOA 2YEZB 3KPQA 4YHPA 1FGNL 5CGMA 3R8QA 2IANA 3L3OA 5KS9A 3LQMA 4MJ4A 1FLRL 3OXSB 2CLVB 1Q0YL 3S5ZA 4LMQE 4K3DH 4DO4A 2Y22A 4UZSA 4ERSH 4PRPA 3CUPA 1YEHL 5J6GA 4AV0A 3GXNA 4ONGH 4L0YA 4YSRA 4ZUUA 4PSPA 1IE4A 2W81C 3K2MC 1NGZA 3FQRB 3MA9L 3RVWD 1QRND 2FEEI 2X4NA 1GXEA 5BZXA 1KCVH 5CXPA 4M5ZH 1PKOA 4NRYB 1R5WB 5IFHL 1XR8B 1TTFA 1CFQB 1OCRB 4L4TD 4NQUA 3LSOB 3RNKB 1XH3B 5EBMA 3BWZA 2OMTA 3GLEA 5DRZA 5EZIL 4PP2A 4ZYKA 3OAZH 1CT8B 2OR9L 4A7SA 1S7UB 3GSUB 3SPIA 4NN5B 1A9VA 3D2TA 2OZNA 4Z7UB 4XMUA 3P3RA 4WUUB 5CU5A 2YXFA 4XCFH 3SPHA 3HR5B 1Z9MA 1TITA 3CVIL 3O2DH 3R1GL 2X05A 2E9JA 2C4XA 3DTXB 3JUYA 3LKRB 3U1QA 2YD8A 5I1CH 4Z7VE 5FA3B 3VSQA 4JDEA 2A1WH 3SDYL 4UQ3B 2C1PB 3VXQB 2CJUL 5EIVA 4GS7B 1PSKL 3QI9B 3G5ZA 2QKIB 5EA0L 4PJ5B 5GIRB 3GK8H 1GW6A 5LVEA 3TJEL 4XNZB 5HDWA 2ZPKL 4MB1A 1OQXA 5GSVB 4E41B 5F0LB 5KYYA 2WXIA 1VA9A 4QHPA 1WD9A 2HVJA 4HFWA 5BNXD 1E9QB 1AACA 1T2QH 1JD9A 2RCSH 1FVCB 4LASH 4PRNB 5D5MB 4K7PX 1EAJA 1JGDA 4P2OB 5TQ0L 1DLFH 3DOIA 4TSBL 3SYPA 2R39A 2WQVA 1BBDL 2YK1L 4TTDC 5DC0A 2ADFL 4ZAKC 3IGLA 4MS6A 4XCEA 2JB5L 4HPYH 5EUOF 3UBHA 2ZYSA 3AUWB 4XO8A 3KLDA 3N42F 1GH7A 1KBVA 4QRUA 3EYQC 1J9SA 2EYSB 1WGOA 1IAIH 1UFGA 5TF1L 2H32B 4Y5VC 3ILPB 3WYRA 4TOYL 5JXAL 4FE9A 2VDPB 2CKBA 3WXWH 1MFCL 5DK3A 4DUXA 1J05B 5C0FA 1IGMH 3BIAX 3PWNA 4ODTL 1P1ZA 2OMYB 2R2BA 3T2NL 3KD4A 5DVKA 2DLFL 3UBXI 2ADIA 1L6ZA 4FQQB 5HI3C 3QEGH 2JTDA 3K6DA 3KCPA 5DLML 1HSBA 4WWKB 2IPKA 1NIDA 2YUZA 3MV8B 5IBLD 4JK0D 5M94B 1E4XL 1T7ZA 2WMPA 3GI9H 4FP8L 3RDTD 1YEJL 4KY2A 5GS1A 3MPCA 3GKWH 3HS8A 3VSUA 3WDIA 5SX5K 1YEIL 3L5HA 4UTBA 5KBDA 4GKNA 2Y06L 3DRQA 4DEPB 1TSHA 3QJZA 4U7SA 4YPGB 4KKAD 3HBPA 4OIBA 4U1IA 2RR3A 1BIIA 1MQ8A 4U49A 4NT6A 4YE4H 1MAMH 3A67L 3RIFK 1HE7A 3P1VA 4PRHB 4XP4L 4KQ4L 3QPXL 1UEMA 2X2YA 4BH7B 4R6UA 3RKDD 2DMGA 2H9GA 2EAEA 5IBTH 3VYNA 2Y5TB 2FUTA 4LQFH 2WVVB 1D2PA 3WBDA 1ZGLA 2YXMA 4RVBA 3TPKA 1QG3A 2ENYA 3DX1A 4YHKH 4BEIA 4B97A 3CZSA 1BF5A 4GMTL 1C16B 4HWBA 4HUWB 5ID0B 5D1QC 1ASQA 3HC4L 1DE4B 3IJYB 1G7QA 3OKDA 3HUJA 5JHMA 2W65A 4NHCH 3LJ3A 4M7ZC 3Q6FB 2ZXCA 1LDSA 4HGWB 5JIMA 3OX8B 3QG7H 3ALPA 3MN8A 4MJ6B 3FSWA 3HG1A 2QJDA 3D0VB 4L1DA 4PJBF 2EABA 1TJHL 4NKMB 1J9CT 3H53A 3JTBA 2XQBL 3EJTA 1PLGL 4PRBA 4D2NA 1GOFA 1D5RA 1SF3A 2FL5A 2I32A 3ABZA 3QWNA 4M6OH 4MDJA 1N59B 3EW3B 3S37X 4HOZA 3L9RA 5BS0E 3PIQB 5INDB 1KV3A 4JREB 5HBBA 1F4XL 5I6LA 2NY0C 4JPKL 1U95B 1QRNA 5ESAB 3DHJA 5DD1H 3D9AL 3W0WB 3GIZL 4JM2A 4Z7NF 3N1FC 3SPVA 1LP9F 1EVUA 3WEAA 4ZSOB 4FG0A 3S36L 4H25A 5TPWH 1JD7A 4LVEA 3PUUA 5DHVB 1U8PA 4XMKH 2OSLA 2ARJB 4DOHE 5DZJA 4NNYA 4HK3J 2NY7H 3FQNB 1P5UC 1JTOA 1ZEAL 2HJKA 4BHUA 3WHE0 2UWEA 4C56A 1YEFL 4NGHL 4ZFFA 4GT0A 2KLTA 1QYGH 4URKA 3NCMA 3OTTA 4MMXC 1QNZH 4LSPH 4MKMA 4B7IA 4F7PA 4Q0XL 3DYMA 3MFFB 2OXHB 3WFHA 3LEVL 4JHWH 3PHOA 4BZ2H 3E9UA 4WI3A 4HIJA 3NCFB 1T2JA 5B39A 2VO8A 1JDDA 5DS1A 4DP5X 1P4BH 3TO2B 4JFHE 4QHLB 2GG1A 4JAMB 1MFVA 2JCCF 3Q2LA 5DZNA 5E8EB 1RP9A 2NSMA 4CGTA 5HDLA 3WD5L 2O72A 1NFDF 3FT1A 5FF6A 5AW9B 2WWMD 5IFJA 4GRLB 2VRAA 2HKAA 3V95A 1KIQB 5CILH 3SJVB 2P80D 1FZKA 3IJHA 3GDBA 4CSZA 1RPQA 2X9YA 4PJCF 3WELA 2DD8H 3HMXH 1AHMA 2J88L 2Z3FA 3QQ4A 4J28A 4ZQKA 3SDCA 2DTML 2CR0A 4U7MA 5DMKB 1DN2A 2EINB 3IJEA 4WY7H 5IW1B 5ICYA 4WCYH 4MHHG 5EU6E 4YN3A 2BW5A 2Z8WC 2IAMB 4UYQA 3SO5A 2JXMB 1EFQA 4AM0A 2DN7A 3TA3B 5LBSH 2JFCA 4XRCA 4I8DA 3TZVC 4BSJA 1BYNA 4ZUVA 1ESOA 2VKXA 1P7BA 1HAWA 4NN6C 3HI6H 5KZCD 3L16A 3U7WL 4HMCA 3VFOB 2Y7NA 1OTSC 1KPRA 3MNWB 1VFOA 4XNMA 4OI9A 4XAKE 3FOMB 1TEGA 1HIMH 1EDYA 4H40A 1IBGL 4OLVH 1NMAH 2HLFD 2EO1A 3TCLB 4BELD 5IR1B 3IGUA 4K3JH 3LHPL 1RMFH 3MHZA 3NUKA 4A6YA 1S9WB 2HRPH 3MRCA 1VEMA 4P9HL 2Q86B 2XZCL 4WLCA 1DJXA 3LKPA 1I7ZB 1PG7H 1XGTA 2EDWA 3NPZB 2VRKA 3RTQC 3EAKA 3GO1H 4JDZA 1D6VL 2Y72A 3WAKA 4UMGA 1L7IH 5FOBA 2VLME 3O6MH 3WKPA 1K3ZA 5I1KH 4MAZA 3KPTA 3IKCB 1YUHB 1HDMA 4DVRL 1AGBA 4D0BB 3VFTB 2K6YA 4F58L 4FULA 3SDAC 1OCZB 1QEWB 4ZPTB 2BY1A 4YHLH 43C9A 4BK5A 2VRQA 3ZDZE 1N7ML 3ETBF 2H5UA 4X6FA 4YZFE 3SGDI 2V3FA 2XWBA 5T1MB 1FLTX 1BVNT 3CIQA 3L5WB 2Z34A 1CFNA 4AJWA 4HUXB 5G4NA 4QJ3B 5INCA 1U8MA 3UCRA 5DDHB 1Q1JH 5K59F 4R7NB 1P7KB 3QH3A 1QLEB 1L7TH 2LU7A 4G59C 3RUGA 3HZVA 4P5TA 5BW7C 1X5HA 3V4PA 4OCWL 1GZHC 1A3RH 3KNBB 4K5MA 3OAUL 3VFSA 5IQMA 4Q89A 5IROD 3U0TB 2D31A 3UZVB 1VHPA 5J9PA 3IU3A 4ZFQA 4O58H 3CHPA 1M3JA 3BT2L 5E4EC 2VW6A 3QQ9C 3EJCA 4UQBA 1JPTH 1JZ2A 5CZXD 4PGDA 1CG9A 4P04A 2EYRA 2XV6B 4UB0H 2JKWA 4AQEA 5DQDL 4UCFA 2O93L 2DQJL 1MJ8L 2V5RA 4A2MA 4EPSA 2R29L 1HZHL 2VQTA 2YD2A 1COBA 4TPRH 5LAPA 2WKOF 1UYWL 1AHWB 3LPWA 4PJGE 1I8IB 3LVTA 4U6XB 2ED7A 3I6GA 3VGAC 4MZRA 1BFVL 3DMMB 5JOFB 1QFWH 4N2HA 1DZ0A 2FJSA 4PV8A 4Q2ZB 4I13B 4JFPA 1JMXA 4W9JC 2L7UA 4P46D 2YPLA 1LO2H 2WCSA 2X4TA 3ASOB 5KJRL 3JUZA 2A9AA 2BP0A 2E27H 4LVNB 2DBLH 2H26B 5AW3B 3UBFA 3IBOA 4Y7MA 5AG9A 3T2LA 1M7DA 1AO7B 4PS7A 1ZLEA 5AW7B 4KFMA 1F6AA 4Z5RB 2AJUL 2JJSC 2WXKA 1R5VB 2ATPA 3PFQA 4R90H 2NY6B 4J4PA 1MHHB 4WK4B 4O5LH 4YEEA 2NXZD 3I6LD 2AGJL 4E2OA 3AQZA 4PP1C 5FW6A 3TM6A 1J48A 5E4IA 2ZJSH 1DSWA 4LCIL 1DSFL 2MQCA 5F0JB 3CX5J 2IH1A 4AEEA 1N6QH 1ADQA 1FZJA 3FPYA 3KWTA 1LQSR 2PTVA 4LL4A 1PX3A 3LZLA 3HHSB 3QDGD 3WN5C 3GHEH 4D8PA 4Y5XB 1ZGLP 3PREA 4R2GD 2BNUA 2EEFA 3KPLB 3KW8A 5IMKA 4QRTA 3CVCA 2H7WA 1FL5B 2ZG3A 2P24A 3HE6A 4U1LB 2HPTA 1KB9K 4WI0B 3WXVH 1YQ2A 4LARH 1A8JH 5F9OL 1P7QB 4F8LA 3IDYC 1AXIB 4FHKA 2L7EA 4U2YA 2MPVA 3ZE1E 3OKNB 4XVSL 4NQCE 3DURA 1X7QB 4JRLA 5IQOA 2CSPA 3RY5A 2ITDA 4CVXA 4AEHH 4NKOB 3D05A 2OMUB 2VSKB 3JT0A 2M2DA 5BPPA 2P8PA 2CO3A 1HWHB 4GKZA 4Z7WA 3RWFB 1DUYB 4WJG3 4XOBA 4RWYH 3HC0B 1KLFB 1N3NB 3H9SD 4XO5A 1BZOA 3ZGIA 4YHYC 1JTPA 3KPMA 5CP3H 2WY3B 5DEFA 3V5HB 1SYSB 5JYMA 1RZ7L 1QWUA 3QR0A 1E90A 5L0QB 3WEXB 5DD3H 3BESR 3VXOB 5E6RB 4K3DL 1CBVH 2L04A 3OBAA 3BEWA 1RPUA 2H1PL 3T8MA 4ERSL 1AGFA 1NCGA 2F19H 4G3YH 4TSAH 3CFDB 4X6CE 1FI8C 4ZMVA 1VLXA 3G3LA 4KUCF 2WCGA 4Y0GA 4ONGL 4YGVA 2NY3C 2W59A 4N6RB 5BOJA 1BQKA 5C08D 4DQOL 1KCVL 4LHUB 4QAMB 4EXKA 2A74B 4GRWH 4M5ZL 2Q1EA 4OKVA 4IJ3C 4FD0A 1M6OA 4OIAA 4Y2OB 3T1FB 2W92A 4UINH 4JQXA 3BAIA 3F05A 5T3ZH 3T4AC 2VERA 4BSVB 5HI4C 1OPOA 3MREA 3CC1A 4JFEE 5C1MB 5AZ2H 2AP2A 2VLJB 1I1FA 3IGKA 3MRNA 4GW4A 4PJFB 3HVNA 3QZBA 4AIXA 4OLWH 4X5LA 5DZPA 4IKKA 3MRFB 5I18L 1RLWA 3VWJD 2XTLA 3PG2A 3O2DL 1B6UA 3RI5F 3WIFA 5I1CL 1LXMA 2VXQH 3SD2A 4JCMA 5IJVB 2A1WL 2LABA 2VH5H 5HHVH 3ZSSA 3GNMH 5AOKA 4OZIF 1L6XA 4Y5YC 2H6UA 1PG7W 4JVWA 2XXGA 5LB1A 3POCA 1WAPA 2R23B 1AZUA 1J86A 1Z1WA 2V2XB 2BHFA 3OC5A 4NFCA 4YDVB 3NP3A 1DDHA 5GRXG 2G0KA 4PJDA 4WTZG 5DTFA 2JIXB 3ALXA 1JYWA 1DANT 3COOA 2RCSL 1T2QL 4LASL 4WHYG 2LTQB 1FIEA 3BWSA 3CZFA 5EWIL 1DLFL 3ZRCC 2BJMH 2J3SA 4MNQA 5FGBC 4L0PB 4ZO8A 1AS6A 3VU2A 2WWNA 2XX1A 3BUIA 1L0YA 3LRLA 1MLBA 2RH0A 3FT3A 1KIRB 4V2CB 4HPYL 3ZT6A 2R1YA 4TNGA 4NNPH 5CD5C 2X4RA 2PCFB 5E8PB 1IAIL 2FJFA 4KVCH 4WW2B 5ISZA 1RZKC 3RVUC 1ZDSA 2R1XA 4DZBA 1ZHBA 1CVRA 3CQFA 5B4MD 1UXWA 3LNHA 3NYKA 3PXLA 5D6DC 3ZYZA 3VX1A 3WXWL 3LQZB 4LSDA 3ARUA 1IGML 3LV3B 4PWJA 3RA7H 3UGEA 3QIBC 3MOBH 3CVDA 1OSZB 3CD4A 2PW1A 43CAB 1ZRUA 3F7QA 1FE8H 1A25A 1YYLL 2ZKWA 4J8RA 4LEBA 5DMJB 3QEGL 5SX4I 4HMEA 4Q74A 2OSWA 3M07A 4R8WL 3H6JA 4FQ2H 4NQQA 1AOHA 3P0GB 5GRVL 2CPCA 1FNGA 1Z7JA 2MCG1 3GI9L 2Q2LA 3W9EB 3GKWL 3QGVA 3WKNA 3BZEB 5LXGH 1IM9D 1EZLA 4ZFGL 1AXTH 2VIRB 2IBZY 1HNGA 1SHWA 1CYXA 1VGEH 4OB5H 5KVFE 1Q0XH 1R3IH 2Q6WA 4P06A 2BOBB 1UT1A 3N1GC 5CIPA 4PREA 1PAMA 3M1OA 1F6LL 3MA7B 1K5NA 3E6HB 3QUZD 1BX2B 1SEBB 4IS6B 3EDJA 1E27A 3UTZA 1I85C 1KOAA 1VZIA 2L0DA 2O26U 2WZAA 1KLGB 4YE4L 3WJJC 4AENB 1E5ZA 3LS5H 3PGFH 4RA3A 3TYFB 3O4LE 4IIQB 3TYGH 1HI6B 5J5EA 4QEGA 3D25A 1DBJL 1GMIA 1CDCA 1KCSH 5IBTL 1F90H 1SLUA 3S3SA 1LO4L 2Y23A 3T3PF 2JWYA 3RVTD 5PAZA 4Z7OB 3H6AA 5ITFB 4EF3A 3PGDB 4J5VA 1AGDA 2J6WA 5BZWA 3RGVC 2GHWB 3N41F 5I2IA 1R0AH 1WLHA 5DJCA 4JFYA 2PPFA 1N70A 2VL5A 3VNZA 4NUPA 1MCIA 5DK0B 3OWRA 5KAQG 2A9MH 3SY6A 3NCBB 3DX7A 4X6DA 3MMEB 4NHCL 2L8AA 4QT5A 1JSYA 1Q9WB 1V54B 5IIEA 1MFAH 4ZK8A 1V8HA 1MNNA 3IDMA 1SDDA 3H8NA 3SKJH 4P59H 4FX5A 3ZKMC 5I28A 3VI4F 1EEYB 4LRNH 4EUPH 1V7NL 1EPFA 3QZOA 1AJ7L 3BN9C 5IHWA 3CHOA 4FTVE 2OPCA 1IO4C 4UMSA 1DQDH 1OD9A 3US1A 5DD1L 1A4CA 2KI6A 1OY3B 1OF2A 3MBWA 5C0BA 1NC2D 5JPNC 3AUVA 1ZA3B 3DOSB 5EN2B 5I1DA 3DLQR 2VM9A 2QELA 1Q9OB 3WFDH 3BWUC 4XMKL 3HS0A 5LNDA 1UTDA 2WB7A 1GGIL 3B4NA 1YEKH 3VA6A 2GTWA 2NY7L 2W0KA 3HRZC 1Z32X 3QUKA 3G6AA 5EU4A 1NGWB 2VLKA 2OJEB 3C9NA 4QHNA 3KBFA 4MA3B 2BSRB 2VISB 3RWHB 4F7MA 1QYGL 3L7EB 3VFWB 4CU8A 1QNZL 2ZCKH 4GAAA 4LSPL 4PG2C 4ODSL 4LKCB 3QARA 4IBQA 2C3WA 3OKOA 5I1LB 4X50A 1X4YA 3QYMA 3BP7A 4JHWL 5CLTA 1U8KA 2ZSVB 4BZ2L 4HVBA 1G7JA 1EEZA 3TN0C 4QRSB 2YUWA 2WNKA 4S2SA 1YNTA 3NN8A 4GBXA 4L9LA 3TBYB 2F8VA 1P4BL 1JPGA 5F96H 1RZQA 2BIPA 2H0EA 4YNYB 1YN6B 4YSOA 2B3RA 5DJ0B 2WNGA 3U1PA 4Z7QE 4YFEA 5CILL 2XXCB 1KY7A 4B0MB 3QZWG 4LK4A 1CR9H 2B1AH 1S7QA 2IMMA 3E8UL 4HHAB 4KHTH 4M4RB 1I8KB 2W0FB 2FNBA 2B59A 2X4SB 2DD8L 3MRPB 4ODWB 5CSBA 4LHQB 1RHFA 4DGWC 4X5WB 4ENZA 1TDQA 3GJFA 4WCYL 4LSUH 2CIIA 1JZDC 4EIZC 1MF2H 3EJJX 3UTPE 3SGJC 4X7TB 1FG9C 4G5AA 4XN2A 1MZZA 4M7LL 4RISL 4XPHH 5E70A 1ZCRA 3OB8A 3WHXA 1BFSA 5E03A 3OXRA 1SOSA 1BM3H 1FVEA 1AG0A 4WNSA 3HI6L 2ICWB 1NBQA 2VR6A 3S7GA 3NPSC 1CGTA 1YEEH 3F3HA 3VFVB 1FC2D 1HIML 1QSFE 1ZJBA 5AKTA 5KAQF 4OLVL 4FNTA 3FF7A 3QNZB 4NCC2 1NMAL 5HI5D 2ZNXA 3CXHJ 3UMTA 4K3JL 3C8HA 1EDHA 2G30A 1USZA 1KTRL 2HRPL 5KBKA 3AM8A 4I9XA 2J4WH 2F54B 2AV7B 3K74B 1URIA 3KPSD 3OAYH 3MRDB 2QDVA 3JTTA 3GO1L 1R3JB 2ENPA 1GGCL 1T66C 3NJIA 1L7IL 2G5RA 1A7BA