3AGWA

Crystal structure of the cytoplasmic domain of g-protein-gated inward rectifier potassium channel kir3.2 in the absence of na+
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
199
structure length
196
Chain Sequence
IQRYVRKDGKCNVHHGNVRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords G protein-activated inward rectifier potassium channel 2
publication title A structural determinant for the control of PIP2 sensitivity in G protein-gated inward rectifier K+ channels
pubmed doi rcsb
source organism Mus musculus
total genus 38
structure length 196
sequence length 199
ec nomenclature
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3agwA00
3ATEA 1U4EA 3SPGA 2WLIA 2WLLB 3AUWB 3K6NA 3SYQA 1P7BA 3SYCA 1XL4A 3AT8A 2QKSA 3SYPA 2WLKA 5KUMA 2X6AA 2WLLA 3SYAA 2WLJA 1XL6A 2WLMA 2X6CA 3AT9A 3SPCA 3SPHA 3SPJA 3JYCA 3ZRSA 5KUKA 3SPIA 3ATDA 3ATBA 1U4FA 4KFMA 3SYOA 2X6BA 1N9PA 3ATAA 2E4FA 2GIXA 2WLHA 2WLIB 3ATFA 3AGWA 3VSQA 4LP8A 2WLNA
chains in the Genus database with same CATH superfamily
3F84A 4LNRA 4S2SA 2MQGA 4X80L 4KJQC 4MA8H 1PZ3A 3HS0C 1WEJL 1D2PA 1QFWH 1KGIA 1P84K 3LV3B 4LSQH 1RXLA 2Y2TA 1C5CH 4NUJA 2V5SA 3VA2C 4D8PA 4PREB 4HPOL 4NBZB 4YHKL 1R3HB 4MAUL 1TOXA 3W0WE 4FL4C 3MBXL 5BZXA 4L8BB 3GMLB 4AK1A 1S9WB 3GMRA 1NBVH 3ETBJ 2MHAB 1N0LB 3MFFA 5I1CL 1NCBH 5DJAA 1JYNA 4KK5D 1MPAH 4XP9L 2ADYA 1GJWA 3EOBA 4MNGB 4GW1A 4A2DA 3UZVB 2JV6A 1SM3H 4PLJC 5MENB 3IE9A 5KYWA 5BO1L 3EIFA 4UNUA 4XMUA 5I1GL 1MRFH 3PE9A 1GH7A 2OYKA 1F6AA 4HJ0D 2IGFL 2NY4D 4YHNA 4BKTC 2JIXB 2X4QA 2EUWA 2Z65C 2DMHA 3FU7A 4FQ2L 4AV5A 2XIDA 3ABGA 4IIQA 1M7XA 2JTDA 3GMOB 4LVNC 3LX9A 4CUCA 1JOIA 2P5WD 4U49A 4NPJA 2LFEA 4FXKA 5DJYA 4DQOL 1OM3L 4NP4L 2ZF9A 3N85L 3I9IA 2GI0A 4EI5A 2R59A 2IALB 4GAJL 15C8H 3F5WA 3MBEC 4U0RB 3BESR 4OF0A 3LNFA 2VZVA 5ACZB 2WWKO 3S35L 1JK9A 2LU4A 1WUNT 2GJZA 4JFVA 2IWFA 1U92B 4AEHL 1DVZA 1LD9B 2N01B 1QKZL 2XXFA 3QZMA 2PF6A 2FT8A 3LZLA 1AZRA 1BZ7A 1VESA 5E8DL 1JF1B 5HDRA 3IKCA 3P4MB 1BVZA 1U9KA 4OIIL 3TESA 4FZ8H 3TBWB 1F42A 4PJEE 4NKQB 3V6ZB 1G7PA 5T1LA 1NMAH 1ZLDA 3QO0A 4N0CD 4AQ8A 4ELMF 2E9GA 4Q56A 4WEEA 1NAKH 4XCFL 4YDMA 2Q86B 1LWJA 2DWEA 3DYPA 1B90A 35C8H 1IFHH 2A3TA 5EFIA 1ZANL 4DP9X 1YY8B 1CE1L 1EZVY 2UUDH 1BZDA 4FOMA 3QP3A 4HKZA 3KYMB 4S1SL 1JYWA 1CDGA 3SDCB 3BT0A 3E8VA 4UT9A 5L8LB 3GSUB 1I8IB 3QFDB 4XN7A 3ILPA 3QC5X 2V2TB 3WS6C 1MWAA 5IB1A 3C09B 4K8RH 3BVDB 1JWSB 4WI6A 5C2BH 1NDGB 3KD4A 2YGQA 3VW3H 4NPYA 4LPTA 1HHIB 4ZMVA 3MYJB 1DVXA 2I9LA 2H6PA 1KCSH 4Z3TA 1L9OA 2VDMB 3FCSA 3UYRL 2VDKB 5FYJD 3VNZA 2AQTA 2VWEC 4XVUC 3H0TA 1S5HA 3Q1SL 1KJ3H 3QEUA 1P5UB 5JW4R 1CF8H 1XEUA 5LGKA 2FB4H 2ZP0T 4NRZA 3W9EA 3S36X 4A6YB 1MIML 1OY3B 2WQUA 5C6TL 1IBZA 2NW3B 4OZFH 1AIFA 1J9RA 1U93A 5HDOA 4PV9B 2J4WL 3S5YA 4FTDA 3U79A 3P2DA 1L9MA 5JDSB 3GBML 3KLDA 2E7DA 3KPLB 4IM8A 4YXHL 1SHMA 5AWNL 3SY0A 1M05B 3NCJH 2G5RA 3W9DA 3NBNA 2AP2A 3QJFA 4XCNB 4KK6D 3BPNB 3UTSE 3SGJA 4Z7QE 3VFOB 5HDBF 3KL0A 4YDKL 2AQ1A 1VEOA 1IGIL 3ARFB 1GGYA 4JPWH 3VYPA 3QORC 2HT2C 4OCRL 4MJID 4XP4L 3N0AA 5AW1B 1ZLSH 3TT1L 3BZFB 3F65A 2JJSA 2PYEB 3GJFH 5C0CA 4KKNA 1H8SA 4MS8C 1WHPA 2NUTA 4KUCF 5FK9A 1AG0A 2MNJB 1C5BL 1GOHA 2L0DA 3I75A 1QAWA 1WUZA 4HOMA 4PGZA 4WNQB 5E6IB 2W8CA 5LGHH 2CLZA 1S9VB 5IBTL 4JHAH 3L95A 2NNRA 5CGMA 1BIIA 1Z7JA 3H1ZA 2IF7A 1HZLA 2ZT9C 4O4YL 4PRPD 1AO7D 4PS4H 3SPHA 2D3VA 1UFGA 3QIBA 1HQRA 2CUIA 3L2NA 2M26A 5D2NE 4ZTEA 8FABB 1OSPL 2OJZH 4F7KA 5ADPL 3U6RB 2YWYA 4UOW1 1MCWM 1M71B 4JM2A 2AJZA 2WO4A 3D50A 4KMTH 3VXOA 3HBZA 2H0EA 1CFBA 3HZKB 4FLHA 1XZ0A 2HX8A 2WLLB 3MGOA 5E4EB 4FQHA 1SHWA 1VCAA 2E9IA 2VITA 3RVUD 2AXGA 4M5ZL 3TS8A 4KZCA 1XGTA 3HFFA 2VO8A 1DVSA 3VD4A 4NQCD 1EHAA 1NBCA 5C0FB 2DD8L 2FJSA 3ZL1A 4MCZA 4PJBA 2W9LA 4MNGE 4XR8C 4S1RL 1FWXA 4G6AC 1BDYA 3GRWL 3HLAA 1U91A 2K7QA 4K5MA 4PUBL 1WC7A 3HRZC 5ECGA 2FVNA 1P5VA 4W9DC 3QNZA 3VAEA 3BIBX 3W81A 4IRSA 5AOJA 5JORA 1IM9D 1ZWIA 4JKKA 4Z7WB 5CKAA 1PX8A 5LNEA 2F7PA 2XQYK 1KFAH 5J0BA 3M07A 2XWRA 3L1OL 4GW4B 4EIGB 3LPOA 4WI0A 2Q2EB 3LQZB 1ZV9A 4DEUA 2NY1B 4BINA 3JYCA 1V05A 4JHWH 3AQZA 4OFDA 1MFAL 5SV3A 4HFWB 4XXCA 2BERA 1E5CA 1KTCA 3O3DA 5H35B 1HKLH 1CICD 1NCTA 5FGBA 2MSPA 1I7UB 3V0WL 1NKOA 5CZXD 2F1EA 2O30A 4H26A 2GG1A 1GC1H 2B0SL 3BAKA 3CMOL 5ANMB 1LEKB 2P9RA 3DMMA 3V0HA 4DP4X 1VGEL 1XBDA 3U4EB 4TVPE 5GS0L 5TQ0H 2V7NA 1GZPA 1KUMA 2C26A 3L5XL 2VAJA 4ETYA 4QUOA 1OOWA 5JMRA 2G4GA 4WTZA 2OJEA 3VQ2C 5ISZA 3MA7A 1DBML 4NQVA 2R69H 1EX0A 1O7DE 2GK2A 3EOAA 3UTZA 4HD5A 4UILL 1IAII 3BZ4A 1U8NB 3DOHA 4JRXD 3B2DC 1HWHB 4J5VA 2GIYA 2IPTL 5FUOH 4OZIF 3B3IA 2ED6A 3VI3A 3PL6D 1W0WB 2W65B 2YN3A 4P04A 1EMTH 1VCBC 2DH2A 3TCTA 3L4WA 4YIQB 2X1WL 1ZY9A 3GO1L 2YD4A 4LSSL 5D1QE 1NBYA 4I2XB 2A6IA 3TCLB 3NFSH 1I9IL 5L7XL 2O5ZH 4X9YA 4BK8A 1TJHH 2UXVA 4GAGH 4J3UA 1OB0A 4YL9A 4NRYA 4MQXD 1I9RL 3EG9B 4R4ND 3UP6A 2JKLA 5IQ9B 5DRXB 3SE3A 3CX5K 3SPIA 1KGCE 5GRWA 1IC4H 4C56B 1TG8A 2ARJB 1PMYA 4G6FD 3PU7A 4BQ8A 1NEPA 3HN8A 4Y7MA 3DJRA 5I8CA 2WOBA 1EK3A 1HHKA 2XG5A 1ZS2A 5AW7B 1CS6A 2O5YL 1KIRA 3APDA 3JWNG 5ESAA 2LGNA 5DWUH 1LEIA 2OX5A 1T1ZA 5IIEA 3RGVA 1QLEB 4G7YH 2UWEB 2E7BA 3BUPA 1RZJL 3RWIB 4ENZA 1U8CB 3SQBB 1V8HA 4BELD 1L5GB 1MCJA 3B9KD 1GCYA 2PYEE 1TCRA 3T8XB 1NCUA 2P24A 4NERA 4NNPL 2IXQA 3GHEH 3U7WL 2BJMH 2ICWA 5JW4M 4A67A 1U3HD 2ZCLH 3RY6C 3O3UN 3ECBB 4JHBA 1HILB 4AVHA 3S2CA 4Z3IA 4BUGA 2G0KA 1H0DA 2GBUA 4JG0L 4DUXA 4JREB 1UD2A 4PRDA 2C9VA 1GSMA 1FCCA 1M7DB 3NP3A 3CVHH 3OKYA 3U0PB 2DQUH 1SYVB 4O00A 4AJVA 4L4TB 2B1HH 4HKXB 5CMAA 3ESUF 3LN5B 2C3HA 2J2ZB 2CLRA 4AGPA 5IB4B 4Y4FC 2X4RB 4S0SD 2Q7AA 3WKQA 1PIFA 1VADA 5BUPA 5KTEH 2Y0SA 3HMWH 5TFSL 1YO4A 1AKJD 4N0RA 3HE7A 4K5OA 1RZ8A 3FQYA 3WTSA 5DQJB 4FTVA 4RRPG 4JFYA 7FABH 4PJ9A 1BZOA 4HQQL 4I3GA 4MDJA 3AM8A 3AGWA 3MV8A 3STZB 1J0HA 1WLHA 3A67L 4RBPK 3IXTA 3JWNE 1MCHA 4WHYG 2WZ0A 2NZIA 3NOIA 2AZUA 3EH5B 4HAKA 1YNKH 2F5AH 2WXQA 3VXMD 4EN3A 3PWPA 2ADJA 1GOFA 5D93C 2X6VA 3WUZA 3EJPA 3D2UB 3TNNB 3GSXA 2RCSH 4CL7A 3TEZA 2FH6A 1R17A 2DLTA 3MRBB 1UOWA 2EH8H 3LN4A 4F7EA 5HYJA 4M6AA 3KPRE 5JPMA 2IANB 1FC1A 3BKMH 3GKZA 4JFDB 4X6DF 1JZDC 3BEVB 3D07A 1FSKB 3HI6L 3PWNA 1FZOB 4Z7WE 4Y2DA 3STBA 2AEOA 4ES8A 3CHRA 4PWFA 1DLFL 1PNCA 5C8JA 2AGJL 1IV8A 4Q6IB 2JQAA 3EAKA 5HHMB 2F53B 4IGBB 1HI6A 4JANB 3RWDB 1G1KA 3GGWB 4KC3B 2CO7B 4N2AA 1FI8C 4GRLA 3KW7A 4P4KA 1KF9B 2Y2WA 3CH1B 4Z5RB 1HH9B 4ZQKA 3AS3A 5ELIA 1W9XA 3KDMB 3PWVB 4FGMA 4G8FA 4HDIA 1A7NH 4PGDB 2R2BA 4XMKH 5FA3A 4M61B 4KPHH 3L5WA 5ICXA 4WI9A 4P5TD 5J1SC 2QGBA 5FYKU 3LDBB 1PKQA 3V4LA 5I1IL 3AB0B 1EERB 5GJTL 2R1WA 5EZJA 2APVA 1VPOH 3J27A 2KLTA 1M6OA 4BUHA 5DO2C 4L1DA 4ALAC 4NC2B 2Q7YA 4NKDA 1KGWA 4CVXB 3VWKC 4N22A 5I1DA 2CUAA 5TQ2H 4MMYB 2OTWA 4V11A 1HXYB 2PW1B 1S2EA 2XACC 2XRAL 3GJEB 4WFED 2B77A 1O0VA 2J71A 3SGKC 3IE4A 4K8RC 2FJUB 5BUAA 5JQHC 1BWMA 3T0ED 1OSZA 2WIIA 5BUGA 4LLMA 4P2QE 3QUZD 3D39A 5DZVA 3GMQA 1MWOA 5CJOH 4NO3B 3VTTA 5BZWB 1QLFA 4KX7A 2PR4H 3BJLA 4NHUB 1BBDL 5HGAA 1U8OB 3CFMA 3GKWH 5HVHC 4PJ5B 2EUXA 3VVVA 4HIHA 4B9ZA 4AE1A 4O2FA 3M17B 1I4FB 3KPNB 2PW2B 5BQ7A 1D3CA 1I1YB 1T21B 2V5MA 4X42A 1QI4A 3HAEB 5DHVH 3L7EA 4AH2A 4I2XE 4YHIB 1R34A 1A4CA 2FGZA 2QHLA 4G5AA 5EIQA 5GRJH 1RP8A 4XNYL 3KCPB 1AQ8A 3QUYD 3P40A 4R5VA 1VB9A 3NCXA 5LG6A 3FB8A 2BY1A 3LHPL 3VFUA 5J13C 2J8UA 4ZPVA 1HHGB 2VIRB 2X4OA 1AHWC 2ODHA 1DZBA 4P57A 2ENQA 3ABZA 1JRHI 3CHOA 3GI9H 3QDJB 5F7YC 2XWDA 1OE3A 3LPGA 4M43L 1FPTH 3KWWA 4A55A 1S7WA 3VH8A 4FRWA 3P3YA 3H9YA 1WT5A 1OCRB 3UJIL 4MCNA 4XNUL 1G87A 2H7WA 3MRGA 1OGPA 2MKWA 1V3JA 3FQ2A 2G9HB 2C34A 4K2UH 3HUJF 3V6FB 1AS8A 2FO4A 2UWEE 3H9HA 4F2EA 2GIMA 2VC2B 3BD4A 4LSTL 4XGZB 1XHHA 1A7QL 3GXPA 3BHBA 4QHPA 4XPBH 1FV1A 1Z5LB 4PV8B 43CAB 3GXNA 4EOWL 3P30L 1PZBA 1IM9A 2F18A 4FFVD 4AXWB 4IMLB 2GFBB 2CNZA 4BZ2H 4XI5D 3HNSH 3ZZLA 2AJUL 3ATBA 4C59B 1NANH 3A24A 1CURA 4AMWA 2HFFA 4J27A 2XQYG 5E9AA 3QIUB 4OJYA 1Z9SB 1ORSB 5GGVH 1DE4B 1KB5A 4YR6A 3VGAC 1EEQA 3IGLA 5AB2A 3FL7A 2EE9A 1CB4A 1SDAB 4MYPA 1XCQA 5FYJL 1CICA 2VSCA 1GZQB 4NQSB 2YD3A 2VDNB 4UIMB 3TN0D 2ITFA 1H3VA 1OGAB 1Q9WA 5DMIH 3NYKA 3RHWF 2PO6C 4FQIH 2WXOA 1AXIB 3ARQA 3KWVA 4YDJB 1RZFH 3QQ3A 4UAOC 2XY2A 2NY0C 4Y16B 4JG5A 2DQDL 1LNUA 4JQIH 3RFZA 2WQAA 4OY9A 1QFUL 1XF5B 3PNWA 1J5OL 1FGVH 1BM7A 1QR1B 1AFVH 2J7LA 3LH2H 3PDGA 1JYVA 3AS1A 2A1WL 2VM3A 4FG0A 3MOAL 3B2PA 1QEXA 3DO3A 4RMRA 2XTJB 3UPRB 1ZHNB 3OKMA 3FU9A 2XIBA 3VSTA 2J88H 3WKNA 3ZDXB 4Z3HA 1DLHB 3DUUB 3T0AA 3SE8L 5JPNB 3AUWB 3ULSA 2JJVA 3O9WD 2VERA 3NJNA 1KXQE 3DETC 2B9AA 2OPCA 4LAQH 5EIVA 5JOFB 1S3KH 5DR5L 1MEXL 2KLRA 3MCLL 5CBAA 3MLPA 4OI8A 3VQLA 1FVCA 2O6PA 3SDYL 4WWKA 2QDWA 4GT0A 4LHUA 1IILE 1BVLB 1PQZA 4JFDE 3QE5A 4PJFF 4PMFA 3OKNA 5SWSA 4NENB 4GRWB 4K5LA 3MOBH 1QUPA 2KZBA 1Q9KB 5F1NB 1FJ1A 4LCWD 2CCLA 1KYOK 2Y23A 4HX1B 5HHME 1UXWA 4NJAL 4JFOA 3WGUB 4MB3A 4AV0A 1P6AB 1G7HA 4Y4HA 1W72A 4M8UA 4JY6A 1AYOA 2AJXL 2R0LH 4X7SL 4NNYB 3BW9A 3WIHL 1U21A 2WNXA 3OF6A 3QSKB 5ALCL 2E8ZA 4AW7A 3HAEG 4NLAA 1YEEL 5EU6B 1UA6H 3WEMA 3ZTDC 2MFNA 1H3PL 5F6HI 3IDMA 4ODBD 4P2OD 3V8OA 3ZQWA 4FP8L 4G59C 3BAWA 2H3KA 3FO2A 4NDMA 2NRDA 4OF6A 1DQKA 1JGIA 3BIKB 1HINH 4RWYH 4XP1L 4D9QE 2E7LA 4AYMC 4M6OL 1R3KA 2NY6C 3KPOB 3B7YA 3C08L 1SZNA 1TEYA 3O0RL 4HETA 4LE8A 4Y4KC 4L0ZA 3U2SB 3O8XA 3O6KL 4E9VA 3QZWB 1WA1X 4W81A 2IV8A 4BGDA 4KK9D 1FFPB 3EBAA 4Q9QL 2YEQA 2IAMD 4UMSA 1I7ZA 5FF6A 2DQCH 3RB5A 4X6CA 1SOSA 4MAYA 3DGGA 3AY4A 3PHOB 4X0KB 5IVZB 3N3EA 4N5UA 4ZZKA 2CHWA 4WO4A 3FOMA 1JF6A 4CVZB 1LO2L 2VXQA 2XVKA 2XNAA 2HVBA 2I7SA 5FA4A 1EAPB 3ALPA 4PJ5E 1BCIA 4XMTA 4PJDB 4YPGB 1FORH 2GJ6D 5D72H 1MXDA 1H8LA 5TE4H 4HWZA 3FQ4A 4LB8A 4MMXB 3NABL 3TPUB 2WINA 4JPIA 3S5LA 4APXA 1AR1C 4AQEB 4I0PA 1IC1A 1IAOB 2I60L 4H4NA 4PJ7A 1F1AA 4RGND 1Y0LA 1S7RB 3PJSB 1AKJA 5EWIH 3H3BC 4F9LC 1Y1DA 5AAWC 1MCPL 4LKXA 1DN0A 2WQSA 4XNQA 3UYPA 5HI4D 3RWCA 1KC5H 1OAYH 2VW6A 4RAHA 5D4JA 4ABVA 3FUEA 1IVLA 1MRDH 1WAAF 4BIKA 2ARWA 1Y18A 1U8PB 1X6NA 3H42L 5BPPA 5F89A 2XCMC 5DVLA 2EYRA 4PAZA 2BRRL 4H13C 4N90D 2WO3B 2J21A 5I15H 4DKFL 4Y1AD 4OBSA 5C0ND 1EEUA 2OQJB 3TV3H 3LS5H 5DRWB 1CL7I 5DRNA 4JO2H 4QKTA 3ZDYB 2HRLA 3G6AB 4RFOH 1CFNA 1QNIA 3DV4A 5CEYA 2OTPA 3LXAA 5T8IA 3MLUH 1T03L 4UT7L 1XZWA 2HT4D 2WYZA 4J8QA 4P99A 3V5DB 3WMQA 4Z7VA 1MW3A 4MXWH 1WE5A 2CSPA 2Y7OA 5KBLA 4LVEA 1S7UB 2BIHA 4ODTL 1HHHA 5T5NF 2EABA 2ZYIA 1CG9A 2X2YA 3WNJA 3IRCA 3MRNB 3ZU8A 5C07D 3T9WA 4OFKA 4XMLL 4JO8A 4XN4A 1Z9NA 2AABH 3TC9A 1GKOA 5KSVA 3G6DH 2V9UA 3J7HA 4PRBB 3WFDH 3M1BB 4N8PA 4HZ1A 4TUOB 1H5BB 4UQ3B 4FQXB 5C0EA 2F74A 3NACH 3SQOL 1ZGLA 4FQLL 1FP5A 3A21A 3MBWB 3GXTA 1KGJA 3U1SH 4XXDA 4NO0A 4PSRA 5B38A 4RQQB 3EUUA 4WWPA 3CDFA 3FB6B 4JZOA 3EF7A 5I19H 5DHDA 3RWGB 1IC7H 3VXQB 1NIDA 3AAZA 4K0OA 1NMBH 4N3TA 4PJGB 4J2QA 4PWIA 3ZE2F 5I73C 4AJ0A 4NQDD 4Y0GA 2XTJE 4OJAA 4AW4A 1K4CA 2I27N 4XNMB 5B7EA 4XP5L 5FHAL 5CHNA 4BK5C 4CGUB 5JW3H 3BKCH 1OEZW 3LZFL 3RVXD 3U36B 2LVEA 3V0IA 3C6LB 3EJUA 3GXIA 4LCCA 4QRPD 3F12B 1ERNA 3QZWG 4MA1C 4W4OA 4E0RA 1JHTB 3NEEA 1IKNA 2V5TA 4JDEB 1VGKB 1SBBA 3IWUA 2DEXX 4GAYB 4WW1B 3FO1A 4Z78A 4LFHD 3V4VA 1G6VK 2WXNA 3II3A 1ADQL 1VZHA 2HLAB 4QRRE 3DX0A 4OUUB 5GRYA 3MV7B 3X3GH 5KVDE 1EHXA 5KW9H 1BMZA 1EGJL 1JNHB 2UY6B 3BISA 4X8JB 4TNVF 5E9NA 3HG1E 1BEYL 1Z9LA 4G8AC 4Q58C 2O72A 4GSDL 4DAGL 3PAVA 1XD1A 1WD8A 2UUDK 5DK0A 4NT6B 5ITBH 3GM8A 3WHE1 3ZYJA 1U8KB 4DGIH 5EU5A 1T83A 1CLZH 2K6WA 3CBRA 4PY7B 1QYGH 5I5JA 5EU6E 5AZ2H 1BG1A 5HPMA 2HRPL 3UTSA 3CFQA 3VRLE 1HHJB 5EC2B 3VDBA 1GAFH 2CKBA 5HYEA 3BKJH 3M6DA 2WBJA 4KUCD 4G8GA 4WW2A 4WWID 5BVPL 5D1ZA 1DSFH 4PGCB 4RNRA 3VI4B 5JHLL 1IBDA 1RJZB 1AXSA 1L3NA 3VRIB 3MYZA 4CDGC 4GPVA 4KZ0A 3E1ZA 4WCYH 2CBOA 3ZTNL 1Q1JH 5FO9A 1UM4L 1KTJA 3AREC 3TM6A 5CCGE 1FDLH 3G5VB 5C08A 3W2DH 5K1NA 1J5HA 4HH9A 1KNOB 3K1KC 1NDMB 3GBNL 4UB0H 2ALWA 3EO0B 1UENA 3GI8H 1EUUA 2GUOA 5F7DA 3RU8H 2B3IA 4E9RA 5T3XE 2W88A 3F58H 5TE7H 1YEFH 3EFOA 1NJ9B 3IAPA 3WUWA 3B8SA 2X87A 3QPKA 3N06B 5D2NA 4PJDE 4M5SA 1YN7A 4MVBC 4HUWA 4V1DD 3S97C 2I32A 2X4SB 4L37A 2K78A 2Z7WA 1CDBA 5CFAA 2PTUA 1G9NC 3VE0B 3S36H 1TQBC 4WU5B 5DC9B 2XXMB 5D96B 1DVFB 3TN0A 5BVJA 1F4WH 5CFHA 3BGFC 5JHDB 4J3OF 4KQ3H 2MOGA 3K6IA 3P1VA 3V0VB 2PKDA 2GQHA 4Z77A 3ARBA 3GJFK 4XVSH 1Z5YD 1QEWA 4FXTA 4RAVB 2OCJA 4OD1H 3ZW3A 4I3SH 1KPVB 4NN7B 3GTTA 1MFUA 3PFQA 4WV1A 3QVAA 5FCSH 5B7FA 3SBQA 1I1AA 1WBZB 4FNTA 1S9XB 2VL5B 4OF5A 3WSQH 3CZJA 12E8H 2PXYC 3FUIA 3ZQ9A 5KG9A 5I1LB 5IHWA 4ZO8A 3B2VH 3INUH 1BLNA 3TA3D 2A83A 1J1XL 4JJ5A 1NCHA 1U41A 2ZUQC 2VH5L 5I5MA 1OE1A 3X11B 2M8XA 3BN9D 5DEFA 5EUKA 1T0MB 2O4EA 3FN3A 3HG0A 5FKAB 5DJ6A 1TJGL 1FAIL 4JDVA 4WENB 1HDMA 4ILDA 2AQRA 1Q0YH 1ORQA 2XWCA 3GWJA 4HEPG 5D6CB 4P9MH 1LDPL 3HZMA 3SDXF 1RJLA 3ROOB 1JRHL 5KSAA 1LO5A 2K9FB 1IC5L 4ZO7A 4PJXF 3F62A 1JNNL 4HPHA 1IGTB 5LXVA 3C9NB 3GHBH 4N3UA 3TO4D 1MXGA 3CFCL 2FECI 4OGAC 4YHPA 7TAAA 1JXJA 2XKNB 3GDCA 5JW4Q 3MJ9L 3VMOA 2F58L 4LESA 3S3JA 3C60C 5DI8A 4BZ1H 4A2EA 1M7IA 3SQRA 3EFDL 2WXPA 2X1XR 5KBDA 5PCYA 2DQFA 2VXSH 1CFVL 1KCVH 1KY6A 1KJMA 4JGUA 4D0BA 1QPKA 1TF4A 3D85A 1NFAA 3TFKD 4IBVA 5AZEL 2OZ4A 1G5GA 3FB7A 2APWA 1U95A 4IEFA 4QXUL 4QRTA 5CBEA 3RTQA 4JQXA 4F1ZA 2VM9A 2AJSL 3FB5B 1V10A 2XFXA 4Z0XB 1P7QB 1PZCA 5C86A 5JXEC 2FUTA 1NGPL 3AT9A 4PJGE 2DMCA 5IB5B 3FC8A 4OD2B 5DFAA 4XTRC 3HMXL 2C3GA 4AENA 4JFPB 3VB8A 5H94B 5BNXD 4H88H 5BS0B 4U1KB 3FRPA 1TVHB 4KV5E 5CP3H 1MLCB 1UASA 3FSZA 5JHMA 4Q89A 3TJEL 5EG6C 3MMEB 2NW2A 3B1TA 4BSVB 1NBZA 4LF3B 4NO2B 3QI9A 4LSRL 5D1QA 3QIWB 3C8DA 2WKOF 3JWOH 2BHFA 2FJFB 1M2VA 1NUFA 3EJYC 3LCYA 3M8OL 3D0LB 4IRZH 4ZRGA 3LRKA 2GJ6A 1ED3B 1N8ZA 2ZX8A 2VR4A 4LOVA 4NRXA 1PIGA 3MV7E 5I16A 4U3XA 1HESA 4XX1G 2O6DA 3B34A 5DEGB 4CNIA 4XPFH 3ZO9A 3QCTL 2B1AL 3Q8EA 3FTVA 1N64H 1WS7A 4LLVB 4X9FA 5IB3B 4OZGB 3BC9A 1K4DB 1PJWA 1C1EL 2ZXCA 2IFGA 5D7JD 1AGBA 3BJ91 1MJ8L 3EJSA 2C1OB 2GSGB 4HD9A 3SE9L 3WJJC 4ZYKA 2ZYHA 1KEGL 4R0LC 2P8LA 5I0XA 4HWEH 4JHUA 5CM1A 1A6UH 4QWWC 1R75A 2OMTB 4OLVL 5DJXA 5E6YA 3T3MB 1H9VA 2GT9A 1KCUH 2QSQA 1OARH 3I74A 1JMZA 3UO1L 2BY0A 5IBLD 3VG0H 3BN3B 3UAJD 5I28A 1FQ9C 2IDTA 3JUZA 4RX4A 1QVOA 3WO3B 4UIKH 4ZNCD 5B7MA 4BH7A 4Y2OB 2BVOA 1TR7A 2G2RA 5K59F 3HVNA 1XR9B 4OF8A 2CBQA 1G0YR 3K72A 4JO4L 4AV4A 1KENH 1MNUH 4OZFB 5EBLB 4KU1A 2BWQA 3ARDA 4FYQA 3A6CH 3U9UB 2FBJH 3WE1A 3APCA 4P3DB 4LEEA 4XNAA 4PGEB 1YPZF 3RB7A 3A5VA 3TVMC 3UZEC 2ZKYA 1G7QA 4OGXH 5LQBL 3GMMB 4XX1E 5GSVB 3TH3T 4GB9A 1NGWB 3ILQD 4Y88A 5DJZB 4DGYL 4G43B 3VA6A 4NI3A 1JBJA 2QQNL 5B3JE 1GPOH 5FCUL 4I8DA 4KX9A 2EDWA 4B7IA 4B95C 1LMIA 1CLYH 2QSTA 2XY1A 3E2HB 4U1NA 2NZ9C 4XWGL 1KGXA 3EH1A 4U7MA 5JHDE 2BSEA 4NN5C 3GJFB 3IN0A 2JB6B 1KXVA 1HJBC 4G7SB 2IH1A 3ZE0B 4QXTB 4QRBA 1D5MB 3IKKA 2R1YB 4M4PA 2CLVA 2P4AB 4FNPA 4XAKE 1GJUA 1TITA 4TVSa 3VSVA 4E5XB 2XLLA 2BZ7A 2B5IB 4MXVF 5A16A 3PGFH 1E67A 4I1PA 2DQJL 4CVUA 3A23A 2BW5A 4K9JA 4DFIA 3CC1A 3MACL 2BDNL 3KPRA 1BQUA 2GB2A 2Z91A 4HU2A 5T3ZE 4EQ2A 4X7TA 2EVIA 3MRLA 4A2HA 1UZ6F 4GI9A 1MCDA 2F19L 2YAEA 4J8RA 5I30L 4W6WB 1JTPA 4RCAA 3KL3A 5ALBL 1BPVA 1B3JA 3BD5A 4OVUA 3MCKB 2MCPL 4GP4B 1D9KC 4U6XA 4JY5H 3CNKA 2Z9TA 4KJPD 4Y8DC 1EFXD 3H3PH 5LBSL 5FW7A 4BWWA 3N85H 1IBBA 3NIGE 2BSSA 5AVRB 4UM8B 1WD9A 2PYFA 4Q7DA 5FWRA 5DU7A 1JN6B 4QYOB 4IYKA 2ZX5A 1KELL 3GSNH 3H6JA 4ELKA 4J4PA 4JFZL 1CL7L 2ED9A 3RIKA 4Y5VC 2F8XC 5EBGA 1ID2A 4AEHH 5ABDE 4U1MB 3LIUA 3FUMA 1GGCH 3QFJA 4GRMB 4XNXL 3S98A 3WI9A 1F56A 3LEYL 5E94A 5HI5D 3T0VA 5HJ3B 5E8DH 3ZDZF 3WFZA 1T7WA 5C6PB 3X1GA 5F3HA 1MUJB 1DQDH 4D9LH 1HT6A 2B4CC 1TU2A 1ZS8B 2EC9U 3B8YA 4GIPD 3B4NA 1F3JB 1R3JB 3NSDA 4MNHA 1OL0A 2D7OA 1X7QB 4H0GA 5DYOB 3ZMRA 2ORBL 3HR5B 1QNZL 4Y5YC 4P2QA 2DJSA 1CE1H 2DQIH 5F96L 2KKQA 4S1SH 5KVFH 2J8OA 3BVNA 3S88L 5DEJA 4NN6B 1R47A 3FTZA 5HHOE 3OAWA 5IOPA 4YQXL 1RIUL 4I4WB 5BS0E 2BSTB 5K9JL 4OJFL 1SHXA 1OW0C 2DICA 3O6FB 3MNWB 5GZNC 3ESMA 3H3KA 3L9RA 4OLUH 4JFQB 4ZPTA 1NCCL 4U1IB 4OZFG 1B6DA 4EVNB 4KXDA 3N44B 5F6IB 3ZL4H 3C5ZD 2ZONA 5IMKA 1VEPA 5IJDC 3O4LB 3NJHA 1BMWA 2W07A 3CBKB 4DZBB 1MN4A 3UTTD 2WUBH 3C2AH 2K9UA 3SOBH 3II2A 2BY2A 3HI5H 2CZNA 1WBXA 4MA7H 3LH8A 4LCYA 5BOPA 2AEQL 4NQXA 5JNYB 5SWZB 4L3ED 3APNA 1KDJA 3CU7A 5DD3L 5A6IA 4CJ0A 5MHSE 2P7TB 1S7QB 1GGBL 4OZGE 2APBA 4NI6A 1CFQA 4IRJD 4ZXBC 1DQLL 2D3LA 2RMNA 5FOBB 2ZAGA 5AB9A 2I85A 2ZSWA 4YXHH 5KYYB 4UWQB 1J1PL 3MA9H 2ZWYA 4MXQD 2BSDA 4DO5A 1BOGB 1LQBC 5ENWA 2CGYA 4Q97A 3DPBA 4DT2A 3LRSA 4GG6B 3MRKA 4FFZA 4E5XG 3TBVB 4KKPA 3VFTA 1VJSA 1WZ1L 1EXHA 1BF8A 4YEEA 4OCRH 4Y19D 4XP4H 2OSYA 2O61A 1VFOA 1W16A 1D5IL 2XVGA 4FZEL 1LP9B 1RKRA 2OXHA 1ECZA 4TSCH 1MREL 3FUJA 1QHOA 5E1IA 3RZCB 1FO0L 3ZN6A 3S6CA 4PS3A 2BWDA 2XWXA 2Z92A 1EV2E 3TZVB 3MRIB 2VLJA 3ASNB 1E3FA 3DROB 4QHMA 2WLMA 4M5YL 3DDGA 4P3CL 3QXTA 5J12B 1UB6A 4GBXC 4LT7A 4MJJA 3C12A 1PVHA 3U1PA 4FLQA 4FXGB 4O9HL 2EDBA 2FIKB 2EIZA 1S7SA 2P52A 3LKRA 3WNLA 3DIFA 5EV7A 2R0KL 1GGIH 4HSCX 2Q7NA 1C5DB 3MRRB 1UD4A 3QDMB 3GYRA 1Z3RA 1OF2A 5FECA 1UATA 2QSCH 2ZWLT 4DVRL 3SJVE 4LLYA 1XGYH 1ET8A 3Q01A 3NRPA 4FA6A 32C2A 3ZE0E 2XVBA 2XBDA 3PAUA 4D0CB 3NDZE 5DRZB 4A7GA 1JXKA 3WKPA 4EPSA 3FQRB 4JZJB 5GZOA 3EGDB 4PI0A 4LLUA 3BE1H 4K3EL 1VRSA 4NKMA 2FWUA 5LUMA 4OH2A 2PPDA 1GHFL 1KPUA 2NY5H 4F5CE 4R7NB 1KXTB 1QBLH 1TZOA 2YBRA 1X7SA 1GYVA 3PWLA 3SDAB 3FULA 1OP3H 1S5IL 2CJUH 2C8NA 2HXAA 4S1QL 3FJTA 5C0AD 4F7MB 4WUKH 4PUBH 2WJ7A 5HTSA 5M94B 4UOW0 2R51A 2YKLL 1U30A 3WNPA 3UG4A 2N7BA 1MF2H 1UB5B 3OD3A 4FQJL 4DP2X 3W37A 4Z7WF 4UT9H 3DXAA 1X5KA 3ZGHA 4AQZA 3O11A 3L1OH 3SPCA 1V7NL 3MLTB 1MWAH 2R56H 4PVLA 3SCMB 2IDFA 3DTUB 1QO3A 4ZFOA 2C9SA 4HGWA 4EKXA 1BQHB 1E4XH 4AUYA 1FYTB 4WEBH 4AJYV 3PHQB 4KZEL 2JKIS 3RVWC 2EEBA 4KQ0A 3HOGA 5IJKC 1YCSA 3QXAB 1KBGH 4P9HC 1NGYA 1WTLA 3QUKA 2IWEA 3IM1A 1NCDH 4ONOA 3IU4H 5F7FA 4DKDC 4G6AD 5AUMB 3UXFA 2DQ6A 4HOZA 1WCBA 5CNHA 1R1CA 3UOAB 4OB5L 2FECL 2C9AA 1IGCL 1OK8A 4IW4C 4JMNA 3ZBMA 4HCGA 4U1JA 5IFAH 1A3LH 3QNXA 2IWKA 4JKPL 1NAMA 5EOCJ 5D8JL 4F8PA 4RWHA 1NC4D 1AMYA 3WY2A 1MFNA 2FD6L 5T1KB 5E8NB 4QHKI 1CR9H 3VXPA 1J8KA 4HYTB 1DDHB 4PCKA 3E9TA 4GO8A 4U6HB 4H7VA 5J6GA 4FYRA 1U3ZA 4AQAA 3JWOC 3ULUC 1FZMA 3QEQA 1FNEB 3HI1B 5BRZA 1EPFA 1PBYA 3QQXA 3QWRA 3Q8AA 1RUKL 4L4VB 3MJWA 1M3JA 2IPTH 3DGDA 4W9KC 3LNGA 1MRCH 5CINL 4E9TA 1E6JL 4JFUA 1A2YB 5CWSB 4QIRA 2WLNA 1XH3B 1SVBA 2H9GB 3EOTH 5E2UL 2ENYA 3BQUC 3WN6A 3LKQA 1JPTH 2NY3D 1QA9B 3O4LE 1P7KB 3UBXI 3NJVA 4YXLL 1REIA 1QLRB 2FLRT 4F8OA 3EO1A 2WXRA 1BMGA 1FZKB 4F33B 2HFGL 2P46B 5D6DA 5SWZE 5DVMA 3ARUA 3N91A 1RK0B 3Q06A 3GLDA 4I1NB 3U0WL 3E0GA 3ZR6A 1QZNA 5GGSA 4ZUWA 3O0LA 2WXFA 4G72B 3RDTB 1FVDB 3C5XA 2DM7A 5DS8B 2YJQA 4HFUL 4NM8L 1G7IA 2VDPL 3QZOA 3T71A 4X6DA 2HFEA 1XCWA 3IS1X 3D6GA 5DD1H 1E8ZA 1YUKB 2O5YH 3HE6C 2ZJSL 1BSIA 1JAEA 2VN3A 3AT8A 5A7EA 4X4YA 2UWEF 2MQ0A 1CUOA 3OAYK 1O5DT 4CMHB 5JQ6L 2XWJB 5DHVB 4NJ9L 4P59L 3CFTA 3QG7H 2APFA 1ONQA 4PJ8C 5GS1A 2WXLA 3EBHA 4ZSOB 3TP4A 5CD5C 5J11B 4JM4L 5MERB 4H2AA 4ZAKC 5JMOC 3E7JA 1LP9E 1X3DA 1NBQA 4QHNA 5C09D 3U7WH 5KVEL 4LVHB 4GKZA 2ZTBA 1LO0L 3HS0A 4K73A 5H4YA 3S5ZA 5EIIB 3U9PL 4AYBA 4ES9A 1R4XA 2FTAA 3KPQB 4WHTB 4TLTA 4OCYH 4AUUA 5C92A 1FNHA 2CRYA 4G1EB 2DM2A 3T0BA 3IMBA 4HWBA 1SDDB 4UNIA 4I18C 4UTAA 2OM5A 1DEEA 5F1IB 2DTMH 1BQHG 3KBPA 3JV4A 3JVFC 4H25A 4XPGL 4RDQG 2R8SH 3UMNA 3K3QA 1ZHKA 4X83A 5MI0B 3QDME 1WZLA 3VXUA 3UIZA 5C3IA 3IT8D 1HEZB 3OC5A 3WE6B 1KIQA 2OCFD 4F58L 2AK1L 3WXWL 3GB7B 4JZNA 3SGEI 1T04A 3SKMB 5AENA 3BP7A 2BOCA 2BP8B 2WVVA 2CO3A 3CN1A 3WO4C 1I31A 4GLRI 4ZX6A 1EA9C 2FSDA 3F8UB 4NZTL 3OKLA 5IB2A 3WFHA 4YSSA 2MPAL 5CLWA 2DV6A 4AVJA 1UACL 3WAJA 5ID0A 3VD7A 1SOQA 3MBEA 4OR1A 3G5XA 1HX0A 4PW9A 2QZ5A 1QSFD 3QQDB 3VWJB 3BAEH 5AW4B 4AM0B 1YYCA 2CMRH 5D7EA 5EZPA 1A9EB 4F92B 1MJ7H 4GQ9H 2VABB 5B3SB 4LIQL 2DZEA 1X5JA 4PR5A 4QNPE 3KXFD 4QRRA 3L9YA 3K2KA 5HHXH 1HH6A 5D2LE 1NZRA 2QMKA 1Z9PA 3VGBA 4BV1A 2MNWA 3HG1A 5F44A 2JQMA 2OBGA 1P2CB 1WCQA 5LXGL 1ETZB 2D0HA 3HB3D 3OHMB 4JFED 3VXSB 1K6QL 4P2AA 3QS2A 2G5BB 2KHAA 1KACB 4HIXH 4PJCF 1ZV5A 4RIRB 5FYJU 2R2HB 3FZUD 2YPVL 4KI5E 3UYOD 5EOCL 1ULVA 3LD8C 3MODH 5B4MD 5F9OH 2BSRB 3KLLA 4JJHA 3EYSH 4L3EA 3DO7A 5E4OA 1P7HL 3T4YB 1URZA 2H32A 4WTXA 2D73A 4EBQH 1A6VH 1DJGA 5GJTH 1HCZA 3FOLB 3OBAA 4CN1A 4NO5A 2VZOA 1E90A 3ARGC 4UAHA 4YXKH 4KJWD 3F7PC 3ZKND 4AZ8A 4L29A 5EH1A 1SXAA 1XF2A 5DS1A 3WGVB 4KVCL 1GYWA 1UADC 2RB8A 3TBYB 2K1MA 4QAWA 3PUCA 3RIAK 3IU3B 5CZKA 1SFHA 3GIVA 1RV6X 1DFBH 2BC4A 2GYSA 5I18L 5I2IB 4OGZA 3FF7A 1CF1A 2JXMA 4L8SC 4TULL 3KPSE 5CCKL 3NCCB 4NZRH 2DEWX 3DK2A 4GMTL 3O3BB 1D5XA 3ZHKA 1E65A 2BNUA 2W80C 1KLFA 3DDFA 5HY9A 1JZ6A 1CDIA 2FHBA 2Y25A 4R4FL 1MFEH 1OLZA 3MC0A 1BHGA 4AIXA 4J3BA 4AQ1C 1TEGA 4Z7OB 2VO5A 2FQDA 4UDUB 4J3OD 1A1OA 3EKCA 3PHAA 2UZXB 3V4UH 3WFEL 4L4VE 1N7ML 1CBJA 3GHPA 2W0PA 4OD3L 5FM5M 1P4IL 5BJTB 1A6AB 3SDDB 1QRNB 2QPEB 1T1WB 3OLIA 3PNRB 3FH5A 5EIIG 2WP3T 3LKOA 2GJPA 5AALA 5T1MA 5K69A 4X2UA 3DJTA 1X7TA 3A6BL 3HPLB 3PP4L 1VFAB 1FG2B 3EJRA 3GSWA 4LU5L 4POZC 1BVNT 4JS7A 4X5XA 4X98A 3NZSA 1FE8H 4MMZC 4Z7NB 5HXMA 4APQC 2DQHH 5EPMB 2DH3A 2YGOA 3QORA 1QI3A 3LHPH 3TU6A 1OP9A 3B6SA 2HJKA 4QHKJ 1SQMA 4GIAA 1R3IH 1QBAA 4MNQD 5LO7A 1I7RA 4KITB 2Y5QA 3UBGA 2X05A 2PCYA 3IDIB 3LKPB 1JF5A 4PP1D 1YSOA 1EDQA 1QMUA 2HPTA 1DQJB 4HULB 1PZ5B 4MJHA 1A8JH 3NZHH 3UJIH 2WO2B 3BH8B 1BQ5A 3FU5A 5AG9A 4N2BA 2Y5TA 4G6JL 2NXZB 4GW5B 4YDZA 3FF8A 3Q8FA 4EIBA 4BKSC 1DJXA 3D9AH 3CFEB 2BOBA 4OCMC 2OMUB 5CU5A 4EOWH 1C8PA 4G9FB 3RKDC 1FL3B 1PF3A 5EZLB 1J0YA 1FUNA 4NZDA 1E6OL 2L7JA 3NEOA 4WFHE 5KS9B 1C16A 2OTUA 1MCWW 5CD3B 4X50A 1UQSA 4G7QB 2WWOA 3CC5A 2UVFA 1KT2B 2RAMA 3V5KA 4NXKA 1ZT4B 3R8BB 5I74B 1UXSB 1HS6A 1XIWC 2FX7H 1MFCH 3CJJA 4PP2B 5BO0D 2H5UA 4PRAB 3OWRA 5A40E 2ZOKB 4DUWA 2IPKB 3L3JB 5D9SB 2NY2B 1WRFA 2EDNA 1F3DJ 2BP5M 3RAJL 1UOLA 2XWBA 4OLZH 3HRZA 3BKYL 1QFUH 3FU6A 4L3FA 4RRPM 2ZXGA 2X42A 5C0IA 2L7UA 4AWJC 3EFFA 4YE4H 5AVWB 4I9WD 3QQNA 1E7UA 2QR0A 1BPLB 1JXFA 1BFTA 3DVGB 4Y9GA 3ZDXF 2DJMA 1AQDA 2P80D 1U2YA 4JAMA 4EZKA 1T4KB 4AIZA 4E2OA 2Z8SA 2UXGA 2J5LC 2BIQA 1CFSA 2FEDC 2E74C 4R3SB 3UMTA 1MQKH 2GUYA 2QV2A 3CFKA 4K9EL 1PLGL 3SDYH 4Y1SA 3BAIA 3LZOA 5A7BA 3ZHFA 3E80A 3MLWH 3O2DA 4FADA 3AWGA 1QWHA 2E0PA 1JWMA 5BZZA 2OP4L 4GRWF 3VNYA 3O4OC 2ERJB 5ESVB 3ZJAA 1CVRA 2KPNA 2L04A 1OHQA 3FXIC 5EBWB 3VYNA 3RE0A 3ZIMA 1J8RA 3KYOB 4M48L 4TNEA 4H5SB 3OG4B 4YLBA 5IUSA 1WDAA 3VXSE 2NLJB 1IZJA 4AYDC 4U1LA 1T5XA 5GS0C 1W8OA 4KKLD 2G9KA 1UWEH 4HF5H 3BP4A 1F3DH 3WIHH 4Z3FA 1JZ2A 5ES4B 3E6FB 3QEHB 1B0RB 1FH5L 3WEOA 4OLEA 2YAPA 1YEEH 1J8HA 2XOTA 4X6FB 4IOIB 1H3PH 3TT3L 4BHUA 3CSPA 3FFCB 4DP7X 1MCIA 5C0BE 4S1DD 1H8OA 1SXNA 4TUKL 3CFDA 3BUQA 5EZIH 1A9VA 2A9CA 4OCXL 3QJQB 3ISWA 1CE6B 4X5QA 4XP1H 5I9QB 3NJJA 3OMIB 3MLZL 2CUMA 3EGXB 4GG8B 1Z1WA 3U2IA 4P46D 3V52L 5ERWB 1J1OH 4HUCA 3ZDWA 3VCLB 3IDXH 4EQ3A 2VSKB 4JGNA 4JN2A 4W70A 5C0RH 4ICXA 3P0YL 2VDQL 4PJAB 3MRMA 2FNWA 5JLZA 3ABMB 1HL5A 4Z7OE 4MJ5B 1AR2A 1OGTA 1DL7H 1UVQA 1JPEA 4OQTL 2JCCB 2BP0B 4LLAA 1QRNE 1XB3A 1C12A 1JV5A 1CLCA 2EC9T 4LASL 1MW0A 2CH8A 2QGDA 1EO5A 5B21A 3GUFA 1YMMB 3G04B 2X0WA 1KB5H 2A9ML 3VFVA 5MEND 1BF5A 3GIZL 1MIEL 2QTVA 2L7QA 1RUPL 4FE9A 4IKNA 1U4EA 5AOLA 4Z7NE 4JGMA 2FUQA 2X89A 2H26A 3QW9A 3WL9B 5SWQB 2JIXD 3ASWA 1O6SB 1KJ2A 2GK0A 2HZHA 2L7EA 1SEBA 1KZQA 3B7RL 2NNAA 3ZE1B 4WI8A 1RZJC 5D1XC 1I7TA 2AK4B 3W39A 4CSSA 5DQ9B 3RY6A 3TIEB 3ABLB 4N0FA 5LVEA 3KR3L 4N9OB 5MP6L 4FG4A 5EU3A 4AC4A 5K9KB 2JKTM 3RX7A 3IB4A 3MUZ1 3QUML 3IVKB 1AP2B 3ZDYF 3DPDA 4HUUA 1KLGB 5A6LA 2CHNA 3BWAB 3ULUF 2EEXA 4MB1A 4DK3A 4Y4FA 1XWVA 3ZL2A 3ZT7A 1T03H 3GSQB 2FSEA 3G08B 4IBSA 4PY8I 3WS3A 2XN9B 5TE6H 1CGXA 1NCAL 4TVPD 2YHGA 2DYPB 3P73B 1BZ8A 4FQQA 4G80B 3T2NL 1KJVB 1CGUA 4YUEH 1NGZB 5KS9E 4P3WA 1DBKH 4JFEA 1X9QA 3MUY1 3OR7B 3X1NA 3KLHD 5J7CC 2Z31C 3KVPA 1P53A 3GSOA 2OI9C 4U4IA 3EYFB 2DIBA 2G0LA 3GXFA 3ZIYA 5DSCA 2OJ1A 2RBLA 2IFFL 3CMGA 4A37A 1A47A 1W72H 1F1GA 2QPDB 3MRHB 4CN6A 5K5YA 1YUHB 2CO4A 3SDCD 1J0JA 2XG4A 3BP6B 4HIIB 3SQOH 3NPZB 2QELA 1CYXA 4QOKE 1DQTA 4G6KL 2XT1B 4WF7A 1YQVH 2CNYA 1AH1A 3MU3A 5CILH 3JQOB 3GNML 3PIQB 3PQYB 3WIFB 2F8OA 1NFIA 1ZHLB 4L1SA 2XZCL 3L08A 1V7ML 3GSVA 3DX7B 4PJGF 4M7LL 4YBLC 3TWCL 2JH2A 4N24A 4DCQB 2V33A 3MJ8B 5HHOA 5TGBA 1DQML 2D03H 4YEFA 5FHAH 4X4KA 5BV7L 1K8IB 4GT7A 2OL3A 3P9LA 3TEXA 3LZFH 3K6DA 4M3JA 5CJ5A 4KV5F 2YUXA 5FO2A 5E08L 2OSXA 3OX8A 1AZVA 2FL5A 2YBGA 3HPJA 2QADC 5E8OA 2GHZA 2WNGA 3KGSA 4MGXA 3HIZA 1BZ9B 1FFNB 1QFOA 2CCVA 5AKRA 1ADQH 2NUPB 1I3VA 4HZLA 1U8MA 1E0OB 5ICUA 5EO9B 2Y1ZA 3SPVA 5F7WC 2VXQH 1OCWL 2ZSVB 1NICA 2WD0A 4LEOA 4AEIH 4ENEC 4P4RB 1YEHH 3VWKA 2YPLB 4KNUA 2Q8AH 3SIKA 5IHUH 2O6EA 1F45A 2KMWA 5D7KD 3V55A 4CSPA 4CW1A 1AI1L 2BNRD 3L2LA 4P23B 4CBZA 2EXWD 4J3WA 1RERA 1UJTA 3MXVH 4HS8H 3SGKA 3ARFD 1NMCC 1FFTB 5I8OH 1D6VH 2VJ8A 1BM3L 1P9MC 5C6WH 5I6KA 2PYED 1N12A 2Z8VC 1NH6A 5J1AA 1EJ8A 2HJLB 3UROR 4Q52A 5IR1B 4FLSA 1XF3A 3MUUA 4KK5C 2VRAA 2VZTA 3CBJB 4JEGB 3L13A 3KLAB 4G1MA 4YDLB 3CH8A 3MI6A 3A4FA 4PJXA 3VI4F 2XZAH 5E6ID 1ZD6A 2QKIC 4W6XB 1JUFA 1CZ8H 3FPXA 3WHE0 2OSLB 4LP4A 2VR8A 1Y6MR 1FNSH 4HJ0C 1DBBH 2NY4C 4BSWA 4ODXA 1TZGL 1BD2A 4MDIB 3FT2A 1IGYB 1S7TA 1RJYA 1MFDH 1RLBA 4Z7UB 4PRIA 2FGWL 4XN8A 1B0WA 2BVQA 2FR4A 1EEYA 5FUZH 3MR9B 1N2RA 2PCPA 4F3FB 3AABA 4MBRA 3F6IA 1JGUL 2FX9H 5E6ZA 4DF9A 5I71B 4L1LA 5I0WA 3N5AA 1MHCA 1AHWA 4LO9A 1QD0A 5B3JF 3DVNB 4MQTB 2JCCE 4JFXA 5IG7B 3IFPA 4WUUB 2PP9A 5G5DA 2PCFB 1SEQH 1U6AL 3EDFA 3SJVA 2R4RL 5F0LB 4NUGH 5L2KB 2Z35B 3ATAA 4WU7B 3K71B 2JLPA 4IBLT 3B7UX 5IK3A 3HNTH 1AQMA 1I9EA 5KJ4A 3VXTA 2QGCA 3P4LA 4QGTA 1G84A 1WGOA 3U48A 3VSQA 4I5BA 4XH2B 2J6EL 3L45A 1XTLA 4PBWD 3AXLA 1HL9A 5ICYA 4N0CC 2D7QA 5H37A 1G6RL 2A6KA 1Y6NR 1IAKA 3REWB 3OJ2C 1AD0A 2O5XH 3ELAT 2AQ2A 4XCYB 5AYTA 1OKEA 3MLSH 3NFPA 2Q5BA 2V5RA 4ABQA 1FGNH 3JVGC 4XVOA 2P80A 4AMKL 1TJGH 2FWOA 2NY1D 1BWWA 2EDLA 3E38A 3NN8A 4K07A 1KTBA 3WXVH 5JPMC 4GFXA 1S7XB 1K2DA 3BSHA 1JDDA 5F7EL 1J86A 4RAUB 3I2CL 2VZUA 4ERSL 1BFOB 2PO6A 3SGDI 4E41B 3SYQA 4RFEB 5CP7B 4G6MH 4U1GB 5E5MB 1PW3A 3ECQA 3DSNB 1JPFB 1YEKH 2DS4A 5C0JA 3CFJA 3NA9H 1T7VA 2HH0H 1A0QH 3BT2L 2WLJA 4I3RH 2D7NA 4FJZA 4FJ6A 2QBWA 3VXRE 3V4VH 4HLEA 2RGSA 1AC0A 3HNVL 4HOXA 2Y4SA 2GTZA 3PXHA 2DKSA 1D5ZA 1WFMA 2Z4QA 4XO5A 4M02A 1UXMA 4X6BB 3UTQA 3INOA 4HJIA 5AW6B 4ZJ9A 4FA8A 1TLMA 1QFHA 2C9UA 2VYRE 3TXAA 3KEDA 1XMEB 3X3FH 2YLHA 5AZEH 4RA3A 3QARA 4FULA 4XP6L 1I8MB 2DRUA 3O3AB 4XVTL 3FAWA 2XXGA 3HN5A 4JHZA 5GGSY 3LN9A 4KK6C 4IS6B 1OAUH 2RA1A 3PQYE 4KZDH 3L1FA 1VKXB 3CZNA 3LSOA 2RFXA 2XJKA 3I02B 4KJYA 1WBYA 2CKBH 1YPZA 2P8MB 3D3VA 4QKXB 2ZIDA 3FTGA 4HCRL 3BXNB 2A4ZA 1FL6B 3GSNB 4OKDA 1EAJA 3KLKA 1JGVH 1NIEA 3FT4A 3GBEA 2WKLA 4PJHE 1K9TA 2EVJA 5HYQB 6FABL 1CYGA 4CJ1A 4JK0D 4L8CA 5I8EB 1MAKA 1CXLA 3I50H 1LEGB 3ZMNA 4MCYB 4DVBB 3ETBF 1NCWH 2X4UB 4Z0BL 1MZYA 4XRCA 3FRUA 1T3FB 4YFEA 3AGVA 3QEGL 3QUXB 4NCC2 5C3LD 1W8NA 2X9XA 5SX4H 2D7TL 2W0FA 4FEMA 1YDPB 3E6HB 4PRNB 1U8QB 1D5BA 4C56D 5F88A 4AG4H 2AXHA 1AOZA 5EDSA 1I3RB 2MHAA 3F7RA 3IJSB 3E8UH 2YSSB 3QNYB 4PBDA 1OTSD 2YPLE 3EYVA 4LSPH 3W82A 3DGCR 5E6UB 1LE5B 2YARA 3AT0A 4Y4KA 4M03A 1A1MA 1E5ZA 5IF0B 3BWUF 3ES6B 3SYCA 4UM9B 2A73B 2X0VA 1LK3L 3OQ3B 3GMNB 3RVUC 3TURA 4L8SB 3AU1B 5F1KC 5IESL 3SODB 1MVYA 4JDTL 2ZF8A 3STLB 1S7VB 2A9NH 3T3MF 2J6WA 5CAYB 4G3YH 3D18B 2VRKA 4JRYB 3QULB 2X70B 2GCYA 5IVXB 2ZUXA 4JO3L 4B5ZA 3QPXH 3UFIA 4F57H 4L4TD 3FQUA 4ODUB 2WUCL 5AW0B 2EXTA 1RUQH 1Q9LA 5FHBH 2C3VA 2IIJA 4DH2A 3D7PA 2B2XH 1JZ4A 3JBG7 4PJ6A 1RIVH 4PS7A 1D5RA 3CVDA 3IFLH 3TTSA 1G9MH 5EOTB 1JL8A 2GW5A 2HKHH 2ZCKH 1MAML 1PU0A 3LAFA 3OG6B 4HXAL 4PU2A 3U46A 5DQDH 5FLUA 3BFOA 4LNRB 4S2SB 4F9LA 4J39A 3CLEH 5AAWA 3DX3A 4UV7H 1KWGA 1OF0A 3KL5A 3S37X 4BFRA 3OZ9L 2AMGA 4ZMPA 2JKJA 4V33A 4NUJB 4XBEH 4D8PB 4OM1L 4QRUA 2JKSA 4BCXA 1CICC 4HGMA 3TEYA 4WUUE 3GMRB 2IG2L 3NTCH 3MKKA 1OHZA 4Y9EA 3MFFB 3MGAA 5CZXC 5DJAB 1OP5H 4O58L 3VDCA 4K7PX 4NC1C 1BXUA 3FT0A 3BPLC 3EOBB 4GW1B 1ROWA 3D2UD 4XBGA 3ZE0F 5KYWB 5FYLH 5T5FA 1LHZA 3W3BA 2VXUL 4OF3A 1F6AB 2IAND 3QZPA 4JL1A 4YHNB 4D0DA 4JFDD 2X4QB 4WAFA 2C3WA 3CVHA 3F00A 1SXCA 3FU7B 2OZ4H 1F4XH 4IIQB 3ECUA 2VDLH 4CMMA 1CN4A 1UD3A 2H6OA 2ZKHL 4C83A 4G42A 3NIFE 2ATKA 4WK0B 2ZUWA 4XVJL 4FXKB 3MACH 5DJYB 1FLRH 5GGTL 5HHMD 2F53D 4IGBD 3P3SA 2VMJA 4EI5B 3BD3A 1QBML 3FU8A 1MFBH 3F5WB 5EBMA 1YLBB 2E9BA 4G7RB 1SVZA 5D2LA 3H9SA 4B5EA 2WWNA 5E9DA 1JK9B 3KLQA 1CD9B 2GJZB 3EBGA 5AKVA 3PL6C 4DKEL 3L1EA 1ZVNA 1FNGA 1P4UA 2F61A 4E41E 1RHHA 5KSBE 1BZ7B 5EEYA 1OM9A 4LRIC 5JYMA 3AY2A 5B1BB 1F8TH 3IJHA 5F93C 4BA8A 3KVQA 5EORL 1G7PB 2YD8A 3DYMA 4E42A 1WF5A 1K8DA 5T1LB 3VFOA 5D4HA 3MRJA 1I8LC 2BNRA 3QO0B 4Z8FL 1IL1A 4JPQA 4XNXH 4NZUH 5LDUA 2DWEB 1GW6A 2FQFA 4MQXC 25C8H 4R4NC 4DKAA 5EFIB 3DOSB 1BEXA 2VR5A 4H20H 4BK5A 2Y07L 4PB9L 2CAKA 2WWMD 2UZIL 2XPYA 4HKZB 3WMSA 5LKNA 3P0VH 4FJYA 3CFUA 4EAEA 3ILPB 4B0MB 4O2CA 4Z3EA 1JPGA 3BP5A 3KPSA 1MWAB 1P4BL 5IB1B 5GS2H 4HHAA 4PJ5D 5JHAA 4FABL 5A1AA 4NPYB 2AJYL 4LLDA 3D8MA 1XCXA 1TTCA 1BYOA 1MG2C 3L3GA 4U7SA 2I9LB 1NA8A 3PF2A 4P2RE 2H6PB 4WI4A 3O4OB 3ARSA 3FCSB 2QQKL 5L8KB 3B9KC 3O2WH 2QHRL 1VZGA 3H0TB 1S5HB 2FATH 5DD5L 4R7VA 3QEUB 2YZ1A 3Q5TA 5KBMA 1U3HC 3L4ZA 3PGDA 3W9EB 2AF2A 2J72A 2WLIA 4NRZB 4G7VH 4B9PA 1HQ4A 4JLRA 2Y6TE 4WSGA 5I6LA 3N44F 3LXCA 4KY1H 1AIFB 1U93B 3VU1A 3WD5L 1ZK5A 4TNWK 1L9QA 2F0CA 2YRPA 5F9WC 4R2GB 5CJ8A 2VSMB 5KUKA 2XHNA 2OYPA 3VB9A 4TVPL 4AUJA 3QDJD 5DHXB 3SY0B 4KWUA 1D7FA 1ZPUA 3ALWA 4HC1A 5CU9A 3W9DB 2AEQH 5CO1A 3KNBA 4NUQA 3QJFB 3VMNA 5KVFE 5B8CC 3MO1A 4FQPA 3KS0J 1WISA 1PSKL 4L5FL 1BYNA 4I48A 3AREA 3Q48A 1UM6H 5DO8A 1O9WA 3MLYL 4W93A 3PXJA 5C0CB 1HOEA 3N42F 2IH3A 5T5FL 2NUTB 4YHYC 5FK9B 3VG9C 4GG6F 4Q9BA 4OCWH 2ZWSA 3LQMA 4WK4B 1INEH 1ZTMA 3I75B 4PRHE 4JO1H 4JRYE 2H45A 1WZ1H 1DVYA 3F2LA 1KCBA 3QIUD 4KTDL 2CLZB 3TONA 2BP3A 1AG6A 1YMHB 3L95B 1LP9F 1LWRA 1D5IH 2VDML 1RULL 4YL4A 1BIIB 3J8F7 2VDKL 4MA3A 4LOFA 3QIBB 1HQRB 4O02A 5ILTH 3MLXH 5HGHA 1OGAD 4YSTA 2XQ0A 4U6YA 1C08A 2YK1H 3MPCA 3VRJA 5CGTA 3IGUA 3F04A 3KAAA 4Y16D 5HDWA 1BIHA 4A6YL 5B1CA 4JM2B 1ZVSA 2AJZB 3VXOB 1ZIBA 1INDH 2ENPA 5KWYC 1DR9A 3OHXC 5MEOB 3SKJL 2IBZY 2ADFL 1BLIA 1XZ0B 4KGLA 1YEGL 3MGOB 2BS71 4FQHB 4ZDHA 2VITB 2AXGB 2OR9L 4FHJA 2YXVA 1XGTB 4PEEA 2R0WL 2UX7A 2XTJD 3N9GL 2Y06H 5L4MA 5CGBA 1KV7A 2ILLA 4K7PY 4OQ1A 4I77L 4P5TC 3K74B 2FHFA 5GSRA 4DJMA 5D70L 4YSQA 4FYSA 3TYGL 5EC1A 3Q2LA 4MCZB 4PJBB 2Z1KA 5IUCA 4UTBL 3CZFA 5DURB 3HLAB 4DGVL 1IBGL 1U91B 3IFNH 3NAAL 4EIUA 1WC7B 3MX0A 3DURA 3L8QA 1HZKA 1P5VB 5DLML 4IBQA 3QNZB 2ATPA 4K3EH 4IRSB 3T1WA 5JORB 1ZWIB 4BFKA 3U7YL 2ED8A 1Z3GH 2HTKD 1PZDA 3WNMA 4R8WL 1L7TL 2NMSA 1JXGA 1S5IH 4FN0A 3T0EC 2ROXA 1GR7A 4WI0B 2W9DL 1TDQA 3QUZC 4BFIA 5B3NA 1L9PA 4QRQA 1MLBA 4YBHA 1TQCB 3LS4L 4YC2B 1JV2A 5J3HD 4QNPF 5DFWH 1A3ZA 3C60A 4FQJH 4R90L 4UV4H 5DZAA 3O3DB 2EEDA 1DN2A 4U3HA 4JQIA 3ZRSA 4JL2A 2Y7QA 1F6FB 5EU6D 4X9BA 1ZEAL 4XPAH 1IM3A 1FIEA 3CDZA 4KHXL 1UUSA 2NX5A 2YEVB 3DMMB 3CZSA 3PS6A 4YMPA 4U3CA 1ZLVH 4XCCH 2V7NB 2F8IA 3EYUH 4H8WL 5E1AA 1NL0H 3FTWA 4LDLB 3QUYC 5JXEA 5C0BA 3CGTA 4N2DA 3CVIL 3K4DA 4E9QA 3MJ7A 4LAJH 5I17A 3QDGE 2UZYB 1PPIA 1ZT7A 1JZIA 3SO3C 4HALA 3NIDB 3T4AC 1XSIA 2OJEB 3BUYA 5ISZB 1O6TA 2WLHA 3MA7B 5I6MA 4NQVB 2HVKA 3EOAB 3UTZB 2RJMA 2DLEA 4JN1L 1H3GA 2I9TA 3NCEB 3BZ4B 4QDGA 1J0KA 4TLUA 3WY3A 4YSAA 3B3IB 3VI3B 1FBIH 1CXFA 3ULVH 3TBCA 2BIMA 4XZ4A 4FFZH 4O5LL 5HDQH 4HGKC 2D2CC 5ESQA 1NBYB 4KXZH 4FFVC 1E42A 2A6IB 1IQWH 3MKGA 2NR6D 5KYUA 5ADOL 2ED7A 4XI5C 3EHBB 1A7OL 3H56A 1FRGH 4IKKA 2BX5A 4L9LC 2QGEA 5GRXG 4X5RA 1BREA 1N6VA 4NRYB 4Q9RH 1NGXA 5E2UH 5IJVA 5JXAL 5AL0A 3M1CA 1XGQA 1CK0L 3WJJA 1IEBA 2OMVA 5C0GA 2XTLA 4R0LA 3MNZA 4B9FA 4OI9A 4F93B 3N1FC 3QS3A 3Q6GH 2VCOA 3JXAA 5EO0A 1XXDC 1R3LA 4ORZC 3TN0C 5I6NA 2LOEA 5EU7C 3OJMB 2E6JA 2H1LM 3BVTA 4IBTA 5I8CB 3FQ1A 1PCXA 3WTTA 1HHKB 2XG5B 5IMLA 1XO8A 4UZSA 3WEXA 1N26A 1IGJA 1KIRB 3FTYA 4LGRB 4JNXA 1KLUB 3IRPX 5ESAB 5ID1A 1VDGA 1LEIB 2OX5B 1T1ZB 5IIEB 3RGVB 1NFDA 2ZX6A 1HJCA 2VLKA 2LTQB 1CLOL 2IEPA 3ULUD 3IDUA 1PG7L 3DX9A 4JCLA 1TCRB 3ZRCC 1M2OA 2P24B 3IJEA 5C0CE 4HOWA 2IXQB 4GXUN 2EDKA 4H40A 2ICWB 1JZJA 4MD5A 3LNHA 3K4ZA 2G3MA 3D0VA 3ISYA 1KYUA 3O9WC 3TVMA 5JQ6H 5IEKA 1H0DB 3UZEA 1JGEA 3BQUD 3WBDA 3O3EA 4J6RH 4PRDB 4GEJA 1VEMA 4P07A 4PJCA 1LMKA 5LGJA 5CMAB 1TFPA 1ZGLM 2P1YA 4OLWL 5EUOE 1A66A 1HYSD 5KVEH 2CLRB 2ZNXA 4FQXD 4H1LA 2ZG3A 3LQAL 1U8JA 1VADB 4BRJA 2Y3NA 4ATWA 4ZQTA 1OAXL 2CK0L 2XTSA 3HE7B 2PLTA 1LL1A 1RZ8B 4JDZA 3L3DA 3QWQB 4FTVB 3EOYG 3MXWL 4JFYB 4GQRA 4OZHA 4BQ9A 2ZUUA 4PJ9B 1F2QA 4MDJB 2I07A 4MKMA 3SN6N 3MV8B 2G5UA 1UJ3C 2D7MA 4QT5A 3OC8A 4V2BA 3FQTA 1SXZA 4ZX4A 3IXTB 3VFWA 3FSAA 4LGPB 2YGVA 3CK0H 5D1XE 4HUVB 4P2OC 4ODVH 1DUZA 4EN3B 3PWPB 2ADJB 4PJBE 4PWHA 3C6LD 4EDWH 3GSXB 5TK2A 5E2TH 2AK1H 4YDVA 4BKLA 2LAGB 1QLEL 2AV7A 4LOEA 3BEWA 3LN4B 4F7EB 5HYJB 3WFBL 1OAJA 1D9KA 1OT1A 1XGUA 1QSEE 2LU7A 3IPBA 1CXEA 4NZTH 4WTZG 3X17A 4LMQE 2Y7MA 3CLFL 5LJYH 1AOHA 4R26L 3PWNB 4Y2DB 2FT7A 4IK6A 5JR1L 4DERA 3US9A 4KK9C 1NAMH 3WNNA 5C8JB 2VDOH 2IAMC 1IQDA 3MV7D 3OM3B 5E0QA 1F41A 2HG0A 3S34L 5HGBA 1HI6B 3ZTJH 3PABA 3D12B 3RVVD 4Y5VA 3VQMA 4N2OA 4GRLB 4P4KB 4N85A 4OLYH 5DJ2A 4ZQKB 4HBCL 1NCIA 2KC0A 3RJQB 3L3HA 1OQOA 1SXBA 2NNCA 4HDIB 4G8FB 1ZPLA 1YNLH 2VMCA 3A4AA 3MHZA 3WKML 4AL8H 4EXPX 2R2BB 3QHZL 4QRSA 5FA3B 1B4RA 3L5WB 5ICXB 3UJTH 3I6GA 1TYJA 4F7PA 4TXVB 1PKQB 2V5YA 3NSJA 1EBPA 2R1WB 5EZJB 2CR6A 1MHHA 5C71A 4JB9L 1M6OB 4LEBA 1FH2A 5DVNA 1TQVA 4KO7A 5KAQG 4LSVL 4OFIA 2Q7YB 3QA3A 4NKDB 2X6UA 2YMXL 4RGNC 4Y5YA 2OTWB 3HG5A 1KN2H 1OK0A 2FYVA 1IE4A 1XF4A 2V0AA 1THCA 5IW1A 4QLRA 4N8VA 1DANU 1FN4A 3HC4L 4K71B 5HI4C 3EH3B 1CU4L 2HB0A 3F85A 2ID5A 1OSZB 2WIIB 1QZ1A 4FFYL 4LLMB 3NRQA 4M00A 4M1DL 3HTLX 3D39B 2GSMB 2P42B 3DSFL 4KVCH 4WKZA 1MCFA 1OW0A 5FV2A 5GZNA 1QLFB 4HIPA 2Q3XA 1CPUA 3BSGA 4HLZH 2X7LA 3CHQA 1AYRA 4LQFH 4OCNC 5HGAB 2WTRB 4HV8A 3ZXAC 5I18H 1LO3H 5I6OA 2ZX7A 5C0NC 4HIHB 4O2FB 2IQ9H 4QLWA 3VI3E 3CU1A 3SHSA 4LPVA 3QCVL 1E4JA 4ZO9A 5HHNA 2QKSA 5BQ7B 3NCYP 2ESVE 2HT4C 4AH2B 3L7EB 4UIMA 4OU3A 1LDSA 1CTNA 1DVFD 3H6AA 5JHDD 2R4SL 5AQ0A 3P77A 2YXFA 1Q72L 3MRQA 4RISL 3WFEH 1TPXC 2V17L 3MUGA 4JG1L 1N7MH 3UZQA 3S4SA 2IOIA 4ZXBA 2PABA 4OD3H 2JE8A 3MUHL 2HX7A 4XAKD 2G3NA 3DHUA 3FB8B 1UWXH 2FX8L 3EH4B 3FSOA 3VFUB 2DQTL 2EAEA 4YDIL 2J8UB 4M3KB 4ZPVB 4M62L 3V4PA 2X4OB 2EZ0D 1OANA 3PP4H 4P57B 1SY6A 4ODHL 2X1PA 4L48A 1YZZA 3U4BL 4HWBH 3KWWB 4CADA 1S7WB 3HS9A 3VH8B 4Z7NF 4Z7IA 1NQBA 5T3ZD 3RWJA 5IT2H 5F8QC 1THAA 1JZFA 5BW7C 3MRGB 3ALXA 3L16A 2EDOA 3G6JA 5AVZB 1ZMYA 2FO4B 2NYZA 3QWOA 3H9HB 3TH4T 5J5EA 4Q4EA 3DIDA 2Q10A 3BHBB 1OT4A 1FV1B 5C70A 3G5YA 1IM9B 3T6VA 5HHVH 2BS8A 3AG1B 5M7QA 3K46A 4G6JH 2WM0A 2L8AA 2WNWA 3RBSA 3RVXC 2HMID 2HFFB 2YD2A 5K39A 4XZUA 5FM4A 5HP5A 4YR6B 2VLRA 1KB5B 4NM4H 2BFVL 1I82A 3RQ3A 1JYXA 1RURH 1R0AL 3IS0X 1XCQB 3AMLA 4N2KA 5KVMC 3IF1A 4IJ3C 3HLKA 4EI0A 1X5XA 4ZS6D 5E70A 4APQD 1GGUA 3NG5A 1Q9WB 4BE6A 2NSXA 3VXRA 2FWSA 3LYRA 3VQ1C 3QQ3B 1DCEA 1PNDA 3QR0A 3LNEA 4FTVE 4YHMH 2QQLH 3IMSA 3RFZB 3LRGA 3PNWB 3PXLA 1P7QD 4XCEA 4B7LA 4JFSA 3SBRA 4KBPA 1ITCA 2L4OA 1QFWI 3C8KA 1HTYA 2YAQA 1F4YH 2BNQA 4RMQA 2DWSA 3QCUL 2W9EL 3OKMB 3PP3K 5GGRA 5I26A 1QUNA 1E28A 3PWPE 2EIKB 3ULSB 4F8NA 3OJDA 4WVRA 1ZTXH 4OFYD 4OIAA 3L3IA 2H32H 4MLSA 2CGZA 3PDDA 3Q5YA 5L6YL 5CBAB 4OF7A 1CTOA 1FVCB 4HAGA 5EA0L 4WWKB 5GGQL 3VYOA 5HYJE 2VC2L 3L5IA 3FYEB 4LHUB 1RZGA 3QIWD 1PQZB 2WCSA 3HC2A 4PJHA 2DLHA 5C7XH 1HXMA 3OKNB 5SWSB 5E8PA 5HBBA 1WFJA 1VFBA 5FAAA 2WAHA 3HHRB 4UT6A 1A7RL 1FJ1B 1ML0A 2VQTA 1OAKL 1RZKL 4MJ2A 1UXWB 4JFOB 5DK2A 5IJKA 1G7HB 2BHUA 2G60H 4Y4HB 1W72B 4Z9KB 4JY6B 1A65A 3NSXA 2MQ3A 1F4AA 4MSWA 2PETA 2HYMA 3BW9B 1TMCB 2OP4H 1KTDA 3T2QA 3RBGA 3JT0A 4NZJA 2AQ3A 3L2MA 3I9GH 2VDNL 5D71L 4NNXA 1XD0A 3IDMB 2QLVB 3WIIH 4U6TA 4TSBH 4UQBA 3FO2B 4FNLH 2VLME 4G71B 4NDMB 3EXJA 4ONGH 1CIUA 3H8NA 3QXDA 4XC3H 5F7KC 3MRDA 2EUZA 1AQKL 4KKBD 1SYSA 3RPIA 2WXJA 3FU3A 3QXWA 3BSZA 5CP3A 1W80A 3RDJA 4KDWA 1WJ3A 1R3KB 4EZJA 3TT3H 4UDTA 4UQ2A 3BWSA 3O8XB 1DVUA 5J9PA 5F9JA 5B1AB 3VH8G 4DN3H 1CDCA 3LEVH 5IY5B 4J3TA 7PAZA 3KWUA 5CIPA 1PG7X 1I7ZB 5FF6B 3PV7A 4X6CB 4MAYB 4HAFA 3DGGB 3D39E 2MQCA 3TA3C 4G83A 1R5VA 2P8PA 3RIAF 1F58L 3BN9C 1ZGLP 4K5NA 4WO4B 3CUPA 3TIDA 2ZOTA 1ACYL 4QXVA 4R7LA 4HPYH 2XNAB 5FA4B 3V52H 1Z0NA 2PUQT 5AVTB 4JO5A 3BQUA 1G7MA 3ERXA 2YWZA 3IK2A 1INQA 1G1OA 1HEHC 4JFFA 1A3QA 4HWZB 3R1GL 4X8GA 5AB1A 1MDTA 3P0YH 2EYSA 4PJAF 2WINB 4JPIB 3S5LB 3FK3A 4APXB 1AO7E 5I75C 4QEGA 4FQCL 1AMXA 3TO4C 4I0PB 4PJ7B 4WKXA 1OAZH 1U8IA 1Y0LB 3KHQA 1AKJB 3W0WB 5E5LA 3WLBA 4LKXB 2JCCF 1DN0B 1PY4A 4XNQB 1MCCA 3O6ML 3UYPB 1X5GA 3N04A 4K3DH 3RWCB 4HXBH 4R7DA 2AI0L 1L4IA 2J8UE 4LASH 5AVQB 3GZPA 4LRNL 1Y18B 1GIGH 1Q94A 1UH2A 4HJUA 5IGXH 3HE6A 2A9MH 3Q8BA 3GIZH 5HYFA 5F89B 3ZVVA 3VG9B 2EYRB 3TFKC 4DPRA 4UCFA 4ZX3A 4P5SA 1E5BA 4PJ8A 5I24A 1O75A 3W11D 3ZE1F 1ZJAA 5DRNB 4ZAKA 5IFJA 1QHPA 1CFNB 1W8EA 2VXTL 3D05A 3DV4B 4RETB 3LEXA 5CEYB 4PTUA 3UJJL 4XMPH 1WFIA 3P9MA 4NHCL 2DF3A 5MP6H 2DBLL 3HG4A 5K9OA 4Z7VB 3MRPA 1QSZA 2R2CA 1EZSA 2NTFA 1HHHB 2VMEA 1FNAA 1Z9MA 4LHUG 5IP4A 3RWEA 5JO5A 2F08A 1MH5A 4GQPH 1CG9B 1BAWA 4I18A 4LHQB 1OP5K 4ZTOH 3VD0A 5KSVB 1A4BA 3QHFL 2ICEC 4A7SA 5KSBA 4WHDA 2DLFL 4XT1C 4MBOA 2OLDA 4F2MA 4PIRF 2WZPA 1T80A 3FONA 5I6XC 1NCAH 5C0EB 2SODB 3G7TA 2IPUK 3RX5A 2F74B 3O2DH 1J9QA 1DP0A 1UM5L 1BFSA 1ZGLB 3RA7H 3S37H 4CN4A 5FPIA 1G1YA 3MLVL 4XXDB 4NO0B 5B38B 3V8CA 4JZOB 2XZQH 2EIJB 3LIZL 5F7NC 2HWZL 4UF7C 2AXJA 4WI3A 2WP3O 4XPHL 1YAIA 1IT9L 1HL8A 2IFFH 1JDAA 3AAZB 2AMUA 3IDGA 3AROA 3OGCA 4K7PH 1L7IL 3KM1A 4LP5A 3VRIA 1P1ZA 5D7JC 4HHWA 1K4CB 3LH9A 3A4DA 5CHNB 4MCMA 3L6FA 1E5UI 1TZAA 1ZA6A 3GNMH 2HX9A 4QY8A 3T77A 4LCCB 1GL4B 3O6FD 1ZLWK 3HA0A 4E0RB 4P2RA 2QV4A 1T6WA 3PG2A 4FNQA 1A02N 3JUYA 4M7JH 5IBLC 3FO1B 1VFUA 3QQ4A 1UCTA 4PCYA 3UAJC 4Z78B 1IGFH 2PWDA 2PPCA 3O4LD 5HGDA 2WPGA 3V4VB 2VR3A 2XYBA 2D8KA 2IADA 4JM0A 5E7BA 1R24A 3PLYA 2VXVH 2ZXQA 1XAKA 2CIKA 4KH2A 5SWZD 3BZDA 3GTNA 5DK0B 5E99L 4XPTH 3D4YA 5EU5B 1VZIA 2J43A 1E8WA 5FV1L 1KTLA 2K8QA 1ACCA 4X99A 1QQDA 3QG6A 3S5LG 3ARGA 2PP7A 3ILQC 4NGHL 3AW5A 3S8WA 1TZIA 5HPMB 1OCWH 3UTSB 3SO3B 4Z7QB 4LVOB 1G94A 1K5WA 5LAPA 3OXRA 2CKBB 3Q3GA 5KYXA 2WBJB 1CWVA 1YJDL 3COOA 4G8GB 4GEIA 4IHBA 4WW2B 4R97C 5D1ZB 3T04D 1TCMA 1QOKA 5JHBA 4RNRB 4XC1L 1H3XA 1AXSB 3OV6A 4I87A 4PD4J 2EXYD 2KZWA 1BX2A 2EACA 3L48A 1JGLH 2YEZA 4HK3J 4M7KH 4UZGA 5FO9B 3II1A 5AD0A 4PRHA 3N40P 3H2QA 2CRMA 4KRPB 5F2FA 3RZCD 5C08B 3HZ3A 3KYAA 4AQ1A 4HH9B 4X6CE 1A3RH 5DVOA 3SBWC 3K2UL 2Z34A 1KJ2H 2ZOLA 5EOQH 5F7DB 2GUOB 1AC6A 4NAJA 1ROCA 5DXWA 3TZVD 3EFOB 1W15A 2ZUYA 3CXHJ 1OAQL 3WUWB 4P5RA 4RFNC 4UYPA 3AWEA 5L88H 1NUNB 5D2NB 2HLFC 3VFRA 1YN7B 5H2BA 4PLKD 3CPLA 4HUWB 4L37B 4LCVA 3WMPA 4HVBA 4KJPC 4Z7UF 3LMJH 4TUJA 1G7JA 3FSWA 3OMZA 4ZS7L 4LBEA 3QAZC 3OQRA 4K23L 4MMZA 3JV5A 4XMVA 3TN0B 3S2AA 4APQA 5BVJB 3AU0A 4PJ7E 2X2IA 4Z77B 3ARBB 1QEWB 1UH3A 2HRGA 3P4NA 2OK0H 4WV1B 5GGUA 1I1AB 2R29L 1ODAA 2DQGH 3CIQA 5KG9B 2IDSA 2R4RH 4Y7OC 4LARL 4XMZA 1JZ8A 5B38G 1BLNB 5HI5C 2A83B 3SDAD 3HN3A 4JJ5B 2AEPL 2J12B 4OV6F 2FWLB 4LNVA 2KS0A 5EUKB 5DEFB 3RPBA 3EO9L 4JFPA 5DJ6B 1HAWA 1WFOA 1EIBA 5F7HA 4JDVB 3MJGX 3L3OC 1HDMB 2JLLA 3QRBA 3RJDA 2MNUA 3VJ6A 2B08A 3GS0A 4KROB 1TJXA 5I1KH 2NYYD 1ORQB 3QJSB 5IHZA 4FQ1H 4PVMA 3U7AA 1RLWA 4NKOA 1JPSL 2XQBL 1TNNA 3HZMB 1RJLB 2WQ8A 2DEYX 3T3PB 1LO5B 3EZ8A 1U4FA 3LTVA 5KSAB 4K5PA 3SCMD 1WIOA 3FO9A 3E3QC 1BGXH 4AGMA 5LDSA 4W9ZA 1B4JL 4Z7VE 4RMWA 1FYTD 5FKPA 5BMFL 5HYIA 4WWNA 1CTMA 1M3IA 5D7LA 1NSNL 1OXYA 4KI5D 4YHPB 1F11A 3NZ8A 1JNLL 2IMMA 3WLWD 3IMWA 3ZTCC 1TTBA 4L1BA 1XIWA 2N4IA 5DUBA 2YUWA 5F7EH 2OL3H 4ZFGH 2HT3D 3PUUA 5DI8B 4KNSA 4B53A 1RMFH 2BWIA 1M7IB 4RMBA 1MHPH 2DQFB 1CXKA 2AANA 3C5ZC 5DMGD 2IV9A 1KJMB 4RMVA 1SRDA 4D0BB 3D85B 4XBPA 2YQ3A 1KYFA 4FI8A 2F1BA 4N8CL 5DUPH 3NA4A 4ZT1A 3T2LA 2VDLB 1T66D 3FB7B 3GRWA 4CILA 1U95B 3R4DA 2X44D 4IEFB 2AVFA 2X9ZA 2BM3A 3HNVH 4O51A 1I3GL 2YC1A 4QRTB 1RUAH 3QDGA 3UDWC 5CBEB 3RTQB 4AYFA 2XFXB 4ALAH 4QXGL 5T1KD 2W38A 4QF1A 1UD6A 4YSUA 1AJ7H 4IRJC 4FI7A 2VM4A 4KQ4L 5DD0L 4WFEE 1DCLA 4NUPA 3FU0A 4PBXA 3GXUB 1R5IA 4XP6H 1NEUA 4AENB 4MXQC 3OAZK 5T3ZL 2IDCA 2OMNA 3T0EE 3ATDA 5E1QA 3POCA 3FRPB 4L8DA 5JIHA 2P5EA 3JWDL 1RZ7H 1D7BA 4PCTA 4F8QA 4L4VD 1EFQA 2JTYA 4PGEA 1B0GA 4K9EC 3L5JA 2NW2B 4MA8L 1F4HA 4YS4A 1NBZB 1YNTA 5DD6A 1ZLVK 1XGPA 1QFWL 1PG7W 3QI9B 5D1QB 4LSQL 1X4XA 4QHLA 5CUSH 5D5MA 4R96A 1AGCA 4NWTH 1M2VB 1U3YA 1OVZA 1WTGT 1G5AA 5JUEH 2GJ6B 3EF4A 4E9YA 1N8ZB 1OZTG 3AG4B 1Q4NX 2AXWA 2K3HA 4NRXB 3WUWG 6FABH 4TL4A 1NBVL 5I66A 5T33L 3X13A 1AHKA 5I16B 1NCBL 3L4YA 5ITFA 1MPAL 2KI6A 1IE5A 4CNIB 5IKCA 2MIZA 1A64A 5IROD 1PZAA 3KPPA 2GHWB 1SM3L 5F21B 5E00A 1XB6A 1E9QA 2D7TH 2RHEA 43C9A 3RDTD 4U1SA 2AEIT 4HJGA 1Z66A 3T65A 1AGBB 4UYQA 4ZYKB 1GGTA 1J9TA 1JGDA 2K7PA 2P8LB 1AGDA 1UT9A 1T22A 4G8GE 4B9JA 2BCKA 1PDKA 5DJXB 1HE8A 1TTRA 2GT9B 6PAZA 3EBIA 3H9ZA 4GSQA 2HAZA 4B60A 5AYUH 3DBSA 1N9PA 3VFPA 4ZNEA 1QVOB 5IESH 1M4KA 1K85A 4BH7B 1GY2A 2BVOB 5E2WL 1KPRA 2G2RB 3W57A 5INDA 4OCSH 3J2PA 4KH9A 3U9WA 5I5RA 3K72B 2BIOA 1TMQA 5C08E 4WFHD 7PCYA 3ARDB 3Q43A 4Y8AA 5DS2A 5IVXF 5GHWH 5H37H <