5F44A

Crystal structure of shaft pilin spaa from lactobacillus rhamnosus gg
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
265
structure length
264
Chain Sequence
TTTQNVVLTKYGFDKDVTAIDRATDQIWTGGAKPLQGVDFTIYNVTANYWASPKDYKGSFDSAPVAATGTTNDKGQLTQALPIQSKDASGKTRAAVYLFHETNPRAGYNTSADFWLTLPAKAAADGNVYVYPKNVQKTTYERTFVKKDAETKEVLEGAGFKISNSDGKFLKLTDKDGQSVSIGEGFIDVLANNYRLTWVAESDATVFTSDKSGKFGLNGFADNTTTYTAVETNVPDGYDAAANTDFKADNSSSDILDAPSGILP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell surface protein SpaA
publication title New insights about pilus formation in gut-adapted Lactobacillus rhamnosus GG from the crystal structure of the SpaA backbone-pilin subunit
pubmed doi rcsb
source organism Lactobacillus rhamnosus gg
molecule tags Cell adhesion
total genus 62
structure length 264
sequence length 265
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f44A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f44A01
3PGFH 3CJJA 4HMEA 1SHMA 3QEQA 2DLGA 1D9KC 4XGZA 1G9NC 3C6SB 3SO3B 1I7RA 1EFXA 1RK0A 3P4OA 4OLXH 5EBLB 3WFCL 4Z8FL 3O41B 2HWZL 1KFAL 1M05A 1RHFA 3G6JB 4NO2B 2VN4A 5JNYB 2EE2A 3DXAA 5T3XH 4XP9L 2VQUA 4QF1B 4PJIE 3ARBB 1PG7H 5AD0B 1YC7A 1H8SA 2C4XA 3QCUL 2CKBA 4ODBD 2DQIL 4HKXB 1LDPH 3KPRB 4H5SB 3ARFD 4NQDA 4WFEE 1CDIA 1U8NB 1UB6A 2Z92B 3O3BA 4JO1H 4PTUA 4XMKH 5IB1B 1HXYA 1CG9B 1YPZE 4GKNB 5INDA 3TJEL 3D6GA 3K1KC 2ARJA 4G6KH 3G08B 5H94A 1T1YA 4P2YA 4UT6H 1K5NA 1K8IA 1C5DA 1DQTA 4XVUC 3M1BB 5DQDL 3OBAA 1HYRC 4TSCL 1MI5D 1YY8A 2PCPA 4Q0XL 4EUPH 3D69B 1QKZH 2FO4B 2A6DB 3U7WH 3GFUA 3BHBB 5FECA 2E27L 2F54A 3EFFB 3PDDA 4H1LB 1QRNA 4BUHA 2AI0L 4V1DA 2AJ3B 4KQ4L 2P44B 4ZD3H 1P2CB 1JFQL 5E8DL 4LPVA 4MXVE 1A3QA 1T5WB 1UJ3C 1CDYA 4NQVA 2Q8AH 4DZBA 2B20A 2OBGA 4QRRE 3KPLA 5C09E 3N1MC 3KJ4B 4WY7H 2HJFB 2X1PA 1A0QL 2CR3A 1MFAL 1FGVH 5DJ8A 3VH8A 2OJEB 3GSNH 4YHNB 1VPOL 4NWUL 4WW2C 4PJBA 4X4MA 4S1QL 3BPCA 2YD4A 3IDYC 4U6VL 5JOFB 2WK2A 3AUVA 5K9QG 1MLBA 1MWAA 5IMOB 3CVIL 3NCEB 5CEZH 1DQQA 3B8SA 2W07A 3QDMD 1N2RB 1YN7A 2DBLH 4BJLA 4FG6D 4L1DA 1OP3K 3S37X 4WV1B 3DRTA 4ZS6C 4HWBL 1A7RH 2OS7A 4FQQB 1UCTA 3ZT6A 4XC1L 3D2UA 2YPVL 3KGRA 5T5FH 1T21B 3B3IB 5CMAB 4M7KH 1S9WA 3ECBB 4APQD 1D5BB 3OKDB 1I1RA 1IJ9A 2VLJE 1D7FA 4OLYL 2QSCH 3S3JA 4GKZA 2BERA 2Z35A 2Q6WB 3FT3B 1VGEL 3NIDF 4LPCA 4JG1L 1AGEA 1FCGA 4NQUA 25C8L 3ETBF 1RZKL 5ALCL 2ERJB 3GMQA 4HCRA 1LEKA 2J7LA 4GJTB 5JMOC 5IBTH 3BPOC 5CP3H 3VFVB 1A1OB 2FJGB 1T03L 4JN1H 3H0TA 1JCKA 3WDJA 3DX9A 5MHSE 5TDNA 1SJVA 4JFPA 3F7YB 1QLRA 4XCCH 4G9FE 4NOFA 3LKNA 5E7BA 4FTVB 5B8CA 1T04B 4Y2DD 3ULVH 1MCSA 1N64H 4FXGB 4M6NH 4M7ZC 4LEXH 1L6XA 3Q2CA 3RI5K 1F4YL 3GI9H 4RFNC 4H8WC 1DBAH 4C56B 1KOAA 2VITB 3IGAB 1MH5B 4XC3H 1TQBC 2XTJC 3VGHA 4UT7H 4KGJA 3VCLA 4DAGL 3NN8A 1A3LH 3FQRB 1DQMH 3X11A 1EGJL 3CH1B 3KPMA 4XX1G 5T1LD 1LEIA 4JO3L 1FNLA 1NCCL 3EZJB 4N8VB 5FUZH 1YNLH 1KCRH 3G5YA 5KVEL 3P77A 4JFZL 3UJIH 1EX0A 1D9KD 4YAQA 4F9PA 1P7KB 4YBQC 1B9ZA 1HYSC 4GG6F 3VGAB 1S9YB 3RVUC 3TA3B 4OFVA 2MMXA 2YHGA 3BKJH 3PIQB 5FYKL 5GGRA 4Z6AT 5DI8B 1JHLL 2P1YA 3ALWA 2ARWA 5JPMB 4WEBL 4NC2B 3RZCC 3GUTA 5F1NA 3O3EB 5AYQA 4LF3B 4XB7A 4HQQL 4NM4L 3HAEA 3GKZA 3FONB 4Y5VA 1W0WA 1WICA 3C5ZA 1YEIH 4ZUTA 1UWEH 1YEEH 2OTWA 4DKEH 3MREA 5D2NA 1KPUB 1HOCA 2YUWA 4XVUD 4P46A 2J3SA 4MA3B 4QHNA 3I6LE 2D7OA 1GIGL 2GY5A 2FB4H 4PRIB 1T7YA 3NTCL 1I8LA 2Z0BA 3KLAA 2DQDH 3AVEA 1OAQL 1T5XB 4MJ4A 5I73C 3BZDA 5HYIA 5I18H 1H15A 4PJAA 4R3SA 1E4KA 4QRUA 4X7CC 2BNUA 4UIMB 1QBLH 4JKWA 4XVJH 1IC5H 1R5WA 2X4UB 3CXDH 4J1UA 1Q9OB 5DJAB 5KOMC 3ZE0F 3BEWB 3CFBB 3VFNA 2R23B 4PRHD 2XT1B 3GI8H 4AK1A 1IEHA 3CPLB 3QFDB 2VZUA 3PG2A 5HHNB 2JIXA 4HIIB 5SWZA 1I1CA 4XPAH 2NX5E 1F8TL 1X5XA 1XCQA 3HMXA 4I2XA 4YFLI 1BJ1J 3DLQR 4MDJB 3FB8A 1FLRL 3GSRA 5CJOH 5D6CB 2N4IA 3E3QC 3T8XB 3ZKNC 1N5YH 1MPAH 4QOKB 2XXMB 5FGCB 4D0DB 1ES0A 1FG2A 1I8KB 3O6FC 1N7MH 3LQMA 5ANMA 1UJTA 1B3JA 1UKTA 3A67H 5E56A 4F7PA 2UWEE 2FEDD 1MFDL 3MZTA 3WNNA 3L3IA 3VFSB 2AJVH 4YIQB 5C0GA 4P4KC 4M43L 5F70A 3NFPA 5DK0B 3M17A 1LE9A 4ZS6D 3GMLA 3LPWA 4NRZB 4WHTB 4HC1L 2V7NB 5EC2B 3I75A 4LVNC 1U91A 5IQ7L 3MV7B 1PW3A 1ZT7A 4KROB 4GUPB 3GJFB 2X4QB 3PABB 1K4CA 2FIRT 3ARDC 3PV6B 4TTGA 5I9QB 1Z0NA 4YZFF 1OP5H 1TZHB 5CUSH 4FQ1L 2OL3A 1XGQB 4ORGB 5FK9A 2PF6A 1AIFA 3FFCA 2X4SA 4NRYB 3EDDA 4JVPA 1JGLH 1ONQB 1IL1B 5D96C 3I84A 2CLRA 4Z0XB 1KCVL 2JJUA 7FABH 3LIZH 4MCYA 3L5JA 4NKDB 3QQ4A 1UM5H 1HK6A 4N0CC 2FWOB 2MFNA 1T7XA 5GRVK 1V7ML 1QO3B 2QQKH 2B1HL 3BP5A 1R5VB 2J8HA 2R29L 5H37H 2EDFA 3N1FC 1MHCB 1IGFL 5HYJE 3HN3A 1A22B 5DJXB 3ZSTA 2P5WE 1AJ7L 2J4WH 1NFDA 4L4JA 3WFEH 3QAZB 3OAUL 5CKGA 3KPPB 1V7NL 4WEUD 3IF1B 2PTVA 1C08B 4HZAA 2GCYA 4PB9L 4WU7A 3EOAA 3HZYB 1W0VB 4QRSB 3GMOA 1QFUL 4LU5L 2DLEA 2XTJD 1X5KA 4K23H 4X7FC 5I1JL 4X7TA 5C0AD 2EE3A 1V05A 1AR2A 4G6FD 4KJQC 5IT2H 3K81A 2R4RL 2ZUQC 1S8DA 4OBSA 3ULUC 1RU9L 4ZPVA 3T1FB 3I02B 2NY7H 4KRPC 3RWGA 3OGOE 4MD0A 3UTPE 5I6XC 2FGWH 4YXKL 5AWNH 1WCQA 4OKVA 4KMLB 2BVYA 1HYSD 3V8CA 2MNUA 2J8OA 3QJHB 1REIA 1FFNA 3MRJB 4XAKD 1UZ8B 5F6HJ 4EI5D 5I75B 1AFVH 1CDJA 1U92B 5TDOB 1Y18B 3VG9C 3RZCD 4N8CH 4X6CA 5ENWB 1E0OB 3PGFL 2B8OT 3CCHA 5B3JF 1GOGA 4XZUA 5D2LA 5LGJA 4CVWA 1JP5A 3QEUB 4OLXL 3MLZH 1PX3A 3F12A 4PS4H 4TNWF 2VSDA 4JZNB 5CJXC 5C08B 3DVGB 4XT1C 5T3XL 1KN4H 1T0NA 4WGWB 1PG7L 3K7UA 4ODWB 1KJ2H 3FO1B 1AC0A 5FDWA 4NDMA 4R4NC 4PJBF 3S98A 1LDPL 5CEXA 4GXVH 4Y1AA 5EU5A 4OF0A 4JO1L 43CAA 4OFYA 4XMKL 1L0XA 2XNAA 1U2HA 3LV3A 1DUYA 1N8ZA 4G6KL 3AXLA 4YK4B 1VFOA 4ZQKB 2F19H 4UT6L 1G9NH 4KH2A 4PJDF 4U1IB 3BKMH 3ZTJG 1IAMA 4NT6B 3ARZA 1LE5B 3KWWB 5D1XA 2ICCA 4UI2A 3U7WL 2BHZA 4LNVA 4JDZB 4CU7A 4KDVA 3C6SA 1JWMA 2PW1B 2HYMA 1F13A 3HUJA 4ZD3L 3W0WD 3O41A 1ULVA 3VXMD 5I74C 4C57C 5JNYA 4NO2A 1XIWA 3KYOB 3STLB 4QF1A 4WY7L 2Z8SA 4JQVC 3V6FB 4UZGA 4JAMA 5AD0A 4M1CC 1FGVL 1ZLVH 3GSNL 4P4KD 3L3KB 2E8YA 3KPRA 4BELD 2X1WL 5HSFA 1U8NA 4OZFB 5LKNA 2N7AA 3GRWA 3GJFK 2DLFH 5GGTH 1CG9A 4KUCD 2CDGB 4HKJB 1HSAB 3G08A 4YNYB 4J3VA 1V3LA 5TFSH 1FP5A 3D0VA 2OZ4A 1HWGB 4DGYH 2X4TB 4LPTA 2FO4A 3OB0H 3BHBA 1I9RH 4F9LA 3D39E 1D5ZB 1K8DB 5DA0B 3BO8B 2DBLL 1DQJB 3ME0A 3EDEA 5EU6D 3FN9A 2VABA 3DURB 4P2OB 3O6KH 2P46B 5IB4B 5T5FL 4PUBH 3Q5YA 4ODHH 2HJFA 2FRGP 3T09A 5T1KD 3AS3A 4BH8A 1C5BH 2OJEA 4DOHE 2NY2B 2QSCL 4YHNA 3IDGA 1T3FB 1H5BB 1UACH 3P11H 3TPUB 1J12A 3VD3A 3KPSD 3RWJB 4OQTA 1FVCB 5IBTL 1NCBH 4HIXH 4PJHF 3NH7L 4JN1L 4PJ8B 3QEHB 3SE9H 3TT1H 3EKCA 3U79A 5A2IH 3B4NA 4XCCL 1KACB 1T89A 4HJGA 3PGDB 4GH7B 4KJQD 4XMPH 4LRIA 4WV1A 3HNSH 3HE6C 3ULUD 5KSBE 4FQQA 1N64L 3UZEA 4M6NL 4HUVB 4LEXL 1RIVL 1V3JA 1LK2A 4R0LB 1NSNH 1T21A 4RGOH 4RZCB 3B3IA 3GI9L 5CMAA 5I76A 1FFPA 4M61A 4JPKH 1U8JB 1DBAL 2WZPD 5B39B 2VDKH 1FQ9C 1QFHA 3FQNB 4QNPE 3ECBA 1R5IB 1J18A 4UT7L 5IVXE 5C0BA 5HJ3B 1A3LL 4L29B 2LTQB 3FT3A 5IG7B 3SDXA 4H0HB 5C1MB 3L3DA 4OF8A 5FUZL 1YNLL 1U3ZA 1KCRL 2VJXA 3EOBB 4HW6A 3UJIL 3HI1B 3HZKB 4F9PC 1ZAGA 4PJAF 1EFXD 1ZVSA 1X4ZA 3MCG1 2VXUH 3VD7A 1CDCA 2FJGA 2HTKD 3D18B 1NUDA 5AG9A 3U83A 2DAVA 3S4SG 1X5ZA 3O45A 3F7YA 4Y4KC 3PWNB 1JRHH 4Z7NE 3DXAD 4DK6A 4Y8DC 1GGIH 1CF8H 2QSQA 2GSGB 3QO1A 4FXGA 2DS4A 4RWYH 3OKKA 4R4ND 4Y5VC 3LB6C 3T0BA 1KNOA 3C5ZC 1YEIL 3MRBB 3IGAA 1MH5A 1AXSA 4U6HB 4U49A 4XCEA 1UWEL 1YEEL 4D3CH 3T0EB 5I0DA 3QWRA 5D2NC 3CH1A 4S0TD 4X6EB 4RDQF 4N8VA 4P46C 1KBGH 4GSDH 1C1EH 3WNKA 5J1AB 2F54D 1RK1A 4H25B 2E7HA 5TQ0H 1I8LC 1QRND 5CINH 1P7KA 3MV8E 4V1DD 2GJ6E 4OGZA 1FZOA 3VXSE 3TA3A 1QACA 1AD9A 2PO6B 5I18L 3PIQA 4PJFB 1CL7H 4WWKB 4C55A 4QHUB 1RHHB 3T77B 1QBLL 4XVJL 4YLQT 1YEJH 1EVUA 1HI6A 1AHWA 1JZ4A 1DCLA 5BVPH 3CXDL 3ULVF 3O3EA 3TIDA 4LF3A 5JPNB 4M1CD 1CLYH 3GI8L 1MCIA 1U3YA 3HCVB 3CFKA 4AENB 5DMKB 5TH2B 4BFIB 5F7WC 2O5ZH 3DGGA 2NQCA 1KTDA 1FJ1B 3NA9L 1I4FB 3GDBA 5CJOL 3VXRE 5B38G 3KYKH 1N5YL 1MPAL 4AQ1B 3N1GC 5BJTB 4X98B 1N7ML 3OKNB 5GISH 4MA3A 3A67L 3KPQB 3V0AC 4BQ8A 3GGWB 2AJVL 1DJSA 4G6AC 4TNVF 3QI9B 3O8XA 5KAQF 3IDUA 5E9DA 3CDGA 3MYZA 1B6DA 4L3AA 4FN0A 3T0DA 4PRDA 2FYYB 1G7PA 3D2UD 4UIMA 5E95B 5HHOD 4XAWH 3DSFH 2X4UA 5LVEA 4MCZB 3MBXH 5ISZB 1Q9OA 5FHAH 2EYRB 5DJAA 5CUSL 1KIQB 3BEWA 3CFBA 5EFIA 3C5JA 1ZHBA 4HUKB 1VHPA 3DETC 4NC1C 4U1HB 5CZVH 3CPLA 3QFDA 4HH8A 3FRUB 5HHNA 3DRQB 1JGLL 1DBMH 2VLKB 3SKNA 4UV7H 1CFQB 2DICA 2VQ1B 4KZEH 1S7UB 1OQXA 4LQ1A 1IEAB 4CN1A 7FABL 3LIZL 3PJSB 2F53E 5D6CA 3T8XA 2P4AB 4QOKA 1UM5L 2XZQH 3QIUB 4D0DA 4XNZC 1I8KA 1LO0L 2EO9A 5D5ME 2QQKL 1CFBA 3RWEB 1F42A 4LCWB 3X3GH 2ED9A 1ORSB 2VNCA 2WWKT 2NNAB 2BVPA 3VFSA 4LFHG 1KENL 4FP8H 1YN6A 1B0GB 3GBNH 3BIKB 3HE6D 2ZUSA 5ITBH 5L2JA 2J4WL 3WHXA 4CDHA 4NRZA 4WHTA 2NY1C 2V7NA 5EC2A 3WFEL 3PHQA 3BH8A 4NFBA 3WL9B 5D71H 1G7MB 3GJFA 2NW2B 2UYLB 3PABA 3LN4B 5BRZB 5T5NF 2H45A 4IHOB 1H9VA 1XGQA 4ORGA 4ZNEA 3MLTB 1TVBB 1WQVT 3E6FB 4NRYA 3BGMA 5JMRA 4MQSB 1ONQA 2M1KA 5CHNB 3QDHA 5IT2L 2X4PA 1IL1A 4X5XB 4TPRH 4Z0XA 4R90H 2C1OB 4F15B 2YWZA 4GBXB 1I3UA 4NKDA 4WO4B 2CGRH 3Q6GH 2FGWL 3RI5F 2FWOA 4LHJB 5GGRY 1MCLA 5AWNL 3H2WA 1R5VA 1MOEA 1NH6A 5FDYA 1OP9A 1ZGLB 4OF7A 1C12B 4NYLB 4P2QB 1H3WM 3VDBA 1T2JA 2VB5A 4NQEB 5DJXA 3X13B 1AFVL 4PB0H 4HKBB 4N8CL 1JNHB 1P5UA 2OTPA 5I17B 3SKOB 1S5HB 3BZ4B 2R4SH 4U1MA 4JR9L 1IT9H 2YBRA 4EUPG 2DQTH 3LB6D 3HZYA 3C5ZD 3SKMB 3ULUH 3MLZL 3SGJA 3S7GA 1CFSB 3G6JF 4UINH 1CIDA 5DJDB 5EOCJ 1K4DB 3LKPB 4MJ5B 5H35A 4DZ8B 4EBQH 3MGTA 3VFPB 2Z91B 3BIAX 3RIAK 3T1FA 3I02A 4P46D 4KI5F 1EVTC 1N0XH 3QJFB 3ZO0A 4PRNB 2E9JA 1BQLH 3M07A 2I9TA 2AJUH 1DVFA 5BMFH 3PDOB 2O5XL 1FHGA 4PJ9B 4GXVL 1KPVA 1JF5A 3O3AB 3LZFH 3MZGB 1YC8A 1UZ6F 3QJHA 3MRJA 5DVLA 2DIAA 2F19L 4F8TA 1G9NL 5M94B 5DJCB 4IRSA 1U92A 3BKML 1Y18A 5TDOA 4EN3B 4Z7UE 2FR4A 1T83C 3HA0A 1Q9LB 1TMCB 1WLHA 4YGVB 4HEPG 3BESR 3PHOB 4JFDE 1R3KA 2I9LB 2JIXD 5SWZD 2ARJQ 3QEUA 4X6DA 2LQRA 4ZDHB 3H9SE 5E1AB 4JFQB 2WSKA 3S35X 5JR1L 2Q7NA 4F37K 4LK4A 4ETYA 2PYEB 4M7LH 4JFFA 3DX8B 5C08A 2EC8A 5EULV 1XIWC 1ZV5A 5I1KH 4A6YL 3WCYA 3U4BH 4ODWA 5E4IA 3B2UD 3FQXB 3WKNA 5JHDA 3HNVH 3PQYB 4WDIA 2F8OA 5CJ5A 5A2FA 4URTB 4U0RC 5E2TH 1G6RB 2EDTA 3F62A 1F2QA 1MCDA 4ZPTB 5GGTL 4S10A 5ALBH 4ZQKA 4CKVX 2K7PA 5TFSL 4U1IA 2HT2C 3VMNA 1JPFB 2ESVE 6FABL 2AP2A 4DGYL 1BD2A 2VTFA 2IMNA 3WMSA 4R7DA 2VXSH 4F9LC 3DETD 6CGTA 3FFCD 3WHE0 4HS6A 4OZIF 4JHWH 5IOPB 5ESQB 3O6KL 1GJIA 3Q0HA 5D7KD 2FHBA 4PUBL 5L0QB 1FNGB 2KQMA 4ODHL 1A02N 5DK3A 4JFXB 3U46B 3T3PE 3V6FA 5CFHA 4TVPD 3HG1A 1MCWM 3HKFA 4ZUVA 1FVEB 5KG9A 3L3KA 4X9IA 1OGAD 4KUZL 2NYYC 3RPKA 4MSWB 1UACL 2NY1D 2Z4QB 3P11L 4F7CB 3QWQB 5GSRB 2CDGA 5IHZA 5CZXD 1HSAA 3CFJA 1JMZA 1RZFH 4BFGA 4YNYA 2I60H 2HFEB 1NDMB 1FV1B 1DANU 2X4TA 4DVBB 1J7VR 1MCKA 1NCBL 4HIXL 2AQ3A 3SE9L 3TT1L 1KEGH 1DLHB 5IMLB 2XYCA 2HFGH 3AFLA 3V0VB 4XMPL 1DQJA 3VXUD 1NLDH 4LRIC 3HNSL 5FOBB 4Z5RB 5EZOL 3AAZA 2VISA 4P2OA 2EIZB 1FC1A 3TBSB 5ELIA 5IB4A 4RGOL 1NSNL 2WV3A 1MHHB 1B0RB 2VAAA 1QVOB 1F90L 2NCMA 3QHZH 4XPTH 5DLMH 1JGEB 2R69L 1U8HB 2ICWB 3C9NA 1P4BH 5HGGS 4CN6A 4E41A 3RRQA 3VA2C 1T3FA 1CD0A 2VDPH 3MRIA 2VLME 3DO7B 1ZSDB 3T04D 3F7PC 4Z7WE 3UJJH 5MP6L 3KYMB 3AREB 1T20B 3FOLB 3HZVB 4QRTB 3R0NA 2CUMA 1KTKE 5EUOB 1P7HL 3PGDA 3OB8A 1JRHL 5EUKA 3BZEB 4LLDA 4H8WL 3RL2B 3P9WB 3E6HB 5A43C 1GGIL 1P7QB 5BS0A 5EZJB 5DEGB 1PZ5A 1CF8L 4N0UA 2C1PB 1E4WH 5DSCB 4RWYL 3S5LG 5AZ2H 4R0LA 2BZDA 4N9OB 5E2WH 3SE8H 4Z7VF 2YUZA 3EYVB 4Y1AD 5B39A 4OCYH 4ELMB 3MJ8B 4OFYD 2X09A 4D3CL 4DKDC 3IKKA 3V52H 3FQUB 2HJLB 3IU4H 3MNZB 4L8DA 1Q9KB 1AGDA 4TYUA 1TTUA 1VGKB 2NZ9C 5D1XD 4GSDL 1C1EL 3HZKA 4WI7A 5TQ0L 5CINL 5F89B 2KH2B 3TA3C 3EGSA 4IOIB 1AO7E 1NEUA 3NGBC 4DVRH 1CL7L 2H41A 1P6FA 3W39B 2HKHH 3HAEH 3PWNA 4YBLB 5KSUB 4TULH 3OXSB 1I75A 1UYWH 1AHWC 1XIWD 3T65B 5BVPL 2GSGA 3DMMB 2YRPA 5C3TA 3V2AR 3TYFB 3QP3A 1BQHG 3JV6B 3DSNA 3RFZC 1BQUA 2CK0H 3NIFE 3KPRD 5HHQA 4POYA 1AKJB 2ATKB 4NUGH 3DBXB 3MRBA 2O5ZL 4WI6A 2ZUUA 2IGFL 3ROLB 1P84K 3T0EA 1XF1A 3BMWA 3KYKL 1TCMA 1JNNH 3MFFB 2YSSA 2HT2D 1A6PA 3KG5A 1TJIH 3JV0A 5GISL 4PJIB 3LRHA 5GGVH 2MJWA 1OB1B 3RNKA 4RMSA 2RFXB 4H25A 1WWBX 1BF2A 4FQJH 5C0IB 1VDGA 3O8XC 1JMXA 4TUOB 5H37G 4H0IA 1CN4A 1UXSB 2AJXH 2PO6A 4PJFA 1YPZB 5ERWB 4WWKA 3CU7A 1RHHA 3T77A 3QNYB 5DFWH 4XAWL 1YNKH 5I71B 2FD6H 3DSFL 2DN7A 5KTEH 3MBXL 1XT5A 5FHAL 3LEVL 3HMXH 5C0CE 2NXZB 5JPNA 3GMPB 4CMHB 5DMKA 4AENA 3IKCA 1DBML 4KZEL 2HAZA 4DJMA 4NQXA 1I1AC 2IBGA 3EZ8A 5I8CA 1I4FA 3MNVB 2D3VA 2XZQL 4NN5B 3QZWA 5BJTA 4QRRB 4OCNC 3ROOB 3OKNA 5C09B 3WUWB 5HGHA 1S7WB 3X3GL 5F3BB 3KPQA 5FAAA 1NGWA 2BC4B 2R0ZH 4FP8L 3EO9H 5F3HB 2CLVB 4MXQC 1BVKB 4P9HC 5ITBL 3QXTA 4PJ7A 4WJ5B 3BDYH 5JUEH 1OAXH 2PUQT 4HWUA 3W9DB 3B6SB 4XPBH 5I30H 4JREB 5D71L 2D0HA 1U93B 4MCZA 1CZ8H 1SJEA 5ISZA 1VADA 4JFHD 1KIQA 1LMKA 1B2WH 4U1HA 5D70H 1W8NA 2EDYA 4GW1B 5C0BD 4DWHA 5C6WH 3DRQA 5KVFH 1DUZB 3GMRB 1X3DA 4PLKC 3X14B 5IVOA 4Z95H 4MJIE 1E6JH 2R2HB 5LWYH 4TVPH 5EO9B 2D03H 3STBA 3Q6GL 3QWOA 1N3NB 1FCCA 1WK0A 3RWEA 4LCWA 5CP7B 4EXPX 1ORSA 1X5JA 2XKSA 2NNAA 3KXFE 1C5CL 1JV5B 1B0GA 4PJGF 2Q3AA 4EDWH 3BIKA 1MLCB 4PB0L 3AU1B 5D1QA 4MAYB 3AM8A 4RAUB 1T1WA 4WUKH 3VFOA 3WL9A 5DD6A 2NW2A 1KCLA 1RQ5A 2UYLA 3HMWH 2R4SL 1PYWB 5BRZA 1IT9L 3U1SH 2DQTL 5F71A 1FO0B 3LQAC 4MD5A 3IFNH 3ULUL 4RAVB 1KLGA 4B0MM 3MLTA 1TVBA 4L5FL 1OP3H 4HPYH 3QWRD 2BHYA 4LKCB 1TNMA 3OX8A 5CHNA 5F9JA 5EPMA 2L4OA 2WBJB 2JELH 2C1OA 1GZQB 2NZ9D 1N0XL 4XVSL 4WO4A 4JB9H 1BQLL 1IARB 4XPFH 4S2SB 2AJUL 1DVFC 5F9WC 1NGXB 3SDCC 3GMNB 2XZZA 3RGVB 4XRCB 3TA3D 5MERB 2YPLD 1ZGLA 3MRKB 3IXTB 4NYLA 4P2QA 1VERA 5D93C 1KJVB 5FV1L 5FKAA 4GMTH 4NQEA 3X13A 4IRSC 1GAFL 2E9IA 4KWUA 3VGDA 1JNHA 1SY6A 5I17A 4Y4HB 1KCSH 4PP1C 5D7JC 3SKOA 1S5HA 4BQ6A 1FSKB 2W9DH 1FAKT 4L8BB 1T6WA 2VYRE 3KR3H 3NIGF 1GYAA 4U1JA 2H9GB 1CLZH 5IESH 1HHGA 3HE7B 5DVNA 5JO5B 4X6FB 3EIFA 1K4DA 4M7LL 3LKPA 3F58H 2ZOKB 3O6LH 2CKBL 4HUWB 3VFPA 3DHJA 5KSAA 1CI5A 2R15A 2R0KH 3QO0A 3HR5B 4RMTA 5KVDH 1GHFH 2IFFH 3QJFA 4PRNA 1EHXA 3U4BL 1S78C 1G1YA 5FO7A 3HNVL 1XR9A 5IEHA 4F7MB 3O8XD 1U9KA 5M7QA 5E9DD 4L3CB 1M6OB 5E2TL 1F58H 1S7SB 4YEFA 5ALBL 3UEZA 5E8NB 4HXAL 5DUPH 2UVFA 5KANI 3AY4C 2W38A 2DOCA 1U8PA 4EN3A 4KK5D 5IHBA 3P0GB 1LGVA 1S9XA 3QDGA 2AK4A 4AIOA 3QDJE 5GXBB 4OM1H 4RQQB 1Q9LA 5JQHC 2VXSL 5D7SH 2HLFC 1E4XI 4D9LH 1QLFB 3RBSA 1S7RB 4HUNB 1ZLUK 3VD4A 2UZYB 1Y6NR 1BVLB 1GOHA 5E1AA 3X12B 2BP3A 2PYEA 1M7DA 4QOKD 5SX4I 3DX8A 2NMSA 2RBLA 3LRGA 4GKOA 4YXLL 2JE8A 2FLBT 2HKFH 3BGAA 3PQYA 2V5RA 3OR6B 1SM3H 5BZWB 3L6FA 4MXQD 3VRLF 2OZ4H 2F58L 1IZKA 1JWUB 4OZ4B 4ZPTA 1I3RA 4P5TB 2FH6A 4ZUWA 4UTAH 3TO4B 2I60L 4HWZA 2EH8H 1JPFA 2J6EH 3U48A 4M8QA 1Z9MA 4JFOA 2UWEB 1JL8A 4X6BA 3ZT7A 1KEGL 2HFGL 4B7IA 3I6GA 4PLKD 1NLDL 5E94B 4RFEA 2EE9A 1MUJB 5K9JH 4L1HA 2DMBA 3QHZL 5DJ2A 4XPTL 5DLML 2UUDK 4OGAC 4KV5F 5CAYB 3SQOL 5IJKA 2R8SH 1P4BL 1K2DB 4YDLB 5BZDA 1Y6KR 2IPUK 4RMQA 1FVEA 3NFSL 4JJ5A 5EU3B 1ACZA 4EIZC 4NZTH 4DUXA 3SHSA 4MSWA 1G6VK 4OQTH 1H0DA 5GSRA 2VDPL 4IBLT 1HHIB 2A73B 2HFEA 3QQ9C 5IW6B 3TNNB 4JVUA 2JF1A 1FV1A 4LCUB 1CE1H 3UJJL 4DVBA 3GSQA 3RUGE 5JW5B 1UADC 3BVNB 5HYJB 1DLHA 5IMLA 3V0VA 5C0NC 3DV6B 5HYSA 4Z5RA 3CFCH 3KPTA 3ZDZE 1LO3H 5F1SA 2EDJA 1E4WL 3QUKB 3VW3H 1DVFD 5AZ2L 3RX8A 3LPFA 5DD0H 5E2WL 3SE8L 1B0RA 1QVOA 1JGEA 5IF0A 4OCYL 3FO2B 3NPSC 4KFZC 3OJ2C 1FNHA 3V52L 3IU4L 5FGRA 3BI9X 4NUJB 4IRSD 5GPRA 1TZIB 4KVCL 3RJDA 4G9DB 1A6WH 4PP1D 3DO7A 3WLBA 1NCWH 2A6KB 1RJZA 3KLSA 5ADPH 4PRBA 4O9HH 5CIPA 3AREA 1T20A 5SV4A 3HZVA 4QRTA 2X9YA 2HKHL 4IIQA 4JFFD 1MI5E 4TULL 5C08D 4IDJH 1UYWL 3RL2A 4PRAB 3E6HA 4I18B 5FYJU 3F65A 5FF6A 1ZLWH 2ZJSH 2C1PA 5JHDD 1CTOA 1S78D 2ZG1A 5DVKA 1GXEA 2CK0L 2RIKA 2V9TA 3AC0A 4NUGL 1DE4B 5K33A 4JFED 4G43A 3MJ8A 3PP3H 1O5DT 1CGWA 1ED3B 2YPKA 3FQUA 4GS7C 3MYJB 5IKCA 3MNZA 1Q9KA 5F7YC 1TJIL 3SGDH 1BD2D 3G5XB 5GRUH 4JCLA 5GGVL 3VU2A 2WLYA 3E8UH 3BP4B 3BX7C 2HLFD 1R24B 1DQDH 4FQJL 2I5YH 4P23B 4LVOB 4XNXH 3G5ZB 1T4KB 3K2UH 4JPIB 1MCJA 4LSPH 4LVHB 5CSZB 2AJXL 1FN4B 2PO6C 3MBEA 5T3ZD 3RHWK 4JGMA 1HEZB 3ARSA 3W39A 4F7EA 5KSUA 2EYTA 3ILPA 1YNKL 2FD6L 3BKYH 3BXNB 4YWGH 4LOUC 5KTEL 4NZDA 3CGTA 1CDHA 3QDME 3T3ME 4YHZL 1E6OH 3DMMA 1OSZA 3HMXL 1RAMA 3SE3C 3HG1D 1F4HA 3TYFA 2MCPH 1QG3A 1G7IB 2C7UA 2GSIB 1XF5B 3P9MA 2FX9H 3DBXA 4FHBD 2IBZX 4P2CG 4U1SB 4ZFZB 2P24B 4CBPA 2BVTA 1CE6A 5KS9E 3SY0A 1J05B 2Y72A 5HI3D 3P4NB 3V95A 3BRDA 3WO4B 4MJ6A 1BIIB 5DDHB 5DMGC 1OB1A 4IRJB 2R0ZL 2VDNH 2VDRH 3EO9L 3OKOB 3OV6A 4TUOA 3BAEH 4S1RH 3BKCH 4PY8J 1UXSA 3H9HB 4NNYB 5GGSB 4P2OD 3H3BC 5JUEL 1OAXL 2GUOB 4Q6IB 1L7IL 4XPBL 3QNYA 5I30L 2VZSA 4XCNA 2I25N 1GCFA 1CZ8L 5IB3B 1J11A 1EUUA 3RVVD 4OGAD 1NL0H 3WNMA 5I1DB 4JM4H 3GMPA 2W59A 2X1OA 1B2WL 2NY2D 2J8UE 4O5LH 3P9LB 5D70L 3EYFB 5EH1A 4E41D 5KVFL 4ERSL 4L3EB 4Z95L 3DVIA 1E6JL 4K3GA 5FB8B 4JZJB 5LWYL 4TVPL 3MNVA 1I7TB 2D03L 4UNUA 4TOYH 2X4OA 3EJZC 3QQ9D 4AH2A 5C09A 2I27N 3SDDC 1MREH 3UPRB 3LDBC 3OAZH 4D0CB 4OLEA 4DCQA 4PY8I 1GGTA 4DOHB 1Q0YH 4HEME 1T1XB 5C0ND 3WIFB 4EDWL 5E70A 4H26B 5IMMB 1RJLB 5BS0D 5D1QC 3V4PH 3AM8C 3QUZA 4WUKL 3GJEB 3B6SA 1CFVH 1N5AA 5FO8B 3HMWL 4KDTA 2LU3A 1PDKA 3U1SL 2XQYG 3GSVB 1A7NH 1PJ9A 1WBXB 3K46A 3IFNL 1SMOA 4LEOB 4HPYL 2GITB 4GW1A 3WNLA 1MSPA 4FOMA 4X9HA 3X14A 3ZHDA 2JELL 1YMHB 5KSBB 1J1OL 2XXCB 4PY7A 1YDPB 4CAGA 3UTTD 4WO4C 4HULB 3ARVA 4U1GC 4XPFL 3EFDH 4GRLC 3WJJA 3VDCA 3U82B 3PP4H 4O2EA 3TJHC 4P99A 5CP7A 1EO7A 3CUPB 5IVXB 4K71B 3MNWB 1BFOA 3AU1A 4KJYB 1KV3A 3LQAH 4LLMB 4MAYA 3WE6B 1KCSL 3IJSA 2W9DL 1PYWA 2P45B 3BP6B 5CSBA 3C09C 1FO0A 1CLZL 5IESL 1ZA3B 4NJAH 3WFZA 3T0ED 5HVFB 1CDUA 4BH7B 3C6LB 1RZGA 1DEEB 4LKCA 4C4KT 4KVNH 5IMKB 2P8LB 3F58L 5K9OB 2WBJA 3H8NA 3FL7A 3O6LL 5KSAC 3U0PA 1EA9C 3HB3C 2R0KL 1GZQA 1IGYB 5KVDL 1GHFL 2IFFL 1X4YA 5DR5L 3S8WA 3VH8G 3UDWA 1J8KA 4PRHE 4HDIA 4QHLA 1JF1B 2GTZB 2G75B 3GMNA 2H3NA 5HBBA 4GQPH 3RGVA 1CXHA 1AC6A 1CD1A 5F88B 2PO6D 3VFGH 1F58L 1RMFH 5EIIA 4WWKD 1KJVA 5DUPL 1KIPA 4K7FB 1TPXC 1WZ1L 4LOUD 3DTXB 3VMPA 4Y4HA 2UY7A 4QHMB 3O4LB 4PTTB 2WMPA 5D7SL 1MCRA 4L8BA 3FHAA 3VA6A 3MV8B 4D9LL 3MA9H 2H9GA 3VXSB 5D7IE 4BQ9A 1BZ9B 4K94C 4BKLA 4N5UA 1MCOL 3U6RB 3PL6C 3C60C 5TJWK 2X4RA 3ZE2F 1S3KH 2PR4H 2HKFL 4PLJC 1BJ8A 5F1KC 1A6TA 1L7TH 5DMGD 3DARA 1BF8A 3KYNB 1SM3L 4I3SH 4F7MA 2NY3B 4P5MB 4OLVL 3VWJA 2Q76A 3JWNC 1M6OA 2OZ4L 3BQUB 3MUZ1 1S7SA 4W68A 2QEJA 4UTAL 4P49A 4JKPH 2FSEB 2EH8L 4QEGA 2H26A 5ISZD 4NN7B 3OKMB 1ERNA 3FKUS 4E9LA 3DX7A 1EH9A 5IR1B 4OZHA 1MY5A 2CJUH 4RQQA 4L8CB 1JI1A 4OB5L 1OT2A 2G9HB 4UTBH 1AY1H 5JOEA 5HHVH 1BVLA 1ZKAA 4K3EH 2FX7H 5K9JL 3MJ6A 3X12A 4Q9RH 1HQRB 4QTHA 1KELH 2VIRA 4M6MH 4WI5A 1VACB 1EEYA 1Z9LA 2YWYA 3EJZD 1IM3B 2DM2A 2P43B 2R1WB 3SDDD 2GIYA 3L3GA 4LCWD 1QA9B 4HGMA 3QUMB 2XTJE 3V5DB 5IJKC 4UMGA 2ZG2A 2ADIB 2R8SL 3D1MC 5C0AE 3OR6A 4KTDH 3OZ9H 4NZTL 3IDMB 2CPCA 1EJ6A 4JZOA 2JJSA 1KCKA 1VFUA 1JWUA 2KKQA 4OQTL 4OZ4A 5D1QD 2F5AH 3NIDE 2NY4B 4WVRA 5ESAB 1R3LB 2F53B 5HGDB 4AG4L 4OF3A 4P5TA 1A8JH 2DJ4A 1ZS8B 1JF6A 4HV8B 4WW1B 1T6VN 5DQJB 5BRZD 5IQ9B 5D5MB 1PKQE 1CE1L 1RUMH 1UG9A 5D1ZC 5EUOF 4OM0L 5ACMA 4XAKE 1VFAA 1A6AB 1KJMA 2HJKB 4K7PX 2HN7B 5MEQB 3CFCL 1MUJA 1S7VB 2V6HA 1R3HB 1LO3L 3HAEG 4WO4D 4G8GA 1JE6A 2MPAL 3VW3L 4ELMF 5DD0L 5TGBA 3TJHD 5IFJB 5BV7C 5IB2B 4TTDD 3ES6B 3MXVH 3DYMA 2F15A 1K2DA 5DHVB 3JV4B 4X5WB 4NQED 4YHYC 2CDFA 2C3WA 4CNIB 1U3HB 4X9GA 4ZODA 1A6WL 4XBGB 5GRVL 4LCCB 3JZ7A 4QGTA 2A73A 3MLRH 2YA0A 1TZGH 2F74B 1NCWL 2A9ML 2IEPA 3CSYB 4JDVB 3TNNA 3RJQB 3T2QA 1MY7A 3WJLC 5ADPL 3OJDB 4PJCE 4O9HL 5JW5A 1E28B 5LCVH 2X70B 2D2OA 4NP4H 4IIQC 5J12B 4IDJL 5KSAD 1IGJA 3HB3D 5HDQH 5CBAA 1HDMB 2ZJSL 3EOYG 1EFQA 3QUKA 4M8VA 1S7TB 2OJZH 1IAII 4HIEB 3W0WE 3LD8B 2H32H 1TETH 3S88H 4JANA 3VXME 4O51B 1EAPA 4PJIF 4NUJA 3QIWA 4MJ2A 1I3VA 1TZIA 5GRUL 4EN3D 4G9DA 3QDGD 3E8UL 2AK4D 3A0OA 3VI4F 2AK1H 5DVMA 4NQCA 3VE0B 5DURB 2I5YL 3QXWA 1YPZF 2M26A 4XNQB 4XNXL 3K2UL 4KRLB 2NLJB 4PGBB 4LSPL 4J8RB 3MBEC 1DLFH 4WI9A 4U7KA 4LDOB 3CFDB 4LGRB 1V8HA 1WFNA 4O2CB 5E5MB 1UEYA 3IVKA 4YWGL 3BKYL 5DF0A 3QULB 4I18A 4WEMB 3F7VB 3DIFA 1QZ1A 1FAIH 4LPWA 1RZIA 4PLJD 1E6OL 4HX1B 3ZYIA 3PQYD 3ZE0E 4NN6C 3L95B 1J10A 2MCPL 3SKJH 3CDFA 2FBOJ 4KHXH 3T0VA 4MXVF 5EU6E 4GG6B 1DE4A 2FX9L 3LKSA 1HH6B 2DLHA 4AEHH 4CUCA 4QTIH 2B5IC 5E4EB 5DEFA 1ED3A 4RBPK 1JJUA 5D4QA 1MAJA 1MVFA 3MYJA 1D5IH 1G7JB 3TH4T 3UP1A 35C8H 3G5XA 2Y25A 2YRLA 3MRGB 4NZJA 5DRNB 4EI6B 1DBKH 5DK2A 4PJEE 5HHMB 3BP4A 1C16B 1XGPA 2VDNL 2VDRL 4UT9H 4P23A 2NTFB 5ITFB 3BAEL 5F7HA 3QR2A 3BKCL 3UAJC 4G8FB 1FN4A 1HEZA 3RU8H 3TVMB 2C3HA 3MOQA 3ZYJA 3OMZA 3BYYA 4YUEH 5L6YH 2CRIA 2WWKO 5I71C 3BOVA 3BXNA 5E6IB 3S3PA 1NL0L 1JVKA 3MOAH 4GLRI 4JM4L 3UTQB 2DF3A 1LEGA 3LEXB 4OJFH 2NY6B 4O5LL 4GG8B 1G7IA 1FYTB 4LPXA 4GO6B 5C0EA 4GAJH 4HBCH 3ULUE 2GHWB 3MV01 3IFLH 4WCYH 5J9PB 3DECA 4JY4A 2V7HB 2L0DA 4TOYL 3RIFF 1D5MA 1J05A 1UXWA 3RWDA 3P4NA 4ZYKA 4X83A 4P9HL 4M6OH 4JHAH 4Y16C 5D1ZD 5DDHA 4AMKH 1MELA 4IRJA 3ABZA 4Y19B 2OR9H 4L9LA 4LSRL 3GBML 3IFOA 2ZSVB 2W65B 3EUUA 5GS1B 3D0LA 1NBYB 2CLZB 3VRJB 3FO0H 3H9HA 4NNYA 3QUZC 3V4PL 1WTLA 4M4RA 4E5XB 4GAGH 1CFVL 5AYUH 5IFHL 4U7MA 2A38A 1QOKA 2PXYB 5IB3A 4P9MH 1A7NL 1CXEA 5KN5B 2VWEE 5FOJA 1BBJB 4MDIB 5IIEB 1NMAL 1A14H 4ZAKB 2LVCA 4LLYB 1KCUH 4DK3A 2OR7A 1JGDB 3P9LA 4ELKB 2F8VA 2AVGA 4OQ1A 3DXAE 3ALPA 2P8PA 3ORJA 3PF2A 4L3EA 2JTDA 4JZJA 1CBVH 3I6KB 2H8PA 4OCSL 3D9AH 3SJVE 3EFDL 4JY5L 3WJJC 3PP4L 4XPHH 3UPRA 3QUXB 5DMIH 4D0CA 1JHKH 5E2JA 3GM0A 4MGXA 3ARED 2OI9B 1LK3L 3C87A 1TDQA 1NC4A 5HGBB 1T1XA 3WIFA 1V3KA 1YEGH 4XP5H 5IMMA 1RJLA 4KJPC 1N26A 1QBAA 4YFEA 3LQAL 3TZVB 4PREB 2F54E 1T66D 1LO4H 4IJ3B 4OUUB 4XP6H 1QRNE 5DJYA 1CICB 2N1KA 5HVHB 1IEBB 3O2DA 3GSVA 3B9KB 3O81A 4NJAL 3O4OC 1OWWA 3MO1B 2XFXB 5C7XH 1W2KT 2GITA 3S4SB 1IAOA 5F96H 4ZSOE 3VDAA 3Q6FB 4KVNL 5JHLL 5KSBA 1Q9WA 5I1GH 1EPFA 3ZKXC 1YDPA 3SQBA 2XKNA 3UBXI 2IAMB 3IXAB 4PP2B 5JDSB 3FO9B 2DQJH 5E2UH 4LSVH 4X4ME 3QEGH 4PV9A 3CUPA 3MBED 3VFGL 1RMFL 1IVLA 1XGUB 2NW3B 4YE4H 2AXGB 2IALB 1UWXK 2R1XB 4YPJA 1AGBB 3G5VB 3MNWA 4MNGA 4KJYA 2VXVH 3MACH 3RKDC 1GGBH 3WE6A 5TE4H 3DMMD 3Q48A 1HNGA 4NIKB 4XBPB 3SBWA 3BP6A 3TLRA 5F6IC 3MA9L 3ZKMC 1SYVB 5EA0H 4L4VA 4ACPA 3V6OA 1ZA3A 2QQNH 3M8OH 3RHWF 5CZKA 5HHOE 5I1CH 3C6LA 1DEEA 5IMKA 2P8LA 4C54A 3WN5C 1H3PH 4KDWA 3LCYA 3LSOB 1BHGA 4PG9B 3S37H 1S3KL 1HIMH 2PR4L 1N59B 2KQNA 5IBUG 2RCSH 1JF1A 2GTZA 2FJHB 3WEXB 2G75A 3ESVF 4I3SL 2IANA 3K8LA 3VWJC 3HR6A 4RGNC 3UAJD 1LVEA 5J11C 1RZJC 4XP9H 3U36B 5B38B 1RZ8A 2K3TA 2UWEF 4JKPL 2UZIH 4MB4A 4C83B 1IM9B 3K2MC 3JSSA 3QCUH 3O4LA 4PTTA 2CJUL 5T3ZL 2XPGB 4K94H 2CRMA 4NSKB 4XTRD 3PNWB 4UTBL 3N85H 1AY1L 5HHVL 4K3EL 3P0YH 3JVGA 5D6DA 4IRZH 3MRQB 2FX7L 4Q9RL 4HFUH 1PQZA 5F1OB 4Y88A 4M6ML 4Q0XH 4OIBA 4EDXB 5T1MB 1KG0B 1RIUH 3TBVB 1XZ0B 4GOSA 1MRFH 2AI0H 2L7UA 4KQ4H 3MLSH 1KB9K 1TJGH 1FNSH 3E0GA 2R2EB 1PSKL 1UB5B 4AIZA 4DEPC 3AS1A 1NAKH 4M03A 3SDAB 3OZ9L 2P47B 3IYLW 3LOWA 4OTXH 3OJVC 1BFSA 2JJSC 4LIQH 3E2HB 4U33A 3QUZD 2F5AL 4ZUUA 4P5TC 1VA9A 3F6IA 1J87A 2FSEA 1MFAH 5IR1A 1RUML 3BD3A 1FGNL 1VPOH 2BOCA 4I3GA 5FA3B 4L8CA 2EDQA 5E8OB 2IH3A 2G9HA 4R97B 3I3BA 2B1AL 5D72H 1SMAA 1R3JB 3IB4A 4HS8H 4I48B 2CMRL 1DDHB 5SV3A 3BN3B 3VMOA 1HHHB 1HQRA 5FUCC 3PDGA 1XGRA 3BEVB 5MI0B 3ZE1E 1J8HA 1H8OA 2X7LA 1IM3A 1F97A 3QUMA 5GS0D 3N50A 4OGXH 3WXWH 5D2NE 5DHYB 3VFWB 4HWBH 2FIKB 2QR0B 4LHUA 2Z31C 4N8VG 2VR5A 1KULA 4MJIB 1NAMH 4QRQB 1TQCC 5ESAA 1X5AA 2F53A 1ZA6B 3MLYH 4OLUL 1VCAA 2X1XR 3GSXA 1TZGL 3MLRL 5DQJA 4W70A 5IQ9A 5D5MA 1BBDH 3P2TA 4PR5A 1YZZA 2Y9RT 1EERB 4LSSL 1T0MB 3QG6A 1YUHB 3D25B 1T80A 5LCVL 1VGEH 3PWLA 2NZIA 4NP4L 2IADA 1I3GH 4JG1H 2VUOA 1ADQH 2ID5A 2WBJD 1FL5B 5F1IA 1S7VA 2NY0C 5HDQL 5DEZA 5BV7H 3EJJX 3KNBA 2AEWA 2C3VA 3FB6B 3FZUC 4HUXB 5L7XH 5SWZE 4J3XA 3T4AB 4EUPB 4U1KB 3KPNB 5F9DC 3Q5OA 3RGVD 4I2XE 1XF2B 1P69B 4ZMAT 2KUTA 2BXZA 3ES6A 4WIQA 3VFRB 1TETL 3S88L 5DHVA 4LARH 2P48B 4X5WA 5ANME 3QIWC 4WI4A 1LO5B 4QYOB 4KXZI 3CX5K 1CR9H 1I8MB 4H88H 1PY9A 1PEWA 5CIPH 2AK1L 2F74A 2DQUH 3CSYA 4JDVA 2GY7B 3QB7C 2EIDA 3ZKMD 2EXWC 4ZTOL 4DAGH 3C8KB 3OJDA 4KK9C 5GZOC 4UB0H 1C7TA 1DLFL 2X70A 3GSNB 3CVHA 3HC0B 4PJXB 4G8IB 1OD9A 3UYOD 3U9UA 4R7NB 3QISA 5IV2B 1FAIL 4NC1E 3DUSB 3FFCE 3SKJL 3G6DH 2BCKA 3IFPA 3HHRB 3VWJD 3CX2A 4KHXL 5A2JH 5ACLA 4RGND 3HC3H 1MQ8A 1OARL 5F7LB 4HIEA 4MMXC 5JOPD 5FA4B 4WEBH 4AEHL 4QTIL 4P57B 1FL3B 5D7KE 5JXEA 3DGCR 5GRWA 1D5IL 4NKMB 3CLEH 3ARGB 1JK8B 3V4UH 1OTTC 4TVPE 1DBKL 4P2RB 4R26H 3EO1B 2HVJB 4M5YH 3OAYH 1FZKB 3VE0A 3MTRA 4OUOA 4YHKL 1OGAE 4WNQB 4UT9L 2CO6B 2UV3A 1NFDE 4ZFOA 4LVHC 3QIBA 4J8RA 3VXPA 3G9VA 2BK8A 4U3XA 1Z5LB 5F93C 3RU8L 1GC1C 3R06B 4YUEL 5L6YL 1ZT4B 1Z0MA 1GIGH 3VXNB 3QULA 3F7VA 4OCMC 3CZJA 5D7LA 2VN7A 4JFYB 4ZNCD 2VO5A 4HX1A 3MOAL 2DJSA 5EBGA 1A6VH 3FTGB 3EYUH 5E6ZA 3VXUE 1GH7A 3CSPA 4GG6A 4GAJL 4HBCL 1F6FB 3TC9A 1LHZA 3IFLL 2R0LH 4WCYL 5C07A 1N4XH 4P5TD 1TNNA 4HH9A 5T1DH 1AQDA 5K9KB 4MNQA 5CWSB 4NNPH 4HUMB 4NO5A 3CFIC 1G7JA 1NLBH 3G6AB 2XA3A 4EI6A 4PGZA 4JHAL 4M00A 4KC3B 3TYGH 2H6PB 1LNUA 2ITCA 4HZLB 1C16A 4P0DA 3RPIB 2OR9L 4L9LC 5ITFA 1KTLA 2V17H 5GS3A 4X6CE 4G8FA 5FYLD 2XZAH 3FO0L 2DM3A 4NGHH 3V6ZB 4XNYH 5KOVC 4G8GD 4GAGL 5AYUL 5D2LE 4NQSA 1JGUH 1J0ZA 2CIIB 5E6IA 1A5FL 2PYFB 4P9ML 5C86A 1A14L 1M7IB 3UTQA 1KCUL 3OG4B 2AV7B 2D4DA 2LABA 5KSBF 4GG8A 4K9EC 1FYTA 2EXYC 2Z31D 4JM2B 5IQ7H 4FQHA 4NC0B 2Z8VC 3OJMB 1RIHH 1BFVH 5IW3A 1CBVL 1NCTA 4JLRB 2BNQA 3D9AL 4QNPF 4HFWB 4OT1H 4Y1AE 4XPHL 5DMIL 5IVXF 1DL7H 1JHKL 1ITCA 4FQIH 1KCVH 4Y19A 2ZSVA 1CFTA 3U0WH 1CD9B 5E00B 2IPKB 5GS1A 1K85A 1FLTX 1A4JA 4XP5L 3VRJA 2NY0D 2F5BH 4HAFA 4YFDB 2G2RA 2B1HH 4XP6L 3FZUD 5LBSH 5KSVA 5DUBB 3H7LA 5J0BA 3AB0B 4L4TA 1RUAH 3HUJE 5KN5A 2Z8RA 1BBJA 1P53A 3RUGB 4LLYA 4K3DH 1AD0B 2O93L 4Z7NF 1JGDA 5C7XL 1B4JH 3ARUA 5F96L 5FGBC 4AEFA 3C2SA 1HCVA 3QIWD 1NMCB 3K4AA 5I1GL 4Y5XB 3THMH 4A2MA 1F4WH 5LG1A 1OSPH 2XOTA 3WIHA 5ACZB 2JB6B 2PW2B 3S5LB 4NQCD 3KPRE 7CGTA 3D85A 2EXWD 2DQJL 5E2UL 4LSVL 1NEZB 4HMDA 4KK9D 5GZOD 2R4RH 3IAGC 4HD9A 3BDXA 4YE4L 1SYSA 3DO3A 1UZ6E 5E5RB 2AGJH 1KB5H 4UOJA 4ENED 5FYJD 2X1QA 1SEBB 3TZVA 4X4YA 3MACL 1GGBL 5TE4L 4UNVA 4PREA 4B53A 4IOSD 1WBYA 2ZZUT 5CEYA 1MCEA 2WM0A 5I1AB 3CSBA 3V5HB 3ARFB 2KBGA 3HI5H 5DTFA 1ZHNA 3B9KA 4QRPE 4X8JB 2CSPA 2I07A 2ED7A 5EA0L 3V6OC 2QQNL 3MO1A 3M8OL 3S4SA 5I1CL 1S7XA 3Q6FA 1MI5B 1RZ7H 2QV2A 4L8SC 1H3PL 5KJRH 1OTTD 3S37L 1HIML 4TN9A 3ET9F 3MMEB 2RCSL 3QNZB 5DYOA 5JDSA 2IAMA 3BUYB 1BQHB 5JDJA 3T08A 4P23D 3TV3H 3WLWC 1TIUA 1FNAA 5FUOH 1X5GA 3WS3A 4I0PB 1T22A 1XGUA 5AUMA 5H2BB 2NW3A 2AXGA 2E7LA 2R1XA 4KTEH 3G5VA 1XCTA 1Q72H 5F7EH 2UZIL 5L9DH 5AZEH 5IVNA 4M62H 3LAFA 2WWMC 1N6QL 4XBPA 4K94L 1I1YB 5MENA 4CW1B 1SYVA 2D9QB 3N85L 5EN2B 4LLUB 3JVGC 3P0YL 2ZCLL 4IRZL 1W72H 4HFUL 5JXAH 4ZFFB 4BSWB 1RV6X 5IM7B 5I15H 1RIUL 3LSOA 1ZMYA 3QDMB 1MRFL 3QQ3B 4QXTA 4U1NB 3BPLC 1RZJH 3MLSL 4Q2ZB 1TJGL 5C0BE 5CJBA 1FNSL 4IRJD 3QRFM 3WEXA 1BLNA 2ZSWB 1NAKL 3MGOB 3SDXE 4OTXL 2ICEA 4LIQL 2WINB 4BSVA 2JK5A 1F3JA 2FECI 3GB7B 5D5MF 5J13B 1HH9B 3OKLA 5SWSA 4U4BA 2HVKB 5EO0B 3UTZB 4TNVK 2ZCHH 2GK0B 4APQB 4GAYB 4LPYA 3QA3B 2XPGA 4YHLH 3MRHA 4NSKA 5EC1B 2K1MA 3QCTH 1NCUA 2EXYD 3PNWA 5D72L 4L3ED 1DBBH 4JPVH 4HS8L 3VWKA 3MRQA 4TSAL 4YC2C 2BNRA 2BHUA 2FHCA 4M93B 1NMBH 5BXFB 4NKOB 1IGCH 1KG0A 4PJDA 4HWEH 5B39G 1NC2A 2FEDC 5IW1B 4HLJA 3TN0A 5KBNC 1NGZB 3L3OB 4RX4A 3G04A 5A2LH 4QXUH 3WXWL 4OGXL 1NC4D 3B9EA 1UB5A 1SBSH 3RA7H 4OD2B 2P42B 2MCG1 3BIBX 4OZIB 3QFJB 1NAML 5TE6H 2LFGA 3OR7B 3WXVH 3Q3GB 3VG0H 3MLYL 1KT2A 2P7TA 2UY6A 2YXFA 4OCXH 4RIRB 1BBDL 2YPLE 1A47A 1EIBA 3FN3A 1KJ2B 1U8OB 4LCYA 3MV9A 2E6QA 3SN6N 3X17A 5E8OA 3RTQA 4JRXD 4PJ5A 1I3GL 5T1LB 1ADQL 3MA7B 2DQCH 4NNXB 4I48A 5HDBE 1XFPA 4OZGB 1HHHA 5BV7L 1KGCD 3IAPA 1D9KB 1GZPB 3BEVA 3KPOA 1ZHKB 1SBBA 3EHBD 3NH7H 5L7XL 4EVNB 3MJ9A 3RY4A 1FH5L 4MS8C 2DI8A 5IJVB 2YEZB 4WU5A 1T7ZA 2AV1B 5DHYA 3VFWA 2FIKA 2W60A 1J1PH 4LARL 4RMRA 1CCZA 1CR9L 1RIVH 4H88L 4TUJB 2C3XA 8FABB 1ZA6A 4IEFB 4PGDA 3IS1X 5CBEA 2DQUL 4LBEB 5TDPB 3VRIB 5E9DE 5ICZB 3DUUA 2QKIB 4YHPB 1T0MA 2E6JA 4L4VD 1YUHA 1MHEA 3NABH 4CN4A 3D25A 4UB0L 4XH2B 3FHQA 3C6LD 1DBJH 4Z7UF 2E7CA 3GZKA 2R0WH 1EHAA 1FL5A 4QT5B 5C8JB 2PNDA 3C08H 1OP5K 3FB6A 1MFEL 1G1CA 1INDH 4QCIB 4LSQH 4HUXA 4RRPG 3TO2B 3G6DL 4HGWB 2IAND 3RZWA 3T4AA 4U1KA 4O2FB 3WLWD 4Y5YA 3HC3L 3HRPA 4DUWA 4PJHA 4N1EA 4BFEA 3VFRA 1UJ3B 4EI5C 3QH3A 1CT8A 4QOKE 3QZWG 1T1ZA 4ZOEA 3PWPB 4PRPD 4QYOA 1JUFA 3CLEL 4KKNA 4Y8AA 1KXTB 3V4UL 3EDKA 2ADGB 1FRGL 4UAOC 2WWMD 1IBGH 3O4LD 4PRHB 4R26L 1QEWB 1GGCH 4M5YL 4XCFH 3JTTB 4Z7VB 1F3DJ 2DWEA 3LKOB 3HLAB 3C8KA 5FYJH 5AAMA 4JRYB 1RUKH 5DFTA 3QIBC 1NGPH 3O3DB 3IDYB 1II4E 2LU4A 3GSNA 4TQEH 3WSQL 3DX6B 1BOGB 3HC0A 4PJXA 5JORB 5TQ2H 4G8IA 4WHYH 3HC4H 3SDYH 4R7NA 3U7YH 4ZNEE 1I7UA 2E6PA 3DUSA 1A6VL 3FMGH 3EYUL 4HKZB 1UM4H 1NBQA 2V2WB 2AXFB 2A6JB 5FA4A 2R0LL 1FVDA 1N4XL 2YR3A 4ONHB 1JHTB 5T1DL 1G9EA 3T3PF 4NNPL 1BWMA 1H3GA 1JK8A 2W92A 1NLBL 4P2RA 3TYGL 1NDGA 5C0FB 5C70A 3PV7A 2HVJA 1CLOL 1GC1H 1FZKA 4OV5B 3L3HA 4WNQA 2V17L 3NA9H 1QSEA 2X9XA 1JPST 3P3YA 4FXKA 2XZAL 2DD8H 5GGUA 4NGHL 5ICXB 1A1MB 4XNYL 3MLWH 3R06A 1IAIM 1ZT4A 1A7OH 1J8HD 3QRGL 3SCMA 2Q86A 4F7TA 3K8KA 4MX7B 1DZBA 1JGUL 3BPOB 1QBBA 4RFOL 2VQTA 5GS2D 1E4JA 4JY6B 3MLVH 1MJUH 3FTGA 4WFFD 5C2UB 1GVIA 5CP3A 4LHUD 3U4EA 1NJ9B 4LLVA 4PLNC 4M7ZB 1RIHL 1BFVL 3UCRA 3DVNA 4AYFA 1LO2H 5D9SB 5K9KA 4GW4B 4BK5A 4RFNB 4OT1L 2O26U 3G6AA 5HVWA 4MZ3A 4NHUB 3TEUA 2Y5EA 1TQBB 4BYHA 2XTJB 1DL7L 4AT6B 1TCRA 4FQIL 5C0AB 1I7ZB 3O3UN 5DZOA 3KLHC 4UQ3B 9CGTA 3U0WL 2AAVA 5I8EA 2LAAA 2VLRB 1LO0H 1QFOA 2F5BL 4MNHB 2PETA 3BPNC 4NBZB 3QDAA 4Z7WF 4GAFB 5LBSL 4K9EH 3S6CA 5C0RH 2P8MB 1OGTA 1PKQB 4X6DE 1RUAL 1KENH 4MS8D 1KPRA 2QADC 4K3DL 3BE1H 1IE5A 2AV7A 5CILH 1B4JL 4JFFE 5C08E 4EZMA 1QQDB 3RZCB 3MROB 3THML 1F4WL 1SJHA 3GSWB 5JHDE 1OSPL 3V79C 2ADJA 4HS3B 4KRNA 1T2QH 4JLRA 3S35H 1AP2A 4HFWA 2LVEA 1ODAA 2W9EL 4M1DH 1ZLVK 4C4KO 4DFIA 4JFEE 4M9PA 2DM7A 4JQIL 2XICA 2IMMA 3DI2B 3LN5A 3UBXA 1YJDC 5F7DB 3BH9A 2AGJL 1KB5L 3C5SB 1BD2E 3IJHB 4LDEB 3MOBH 3O2DH 4UIKL 1A2YB 2Z93A 4U6TA 4R4BB 5ID0A 2FGZA 1FNEB 1MRCH 3OB0K 4J3OC 4NKQB 5DUBA 5EO1B 4YO0B 5I73B 3HI5L 4CU8A 4LCIH 1M71B 3KYAA 4PJCB 5T3ZE 5IB5B 2IQAA 2EKSA 1A4KB 4F3FB 5HYEA 2P5EA 5JXED 1F00I 4PJGB 1XF4A 5J4MA 3IDJB 4XNMB 1KXQE 1RZ7L 4HBQA 5DRZB 3P4MA 5CJQH 5KJRL 3U2SB 4Y5XA 1DP0A 1U41A 4JR9H 4HXBH 3VGEA 1YEFH 3HG1E 5DVOA 2HH0H 3NIFF 5A16B 4XMLL 1WF5A 2JB6A 2AJSL 4IS6A 3S5LA 5MEOB 1MCPH 2HTKC 2VWEC 5DURD 5ICYB 3TV3L 2K7QA 1L4IA 4R6UA 2AKRA 1NEZA 2DYPB 3NACH 1U8IB 1OAZL 3QIBD 5FUOL 3W0WB 3FQTB 3FQWB 1RUQH 3B8YA 4ZUSB 3VXMB 4NPYA 3V9FA 4KTEL 4ZO9A 3O6FB 1CXIA 1RFDH 1Q72L 1YMME 3B9DA 5F7EL 4FFVC 5L9DL 5AZEL 5D7LD 2FX8H 4M62L 5EU4A 2IF7A 1SQ2N 2O5XH 4F58L 4I3RL 4P4KB 1E4XH 5F6HI 5LAXB 5L2KB 4LVNB 1U8MB 1W72L 5JXAL 5C07D 2E3VA 2YD1A 3BMVA 1F02I 5SX4H 3ARDB 4MNQD 5I15L 1J86A 4MMZC 1TVHB 2XN9B 3L7FB 3L5WB 4MVBC 4MA1C 1RZJL 3MMEA 2OMBA 5HHMD 3RAJH 5EBLA 1QUNA 4E41E 3QNZA 3BUYA 2BDNL 1EUTA 1BQHA 3UMTA 3L7EB 2CKNA 2D7QA 4IMKA 5JR1H 3NA4A 5D96B 1BMGA 4J6RH 1I8IB 3VRLE 1MQKH 3G6JA 4I0PA 1SEQH 4U1LB 1MEXH 1U58B 2GQHA 1BGXL 1PG7W 2AEPH 3ARBA 4A6YH 4OFPA 3CAFA 4R2GC 5E6ID 4X4XB 1U3JA 5T1KB 5HXMA 1CQKA 2ZCHL 1D5XB 4HKXA 4PJEB 3P30H 4H5SA 1FIGH 1HCFX 4YHLL 1ETZB 2Z92A 2NY6D 5I1LB 1FYTD 1EHNA 3QCTL 5IB1A 5HYSG 1P84J 2IWGA 4GKNA 4NWTH 1DBBL 4JPVL 5EN2A 5BS0E 1WGOA 3VWKC 4N0UE 3RDTB 3M1BA 1EO5A 5GIRB 4RWHA 1UENA 4ZFFA 6FABH 1WVZA 4BSWA 3D69A 1M7XA 2W9LA 1NMBL 2BNQD 2XV6B 5IM7A 2A6DA 1IGCL 4HWEL 4V2BA 2JB5H 3EFFA 3TN0C 4H1LA 3H7BB 4XXCA 3QQ3A 3MPCA 2AJ3A 3W11D 5JIPA 4N0FB 4QXUL 5SX5K 4Z77B 3KLHD 1P2CA 1SBSL 4Y19D 3V7AE 2ZSWA 3RA7L 2ZUQB 1T5WA 3MGOA 3CMOH 2D0GA 4UQ2B 2GJJA 4KRPB 3OKEB 3FT2B 4YHIB 3UTTE 2WINA 3CU1A 2D7NA 2A77H 3L5XL 5I6XB 2RJMA 5TE6L 3GB7A 4AIXA 2GKIA 3WXVL 3VG0L 4Q97A 4OCXL 1G84A 1S7QB 5I1EH 3QHTC 4UILH 4L4TD 1L6ZA 4RCAA 2HVKA 5EO0A 4IMLB 3UTZA 5FO9B 1QLEH 2GK0A 2QADD 3QA3A 4KUZH 1S9VB 5EC1A 4K8RC 2APWA 3RTQC 3VG9B 2A6IB 3TFKC 3CIQA 2DQCL 5JOFA 5FYKD 2E7BA 3MUJA 4LMQI 2HLAB 3BWAB 5IMOA 1AR1C 5BXFA 4GW5B 5GRXG 1LD9B 1I7RB 5T33H 1EFXB 3L5HA 2QSTA 3D85D 1N2RA 32C2B 1NGZA 3L3OA 1MCNA 3D3VD 4ONFL 3BP7B 3T0EE 5A3ID 4FQXB 5EZOH 5B8CC 1W8OA 4OD2A 1J1PL 3DXAB 3WKMH 5F9OH 3MLPA 5HHPB 4OZIA 3QFJA 1QSVA 3NAAH 3TZVD 1OY3B 2ICWJ 3OR7A 1F90H 3Q3GA 2OLDA 3WFDH 4ESKA 3UZQA 2R69H 4WUUB 5HDLA 3SJVB 3R0MA 1JZ5A 1D5BA 3OKDA 4JDTH 1HXYB 4PJXF 1KJ2A 4PJFE 3NABL 1WFTA 1MCHA 2Q6WA 5INDB 2ARJB 2EDDA 1KEML 1T1YB 1K5NB 1K8IB 3MV11 1ZHLB 3MC0A 1DBJL 5BO1L 1YY8B 1BVZA 4MB5A 4NNXA 2CQVA 2R0WL 4ODSH 3QEQD 1ZT1B 2B39A 4OZGA 1MJ7H 5HVGB 5FECB 3C08L 5MP6H 1QRNB 1INDL 1ZHKA 4LSQL 3VFVA 1A1OA 4JN2B 4QHKJ 2EH7L 4O00A 4Y5YC 5IJVA 2YEZA 4XWOC 3LKRB 3TWCH 2COQA 1PLGH 1UCBH 2AV1A 4FTVA 4H8WH 4DZBB 5I74B 5DMJB 4ZSOB 1T04A 3KPLB 4OCLC 2ICWI 1OL0A 3VFMB 4FFVD 5DRWB 3ZZ1A 4TUJA 8FABA 4OF5A 1IBGL 5DA4A 3VH8B 5MEPB 5DUMH 4C56A 1T0PB 2VITA 1GGCL 4NQDD 2MQCA 4LBEA 4XCFL 3CVHH 3VRIA 5MEND 5ICZA 2I26N 2QKIA 3ARRA 4PJ7E 5FYJL 3FQRA 1RUKL 4F8QA 1NGPL 4PIRF 1EJOL 4TQEL 3BGFC 4XH2A 2YKLH 5TQ2L 3GK8L 3HC4L 3SDYL 5GGTA 5C8JA 3FN0H 3DROB 2FL5B 4QHKI 4MVBD 3U7YL 2JJTA 1YN7B 3QNXB 4QCIA 1S9YA 3FMGL 4HGWA 2JKXA 1MIEL 1UM4L 1E4KC 3BT2H 5DI8A 3DRTB 4ETQB 4LLWB 5JPMA 4XHJC 1MAKA 3D2UB 5HHOB 3HI6H 3LKQB 3PWPA 2BSED 4R2GD 5SWSD 4LCWE 1S9WB 3FONA 5JIHA 4MAUH 2IGFH 1GC1L 1CVRA 4Z7VA 5K93A 3LKOA 1KPUA 4JRYA 3VWKD 3DOSA 1KXVC 3U30C 1LWRA 2DD8L 2BNRD 3DX6A 3UTSB 3MLWL 5BRZE 1A7OL 3SCMC 4N90D 1NC2D 4KK8C 3B2UC 3AROA 4PRIA 3TN0D 5EZIL 4RX4D 3DX9B 3MLVL 1T5XA 4L9DA 4JM2F 1MJUL 3ZL4H 3LMJH 5BOPA 3X3FH 4HKZA 4KY1L 2YD2A 3VI3E 4ZTPH 3HE6B 3O11B 3DI3B 4UNTA 2V2WA 3AGVA 4ONHA 4B7LA 1JHTA 1X4XA 3LEVH 1LO2L 2R2CA 1JTTA 1VENA 4P59H 2R23A 4FNLH 4WRLA 2NPLX 2X9WA 3ULVC 3VD5A 4HIIA 2V2TB 3MV9D 4K8RD 4OV5A 4NQEE 3RTQD 4PJ5D 4MDJA 2BOBB 1LEIB 1ZK9A 3KPMB 5TPWH 1QR1B 1F5WA 3TFKD 1QYGH 5E7FA 2YA2A 5ADOH 2D9CA 2WBKA 4QXGH 5ICXA 1A1MA 1NCNA 4YAQB 1AR1D 2XQYK 3I2CH 3RUGF 4K9EL 4O02H 4NRXB 1LILA 3FRPG 5C0RL 1D6EB 4YIQA 4ALAH 5GGRB 4JY6A 4YDJB 1JPSH 5DK0A 5HHXH 3BE1L 4CL7A 4Y4KB 2D31B 5CILL 4U6YB 1KIRB 1EBPA 2MQ3A 3MV7A 5CZXC 1HZHH 4GUPA 2DRUA 5EOTB 4GKSB 1NJ9A 2X4QA 3PV6A 4RGMC 4G3YH 3HAEB 3Q5TA 1TZHA 1T2QL 2IBZY 5D9SA 3S35L 2B7DT 4Y5VB 5T3XD 1W0WB 2DQEH 4NHUA 4M1DL 1RULH 4AT6A 3UYPA 1A9BB 4DTGH 1WAAE 5D2NB 1DFBL 1I7ZA 2VDMH 5C0AA 1HOCB 2HG5B 4AY0A 4UQ3A 2ZOLB 4AEEA 4D0BB 2HT3C 4P46B 4LNRB 4S0SD 3MOBL 3O2DL 2E5EA 2VLRA 5E8EB 4MNHA 3QDGE 2AK4E 1QO3A 1NCDL 3KLAB 3QUYB 1MRCL 3B43A 2P8MA 2GAZB 1A7QH 1MHCA 4LCIL 1C5CH 2DJUA 4XWOD 2BFVH 3MX0A 4QRUB 1RSFA 2DQHH 2BNUB 5DQ9B 4CVZB 1WWCA 1WTGT 1R5WB 1S5IH 4J1UB 5DZLA 3KPPA 2QHLA 5CJQL 3IF1A 5EIVA 1Q1JH 3MROA 4Y5XC 1C08A 3VFNB 3GSWA 4P3WA 4HXBL 3IT8D 4HS3A 1YEFL 4CMMB 2HH0L 3PQYE 1W0VA 4QRSA 4KJWC 4U05A 2JIXB 1YJDH 1MCPL 2CIKB 5SWZB 4L5FH 1YECH 3KHQA 1EZVX 3NACL 1RUQL 1G7QB 2VH5H 1VFMA 1NCAL 5ANMB 1KUMA 1RFDL 4J4PA 4XVSH 3C5SA 1F45A 3TM6A 4LIQE 1A2YA 2ZUYA 3OL2A 2FX8L 1MFNA 4FQCH 4HIJB 1PAMA 2MWCA 4R4BA 5GHWH 4LMQE 1X5IA 1E4XL 3M17B 1HINH 1K6QH 3WUZA 3GHEL 3C8DA 5CEZD 4Y7MA 4PJCA 1UZ8A 3I75B 4X7EC 4XHJD 1A4KA 1GAFH 1VESA 4DKAA 3I3DA 4CVUA 4PJGA 5DHXB 1F3RB 5ILTH 1K4CB 3IDJA 4XNMA 5F7FA 5ENWA 5F8RC 5D1XC 3T3MF 3VFTB 5GGQH 3SO3C 4P2RD 3ZE2E 1AIFB 3IJYB 5DWUH 3RAJL 3CDCA 5F7MC 5MEOA 5ICYA 2ED8A 1QSED 1FIEA 2CLRB 2ICES 4J6RL 2DYPA 2YD9A 1U8IA 3FQWA 4JZNA 1MQKL 4XVTH 3DVGA 3QQ4B 1SEQL 2CKBH 1MEXL 3ISWA 2AW2A 2AEPL 4XNZB 3O6FA 3ARBC 3SCMD 3UPAA 4KK8D 3FO1A 5HPOA 2EDBA 4KI5C 1X5LA 3P30L 3I9GH 3UYRH 1FIGL 2VDQH 4HJ0C 5DD1H 1OGAB 5DJ6B 5L2KA 4HXAH 1NFDB 4NWTL 2EICA 2NY1B 4FRWA 3A6OA 5C9KA 3CZFB 1BM3H 1C8PA 4NT6A 1LE5A 3KWWA 3ARDA 2GCYB 1A6UH 4JDZA 3GMOB 1MF2H 5IHUH 1TVHA 2JB5L 2XN9A 2VKWA 3L7FA 4XXCC 3NOIA 2J8UF 3ULVD 4ODVH 1QPXA 2PW1A 3NVQA 5GJSH 3L7EA 3VXUB 4QWWC 4ZPVB 3CMOL 4MD0B 4U1LA 2A77L 5GJTL 3U7AA 3KYOA 3PUCA 3STLA 4YXLH 1LP9B 3KJ4C 1ROWA 4NO0B 1CVSC 4OKVB 5I1EL 4EQ2A 3CSGA 4UILL 4X4XA 2V5TA 5GQBA 1QLEL 4TSBL 4PJEA 3EO0B 3CK0L 2EC9T 4LVEA 5FHBH 2AXHA 2EYSB 4OZFA 1MWAH 2F58H 4KI1A 4OZGF 2SEBB 4FFYH 4KK6D 4HKJA 1VSCA 4X6CB 4ODXB 1CU4H 3RDTA 1ZGLP 3CCHB 5ETUB 2OR8A 4Q58C 4LSDA 4UBDC 1WCBB 4XZUB 5D2LB 1ZANH 2DIJA 5LGJB 5T33L 3EYSH 5GSVB 2GK2A 1D5ZA 1K8DA 2AEQH 3BO8A 4N0FA 1J1XH 1T89C 5CS7A 4WV1C 2AJZB 4ZOAA 3DURA 3D48R 3EYOB 1I9JH 3WKML 5F9OL 2HT3D 4XHQA 1T0NB 3FT2A 3NAAL 2BJML 1Y6MR 5FDWB 3WFDL 3SQOH 2Z9TA 1S7QA 4K8RH 4Y1AB 4JKMA 2VDLH 5FO9A 4IMLA 4JDTL 5LXGH 3WD5L 1G0DA 3NFSH 3SE4A 3EW3B 1OM3H 3LV3B 1DUYB 2P5ED 4HCRH 1CTNA 1S9VA 1H5BA 4ISVB 2A6IA 3TPUA 3MJ9H 1JGVH 4EEEA 4ODSL 2ERJC 2XRAH 1MJ7L 3RWJA 1ZEAH 2HLAA 3BWAA 4P4RB 4M4PA 4WHYG 3MFGB 1FVCA 4LL9A 4KJWD 4Z76B 1PKOA 4GW5A 1LD9A 4PJ8A 1JWMB 3QEHA 4PD4K 3HUJB 5JW3H 32C2A 1IAIH 1R3IH 5HDOA 3BP7A 3QT2A 4FQ2H 4LDLB 4FQXA 3TWCL 1PLGL 1UCBL 5HI4D 3MRMB 5CJXA 2R1YB 1XIWB 5IK3B 5HHPA 4HUVA 1LQSR 5JIKA 2OCFD 4RZCA 4JAMB 1U8JA 1WBZB 4GFTB 4WW2F 5DUML 5K59E 4WUUA 3SJVA 3VI4E 3FQNA 4H0GA 4U0RB 3CVHL 1R5IA 3GBLA 5HJ3A 1KIUA 4L29A 1Y0LB 5IG7A 4PLOB 1ZHLA 4KVCH 3D0VB 2YKLL 2R39A 3RVTC 3EOBA 4CRPA 3HI1A 2BY0A 1ZT1A 3FN0L 2J88H 2JJTC 4K7PY 3VGAC 5C6TL 4JN2A 5D7IF 4KKBC 3D18A 4OCRL 4QRPB 2A83B 3BT2L 2VABB 3LKRA 4I0PD 1H3VA 1H3XA 1QSFB 3HI6L 4ZSOA 3ARBD 4N9GB 1DN0B 5I8OH 1FNFA 1CK0H 1XEDA 1UM6L 3PXJA 3VFMA 5DRWA 5DT1H 4JQVA 4KI5D 4ZFOL 4BH8B 5TF1H 2FEEI 4OD1H 5MEPA 5IBUB 4DKFH 4HJ0D 4U6HA 3RP1A 4MAUL 3IDGB 4Z0BH 4GRMB 4WI8A 5C0DB 3WFHB 4EQ3A 2APXA 3ZTNH 2ZNXA 4X6EA 4OI9A 5KVMC 4OIAA 2XY1A 2VL4A 3RX5A 1VB9A 4DGVL 5FV2A 5J1AA 3ZDYE 3DROA 1IKFL 3GIZL 2FL5A 3EOTL 2YD8A 2VMFA 3QNXA 4GLRH 3ZL4L 3LMJL 4FS0A 4Q9BA 4HJGB 3X3FL 2CRZA 3KHOA 4WWID 4QWWD 4LP5A 4ZTPL 4ETQA 4QHUA 1ZTXL 4LLWA 5HHOA 1LK2B 2VDOH 4KK5C 4YHZH 3LKQA 2VR9A 5I76B 1FFPB 4M61B 4P59L 3IDIB 1OAUH 4FNLL 3WIIH 3HCVA 4BQCA 1AE6H 5TH2A 4BFIA 5C0BB 1FJ1A 5TPWL 3JXAA 3SDXB 1U6AH 2PKDA 3GHBH 3K1DA 1QYGL 3L3DB 5E03A 4X98A 5ADOL 4QXGL 3UTSA 4UBDD 3I2CL 1ZVSB 4O02L 3HRZB 4BK4A 4LQFH 2X6MA 3GGWA 2WLZA 4ALAL 2VC2H 3QI9A 1JPSL 3O45B 5HHXL 2J12B 4O58H 2BSRB 5JA8B 2Y06H 3L9RB 3HE6A 3O11A 2FYYA 2OL3H 3RVXD 1L7IH 4YH6A 2OQJB 4KROC 2KPNA 1HZHL 3QFJD 3QO1B 3N06B 1R0AL 5I9QC 3OKKB 4G3YL 4OIIH 4PYGA 2EYRA 2DQEL 1KNOB 4XCEB 1AXSB 1RULL 3FRUA 4MHHG 2VLKA 2ZKHH 4ERSH 1CFQA 2V2TA 2VQ1A 1CGUA 1S7UA 4DTGL 2VDML 4BA8A 2BOBA 1IEAA 4Y2OA 5KVGL 1QR1A 3PJSA 2B4CL 1IQDB 3JWOC 3TGXA 3QIUA 2DQFB 5KANG 1RK1B 3N1QC 3ZLQC 5I8KH 4PJCF 3LPGA 3V6BR 3W81A 4NRXA 5DD5H 3NCJH 1D6EA 1FZOB 1A7QL 1A1NB 2VLJB 1AD9B 2YPLB 4Z7OE 3NGBB 4YDJA 4U3HA 2BFVL 2DQHL 1NFIB 2F8XC 4FTVD 4Y4KA 2RHEA 4OFDA 4G42B 2D31A 4OAWB 4U6YA 3WIHL 5K9QI 1HI6B 1KIRA 3QAZC 1AHWB 4ZO7A 2R2BB 1S5IL 5EOTA 3DPBA 1G7MA 4GKSA 3TIDB 3H3PH 3MLXH 1Q1JL 3LN4A 4IHOA 1MHPH 5C3LD 4C56D 3CFKB 3SGJC 1YJDL 4RGNE 3E6FA 1YECL 2ENSA 3DGGB 2I24N 4NCC2 3NCCB 5JOPE 1KTDB 2B2XH 2X10A 2YZ8A 1A9BA 4G9FB 2H2PC 3GKWH 4ODTH 5EZLB 2EDWA 4X5XA 2HG5A 4ZOCA 1J1OH 1OW0A 2VH5L 4GBXA 4NFCA 2ZOLA 3RVTD 4J4PC 2Y5TB 4D0BA 4LNRA 5E8EA 2EDRA 3KJ6L 4D9RD 2GI7A 4OZHE 2EECA 4FQCL 5GHWL 3B9AA 3QUYA 3O8XB 4KKBD 4KUCF 1Q94B 5E9DB 2GAZA 1PZUB 3RY5A 1HINL 1C12A 1K6QL 1OD7A 3CDGB 1TITA 4PRDB 4AZ8A 4PV8B 5I75C 1G7PB 5DQ9A 4CVZA 4HKBA 1L9NA 3MR9B 5ILTL 1XMWA 3PWPD 5IROA 5FM8A 4YX2L 3BZ4A 2NY5C 3WV0A 5GGQL 1WIPA 2A1WH 5EFIB 3C5JB 3QPQC 1ZHBB 4CMMA 2IPTH 2XWJB 4J3WA 3SKMA 5DWUL 2VKXA 3SKNB 2CIKA 1QRKA 1BZQK 1CFSA 3BISA 1CGVA 3ARYA 2RB8A 1I1AB 1RJCA 4DQOH 5DJDA 4JRYD 2R9HC 4MJ5A 4P3DB 4DUVA 4XVTL 4DZ8A 1C7SA 2Z91A 1G7QA 1P5VA 5J3HC 5DR5H 4NBXB 4PJEF 4MHHI 3TBTB 4PRID 3JWDC 4XWGH 3PDOA 4HIJA 1ORQB 2BVPB 2WBWB 4PJ9A 3I9GL 3UYRL 1YN6B 2KZWA 2VDQL 3O3AA 5DD1L 2QSVA 5FYLE 2FH8A 5L2JB 8CGTA 3WHXB 4YK4C 5FUCE 1WZ1H 2N7BA 3PHQB 3BH8B 4F33B 3QXUA 4TRPH 5DJCA 1BM3L 5BOZG 4G8GE 3W82A 2X41A 2PN5A 3VFTA 1A6UL 1MF2L 5IHUL 4K7PH 4YGVA 3S34H 1B0WA 3PHOA 4ODVL 2I9LA 1VFBB 3IJYA 3LEYH 3MRLB 5JQ6H 4X9FA 3BGMB 3ULUF 4ZDHA 4LHUG 5GJSL 2OSLB 4JFQA 2X4PB 4KPHH 1AXTH 3LHPH 1MCOH 4JE4B 3VXTB 4TVSa 3RWIB 2JCCE 1CXLA 3VFUB 1O7VA 1GOFA 2K9UA 3GRWH 3FQXA 3FB5B 4ZS7H 1KTRL 4OI7A 1JN6B 4OLVH 1AGFB 4AM0B 2NX5B 4HGKC 1XF3B 3MRRB 5FHBL 3T4YB 1G6RA 1MWAL 1GPOH 4F57H 1OGAA 3INUL 5DJ6A 1L0YA 4FFYL 3MV7D 3HFMH 1DQLH 4KROD 4R9HA 1CU4L 4H1LH 3RDTC 3CZFA 3I50L 5HI3C 1P1ZB 3OPZH 4U1MB 5I19L 1XGYH 1ZLWK 2IC2A 2YBRB 1ZANL 5F72S 3ARXA 3EYSL 3CMGA 1RJYB 1ZXQA 2AEQL 4OB5H 3HNTH 1V5JA 1J1XL 1ZGLM 3PP3K 3CXHK 3VXUA 5IOPA 5H35B 4N1CA 4P2OC 3MGTB 5ESQA 1I9JL 4HAGA 2MSPA 2VLRD 1EEQA 3OQ3B 3RIFK 5J1SC 1FNGA 2I9TB 1LP9A 1DVFB 3QXAB 3RVVC 4JFXA 5F9WB 4NQCE 4NO0A 4YBQD 3SDCB 3U46A 4YDIH 4K8RL 5A40E 1KPVB 2ITDB 3RVUD 2VDLL 5LXGL 2NY2C 5HGAB 3EO0A 3SE4C 5FXCH 1BZ7B 5D93B 1OM3L 4HCRL 2EYSA 1OQOA 1H5BC 2Z4QA 4F7CA 2SEBA 2VXTL 4JKKA 4DFHA 4IRSB 4AG4H 5FYJE 5HYFA 4ODXA 3MJ9L 1JGVL 2FR4B 5D7JB 4M7LT 1NUNB 1NDMA 2XRAL 5CKAA 5L8JB 1ZEAL 1OHQA 5ETUA 1MFBH 4HK3N 1WCBA 1R3KB 4OM0H 3CLFH 4PJ8C 5EU7C 5GSVA 5JIIA 4X6DB 4M7JH 2X4NB 5JW3L 3WDHA 1IAIL 1R3IL 2H2PD 4FQ2L 3V8OA 4FQXC 5FOBA 2P5WB 2KL6A 2AJZA 1EBAA 4JFFB 2EIZA 3EYOA 4J4PD 3TBSA 4KXZH 1OF2B 2MPAH 1QFWI 4R0LC 2RGSA 5JHDB 1MHHA 4BZ1H 3V0WH 3ARWA 4WDIB 5B3NA 4M3KB 1U8HA 2ICWA 4POUB 2CXKA 2QHRH 4JFEB 2OP4H 5INCB 3SGKA 3BRFA 2LTQC 4HWNA 4ISVA 1BD2B 1CXKA 1QKZL 1T83A 1ZSDA 3CH8A 4YDKH 4R7DB 2A9MH 3UJTH 1PFCA 2J88L 3QPQD 4P4RA 3R4DA 4Z76A 3KYMA 1YEDB 2V5SA 5GZNC 4LGSB