5F44A

Crystal structure of shaft pilin spaa from lactobacillus rhamnosus gg
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
265
structure length
264
Chain Sequence
TTTQNVVLTKYGFDKDVTAIDRATDQIWTGGAKPLQGVDFTIYNVTANYWASPKDYKGSFDSAPVAATGTTNDKGQLTQALPIQSKDASGKTRAAVYLFHETNPRAGYNTSADFWLTLPAKAAADGNVYVYPKNVQKTTYERTFVKKDAETKEVLEGAGFKISNSDGKFLKLTDKDGQSVSIGEGFIDVLANNYRLTWVAESDATVFTSDKSGKFGLNGFADNTTTYTAVETNVPDGYDAAANTDFKADNSSSDILDAPSGILP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cell surface protein SpaA
publication title New insights about pilus formation in gut-adapted Lactobacillus rhamnosus GG from the crystal structure of the SpaA backbone-pilin subunit
pubmed doi rcsb
source organism Lactobacillus rhamnosus gg
total genus 62
structure length 264
sequence length 265
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f44A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f44A01
3D9AL 4GT7A 2H32H 3EIFA 4NQVA 4PLKC 2XG4A 3EGSB 1A7OH 1YEKH 2DS4A 1I8KB 4P4KA 3BPNC 1NDMB 2IPTL 1LK3H 3EOAA 2BFVL 5I1AA 4R9HA 2I9TA 1L9MA 5C0JA 5I0DA 1CIUA 4MDIB 2DBJA 4HJJH 1JRHI 3WL9B 4APQB 4Z8FL 1N5AA 3WN5C 2P8PB 4G3YH 1M7DA 2ESVA 1WLHA 2ARWA 1Z9SA 3ZTJH 5DD0H 4LPVA 3GHBH 3U4BH 1MJ8L 3QJHA 3TVMD 4LLVA 4X6DA 3H9HA 1RULL 1SVZA 1FVDB 3D3VE 4ODTH 2EC9T 4C57C 4HUNB 4XXCA 5JW4M 5EO1A 2V2WB 4HV8A 2X4NB 4MNQE 4LNVA 1FV1A 2VLRE 2W0KA 2EKSA 5HGBB 3WNOA 3F5WA 1S7XA 5T1MA 3TJEL 1WEJL 2QKIB 3OXRB 1JYVA 1ZHKB 3PQYB 3MCLH 3GI9L 2DQTL 4E0RB 3P0YH 1MF2H 1BFOB 4PJDE 1GGUA 5HHNB 3TA3A 5EO9B 1F5WA 3QFJA 4NZJA 1HXMA 3BRFA 3MUJA 4N5ED 3CFKB 3V5KA 4NZTL 4KFZC 1Y0LA 1U6AH 4I48B 2QEJA 1RZGB 1AC0A 3NCBB 3QA3B 1C16B 4OLYH 4FS0A 1EFXD 1L6XA 2HT4D 3FB6A 3P4LA 1I4FB 2FD6H 1K8IB 3V7MA 4C56B 3IFNH 4O5LL 4F7CA 1AXSB 1JPST 4XNYL 4JJ5A 2ICWJ 1JPGA 1GGIL 5EOQH 4IDJL 3MLRL 1UVQA 3OGCA 1QBLL 5SV4A 4Y2DC 4P3CL 3N1GC 2ADJB 3GJFA 3L7EA 3MYJB 5JTWA 5HHOE 2FIKB 4XP5H 3WEXB 4TUJB 4LPTA 2L0DA 5DZLA 1CDGA 5FYJH 3QIUC 1AO7D 1FYTA 2CK2A 2FR4A 4BYHA 1PG7W 2LTQC 1T04B 4OIIL 1CG9B 4S0TD 2R15A 3QUXD 1Q72H 1TMCB 1CXFA 3C09C 3F12B 1G9EA 3HB3C 2W92A 3KR3H 3U0PB 1E6OH 2CIKA 1QYGH 4NP4H 4GRLC 1VFAA 1QNZL 3PWNA 4U1JB 5TQ0H 5H8DA 4MNGA 4L9LA 2C4XA 2DRUA 4N5UA 3V0WL 5C0CE 5FB8B 4OF7A 1L7IH 2ZPKL 1A64A 3DMMD 4LSTL 2XV6B 4L8CA 5DHVH 4GAGL 3G5VA 1MH5B 3PV7A 4ZOCA 4K8RD 3M1BB 1MIEL 3Q5TA 3RVXD 3OB8A 3G5XB 1KJ3H 3S7GA 1A6VH 1S7VB 5I66B 2GSIA 4NKOB 4WCYH 1AGFB 1FFRA 2R29H 3ULUL 4OT1H 2CO7B 2K7QA 4DW2L 4ORGA 3T65A 5I71C 3WXWL 2E9JA 4WEBH 3BSZH 4KDTC 2HFGH 2P44B 3SE4A 4V2CB 3QRGH 4NO3A 4LIQL 4ODSH 1INQB 2R0LL 5GGTL 3QEHA 4HJGA 4XNZC 1UZ6E 5D7JD 5CSZB 3KPRD 4PJDF 5D1XB 4KHXL 1BFTA 5JIHA 3TPKA 1T6WA 2C3XA 2PYED 3ARDA 3DX9B 2B4CL 3D18B 4MSWB 3I75A 5I18H 2H8PA 4IRSB 5CLWA 2CDEA 3BDYL 3VXPA 2AK4E 3T4AA 4LEOA 4PLNC 1U8PB 5B8CC 1LEKA 1N59A 1OGAB 4HS6B 3NCCB 4HQQH 5CEXB 3JTTB 2ESVE 1CFTB 1F42A 4NHCL 4M03A 4PJIB 2UZIL 2KH2B 5J3HD 5L2JB 3C5JB 12E8L 4LVHB 5MI0C 2YSSA 4KJWD 3O3BA 4PS4L 3UAJC 5JOFA 3DVIA 1SQ2N 3GBML 1EH9A 4X6DE 2WP3O 2FEEI 4G43A 4LU5L 2JTDA 5BQ7A 5B22A 4MJ4A 1TJHH 5DGQA 1T7YA 1Q0YH 3QHFH 4GKOA 3UAJD 2H3NA 5FO9B 4YWGL 3ARED 5ETUB 1QSEA 4GW4B 5GJTH 3CSPA 4B5EA 5CBAB 5I17A 2OR8A 1ORSB 43C9A 3FN9A 3VXRD 3S34L 5K9QI 4JFYB 4BH7A 1P84J 1JWMB 1NCAL 4JPWL 4HC1L 5EPMA 1MFDL 2XWTA 4PJ9C 5GJSL 1YYLH 4XB7A 1F97A 3LS4H 2VNCA 4E41B 1NANH 1P4LA 2CDGB 3D0LA 3QFJE 2ADFL 1OOAA 4ZO8A 3EOTH 3X12B 3BPCB 5EC1A 3VWKC 5CGMA 2DOCA 1NEZA 3ZE1E 2IPUG 5K33A 4X5XB 5EUOB 1GZQA 4BUHA 3MACL 5KW9H 5IJKC 5L6YH 4U05A 5EZOH 1EGJA 1K4CB 4OV6F 3R8BB 3QIBA 2FRGP 3DVNB 2QLVB 4GW1B 4MDJA 4JN1H 3FOLA 3LEYH 1MHPH 4ISVA 4NZUH 5IGXL 2W60A 4ELME 2HKFH 3QXAB 3CFDB 3D39E 4MZ3A 3HNSL 3KPPB 2OYPA 4FABH 1YPZB 3T1WA 2R0WL 1DUZB 3C2SA 2VXUL 1LO3L 1A7NL 3WFEH 4DQOH 4TYUA 1TJGL 1JF1A 2P8LA 4NQXB 3W9EA 2P24B 1EVTC 1KPUA 3GMPB 1KEMH 4PGDB 1K8DB 1T66C 2G9HA 1G6RA 1FO0A 1UEYA 1H8SA 4LSUL 4QRTA 3X3FL 4NQDB 3MRQB 1WSST 4PJBA 1JHTA 4JFPB 4WTWA 4Z76B 4KZEH 3HZYB 4HIEA 1GH7A 1C12A 4NCC2 4Z0BH 4O58H 3ZO0A 5EZLA 5I15L 2P49B 4NN5B 5D70H 1UT9A 1H8NA 1I85A 5T1DL 3D69A 4MNGE 3FQRB 2P48B 4QHUB 1FJ1A 2CUHA 3L95B 2R8SL 4DZBA 3MLTA 4X6DF 3TN0C 1MI5D 4OLWL 1AKJB 1AGDA 3TO2A 3HC4H 1JPTH 3FQTB 3T77B 4D0DA 4NSKA 4TNWF 2YZ8A 1WT5C 2OBGA 5EOCH 2FYYA 3T0DA 3IXAB 4RGMB 1DQJA 2DTMH 2NZ9D 3OAZH 1HWGB 4Q9QL 1NFDE 3C9NB 4GRMA 2BC4B 1G7LA 2ZSWA 3G5YB 1SY6H 4Y16C 3C08L 5FHBH 1M71A 2VSDA 5C0GA 4OLXL 4Y1AB 3D2UB 1FSKC 4FQ1L 4S1DC 3MX0A 4WTZA 3EYQC 5CKGA 2VDRH 1BOGA 1I3UA 3R8QA 1KENL 2QADD 3QCTH 5JIIA 1NC2B 4JKKA 4BSWB 1C5BL 5TF1H 1CICA 4MX7A 5TE6H 2RBLA 1RMFH 5A2FA 4KK9C 2ZSVA 4HH8A 4I2XB 3KXFD 4PGCB 3WXVL 3VXSD 1HCFX 3PNWA 4F33A 2VXTL 5E8DH 4TNWK 4LEXH 3STLA 4R6UA 1AD9B 4P99A 5K9OB 2D31A 3G6AA 4YFEA 1WFTA 3SDCD 4U1NB 2NY0C 3RKDC 1JGLH 2LU7A 5EBMA 4LSVL 1J11A 1RUAH 4PY8J 1ZSDB 2WUCH 3OAYK 2Y7QA 3V2AR 1ZEAL 4FQJL 1Z6JT 3AS2A 4RDQF 3VI3E 1BBJB 1QSEE 3NIDE 1F4AA 5DK0A 3SQOH 3WUWA 1FVEA 4KVNL 4HT1L 3PHSA 3ARPA 4JB9H 3QNYB 1IQWL 4UIKH 3N1QC 1SMAA 2IBBA 3IDNA 3QUMA 4L8SA 4XB8A 2MCPL 4ZFOA 2DKMA 4RSVA 3SOBL 1JGVL 5ESQA 5E2WH 2VKXA 4HWBL 1BD2D 2A1WL 3GMLA 4UTAH 4NO5A 3QEUB 5HYJB 5ADPH 1YZZA 4XMPL 4LKCB 3PGDA 4PG9A 2Y36L 4JHBA 3DXAB 1FAIL 4XNXL 1V05A 4ZQKB 5J9PA 2W9EL 3QUZC 3WJJA 5DFVD 3MR9A 1JN6B 1X4ZA 1RHHA 3QG6A 5BXFA 2F54D 3ZE2F 1JPFB 3MUZ1 3OR7A 3MRPB 1UWGH 5GZNC 1U8NA 5EU3A 3GJFK 1F2XK 2PW2A 4HKJA 4PRPE 2AJZB 5BMFH 4R4FH 3WS6A 3HNTH 2GTZB 5CJ8A 4GJTB 4LVOB 5I73B 4UB0L 4HWEL 3CFCL 2APTA 4NBZB 1EFXA 2NY4D 3VFOB 1HSAB 3TT3H 4JG0L 4GMSH 1VCAA 2OTUB 4N0RA 2AJ3B 4BZYA 3JXAA 4ZUWA 4CVZA 4YNYB 4OCYH 1CR9H 4OCSH 3UTPD 4BFEA 1MFCL 3H2WA 1NGQL 1R24A 3LHPL 1RFDH 3I02B 3I6KB 5MEOA 5I19L 4AG4H 2ZUUA 3MRFA 5IBLD 1IEAA 3HFML 5FKPA 3TYGL 1PDKA 1YYMH 5KSAD 4I5BB 4C83B 3C2AH 4PJBE 4ZG1A 2Y06H 3RIFF 2JJTC 3WYRA 5LQBH 1AO7A 4OZFB 1N5YH 4R2GC 3U6RB 5L88L 3HR5A 5ID1B 5FOBA 1OTTD 1EHLH 3ZKQD 3QUXA 3I6LD 4ONHB 1HXYB 3VGBA 2VLLB 4OSUH 5I8CA 3C5ZD 5JNYA 5EC2B 4LKXA 2YA1A 4RMVA 4ZXBC 1ZLWK 2DWDA 3ROOA 3ARBB 4MCZB 4R8WH 2BSRB 1S8DA 3BP5B 4J12A 4HMDA 4XBPB 4AEFA 1C5DB 4FFYL 2G2RB 3DMMA 4GMTL 3D3VB 5F97E 1JV5A 5C9JB 4O2CB 1KNOB 2NMSA 5DJDA 3TLRA 4M62L 4LLQB 3WO4B 4PJGB 1XF2A 1HYSC 1XAUA 2EDJA 4MNQB 5E4EC 1W0VA 5FYKD 2FX8L 1CK0H 3FT3B 2VLRB 4U1GC 3GJEA 1SBSL 3RIFK 3TC9A 1JNHB 4HBCL 4KHTL 3TNMB 3ZE0E 4PRBA 4LLDA 3EO1B 5KG9B 4XP4L 1Q1JL 2EZ0D 3BGFC 3VE0A 2XZAL 3KG5A 4OCLC 1FGNL 3TBVA 2V7HB 1F13A 1T03H 4NGHH 2X1PA 3BH8B 5KVFL 3FCTA 1G7QA 1XFPA 4KAQH 1KGCD 5EU4A 4DUXA 5JHDE 1FZJB 1EERB 4M9OA 5D7SL 2V5TA 4PJ5D 5D7JA 3KPRA 5DRZB 4F8QA 4OI7A 2XQYG 1MHEB 1OP3K 2YHGA 5J1TC 2PYEA 1NBZA 2NNAB 3I6GB 4I77L 1XF3A 2HTLC 3MLXL 3PP4H 4WUUD 1E27A 5JLZB 1BFSA 3S35L 2Z35A 3ZKNC 5DTFA 5J8OA 4EUPA 4I0KA 1BVLA 2CIIB 4WO4B 3OMZA 3LQAC 4EI5D 5SX4I 3ZHLA 4HIJA 2P7TA 2X70A 4UT6H 6CGTA 4D9QD 3AU1A 3GRWA 2D4FA 5DJYB 4R3SA 4YPGB 3L5WA 4XPTL 4P46D 1AIFB 1MFEH 3HLAB 4AY0A 4LSDA 1CDBA 5HHOB 3QSKB 3AREA 2GJ6D 1A14H 4H25A 3K4AA 5FUOL 3ESUF 3RNQB 4G8IB 4PJBF 1P7QB 1J1OL 5T1LB 3GSWB 2PXYC 1BZ9A 2HVJA 5E7BA 4NRZB 5INCA 4HX1A 2PUQT 3QULB 5EULV 5GSVB 4UDTA 4BZ1H 4OJFL 2VC2L 4C58B 4PLJC 1A9EA 1OAYL 3U4AA 2X7LA 3T3ME 1LMKA 2IH3B 2ZKHH 3RUGE 3L1OL 4Z78A 1I7RB 1A4JB 3S8WA 3Q6FA 5DJ8A 1FZKA 2WWKT 3EYUL 3UJIH 2ICWI 2K1MA 3FAWA 1WQVT 1G7JA 2YD1A 5GS1B 3P11L 4HG4J 3LD8B 5HVHB 1GHFL 2VQ1A 3EDJA 1PEWA 5FA3B 2NPLX 3MLZL 1QKZL 2FBJL 5DEGB 5BRZD 1U3HB 2W07A 3FKUS 1FG2B 4KQ4L 3HPJA 3IGAB 1NFIB 3VFPA 4XCEA 1Z5LA 1BLNA 1CS6A 3BMWA 4WWKB 4QKXB 1GPOH 5EOCJ 4OGYH 2VXVH 1F6AB 2EDEA 1A6ZB 1AO7E 1NEUA 3H42H 3DHJA 2XICA 3TWCH 2AK4B 4M7ZC 3QDGD 4DOHE 5SWQB 1EEQA 1CD8A 3EJYC 3C60C 5J1AB 5C6PB 1M7DB 2FX9H 2ESVB 1SVCP 1KCSH 5BZWB 1N6UA 2NY3D 3VXMD 2XTJD 2XWBB 3RWCA 3EYVB 5E6YA 3LKQA 4X6DB 3C6LC 3UZQA 3BRGC 1B0WA 4OB5H 2ED8A 1MI5A 2C4FU 2JIXB 3SGEI 1AHWB 2ZUQC 1ONQB 1SEBB 3IJHA 4QLRA 4BM7A 1FV1B 1WVZA 4HKBA 4QY8A 3ETBF 1XF5B 2DLGA 3HR6A 4MHHG 4I3RH 5LVEA 2JJVA 1KC5H 2B2XL 4KY1L 2AABL 4D0CA 1JNNL 3GKWL 3U83A 4C55A 4CJ1A 3OKKA 3ZT5A 4PP1C 2GHWB 4RFNB 3O45B 1B2WH 3DNKA 4OQTH 3KPRE 5DUBB 2C1OB 1A3LH 4JGJA 4F7PB 3BKJL 4YHYC 5DQJA 5J57B 3LVEA 3RUGF 3PP3H 5JZ7C 1ZLSH 1XR9A 4OZFG 3K2UH 4HKZA 1JYWA 4QHMB 1IM3B 3KXFA 5DURB 4OZIA 3VXSA 1U58B 4Q97A 4OBRA 2Q7NA 2XN9D 3SDCA 2JB5L 2O5XL 5F3BB 3I50H 2YBRB 1GGCH 4UT7H 1F8TL 1M6OB 3PABB 4ELMB 4JM2C 1JGEB 3D39B 1NSNH 2CR6A 2I26N 2PO6D 1JZ5A 4KKBD 4FFVD 1CFNA 1GOGA 4MD4A 4HGKC 4UV7L 4X7TA 4G9FD 3O2DA 2AGJL 4D3CL 4MB5A 4HK0B 1HHIA 2FR4B 2CLRB 3ARSA 4KTYA 5DC4B 4F57L 2LABA 4HCRL 1ED3A 2APBA 4L29A 3S36H 4JFHE 4QRPB 4Z0XA 4JPIB 1I1FB 3V6ZB 1IT9L 1IAOB 5J6HA 4NJAL 5F9WB 1BD2A 2N1KA 1R5VA 3UYPA 3T04D 2PTTA 1F11B 3GSQB 4NNPH 5I1KH 5C9KA 4MNGB 2L7JA 2ZJSL 1IGIL 4PRID 2NX5D 4NO2A 1EHXA 3N9GL 1NAMB 2JB6B 5HHVH 4PV8B 4QCIA 1YEFL 2CRIA 4QF1A 4P5TC 1NFDB 2ED9A 2GUOA 1T1XB 3OZ9H 4NO3B 2YMXL 3HAEA 5IQ9A 4X4YB 3SGKA 5T3ZE 1UYWH 2DLIA 4N0YH 3WD5L 1AP2A 4WHYG 2QSCL 5I76B 2EIBA 2Z93B 3ARDB 4XNQA 4YDIL 5KSVA 2H8PB 3T2NH 4QGYA 3O6KL 3MCKA 2WQ8A 3S37L 3KWWB 1SEQH 5KSAA 1PFCA 3INUH 4LSQH 3MV9E 1RUQL 4OLZL 1NAML 5I1GL 4Y4HD 4JO3L 1DLFH 2IAMD 1SJEA 3D0VB 1DBAH 1A6WH 3MRBA 2R1YB 3O3BB 4ZAKA 1FPTL 3HRZA 3ZSSA 1DQQA 3C5ZA 5I1DB 4X99A 4MS8D 4KRPB 2ICWA 4PGBB 1BM3H 2XA8H 3VG9B 4LFHG 1I3GL 5I17B 4YIQB 4MA7H 2ZCHL 3TO4B 4HF5L 3IVKB 2Y25A 2D03L 1H15A 3CMOH 4HK3N 5FO7B 5SWSD 1NLBL 5E8PA 4X4MA 3KPSD 4LSSL 5F7EH 4ZUTB 4Q58C 5EPMB 4KI5C 4W6XB 2J2ZA 1WBZA 2HWZH 3RX5A 1JK8B 3D0LB 4J3OC 1XF1A 1P1ZA 3RTQB 2AJUL 2NW2A 4LGSB 4G6JL 1BJ1J 4R90L 3VDAA 4KKLC 1UKTA 4K7PH 5IWLA 1NEZB 3HMXL 4GKZB 2QV2A 2D9CA 3ESVF 3CSYB 3E6FA 2X1WL 1A7PL 2NXZC 2C1PB 1ADQH 3KXFE 4OZIE 1WZLA 2W0FB 1YDPB 4JPKL 4PJ5A 5DK3A 3UYRL 4PRPB 4N0CD 4XCYA 4PY8I 5C3TA 4IRZL 2F74A 2ITDB 4LDOB 5IR1B 4YXHL 4HBQA 1VB9A 4NM8H 3ARTA 4ISVB 5EO0A 5HGDB 5TDNA 4ZOEA 2F58H 1QQDB 5E5MA 1KEGL 1I9EA 3QI9D 2W60B 4XVJL 1P2CA 2E7LA 3S3JA 3OKNB 4TRPH 3AC0A 5KN5A 5D1QC 1U41A 2V7NA 4EI5A 1C5CH 3KLHD 1ORQB 3KPMA 1JF1B 4JPVL 4J3XA 3QWOB 3MBXH 3W9EB 1M7XA 3GUTA 3LRSB 4OKVA 4R7NA 4ODUB 5CJOH 3KPTA 4KTEH 4XVTL 1G6RB 3L6FA 2MQ0A 2FIRT 1AQKH 3SKUD 1DCLA 4JQXA 3REWA 2GJ6A 1JHTB 2ZOLA 5F6IB 4GAYB 4M1DL 4O9HL 1BD2E 1EK3A 4HJ0C 1R3IL 3MOBH 4HAGA 4MJ5B 1VPOH 5KJRH 1S7WA 3MFGB 4KKAC 3D69B 5BS0E 4WI4A 3U9PL 4NN6B 4GUPB 3MJ9A 3FT2B 2F19L 4F2MB 5ISZD 3D48R 3NIFE 5BJTA 3DSFH 1YUHB 5JUEH 1AGBB 2VZ3A 4Y5XC 1II4E 5IB4A 3PL6C 3WFCL 1MCBA 5J1SC 2FYYB 3QEGL 4NQUA 3D9AH 4U7SA 4WI5A 4LCCC 1KACB 2G5BB 3B9DA 4U7KA 5BCAA 1QBBA 2IPTH 1M71B 1X4XA 1Z9MA 1WCBA 3LKRA 5EBGA 3KHOA 4QXWA 2A6DA 4Q0XL 3T8XA 3Q1SL 4U3XA 3H8NA 3UTPE 4BKLA 3MROB 3WIFB 4LLMA 4JANB 3R1GH 4PREA 5BRZA 3Q3GA 1MJ8H 2SEBA 5B21A 1QFWH 5HGAB 3U79A 1RULH 2VAAA 4HUVA 2ZP0T 3GSXB 1F4YH 3P3YA 3FQNA 5JHDB 4LVNC 3AMKA 4F33B 2RCSL 5J11C 4OZIF 3LEXA 3EO9L 1YNKH 3S3PA 4UZGA 3JSSA 4KROC 1KB9K 4HUUB 1WEJH 3QDGA 2D7MA 5F96L 4L3ED 5IEHA 1FZMB 3KYOB 4Y89A 4OFKA 5E2UL 3UBXI 2DQTH 2LU3A 3ARVA 4M4PA 5J89A 3MJ8A 5MP6L 3VXMA 4U6YA 3MNWB 3WUWB 3DETC 3MBEC 3TFKD 2MKLC 4RMTA 2CUIA 4JDVA 5GZOC 5EOTA 3G04B 4X4XA 3QQ3B 1UM6L 3A6CL 4WJ5A 3IDNB 3P0VL 3P4NB 4X4ME 5GGRY 3U30C 3SDAB 1MWAA 2WIIB 4JFDD 1F3DH 2FL5A 2Y4SA 4RWYL 2BOCA 2IQ9L 2OQJA 4AK1A 5CHNA 5A40E 4LLWA 5BVJA 5C0DB 3PGDB 4O5LH 4E42A 3IFOA 5HDQL 4C59B 1E28A 2OK0L 5J9PB 4IDJH 2Z8VC 3VDBA 4S1RL 2OZ4L 1RHHB 2X05A 2DM7A 1EDQA 3CVHL 3MLRH 1KIPB 2ID5A 2N7BA 4DGVH 1AGCB 2F5BL 3NIFF 2O5YL 5CJQH 4RGNC 1U8NB 3RUGB 4PJ5E 4JKLA 3U2SA 1BX2B 2PW2B 3BESR 4OM1H 4WFED 4JN2A 5ERWA 1DEDA 1NANI 2OTPA 3HE6D 1BVZA 4E5XB 2DDQH 5HVGB 2X4OB 4OIIH 2ARJB 5K59E 4O51A 3SN6N 2H32A 3PWJB 2A83B 4CVZB 1ZOXA 5D4QA 4DZ8A 4KTDL 2AI0H 2XN9A 2L4OA 1QNZH 1WAAE 3GIZH 4M1CC 2Z91B 4J4PD 1RZJL 1IEAB 4GQPH 5F88A 4ZYKA 1TETL 1FNHA 5E95B 4LSTH 3SJVE 4GAGH 5LCVL 5CAYB 2GJ6E 4U3CA 4G6ML 1TITA 3RL2A 4PJ8D 2IALB 5JQHC 3RIAF 4G9FA 2XG5A 5D72H 4YHLL 3X11B 4KDWA 4ODWA 4WWID 2A6JA 1R5WB 2VZTA 1MAML 1QO3B 3ULUH 2EXYC 5E94A 2R9HD 4DW2H 2EE2A 4DOHB 1IGJA 5DRWA 2XZQL 5I8CB 2LE9A 1LDSA 1K9TA 3GGWA 4LIQH 2DD8L 3QG7L 5E70A 7FABL 2R0LH 4OAWA 3GB7A 3ROOB 4FTVD 3QUKA 4M4RA 3K3QA 2PTUA 4YBQC 1X5FA 4N9OB 4TUKL 2NXYB 5T1KD 2B4CH 1JV5B 4PRIA 1PYWB 2WUBL 1NGYA 5SX5K 4JFED 1UJ3C 5DJDB 4QXGH 4P5MB 4A6YL 1D5MB 4FQ2L 2NX5A 4MQXC 4KJPD 2Q3AA 2WSKA 3V7AG 2RAMA 2GK0A 2OL3A 3C8DA 3N1MC 5IIEA 4LSPL 4V1DB 3V79C 1BZQK 4WI3A 3RIAK 3OPZH 5E0QA 4NHCH 3FO2A 4HH9A 2UZIH 4IOIA 4LLDB 4WTXA 1TXKA 4DN4L 5KS9E 5BRZE 3VE0B 12E8H 1DN0A 2Z4QA 4GXVL 3CSGA 3E2HC 4PS4H 3DV4A 4Z7UB 3GBMH 3Q6GL 5T3XH 2DQJH 4LU5H 1JBJA 1X9QA 2HA1A 2BXYA 3RVWC 1G7QB 2R23A 3FONA 3ZHDA 1OAKL 1VFBB 4QYOB 1IGFL 2DQCL 3WJLC 5M94B 1JF6A 1NBZB 2GKIA 1XF3B 3N0PB 1HHHA 3O8XA 3PHOB 4J1UB 3IETB 4NQED 5AG8A 2HJKB 3CZFA 1IBGL 1YMME 2ZG2A 1ZT4B 5SWZD 3T0ED 5T33L 5DTFB 1ZS8B 3MGTB 3S4SA 4JPWH 4HC1H 3DRTA 5K59F 1MFDH 5GJSH 4Y4HA 4G7YH 5HPMB 4LHUD 4PJFA 5JPMA 3MJ7A 2DM3A 4HIJB 2IAMA 2P7TB 1KTLA 3HHRB 4OFYD 3VXME 4BJLA 3RY4A 1QEWA 3AU1B 1YEEL 2CKNA 2ZUSA 2Q76A 5K93A 3B5GA 3L5WB 4WFHD 1FRGL 5DR5L 5B4MD 1AGEA 1WAAF 5C70A 1DL7L 5DS8A 4C4KO 3BPLB 1TJIL 2BVQB 1CGVA 3F8UB 3LKSA 3DGCR 3V4PL 2CMRL 4NZRL 1NCNA 3E3QC 1Q0XL 2FO4B 3MOQA 1CIDA 1JUFB 1NUNB 1RK0B 3EDDA 4TVPL 5DHVA 4Q7DA 1FLTX 1QG3A 1A47A 4I18C 5D1ZD 4JO1H 5MERB 5SWSA 3KPSA 3MLSH 2Z31D 5GGUB 1LO2L 1XF4A 4PD4J 4AH2A 5IGXH 4LOUD 3BO8B 3PV6B 1MPAL 3MO1B 2R0WH 4Z78B 2VXUH 1LO3H 4P2OD 3W11C 1A21A 3DARA 3GMQB 3Q6FB 3AM8C 5CWSA 3LEVL 2R2HA 3RZCB 1UCTA 3NFSL 1F4HA 1J0HA 5FGSA 1NBYA 1JZ6A 1A6AA 4LSUH 1QUNA 2XQBH 3X3FH 1D7FA 2XPGA 5IVZB 3W81A 1JGUL 1R3KA 2VQ1B 2BVTA 3GMMA 1YJDC 3TBYA 4JRXD 5I15H 4W6WB 3UBXA 5T1DH 5BV7B 3KPLA 1CGWA 1DBMH 3S88H 1QBML 3BISA 3QI9A 1T5XA 5IKCB 1XGQA 4H5SA 4Q6IA 1EJ6A 4AEHL 2ATPA 4OLWH 1DQTA 3P4OA 1A2YA 1T83A 4TSCL 4MQSB 1OPGH 4G9FE 3FN0L 1QSFE 4JO2L 2Q8AH 3FRUB 3REVB 2D7PA 4Q9QH 4M5YH 3WDHA 3MUGB 4MXQC 4K7FB 4PB9L 3MV9B 3C08H 3P30H 4ZFFA 3QEQE 1OM3H 2DLFL 2YWYA 4FQ1H 3CFBA 2MQ3A 1MCCA 5BV7L 3L3HA 2XOTA 2O61A 4HUKB 1HILA 1KUMA 1KENH 2V17L 2VDLL 1MLBB 5I74C 5ISZA 2E6JA 2YS4A 2HT2D 1C5BH 4PRIE 4WHTB 5T3ZL 1CD0A 1P84K 4MAYD 2D0FA 2NX5E 4PRDA 5CZXD 4ETQA 4HKBB 2RHEA 2VXTH 4UQ2A 1QTYT 1XGTB 4NYLB 3JV0A 4D0CB 2J5LC 2FHCA 3QRFM 1Z3GL 1GGBH 4D9RE 1AR2A 4FQIL 4CNIB 5TPWH 2XY1A 3IXTA 4M93B 1RPQA 2VYRE 2DKUA 4IDLA 1ZEAH 4FQJH 3HPLA 1NH6A 3FZUD 3VXUD 3QPQD 3CK0L 1TNMA 1TZHA 4KVNH 1OW0C 4CGTA 3DVGA 1BJMA 1NDGB 5EU6E 4D8PA 2WP3T 1IQWH 4BH8B 4HKZB 1Q8MA 3V5HA 3VRIA 4OZIB 1F3DJ 4MLIA 3AS3A 1PZUB 3SOBH 5L7XL 5MENB 5FYJE 1RZ8B 5B38B 3NIGE 4J3WA 4HWBH 2A1WH 4PJFE 1IM9B 4P57A 5HYFA 4XMPH 4JAMA 1O7VA 2C3VA 2OTWB 4G7VH 3PGCA 3KYMA 4GLRH 25C8L 2W9EH 1RJLB 3GHEL 4L3EA 2NY5H 3V4VL 3FQUA 1MJJA 3V52L 1OGTB 4YO0B 1ZHLA 5DMIH 4Y19D 5IVOA 4DKFL 4P2QE 1FL6B 1C08A 3VJ6A 2QR0A 3QUYB 1I8MA 1HQ4A 3ULVC 1XGYL 3LZFL 3CD4A 5I1LB 1XZ0B 1ED3B 1P9MA 3ISWA 4XGZB 4XMLL 5SWSE 3GMOB 4UB0H 4HWEH 1IAKA 2IADA 1R3JB 5J6HB 2GJZA 2V9QA 4JG0H 2G5RA 3KPQA 5IFJA 4G6AD 4UAOB 5C0BD 4AIZA 2A9NL 2GSGA 4XP6L 1KPVA 4GOSA 5BS0B 1HK6A 1ZMYA 1OTUD 5TE4L 3LHPH 4U1SB 3T0WA 1SY6A 4KRMB 2KZWA 5E6ID 3N1PC 43CAB 4AJ0A 3BAEL 1VERA 4ZNCD 3U82B 5D7IB 2BVOA 3ZKMC 1W2KT 4NO2B 3ARFB 4XMKL 2AKRB 5GISL 2HKHH 2EH7H 2XFXA 1X5GA 4V2BA 3HE6A 4I4WB 1F3JA 4X8JB 4CN1A 4FZ8L 4NKQB 1KT2A 3OKYA 3IDGA 2E3VA 2E7HA 3E6HA 3HAEB 2A73B 3MLVH 4QNPE 1IEBB 2WBJC 3JUYA 5HI3D 3O4LB 3VRJB 1KLFA 5KSBE 5CLTA 1HSBA 3ILPA 1I7TA 1WWAX 3JVGA 1A7RL 2OR9L 2VUOA 4P23D 4WY7L 2GYSA 4J4PA 3HN3A 1BAFL 3EOBB 4S1QH 1T20B 4FFYH 4EN3D 3MCKB 2C9AA 4HKXB 4GMTH 2BXZA 2X40A 4M61A 3UP1A 2HTKD 4GBXC 4PJ8A 1PVHA 3EDKA 4MLSA 1XR8B 1FORL 4OZFH 4OZGA 1SBSH 4U6XB 3OTTA 1SJEB 4HBCH 1WJ3A 3QYCA 3HTLX 4PJFF 4ZAKB 1N64H 4XP4H 1QHOA 2XZAH 3BKCH 1VADA 1FGNH 3R0MA 3TM6A 4X99B 2EYTB 5A2IH 3WHXB 5KVFH 3QO1B 3WNMA 1UQSB 1R3LB 3VWJD 2NY6D 5TF0A 5D7SH 4FTVA 2VLJB 1SJHB 3WSQL 4TPRL 3B6SB 1EAJA 4Z7VE 4I77H 5F7WC 4EQ2A 3MLXH 1WBXA 1MVUA 3T2QA 2BHZA 4JFEA 1UEMA 5GQBA 4KJQD 3O3UN 3S35H 4U1MA 1WBZB 3OKDB 8CGTA 4QT5B 3GMNB 3UPRA 1P1ZB 1Z9OA 3O9WD 4OCMC 3WLWD 5F9OL 4BK5A 1UJTA 4XPTH 3IKCB 2VITA 1EZVX 5B3JE 4IS6B 1P5VA 5CD5D 5I1CL 1XIWD 2Y72A 5DI8B 2VDNL 4BK4A 5FUOH 2F74B 3U1SL 5FDWB 1CD9B 4MJID 1J1OH 4O2FA 2AXHA 4YUEL 2WAHA 5SWZA 3T0EA 4ORZC 2W91A 3MRJA 5KN5B 3QIUA 1BZ7A 1OAYH 2VLME 4UI2A 4LHUA 4QNPF 3SCMB 4OFYA 3VFWA 4U31A 1F00I 5L2KA 4OTXL 5ANMB 1EPFA 1N2RB 5C0ND 3L6FB 1NCTA 4GRLA 5GGVY 4RRPA 1F2QA 3SJVB 5DO2D 4WHYH 4ACPA 4UINL 2Y1VA 3MFFB 3P11H 5HGGS 4JFZL 1MHHB 4PUBL 5A16B 9CGTA 3FB5A 4Y4KD 1J1PL 3MLZH 5D1ZA 2JJSC 1C8PA 5H94B 1QKZH 3LB6D 2FBJH 2CGRH 2F8OA 4NO0D 3FT4A 2HP4A 4KQ4H 1X5JA 5GGVH 2X09A 2CJUL 1KJMB 1RIUL 5IB4B 2OI9B 1X7QA 3MMEA 5FO8B 2P5ED 1MNUH 3HRPA 3IB4A 5DQ9B 5B38G 3O6FC 5KVDL 3SHSA 3H9SD 3QO0B 1S7UB 2VMFA 5F7LB 4I9WD 4YDLC 3DBXA 4YHML 4JRXA 4U1HB 1KV3A 3MRHB 3O0RL 4LLMB 5KVGL 5KS9B 3RGVC 3HC0B 3Q3GB 5B8CA 1ZVYA 2WLYA 5F1IA 1ZT1A 1FHGA 1U92A 1D5XA 2F8VA 2JKXA 2YRPA 4HUVB 2WINA 3V6FA 1YN6A 4ZFZB 4ETYA 5B3JF 3B9EA 1LO0L 3AY4A 4MXVE 1WTGT 4Y4FB 2DIAA 4QHLA 1J05B 1A3RL 1RZIA 5HHPB 2B2XH 1LK2B 4KY1H 4KQ3L 3DYOA 1JFQL 3RWJA 2EO9A 1YMMB 5CZKA 3GKWH 2R2CA 3AXLA 4CMHB 2X1XR 4QWWD 1PKOA 1FN4B 1CGYA 3UZVB 1JE6A 1AY1L 3BKJH 3QIWD 4PJ9A 5EOTB 3QCVL 4JFEE 1YN7A 4MAYA 4OLEA 1MWAB 3MNZA 3RX8A 4I0PD 3O41B 4PJXE 4RBPH 3VWKA 2FSEB 4CJ0A 5CHNB 4XPHH 4X6CA 1E28B 2ZUXA 1G7IA 6FABL 5LGJA 2O5XH 4K23L 2A9ML 1LQSR 4N1EA 2MJWA 3HNVL 3KYAA 3TV3L 1F8TH 2I27N 1RJZB 1I9JH 3BWAA 3VXUA 4S11A 2O5ZL 1E4KA 2MKWA 1LO4H 1MCRA 3MGOB 4NQCA 1L9NA 3K2MC 4D3CH 3MRLA 1URLA 2BDNL 3MRCA 1QHPA 3T0EE 4XHJC 4YZFF 5IBUG 3V4UL 4CMMA 1EEYA 1MCOH 5DJ0B 5B39B 1EUUA 1A7QL 3PHQB 3BE1L 1F4WL 4WFFE 4OV5B 1NMCB 4JKPH 4QTIL 1KLGB 1BGXH 3GI8H 3DV6A 4G8EA 5L2KE 1T1YB 3OAZK 1UKSA 4P9HH 5AYQA 4APQD 1OF2A 4YHKH 1IGIH 4LLYA 3CIQA 1MUJA 3IDXL 4X7EC 5E5RB 1RZKC 2ZCKH 1PY9A 3VH8G 3HI5L 2YPKB 4PJEA 3GSNL 4Y19A 4KPHL 1RY7B 1QSFB 2VAJA 4I8DA 3N9GH 3TN0A 3WUZA 3ZTNL 2XWJA 5F70A 1YEFH 4RA3A 2HFFA 2FO1A 2CSPA 4JFQA 4JY4B 4WI7A 2X4RA 3E8UH 3EFFA 3QEQB 2YMXH 3EOYG 5C0BA 4NNXA 4PTUA 3MODH 4WGVB 3RWDA 1I7ZB 3GB7B 3O3EA 4H88L 4TSBL 3WD5H 3V95A 2A0LC 2FB4H 3QAZC 5IB2A 4RFEA 5C3LD 3PQYD 5E6IA 1I1AC 3S6CA 5ICXA 3LKPB 4YDIH 2AV1B 1OB1A 2J8HA 3BIKA 4NPYA 2PF6A 3RVUC 3O6KH 2G60H 4F7EB 1TQBC 2BNQA 3S37H 4JR9L 2ADIA 4HW6A 5ILTH 1GAFL 2OL3B 4JRXE 4UOW1 4GQ9L 1RUQH 4OLZH 5SV3A 1NAMH 5F1NA 4OFPA 4PJXF 3F65A 2KUTA 4ZOAA 1DN0B 3RPKA 4DVBA 3U9UB 1FPTH 1M7IB 3GBLA 4KKCC 3TEUA 4M3JA 4RGOL 4C56D 2R23B 5IFHH 1GOFA 1XMWA 3ARGC 1HZHH 4NWTL 5KSUA 4DEPB 3BYTA 2A6IB 3TBSA 3I84A 3VU2A 1LE9A 4P23A 1FBIL 3HUJA 1HHHB 3O8XB 4X5WA 1PLGL 1FP5A 5DC0A 2ZCHH 4W70A 4EN3A 3CUPA 5EU6B 3RL1A 1NGWB 2D03H 1OY3B 1RHFA 2OCFD 1QFWI 2H26B 4MCYB 5EIIB 1NLBH 4LSSH 4YHPA 1S7TA 4MMXC 1FC2D 1OP5H 2IC2A 4PJFB 5E08L 3RDTC 1UB5B 1EEUA 1KTLB 1OAXH 4WV1C 5JW3L 5JORB 1QEWB 4YHNB 1ZHBB 1VKXA 2AJUH 3CGTA 3ULUD 1ZVHA 3O3AA 2W38A 3WKMH 2Q87A 1CXHA 1AGEB 4DUVA 2X4SA 2Z0BA 1T89C 2HJLB 3HMXH 1JNJA 3QH3A 5FOJA 5BO1L 1FNEA 1A7PH 2PW1A 3VWJA 1QRNA 4IRJC 3K4ZA 1FAKT 2VOTA 3SGDH 3HE7B 4JPKH 3UYRH 3IFPA 3P0GB 4P2QB 1D5IH 1HDMA 4IRZH 1FL3A 1CGTA 3CZJA 5EORL 3NGBB 1CXEA 5CBEB 4AH2B 1E4XH 1CL7L 5HJ3B 1I1YB 3TNNB 3WKNA 3LKOA 3MA7B 3GSUA 3VXUE 1S7QB 1P4IL 4JPVH 2R2BA 2DQFA 4AL8H 3EFDL 1G1YA 4NQCE 5T3XD 1NGPH 2X4TB 1A1NA 4F7TA 4M02A 1OTSD 4XVTH 1A6AB 4UT9H 4JDTH 3HS0B 2XPGB 4OZ4B 1EO5A 3C6SB 3DO3A 2JE8A 1IKNC 1XIWA 5KTEH 3GMMB 1NMBL 5D1XD 3TBYB 1N3NA 4O9HH 1QFWM 1DUYA 5DJ6A 1ZK9A 3FQWA 3PWUB 1R3IH 1RVFH 3QZWB 5DA4A 2VDMH 4MJIA 1JRHH 4IRSD 3HC3L 4D0BA 2VIRA 3NCYS 4K2UH 4YK4C 5IG7B 3U9PH 1U8IB 2MSPA 3SKOB 4JZJA 1AR1C 1OGAD 3BEWA 3DTXB 3ILQD 4LLUA 1XGQB 2B0SL 3PJSB 1V7MH 4JY5L 5KSBB 3IYLW 3QBTB 3QNZA 4YQXL 1LEGA 2XKNB 4PJEE 3WFCH 5ACMA 3BZDA 3QEGH 2YD4A 4GAJL 5ITFA 5EBLB 1G6RH 4ZXBA 2ORBL 5DFWH 4LSRL 5HGHA 3MRNA 4ZFFB 4FXGA 4B50A 2XA3A 2XNAB 1KLUA 4Q0XH 4ZPVA 4M43H 2W9LA 3VDCA 4ONFL 1IRAY 2NY1C 2V2XA 4NO0A 3VGAB 4HS3A 5FUZL 2K3TA 1MCHA 1IC1A 3O3DB 4XVSH 2BNQE 4E41D 4CVXA 4XTRC 3UZEA 2HMID 1GYAA 2P5EA 4PJCA 4IIQB 4Z7VB 2EEDA 1ODAA 5B39G 2XY2A 3H9SA 2Y07H 1ADQA 3ARYA 1FFOA 1YEDB 2GTWA 4TVSa 4X6CF 4EDXA 1A0QL 1WIUA 5FGCE 3W82A 5F96H 1YNTA 5IHZB 4Y5YA 3EW3B 1MHCA 2DQIH 4NBXB 5E2UH 3BPOB 3MXVL 1EZVY 2VL5A 4R0LA 4XZUB 5MP6H 1UXWA 1U93A 3IDMA 3TPUB 3HI1A 4JRWA 1CDCA 3DYMA 4H1LB 2G75A 3A6CH 3SE3C 1X5IA 4X6BA 1HWHB 1LNUA 5GS3A 1LE5B 1Q9WA 4FNLL 4RWYH 2IQ9H 3KJ6L 4NDMB 3HKFA 1MFNA 5D9SA 2C3VB 4YE4L 3NZHL 4NQDD 3LQMA 2OK0H 4CDGC 2Z8WC 4OBSA 4S1RH 4PP2B 4LAQH 3L3OA 4GH7B 4KJYB 5AD0A 1PG7X 4LMQI 3FO1B 1MJJB 3P4MA 5ELIA 1QRNE 2F5BH 5GIRA 2Q7YB 4MVBD 4N90D 5HDBE 2O5YH 4YDVB 3KGRA 1ZHLB 3QWRD 5HI4C 3P9MA 3QIWA 4HIIB 4KK8C 4PJEF 1KYOK 5DGRA 3VCLA 3VGGA 4RMSA 3BGMB 4O02H 5H37G 1ZT7B 1IAKB 3PIQB 1AKJD 1HHJB 3EYFA 3GDBA 4FP8L 4NUGL 5IFJB 4Z9KB 3VXQB 2X4QA 4L3CA 1WIPA 4JRYE 1MRDL 2GSGB 1U3YA 1IGMH 2DYPB 5F8RC 3STZB 1PSKH 5IM7A 1RZJH 5BOZG 4Y1AD 3D2UD 2IFGA 4L4VE 5I30L 1I9RL 3O6LL 1TETH 2PCPB 5I6XB 3O4OB 5LCVH 4G6MH 2BOBA 5HY9B 3IDYB 2WM0A 1F58L 5JDSA 1NC2D 4MJIE 4YHLH 1S9XA 5H2BB 2AQ2A 1XGUA 1MAMH 1TCRB 4JZOB 3ZDZE 5JXED 1AI1L 4W6YB 4AMKL 2R4RL 4YH6A 2XZQH 3SGJC 3EGSA 3RRQA 2DD8H 3BPNB 3QG7H 7FABH 1I8KA 5GS0L 2FH6A 3KYKH 3ILPB 1I7TB 1NDMA 3NBNA 1AC6A 3IDIA 1CD1B 4MDIA 3C60A 5DT1L 2NTFB 3WN5B 3HUJF 4APQA 4TUKH 5CP3H 5ADOL 2FDBP 5HBBA 2UWEE 4M61B 2WUBH 4A6YH 5C6TL 1CLZL 3W5MA 4FQQB 3ES6B 1PD6A 4OD1H 2JJUA 4LSPH 4HWZB 4KK5C 4DN4H 3PP3K 3DVFA 3VFGH 1GIGL 5IESH 2V2WA 1VADB 2R0KH 3RZWA 2X4NA 4Z7NE 5C92A 1VGKA 1L6ZA 4AENB 4P2YA 1LD9B 5IROA 5HYJD 4JREC 2MPAL 3TYFB 4KGLA 5HGBA 2W59A 3DXAD 2QKIA 3LPGA 5LXGL 2FEDD 2EE3A 2NR6C 4LARL 2AXGB 3CFEA 3OXRA 5FGRA 2P5EE 4PJCE 4M00A 1ZHKA 4PTTB 4XI5C 3PQYA 5HDBF 1D6VL 1IGFH 2FLRT 2DQCH 2J4WH 3O6MH 4K3EL 4E0RA 3QZWG 1KJ2B 1V3MA 4HWUA 1BFOA 5IVNA 5D7LA 5HHNA 1YY9D 3QUML 1I1RA 4ZFOL 4TNVF 2BNUA 3BZEB 4PJXB 4QOKA 3CFKA 1WFNA 5DRNB 4LGPB 1J0KA 5AZ2L 4KRNA 4I48A 1WF5A 4XWGH 1RZGA 4NJ9L 3QA3A 1C16A 5DJAB 3BD4A 3KPNB 1YEEH 1DBKL 2FWOB 1K8IA 3CH1B 3SDXE 1DL7H 1RZ7L 1AXSA 1TJIH 4NHUA 3MXWL 2WWKO 4XAKD 3ZYZA 1QRKA 5I8OH 2EKJA 1RUKH 5DVNA 5E7FA 2CMRH 3G5ZB 4NZRH 4Y2DB 1CVRA 3SKMB 5IFAH 4DK6A 4JM2A 1Q0XH 1KJ2L 2ADJA 4TVPH 4X98B 4O2FB 1AH1A 3BRDA 4H20L 2FIKA 3JWDL 3WEXA 4TUJA 5DLML 1LO2H 3QIUB 3U46B 4TNVK 3ZDZF 4LF3B 3K7UA 1SJXA 2LTQB 3AS1A 1MPAH 1T04A 1CG9A 3K81A 2DI9A 5L2KB 3C09B 3VMOA 5E56A 3F12A 1ACYH 4M9PA 4ONGH 4XXDB 5J4MA 3U0PA 4GRLB 3MLYH 1KOAA 4K94L 3RWGB 1VEOA 1AJ7L 3QP3A 3ARBD 3NMEA 1XGRB 1GVIA 4JHZA 1DQMH 4OF6A 5FB8A 1IC5H 1BQLL 4ZTOL 1MCWW 2JLLA 3D3VD 5DD1H 3M1BA 1UC6A 2YC1A 3FT4B 2CQVA 4MNQD 4AYFA 1CQKA 2Q20A 3G5XA 2VLRD 5JIKA 5I66A 4NKOA 1NAKH 2BCKB 4P5TA 1AGFA 4H1LG 4X9GA 4F7MA 1X7QB 4HEPG 5I71B 5DMGD 4WU5B 2YUWA 4TSCH 2NY7L 5CJBA 1CLOL 4JO2H 4PJCF 3VFMA 4E9LA 2VE6B 4X8XA 4XNZB 1YQVL 2A74B 4X83A 1A6UL 5A43C 4XBEH 1TZGH 5CSZA 5D1XA 4PB9H 4HPYL 4MSWA 3DX9A 3D18A 4XNUL 1C7SA 3U7WL 4IRSA 1U42A 1VFOA 1H0DB 2P46B 3NABH 5B8CB 1S9YB 5CILH 5BV7H 1U8PA 1ZT1B 1I8LC 1U92B 1R0AL 1OGAA 4G5ZL 4HS6A 2V17H 2VDLH 4HC1A 4WO4D 3JTTA 2WINB 3GNML 5T3ZH 4PJIA 5L2JA 5MI0B 4MHHI 3C5JA 3SDDC 2KQNA 4NWUL 2PETA 1JJUA 1RZFL 3QFDB 5K9JL 5HHOD 5FO9A 1R5IB 4JQIL 1Z3GH 1MFAH 2H2PC 5ETUA 2MFNA 3EKCA 4FQXC 4GW4A 1DVFC 4A2LA 5CBAA 1P7QD 3T08A 1ORSA 1FH5H 5T1LD 5CD3B 4EOWL 4CU6A 3CDYA 1UM4H 3B8YA 3NA9L 4JFFE 1ZTXL 4LCUA 3TJHD 4JFYA 3GRWL 4PJ9B 2AP2A 4IMKC 4OD2A 4X0KB 4ODXA 5D7LE 5HHQB 4E41A 4FFWC 2CDGA 4YXLL 2GQHA 4YFLI 1P5UA 4ZODA 4QOKE 1JWUA 3VWKB 3X12A 3BPCA 4PBXA 3B9KC 2J88H 5L7XH 4U1KB 4P49A 3ZKXC 3IS1X 2VN7A 3BP4B 2FGWH 1G7IB 4U1LB 4CN6A 4LFHD 5LGJB 1K2DB 5CEYB 4EJ1C 2DWEB 3VFVB 5FF6B 3JTSB 1CXKA 4NQTA 5A3IC 1K4CA 1QA9B 1H3PL 3DVNA 4GW1A 1M05B 3V52H 1FNGB 4FZEL 1U3HD 3A67L 3QHTC 4NQCB 4DKFH 3MRLB 3QXAA 3CFDA 2ZUWA 3WFDH 3KPPA 3LZFH 1YPZA 4O2EB 1DUZA 1BHGA 4WWKD 4HZAA 4C4KT 4P4KC 5KANG 2VDOH 2OJEB 4NQXA 1NCCL 2P24A 3GMPA 3W39B 4PGDA 4UV4L 5F7HA 1KELL 3QHZL 2ERJC 1K8DA 3D6GA 4POZC 2A9NH 3QNXB 4NQDA 4MA3A 5IBTH 3ULUE 2FBOJ 2AK4D 5E00B 3MRQA 2ICES 4FXKB 4JFPA 1EO8L 1C7TA 1OF2B 3H3PL 4LIQE 4LLYB 2ESVD 1XH3B 1U3JA 3RVVC 3MJ6A 1T2JA 5E9DE 3N85H 4XWOC 4L8BB 2EIEA 1MEXL 3WE6B 3FQRA 4XMKH 5GISH 3QWRA 4K3JL 1N4XH 4XXCC 3FO0L 1BJ8A 4G9DA 3TN0B 3B8SA 4U1IA 2B1HH 5I1EL 2JIXD 4FZ8H 3A6OA 3RY6A 3FQTA 3T77A 2X4RB 3EFFB 2NCMA 2UYLA 2YK1L 1K6QL 1MY5A 5JR1L 3W9DB 4NNXB 3IXAA 4U3HA 2I60L 2IPUK 3MQIA 3C9NA 1PEZA 4UU9A 2BC4A 4Y16B 4RFEB 3G5YA 2EDYA 4URTB 3TA3C 3PWLB 1A7RH 1NCBL 4WY7H 5EWIL 2QHRL 1FSKB 3FAXA 1EIBA 4Y1AA 3D2UA 4O4YH 2BNQB 4PGEB 3VXOB 1U8OB 1X5YA 3RU8L 2YRLA 1NC2A 4J8RB 4BSWA 1T7ZA 2WBWB 4L3AA 3U4EB 4LPYA 1OGAE 3I9GL 4I2XA 5DURD 4PGCA 5JXEA 3NTCL 3HAEH 1I9IL 1LP9E 4HWBA 1AD9A 5K9OA 2OXHA 2NY0B 3L5XH 4UIMB 2ATKB 3V0VB 3NN8B 4ZS6D 1CCZA 2VLKA 3PUCA 4LDLB 3GSRA 1G9NH 3D39D 3IU3B 1ZSDA 4JM2F 4WW1B 4PV9B 3CDFA 3K8KA 2RB8A 3TZVC 4XP9H 4P59H 4NC1C 3QNYA 5F1SA 1DFBH 1Q9OB 4WI9A 3ZDXE 1MQ8A 2CDFA 1BVKA 4FFZL 4QRPD 4JEGB 3ULUF 4LCYB 4L9LC 3VXNB 5F9OH 3SPVB 3QEUA 5HYJA 4E41E 1FNEB 3CC5B 1QRNB 3DXAA 1OAZL 4LAJH 3EHBD 3K1DA 3BUTA 1YEHH 4ZQKA 5I1CH 4M7LH 1GCFA 1BOYA 1WC7B 2VDNH 4K71C 1RIHL 1KFAH 3MV8B 5IUSA 5E24E 1JPFA 3MRPA 2P42B 1V3LA 1JPSL 2AJZA 1IZKA 5E2TL 5F6HJ 3LKOB 2P5WE 2GTZA 3CJJA 1SYSA 4JRYB 3W5NA 1T80A 3MA9L 4ZS7H 1MLCB 3LCYA 3CLEL 5AZEL 4POYA 4Q2ZB 3IDJA 3VFOA 3QB7C 1NGZB 1HSAA 1BMGA 2XZCL 2OTUA 1A1NB 3KS0J 1YPZE 2AJ3A 4L4VB 2V2TB 4Q9CA 3ARDC 2QTEA 2FATL 1P7HL 1VEMA 3VG0H 3FFCE 3I02A 3I6KA 4JHWL 1T3FA 3FQWB 3QDJB 3ARDD 4WU7B 5F8QC 2YEZB 4D0BB 1J1PH 2JCCB 4C83A 4GKNA 3BEWB 3UO1L 1B6UA 5JW5B 2X4UB 4R2GB 2XKUA 4OZFA 3U6RA 3UJTL 1BQUA 5ID1A 3VFRB 2VXQL 1RIUH 4PJIF 4XH2B 5J12C 2ZOKB 3SGEH 1DDHB 3OKMB 1OD9A 5EC2A 4ZXBB 4KRPD 4CAGA 2UWEB 3KHQA 4MQ7B 4MWFB 3BP7B 4BFGA 2D7NA 4FXGB 3ARBA 4MCZA 4YHMH 2BSRA 4FMKA 2OM5A 3DPBA 4XBPA 4BA8A 1C5DA 3TO4D 3IU4L 5IMMB 1MRCH 3D3VA 3QISA 4X80H 5C9JA 5JW4Q 3O0RH 2V2XB 4O2CA 5IP4A 4LLQA 3ZDXF 4PJGA 1KIRB 4RZCB 5E4EB 5C08E 1AFVH 1E6JL 2AJXL 4U1GB 4FQPA 4Y1AE 3FT3A 1KB5B 1JNLL 1DQDL 2A38A 1JNHA 4KK6D 3TNMA 3RTQD 3BGFB 3EO1A 5KG9A 4QRSA 4PJCB 4R26L 5IHLB 3ZL4H 1G7PB 1LO0H 4MB4A 1G9ML 1A3RH 1OL0A 4F80A 1BBDL 1FFOB 4KQ3H 1JFQH 2IBGA 3QIBC 4I2XE 4K3DL 5AAWA 5TE7L 4PBVC 1YNTB 4PRPD 5DRZA 3L3GB 1MHEA 3MRMA 3I6GA 2VL5B 3KJ4C 4FQHB 4PYGA 1J1XL 3WIHH 5JLZA 1OARL 3IDMB 1J12A 2EC8A 2VLKE 4JHAL 2BRRL 2CIIA 3L9RB 5E2VL 1IMHC 3SDXB 2YD7A 1IL1A 4LCWE 2A77H 4H0GA 1IGYB 5EU5B 2HFTA 1YPZF 4FN0A 2DMBA 2BSSB 5DJXB 3CXHJ 5DJYA 3SBWA 3SEPA 3HLAA 4AEIH 3LH2H 1JVKA 2BVPA 6FABH 2YD3A 1I85C 3SE9L 4EVNA 5AYUL 1J18A 4K23H 2A9MH 1WFOA 3RNQA 1P7QA 3HNVH 3TV3H 2PXYB 5T1LA 3GSWA 2FJHB 4NRZA 4ODVL 1DTUA 3FMGH 3QULA 5GSVA 5IOPA 4IHOB 1OLZA 3QIWB 4R4ND 4EDWL 1IC7H 1O5DT 1HI6B 1UB6B 3TCXA 3LQAL 2UZYB 4RGNE 4X5LA 5DWUL 2PN5A 2IH3A 1FG9C 2APXA 5EIQA 1MWAH 3TH2T 1EJOH 1I7RA 4OD3H 1A4JA 1T1WA 3V4UH 4L3CB 2R4SL 4M7KL 2LAAA 3EJZC 5GGSA 1A7QH 2HG5A 3L3JA 3BE1H 4ZSOA 1Z9LA 1F4WH 4LQ1A 5E6ZA 5HHME 4EI6B 5GS1A 5GS0C 5CS7A 1DJSA 2NW3B 3DLQR 5FA3A 2GAZA 2XQYK 4H0HB 1CICC 3D5OF 1A1MB 1U8QB 2WWMC 1S9WB 5DEGA 1HH9B 3HI5H 1U3HA 5JDSB 3LN4B 3GSNH 1FG2A 2OJZL 1NFIA 4DFIA 3ZTNH 1IEHA 3IRPX 4X9IA 2EXWD 3NPSC 4WWKA 2IG2L 5JHDD 4IJ3C 4H8WC 4H26B 3Q2CA 1F6AA 1A6ZA 1IFHL 5CMAA 3LKNA 4GS7C 4M7ZB 4IOFD 4PRHE 4X9BA 5IB5B 2AK4A 4H88H 4TSBH 1SBBA 3IDIB 4XC1H 5SWQA 3C60B 4Y5VC 4YEEA 2VR4A 3WIIL 5E1HB 3AAZB 2DQEH 3FB7B 1QACA 4RMRA 5J1AA 4BQBA 5HYEA 3TVMC 1V7NH 5BZWA 2OLDA 4JR9H 5D6DA 2XWBA 3EYVA 3OXSA 4L8SC 4MJ6B 3C6LB 1GAFH 4GQ9H 1PQZB 3VGDA 5EZJA 4LPCA 2JIXA 1B0GB 2ZUQB 4PJGE 3SDAD 1AHWA 1ONQA 3GO1H 2VO5A 5FA4B 1SEBA 1VGKB 3WJJC 4HAFA 5EZIH 1XF5A 2RFXA 3P77B 1OT2A 1IJ9A 1IC4L 1IAMA 2HH0L 2XRAL 3M07A 3BW9B 1DZBA 4NWTH 2X42A 5D5ME 3CDGB 3CFEB 4JFFB 4M48H 4HXBH 4G6KL 1FBIH 1NPUA 1HH6B 3MV7D 4N5EC 4MZ2A 4GKSB 5C09B 1PLGH 1ZANL 3WS6C 2WLZA 5D7LB 3ULSB 3O45A 2IGFL 5F9JB 5DJ2B 4YHYB 2BNUB 5DUBA 2C1OA 3MC0A 2VSCA 1X44A 4QOKB 4F7PA 2OL3H 3JWDC 2HT4C 1OW0A 2JELL 4TN9A 3D1MC 5H37H 3HG1A 2EDDA 2JK5B 4OCXH 5E08H 4B53A 5JHLL 1GC1C 5JW3H 4QEGA 1A1OA 3AROA 1IM3A 4QHMA 2VABB 1U58A 3RVTD 1QFPA 4NHUB 3RBSA 2ARJQ 4XCFL 2ZCLL 5INDB 4K94C 5FHAH 5F3BA 2YD8A 2YBRA 3NFNB 4JM2B 4N68A 4UILL 1M6OA 3PABA 4ELMA 1JGEA 1JWSB 3D39A 1D6EA 5JW4N 1G0DA 1U8LA 1ZVSA 5IEKA 5FFLA 2Y6SD 4HPOH 3UXFA 5T5NG 5LGKA 5EORH 3WS3B 1J5OL 2BSTB 3E3QE 4DWHA 3QUXC 4M3KB 1JZ4A 1CL7H 3CNKA 4HK0A 2CLRA 3LPWA 2VRAA 5DJZB 4QRPA 4JPIA 1I1FA 3V6ZA 3CFJB 1IAOA 3LPFA 3EFDH 4YFLF 4AQOA 3WFBH 1JGDA 4G3YL 5JMOC 4U0QB 5HXMA 4LASL 1F11A 1FLRL 1K3IA 1MAJA 3DMMC 3GSQA 4XPGL 5E9DB 3QQ9D 5DD0L 3UEZA 2EDTA 3SO3C 4K8RC 3GHBL 1NMBH 1CFSA 3RVXC 2R0ZH 2NXYD 5I1JL 4ZSOE 4YHOH 3OL2A 1RI8A 3HC3H 4F37F 2YC1B 4PJGF 1NAMA 2JB6A 3NOIA 4V1DD 2B0SH 4RAUB 4PV8A 4P5TB 3TH4T 4F7MB 5TDOB 1NFDA 3ARQA 1T1XA 5D7JC 3VFMB 3DX7B 4GAJH 3GIVB 4X4YA 3BN9D 2VZSA 5IK3A 1MF2L 2ORBH 5I76A 3F7YA 2Z93A 1HQRB 5E99H 3DROB 3U0TB 4RMWA 3CXDH 1TTFA 3I3BA 4M7LT 3CVIH 1KBGL 4TVPD 1EHAA 3KWWA 5J3HC 4UOW0 4MNHB 4AZ8A 1VFUA 2HYMA 2HRPL 3FB8B 1HYRC 4KJWC 5GS2H 1LP9B 5FCSH 5FUZH 2IANA 32C2B 3IFNL 5L0QC 3PWPB 4FQLL 3D0VA 5EOQL 3JWOH 2MHAB 2R1YA 3CCHB 4NKMA 1REIA 1YMHB 3AREC 4YFDB 3HMXA 5K9KB 5I1DA 1EXUB 1CBVL 4NUJB 2DL9A 4PGBA 2K9UA 4NFDA 5HD8D 1DEEB 1SM3H 1A0QH 2EIZB 4U6HA 3W0WA 4YIQA 2DQDH 3L3IB 3TO4A 4QRUB 3MXVH 3IVKA 4LCUB 3UC0H 1RIVH 1KCRH 5FO7A 3AMLA 1NBQA 4JFHD 3EZ8A 3T4YB 3S96B 4ZUTA 1Q72L 4OD2B 5DEZA 2YN5A 1WK0A 4ODXB 3U0WL 3LQZB 2AQ3A 1JK8A 4NKIL 4NP4L 3RKPA 3RTQA 3MNVA 4FRWA 1JWUB 2WV3A 5IJVB 1WZ1H 4GKZA 3RZCD 3HG1E 4FNLH 1KIUA 5DDHB 2NXZB 3CSYA 1WBYB 1T0NB 4TUOB 1MCKA 2C1PA 3NZHH 5C1MB 4GG6B 3DUHA 2VISB 1YDPA 2W0FA 4LK4A 1N7MH 4PRPA 4LRNL 2P5WB 1KJ3L 3OX8B 2ITDA 5IR1A 1S7SB 4Z95L 1A8JH 1CE1H 4OT1L 5HGDA 1JHKL 1QQDA 3O11B 4YLQT 1CDJA 4WEBL 3OF6D 1S78D 3ALPA 5D1QB 3OKNA 1H3WM 4H1LH 5T3ZD 1ORQA 8FABB 2IEPA 3S36X 3MRRB 3FFCB 3QWOA 1MCLA 5HDOA 2CH8A 5I8EB 4NUGH 3LRSA 1UZ6F 4ODUA 3AVEA 4XP1H 1J8HE 4XNMA 2OMBA 1MRDH 2UV3A 1T0MB 4FHBD 1HKFA 2EE6A 4MA3B 4QRPE 2VDKH 4LCIL 3ROLB 2OSLA 4GAYA 3MV9D 4RNRB 1WZKA 3CX5K 1ZA3B 2FECL 4JQVA 2E6QA 4MJ5A 2E7MA 2DLHA 3O6LH 3NAAH 2VUYA 4OFIA 5F6HI 1QLRB 3RBGA 4GUPA 3FT2A 4G9DB 1F58H 4F2MA 1NMAH 4U1IB 1YUHA 4EIZC 1AGBA 1DP0A 2QQKL 4OCRL 4DGYH 4Y5XB 5EN2B 1TJHL 3PL6B 2NZ9C 1Q0YL 3QHFL 1HKLH 2DMCA 5DQDH 2UYLB 5DHYB 4ELKB 4LCCB 4BFIB 2DM2A 1RD6A 1H3GA 4ZOBA 2G5BA 4UU9B 1BREA 5HPOA 5FUCE 5C08B 2CKBB 3GFUA 2DJ4A 3BKYL 3ZTJG 4NRXB 5DT1H 2QADC 4ZUVB 1UWEL 3F58L 3MROA 5ADOH 1B6DA 3LS4L 3WIFA 4JANA 4JJHA 5D93C 4F58H 1CLZH 5DK2B 5HGAA 3LN5B 3IS0X 1S9VA 3ZE1F 3GSXA 1CQYA 4LVNB 5JHDA 1SHMA 5CP7B 1GIGH 3B2UD 3SDCC 5J11B 5MEND 2IANE 4PRAA 1RQ5A 3G6DL 1IM9D 4KROB 5LGHL 2MPAH 4MXWH 3EDFA 4NFCA 1C1EH 4HUUA 4RBPK 2BY3A 1DSFH 5LXGH 2Q8BL 3KYNB 4QHKI 2CKBL 5IHBA 1FNFA 2QSVA 4MJ2A 1MHPL 4AEEA 2VLKB 1D6VH 1FZMA 3KYOA 3HZVA 3GSRB 4R96B 2HKFL 4K3EH 4LCWB 3QXWA 4UOJA 4ELMF 4FABL 5FM4A 4NIKB 4DQOL 3MBEB 3MNWA 1RJCA 2V5RA 3W0WE 2D7OA 2ICCA 3QUYD 1NGXB 3G04A 5AZ2H 3QQ3A 1H8OA 1CI5A 5I1HL 3U30B 4NJ9H 2CDFB 3P4NA 1BVKB 3UPAA 3GBNL 3SDAA 4U49A 2WIIA 2P8MA 1DBKH 5ALCH 2MTPA 5DFVC 4K7PX 2ZUTA 4UNVA 4LPWA 4LRIA 2APFA 5C0DA 1RZ7H 5D70L 3MXWH 5BS0D 3MV11 2VH5H 3V6OA 1HHGB 2X9XA 4Q6YA 1QR4A 1KIPA 2IQAB 3MV7A 3DURA 3RWFA 1AGCA 1KJ2H 4RGNB 3U36A 3K8LA 4OGAD 3RUGA 1H5BC 3D87B 3ARFD 1BX2A 2NY4C 5DLMH 1SYSB 2VZUA 4E5XA 2X4OA 3V7AE 2ARJA 5A2KH 3H0TB 3IDJB 5HHMB 4G8FB 1NFDF 4JLRA 4DTGL 5FHBL 3PWJA 1MELA 1ITCA 2A83A 3O4LD 2EE9A 5IBLC 5BOPA 5HI5D 5I1IL 4YPJA 1T3FB 3C8HA 1AJ7H 2VDRL 5KSAC 3OR6B 2Z91A 4M7JL 3QCTL 3QPXL 4Z5RB 1CT8B 5CP3A 2GT9A 1BQLH 5TF1L 1J7VR 1RMFL 4GKNB 4A6YA 2F53B 1D3CA 2X9YA 4B41A 3ARRA 5DSCB 1OTTC 1EA9C 2IALA 2F9BT 3X11A 5LAXB 1U9KA 2VXSH 2V9TA 3HI6H 3SKNA 1R5WA 3C5ZC 3BXNB 4PRHB 1QO3A 4ZAKD 1QP1A 5KZCB 1JGLL 1KJVA 4X7FC 1D9KD 1G9MC 2WUCL 2V9RA 2YPLB 1QPXA 1IAIL 5J7CC 2VLJD 4FG6D 3VI3F 3SQOL 3NIDF 2EC9U 4HPYH 3TBTB 3BWUC 1UJ3B 5E8NB 1PYWA 3U7WH 3QXDB 4P5MA 1WWBX 5GRWA 1D5MA 2H45A 5FEBA 2EZ0C 2ZWLT 5IVXE 3BP6B 4G5ZH 1T1ZB 4V1DA 4UTAL 5IWLC 4HFUL 3M45A 5CEZL 5D5MB 4OFDA 3E2HB 4QRSB 1BIHA 1OP5K 4NWUH 3S5LG 1KCVH 4Z7UA 4OGXH 4I13B 2VQUA 5K9JH 1U95A 2ENSA 1P7KB 1BQSA 3ARGA 4Y88A 3VXTB 1DANU 1E0OB 3I3EA 3JV4A 3M17B 4GG8B 3BKMH 4JQIH 3RWHB 2IMNA 1VFBA 4G8GB 4QYOA 3MRMB 4HHAB 5CGYD 3PHOA 4J1UA 3IETA 3K0WA 3LV3B 4YHIB 4ZO7A 4GFTB 5ESAB 2E7LC 2HJKA 3IJYB 2H9GB 3NA9H 4EI5C 5I75C 1QPPA 1ZT4A 1ZTXH 1NJ9B 2HLFD 1OHQA 1ZS8A 3MGTA 4A2MA 5GRXG 2R2EB 4GMSL 1IL1B 3BT2H 4P46C 5HPMA 3SCMD 3DSNA 4OCYL 1CR9L 4OCSL 4YXLH 1TPXC 5C71A 1BJ1H 4JQXC 4NFBA 2BVPB 2VR9A 1TVBA 3SJVD 2BVQA 4GO6B 4IRJA 5JOPD 4EVNB 2CD0A 3C2AL 1NCWL 2C5DC 2Y06L 3VFTB 3OKLB 4P2RB 2FO4A 4M8QA 4PY7B 1JUFA 5LQBL 1RK0A 4I18B 1H3PH 2EECA 4IMLB 2HVKA 1N5YL 3V6OE 3FOMB 4U7MA 5MERA 5IOPB 4YR6B 1QFOA 4FZEH 2HLAA 5EBWB 5JQ6H 1CXIA 2GITB 5GGUA 3MV7E 5F9AC 4L8DB 2X6MA 3BO8A 3PV6A 2BSED 5E2JA 3MO1A 4HIHA 2DN7A 3GMQA 1T1WB 4XC3L 4R8WL 3V5DB 1NCCH 3E1F1 3RZCA 5GGSB 4UV4H 1KELH 2HG5B 3L3JB 3QHZH 4ZSOB 4OFVA 1QFHA 3CPLB 5EU7C 5IVZA 1KN4H 2I07B 3B3IB 3UDWA 4DN3L 4N0UB 1J8KA 2AJVL 1AD0B 1CK0L 2GAZB 3H3PH 4JO4L 2AJSL 1F45A 3O2WL 3ZE0F 1MEXH 1CE6A 1MAKA 5DEFB 5GGQL 1TCMA 4K3JH 3OF6A 3FO0H 5CSBA 3S98A 1T03L 1TVDA 4NGHL 3BGAA 5IKCA 4QXTB 1FDLH 2VZOA 3CLFH 1Q94B 2AK1L 5DMKA 2WMPA 1VFMA 1P6AB 4G42B 5IMLB 2ZUYA 2E8YA 4Y4FD 2YK1H 4LQFH 5CMAB 3LKNB 3B5TA 3FRUA 4LL9A 3PP4L 3REVA 3L5IA 1HINL 3VGHA 4P0DA 2C7UA 1YMMD 4M1GH 4KMTH 4L1DA 1YJDL 5FKAB 1QSVA 5DYOB 3MUGA 2NY3C 1RUPL 1IVLA 3MV9A 4K7FA 4HD9A 2XTJC 1W72B 4OM0L 2QHRH 3RA7H 1N6QH 4TTDD 2HN7A 2ADGB 1B4JH 2KDGA 3SE8L 1EMTL 5J6GB 3OXSB 5I74B 1MLBA 5EZJB 1FZOB 5L9DH 15C8L 2Q86B 4WHTA 2VL4A 1AXTL 1WFUA 2EDHA 3VRLE 5IMOB 3BEVB 3HZKA 2RFXB 3NTCH 1EVUA 1I9IH 4V1DE 1JIBA 1EEZA 1XGTA 4NYLA 2J5LB 1S5IL 1W8OA 4N1CA 1EX0A 2EDLA 2EH8H 2YUVA 4NT6B 4Z7UE 1W72L 4CNIA 1P4BH 1MCSA 2ZKHL 4PJAA 3T3MF 1MCPL 5C07B 5KOMC 3THML 1AE6L 3QDMB 1FFNB 3HG1B 1KPRB 1QLEH 4TVPE 3T0XA 1NDGA 1CU4L 4TQEH 4BH8A 1A1OB 5KVEL 4MMZC 1NCUA 4ZUUA 3BQUA 4ZD3L 5MENA 2X4PB 1RZ8A 3WV0A 5B38A 35C8L 1IM9A 1FNSL 3H9YA 5CIPB 2OTWA 3DUUB 5IW1B 2PO6C 4Z7WE 5D2LE 4KKBC 4FFVC 2KQMA 3PXHA 1RJLA 3RGHA 1OSPL 1D6EB 1ZVSB 1U8LB 5IEKB 1UCBL 1OGTA 4BZ2H 1CTNA 4U6TA 4YO0A 5GRVL 4JE4B 2D7TH 1X3DA 1WWCA 1N26A 1QSFD 1FL6A 5E2TH 1G1CA 2X9WA 3QUYA 1MREL 1IKFH 1J8HB 3D25B 5I1LA 1XZ0A 2P45B 4XGZA 3GMOA 3CLEH 5TDPB 1R3JA 4NM4L 4DKEL 3QEQD 2XZCH 4PRNB 4BFBD 1JGDB 4U33A 2AJYH 4YC2C 5BS0A 1KCSL 2RQ8A 2NLJA 4U1SA 1CFSB 1MQKL 5GHWL 43CAA 2LAGB 1IILE 3AB0C 5D7IA 2I5YL 4OB5L 3UTSB 5D6CB 3ARFA 2AKRA 3G08B 2CLZB 4W4OC 4B0MM 4ENED 1I3RB 3VRLF 3ULVL 1NC4A 3QDAA 1RU9L 3OB0H 4I3RL 4I4WA 4LDEB 1ERNA 4X8JA 5C0AB 2VXQH 5F1OB 4D9RD 3QJFB 3TIDB 5E8OA 5CKAA 2WBJB 4WUKH 2A73A 1X5HA 5ID0B 1IEBA 2AQ1A 3RWEB 3AFLA 3VRJA 3O4LA 4Z7UF 5IK3B 4QRRA 4RIRA 1W0WB 4OQTL 3F7YB 4F9LA 3O8XD 3EOBA 3VA2C 1T20A 1ZLSL 4Y4HC 5EU6D 3IU4H 4HKXA 4ZFGH 1JTPA 3WDJA 2NYYD 2W0LA 4GBXB 2IAMC 3K2UL 4RA0C 1XGPB 1E6JH 2D0GA 4I3SH 5FYJD 2IANB 4AQ1B 1XR8A 1DQDH 4N0FB 4U6XA 5BVPH 3D85B 1NUFA 4MS8C 2IFFH 5C86A 1J0IA 4NKMB 4Y7MA 3I50L 5ECJE 3FQXB 4UT7L 2EYTA 1D9KA 3WHXA 4CVWA 3QO1A 1UQSA 1NSNL 1R3LA 2DKSA 3R06B 4K3DH 3WFHB 2VLJA 1SJHA 3HE7D 4U6HB 3W0WB 2Y5EA 5CCKL 4K7PY 4K55A 4P2QD 4DJMA 2C3HA 3B6SA 2LVCA 1L7TH 1F90L 4ODBD 1NCDL 1LGVA 3VH8A 1J1XH 1OARH 5EFIB 4WEUD 5EUKB 4DKAA 1KB5H 5E2VH 5HSFA 3OKDA 4QT5A 3GMNA 3MNVB 4PJAE 5FV1L 4C54A 2LU4A 3EYOA 5I0ZA 2DQUL 5C2BL 5MHSD 2R56L 1VDGA 2HAZA 4PJHB 4N0CC 3IKCA 4R4BB 4IS6A 1GSMA 4LP4A 5MENE 5DI8A 2DQHH 3SE9H 5AYUH 3P2TA 4F9PA 1TVHB 3QI9C 5FDWA 3NVQA 2NY2D 4Q6IC 1L0QA 5FM5O 3KLHC 2CRMA 4G80B 1T83C 5C7XL 2EDNA 4N8CL 5I9QC 3DI2B 3LQAH 1JCKA 5DVMA 2AEQL 5DWUH 3SCMA 1UYWL 1ITBB 4N0YL 1WAAA 5C0FB 4UUJA 1BECA 2VDPL 5ANMA 1N2RA 4M7KH 4MAUH 1LHZA 4XNMB 3T2NL 3SJVA 4X6EB 1YY8B 5D71H 5C0EB 3INUL 2OSLB 3MFFA 1QBAA 4KUZL 2YN3A 4LSQL 5A2LH 5A16A 1MHHA 3BHBA 3I85A 4IEFB 4ZDHA 4GSDL 3U7YH 4J23A 2LVEA 4NNYA 4KDVA 1D5ZB 4Y8DC 1DLFL 1YECL 2HT3D 5H94A 4P4RB 1DBAL 1CL7I 3QDHA 3KPOB 5D7IE 4J3TA 3OBAA 4QTHA 2OJZH 1RURH 3X13B 3WBDA 1KJMA 1YEJL 1BM3L 2LFGA 3ZHKA 5FO8A 4Z7QE 3O6FB 1Y6NR 5D96C 5DQ9A 1FFQA 1MCFA 5C6WH 3QO0A 2MMXA 5ALBL 1S7UA 4YDLB 1U8JB 2BFVH 3ECBB 4KU1A 1ZE3C 5F7EL 1UWXH 4O00A 3O4LE 3WIIH 5IVXB 4Z8FH 4U1HA 4QRRE 4Z77B 2YR3A 3RGVB 5BW7A 2HWZL 1PJ9A 3MRHA 4GRWB 5KS9A 2IPKA 3WIHA 3HC0A 2COQA 1I8LA 3F7VB 4JVUA 1TLKA 2H2SD 4PJAF 5F72S 3GM8A 4NN7C 1KB9J 2H1PL 4OCWL 1S9VB 3ZSTA 5DC9B 2FJFB 3T3PE 2K7PA 1D5BB 4ZFZA 5DRXB 4HUMB 5IW6B 4PRAB 4N9GB 4Y4FA 5HYQB 1J05A 4NZDA 1IC4H 4FA8A 2HH0H 5HHPA 1LK2A 3TJEH 2XRAH 3CXHK 3RI5F 1YMMA 5JO5B 4FQXA 4HGMA 4G6KH 4HUWA 3CVHB 3HZVB 4XVUD 3P73B 3GI9H 5HYSB 3TFKC 1A6TB 4TRPL 1ZGLB 2VLMD 1ZANH 2IGFH 1FN4A 2VLJE 1P9MC 3S35X 1BQHG 3UCRA 4PYHA 1HOCA 3SY0B 1A3QA 4NZTH 3C8KA 5EDXA 3MV01 2JELH 1LEIB 1EBPA 2J3SA 4P48A 1MRFL 1WISA 5JHLH 1CFVL 2P8MB 3OQ3B 3O41A 2BZDA 1GGYA 2FSEA 3B9KA 1Z0NA 4L4TB 4XNYH 4ZPTB 1GGIH 4XBGA 4XCFH 2ZCLH 3EZJB 2DYPD 1U36A 3MV7B 2YUZA 3DURB 1QBLH 3RWFB 4UILH 4P3CH 1HE7A 3U36B 1NL0L 1RJZA 5D7IF 3HE6C 1IQDB 4WEMB 2QQQA 2F8XC 1J5OH 3GSNA 1I8IA 1T7WA 3MGOA 3Q48A 3FO9A 4Z7QF 4JLRB 4NKDB 3SQBA 3JVGC 4QXUL 4PLKD 4KXZH 4J4PC 3RWIA 5F3HB 5DJ0A 5B39A 3PHQA 3BJ91 4CU7A 1MCQA 4YDKL 4YGVB 1RUML 4OV5A 4LASH 4JY6B 1FLRH 4XPGH 1KLGA 3R1GL 1T1YA 5ANME 3V0WH 1UM5L 1QFWL 4PJ8C 3CX2A 2GT9B 3R0NA 4EKXA 2ZPKH 1S7RB 1BIIB 5I1JH 2Y5TB 1UXSB 3EO0B 5F9DC 2J8OA 5JOPE 1F4YL 4A6YB 2VWEE 2EIDA 1MIEH 2YPKA 4NQSB 1QFUL 3T3PF 5KAQG 1QSFA 5CJ5A 2R9HC 3SKNB 1JYXA 1YNKL 2FZ3A 5ACLA 4LNRB 4HFWA 3WXWH 4JY4A 1ZA6B 3ALWA 1KJVB 3QEQA 4Y2OA 3ELAT 1TQCC 2H6PB 5GGTH 2KBGA 4PG2C 1VGEL 5I8KL 1I7ZA 3O81A 3TESA 5GGRB 3QAZB 1CLYL 2E8ZA 1I1AB 3DHMA 4KHXH 1PZ5B 4KJPC 5IMKB 1DANT 2AEPL 2QSTA 3LKPA 2AV1A 3FFDB 1RZKL 1TQBB 3BDYH 4JGUA 1KBGH 5HHXL 4F7EA 5CJXA 1A02N 4HLZG 5D2NC 1CDIA 2HRPH 3T0AA 1HNGA 5J06A 3J7HA 2GW5A 1IGCL 3WMSA 1DLHA 1YC8A 4FQLH 4U0RC 3U9UA 1M7IA 5F7MC 1U95B 3ARGB 4HGWB 5J0BA 1CBVH 4DGVL 4WW2C 3JV4B 2DIJA 4YWGH 2A6IA 1UH3A 4J3SA 5CJQL 2Q3ZA 1U8KB 4OM1L 3T0EC 1OWRM 4Y2DD 4YX2L 5MEPB 5EU6A 3NPZB 1NGWA 2L7UA 2DDQL 3S34H 4IM8A 2H26A 4MCYA 3TZVA 5EIIA 4P3DB 1NCAH 4UTBL 3LDBC 1B88A 3QIUD 1HHKB 3M8OL 3P40A 3RDTB 3TCLB 5B4MC 4WV1B 3U0WH 5FGBA 1UB5A 4NKIH 5JORA 4WFFD 4TOYL 1ZHBA 2ADFH 2AI0L 4YHNA 5L2KD 4Z7WB 3GIZL 5D2LB 4ZUSB 3HB3D 2HJLA 1T6VN 1TVBB 4GRLD 5LJYH 4IRJB 5EB9A 2PYFB 5D1ZC 3HE7A 3MACH 4TSAL 3ZMRA 2Z31C 4M8QB 4P2QA 5D72L 1MJUL 3OHXB 4LRNH 2IMMA 2HVKB 4LOUC 1QOKA 2HLAB 4Z95H 4OUUA 4HZLB 2R69L 4P2OC 1JHKH 1ES0A 5CBEA 3BVNA 2XKSA 4B7IA 5HJ3A 1I1YA 3TNNA 3T1FB 5KANI 3HNSH 3MA7A 4HIHB 1E4JA 1A7NH 1JHLL 1S7QA 4EQ3A 2J6EL 1TJGH 1FNLA 2F15A 4CDHA 1ZXQA 3CAFA 2X4TA 3NCEB 3HS0A 4OZ4A 3C6SA 1FVCA 4QHNB 4QXGL 4DCQB 3BUYB 5IF0B 4LCIH 2Q6WB 1N0XL 3ZT7A 3PWUA 2B5IC 3QZWA 2NZIA 4XPFL 5HYSG 1PKQB 3B43A 3OPZL 3ARXA 4YK4B 3EDEA 1XT5A 5DVLA 5IG7A 1CE6B 1U8IA 5DUPL 4IOSD 5KS9F 3SKOA 4WRLA 3RNKA 3DTXA 2R8SH 1R3HB 3AY4C 5T3XL 2DQJL 3PJSA 1RK1B 5KSBA 4DKDC 2QQKH 4OCRH 5DMKB 3EAKA 5C0IA 2Z92B 2XKNA 1RJYA 3L3KA 4CUCA 2C4FT 4HK3J 4W4NA 5EBLA 2C7UB 1J0JA 3MLWL 5GSRA 1TZIA 4WIQA 4OLXH 3BKYH 2XNAA 4JDZB 2HN7B 3TBWA 2ZNWA 4F15C 5I2IA 1QD0A 2HT2C 4G7YL 4K07A 4X7CC 1UWEH 2NY1B 3F58H 3S37X 2GCYB 4MAYC 5CZXC 4PJ9D 4P5KA 5MEQB 1M1SA 5DZOA 3O3DA 1JI1A 4KKNA 4RQQB 4WI6A 4YBLC 4BSVB 4CBPA 3HZKB 3WXVH 3VWKD 2YA2A 2J8UB 5C8JB 1EEZB 1M4KA 1E4WL 2NTSP 4IIQA 5I16B 3K1KC 3G6DH 4Z7VA 1JF5A 5LGHH 5F21B 1YEDA 4JO1L 2EYRB 2Q8BH 5A1AA 1KCUL 2CKBH 3FZUC 4KUCF 3MLSL 5EH1A 4LSVH 3QPQC 5IHZA 3C5SB 1E4KC 4FOMA 3MOAL 2JF1A 5HDLA 4PJAB 2R39A 4XZUA 2BHYA 3KDMB 3TPUA 5F7FA 4ZTPL 1YEGL 4HT1H 4NQCD 5GRUL 4H1LA 1FYTE 3GSVB 5I1HH 2XQBL 2MCPH 2H41A 4ZUUB 3GBNH 3BQUB 3DRQB 1KCKA 2VKWA 1JGVH 4NC1E 4XCCL 2APVA 1LE5A 2VERN 2HFEA 1T66D 5TGBB 4NDMA 3MCG1 1ULVA 2Y36H 4XNXH 1FAIH 2AXFB 3GMRB 3OKEB 4CADA 2BMKB 4PP2A 1DBML 1V8HA 3ZKSD 3S88L 4KJYA 5E1AA 3ZE2E 1BP3B 3FO1A 4R7DB 3G9AB 4YGAB 2Q7YA 3DUSA 3UX9B 4YDVA 2X10A 1YA5A 3KLDA 5AG9A 1OPGL 2OP4L 4HIIA 3QXTA 4ZO6A 4S10A 3TN0D 3BGMA 4G6AC 2Q8AL 1ZT7A 3MJGX 3CFCH 3PIQA 1QSZA 4D9LL 3MRIB 1HHJA 4M5YL 2GK2A 5F71A 1OTUC 4DTGH 3VXQA 3P30L 1I3VA 7CGTA 1G7HB 4N1HB 4Q9BA 5E6IC 5AAMA 1OM3L 4CKVX 5BZDB 1GXEA 2X41A 1MFCH 1NGQH 5I1IH 2NLJB 3B83A 3NZ8B 1LO5A 4Y16D 2DYPA 5MHSE 5I19H 2WW8A 4NC2B 5F7DB 3STZA 4M7JH 5ICYB 2DQGL 3HFMH 3QPXH 4S1DD 3TYGH 3Q0HA 1ZWIB 2PCPA 5FYLL 3EYQD 2BNQD 3VFSB 3KLAA 5ICZA 1R6VA 5HY9A 1NC4B 5H2BA 5D8JL 3X14B 4KK9D 5L88H 5HI3C 4YEFA 3DO7A 1A4KB 1TCRA 4XT1C 4JZOA 1GGBL 3PXJA 5E8OB 4KV5E 4XRCB 3CMGA 2X1QA 4P23C 2CXGA 4QRRB 5TPWL 1DQLL 4RIRB 3HCVA 4EN3C 2NY0D 3RKDD 1U2CA 1IAIH 3K80A 5J13C 3LSOB 4Y5VA 1CD1A 3VMNA 2NTFA 2HTKC 3N06B 3UTTB 3WN5A 3TVMA 5DMJB 3F7QA 1PGRB 1U91B 4M62H 1IARB 1XCQB 2MNUA 3NACL 4FQQA 2FX8H 3BYYA 2E7BA 3EUUA 3ES6A 1QVOB 3EBAA 1ZLVH 4N8VB 4KHTH 3NIGF 4HWZA 4HFUH 3Q5OA 3MRGB 5CEZH 5IBUB 1Q1JH 1T2XA 2BNRB 4G7VL 3VWJC 4PBWD 1CGSL 1FGVL 2NY6C 1FIGL 2A2QT 4AENA 4JREB 1D9KB 2NY5L 1LD9A 3TYFA 3ZT6A