5F44A

Crystal structure of shaft pilin spaa from lactobacillus rhamnosus gg
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
265
structure length
264
Chain Sequence
b'TTTQNVVLTKYGFDKDVTAIDRATDQIWTGGAKPLQGVDFTIYNVTANYWASPKDYKGSFDSAPVAATGTTNDKGQLTQALPIQSKDASGKTRAAVYLFHETNPRAGYNTSADFWLTLPAKAAADGNVYVYPKNVQKTTYERTFVKKDAETKEVLEGAGFKISNSDGKFLKLTDKDGQSVSIGEGFIDVLANNYRLTWVAESDATVFTSDKSGKFGLNGFADNTTTYTAVETNVPDGYDAAANTDFKADNSSSDILDAPSGILP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell surface protein SpaA
publication title New insights about pilus formation in gut-adapted Lactobacillus rhamnosus GG from the crystal structure of the SpaA backbone-pilin subunit
pubmed doi rcsb
source organism Lactobacillus rhamnosus gg
molecule tags Cell adhesion
total genus 62
structure length 264
sequence length 265
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f44A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f44A01
4PGBB 1CG9B 5DS8A 3V4VL 1FFOA 4R4ND 3TESA 1IAOA 1HZHH 2O5ZH 2NLJA 4FZEH 4C56D 5EBLA 3IVKB 4HK0A 4Y5VC 4ZFZB 1XGYH 2IH3A 4QRPD 4LL9A 2BOCA 4YGVB 5C07A 3UYPA 4JY6A 5TE7L 3IDIA 2NQCA 4PY7A 3QT2A 4B53A 4WV1A 5JW4Q 3JWOL 2R69H 3O3BB 1YEDA 5E08L 1OSPL 1YNKH 3SKJH 4HUUB 1MH5B 4U7MA 4UI2A 1G6RB 2X4TA 5IF0B 4R7NA 2QEJA 4OIIL 1A4KB 2IGFH 1FN4B 4ZYKB 3U7WH 4Y19B 5I71C 4NOBA 4IHOA 3LDBC 4MB5A 1CXKA 1KIRB 3DYMA 4QRUA 5GZOD 4P57A 4PJDF 4Y7MA 3RTQD 1J8HA 4MA3B 2DQDL 2LU4A 1KJVB 1JRHH 3EYUL 1WISA 5HHNA 4JG1H 5TDNB 2E9JA 4U1GB 5ESAA 4R7DB 4KK8C 5CJ5A 1MI5E 1X5FA 3QZWB 1HI6B 4MXQC 1JFQH 5J89A 4H8WC 3GSVA 4BQ8A 1OAZL 5AYUL 5L2KD 4KH2A 4X4MA 5IB5B 2DJ4A 1KIQA 1I8LA 2WUBL 3JV0A 1W0VA 4RISH 1EEZA 5TGBB 5TQ0H 5L8JB 1H3PL 5FCUH 4WJ5A 5ADPL 5L7XH 4ONHB 3MFFA 1S7SB 4XVTL 2ADIA 1PG7X 1KTRL 3FO9B 4JZJC 3BMVA 1OWWA 2UWEA 4JQXC 3BPCB 1NEZG 5GS0L 5FB8B 4FMFA 3M8OH 1ZT7B 2Z93A 4EI5D 5IR1A 3GRWA 1BJ1H 4NKMB 3O11A 4Q9QL 3WSQL 5C0RL 3PGCB 3SGJA 3OF6D 1WT5C 2BK8A 3CXDL 4D3CH 1PGRB 3CFEB 1QLFB 3IKCA 4APQA 3BKJH 2H3NA 1PJ9A 4HKXB 3FT4B 1K3IA 1XH3B 5E6YA 3PWUB 4POZD 1HHIA 1YMHA 2A38A 3SDYL 3LB6D 4DUWA 3OSKA 4U3XA 3STLA 5HI4C 1R3LB 3D25B 5E99L 1XF2A 5MI0B 5HPMB 3PWPA 4Z7VF 2PXYB 2X4OA 4GUPA 5D7JC 3E2HB 5T1MB 3O2VH 2DLTA 5FOBB 3CXHJ 3FAXA 4HKJA 5DJ0B 1YEEL 3ARBC 4YHLH 2WINB 3D39A 3IJYA 5C0JA 4PGDB 4LSRL 4NKQB 5ALBH 1IZKA 2ESVE 2DQCH 3P0YL 4Q9RH 2IPTH 2J1KA 4QRRB 1JGUL 4R96A 1MPAL 3SHSA 2P45B 2VR4A 3PABA 1LQSR 3DECA 4Y5XC 4QOKA 2YWZA 3P9MB 3GSOA 1JP5A 2H9GA 2F54A 3CCHB 4JO3L 3AM8A 4PJ8C 1IGML 4O9HL 1MRFH 1A1NB 1DR9A 2GQHA 5AG8A 4WGWB 4EDWH 4JDZB 4POUB 1U2HA 4XNMB 4ONOA 2QADD 3QG7H 4RQQA 3ALXA 3X13B 2H2PC 5CBAB 2V6HA 4GMTH 3SGKC 3RDTB 3VDBA 4BK4A 3IF1A 5D1QC 1V05A 5TDPB 3QDJB 2ZSVA 2N7BA 1A7QL 3LHPH 3LIZH 3G5YB 1CU4H 1LEGA 4CL7A 1EXUB 3MV9B 5IEKB 5DLML 4LNRB 4Q6IC 3ZE0E 3BPNB 1P7QD 2QSCL 3S34H 2I9LB 1VADB 5HGGS 4MNGE 3TIEA 3KPRE 1UEMA 1HKLH 3EO0A 3MRDA 1T3FA 3HAEG 2QQLH 1B2WL 4H1LH 1U3HB 5KW9L 4YHOL 2COQA 5BVJA 2ED8A 1WLHA 3N9GH 5FK9B 5I1IL 3OXRB 4KK9D 4U3HA 4X6CB 2VUOA 1NCTA 1LO3H 2EDKA 4X6DB 4GG6E 3DVGB 2FWOB 4BKLA 2P5WA 5IJVA 2IEPA 3KYMA 4I2XA 3EZJB 4MJ5B 1QO3B 1Q9KB 5IWLA 1U41A 2BJMH 1BX2A 5JOFA 1BGXL 4YHIB 5D7IA 3VDCA 1MAKA 3F6IA 1I7RB 5J13C 3X14B 3IFLL 5EU4A 5A16B 4TTDD 4LLAA 3C60A 3EYFB 1TZIB 2XA3A 1XF4A 5JA8B 1M7IB 1N3NB 1T2QL 2ZG2A 3ARGC 4XHJD 5CSZA 4H88L 1CBVH 3MNVA 3RIAK 3GMNB 1JK8B 2PO6A 4Y4HD 2APWA 3LKPA 1DANT 1LK3L 3IGAA 3BP5B 4WRLA 5DJAB 3BRDA 2NY3D 5D6CB 3H0TB 1C5CL 4Q9BA 4S1DD 3TP4A 3CUPB 3NCBB 3WFHB 3STZA 3ZL4H 4DJMA 1ZT4A 5HHVL 2GSGB 4F7PB 2VISA 2YUWA 2HLAA 2D7TH 4LSUL 5CS7A 3GMMB 3IDYB 1HH6B 3P3YA 3VXOA 4LBEB 4OZIA 5ESQB 2B5IC 1QA9B 2R9HD 4NJAH 4PRPA 2VLRD 2VLKA 2HT3D 1MI5B 4L8BA 2DMCA 2C3VB 1UM4L 4FABL 1CLYL 3FB8B 2D3VA 1XF3A 5EORH 4P5TA 1FGNL 1CK0L 4K3EL 1CFBA 2NW3B 4HX1A 2R4RH 3GMOB 3UPRB 3W9DA 2FNBA 1GC1C 5DR5H 1TZHB 3OAUL 4KHTH 4KTDH 4MQXC 4FTVA 1T21A 2F53E 2IAMD 1Q94A 2R0ZL 3WLBB 2YK1L 5C9JB 3L3OA 4RBPH 1JN6A 1S5IH 3IFNH 2NY6D 5AZ2H 1XIWC 1UWGL 5LCVL 2NXYC 1R3JB 4RMUA 3H3PL 4PJDB 1U91A 3MLXH 1FFPA 2OS7A 1U8QB 3MGAA 5GRXG 4YHZH 3WEXB 4K3HA 4KJYA 2K7QA 1INDH 4LLUA 1KLUB 5SX5H 3FT3B 4TVSa 5DD5H 4O5LH 3MCKA 3RVTD 5I1HL 5EPMA 2CO6B 1Q1JH 3O6ML 1XGRA 1RMFH 3BKYL 2VXQH 4FQ2L 3EYQD 4K9EH 1SEQL 3VFUB 1A6TB 1JTPA 4NM4H 4X0KB 4Z9KB 1P5UA 5HHPA 3T1WA 4IBLT 3QDHA 4O02H 1MCKA 3Q6GL 2B4CL 3NBNA 2ZCHL 3VMOA 4HD9A 1XEDA 3QQ4A 2L7UA 3EJYC 4M61A 3FZUC 4MYWB 4UV4H 2UUDH 4FQHA 4UDUA 5EFIA 1IGFH 2ESVB 5JORA 5SWSD 3BGMB 3OGCA 5IW1B 2FBJL 3HZVA 3P4MB 1LO4L 4AIZA 4HPYL 1JYXA 3P9WB 2OZ4A 2R29L 5FYKH 4OCWL 3MRCA 3DMMC 4CVZB 1A3RL 4AT6B 1MCRA 2ZKHL 3O41B 2YXFA 5FV2A 5IROA 1Z6JT 3QDMA 4JHAL 1D5XA 5T3XD 4U2YA 5BMFH 2HKFH 5JLZA 3TVMA 3K8KA 2OTUB 2OTWA 5IBTH 4PJ9D 1VACA 5GRZA 3GMQB 1QR1B 3KPPB 3RNQB 1YY8A 2FECL 1KIUA 3D2UB 2Q8BL 1DUYB 3REVA 4D9LH 5JOPD 2LTQB 3GI8H 4DGVL 1FVCA 1E0OB 5DZOA 5I1LA 5HGAA 3LQAL 5D2NC 5EUOA 2NR6C 3CVHA 1T1ZB 5DEFA 4J7RA 1NKOA 4MNGB 4ALAH 2Q76B 3LZFH 5JZ7D 4NO5B 3AREB 2WBJC 4JANB 4KVNH 4MJIB 1S7TA 2CLZB 3L7FB 3UTZB 2DI9A 4KHXL 4X8JA 5F9JA 3KR3L 3AS3A 3LMJL 1NBQA 3BD5A 3EYOB 4OLUH 2KL6A 1S9WB 4M4RA 2EDXA 4YHMH 5DFWH 3RVUD 1KN4L 2L7JA 3AB0B 4F2MB 4P46D 1UXSB 1TVBB 3T3PE 2DWDA 3CZJA 5LGHL 5JXEA 3NTCL 5DJ2A 5DXWA 5DRZA 5I8KL 5CP7A 3VFPA 1DBBL 5FM5O 4ZS7L 4F9PC 4JDTL 1CL7H 4KUCD 2J5LC 4ZAKC 1UJ3A 3NIGF 1MFCH 2BSRA 4NCC2 5CILL 1KJMB 4KQ3H 2BSTB 5BVPL 3GJFK 3O8XA 2BXZA 4FFZL 5FM8A 1YQ2A 3L3JB 1KTLB 4JM2A 3FCTB 2ZZUT 3TO4D 2XN9A 5BJTB 4J3TA 2BRRL 1BWWA 5GZNC 4EI6A 4Q0XH 3CDCA 5C8JB 3C08H 3EO9L 3WMSA 3VGAB 3IAPA 4Z76B 4YDJB 3IDXL 3LKQB 2VSCA 1GPOH 3ZKMC 1R24A 1HDMB 3RJDA 4TTGA 3DTXA 4P4RB 1BBJB 2M1KA 1S7RA 4NUJA 4GMSL 2KDGA 1IFHH 4JO4H 4EJ1C 1DLFL 2R4SH 3LKRA 3NCYS 1Z2KA 3AY4A 2G2RB 2Z31D 3T0XA 5DT1L 2YPLD 3VXUA 3QXDB 1X9QA 1RK1A 2VL4A 4LPUA 4WW2F 1A9EB 2BVPB 3KWWA 3H9SA 2A6DB 1NAKH 3GIVB 4U2ZA 2AJVL 2Y07H 2DMKA 4GAJL 4JN2A 4QTHB 4ZQKB 5HYSG 3CNKA 3O3EA 4LLYB 2FZ3B 1F4XH 2F53B 3FRUA 4Y2DD 5TFSL 4HT1H 1L0XA 4TULH 3ZE1E 4V1DA 1QZ1A 2ICWB 1X5AA 3UX9B 4LSVH 1BD2D 5CZVH 1WK0A 1JPGA 3TZVD 1I8MA 1RJLB 1FL3B 3KJ6L 4UINL 3UTPE 2N7AA 5MEQA 3VXMD 1JHLH 1FNEA 5IVXE 3RU8H 5E6IB 5B8CA 2L0DA 1E28B 5ETUA 4R0LC 3DSFH 3NPSB 1FBIH 4P0DA 2NY1C 1B0RB 4FXGA 4KRMB 1MIMH 1Z5LA 4U1JA 1DQMH 5IJKA 5J6GB 1JZ5A 3VFRA 1DQDL 4HC1A 3O6FA 3B9KC 2EYTB 3G5ZA 4DTGL 4ZFGL 5D7LE 3WUWB 1JWUB 2VXUH 5CJQL 2JIXA 2EH8L 4N5ED 3ZDXF 4Y1AD 4P2OC 4QWWD 2G9HA 1A6AA 1QLRA 5F7EL 4MNQE 3U30C 1NCAL 3S96A 4M02A 1D5IL 5B21A 4HCRL 1IGCH 2VH5L 1KN2H 4KRPD 1YNTB 4LSDA 1OD9A 5JOEA 4LLQB 2EE9A 5JUEL 3SE8L 4KK5D 3NCEB 2OM5A 2DJSA 2AXJA 4I3SL 3FO2A 3H3KA 1PLGL 1F8TL 2GT9B 5D9SA 4DVRL 4AJ0A 5FYKU 5I8OH 3I02B 3MJ7B 1WIOA 2PYEE 3MV8E 5KANG 1DQQB 3DRTB 1MFDL 2EDYA 1JF1A 2CR6A 4X6EB 3QWQB 4FRWA 3WKML 3THMH 4XBGA 3G6DH 4OZ4B 3CDGB 5F6IC 1KOAA 5JXAH 3ULUD 1EBAA 4KKLD 1CDJA 1V5JA 4B7IA 3WFBH 4JHWL 1DEDA 3DX9A 4YIQB 1I1AC 2VWEC 5BS0E 1U93A 5FYKE 3SO3B 5EZIL 5E00B 2Z91B 5F3BA 1UACL 3TV3L 3P9LA 4JPVL 4WHYG 4NUGH 2V2XA 1T0MA 1CE1H 1MCQA 5FHAH 4KUCF 5DJZA 3RZCC 3FT2B 2EYRB 3D9AH 3MV7B 1AE6L 4UTAL 4RDQG 3GMPB 3S4SG 4ODVL 4LKXA 4WI2A 3BQUA 1OVZA 5E03A 2RIKA 2WMPA 2X44D 1OP9A 3HE6A 1Q9OB 2GSIB 4XPFH 4I77L 4JGJA 3U0TA 2IF7A 3HI5H 3DYPA 1SEBA 2QKIB 4MX7A 5KG9B 4XCCL 2KZWA 4R97C 1QEWA 4D9QE 2XACC 4HDIB 3VFSA 2VL5B 3OZ9L 1PQZB 2ZCKL 1OTTC 4ZTOH 3DOSA 4J23A 2A77L 5MP6H 5IB3A 3MRGA 1U8NA 3KXFD 4MCZA 5E1AA 3S3JA 3SQBA 1Q72L 1YN6B 3WJJA 2CH8A 3SKUD 3VWJD 3U7YL 3HLAB 3WL9A 1YYMH 4IJ3C 2H1PL 2IPUG 3VFOA 4D0BA 3OG6B 1DQJA 1XR8B 4CKVX 3HN3A 3LN4B 4WHTB 4EVNA 4V2CB 4HFWA 3IJHB 3RTQC 2PF6A 2EE3A 1TETL 2IADA 1G1YA 4L4TE 4U6YA 1I7TB 5FGBC 1VKXA 5HPOA 5KAQF 3ULVL 1G9MH 1B0GB 1AKJB 4F57L 5C0DB 3PQYE 2NX5A 1GOFA 2GEEA 2A73A 3P73B 1CFNA 3TA3B 1WZ1L 4CW1A 4PB0L 4HJGA 1AO7A 4F7CA 4UB0H 1K8IA 4F7EA 5E2VH 2NY7L 3GSNL 3DHMA 2BY3A 3U9PL 5I1AA 4CU7A 5HXMA 2VITB 3L6FA 3MRMB 2Z35B 4NQDE 2ADFH 3CXHK 4QT5A 2FX9H 1ZAGA 4GAYA 4LCWA 1IAIH 1T20A 4LCYA 3W2DH 5AD0A 5DGRA 4GRLA 3EDEA 3SDCA 1KCUL 3KNBB 3N1MC 1KB5A 3RNKB 1EHXA 5FUOL 5JW4M 2FJFA 2O93L 1EJ6A 1BVKA 1CICD 4WFFE 3BIAX 2NW2B 1MCEA 4OZHA 4PB9H 4NKIH 3G6JA 1LDPH 4YNYA 1JWSB 1A0QL 2A83B 4EUPG 5IK3B 1YMMA 2O5XH 1J1OH 2FX7H 3CFKA 1IKFL 3OKOB 4XNZC 4XP9H 5GRUL 4AEHL 4HS8H 1X5KA 1QRND 1SJXA 3QXAA 4POZC 3OB0H 1T1WA 5IVXB 3CFDB 5JDJA 4MNHB 3VW3H 4KPHL 4P3DB 5BO1H 3GFUA 3O2WL 4KMQA 3MNWA 4OCLC 5B39G 1U8LA 4ODTH 5CCKL 3P4NA 4C83B 3VXRE 2WP3T 1DBJH 4ZUWA 4XBEL 4OTXL 25C8H 3BIKA 5F7UA 3HG1E 5D7LB 4LVNB 4UU9B 4L3ED 2W60A 2ARJA 5KJRH 4P3WA 3SE4C 4XBPA 1GJIA 1PAMA 3I6KB 5F1IA 4XXDA 1A14L 3F7YB 3DVNB 3MFGB 2Z92A 3ULUF 3B6SA 1B6UA 3HA0A 4J12A 5F3HB 1KLGA 4NQCA 4OUUB 5ILTH 2HFEA 2IC2A 3CDYA 1AR2A 4RGOH 4YE4H 4KMLB 3RWJB 2VSDA 1EHLL 4CRPA 1YDPB 4JAMA 3QIBD 4WDIB 4UUJA 5GRVK 4CNIA 1DBMH 5H2BB 2PYEB 5IFAL 3MV8B 1FNGA 2G75B 2GIYA 3SE9L 3W0WE 1OWRM 1ERNA 4HV8B 3SO5A 1R5VB 1GH7A 2VMFA 4K71C 4G43A 3MJ8A 3HE7B 4ZD3L 3CVIL 5IV2A 1RIVH 1O7VA 1A7RL 2ENSA 5DD1H 2F19H 3TT1L 5CJXA 4ZUUB 4JN1H 1HHKB 4JFXB 3MUGA 2IBGA 2R1YA 4YUEH 5A40E 3WBDA 1AXTH 4L8CA 5BS0B 4NRYA 4NQXA 5C0AA 4ISVB 1G0YR 4G6ML 2X09A 4JO2L 2JJTA 4BQCA 3EOTH 5HHXH 1G0XA 5D1ZA 5MEOB 2OBGA 4FQJL 3D0VA 2YKLL 3FB5B 1MQKH 5T1KD 3ZZ1A 2K9UA 5C0IB 3V8CA 1G7PB 1WAAA 5HHOB 1WICA 5I16B 3MREA 4KK9C 1RZKC 2MMXA 2Q1EA 1Q0YH 3NABL 4J3OC 4J3VA 2OR9L 3EOYG 3PXHA 4XZUB 3LEYL 4BELD 5JTWA 2PW1A 1CYGA 1S9XB 1MAMH 1PEWA 1D7FA 1DQLH 3QZWG 3DRQA 3QPXH 4L3CA 2DLGA 3WXWL 2VKWA 3IU4L 4ZO6A 1S7QB 3K1KC 7FABL 43CAA 4TTDC 3IU3B 5JPMB 2QQKH 1AP2A 4WW1B 1VHPA 4G6FB 1OT2A 3T1FA 1K4DB 3WFZA 2OL3H 4EDXB 1TVDA 3QO0B 3S36H 3V9FA 4Y4HC 2AGJH 1FIGH 4G9FE 1CXLA 4I3RL 4TSBH 5HVFB 3SQOL 2XV6B 4NN7C 3MGTA 3SE3C 4Y5VA 1J1PH 1U8PB 5DHYA 5GGSY 4K7PX 5GIRB 2YA1A 3VGBA 2X4PA 1MCIA 2BNQE 1F11A 3GKWL 3RWGB 5F9WC 5IFJA 5EC1A 3IRPX 5EIVA 2VDPH 4LIQL 1NGZB 5ITBL 3O6KL 5KVEL 5HYJE 3DGGA 1KJ2L 1OD7A 5DK0A 3GI9H 5E8EB 2PW2A 2V5YA 1OY3B 2YC1A 1F4YL 3MR9B 3ECBA 2Y36H 3QQ9D 2W65B 2Q8AL 1FNSL 3ZTJH 5DJDA 3PQYB 2R9HC 2CRIA 5J8OA 3RIAF 1U2CA 2HT3C 4HULB 2X89A 3QHTC 1QFOA 5GS3A 3VRJB 3BPLB 5K59E 4TUJA 3DVFA 2CK0H 1T4KB 4NBZB 5FUCE 4WCYH 4Z8FH 1T5XB 5IB1A 3R06A 1QP1A 2DB8A 3GJFH 3DROA 1ORQB 4I18B 4P49A 2Y23A 4LSSH 1JGLL 3ES6B 3PL6D 4W4NA 4G7YH 3L9RB 2HRLA 4Y5YB 4ZXBB 2IQ9L 4P5KA 1IZJA 5DMJB 4GRWF 7CGTA 3NACH 4U6HB 3SCMD 4JZJA 1A8JH 4G80B 1FZOA 3BH9A 2X41A 1JWMA 4JQXA 3WIHL 1I9EA 2WIIA 5KSBE 5KZCD 3BZEA 4JDVB 3KPRD 4U1LB 2PTTB 1YEIH 3OKNB 2HVJB 5GGTL 5DMIH 1F90L 2GTZB 1RUMH 2A6JA 2Y06L 1WT5A 1OLZA 4F8QA 1Q38A 1AQDB 2P7TB 3EYQC 2P24A 1FSKC 1U58B 1A6UH 1FLRH 2EH7H 4HMDA 4NZUL 4OLXH 4HKZA 5JW5A 3VXRB 4POYA 1MCJA 4PY8I 5INCB 3HG1B 3O4LA 3TBVB 4PLKC 4M5ZH 1KYOK 5EO9B 3AAZB 2Z4QB 4TVPL 4RNRB 5D7JA 1RIHL 4LRNH 1ZLVH 5IFHH 5K9JL 5LXGH 2DD8L 5D7KE 1X44A 1KEGH 2D03L 2P8PB 2DQEH 2DYPA 4N8PA 4GRWE 3ARBA 1S7WA 4PV8A 5KSUA 1RVFH 3DYOA 4LCUB 3RL2B 5K9KB 3VWKB 3HPLB 1WC7B 1QSEA 5CEZH 4RMQA 5GPRA 3BAEL 3QQ3B 4BZ2L 1OOAA 4G6JL 3TO2A 1ZHBA 2NZIA 1I1RA 5CZXD 3HNTH 5FUZL 5E9DA 4Z78A 2VZVA 2AK1L 5TE6L 3SGEH 4Y5XA 2VXVH 3QYCA 4PJ9C 1UKTA 3DXAA 5ICXB 3VXNA 1TQCB 4U1MA 1LO0H 4PJ8A 4PUBH 3W0WB 4EXKA 3JZ7A 3KPOA 2NTFB 5CBEB 1MHCB 5EO1B 1N2RB 2VUYA 2R2EB 3H7BA 5EH1A 3DX7A 3H2WA 2G60H 1LK2B 3PWJA 3L1OL 1UCBL 4C4KT 1RHHB 3MJ6A 4XWOC 3SGKA 3TNNA 4NZRL 3VD4A 5D1QA 1NKRA 4F7MB 5BXFB 3EYVA 3CPLB 4PRNB 1RJZB 2R2BB 1BEYH 5C07D 3QNXA 2BCKA 3S88H 4Q6IA 1D5ZB 3MXVL 1ED3B 1C5DB 1NDGB 1W72A 4HFUH 1CT8A 5B38B 1GIGH 2XQYK 1LE9B 1C12A 4NNPL 3KPQB 3RUGE 1I8KA 4JPWL 3U0WH 4W6XB 1F13A 3R8QA 3B2UC 3FONB 1ZE3C 3V52H 4WI9A 5FA3A 4R2GD 1NFDF 4NCC1 2JELL 3NZ8B 2AABH 1KELL 4M1GH 3C2AH 1BIHA 1J8HD 3Q3GB 3GSWA 5J9PB 1K5NB 1ORSA 1JL8A 3BE1H 4JFDA 2JB5H 5CFHA 2OK0H 1HEZB 2E7LC 2Z8SA 2ZPKL 4NBXB 4CU6A 2E6PA 3DUUA 1D5BB 3MLTA 4CAGA 4IRZL 1K2DA 3PHOB 5C0EB 3VA6A 2HG5A 1DN0B 1QR4A 4L8SB 4XVSH 2VDMH 4G9FB 2CKBH 1FO0B 5LGKA 4X5XA 1M6OB 3V4VH 1IGIL 1ZHNA 1IILE 1A1MB 3ARGA 3KG5A 4HH9A 4FFVC 5DJYA 3L3DB 1BQHA 1D9KB 5H35B 4PRHA 2BNQB 4OIAA 2AXFA 4X6FA 1ZHKA 5TE7H 3UPCA 4JREB 4WO4D 3GMLA 2A6IB 2EEDA 3JWOH 5E08H 1OSPH 5HYJB 3I3BA 3FTGB 4P4KC 3KPMA 1AHWC 4WEMB 3T4AA 2YSSB 4OIIH 1INQB 4X4YA 2Z31C 5E7BA 1EGJL 4LDLB 2BHYA 1MHHB 4YAQA 4OD1L 4PG9B 1YJDC 4OQTA 4KI5F 1NFIB 1SYVB 2DQDH 3P0GB 4KKBD 4HS6A 4D0DA 2X40A 2IWGA 1KCRH 1TIUA 3RWIA 1DANU 4JHBA 4WWKC 3FQWA 3GHBL 5KVDL 4IMLA 1CLCA 4RMWA 4QHMB 1JTOA 1OAZH 5AYUH 3QUZC 4J3WA 2G5BB 3OKKB 3QAZC 4QXWA 1PKQB 2WUBH 2ERJB 3HUJA 2ZUQC 5F70A 4LOUC 1QQDA 1H3PH 1WIPA 2H26A 2AKRB 1DEEA 5ADPH 1T04A 2R2HA 5EN2B 4RGNE 5BRZE 3U2SA 4WHCA 4XVTH 4WFEE 1KIPB 2X2YA 1XIWA 4MLIA 2RAMA 5I8CB 4QOKD 3FFDB 5GS0H 2F54D 4Q9QH 3WSQH 1Q9WB 4LLWA 3LKSA 4MGXA 1Y18A 5C0RH 4JKWA 3NAAL 3C6SA 3CXDH 4RGMC 2DQIL 2V2WA 1D6EA 4HUWA 4PJXA 4ZPVB 1C7SA 4DEPC 2HJLB 4CJ1A 2QL1A 3P11L 4QWWC 2XNAA 1LO5A 3VI4F 3GSXB 5E2UL 3SDYH 3KPNA 5IMLB 4XCEA 3O3UN 4G42A 2VYRE 2Y9RT 5E99H 1LE5A 5DD3L 2X1WL 4XNXL 3B2VH 3ZTNL 4GRWB 4P48A 4KK5C 1D3CA 4JQVC 5ACZB 3KYNB 2DLFL 2H32A 4NN6C 1R3HB 1YEEH 1WFUA 4XH2A 2WP3O 4XTRC 1SJEB 12E8L 4LSRH 5FYJD 4FFYL 4HK3N 5TDOA 4FQXB 5IBUG 4Z0XA 3P0YH 5SWZA 1WV7T 1JGUH 1MPAH 2VZTA 3DMMA 3VH8A 4K23L 3C8DA 3DJ9A 4P5MB 1SBSL 1JGDA 3DX6B 4GW5B 4WI4A 3MRKB 3AU1B 3NA9L 1MFAL 4JO3H 3WXVH 1IGMH 3EO1B 4KKLC 4O9HH 4PRIB 3TBTA 1U3ZA 4PR5B 5DQDL 3C60D 5FKPA 3JWDC 5IKCA 1SBBA 2VABB 5I9QB 1JHKL 1G7HA 5CEZE 4JEGB 2JJSC 4Q7DA 4YPGA 3O45B 4GAGL 1VFOA 4LLVA 3SKNA 2I07A 4W70A 3S37L 2HRPL 5IVOA 5CIPA 1NCCL 2D7NA 2D0GA 4YQXL 4QF1B 4FG6C 5D2NA 5T3ZH 2W9LA 4MS8D 1NCDL 5GRJL 2HH0L 1W8NA 3QXVA 4LK4A 4GKZA 2C1PA 2GJ6A 2QSCH 4HK3J 2WBJA 3HR6A 4Q97A 5ISZE 1KPRB 5HDLA 2D4FA 4IM8A 1JZ2A 1B2WH 1MWAB 2D31B 2AXGA 1OM3L 5KW9H 2VQ1B 4YHOH 2EXWC 1NAML 5I1IH 3K74B 3QRFM 4NIKB 1CGSL 2UWEF 4LMQE 3OAYK 1U8KB 5JMRA 3UTPD 4U31A 4GQ9L 4DWHA 2CIKA 1BGXH 1LP9E 2APTA 1WWWX 4QNPF 3IAGC 3IFLH 4P5TD 4F9PA 4GS7B 5KOVC 3JTSB 1EAPA 2PXYC 4MCYB 1TTFA 2APVA 3VWJC 1YY9D 1GAFL 3KYOB 4ZAKA 4W68A 3LKNB 4YDKL 3C6LB 4DKEL 3ZSTA 3FOLB 1T2QH 3CLFL 4JKLA 5BQ7B 2EDLA 4FTVD 3TIDB 4H88H 4G6AC 5C08E 3BZDA 2W9DL 4MNQD 1LK3H 1NFDB 1P7KA 2C7UA 2X4RA 1RZJL 1KTDA 1C5CH 4PD4J 1RULL 1ZV5A 2HJFA 2VLJA 4PJIE 2NY4D 2EIEA 4D0CA 5HGBA 1KXQE 3DGCR 5A2FA 4KJPD 4AEFA 3WUWG 3VCLB 4NP4L 4QY8A 4YHKH 3RAJH 5HHVH 2MJWA 2MCG1 1CFVL 5DO2C 3TYGL 4ODWB 5EUKB 3FHQA 4PRDA 2XPGB 4MDIB 5DK2A 4PJ7A 1NEZA 4LSUH 2BMKA 4QNPE 2OR7A 3RDTC 4E41B 3P30L 1BBDL 3RY6C 4QCIB 5D72H 3AXLA 4YHNA 2BVEA 5T1LA 1UYWL 1EEYA 4MD5A 2JKXA 4PJCE 4FABH 1CLYH 4X9GA 4H5SA 4KDTC 1CK0H 1BFVL 4A6YL 3WLWC 1G9EA 3U36B 1NH6A 1E4XL 1HOCB 2MFNA 4RAVA 3BPNC 5ADOL 2XKNB 1T1XA 4NPYA 3OAUH 1IM3B 1MAJA 3QIUB 4PJAA 3Q5OA 3I3EA 2R0ZH 4RGNB 3STBA 2YK1H 2GW5A 1PY4A 5C09A 1ADQA 5D2LA 4J1UA 1NGXB 1UWGH 3RGVD 2GJJA 3FQUA 1ZHLA 5LCVH 3TH3T 3QDMD 4QRTA 3H3PH 4UT6L 3GJFB 5ENWA 2EDFA 1AGFA 1HXYB 4JKPL 3G5VA 4PTUA 3SDAB 3TVMD 1ADQH 1T1YA 4JFHD 4JFFE 4K94L 3VFGL 5I1DA 4R0LA 3EFFB 2Y25A 3ZKND 5DJ8B 5DHVB 5EBGA 4UTBH 2XTJB 5DQ9A 5F7DA 1MFBL 3IXAB 2D0FA 1MELA 1A7NL 3JV6A 1N59A 4ZDHA 5I1HH 3B9KA 1S8DB 4D9QD 3O6MH 4RRPG 1B90A 3BKYH 4FQ2H 1OPGH 5D7IF 4HG4K 2FSEB 1J0KA 4E42A 5SV4A 2FHFA 4P2OA 2XIDA 1CGVA 5HI3C 3VFMA 3S97C 3Q6GH 2B4CH 2HLFC 3ULSB 2ZCHH 5JW3L 1F4WL 3BN3B 4OD2A 1HHHB 2XI9A 4PJ5E 3OR7B 4DVBA 1FZMB 3QIBC 1T0NA 2MNUA 3C9NB 3MRFA 1MJUL 4G8FA 1V8HA 2FBJH 5H94A 1N8ZA 5BZWB 4P9HC 1LO4H 1UA6L 1EO5A 2BOBA 2R29H 1HYSD 3I84A 4OCWH 5IESL 3MOAL 4PLJD 4JY4B 1A3RH 4L4TD 4H1LG 2ICCA 3IDYC 4X4XB 3KPSA 4JHAH 4PRBB 1DTUA 3V79C 5JXED 1JZ3A 3HAEA 1FVEB 5KSAB 1NGYB 3RBSA 2W9EH 2EC8A 5L2JB 1UM6L 3TBYA 3BEWB 4HIEB 5GSRB 4HIJB 5IG7B 5C71A 3HAEH 4S1SL 5DA4A 4AQ1B 4N68A 4OZIF 2Q8BH 4YDLB 4WI6A 1IM9A 1I1AA 2DIBA 3QPQD 4NQDD 1JNJA 3ZT5A 1H3UA 2XWTB 3O8XD 3OKDB 5AZEL 4DGVH 4ZSOA 4MXWL 1L7IL 5TH2B 4JM2D 4LFHD 5EBLB 3D85A 2QV2A 4GFTB 3QFJA 4JY6B 4LGSB 1LWRA 5D5MA 3IDIB 3RZCA 2F74A 4PY7B 5T5FL 3NFSL 4Z7UA 3QEHB 4PG2C 3QDGA 5CAYB 1H3XA 3X3FH 1RZFL 1PG7H 2N4IA 4QHUA 4XP6L 4YR6A 4KHXH 1U95B 3KR3H 1VERA 3MV11 1WF5A 1OTUD 3T77A 3W39B 3LMJH 4IHOB 2R1WA 2APBA 4P57B 4PJFA 3QA3A 4ONFL 5E70A 4ZUTB 3VXUD 1LP9B 4UT9L 4DQOL 2Z8VC 3RVWC 4TPRL 4M8QB 4OZGE 4L4VE 4QRPA 3H9SD 2HVKB 5HHNB 2OMBA 2FO1A 2H2SD 5I8KH 4WTXA 3VXRD 1DBBH 4PFEA 2LU3A 4PJHA 4ZS7H 4DCQA 2XKSA 3CFBB 4JDTH 5JW4R 4U6XB 4Y4KD 4BJLA 3VD3A 5DJXB 5JMOC 4KGLA 5CILH 1O0VA 2B39A 3KLDA 3IKKA 5BVPH 4G8GE 3QUML 4FFZH 5JQ6L 5BZDA 1JI2A 2A74A 1W0VB 1EEZB 4DN4L 1NMAL 4MZ2A 5I74B 3K2UL 4WJ5B 2BRRH 2LVEA 3DNKA 3RTQA 5D96B 2ZWLT 1HQRB 4AL8L 3EO9H 1JPFB 4DK3A 5FGBA 2CKBB 3IDXH 4DUXA 1QSFE 2XICA 5DJCA 3QXUA 2UY6A 1ZA3A 1VEPA 4U1NB 2Z93B 5IR1B 2CIIA 1TFHA 3QHFL 1A2YA 4JJHA 1J10A 2NY2D 1DLHB 2D0HA 2R1XA 3FKUS 3IKCB 4APQB 4GW1B 1FYTE 1J18A 2H3NB 5ITFA 5DT1H 4YEFA 4PJCB 2Q7YA 3LV3A 2JIXD 4AEIL 2GK0A 3VMNA 1TQBB 1YMHB 3VXPA 3BHBA 2WQRA 2UVFA 2AJVH 3STLB 4GAJH 3GGWA 3WNMA 3PWPB 4QHNB 3C8KA 1QVOA 3UTQA 4XP4L 4LVHB 4HKJB 3AREC 5FO7A 3MRRA 5TFSH 3E1F1 2D7MA 3DETD 1XGUA 3D39B 3FO0L 3OF6A 5EUOF 3W81A 1M05B 2P49B 5CD3A 3TBWA 2F58L 3KJ6H 4R96B 4UINH 5JA9A 3V6ZA 1P4LA 3PWLA 4K7FA 3AB0C 2QSVA 4HHAB 4RIRB 2DQFA 2FDBP 3K80A 2VZ1A 4JGUA 2EDTA 3HRZB 3K1DA 1J5OL 4I9WE 1DQDH 4RQQB 1VFAA 3RWEB 3WN5B 2VE6A 4DTGH 3IF1B 4ZFGH 3SE4A 5GQBA 4XI5C 1WCQA 5CJQH 5I6XB 1ND0B 3JBG7 2DDQL 1ACZA 5F7EH 1A7BA 1IGJA 4PJ5B 5F88A 3RP1A 3C5JA 5JPNA 1NCAH 3VFTB 1HHGA 1D5IH 2NCMA 5JHDE 3ARDB 4HCRH 3MRNA 2VH5H 4KMTL 3W11D 3VGAC 1OAKL 3TIEB 5JUEH 3SE8H 2ADJA 4I0CC 3BQUD 4G8IA 3EGSB 3EO0B 4JM2F 3DIFA 4UILL 1PLGH 2YEZB 1F8TH 3QUKA 3K81A 4DVRH 2BX5A 2VAAA 1QTYT 4JVWA 4YO0A 5FAAA 2KUTA 5C0BE 1V7ML 2P5WB 3X11B 4BKLB 1MFDH 4I4WA 3IFPA 3RKDD 4UAOB 5IJVB 2X70A 3BZFA 4LPTA 4X83A 1EMTL 4YWGL 2FBOJ 3UTSE 1L6XA 1KFAL 4D9RE 4M9PA 4RFNB 1BX2B 4Q2ZA 5JOFB 2P4AB 4JFPA 3TYFA 3AS0A 1Q0XL 5EU4B 1P7QA 2CXGA 4JHWH 3F6LA 3WHXA 4PJGA 4JRWA 1QRKA 1XF4B 1X4XA 4AK1A 2R0LL 4PJEE 1UT9A 4R2GC 5C7XL 5KS9A 3UCRA 3BYTA 5EZIH 5A2JH 1UACH 3U4BL 3TV3H 5DMKB 3VJ6B 2ATKB 5TQ2L 5C0FA 2PO6B 4YFEA 5HYQA 3RWFA 1H8OA 3PP3H 3SJVE 3SDXE 2ICWI 4UTAH 1EVUA 3TJEL 3ZDZF 2NX5D 4GO6B 4ODVH 2VB5A 3DV6A 2OQJA 1XCQB 5E6IC 4LFHG 3R8BB 3NPSC 4QHLB 4JLRA 2RCSH 3CDFA 3R4DA 4N9GA 3CK0L 4I77H 1G7JB 3U6RA 1CXEA 4XCCH 2VISB 2HLAB 3VXOB 4L4VB 3OL2A 2G5RA 3OZ9H 4LCWD 2HTLD 2ZCKH 1JUFA 3UTOA 4PRPB 4Y4HA 4GRLD 3SDCD 1HSBA 2VLKB 2A77H 1J0JA 3MRPA 4WO4C 4ZO9A 3SE3A 3MLUL 4Y8AA 2PCPB 3FB6A 5EU5A 5HBBA 5GRYA 2I9TA 4HX1B 4G8GB 2AJZA 2R23A 3U7YH 1YMMD 3SKMA 2H1PH 5FDWA 1CQYA 4P2QE 4Z7NF 5CGYC 4Z95L 5HYSA 1T89C 1KPVA 3QH3A 2BY2A 3QUYD 1TETH 1OQOA 2FEDD 2YD9A 3EOBA 5IMMA 4WVRA 3ULVH 1E6JL 2GFBA 4F57H 1E4WL 1INEL 2VLRA 3REWB 5GSVB 1CE6A 1JZ6A 3LPGA 2PYFB 3LRGA 1WZ1H 4LASL 5K9OB 5LQBL 2H6PA 1DVFD 3MJ9L 1QPXA 1OAXL 2NY7H 3GSNH 3PXJA 4ELMA 1M71B 4LLUB 3U82B 3U9PH 4E5XB 3MCKB 3RX7A 4XCFL 5EPMB 5T3XL 5DURD 3SO3C 1XGRB 1JF6A 1YPZA 4IRJB 3P40A 4LVOB 3BO8B 1U8IA 3FFCE 1KCUH 1FPTL 1RIUL 4MVBD 4RAHA 1RJYA 1XZ0A 4TSAL 5LAXA 4RFEA 5FUOH 3ARYA 2Y5TA 1N5YL 3QQ4B 4WUUA 3RY4A 4Z0BL 5HD8D 2AV1B 1A6VL 1X4ZA 1A0QH 2VJXA 1KT2A 1CFTA 2GTWA 4ZTPH 3QFDA 2CR3A 1BOGB 1LNUB 1GZPB 1CDHA 1IKFH 3TNMB 5ID1A 1K4CA 5HHMB 5GRUH 1N5AA 4OT1H 4AIZB 1MJJA 4JZOA 3NOIA 1D5MB 3CH1A 2IBZY 4JFOA 4EQ2A 3PGDB 4RMVA 1R5WB 4KPHH 4QHKI 3VFWA 3O2WH 4KY1L 4NYLA 2KQMA 4N1HB 4KKCC 5HGHA 5JLZB 5CCKH 3F5WA 1WBZB 4CVUA 2HT2D 1OP5K 1I9RL 4XBEH 1VACB 1OSZA 5C0AD 1YC7A 5IEHB 1BIIB 5I75B 1HHJB 2Q20A 1HE7A 5GISL 5SWSA 1B6DA 2D9QB 1WWAX 1T7VA 5DRNA 1ZGLA 5DVMA 1F6AB 3VXQB 1A14H 1I1CA 1MCCA 4NC0B 1UB6B 3MYJA 5HGAB 4LF3B 3LRSA 1F6FB 3J7HA 5E8OA 5L8LB 5EUOB 3NFPA 3PIQA 2M26A 4HIIA 4UBDC 3VI3F 3K46A 3QXWA 3MRHB 1RZIB 1OGAE 4BQBA 35C8L 1EHLH 1VESA 1FORL 3O3DB 4PJ9A 5E5UB 4GKSB 4X99A 2DICA 2W92A 4LQFL 5IFAH 4JRYA 3MZGB 4X8JB 5HJ3A 5J6HA 2IFFL 1AXSB 3O4OC 4KC3B 3SE9H 5HVGB 5BOZG 3UTSB 3NIDE 4OFPA 4ZG1A 4LLMA 2PR4L 2CRYA 3S4SA 3BKCL 4ZD3H 3CVIH 5ANMA 2WIMA 2NXZD 1NC4A 1A7RH 4FQIL 3QCTH 3TT1H 2X4QB 5SX4H 4LLDA 1U8JB 5CLWA 4MS8C 2YPKB 3JUYA 4HWZA 1MHEA 1ZEAL 4WIQA 5CP7B 3VFPB 3VXSA 2QBWA 2AI0L 1EIBA 2DMBA 1XGPA 4B5EA 4PJEB 4G6MH 4JO2H 5I76B 1P84J 5C0CE 2MQCA 1UJ3B 4L8DB 1F58L 1SY6A 2JB6B 3MRLB 1MUJA 2BSRB 4FQJH 5J1TC 2YKLH 3MLSL 3L3IB 1QOKA 3T2NH 4FHBD 3E6HB 5BCAA 4PGZA 1T2XA 3NABH 4TYUA 2EKSA 3OJMB 4BQ9A 1JZ7A 1S5HA 1I75A 3SDXB 2K1MA 2XN9B 1MOEA 3LEYH 1X5YA 3N50A 3MACL 5BRZD 4OZHF 4LQ1A 3G6JF 4WFED 3QJHB 5I2IB 3VRIB 4JFEA 4YDVA 5I73B 2X89D 3WXWH 4XP1L 4XMPL 4N0FA 3IU4H 7FABH 2E7LA 1R24B 4HWBA 2EYSB 4WEBL 4UDTA 2A2QT 2C3XA 2YD7A 4ZNEA 4LVNC 5F1SA 1EV2E 3BVNA 5I8EA 3BXNA 5EB9A 4JFYB 4YFLF 5A2IH 2XWBA 3HI6L 4I3RH 1G9NL 3P2TA 4KK6C 3T0EE 4F7TB 3QIWB 5IVZA 3GKWH 3GSUA 5GGQL 3T8XA 3LN9A 4P2QB 4E0RA 4P4KA 1KGCE 5ITBH 3O6KH 5E8NA 1ETZA 5KVEH 4J2XA 1AHWA 4YZFE 5KN5A 3MLRL 3T4YA 4LAJH 4V1DB 1KJ2H 1WITA 4ETQB 1WGOA 1F4YH 4OZFH 5DTFB 2Z31A 2X05A 5J0BA 5SWQB 2Q8AH 1FNSH 3D3VE 5E5RB 3ROOB 4QEGA 3NGBB 5MEQB 4L9DA 4LCCB 1OB1B 4EUPA 3F7VA 3DUHA 1CGTA 4H26B 4HLZH 2CD0A 2APFA 1QYGL 1J1XL 2F5AL 3MSPA 3CC5A 1X6LA 5EZJA 1TVHB 1X5JA 5HI4D 1I7UB 4FXGB 4WWKA 1ZWIA 3G6AA 4PGCA 1Z5LB 1FFNB 4HZAA 3VFRB 1WWBX 2YN5A 5IVNA 2NY0B 4PGEB 3O6FB 1YN7A 2DYPD 3QUZA 3FFCB 5B39A 3ARBD 2VDOH 2P5EE 2E3VA 1BD2A 1JGLH 3AS1A 3LS4L 3ULVE 4IS6A 1JNHB 3ULUL 2XT1B 3MROB 4G7VL 2IQ9H 1FJ1A 3GEWB 1RUKL 5EOTA 3RGVC 2JK5B 2FEEI 2GITA 3MLZL 4ODHL 3VXMA 2CLVB 1GSMA 5FECB 5E9DD 4DKAA 4HBCL 3WNLA 3WIHH 4P2RA 4O2EA 3MUY1 4JJ5B 2EE6A 5ISZD 1WAAF 1A3QA 4PJ8D 5GGTH 4WEUD 1F90H 5DDHA 4IDJL 4KWUA 3IRZA 2DIJA 1GZQA 4DZ8B 2Y06H 2PTUA 2H2PD 5F96L 1CZ8L 5D1QD 4NZUH 1OCWL 4C54A 4PGBA 2FR4A 1CG9A 1AGEA 1IC7H 3IDNA 4U05A 1WTGT 3GJEB 1WTLA 4IOIA 5JQHC 4XBGB 3D0LB 1VDGA 1IL1B 3IVKA 3O2DL 4LPWA 4N8CL 1K3ZA 4MHHG 4TVPH 3U46A 4UIMB 3MXWL 1RIHH 1Z3GL 3ARUA 5K9JH 4Z7OE 1EFQA 1A7OL 4JQVA 2DD8H 2D03H 4UV7L 3B83A 3BMWA 1QPPA 1HYSC 4Y16B 5F3BB 1G6RA 5IF0A 4LGRB 5C08D 4PYGA 3BAEH 4BZ2H 4DAGL 4G6JH 1FN4A 4ZYKA 1OGAB 3OPZL 1G6RH 2AAVA 5FUZH 4JFDD 5CWSB 2AK1H 1KIRA 5TE6H 1I3RB 2XZCL 4FP8L 4NQSA 2EZ0D 1LEIB 4MA3A 4FQQA 2GHWB 1UH4A 3C09B 3HZKB 3BPLC 3GNML 3HE6B 5TDNA 5F71A 2X4UB 3QPQC 4R7DA 1FAKT 1NCNA 2J8UE 3L1OH 4ZUSA 3QZWA 3S35L 1HI6A 3PV6A 4NZRH 2JJSA 4OGAC 4K3JL 3JXAA 4HUVB 1DBKL 2Z0BA 2HFTA 4PRHD 5EOCL 1IQDA 1U3JA 1BQLL 5TGBA 5IB3B 4Y5YC 4ZXBC 3MRGB 5C0CB 1NUDA 4M7ZC 3MXVH 1EO7A 1MREH 1G1CA 4ONHA 2AV7B 3BD3A 5E94B 5E1AB 4D2NA 5DF0A 1G7LB 2YUZA 3FO9A 4EZMA 3P77B 3AGVA 3BEVB 3BPCA 4PREB 5FB8A 3WL9B 4X5LA 1ZT7A 1OTUC 5FO9A 1I4FB 1DQJB 4LPYA 4YC2B 5J3HD 5EOCJ 4BZ1L 4EVNB 3M17B 1PG7W 1KELH 3KPTA 5CHNB 3QNYA 3QULA 1QLFA 1XFPA 4U6YB 4HKXA 4QRQB 4ZFOL 4M9OA 3FT4A 4C57C 2DKMA 5HHQB 3ZTJG 3PWUA 3QEQE 1U8MB 1GCFA 4ZOEA 1TJHL 2ZPKH 4JFFD 4Y4KC 1CFNB 4NOFA 4CW1B 5CJBA 3KXFA 1AO7B 1IEBA 4F7CB 3HMXA 1R3LA 4F7EB 4IRZH 5HPMA 2PXYA 3T3MF 5GGRY 1ZGLP 3VWJA 4NO0B 1REIA 1FVDB 4YHPB 5T1MA 5MENE 1CFSB 4QT5B 4QRSB 3CU7A 1IGIH 5F89B 5I1KL 5DJ0A 4O58L 4MQXD 2WINA 1T20B 4PGDA 1TTUA 2QSQA 2ZUVA 2WLZA 4MD4B 5GS0D 3LS5H 3VWKC 1Q9LB 3F58L 1U6AL 4GBXB 4HJ0C 1BVKB 4QRRA 2EIZB 4OZHB 3G6JB 2BNRE 5IQ9A 2PTVA 1AY1L 5I66B 1N26A 3P9MA 4OCRL 3HC3L 1TQCC 2WM0A 3CCHA 1NBVL 1L7TL 3PP4H 3V6FA 2AJXL 3CFKB 1A1NA 1EGJH 5C1MB 5JIIA 4JDZA 4OD1H 1ZSDA 3N1QC 3QXAB 4Q74A 1T1WB 3X13A 5CBAA 1NCBL 4NKOB 1MY7A 3RDTA 3AROA 3LVEA 3FQXB 2E9BA 5DC0A 3RY6A 2GKIA 5TDPA 3QDJA 3SOBL 2IG2L 4NFDA 1B88A 3G5YA 4NRZB 4I5BB 1EXUA 4KZEL 4LIQE 3GHBH 2PKDA 4ZUWB 5KVDH 1JNLL 4KDTA 3OR6B 2OJZL 3CFJA 3FZUD 3ROLA 4AIOA 4R90L 1Z9OA 2F8VA 2I9LA 1VADA 4HSQA 4Q6YA 2JCCF 1BHGA 3Q6FB 4N0UE 5F1IB 4XXDB 5FV1L 4NQEE 1H15A 3U0PA 4LHUB 1TCRA 3UTTE 2X1PA 2Z92B 5SWZD 4NT6A 3DMMD 3VRLF 3GSNB 1EFXB 2AEWA 4NQCB 4QO1A 2HFEB 5FK9A 4X6CA 1HXMB 1G0DA 1QBLL 4X6DA 1BQUA 3PWVA 2Q86A 1HSAB 4V2BA 3BW9B 1MWAL 6CGTA 3K3QA 1J12A 4MJ5A 1MCSA 1QO3A 1Q9KA 4JAMB 4K8RL 2QHRL 3A6CH 1CDIA 2PETA 5FYLL 3NAAH 4EN3D 1I7RA 3BP6B 3X14A 1SQ2N 2DQIH 3MNZA 3EYFA 1VEOA 1ZKAA 1F2QA 4R26L 4L8SC 2GY7B 5T3ZD 3MRJB 3P11H 1RZ7L 5IV2B 5EU6E 1J87A 3S5LB 5E2UH 1N3NA 3O9WB 1KUMA 3FN0L 1D9KC 4X7EC 3GMNA 2NR6D 4DN3H 1JK8A 2W07A 4ZFFA 4QYOB 1JI1A 5DD3H 2JCCE 4XNXH 3UJJH 3OHXB 2GJ6D 3ZTNH 2KZ1B 3BP5A 2YRZA 4JREC 3VFVB 2CRZA 5DJAA 1XCTB 4GG8B 1UJTA 5DC9B 2WBJD 4G5ZL 2DLFH 3H0TA 5F1NA 3QIBA 4HAGA 5D1ZB 3BPOB 2AK4E 2CLRA 12E8H 4Z7QF 4FFYH 1JMXA 3EW3B 2VQTA 3CUPA 5K9QG 4HQQL 3QUXB 4TRPL 4YBLB 1MIEL 2PW1B 2GSGA 3SDDD 4F7PA 3GMMA 2AERT 5DUBB 4TVPE 1QSFD 3DRQB 5ESQA 4Z5RB 3NA9H 1MFAH 4X7TA 5FUCC 1OP5H 2Z8RA 4P59L 3H9ZA 5DC4B 1AP2B 2J8UB 1MI5A 3KLHD 5DQDH 2EDJA 3T1FB 4LCIL 2XWJB 3ETBF 3CZFB 1JHKH 3ZDYE 5CEXB 2NW3A 1UC6A 1FYTD 4GOSA 4HXAL 4NJ9L 5C6PB 5JHLL 3GMOA 3MTRA 4QTIL 3BRFA 2BVQB 4GAGH 3UPRA 1G9MC 1TZHA 5J11B 2HRPH 2ERJC 1NCCH 3QI9B 3U4EB 2UYLA 3L7EA 4YQXH 1T7WA 5C9JA 4Y19E 1NCDH 5GRJH 1TDQA 4JZNB 5GZND 4Z7QE 2LE9A 1RD6A 4DUVA 5KBNC 4PG2A 5IFJB 3HUJF 4HXBL 4L3AA 2BSED 1AGDA 2VN4A 1JV5A 1U8QA 4F15B 4F80A 5JW4N 3DGGB 3WEXA 3INUH 1OM3H 4OGXL 1J0IA 1NAMH 4XNQB 4NQUA 1HH9A 1CGSH 5T33L 3FT3A 1IAII 3LDBB 4W6WB 1RUPL 2HYMA 5HYEA 4GQ9H 5T1LD 4OCSL 5EU7E 1JE6A 2A6KB 2D9CA 1M7XA 1A6TA 4M48L 4PP2B 4MQ7B 1U8OA 4UNTA 5IB1B 1RY7B 3BSZL 5MENB 4PJXF 2C5DC 4I9WD 1GAFH 1N0XL 3BGAA 3CX2A 4YDKH 4KROD 4QXGL 1ZA6B 2ZUUA 3CLFH 3GMRA 4TQEL 2ESVA 3W82A 3QUYC 5IW1A 5KVMC 5C09D 3P4MA 2W9DH 1QNZH 2FEDC 4P5KB 4MJ2A 2EDDA 2CMRL 3W9EB 3IXTB 1RZJH 4HAFA 5JHDD 4O51A 4CMHC 3QEUA 4CVZA 1RULH 3O41A 4G6KL 4RZCB 3BH9B 1FAIL 3BZEB 1KBGL 1DVFC 2CUHA 3KPLA 1CLOL 3IFOB 2NY1D 2VAJA 4J4PD 2OTUA 5C0GA 1CFVH 4PJBE 3TYGH 4MB4A 1T6VN 3V5HB 2CJUL 1QR1A 3KPPA 3RNQA 5C0BD 5I9QC 4KKAC 5EULV 3B9KD 2LQRA 1PZUB 2MHAB 4U6TA 1BBDH 4TSCH 1UQSB 2ITCB 4H20L 1CD1B 1RZGB 1S9YB 4HKZB 1UYWH 4FOMA 4P2OD 1AC0A 2QQQA 2FGZA 2CK2A 2RJMA 3O4LB 1FFQA 1CXIA 4OZFB 3MODL 5CMAB 1BFVH 1T1ZA 4NQTA 1E4XH 4MNGA 4XP5L 5ADOH 4NQVB 5D7JB 4N0UB 3KPRA 2Q76A 3PHSA 3AREA 2YZ1A 5H8DA 2V9RA 3UTTB 3BDYH 4PV8B 4WU5B 5JO5B 2IPUK 3LY6A 5I1GL 3PDDA 4KTEL 2CLZA 1JZ4A 4BZYA 1URLA 3L7FA 3LAFA 5ACMA 1QSEB 4YXKL 4GG6A 1N6UA 1X4YA 3EYOA 4L5FH 1I9IL 3SJVD 1S9WA 2EE2A 4UT6H 3FQRA 4MHHI 4JKPH 4Y4FB 2HT2C 3DXAB 2DIAA 4K94H 3VXNB 1TVBA 3VFGH 3MV9E 4JG1L 1F3DJ 5E2JA 1ULVA 3FOMA 2QTEA 4GS7C 3I3DA 4GLRI 1A7NH 3DX7B 5EU6B 1I1AD 1A9BB 3UBXG 1BLNA 3KS0J 3TNNB 4WTZG 1A6PA 4L9LC 2J6EA 2R2CA 1CD9B 1KJMA 1OP3H 3EYVB 2BSTA 4QGYA 2JCCB 3MRQB 3D85D 5JIPA 3PF2A 4N8VG 1KTLA 3OQ3B 3QNXB 5JW3H 3FCTA 1F4WH 4Q6IB 5GGUB 1EAJA 5BJTA 5L7XL 1CT8B 3OJ2C 2AK4B 4LGPB 4UQ3B 2C9AA 5C8JA 1C12B 1AIFB 1HQ4A 4Z76A 3QIWD 2WK2A 3QDGD 4YDJA 5HVHB 1JPSL 3LKQA 3T0VA 1NDMB 1HILA 1HDMA 5EU3B 1C16B 2V17L 3FB7B 3ZE2F 5CUSL 1BBJA 5IESH 3QWRA 3MOAH 2NXZC 1Z9SA 3GRWL 3ILPB 1OTTD 2FX8L 5E4EC 6FABL 1XF1A 5C3TA 1A9EA 2FD6L 1UM6H 2X9WA 3QSKB 2IQAB 2AVGA 2A6DA 4FS0A 3DUUB 1MCLA 5J13B 1N6QL 5GHWL 4S1SH 5I0DA 4QTHA 3IDMB 1K2DB 4O2CB 4KU1A 4KXZH 4I0PB 4X5XB 2BVUA 4XPAL 1X7QA 5AZEH 5EIIA 2Q3AA 5HDBE 2F53A 4MXWH 1L7IH 5HYFA 2CGRL 4YHLL 4G9DA 3ARGB 3OKMA 4HH9B 4UOW0 5DJYB 3UJIL 5IHBA 1XAUA 2ICWA 4RGNC 1HKFA 1QSZA 2F5BL 2AXFB 1ZHKB 1ZMYA 3B5HA 4HBQA 3I75A 4ZOBA 1FV1A 4M3JA 5E95B 1RJLA 4Q9RL 1PVHA 5D1XD 5T5FH 1J0HA 3NFSH 2YD2A 4ONGL 1RZFH 4XP6H 3L3KA 4M00A 4OIBA 5E6IA 1E28A 4BSVB 4JG0L 4X6BB 1TPXC 3VGGA 2NY5L 1MNUL 1B0RA 5D2LF 4F8TA 3HPJB 4EDWL 2X42A 3C5ZD 3JV5A 5J6GA 4ONFH 5C70A 4ODXB 3FO1B 2BSSA 4UT9H 1CF8L 3H9HB 2EYTA 4LKCB 4DQOH 1H3GA 5DVLA 1P69B 2WUCL 2B5IB 4TPRH 5L9DL 3IT8D 3WUWA 2P48B 3MV01 3RWIB 4TOYL 2IANE 1UKQA 4XPBL 1GGBL 4WO4A 3A0OA 4MWFA 4IMLB 4J6RL 3TPUA 5CD5D 4RMSA 5T1DL 3BI9X 4X7CC 3HCVB 3ZKXB 4PJDE 2FJGB 4GXUM 3U9UA 1C7TA 1CXFA 1P4IL 5JQ6H 1FZJA 2M2DA 3I6GB 4G8EB 3D69B 2XOTA 4DN4H 1QQDB 1NMAH 1TNNA 3NZHL 1ZGLM 1T89A 2IALB 3K2UH 1DEEB 1T04B 3PV7A 2ED9A 2GT9A 2R2HB 2VLLB 4DGYL 4AL8H 3QHZL 5DI8B 3I02A 1XIWB 1R0AL 3DRTA 2NXYB 5GS2D 5FYJL 4U49A 3VXTA 3L95B 4PJBB 4R8WL 5KSAC 4X6EA 2DQTL 3CSBA 4Q9CA 4OZ4A 3QHFH 3CDGA 2A9NL 4BQ6A 1M7DB 1U0QA 4UT7L 2V2WB 2F9BT 4HUWB 2BP3A 4PJXB 4YIQA 3IAQA 3NFNB 4YDLC 4XRCA 4ETYA 2I60L 3GDBA 1UEYA 2Q6WB 2XY1A 4AEIH 3X12B 5E00A 3KPNB 1BZ9B 4U0RB 1NC2D 1CBVL 1NSNL 5K93A 3GBLA 3NCMA 3SGEI 2LU7A 3ALWA 4RRPA 3RKPA 4XP4H 5DD6B 4JR9L 1PX4A 4NNXB 3WJLC 4BFIA 4Y89A 2FGWL 3R1GL 2DN7A 3GMPA 1ZANH 3FO0H 1G7QB 3WE6B 2GYSA 1T6WA 1F00I 1Q9OA 2GSIA 5ELIA 4CVWA 2F58H 1WFTA 5INDB 3OV6A 3CGTA 2QKIA 4Z7VE 1E6OL 3TFKC 3ZLQC 5KG9A 1JGDB 5DFTA 4HDIA 4LMQI 4FQLL 2VL5A 5ICYB 1ONQB 3C5SA 1PQZA 5EIQA 3TN0D 1JHTB 4NJAL 2AEIT 3TBTB 3GUTB 1ZLWH 5FKPB 1J5OH 4EIGB 4H1LA 4PJFF 1G7HB 5GRVL 3RIFF 5K9QI 3BJ91 3TM6A 1YN6A 3ORJA 4MJIE 3H8NA 5A43C 2YRPA 2I07B 5DR5L 1NANH 2DDQH 3HLAA 4B7LA 4PJHF 2QSTA 4JRXE 4EXPX 3LN4A 1IC5L 4WHTA 3OAZH 5I74C 3IJHA 3T0ED 4WUKL 2EZ0C 3ARVA 5JIHA 1IGYA 4KMTH 4IRSB 1AD9B 4RX4A 3ARFB 4GQPH 1I7TA 1OAKH 3ABZA 1AKJA 1KGCD 4P3CL 1BFSA 3LEXB 1H0DB 3ZMRA 4OBSA 3P73A 4W6YB 1B9ZA 3MCLH 3RL1B 2B0SL 1UH3A 2NMSA 4MSWA 3D3VD 3PG2A 1PZ5A 1V7MH 3T0WA 2VITA 3JWOC 2Z35A 5DD5L 4YWGH 1EMTH 2HN7B 3H7LA 2CIKB 1XT5A 4K9EL 1TQBC 4C56E 2ZCLL 1Q0XH 3QRGL 3KNBA 4O02L 3RNKA 5IHUL 1N7ML 4JFQB 2XQYG 4ZAKB 2BNUB 2NW2A 2R0LH 5C7XH 4P23B 4H0HB 3L5HA 3NCFB 5J3HC 2P5ED 3U4BH 3ULVD 5IK3A 1CDCA 1P9MC 2F8XC 3OKOA 3MBEB 1P7KB 2C7UB 2BC4A 4U6VL 4GXVH 5IVXA 3CFDA 3TJEH 3BP4A 4MNHA 1KLFA 4OUOA 1VPOL 3EBAA 4MB3A 2VLJB 2VIRB 4P3DA 5KVFL 2FATL 4XMKL 3QR2A 2OZ4L 5HGBB 2FYYB 4AENB 1KB9K 4KI1A 3CK0H 1CIUA 1XGQB 4YJZL 4JB9L 8CGTA 1IRAY 1L0YA 3HC4L 2P1YA 4MAYD 5DK2B 4UIKL 2OYPA 3B3IB 5D7LA 4UU9A 3WN5C 1GGUA 1Q8MA 1NCWL 2VLMD 3OX8A 4MXVF 3MLYL 2IANB 5GS0C 3AXLB 5D6DC 1EEYB 4MA7L 4MNQA 3I6KA 3BZ4B 1QUNA 3F7YA 1OARL 5J7CC 3MLUH 4BSWA 1NAMB 4H5SB 4K2UL 3ARDC 3QO1B 4F33A 4WUUD 4OUUA 1HWGB 4WI7A 4M6NL 3RWJA 3WIFA 1AI1L 3VD7A 3CVHL 4X5WB 4KVNL 1YDPA 4Z95H 3D18B 4Y88A 4WDIA 2ZSWB 1P2CA 5H2BA 2PYEA 3MV8A 2G75A 2VXTH 2IH1B 1JYVA 3VD9A 2R56L 5D2LB 4OLUL 5FOJA 2XTLA 1A3LL 1E6JH 1R5VA 1E4WH 1INEH 3IDGA 4CN1A 1QFWI 4UAOC 1HWHB 2HWZL 4C55A 3DURA 5DRXB 3ARQA 4ZUUA 4LASH 5I1DB 4RFNC 5LQBH 4JFXA 1HCFX 4PLKD 3MJ9H 3JV4B 1OAXH 5BS0A 3L5WB 1N6VA 4ISVA 1Z0MA 4XCFH 3G04B 5T3XH 2ILLA 1T5WB 2AJSL 2E7MA 1HNGA 4OAWB 2I26N 3CSPA 5EZOH 4E42B 3ARPA 3FB5A 1AGCB 4O2FB 3VFMB 1RIUH 5C0IA 4YBQC 1G7PA 4TSAH 5I16A 3RGVA 2EDEA 2VZOA 3O6LL 4PJGF 3U30B 2A0LC 5DQJB 5CP3H 1N5YH 4XZUA 5A3ID 3H3BC 4NWTL 1S9XA 2XRAL 4Q0XL 4Z0BH 3V5DB 4U7KA 1A6VH 3BDBA 2OSLB 2FCBA 3UBXI 4EN3C 3MRFB 4NO3B 1S7QA 4ACPA 5LWYL 4JRYD 1WCBA 5BV7L 3I85A 3IU3A 5JPMA 1V7NH 4PV9A 4Z7VB 2BOBB 3I9GL 3RWDB 1K4DA 4A6YB 5GS1B 1ZXQA 1IFHL 4XWOD 5FGCB 1NC4D 2VO5A 3WFCL 4KY1H 3KPSB 3QO0A 3TLRA 1KYOJ 3TH2T 2AQ1A 4NDMB 2YUVA 3QEQD 2KPNA 2V5TA 1M4KA 1MRDL 3RWCA 3VXSD 1IT9L 1I9RH 5F6IB 1RQ5A 1U8PA 5GIRA 3MA7B 1IM9B 3MV7E 3K0WA 4JRXB 3RWGA 3B2UD 2E8ZA 4GJTB 1NGZA 4R3SB 3MRIA 2J88L 2YD6A 3SDDC 5E8EA 4L4TA 3QFJB 3SKOB 3MR9A 4ORGB 3DBXB 2W65A 3OG4B 3RZCB 2AQ3A 3PQYA 4JFED 3LKOA 2XY2A 4QXUL 2UVEA 35C8H 2BNRD 2FH8A 1FORH 1K8DB 1UENA 3KLHC 4ODBD 3VRJA 4YR6B 4LQFH 2L4OA 4WFHE 4CVXB 4DZBA 1T4KA 2C3WA 2IFFH 4XC1L 5IB2A 1DQML 4NQDA 5KTEL 2PR4H 2R1WB 3VE0A 3BKCH 4PJFB 2W0FB 4FQIH 4C56B 4IRJC 2OX5A 2FJHA 1BFTA 4LVOC 2B1HL 4FFVD 4Z18A 4QRPB 1CDGA 1ZEAH 5J56B 3L9RA 4HC1L 5TF0A 4PJHB 4ELMF 4Y5YA 4ZXBA 2AI0H 3V95A 3T0AA 5DRWB 2EO1A 4XNYL 5IBLD 2GAZB 4U6HA 1YPZF 1F58H 4JVUA 4P4KD 4G80A 1V3LA 5B4MD 3MLSH 3GSRB 1MLCB 4JDVA 2PTTA 3OKNA 4IJ3B 2HVJA 4NQED 3V0VB 4M7KL 3KDMB 5CINL 1NJ9B 3OBAA 3RTQB 3MACH 4U1IB 2YR3A 2CKNA 5I8OL 1AQDA 2P7TA 4M7JH 3OJVC 4XMPH 1A7PL 3NIGE 3K4AA 3VXRA 2CIIB 1S7XA 4QXTB 2ZNWA 4WWKD 4Y4KA 1MVUA 5INCA 4WEBH 3HG1A 2W38A 1A2YB 2ZUSA 4KROC 4WU7B 3TBVA 4LHUG 4YHYB 3AAZA 5L2KB 1EERB 4JVPA 4RNRA 3WFBL 3QUZD 2ZOKB 2Q7YB 3RX8A 1MQ8A 3HI6H 4LOUD 2V7NA 3V6OE 3VXPB 2P8MA 3TH4T 2OP4L 3RL2A 5K9KA 3VWKA 1WC7A 1NMCB 5BOPA 2R15A 3C8KB 1QVOB 3UTQB 1QBML 4GKNB 5GGQH 1EJOL 5C2UB 4P2RD 4EI5B 3F8UB 2XG4A 5FO7B 2PNDA 2Q87A 4J4PC 1I3GH 1FYHB 1XGUB 3WS3A 2X1XR 4A2MA 5IT2L 3S5LG 3W0WA 5CD3B 2B4CC 3HMWL 4XNZB 3LCYA 4OLWL 2NTFA 5CBEA 2YA2A 5EO1A 2R0WL 1CDYA 1LK2A 1RHHA 4TVPD 1P4LB 4X9BA 3RI5K 2UY7A 2DWEB 1QYGH 1J1XH 2F5AH 3QUMB 4LEXL 1Z9MA 5BXFA 4PRNA 1RJZA 3V7AE 5CJOL 4KZDL 3GB7B 5DMGD 1D5ZA 1ED3A 1GRWA 1YUHB 3HKFA 1C5DA 1NDGA 4A2LA 3B43A 4GRMB 1LE9A 3D1MC 5CEYB 4XTRD 3LS4H 4CMMB 3GSQB 3ULUH 3FONA 1RUKH 2YD8A 5F88B 4M7LL 3C5JB 4Y19D 3MLZH 4AEEA 4ODHH 1HHGB 4XMLL 5L6YL 3WNPA 4HBCH 4DFIA 5J9PA 1K5NA 3I2CL 4M5YH 5I73C 2ADJB 3MC0A 3QWOB 4DW2L 4YXLL 4NN5B 5CSGA 4G8IB 4XGZB 5T3XE 3DIFB 4IDJH 3LQAC 3ZDXE 2FECI 2QADB 1FH5L 3QUKB 4N90E 2Y4SA 3ZYZA 3CFCL 2XKUA 5F96H 1CZ8H 3PHOA 5C0EA 1IBGL 5EZLB 2HTKD 4L8SA 4K71B 4G9FA 1OCWH 1FO0A 2X70B 3BZFB 5KSVB 2ZNXA 3MA9L 5HHOE 5IM7B 1A1MA 4Q2ZB 2HFFB 3L3DA 4FG6D 5DVOA 1D9KA 3O2DH 5H35A 4N8CH 3DV4B 1FO0H 3IETB 1P7QB 2BNQA 1GXEA 2OMNA 2OJEB 1XF5B 1KF9B 3MXWH 3QIWC 3WHXB 4PJGB 1Z3GH 4S2SB 1UFUA 1Y0LB 2A6IA 3F12B 4EOWL 1OHQA 5HYJA 5FDYA 5E8DL 3HZMB 2EC9T 1F3RB 1KB5L 3FTGA 1MJ8L 1KCVL 2QR0B 1GHFL 5MEPB 2YSSA 2E6JA 2EXWD 2BVTA 4DAGH 2FX7L 3HI1B 1CD8A 3ZSSA 3OPZH 4OF0A 3ESVF 4PG9A 2XZCH 3NGBC 4LCCC 4OB5L 1NFIA 4YXHL 3VW3L 1SYVA 5JDSB 1N64L 3VDAA 5LBSL 5HY9B 3MUJA 3GNMH 1FNFA 4YGAB 1WUNT 4RMRA 2EEBA 4N9GB 4PS4L 1FL5B 3P0VL 3ZT6A 2PXYD 3WV0A 3U6RB 3S35H 3VGHA 3Q2CA 2NY0C 25C8L 1XGTB 1Y6MR 4QHMA 4XPGL 1JJUA 1DBKH 2CDEB 4I0KA 3OKKA 3PJSB 4Y4HB 4G6AD 5EOCH 1HSBB 4DKFL 5ID0B 1EZVY 3UO1L 4JO1L 3G08B 5D1XC 2AKRA 2NY3B 5EU5B 2CQVA 4QRRD 5EN2A 1QKZL 5C3LD 1NL0L 1C8PA 4L4JA 5ILTL 2J7LA 5KSBA 1KIPA 1I1FB 5ESVB 1JNNL 3HNVL 1PKOA 3D5OF 2FHBA 2ZUXA 1NGQL 5FDWB 2V7HB 1MEXL 2ITDA 1Q9WA 3C5ZC 5DO2D 1YQVL 3QH3B 1CR9L 1DBML 4ODUB 3V4PH 3L3GB 3RDTD 4OZFG 1PEZA 4K07A 3WD5L 4ZPVA 5HI5C 1I7ZB 2YPLE 2HJLA 3QDJD 2VLRB 4TUKH 1CE6B 4YFDB 2ICEA 3HS0B 4HWEL 1TJHH 3GSXA 3MV9D 2YRLA 4FXKB 2H6PB 3F65A 4HLZG 5CD5C 4MD0A 2ORBL 3FMGL 3WLWD 4MA1B 4XB8A 1FRGL 2ID5A 2BRQA 2YXMA 5I1KH 3KYNA 4O58H 2IAMB 1R3HA 3VGEA 5D71L 1SJEA 4Y16C 1UADC 1ZS8A 3DWTA 4GRWH 3QUYA 5EO0B 4AMKL 1MQKL 3DSNA 5C6WH 1U3HD 4LP4A 2NY6B 1A21A 2DQHL 4HH8A 1VCAA 3WIIL 1KCSL 5GGVL 3CSGA 4WW2B 4P5MA 1AY1H 1HINL 3LN5B 2GTWB 1CFTB 4DGIL 1DVFA 3MRKA 3HC3H 3QFDB 1NBVH 1L7TH 2AJ3A 4ZO8A 3DUSB 3QNZA 2AJXH 3EO1A 1MHPL 1LILA 5ID1B 1J0ZA 2X7LB 1LEKB 4PR5A 4BK5A 2X4NB 3LQZB 3JTTA 4CGTA 4HZLA 1NCBH 5DVNA 3CSYB 1FSKB 3O45A 1EUUA 3PNWB 3SOBH 1EH9A 2N56A 3T08A 5EWIH 5HGHB 5HI3D 4KZEH 3OJDA 3F5WB 4HUXB 4ZPTA 5E4IA 1WEJL 2HLFD 4Y1AE 5IMKA 3ZYOA 2VDNL 1JNLH 1LO2L 2APXA 4XAWL 4DKDC 2P43B 1J11A 2NNAB 3RUGA 1MRCL 1AXIB 2OJZH 5F6HI 3PUCA 4R90H 5SWSB 5DRNB 3LEVL 5EOQL 3QG6B 2NYYD 2X1OA 3MYJB 5EDXA 1BFOB 1BVLB 1ES0B 3DVIA 4Z77B 4YC2C 5E8OB 5FGSA 4JKKA 4LAQL 1S7UB 3BP7A 3NFPB 3PIQB 4M6OL 4HIIB 3RHWF 1QBLH 4OLZH 4OM0L 1OW0C 1U8KA 1JPTL 2E6QA 3TN0C 4RBPK 1SVCP 2F15A 1MWAH 1WBYB 1AD0B 5A2LH 4BFGA 1LMKA 1TNMA 4K8RH 4PJ9B 5EA0L 3VFNA 2HMID 2QHRH 1MI5D 1DBAL 3CX5K 4X99B 3EAKA 5FYLH 4IOFC 1CWVA 4ZOAA 5HJ3B 3ULUE 4Z8FL 3AUVA 3RFZC 4CN4A 4HG4J 1A5FL 4MCYA 2WWKT 4R26H 2B2XL 4YPJA 4LLMB 3KYOA 1RZ7H 1U9KA 4IMKC 3LKNA 4S0SD 5SX5K 4L9LA 3MLPA 5BQ7A 3UAJC 2ARJQ 3T0EC 1MVFA 1YZZA 2X6MA 4H8WL 4N9OB 3TT3L 1XGPB 1YEFL 1LVEA 1W0YT 4IDLA 4GBXC 2OL3A 1VFUA 3RZWA 1WVZA 4G5ZH 1RFDL 1BVZA 5HSFA 2ATPA 1RAMA 1X5XA 1CDBA 2UUDK 1YA5A 4PPTA 1O5DT 4HQQH 4JKMA 4OBRA 3VCLA 1RZ8B 1S5HB 4TRPH 1MIEH 2VC2L 2OR8A 5EUKA 4NRXA 1FE8L 1UXWB 4MDIA 4P46B 4KGJA 3PDOB 3FL7A 3HR5A 3RVWD 2FO4A 1QLEL 4P59H 1TJGH 3ILQC 3SPVA 4LCIH 2EDNA 4NFCA 1MFEL 2HT4C 3WNKA 4NJ9H 1HOCA 5JHLH 3VGDA 4QTIH 3LSOA 3BVNB 3ULVC 2QHLA 2ESVD 4MJ4A 1HCVA 1IM3A 3ISWA 4XPTL 4XCNB 5FIEA 3S3SA 3TO4B 5IOPA 5BRZA 1KCLA 2LAGB 5FKAB 5I1JL 1I1YB 1RK0A 4CADA 1NGWB 3T8XB 1UB5A 4BH8A 3HNTL 4HW6A 3GJFA 4O4YL 4HXBH 1A6WH 4EQ3A 1AHWB 5KN5B 1KXVC 2IPKB 1CIDA 3EFFA 3S37X 4MAYC 4OGXH 5DJ8A 5B3NA 2Z31B 4X6CF 3V7MA 2YPLB 4X6DF 4FQ1L 2LVCA 3IXAA 5T33H 1OTSD 3D2UD 1RUPH 5M7QA 4M1CC 1YYLL 3N1FC 4OCSH 5DHVH 1U42A 1PKQE 3CC5B 3O9WC 1JCKA 1K85A 4M48H 4Y0GA 2FSEA 5EZJB 5FCSH 2LABA 3G6AB 3BSZH 5GGRB 4AM0B 4PP1C 3EFDL 3OKYA 1BP3B 1W0WA 1N0XH 1A1OA 4Y2DB 4CDHA 4N0YL 3ARED 4QXGH 3OR7A 4U1KB 3TGXA 5ALCL 1FZMA 1ZVSB 1UKSA 5B39B 5GXBB 4MJID 3BRGC 3BPOC 4TQEH 1BD2B 1E4JA 3TZVB 2HJKA 3C9NA 1W72L 5LGJB 3V52L 5BZWA 4FNLL 4WI3A 3GKZA 3KJ4C 5EOTB 2MQ3A 2CMRH 3QUXC 1FNLA 4YBLC 1T7YA 3VXMB 5IIEB 4U1SB 5H37H 2AABL 4JY4A 1QRNE 5EBMB 2ZUWA 4G6KH 5IMOB 2DQUL 1FAIH 5DD0H 4X4XA 4PRBA 1KBGH 1RUQL 4YH6A 2JB5L 3F62A 1FVEA 5KSAA 1CLOH 1NGYA 4U1HB 5DDHB 1EEQA 5L2JA 4X7SL 3BEWA 1FG9C 1A02N 4HIEA 5GSRA 4MJ6B 3P4LA 4M7LT 1IGTA 5KANI 3BYYA 2VR5A 4PLOB 4L3EE 3LPWA 4XI5D 4H20H 2DL2A 5GGVY 1AFVL 4Y1AB 5L88L 2FR4B 2XWTA 3OKDA 1AGEB 5J11C 3IDNB 3MO1B 1FQ9C 3QI9C 4IOIB 5TH2A 4NM8L 5A3IC 5IW6B 1S78D 3MODH 1B3JA 4XVJL 1SJHA 4KRPB 4XP5H 2BDNL 3U46B 5ICZB 4MAUH 1T22A 3MOBL 3WJLA 5ISZA 2LAAA 4NN6B 4C58B 3QEHA 5D70L 3BWAA 1TJIL 5KVGL 5I1GH 1F3DH 4KTEH 4PRIE 4HUKB 4F15C 2VZSA 4YXKH 3QWRD 3ARWA 1U95A 4RWYL 4WTWA 1R5IB 3BX7C 3W39A 3TWCL 4H25B 1I9IH 3KS0H 3Q0HA 5SX4I 1I85C 4NQSB 1KENL 2DQJL 4ZUTA 1LP9A 1P1ZA 4FQQB 1LD9B 3U48A 4M8QA 4MDJA 2RBLA 3GBML 2H8PB 2HVKA 1KCRL 4AG4L 1S9KC 4OQTL 1JGVL 3NCJL 3CFBA 4U6XA 4BA8A 4ZUSB 1UVQB 5A2KH 3PV6B 5DJXA 3VG0L 2DM4A 1BREA 1S9VB 2F53D 4J8RB 1MSPA 1GL4B 4M93C 4Y8DC 2YWYA 5C08A 4HIHB 1H5BB 1IQDB 2Y6SC 3TEUA 4OKVA 3O3AA 2FIRT 2OI9B 2GUOB 1WIUA 3HB3C 5FYLE 3G9VA 1GC1L 4RAUA 1HQRA 4PJIA 1JPFA 1QBBA 2CKBA 1JPSH 1IC1A 3DPBA 5E6ID 3WO4B 2WANA 2P8LB 4U1NA 5FO9B 1N4XL 2V17H 5CUSH 3MX0A 4XVUD 1NCUA 2UZIL 1DLHA 3QNYB 3QULB 3GRWH 3M1BA 3LD8B 4GW1A 2FLRT 3JUZA 2VTFA 3FJTA 4PJCA 2FX8H 1RUAL 3U83A 4YX2L 6FABH 3KYKL 15C8L 3PHQB 2FD6H 5ERWA 2AJUL 1N6QH 5IBLC 3KXFB 1QFWL 3ZHDA 1NFDE 1IEBB 1EDQA 5GHWH 4LNVA 2CDFB 1EHNA 4QHNA 5B4MC 3VWJB 3B2VL 3E6FA 1MCHA 4PTTA 4XPAH 4U7SA 3CLEL 5E5MB 4BFBD 1YNLL 2VDRL 3EOAB 3ZE0F 1NFKA 2CGRH 4N0CC 5CGYD 2FIKB 3UJIH 4DOHE 2F5BH 4R4BB 1P9MA 1M05A 3X3GL 3G5XA 4OLVL 3EYUH 4E41E 5F7HA 4U4BA 2EO9A 3WO3B 4ONGH 4JFFA 5IQ9B 1JGEB 1RURL 4Y4FC 3U4AA 5L0QC 4JG0H 1KNOB 4HHAA 1KEML 4NHUB 4RIRA 2NY5H 3V6FB 3WXVL 4GG6F 4NKDB 1IEAA 1MNUH 2WBWB 3VMPA 5IHLB 1JIBA 3HRZA 1H9VA 3W5NA 5D8JL 1ZSDB 3MMEA 3RWEA 4XAKE 4OV5A 1IAMA 2O26U 1CF8H 3WN5A 2WUCH 5L9DH 3V5KB 4YDIL 5D6DA 1ND0A 4TOYH 1SYSA 4XPBH 4KFZC 1GGBH 4HKBA 4KJWC 1FDLL 4PJ5A 4C59B 3HHRB 1CICB 4OGYL 3VFTA 3B9DA 3EHBD 5T3ZL 5LJYH 4J6RH 5E24E 4OI7A 3L5XL 4Z7WF 3ARDA 1F3JA 5T1DH 2MQ0A 3CFJB 3ROLB 3MV7D 5FO8B 1T66C 4ZFOB 3MGOA 4KI5E 5HVHC 2YZ8A 2VNCA 1P4IH 1NBZB 2RHEA 3KLAB 5DEGB 4KAQL 3EGSA 1H15B 3K8MA 3U0PB 3NZHH 1TCRB 1QRNB 1OAUL 2XTJE 3TJHD 2ADGB 2YEZA 1A4JB 4NT6B 4DGYH 3QHZH 5JNYB 3WKNA 1FZKB 2W0PA 1IAKB 3DO7B 4HUMB 2ENYA 2YBRB 1R0AH 3PWVB 5FYJH 2Q86B 3X11A 4ZS6C 4KKCD 4R8WH 4KDVA 1IKNC 2DQTH 4HGKC 5DMGC 4LP5A 5IW3A 4GW4A 4WFHD 2E9IA 2A9NH 4L3EB 4UT7H 1H3WM 1SJVA 3MNZB 4FZ8L 4LSQL 2UZXB 4AQOA 3G9AB 3ESUF 1W2KT 2I60H 1FLTX 4I0PC 1ZT1A 2ZP0T 1BAFL 1U8HA 4Z7WE 1KJ3L 5DMKA 3VJ6A 1NSNH 2ATKA 3O0RL 1WBXB 4ZFFB 4GKOA 1J05A 4FXLA 3UBXA 2C1OB 3RI5F 2CUIA 4HEPG 4UBDD 4WTZA 4JR9H 4RX4D 2FGWH 1AKJD 5F1NB 1P5VA 2F8OA 2HKHL 3QIBB 3R1GH 5LVEA 2VERN 4U1GC 2CLRB 1H3VA 3VI4E 4EN3A 4OF8A 4N8VA 1AJ7L 3EUUA 1XCQA 3Q1SL 3TA3D 4O00A 4QHLA 1YEJL 1XR9B 1DDHB 2HTKC 4YHKL 3RAJL 4BM7A 4MZ3A 1WFOA 1A7QH 1G7JA 3QDAA 2IBZX 3UZVB 3V4UL 5EU7C 1E6OH 4FQCL 3HFML 2C3GA 4OZGA 4L4VA 5DLMH 2X5PA 4FQLH 3SGDH 3OB0K 4X7TB 43C9B 2XQBL 5D72L 1VGKB 4NO2B 4ENEC 5E8PB 5C07E 2PCPA 4CDGC 3TCLA 1MCOL 3QISA 4G8GA 3ZKXC 5I17B 5T1KB 4JFZL 2UYLB 1OAQL 3L7EB 1HIML 4K3GA 2V2TA 1DE4B 1CXHA 1YEGL 1IC5H 3SDDA 2WWKO 4WUKH 2WZPD 1QSFA 1J8HE 5JR1L 2EDQA 4S0TD 1NEUA 4XNUL 5TE4L 1KPUB 5GSVA 4P3CH 3REWA 1C08B 2QLVB 4OLYL 2CDGB 2JJVA 1AGDB 5MI0C 1ADQL 1JV5B 2PYFA 5K9OA 3E2HC 3RWHB 1FYTA 2B0SH 1GOHA 1I8IB 2SEBB 4RFOL 4UTBL 1HH9B 3OKLA 5D7LD 1M71A 5EBWB 4B50A 3UMTA 4E5XA 5IB4B 2W59A 4X4ME 2MKWA 3V2AR 4WFGE 4IRJA 2AW2A 1MCDA 3DHJA 1OPGL 3BO8A 4NZJA 2RB8A 5I0ZA 5I19L 2ZCLH 4HLJA 1ZTXL 3MBXL 4U0RC 1U8OB 2B7DT 4LEOB 3QRGH 4KK6D 5IHUH 1NBYA 2FL5A 5J12B 3PWNB 1N7MH 3BUTA 3BESR 1AGBB 2UWEE 4W81A 5IHZA 2DI7A 3NN8B 4M43L 4DOHB 3GMRB 4IOSD 2AV1A 2DQGL 3BKML 1UZ8A 1BOGA 1LNUA 2EDOA 2YOCA 1ITCA 1GZPA 4WENB 2BVOB 2PYED 3TNMA 3MV8D 1A22B 1C5BL 4U6VH 4O51B 4UQ2B 4ZUVB 1IMHC 1CQKA 3QEUB 3VA2C 1D5MA 3PGDA 3HE7D 1NGPL 4NCDA 1VPOH 1R5WA 2J8HA 1UM4H 5KVFH 2FATH 4XMKH 1R3KA 1YECL 2OZ4H 3OKEB 1FGNH 3KPLB 3O81A 3T09A 3VG9B 4K3EH 3WNNA 2D7PA 1CFQA 4UOW1 2W9EL 3PDGA 5C0GB 4HEME 1WBZA 4JB9H 4N90D 5BS0D 5FYKD 3PWPE 4X80L 1BZ7B 1U92B 3HC4H 3ZT7A 5IEHA 2GJZB 5MERA 1FHGA 4UIKH 3T3PF 1BIIA 5DUML 1JMZA 1HHJA 3QCUL 3QEGL 1NCWH 5HGDA 3MLYH 3PL6B 2Q3ZA 3UPAA 1PYWB 3D39E 1DUZB 3UJTL 1ZLSL 1F6AA 4MA7H 1U3HC 3VXQA 5HHOD 1OARH 1SMOA 1UB6A 3RPKA 5JHDA 4LF3A 3DX8B 1KC5L 3FN9A 4WNQB 2D7OA 4K2UH 1FG2B 3SCMB 4JY5L 2XXCB 3L3HA 4JPKL 1F4AA 5DFVC 3P4OB 5KZCB 5IGXL 3KPRB 4IRSC 4ERSL 3ARFC 4M6NH 5I1CL 4ZODA 3E3QE 4QOKE 3MRHA 1RZIA 1AI1H 4J4PA 3CVHH 4TUOB 1EUTA 2F54E 1R3IL 32C2A 3O3DA 5F72S 3ARRA 3X3FL 1E27B 4HGWB 1PG7L 4GKSA 4G6FD 3U7AA 5C0BA 4HPOL 4CN6A 4GG6B 1AXSA 2R56H 1SEQH 5HYIA 5EC2B 3UTSA 1A3LH 3MOQA 2IBBA 3FQRB 1G7IB 2HWZH 5AWNL 5FYJU 3HC0B 5FM5M