1WV7T

Human factor viia-tissue factor complexed with ethylsulfonamide-d-5-propoxy-trp-gln-p-aminobenzamidine
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
205
structure length
191
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/blood clotting
molecule keywords Coagulation factor VII
publication title Structure-based design of P3 moieties in the peptide mimetic factor VIIa inhibitor
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 191
sequence length 205
ec nomenclature
pdb deposition date 2004-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wv7T01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wv7T02
5E2TH 4XPTL 1CD1B 4CNIA 5HGAA 4DUXA 1IARB 4HJGB 4Y8AA 3PWVB 1OAKL 5CILL 3MRQA 4CW1B 2OM5A 3RWDB 3VD5A 2E9JA 2O5YH 2BFVL 4U6XB 3UTSB 1CZ8L 3P9WB 5EO1B 1TZIB 1R5WA 4RCAA 4LHJB 1F4XH 4MQ7B 3ZDZE 3T1WA 5BVJB 1J8HD 3QT2A 5D7LB 1G9ML 3ARRA 3GNML 3PHSA 2EDKA 4KK9D 1HHGA 4OGXH 2OR9H 2EICA 3ZTNL 3T3PE 5JA8B 3CXHJ 2H2PC 2R29L 5DUPH 4PJAE 5SWSD 4ELKB 1OGAD 1HHKA 4OZHA 1OGTA 3O3DB 2R0ZH 3OQ3B 5F96H 4NWUH 1X4ZA 1NCDL 5IB4B 5L88H 3TYFA 4ETQB 3W5NA 2VABA 1YC8A 1K8DB 5D1QC 4LF3B 4I0KA 3GMPA 5IHZB 1T5XB 4XAKE 4X6BA 5BXFA 4PLKD 3E3QC 2V5YA 1U92B 3MNZB 4R4BA 3X3FL 1CG9A 3F62A 5B8CB 4J2XA 2YZ1A 5DHYB 2HN7A 3TO4B 5JPMA 1A6UH 4S1SL 1AR1D 1YNLH 3T65A 1A47A 1NEZA 3KPQB 1T0PB 2P24A 4KDTA 4BSWA 1G7HA 4ODTL 4WFHE 3QG6B 4AQOA 5D6CB 1A4KB 1U8OA 4N0UE 5DT1L 1MVUB 2AK4E 2FYYB 2VR5A 2C3VA 2CD0A 5AYQA 2O61B 1FE8L 3BDXA 3QQ4B 1TTUA 2Z9TA 5MENB 5DVOA 1IC7L 1JTPA 5CBAB 5JUEH 2IPTL 3JBG7 2PO6A 3TP4A 1RFDL 5IVXE 2RAMA 1XF3B 1AGCB 2NY2C 4WVRA 2GQHA 1OSPL 1SBBA 3B3IB 4BSVB 1WTGT 2VDQL 1HQRA 3FO0L 3MLZH 3L3GA 4JFEA 3JTSB 2XWBB 1N4XL 5GGQH 3GM0A 4TYUA 3MBED 3BOVA 5TDNA 1XF5A 4X6DB 1Y0LA 3JV0A 4GW4B 4MVBD 5D96C 2E9BA 5TE7L 4WI8A 4WFFD 4QF1B 3LKQB 2DQTH 1MCHA 3U83A 1N0XL 4E41E 3TM6A 4B41A 4GRLA 4GJTB 1I8KA 5C70A 2VR9A 1WF5A 1SM3L 1T3FA 3TT3H 4WHTA 3U4BL 4Z77B 1G9EA 3IRZA 4NO0B 4X4MA 3RVUD 4WCYL 2GAZA 3QB7C 2YEZB 5JOFA 1QLRA 2R56H 4MJIA 3ZT5A 2BDNH 4X7SH 5DD6A 4UQ2B 3ZYJA 4JY4A 1D6EB 3PDOB 1CXLA 1MFNA 5H94A 2XA8L 3QHZL 1T66D 2KZ1B 3SHSA 1OAZH 5FHAH 5I1EH 3VD9A 1DQMH 2X4QB 1E4XI 4HCRA 5J57B 1G9NC 4PGDA 5C0JB 3H7BA 3IB4A 4OLVL 1E28A 3WIHL 2VZTA 4XPTH 1WWWX 5D71L 1WBZB 2F15A 4RFEB 1OAKH 2BHZA 4P4KD 5CILH 5DJ2B 3MV9B 1T4KB 2BFVH 5D1XC 2C7UA 1CZ8H 2YRZA 1CQYA 1BQSA 2EE2A 2XZZA 5C07D 4QXGL 2FZ3B 3OSKA 5IWLA 3VXOA 4GW5B 4CVXA 2JIXD 1OARL 4LGPB 1G9MH 3GNMH 1QUNA 1QFUL 2CIIB 4MMXC 1ONQB 2R1WA 4R4FL 3MJ9A 4HV8B 3O4OC 1JHTB 3WO4C 5HI3D 3ZTNH 4ORGB 3LRHA 5EN2B 4P9ML 5SX5K 3UTQA 3BESR 2R29H 4JCMA 1KCKA 5C0IA 2AV7A 4ELME 1NCDH 2HTLD 3ARGA 1FIGL 3ROLA 4ZPTB 2BZDA 3KXFD 5C0ND 5JIIA 5FXCH 1U2HA 4MX7A 4Y4FC 1JZ2A 3H9ZA 4NRZB 1YEGL 4EI5A 4NM4L 2VLKA 3VFRB 4JREB 3X3FH 1A6AA 3FMGL 3VI4E 1AH1A 3PHQB 4PRPB 4N68A 4Y4HA 1H3VA 4JQXC 3JV6A 2P8PB 1UQSA 4MSWA 4S1SH 4XPFL 2A9ML 5JIPA 3KYNA 3OKNB 2P46B 4XVSL 4ODTH 1KTRL 3EYVA 5DT1H 2DQDL 2DLIA 2R4RL 3ARVA 2DL9A 5INDB 3ZKNC 1FE8H 5DD1L 3RUGA 2MWCA 1QO3B 3TH4T 1RK1A 1X5GA 2ARWA 4G80B 1GXEA 4Y4KD 4MYWB 5J12B 1IC7H 5BRZA 1GC1L 1PGRB 2IPTH 3GMOA 1J12A 5IVOA 5FDYA 1VFMA 1OSPH 3MREB 4K94C 3P73B 2VDQH 5DA0B 1K4CB 1N4XH 3CFEA 4ALAL 1T5WB 3DXAA 2BNQE 1QA9B 4JKLA 5B8CC 3GSWB 1IL1B 3TO4C 3HZYB 4JLRA 5JHDE 5TE7H 3BW9B 3NCYP 2IH1B 3DX9A 2C4FT 1I1AB 1FFPA 1S7TA 5CJ8A 4Y89A 3CH1A 3K8KA 1ZS8A 1N0XH 5AAMA 4EQ2A 4OV5A 1RUAL 1U3HB 2Q20A 4O58L 4PJCE 2BNUA 3D0VB 1SM3H 1G7LB 3U4BH 2WWKT 2ADIB 4HIXL 5HYQA 4WCYH 1MJ7L 2A6DB 5B38B 4LLMB 1P1ZB 1RUQL 1NGZB 3QDMD 4OF0A 1T1XA 2OJEA 1MOEA 5HDOA 1YYLL 5IBLC 5DJXA 1MAJA 3U2SB 2NZ9D 1M7DB 4U2ZA 2PUQT 2XA8H 3QHZH 2JCCB 5CP3H 2ADGB 1TPXC 1CDIA 2QQQA 4KRPD 4F3FA 4KZEL 1P7QA 4DN3H 1TVDA 4OLVH 4QLRA 3WIHH 1I1FB 2NY3B 3QHTC 2ERJB 2X2YA 3RWHB 3S4SG 3V0VA 5D71H 4G8GD 1YEDA 4X9FA 5FYLE 1MY7A 4N0CD 1KXTB 4NFBA 5GSRB 1I85C 2OYPA 2YPKB 4QXGH 5FGCB 1NSNL 3C6SA 1QFWM 1OARH 2D2OA 5D5MF 3D87B 4G43A 1FL3B 1QFUH 4ODUA 4LIQL 4XP4L 4R4FH 2GUOA 3SE3A 1U6AL 1X5AA 2R1YB 3OKLA 3P4OB 4OFIA 5DMJB 4P9MH 4IOSD 1VGKA 1U8PB 1HHJB 4D8PB 4EIGB 1U8NA 2VQTA 3RWEB 1GZPA 4JRYB 3O2DA 4N8CL 1FIGH 4O2CB 4F58L 3ULUF 4R9HA 4Q58C 3AS1A 1GGCH 2Y1VA 4N8VA 1SMOA 4NBXB 4RBPH 4Q6IA 5C0AE 1CTOA 4Y7MA 4ZDHA 1YEGH 4GSDL 3SKMB 4NM4H 43C9A 1FZOB 3FMGH 1F90L 4CN1A 4M62L 2J8OA 4JDZA 2EH8L 4UT6L 5ISZE 3ARDA 3HZMA 4HGWB 3TNNB 1UJ3B 4QOKE 4XPFH 2A9MH 3SGDH 1WLHA 3OJDA 1S7WA 1ITBB 4I8DA 4TVPE 4HS3A 2Y5TA 3VXTA 4ETYA 4X6EB 4XVSH 4MCZA 1PZUB 1A6WL 1QLFB 3G04B 5TF0A 1YY8A 2DQDH 2X89D 1X6NA 2R4RH 4U1HA 4P5TB 5DD1H 4E42A 3TN0A 3VGBA 5HXMA 4QYOB 3RWJB 3S96B 1E4KA 3CJJA 4AM0B 1GC1H 4MJ5B 3QIBB 5T5FL 2VE6A 1RMFL 2XXCB 1KCLA 1NC2B 4ZFGL 4WFGD 2DWDB 1G7QB 4LKCB 1DANU 4HG4K 3DMMC 1ZA6A 3FB6A 2XTJB 4M3JA 3ZE1F 4ALAH 1ZSDB 1EEQA 3RGVA 1INDL 5IK3A 1FYTE 3KPRA 3MV01 2VISB 4QRPE 1H3TA 2HFGL 3QZWB 4YHNB 3GSUB 3VFSA 4NKQB 5DJ6A 1RUAH 4U1JB 5FGRA 4JPIB 5I1AB 5HYJA 4O58H 5JDSA 1NAMA 3BH8A 4EN3D 2DQCH 5FO9A 4KHXL 2WM0A 4HIXH 5C2UB 3U36A 1MJ7H 4G9FD 1AD9B 2HJKA 1OLLA 1YPZA 3BUYA 3AMKA 3BRFA 1RUQH 1HXYB 3CU1A 5IBTL 1UFUA 5D7KD 4OCMC 5J12C 3WLWC 1YYLH 3NCFB 5GGUA 2ENSA 2ZCKL 3BP6B 5BS0A 4EXKA 4KZEH 3TZVB 5B22A 1I9IL 3V6FA 3MRHA 4U1IB 1I7UB 1R24B 1J1OL 5CWSB 4LPYA 4RAUA 5EC2A 3UBXG 1I1AC 3DGGB 3H2WA 4MS8C 3BD4A 4PRHB 1U3HC 4OZIE 1FDLL 3NACL 3PWPE 4HFWB 4I0PC 1FNEB 1NSNH 3NA4A 5ID1A 4X8JA 1QQDA 2LU3A 4ISVB 3BT2L 3DHMA 2LABA 5SWZD 4LIQH 4X99A 2H32H 1RZ7L 4XP4H 5J7CC 1D5BB 1U6AH 3ZYOA 1CDJA 4HS8L 5EO9A 2JB5L 2VDKL 3BKJL 4PREA 4G6AD 1D9KB 4N8CH 4PJFF 1PY4A 2B4CL 1SJHB 3RKDC 4F58H 1WC7A 1JNHA 1ZT7B 3GMNA 2JK5B 4L4VB 1ACYL 3VD3A 3TGXA 4B5EA 1SYSB 2DQJL 1FSKB 2ERJC 3ZYZA 4GSDH 3U9UA 4KV5F 1F90H 4FXKA 4M62H 4NC1E 43CAB 2EH8H 4UT6H 3GMQA 4G9DA 4ZOEA 4YHIA 1CICC 3FZUD 1EAPA 3SGJC 4OI7A 4Z7WF 4MDIB 1ZLSL 1HQ4B 2GJ6E 2P4AB 4XAKD 1U8MA 1N3NA 3VMOA 3QQNA 1EK3A 2X9YA 3MRGA 1A6WH 3H0TB 1WQVT 3U0TA 3VXSE 4B7LA 2EE6A 4PJHE 4R3SB 4RA3A 4QT5B 4ZAKD 3NZHL 4PJIE 1IGFL 4H1LA 5T1LB 5IJKC 2AJZA 3KPSE 5GGRA 3QIUA 5T5FH 1RMFH 5HPMA 1GGIL 4ZFGH 2ED7A 3NFNA 5C0CE 3RZWA 1QSEA 5JNYA 2AK4D 2R1XA 4X9IA 2R69L 4D9RE 3PQYB 1FRGL 4LLYB 1GGBL 1HIML 1JCKA 5F1NA 2NW2B 1INDH 3VFVA 4P0DA 5I76B 3BXNA 4KZDL 2C9AA 1KB5B 4XWGL 2HFGH 3OKOB 1MCFA 4XBGB 3MROA 3DGCR 5HBBA 1Y6KR 3OAZH 1M6OA 2XI9A 3G08A 2F53B 4P9HL 2VAJA 4KHXH 4WTZA 5JW4R 4L3EE 5J6HB 5HHME 1PEWA 1WJ3A 4NKIL 3QUML 1TCMA 2X4OA 3QXDA 1L9NA 1SYVB 5IBTH 4ZUVA 4WIQA 3VE0A 3MRLB 3GI9L 4E41D 2OTWA 3FHAA 2ZCKH 5BQ7A 4C57C 4PGBA 5M7QA 3RVXD 1UT9A 5FOJA 1KTDA 1I9IH 3G5XB 2XA3A 1J1OH 3V5HB 1EVUA 1TETL 3QH3A 1IZJA 1IGCL 5A3ID 4LK4A 4PGCA 4G6JL 3MV11 5E8PA 1A6VL 1FDLH 3NACH 1OCWL 4JFXB 4V2CB 4XP5L 2K1MA 2VLRA 1L0QA 3H3BC 4DKDC 3BT2H 4F8QA 1MCLA 1RZ7H 3BP7A 3SO3B 4KK8C 3QDGE 1YJDH 3FAWA 2JB5H 2FJHB 2VDKH 3QO0A 1K3IA 3SN6N 2YHGA 3BKJH 3C5JB 1KGCE 1YZZA 2B4CH 3CDFA 3MRJB 2C3GA 5EIIB 1ERNA 1EEZB 1GSMA 5HYSA 1PG7L 5DRWB 1X6LA 4GW1B 1R3LA 1LE5A 1SVCP 3TZVC 4RGNB 1ACYH 3T2PA 2FJGB 2W65A 3R0MA 2NQCA 2DQJH 2VDNL 3QUYD 5E4EB 2OCFD 3OMZA 8CGTA 3GHEL 4LCCA 3OX8A 1QEWB 4JN1L 3SBWC 4IRJC 4JZJC 1ZVSB 5DZLA 5I8CA 1L7IL 1IILE 4DEPB 3RDTB 1ZK9A 5E7BA 4PJBA 3O3AA 4X4ZA 4PJDE 2IQAA 2BK8A 1MCDA 2IANE 4K9EL 5L9DL 4HIJA 2XQBL 5DR5L 2YUXA 1D9KC 2I24N 3NZHH 4IRSA 3V5KB 1IGFH 1OF2B 2PF6A 4GAYA 4QRUB 2OL3L 1U91A 3BZFA 1UB5B 1AKJB 4R97B 5CJBA 2K3TA 1Z9SA 1GGIH 1MFBL 1NCWH 2VJXA 4PV8B 1FSKC 3KS0J 2Y7QA 1BZ9B 4Z0BL 1IE5A 1NC4D 1UB6A 2R69H 5J3HC 2ZNWA 3PV6A 4ZXBD 4NUJA 1FRGH 2BNRE 3ZE2E 1GGBH 1HIMH 5E24E 4KZDH 5E9DA 4GKNB 5GGSA 4X4XB 2CUIA 3LKRA 2D0FA 3QFJA 4Y0GA 4JM2D 1XFPA 5E2WL 3HE7B 4TNVK 4WV1C 1IM3A 2O5ZH 3OKKB 2Z31B 4P9HH 1T21A 1BJ8A 3ECBB 2EXWD 3STZB 4L8SA 1Q1JL 2YA2A 3I6GB 5JPNB 3HUJE 4NQEE 1KEML 4UTBL 3REWB 2BNQD 3QIWA 4NDMA 5DYOB 3QWRD 4TPRL 3E6FB 4NKIH 5JHDD 3QUMH 1KPVB 5SX4H 2QADB 3O4LB 1HILA 4LNVA 4ZFFA 3X12A 3TYGL 5HHQB 3GI9H 1NCNA 4NUGL 3KJ4B 5DZNA 4JE4B 4JRXA 5I8OL 3CCHB 1P4BL 3KNBA 4QRRA 3V95A 3QRFM 4ZO9A 3BP4B 4R4NC 2EKJA 4X5WA 3ZKQD 2CDGB 1TETH 3EZ8A 1S3KL 4RZCB 1IGCH 2NXZB 2ZUXA 4IDJL 4G6JH 3U4EA 1HSBB 3RWCB 1OCWH 2EH7H 3PWNB 2D03L 4YHML 4XP5H 3VGGA 2AKRA 3WLBB 1DQDL 1WWBX 4HH9A 2XKSA 5D2LE 5DF0A 4PG9A 2I5YL 4CL7A 2X7LA 1ZHNA 2EXYD 2HTKC 5I73B 4YR6B 2ZCLL 5FYLD 3PWJB 3B9KB 2V7NA 5DVKA 1CT8A 3UROR 5I1GL 1ADQA 3KLSA 3ELAT 2HT4D 3BYYA 2LE9A 3P4NB 1KULA 3LRSA 1BBJB 1L7TL 1NFDF 3OBAA 1PG7H 3DO3A 1S9KC 3VFOA 1AQKL 1RZ8A 3VD4A 2CJUH 4WW2B 5MI0B 1NDMA 5I2IB 3MRRA 3SGKC 32C2A 5F7HA 3GHEH 3WNNA 1KYOJ 2J7LA 4PJ7F 1MI5E 4JN1H 1L7IH 2UUDK 4N0FA 2PYEE 3KWWB 4GRMA 4H25B 5T1KB 3EW3B 3FTGA 3LDBB 2PR4L 5C0AD 4WEUD 4Q9QL 2I9TA 1UH4A 5I71C 4K9EH 5L9DH 4PJ9A 2XQBH 3VCLA 4JFZL 1JBJA 4D9LL 5ISZD 5DR5H 2BOCB 4JJ5B 4Z5RA 4QOKD 1NDGB 5BO1L 1VADB 3C5ZB 2OL3H 1U8IA 2WSKA 2XG4A 4TVPD 2I07B 2XV6B 4JGMA 1SJEB 4TNWK 3QDAA 1XGPB 4RGNC 3CUPA 5KN5A 1MFBH 3RZCD 3EO0B 1XIWD 5CSGA 3IDXL 2F74B 1G7MB 3M07A 2P5WA 4OUOA 3U9PL 2CPCA 5EZOL 1J05A 1LP9F 1W0VB 1EA9C 2A6KB 1JZ6A 2IADB 4DEPC 4PV9A 5E2WH 4ERSL 3RDTC 3BRDA 4Z0XB 3RFZC 2E7BA 5JOPE 1Z2KA 5CP7B 2A73B 3VXQB 5C86A 3ZYIA 5KSBB 5KS9A 1Q1JH 3S37L 2MKWA 3FQRA 5K9QG 4X9BA 1J0ZA 4TPRH 2FB4L 1X7QA 4HIHB 1FYTD 3GJFK 2ITDA 3FRUB 4MDJB 1UZ6F 4QRPD 4Q2ZA 4DGYL 2Q6WB 1IM9B 2G9HA 3TYGH 1BFVL 4NUGH 1XCQB 3EOBB 3M17A 2DYPA 5I8OH 4F7PA 1P4BH 1QBBA 2AJ3B 2ZWLT 3WHXB 4HUUA 3BQUB 3I84A 1VENA 3C08L 5CGYC 1XGRA 3L3DB 4PJXE 1S3KH 4IDJH 1QSFB 1WWCA 2KDGA 4G7YL 3OAYH 2H3NB 1EGJL 3H7LA 4ZFOB 3IDGA 4M4RA 5HYEA 2EC9T 3HE7C 4MB3A 5D7SL 1TNMA 2GT9B 3S6CA 2D03H 4YHMH 1C1EL 5I15L 3DRTA 2KPNA 1Z5LB 2YN3A 4OSUL 5IM7B 1KB9K 1RJZA 1DQDH 5ETUA 4YX2L 3QULA 2I5YH 4NHUA 3SCMA 2APWA 4ZYKA 4Z7UA 1AP2A 4KXZI 1HWGB 5INCB 2ZCLH 3GBML 3N85L 2HKHL 5I1GH 2IBZY 3ZKXB 2A6JB 3KJ4C 3PWPD 3QXAB 1A7NL 1KCVL 1L7TH 4MGXA 1U8QA 4Z7NE 4NC2B 3RWGB 2K7QA 4QHUB 1AQKH 4H20L 1WBXA 3FAXA 5ICYA 2J6EL 2EDEA 5FO8A 5A1AA 2JJTC 5JW4Q 5SWSA 1AXTL 4OF5A 3O2DL 4CVZB 5F88B 3NMEA 3EUUA 4Z76A 1PEZA 3ALWA 1AQDB 3SKUD 1YNKL 3NTCL 2UZXB 4PGEB 3DURA 1NEUA 1C5BL 4RAVA 5DS8B 3RIAK 5I73C 1B0RA 1K9TA 4Q9QH 2X4PB 2AQ3A 4E5XA 3B9KC 4JFZH 3O41A 4D9LH 1R5IA 2FL5A 4PD4J 5BO1H 1NBQA 1U9KA 1EEUA 3IDIB 3GB7B 2GJ6D 3VXUA 3BWAB 3MLTB 2FGWL 5B3NA 2F8VA 4GRWH 4DZ8B 4AJ0A 3IDXH 3VXSD 3U9PH 3B8YA 5EZOH 4P99A 5HGHA 1M4KA 3O9WD 3SKOA 1WITA 1MHCA 3FFDB 5DGQA 4V1DB 1JWSA 3W2DL 1DVFB 4P2RE 2NYYC 4DVBA 3KPSD 4ERSH 4X7CC 3F65A 1P5UA 4FFVC 3LDBC 1CIDA 5C0CD 3VFNB 3WN5B 4D9RD 1EERB 4OF3A 3MBEA 2VC2L 3S37H 3L3OA 3ARFC 5F9AC 3CSBA 2FB4H 4AIOA 3MFFA 5E7FA 1I1RA 5DFVD 2BY0A 4P23D 4EIZC 1BOGB 4DGYH 4BKLA 4ODXB 5TQ2L 1R3HB 3C5ZC 4C55A 3L5HA 1BFVH 4U3XA 5DRXA 4U33A 3GSXA 4K8RL 3BN9C 2ZOKA 2VERN 2VMFA 1YMME 3C08H 1ZKAA 3N06B 4NIKB 4L3ED 1AO7A 5JXEC 2NY5C 5FV2A 3CSPA 3T77B 5I1CL 3QYCA 5HHMD 3MRNA 4PRBB 3PWUA 5EUOB 3H9SE 4RQQB 4U0RC 4P3CL 3GSOA 1JWMB 3KYKL 3B5TA 4G7YH 1EGJH 4YHPB 3QPQC 4QNPF 5D7SH 4L4TE 4CNIB 5HGAB 5I15H 1C1EH 5KSAD 3QO1A 4YEEA 1PD6A 4F80A 2J88L 4OSUH 2ATPA 3ARXA 3QDJE 1T89C 3UTZA 4HT1H 3HB3C 1FYHB 4YX2H 1R5WB 4KHTL 1NGQL 1CQKA 2OS7A 5DMGD 2CO6B 5KSUA 4P4KA 3N85H 3GBMH 4UDUA 2HKHH 4XCYA 4N1HB 4BFBD 4GG6A 1A7NH 1KCVH 4O51B 3NIGE 2I25N 4K7PL 2JIXA 1A9BA 5SWQA 4YIQB 1K5NA 4XHQA 5JZ7C 2A74B 4H20H 4Y2DA 1Z6JT 5EZJA 4KJQC 1OGTB 1L6ZA 4NQDA 5E0QA 4W6WB 2J5LB 3HKFA 2J6EH 3QDGD 1MWAB 3TYFB 2VABB 1IC1A 5E95B 3I85A 4LEXL 5DRZA 5HJ3A 3GMPB 2BSSA 2DICA 3PXJA 5BXFB 5L8JB 3TVMC 4NZUL 2E9WA 4I13B 3KXFA 1YNKH 1CG9B 3NTCH 2V9RA 3S5LG 1LD9A 3LB6D 1C5BH 5DXWA 5CHNA 2Z8VC 5M94B 2YUWA 3B43A 3ISWA 4PTTB 1BMGA 3T65B 5HD8C 2F19L 3OXRA 1NEZB 4M93B 2P24B 1F45A 5I1HL 4BSWB 1TDQA 1G7HB 4U1SA 1S5HA 3VG0L 3ZKXC 1VHPA 1U8OB 1YDPA 2BXZA 4OZGF 4U1NA 2HJFA 1H0DA 1X5HA 2C3VB 3E3QE 1F3JA 1RZJH 2HP4A 4WI2A 2E5EA 1KIQA 2CIKA 2FGWH 1S7QB 1TZGL 4OCXL 2IAND 4L9DA 1Q9LA 2HG5B 4ODVL 4XBPA 3KGRA 2PO6B 4MZ3A 4PIRF 2ICWI 3G6JB 3RVTC 4Y4KA 3CH8A 1HQRB 3L3GB 3KPMA 3W2DH 2B7DT 3U30B 3MJ8B 3LKPA 5K59F 1Y0LB 3PJSA 1D7FA 2AABL 5H35A 5T3XE 3ABZA 4E0RA 1LEIA 4F7EA 2VC2H 4YHYB 2BNRD 4X6CF 3IU4H 4GRLB 2VLJE 4K3GA 1I8KB 4M1CC 1HNFA 2UY6A 5IMKA 1T3FB 5TQ2H 4WHTB 3DSNA 4YGVA 1QG3A 1EFXD 2GAZB 3RP1A 2XY1A 4AG4L 5IVZA 4HK3N 5JOFB 4K8RH 1QLRB 4OLEA 4MJIB 1P5VA 4K3JL 4YHKL 1NUGA 1VACA 5DD6B 3VFUA 4RMQA 4JY4B 4NQED 4OF6A 5I1CH 1XGUA 5DJ8B 2R0KL 5H94B 3IFPA 2DN7A 4B0MM 2ZG3A 3MRDA 4P3CH 2FX7L 4PGZA 4PGDB 4P9HC 1DVFC 4BFIB 1MFEL 1E28B 3T4AA 4WWKD 1BECA 3MRBA 3ILQD 2J88H 2OTPA 3WN5C 3SQBA 1FL6A 4NO5A 4KHTH 3VRIA 1NGQH 3N50A 3T09A 1DE4B 3VXOB 4CVXB 3VGFA 4NQUA 4LMQE 1NLDL 3QQ3A 4F9LC 1TQBB 4P46C 3RNKA 1FAKT 5DDHB 2B1AL 4K7PH 4LQFL 3V6ZA 2YD7A 2D4DA 2VN7A 4KMLB 1LGVA 3WJJC 3CD4A 4GBXA 5C0IB 1E27B 5DVMA 2AV7B 4N0YL 1QRNB 1UXWB 2ADJB 2DKMA 2EDQA 4EDXA 1X4YA 3ARGB 3UTTE 1AI1L 2A6IA 4JANA 3PG2A 4YFLF 2IALA 4KRLB 4OBSA 4LEXH 5F7FA 5J4MA 1QVOA 4OFKA 3S88L 4NZUH 2VLKB 2QKIA 1J8KA 1LO0L 3ARPA 1A6AB 4X6FA 2E7MA 2NTSP 4Y4HB 2Q8BL 3ARBB 3CSYA 4LVHC 3T4YA 1I9JL 3JV6B 4Y2OA 1UQSB 3NBNA 3UZQA 3BPCA 2E7LA 2F19H 3SKNA 2FLRT 4Z6AT 1LNUA 2EIBA 2IMMA 3RRQA 5I1HH 1MI5D 1CLOL 1T0MA 1JV5A 4ZUWA 3VG0H 2QQLL 2NX5E 2BVPA 3GI8L 1N5YL 2PYED 4S2SA 7CGTA 4NJ9L 3RUGB 3UTSE 1KEGL 4YDKL 2CRZA 2L4OA 4M9PA 1RK1B 2C26A 1KLGA 1KC5L 2GTWA 1TZGH 2QHRL 2J5LC 3K4DA 4RMTA 2X89A 4OCXH 1PAMA 2D0HA 1FO0H 2EC9U 4J1UA 4OCRL 1F97A 3AFLA 4D9QE 5C0BE 2MSPA 4KKNA 4JFFA 4YWGL 4ODSL 5D5ME 5E94B 4PY7B 3BZEA 1YY9D 3CFEB 1N59A 5F93C 1ED3A 3CVHH 2Z35A 2VYRE 1WBYA 2WBJB 2XPGA 3EGSB 4HKBA 2AABH 1TFHA 3QNXA 4WUKH 5DO2D 3DX9B 3LD8B 4K3DL 3VXPA 3C8DA 1UH2A 3GGWA 1FFPB 1S7TB 4WW1B 4ZTOL 1ZS8B 4M93C 4OV5B 4KDTC 4YQXL 2BNUB 3ULUE 1MCNA 3SY0A 4JPKL 4Y19E 4OLYH 5HYQB 1C08B 4AG4H 1NFKA 1WZ1L 3MV8A 5JOPD 4K3JH 2Y5EA 1T1XB 4YHKH 5D7JB 2OJEB 2N56A 4AMKL 2HVKA 5DJXB 3MRMA 2PO6C 2R0KH 1U58A 2C3HA 2NY6D 2FX7H 1BQHB 1U0QA 3DX6A 3GSNA 4F3FB 4GUPA 1MFEH 3SDCD 4UAOC 1KJMB 2DMBA 1OTUD 3V0VB 2KH2B 1YEDB 2DQIL 2G5BA 1IEAA 1HH6A 4YHYC 4U05A 4JR9L 4GRLC 5ANME 2XY2A 1K4DA 3IRPX 4G43B 1D3CA 4ODUB 1NLDH 4POUB 1I1YA 4YO0A 2GUOB 3DUSA 4JKPL 3JUYA 3V7MA 4X6DE 4C56A 2B1AH 3OKLB 5T1MA 4OZHF 3C60D 4LSUH 1YN7A 4LQFH 2MNUA 4OQTA 3ZE1E 1VGKB 5MERA 3D18B 4P49A 5SWZA 3JWOL 1U8NB 3FFCE 4KPHH 2CO7B 4N0YH 1GZPB 3D85A 5I8EB 1AI1H 4WUUE 2GTZA 1ADQL 3TJHC 4N8VB 3T08A 5D8JH 3M45A 1Z9MA 5FK9A 3S88H 3EIFA 43C9B 4NNYA 1S9VA 1F4YL 4JDZB 4W81A 1AGDA 3TH3T 2Q8BH 3QEQA 1IGJA 3U82B 1I9JH 3ARDB 1S78C 4NQCA 2XFXA 5IWLC 1L0XA 3OJDB 4AT6B 1S7WB 4MXQC 1OTSD 3ARTA 5DTFA 4HS3B 2P43B 3GM8A 1CLOH 2Y5TB 3VXTB 5DQDL 1OTTC 1D5ZB 3LN5A 4MCZB 1TQBC 3S3JA 2AS5M 2QQLH 4QXWA 1YY8B 3GI8H 2BSTB 1N5YH 2WNGA 3GMLA 1DDHA 4NJ9H 1KEGH 4YDKH 4E42B 1KUMA 3TN0B 1A1OB 4MD4A 5KVDL 5DSCB 1KC5H 2WINB 2QHRH 3FQUB 3ARGC 2DJ4A 3VW3L 4K7FA 1BFTA 4JO1H 4MJ2A 3T0EA 3BEWA 4GO6B 1F00I 2VE6B 3HPLA 4OCRH 3MGOA 4LDOB 4YWGH 1ZGLP 1ZA6B 1JYVA 2FSEB 4ODSH 2VZUA 4EI5C 4NOBA 2VSDA 4LCYA 1T6VN 3SDDB 3RGVB 2PW1A 5C8JA 5IOPA 2VSCA 2P47B 4Y4HC 4KKCC 5EU4A 5IK3B 1OP9A 4YZFF 3KPRB 1BQLL 1UENA 1A8JH 4POZD 4K3DH 3A6BL 4KMTL 4NKDB 4XNMA 3QUXD 4ZTOH 4KKLC 3VFSB 5DJ6B 1RURL 4XI5C 5C09E 5HYJB 4PJFE 4ONGL 5GRXG 4YQXH 2E7CA 3MUY1 4EI6A 1NAMB 1BD2A 5JW4N 2VO5A 3BH8B 3TA3D 4JPKH 2HT3D 5L8KB 4P2RD 4P3DA 3U36B 3HI1A 4LCIL 5KSVA 1WTLA 1WZ1H 2HJKB 1YPZB 3BUYB 2DM2A 3RA7L 3KHQA 2E27L 5ICZA 4KV5E 5GRVL 4AMKH 2XQYG 1NMAL 4JFHE 4FFWD 3WUWG 2ARJA 1MCEA 5IMOA 1LMKA 2M26A 4D2NA 2XT1B 2ZUVA 5BS0B 2X9WA 3FQXA 5I6XC 3V6FB 3MJ6A 3MRHB 4E41A 1X5XA 4NJAL 2BHUA 3HE6C 2FDBP 2D7PA 1XCTA 3MLYL 1KIPA 1FL5A 3I6KA 1YMMD 2YPVL 3QCUL 2DQIH 1T7VA 5EC2B 5JW3L 2DWEA 2P45B 1EO5A 4JR9H 5ID1B 1AC6A 2BVYA 3UBXI 3GO1L 1P9MA 4YBQD 4HWNA 1EZVX 5KVGL 4WFEE 4X99B 1SJVA 4M7LL 4L4TD 2JE8A 5DEZA 2YD2A 3O6FD 4TUKL 1Q0XH 5EO9B 3QDJD 4YC2C 4PREB 3SE8L 5ENWA 3WNMA 2APTA 5FYJL 2IG2H 2CLVB 1WC7B 4KTYA 5FCSH 3CXDL 1ADQH 1JNHB 1WEJL 3VXRE 3K8LA 2ESVE 4G7VL 4OQ1A 2BY2A 3IS0X 5C0DA 1T1YA 3MRCA 4MAYC 4HWUA 3U9UB 4QXTA 5AG8A 4JVPA 2X4TA 1KCUL 1F4YH 2BY3A 3D2UB 1A14L 3DUHA 1KTKE 3GMQB 3DO7A 3W39A 4EUPG 3WJLA 3NCMA 3BPOB 5CUSL 4YHLL 1EJ6A 3D5OF 3VI3F 5LQBL 3T04D 1EAPB 2ZKHL 4GRWF 5DQDH 5ADPL 4ELMA 1U8MB 3SE3C 3S36L 2JJVA 1HCVA 9CGTA 4HLZH 2CRYA 3U0TB 2FWOB 1V05A 5ALBL 3MNWB 1JRHI 3LY6A 5KVFL 5EO0A 4ZUUB 2BVTA 5KVDH 4FZEL 1KXQE 1FNSL 1DN0A 4H1LB 4BELD 4YHZL 4KJPC 2IPUG 5GGRB 5D1QD 3NZ8A 4JFOA 5HPMB 4P2QA 3IDNB 4LAJH 3RY4A 3NFNB 3K3QA 2CK2A 2Q3AA 4Q6IC 1QSEB 1NGXB 1U3ZA 5E99L 4KH2A 5B21A 4EVNA 4XWOC 5F1NB 5BVPL 5BV7L 3BXNB 4YXLL 4G8FA 3ARDC 1BQLH 1JGLL 1FIEA 1PKOA 1NC4A 3B83A 1EPFA 3A6BH 4KMTH 5CSBA 5KAQF 3MODL 1NBZB 3MROB 4LOUC 1RURH 1M6OB 3PWVA 4CW1A 3G08B 4ONGH 3EJZC 4U6XA 4LMQI 2Z93A 1ZLWK 3UYOD 5J06A 3I75A 4LCIH 4MQ7A 5DHVH 4O2FA 3TN0C 2X4OB 3QXDB 5T3XD 3WFHA 3RA7H 4HGKC 4LVOC 2E27H 2HWZH 1E4KC 1NMAH 4FQIL 4N5EC 2VLJD 4GQPH 3AB0B 5BQ7B 1DP0A 2E3VA 4ZQKB 2R2BA 1KTDB 4G42A 2FECI 1F42A 1WAAA 3BAEL 3RGVC 4NJAH 5E5MA 3BJ91 3MLYH 5D1ZD 2YPVH 3QCUH 5GRWA 5JW3H 4PGCB 5I30L 2YUZA 3SJVE 1YC7A 1I7TB 5E8PB 4XPHH 2ENYA 2Y06L 3IFLL 4CADA 1U92A 5F21B 1FVEA 4JDTH 2LU4A 2VLRB 5FKAA 3GO1H 4K8RC 5KVGH 3S9DB 2MQ0A 3BP7B 2Q86B 3IJSB 4M7LH 5FCUL 2FHCA 3PABA 4TUKH 2F5AL 2J12B 4FQHA 4I77L 5ILTL 4F7CA 4HBCL 1H3UA 2G60L 3HAEH 4W4NA 3UYPA 3HCVA 3CFBA 3QO0B 5KZCB 3WIFA 3SE8H 1LQSR 1B90A 5HYSB 2EYSB 5FYJH 2M1KA 3CXDH 5HHNB 1WEJH 1ZE3C 1R3LB 3BVNA 2GJJA 4G7VH 2FX9L 3IJYA 3QQ4A 5ITFB 4RA0C 5ERWB 3AS0A 1FVCA 4HMEA 2AJXH 4HUMB 1KCUH 3OX8B 5D1XD 3B3IA 2UWEB 5E8OB 5LGJA 5F7NC 2W60A 2B39A 4DJMA 1JPFA 3T3PF 2QSCL 5I8CB 5CUSH 3MV7A 4Z7VF 1JTTA 5LQBH 1ZHKB 4GW4A 5JO5B 2ZKHH 1Z3GL 2EDDA 2IFFH 4QF1A 5ADPH 2X1WL 4PJBB 1JVKA 3O3AB 3DARA 3DHJA 1ZT4A 4Z9KB 3S36H 2IQAB 3LQMA 1I75A 2FCBA 4HIJB 5ALBH 1LHZA 4MNQB 5KVFH 5C0AA 3V7AE 3O3UN 4FZEH 4IRSB 1SHMA 1FNSH 3P77B 3JZ7A 4XC3L 5GGVL 3TJEL 2DS4A 3BZFB 2YEZA 4YHZH 2FHFA 5EZIL 4XPGL 1MUJB 4U31A 5ISZA 1RJYA 4Y4FD 4LP4A 3OR6A 2NX5D 4HJJL 1D6EA 4EXPX 1UB6B 5E99H 3PV6B 1SEBA 4NUJB 4HWBL 1QKZL 4OZFH 3UTSD 2GITB 4YUEH 5BVPH 5BV7H 4YXLH 2IEPA 5E9DB 5GGSB 5C0JA 3LKRB 1JGLH 3BPOC 3IF1A 3QFJB 3MODH 5EH1A 1KOAA 3BJLA 3DSFL 5ELIA 2OP4H 1WBZA 1B0WA 4D9QD 3D1MC 5C0BD 1JPST 5FA4B 1IM3B 3MV9A 4WHDA 4EKXA 1T21B 4LRIA 3W9EB 1YPZF 4I2XE 4M03A 3VGDA 3IAPA 3RI5F 3QIWB 4NDMB 3QJHA 3ZKND 3FRPG 3KLAA 1U36A 4XHJC 4RISH 1HILB 4HV8A 5JIKA 3X12B 1JHTA 1CD9B 4PJ7E 4FQIH 3QIUC 3KVQA 5CGTA 2AJYL 5EN2A 2W92A 4N9GA 1G6VK 5DJAA 1GYAA 3ULUD 4M7KL 4QRPA 3I50L 4QRRB 4M7LT 3PP4H 4Y19D 1LVEA 5J13C 3FB7A 2E6PA 3VXNA 3V8OA 3BAEH 3AGVA 3HZVA 1CDGA 4X5WB 1T80A 3S7GA 3WNLA 4ZPTA 1W0WB 4FG6D 5IBUB 1FG9C 5B4MC 3SDXA 3GJEA 5I30H 3BPNB 5T5NG 4C54A 2Y06H 3IFLH 4N90D 4PJ8B 3RY6A 4GLRH 5GGTL 1OY3B 1XMWA 3ZT7A 4HH9B 2DQGL 4PG9B 2X7LB 2Z91A 1TTFA 1ZHNB 3PQYE 5KBNC 1N6QL 4R2GB 3BFOA 4CJ1A 2F5AH 4I77H 4WI5A 4Y16A 3PL6B 5DJYA 5ILTH 4HBCH 3H6JA 2G60H 4HWZA 2V7NB 3B9DA 1CT8B 4WY7L 4NCC1 3REVB 1J87A 5IBLD 3DYOA 4TSCL 3LRSB 5LGHL 1KXVC 5INDA 2ED8A 1RZ8B 2FX9H 4I4WA 1GOFA 4WNQA 5J11B 3PWPA 4RFNB 1EHAA 2Y9RT 1URLA 32C2B 1QSZA 1R3KA 4JHAL 5KG9B 2YSSA 3FFCD 4OCYL 2E7HA 2H9GB 2EDBA 3MSPA 5DK0B 2QSCH 4WUUD 3VFPB 4N0FB 1QA9A 5C6PB 3VH8G 1RZGB 3HZYA 4GRMB 5DC0A 1Z3GH 4AEIL 3FTGB 5TFSL 1C7SA 4NO0D 2D31A 2OI9B 2VKWA 3HTLX 1MAKA 2I9TB 1A22B 4Q7DA 5IB5A 4PJ9B 4OFYD 3LZFL 3VCLB 2WQRA 2CKBL 2NXYD 3PIQA 3VWKA 5BZDA 3HN3A 2JLLA 1G7LA 4Z5RB 2ADIA 4XC3H 5GGVH 3TJEH 1P4LA 1U8IB 1C5DA 5L2KE 5EZIH 4LLMA 4XPGH 1MCSA 5HGGS 3WXVL 5I17B 4XP9L 3CUPB 5KN5B 4OD1L 1ORQA 4HJJH 4HULB 3R1GL 4O2EA 2Y36L 1ROWA 2P5WB 4S10A 4HWBH 4LCCC 1QKZH 5ESQA 5CKGA 5TDPA 3CZFA 2FD6L 5E5UB 3CDGA 5IR1A 3BEVA 4PJHA 1A3LL 3DSFH 4KJYA 3RWHA 1MHEB 4RGNE 4Z7OE 1QHOA 5KS9B 3FQRB 1X7QB 5C0CA 5KAQG 2ITDB 4IRSC 4Q2ZB 3SDAD 5IQ9A 5K9QI 1U8HB 2G9HB 1XZ0A 4BFEA 1PFCA 2R1YA 3M17B 5C09D 2DYPB 2AJYH 4F7PB 5CLWA 3AS3A 3AROA 4P23A 1U8PA 4M7KH 3I50H 4D8PA 3DMMD 3RWEA 4JRYA 3F7RA 3ZKMC 4ZTPL 5JORA 5E8NA 3T0XA 4QHKJ 1BJ1J 4RBPK 1A5FL 3IDGB 4JFHD 1BLNA 3R06A 1H3XA 4C83A 3DRTB 1FZOA 5IW6B 2DTSA 3S3SA 5GGTH 1RJZB 3F8UB 4L8SC 3L5XL 4NBYB 5ETUB 1UJ3A 5CBEA 5LVEA 3QULB 2DQGH 3QIWC 3SCMB 4Y5VB 1G7JA 5KSAA 4ZYKB 4HH8A 1AP2B 4Z7UB 3BYTA 2HFTA 4WY7H 1IAIL 3WLWD 2XWTA 1OP5H 4WGWB 2PXYA 4TSCH 4CDGC 3EYSL 5LGHH 4P5TA 1U8QB 4LP5A 3OTTA 3PXHA 2JB6B 1X5YA 4WFED 4AEEA 1WBXB 4OI8A 3RWJA 3OGOE 4OM0L 3S96A 5IB2A 1KACB 5ICYB 3RJDA 4JHAH 1NC2A 5SWSB 4OCYH 1XR8A 3B4NA 3BPNC 4I18A 4MS8D 4N8VG 1K85A 6FABL 4PBWD 1U3HD 1YYML 4I0PD 1ZSDA 4Z76B 1IFHL 3V9FA 3VXRD 2ESVD 2AQ2A 3DURB 4AEIH 4TOYL 3E0GA 2DBLL 5AEAA 3JWOC 3TIDA 1X4XA 2AQ1A 1CXKA 3RVWC 1B0RB 1PYWB 1WZLA 3QZWA 3GSUA 2ZUWA 4CAGA 2V2XB 4JPIA 3LZFH 3MMEA 2CKBH 4P2YA 1BFOB 2FL5B 4LIQE 4KVNL 4NRYA 5E4IA 4JPVL 5I19L 3RKDD 5DJCA 2NW3B 4JDVA 3T2OA 4QNPE 1ZT1B 3WXVH 4XP9H 3VXUB 5FOBA 4OD1H 4RFNC 1HDMA 3R1GH 2Y36H 3GEWB 4OD2B 3CAFA 3BP6A 5HGHB 3K7UA 3GSVA 2FD6H 1CD8A 2L7UA 2A0LC 1CICD 3SKOB 2IANA 1JWSB 1R24A 2OJZL 2VZ1A 3P11L 4AIXA 4DVBB 1A3LH 3QEHB 4LSSL 5LWYL 1E0OB 4YNYA 1CVRA 3MBEB 4PJ9C 5CZXC 4HFWA 2DD8L 3L3OB 5F7YC 4HFUL 3OKDA 3MFFB 5A16A 2WP3O 5DEFA 3MCLL 1PKQA 1NFIA 1QBML 5HDBF 1ITCA 5DRXB 2YPLE 2KUTA 3GSXB 2EO1A 2ZOKB 5E6IA 2YD5A 4JY6A 3L7FB 3U0PA 2YS4A 3ZDXF 1EFXA 1AO7B 1G6RL 1N5AA 2NMSA 2I9LA 1SJHA 3MRNB 4ZTPH 3PWUB 5F1IB 5F1SA 1G7PB 4X5LA 5CSZA 3GSOB 2EDWA 4DKEL 5J56B 1SYSA 1MCWM 1A5FH 2VXUL 5JA9A 4OZGE 3IAQA 3K0WA 5HVGB 2ATPB 3DV6A 3V5DB 3UTZB 1YN6A 3KDMB 3L5XH 3DVFA 4X9HA 2ZCHL 1I9EA 3UTPE 5KSUB 2H41A 4P4KB 4MDIA 1H3PL 4UDUB 4XCYB 3SJVD 1OPGL 1IAIH 4YDIL 5C07B 4IBLT 1A6TA 4RGOL 5H2BB 3EYSH 2JIXB 1A9BB 2ICWA 4HW6A 3X14B 5SWQB 1K5NB 1FGVL 1JNLL 4IEFB 1IGTA 4Y2DB 3CIQA 4OM0H 4LCUA 2D7QA 1J5OL 2MJWA 4X98A 1NCAH 3MRPA 2HLAA 4X6CE 5D2LA 5DRZB 5HJ3B 1HSAA 2BRRL 6FABH 3G6AB 1YYMH 5ESVA 4I1NB 1IFHH 1FN4A 3KXFB 4LPXA 2VRAA 1LD9B 1KB5A 4TOYH 4HUNB 5AZEL 2DBLH 3SCMC 2WIMA 4KK8D 5JMRA 4FQPA 4MA1B 2JF1A 3OAZK 2I60L 3HLAA 4U1SB 1S5HB 1PW3A 2Q87A 4U1NB 4KVNH 2HJFB 5J6HA 1H0DB 3O6ML 5I19H 4RX4D 1F3JB 1RZFL 1MI5A 4LBEA 2WBWB 4TQEL 4HWEL 1SYVA 1KIQB 1MCRA 4XCFL 1AXIB 2V17L 3HG1E 2B5IC 5D7IF 3MRLA 1ZVHA 1Q9LB 4H1LG 2UV3A 3CFDA 1A64A 2OR7A 4XBPB 4BZ2L 2AJUL 5B39G 1JP5A 4IMLA 3WNOA 2LAAA 1MJUL 4IRJD 4NHCL 2KKQA 1JK8A 3LEXB 4Y4KB 2OJZH 3KPMB 1PZ5A 3P11H 4QRSB 1DBBL 3MA9L 3LKPB 3STLB 5GRYA 4LSSH 3D39A 5LWYH 3X11A 3PJSB 4PJIF 1J8HE 3FQTA 5H35B 3BX7C 4OLZL 4E0RB 5E00B 1LEIB 2DD8H 3EDDA 1R3IH 1CR9L 4HFUH 3HI5L 3MCLH 1TCRA 1D9KD 1AR1C 4M61B 5IMKB 1OGAE 4DUVA 3HMXL 1E4JA 4LL9A 1KIRB 1EX0A 5DEGA 2P5EE 5IVZB 5ECJE 4L4VD 1F3DH 1VACB 3VFUB 3C5JA 5J3HD 4KTDH 1V7NL 5F7KC 1G6RH 5EIIA 1XGUB 3IFPB 1CL7I 5GZNC 4GW1A 2FRGP 1HE7A 1AGEA 5EU6A 1RZKC 1UVQB 4RRPA 3VDBA 3T4AB 2VXUH 2Y4SA 3MRBB 4J4PA 4ZS6C 1FL6B 4LARL 3MBEC 4M48L 4NO5B 4F8TA 3RWIB 2ZCHH 3VRIB 1S7XA 3KHOA 4MVBC 3LPGA 4KJWC 4LKXA 4G8GB 4H8WL 4LASL 4KWUA 1H3PH 2BCKA 1DEEA 4K94L 1OPGH 5DUML 2PCPB 4V1DE 4YHOL 4PJXA 4YDIH 3QQ3B 4HXBL 3RIFF 3RNKB 4RGOH 1O7SA 3CPLA 3ILPB 4PJEA 1YECL 2ZG2A 2X6MA 1JRHH 3DX7A 3NFPA 3T2NL 1YEFL 4ONHA 3V6ZB 1FGVH 1JNLH 2J8UF 2VDPL 4GBXB 4XVTL 1OF2A 2VUOA 3PQYD 4K71B 4EDXB 1J5OH 3IETA 4GKSA 4WEBL 2A6IB 4JANB 2IALB 4P57A 2BRRH 1BZ9A 2BP3A 1QVOB 1P7KA 1HWHB 2QKIB 2OK0L 3MQIA 1I8IA 2CK0L 4X6FB 4FTVE 3AUVA 5AZEH 4KQ3L 3T4YB 2HTKD 2UYLA 35C8L 3WIIL 3BPCB 4UBDC 4P4KC 4ZSOA 3SKNB 3OF6A 3FN3A 3OKYA 1G9NH 1T0MB 2I60H 2Z31A 2V6HA 1JV5B 3ECBA 5I0DA 4M6AA 1GJIA 1G1CA 3STZA 2A77L 3L7EA 5FECA 3I6GA 2VITA 3REWA 4UUJA 2YBRA 3O6MH 5DYOA 3KPPA 3D6GA 2DM3A 1RZFH 4S2SB 1JGVL 4Y2DC 4TQEH 5FUZL 4HWEH 3O4LA 4XCFH 1KLGB 1YUHA 2GTWB 2V17H 1Q9WA 3VGAC 2CR6A 1J10A 3CCHA 4JO3L 4BZ2H 1SVZA 2AJUH 1MJUH 4NHCH 4JFFB 3S4SA 1UM6L 4KROB 3V4VL 2NY0B 3UMTA 3BZEB 1A6ZA 1DBBH 5L2KD 1N59B 1JNNL 4YPGA 5HVHB 1ED3B 2Z35B 4RZCA 4S1RL 1WBYB 3F12A 2XPGB 4HKBB 3QNXB 4MXVF 4OZHE 4PRAA 4OLZH 1ZLVK 3RWCA 4LLQB 3VXPB 3GGWB 1REIA 2YC1A 3PHOA 3PWNA 4ACPA 5BW7A 2GEEA 1FGNL 1CR9H 3HI5H 3ETBF 4CMMA 3MZTA 3SY0B 3HMXH 4HKJA 4IMKA 3VFTA 4R0LC 4YR6A 4RGND 3MO1B 4Q9BA 1IKNA 1WK0A 4HMDA 1VB9A 1YQVL 4OF8A 3R8QA 2X1XR 1V7NH 1BBJA 4G9FB 3MRMB 2EE9A 3ET9F 1U58B 3MJ7B 2X5PA 3DX8A 3OG6B 4R90L 2K7PA 1U8KA 2QEJA 4Y4KC 3GSNB 4GUPB 4WW2A 4ZFZA 4RDQF 2D7MA 5I2IA 3LKSA 1VFAB 2H26A 4DVRL 5HGBA 2G5BB 1IEAB 4LARH 1HH6B 4M48H 1EO7A 5CS7A 4NSKA 1AFVL 4HGMA 4GG6F 4H8WH 4LASH 1K4DB 4K94H 5DUMH 2LTQB 1W72B 1HKLL 1XGTB 2R23A 4JFEE 4YHOH 5CJXA 1I1YB 2WWMC 1AKJD 4HXBH 4YO0B 3H9SA 1KLUB 3DUSB 5IG7B 4C56B 1DLFL 4ZUSA 5T1MB 1AR2A 1YECH 1YN7B 2F58L 5D9SB 3T2NH 1YEFH 5MERB 5CGYD 1BZQK 5SWZB 3WSQL 2VDPH 4G8EA 4XVTH 4ODHL 1NDGA 3L1OH 3D85B 4YZFE 1BIIA 4PY8J 2I07A 4IJ3B 2GTZB 1MNUL 3QDJA 1UEYA 4DAGL 3W11D 4YXHL 4UT9L 3CFIC 2NZ9C 1OAYL 2A1WL 2F74A 4DQOL 3HE7D 5C92A 1G7MA 4K23H 5FK9B 4WWID 4NNYB 4EDWH 2OK0H 4MJIE 1S9VB 2CK0H 4UILL 4D0CA 1AGDB 3QEQB 4KQ3H 5GPRA 2RIKA 2HMIC 35C8H 2XFXB 3WIIH 3WEXA 1ZTXL 4N1EA 3OPZL 1ZMYA 2KL6A 1LDPL 4PJAB 3CNKA 4XMLL 5DTFB 5FFLA 2FR4B 2A77H 3C6LD 2OSLA 3GMLB 4C58B 1DDHB 2IF7A 2OXHA 3VGHA 1JGVH 3GMMA 4MDJA 4MMZC 2FEEL 4GBXC 5FUZH 2Q6WA 1R6VA 4K71C 1OWWA 4MD4B 2OZ4A 1G7IA 4WU7B 4K7FB 1XCQA 1NAKL 4JO3H 4ZO7A 3T0EB 2AJ3A 3BEWB 2NNAA 3HPLB 1Z9OA 3BQUA 3MGOB 4M5ZL 2ZNXA 1HHHA 4GAJH 1XGYL 4OI9A 4ZAKB 5EOCL 1UM6H 3V4VH 5ITBL 4D94A 3GRWA 3G5YB 4LCYB 5D2NA 1JNNH 3UBXA 3SEPA 5GS1A 2PW1B 2Q7YA 2XXMB 5C8JB 1TITA 5EU4B 4N0UB 1QSFA 2AK4B 2PTVA 4HHAA 3OAYK 3GHBL 2E7LC 4M7ZB 4XNMB 4HXAL 3CFJA 5TGBA 4Q97A 5CCKH 3BHBB 3NCYS 3RVVC 1FGNH 2R0LL 1Z5LA 5IM7A 1BD2B 1J0KA 3GZKA 1BJMA 1XT5A 3O45A 4KU1A 4P3DB 3RU8H 2VLKE 3ME0A 5KSVB 4L8DA 5IVXB 5C0RL 5IFAH 4F37F 1B4JL 1V7ML 1WFNA 2VDRL 3WFZA 5ICZB 3JV4A 3X17A 1YQVH 1F3RB 1CYGA 3NVQA 3KJ6L 2ARJB 4QHUA 3VI3E 4R90H 4KROC 2NY0C 3FQXB 4GRWE 2NYYD 4E41B 2YPLD 5HVHC 1UYWL 5JLZA 3RL2A 5T1KD 5KJRL 1XCTB 4DVRH 1KIPB 1FL5B 3I6KB 2AI0L 5EOCJ 4OGYL 2HH0L 2WZPD 1KCRH 4PBXA 4H88L 5IHLB 3BGMA 5F88A 5BRZE 2RHEA 3ARFD 2VZSA 1AFVH 2X44D 4IOIA 3UEZA 3V4PL 5D1ZA 1G0DA 3RKPA 4O4YL 1VESA 1HKLH 3C5ZD 5DS8A 2WBKA 4MB4A 1OAXL 2VZ3A 3DXAE 1DLFH 4FP8L 2X4PA 3DTXA 1INQA 3BN9D 2F58H 2D4FA 4IHOA 1OOAA 3BMWA 3WMSA 3WSQH 1F58H 5A2FA 5JXED 2CLZA 4ODHH 3UTPD 4AK1A 1Q94A 1MNUH 4DAGH 4YXHH 1MFAL 4UT9H 4YBLB 2A1WH 3UPCA 5CEXA 3IXAA 4X5XB 5H37H 5C0DB 4XRCA 3F7VB 1OD9A 1T1YB 1MJJA 5IVNA 4QXTB 2X4TB 4UILH 1QLEL 5I74B 1IGML 3W39B 2QQNL 3KLDA 5CJOL 1BEYL 4Z7NF 1ZTXH 2VXQL 3OPZH 4UMGA 1LDPH 4XMLH 1OQOA 1IM9D 4YFLI 4ELMB 3VFNA 2LVCA 3UTTA 1CDBA 1FO0B 3HPJB 1FNGA 5IIEA 4KI1A 4PJ5A 5JZ7D 1T20A 1BOGA 5EO0B 4KJQD 4UV7L 3UC0L 1LE9A 1DN0B 5IV2B 2ADFL 3A67L 4XCCL 3QA3B 4DGIL 3CVHB 3TCLB 3NZ8B 4JFOB 4NM8L 4M5ZH 4O5LH 1XGYH 2JJSA 5C3LD 3HFML 5EOCH 2DLTA 4U7KA 4F7MA 5ITBH 3TVMD 1EBAA 3N1QC 5EUOA 3ZMRA 1VFOA 4RQQA 3OKEA 1X5IA 3D69A 1JWMA 5HHVL 2NX5A 4G8FB 3HG1D 4FS0A 1NC4B 4YHPA 3GHBH 4JFPB 5HD8D 4ZXBB 4YJZL 4C4KO 1JF6A 3JTTA 2R0LH 2CDEA 2CXGA 1DANT 5FYKU 5DJDB 1NCBL 1OVZA 2Z93B 4F15C 4OLWH 4JM2B 4UNUA 3I75B 2O5XL 5C0RH 3AXLA 4O2FB 3WFCL 5C0BA 1NPUA 4JGUA 3MLVL 1B4JH 2VDRH 3WFHB 5D5MA 5LG1A 5SX4I 1RUML 1C16A 3LPWA 3QFDB 5ESAA 1A4JB 3T0EC 4O51A 2X4SA 4G6KL 3NPSB 3KJ6H 5JHDB 1OHQA 4YIQA 4Z7VE 3TIEB 3EYOB 2A74A 5DD0L 3VFGL 3L3IA 4OGAC 3ZE0F 3C8HA 2R2BB 3QXTA 3ROOA 3EYQD 1JWUA 4G42B 2P5ED 4LNRB 3ESUF 4JKWA 1UYWH 1MWAA 4PJCB 5E5MB 2AI0H 3O81A 4OGYH 2HH0H 4MQSB 1JZ8A 4H88H 2BMKB 4M7ZC 3ZDYF 4CADB 1MCOL 1FVEB 4RDQG 5FKAB 4O4YH 3QNZA 4S0TD 1RIHL 1QYGL 3RPIA 5IMLA 4PTTA 1OAXH 1QZ1A 3OAUL 4FP8H 2OQJB 3PABB 4FQHB 2ZG1A 4F7CB 1QBLL 3KPRE 4DGVL 3HCVB 3CFBB 3QG7L 3WIFB 2COQA 2Y25A 4HQQH 4RAHA 2YD6A 4U1GB 4P5KA 3BVNB 4V1DD 4MLSA 1S7QA 4QO1A 1MFAH 3BGAA 3IJYB 2BVQA 2AJVL 4MD0A 2HG5A 5ANMA 1GGTA 1YPZE 4HSQA 1FVCB 1IAMA 4Z78A 1LO4L 1SY6A 3GKWL 3UYRL 1QLEH 3MRIA 5LGJB 1CI5A 3G6JA 3FT2A 1IGMH 2W60B 3WFDL 1JPFB 3NIGF 3MRFB 1BEYH 3MJ8A 3MV7B 1A21A 2VXQH 4NBZB 2DM4A 2YRPA 1P9MC 5IJVA 4P46D 1U93A 1ZT4B 4W6YB 4WUUA 5F70A 1JYWA 3UCRA 1KB5L 5I9QC 4FTVD 1T7WA 2AEQL 4LSDA 5C0AB 5CKAA 4UV7H 3UC0H 1H5BC 2APXA 4GAFB 4I3RL 2V5TA 2ADFH 3A67H 3MFGB 4OFYA 4XCCH 1S9WA 3CMGA 1HHIA 2VDML 5IW1A 5ISZB 1RJYB 4NM8H 5SV3A 1MCQA 4YBLC 3OR6B 4QOKB 3HFMH 3EYUL 4R96B 5GHWL 5DJ8A 1SEBB 3UO1L 1CL7L 4PRDA 3MPCA 5L0QB 3RGHA 4P59H 5GJTL 5I74C 5HHVH 1XIWB 3WJLC 4BFIA 3IF1B 1Q38A 3U4AA 3ZLQC 3U48A 5HDLA 4F33B 3HHRB 1KG0B 3DROA 1ULVA 1T7YA 1RV6X 3W5MA 3SGEI 1NCBH 1A1NA 1CTNA 3LVEA 1UA6L 1EHNA 5HPOA 2MQCA 2O5XH 3C87A 3D25B 5F89A 1DE4A 3QJHB 3MLVH 3KLAB 2E6JA 1RUMH 1NUNB 4TRPL 2Q7NA 2VZOA 5IHBA 5DDHA 1O5DT 1MHPL 3KYMA 4G6KH 3O8XC 3FO2A 3TPUA 4TTGA 1FYTB 4N9GB 5DJAB 1MEXL 4QRPB 3SDAA 5DD0H 1H8NA 1E27A 5FA3B 1QRNA 1UXWA 3FB7B 1G84A 2ADJA 3VXNB 3EO1A 4LLDB 3HZVB 4PJFA 5DD3L 3OWEA 5I16B 3SDXB 3GJEB 4KGJA 2NY1C 1S9YA 4APQA 4J3VA 4ZNEE 2PW2A 4XMKL 3C09B 1ZHLA 1MCOH 4K7PY 5CIPA 5TQ0L 1H3GA 3ARBA 1RIHH 4DW2L 4U1MB 1QYGH 4NQXA 2Z91B 3OAUH 2DIJA 4OZ4A 5MEQB 3DOSA 1KENL 3LCYA 4Y16B 5DJYB 4Z7WA 5KOVC 1QBLH 1DQQA 4HWZB 4DGVH 5CAYB 3QG7H 1E6JL 1AGBB 3DUUA 2XOTA 3NPSC 2BERA 4JFDE 4LPUA 3QWQB 2NR6C 4QHNA 2DLGA 4FXGB 5J9PB 4LPCA 5IGXL 4JFED 3F7PC 3S3PA 4I4WB 4WNQB 4OZIB 3WYRA 3PWPB 2VWEE 2AJVH 1T2QL 4XNQA 4WI9A 4S11A 4J7RA 4Y5XA 1LDSA 2WK2A 3O3EB 1RFDH 1R3KB 1LO4H 3GKWH 4H8WC 2XYCA 1IGIL 2X4NA 2YSSB 3UYRH 4PJGF 3D48R 3FO0H 3WFDH 1OL0A 4QHLA 4PLOB 4PY7A 5E94A 1CLZL 1CGWA 3E8UL 2YD8A 2WBJA 3EGSA 1V3MA 4XNZB 1RU9L 1GRWA 1J7VR 2D31B 1FZJA 4WW1A 2FGZA 5IB5B 4MJID 3VXRA 2YR3A 1KB5H 5EOTA 2ESVA 4BQ9A 5KVEL 1OB1A 2AEQH 3PIQB 2XZCL 3VWKB 1MSPA 5BZDB 3IDMA 2LU7A 3EYFA 4I3RH 4LLVB 1C08A 1F2XK 3B9EA 5GGRY 3TESA 1P4LB 1C5DB 2VDMH 3ZZ1A 4F57L 5D7JA 3OR7A 1N8ZA 1ORQB 4HIEB 4RIRB 3EYUH 3MNVB 3HMWL 4O2EB 5GHWH 3UO1H 2P8MA 1CL7H 5ESQB 1LILA 2GJ6B 2GKIA 2GCYA 1BQHA 5GJTH 5TDPB 3CZFB 3CDGB 5IR1B 1S78D 3BEVB 4IS6B 2DIBA 1KJMA 3VXSB 2DQHL 4PJHB 1WIPA 4KJYB 3H9HA 4TTDC 2RR3A 4F7TA 1OTTD 3O9WB 4X4YA 1UA6H 2ZOLA 1CN4A 4BYHA 4HKZB 1WZMA 4OIBA 4BZYA 5C0CB 1JTOA 3LEVL 1ZVYA 1EMTL 3HS0A 1JHKL 4FQQB 3ARGD 4TRPH 3OGCA 5IQ9B 1XZ0B 2YZ8A 3D3VE 3BKCL 4PTUA 1MHPH 4NT6B 2IGFL 1FC2D 3D18A 1MEXH 4P23B 1WAAF 3WNPA 1UJTA 4EI5D 5IJKA 4Y1AE 2VLKD 1LWRA 5F6IB 5I8EA 5DD3H 4NFDA 5JORB 5F3BA 3BZ4A 5E8NB 3V8CA 2VKXA 4HJ0C 4KKCD 1A1MA 2MPAL 4KK5C 1B4RA 4NZTL 4L3EB 1K2DA 3MLUL 4GG8A 4XMKH 3K2MC 5HHMB 1BLNB 3L5WA 4KQ4L 4XI5D 3C8KA 3R06B 1CCZA 4C83B 3HAEB 3QQ9C 2ARJQ 4LRIC 1C8PA 5TQ0H 4LHUG 4DW2H 1F2QA 2EDTA 5CBEB 1HH9B 1V8HA 3Q6GL 3MC0A 1G7JB 5KSAB 4AT6A 1KENH 4TUJA 2Y6SD 1D5ZA 3LRGA 1MFDL 4UIMA 5BRZD 2XWTB 1E6JH 2PXYB 2BSTA 1K8IB 3LKOB 1JPGA 1N6VA 4JKMA 4I0CC 2PETA 2BSED 5IGXH 1A1OA 2CSPA 5DSCA 3KG5A 2WINA 3O6KL 4UU9A 3FQUA 3DXAD 5AUMA 4TSBL 1T2QH 3HE6D 5DA4A 4LGRB 5IB2B 5D6DA 3BIAX 1FLTX 2HLFC 1GVIA 5JIHA 1IGIH 3EDKA 4WDIA 1XR8B 4X6DF 4I18B 2FSEA 4NP4L 2OX5A 3VFMA 4JRXE 1CLZH 3E8UH 3QDGB 3SDDA 4Q74A 4JREC 3RY6C 5HDBE 4W6XB 4YDJB 4QRQA 4KVCL 1A02N 4YBHA 3SE4A 2H45A 3FKUS 3TIDB 2NY5L 4NKDA 1FFNA 4Y16C 3ZDXE 1CFBA 3MMEB 3X3GL 5KVEH 4HX1A 2FIKA 2XZCH 4P2OA 2NY4D 3K2UL 1IQWL 2APFA 4NRYB 5DJCB 4JDVB 1IVLA 2C4XA 5I1IL 4F57H 4FQXA 1P7QD 5FOBB 1Q8MA 3WFEL 3EOTL 4ORZC 2V9TA 3AMLA 1HDMB 4YGAB 2V9QA 4RX4A 4MAYD 4QXUL 3M8OL 4J6RL 2Q8AL 4PJDB 3GSVB 5HY9A 4LU5L 2D7TL 1HZHL 2IANB 4M6OL 5HHOE 3F7YA 4HEME 4XNZC 5GZOD 3TEUA 4LLUB 4OAWB 4MCYA 4YNYB 3GRWL 5KANG 3DVGA 1WT5A 4W4OA 4XNYL 3DETC 4NWTL 3O3BA 1N64L 3OKDB 3VWKC 5A16B 4PG2A 5DEFB 4ZFOL 1PKQB 2OR8A 3LEVH 1EMTH 4BQBA 3UPRA 3K4ZA 3GIVA 1NFIB 2AXGA 5D70L 2BNRB 3BKCH 4KJPD 3HZKA 3MOBL 3W0WE 1TMCB 2IGFH 4I5BA 4XTRC 3LPFA 3PGDA 5E6IB 2IQ9L 4JY6B 3U0PB 1MH5A 1EFXB 5DK2A 1A7PL 1MPAL 1I1CA 1N5AB 2I9LB 4XWOD 1J0YA 1NFDA 2CLVA 4OFPA 2MPAH 5CSZB 2HRPL 2OBGA 4I2XA 4PRIE 1RJLA 4NZTH 4NQEB 2NY3C 3MLUH 3OJ2C 2CMRL 4PFEA 4LOUD 4RNRB 4KQ4H 3BZDA 3D2UA 1UADC 3DV6B 1YN6B 1I9RL 1KELL 4CN6A 4WTWA 3Q6GH 4WV1A 5D7IE 3TN0D 5F7EL 3EOAB 4XT1C 1MFDH 2N4IA 2YN5A 1NKRA 1A6TB 1BM3L 3FOLB 3IYLW 4N5ED 2FWOA 3MNWA 4P23C 2ICWB 3EDJA 2C5DC 1PQZA 2RBLA 1IGTB 1MREL 4ZUUA 5KS9E 2YXFA 1P69B 3T3MF 3O6KH 5F6IC 1TJIL 3RGVD 3JWDL 4KI5C 4TSBH 3N1FC 4LCUB 5JDJA 5EBWB 4X98B 2J4WL 1LEKA 3KPRD 3MRPB 3IDNA 2YWZA 2HLAB 5D2LB 1QRKA 1NCCL 1HSAB 1NGXA 4NP4H 3HC3L 5ESVB 5HYJD 1FNLA 4XVUC 3WKNA 5C0FB 1FN4B 2VDOL 2BVOA 4K8RD 3PGFL 4KVCH 4WHYH 1A7OL 1BX2B 1AE6L 1LP9A 1UJ3C 4ENED 3IDYB 2AERT 4XP6L 2NTFA 2NY5H 1NBZA 4OIAA 5KSAC 1LO2L 4DOHE 3PNWA 4EOWL 4OJFL 3MR9B 1NQBA 4QY8A 3MUHL 3X3GH 4N0RA 3HLAB 2PXYC 2GHWB 3QXUA 5DMGC 3K2UH 1IQWH 4MLIA 1NANI 2VIRB 3TBVA 4P5TC 5CP3A 1DL7L 5I1IH 1MI5B 4LBEB 3B5GA 3WFEH 3EOTH 1UKQA 2JCCF 3WIHA 5BZWA 4BFGA 4X7EC 3QIBC 5GRVK 5C0EB 3KLHC 4QXUH 4NKOA 3CFDB 2CH8A 4GKZA 3M8OH 2EDFA 4IMLB 4J6RH 2JELL 5FYJE 2Q8AH 1K6QL 4I18C 4ZQKA 3WDIA 3MLWL 2XTJC 1JK8B 4L3AA 4LU5H 2D7TH 1HZHH 4M6OH 1PZ5B 4WGVB 3LSOB 3GJFB 3D39B 4GXUN 3X11B 1EHXA 3FQTB 4S1DD 1I7TA 3GRWH 1CDUA 5L2KA 2J8UE 4GH7B 3RWFB 3V4UL 4XNYH 4NWTH 1FZMB 1N64H 3WS3B 4W70A 2P8LB 1TCRB 4X7DC 4L3CB 2Q86A 5D70H 4YAQA 3IJSA 4OBRA 2YXMA 5DEGB 3MOBH 1UWEL 4RWYL 4HS8H 4L9LA 3I3BA 2IH3A 4ZUTA 2IBZX 5GIRA 4HF5L 4OT1L 4KI5F 3W81A 2IQ9H 4WO4D 3FQNA 3JWNC 1A7PH 1MPAH 1IAKA 2EYSA 3I02A 1JI1A 1M71A 5HHNA 2HRPH 3DYMA 5FHBL 1T22A 1AGEB 3QPXL 5EU6B 5ITFA 2LVEA 4MHHG 2CMRH 3VXMA 5ERWA 5FM4A 3RIFK 2NY6B 2QHLA 3N1PC 3RJQB 5ICXA 5M95B 1DBKL 3I6LE 2UWEA 5E8OA 2C1OA 2V5RA 1KELH 1MWAL 1QTYT 3WE6A 1TLKA 1S7XB 1ZHKA 5JO5A 4LKXB 4XHJD 4EUPH 3WCYA 1ZLSH 2BCKB 5F7EH 1DEEB 4WI4A 4OV6F 2WW8A 3HRZA 3L3JA 2Z4QB 4PJXB 3RY5A 2XN9E 4PLJC 3QIUD 1BM3H 2CR3A 5E8EB 4JAMA 3CPLB 4PJEB 3DVIA 3DX7B 3NFPB 5E6IC 4MNQA 4ONHB 1MREH 3QRGL 1WWAX 3PV7A 1RQ5A 3P77A 1TJIH 2A83A 4MXVE 3JWDH 2IAMA 3IETB 4GKSB 2J4WH 4JJHA 1MUJA 2DJUA 4UT7L 5B4MD 3AU1A 4P57B 1P2CA 5GS2D 1NCCH 3FJTA 5FM5O 1CGXA 4JFDD 1P7KB 2KQNA 5BOZG 2VDOH 2GITA 4U6YB 1I8IB 3PGFH 2W1NA 1A7OH 3AREA 1AE6H 4XWGH 1AO7E 2UZIL 2UYLB 4LSPL 1LO2H 3Q2CA 4EOWH 3ILQC 4ZSOB 4OJFH 2NZIA 3SE9L 1CXFA 5FA4A 3JSSA 1YQ2A 4CMHB 3H42L 3W9EA 2YOCA 3L7EB 3NABL 3PF2A 5FECB 2VITB 3RX8A 4UUJB 5J89A 2YBRB 2X42A 3KPPB 1E6OL 1EEYA 4KTEL 1DL7H 2LQRA 4C59B 4ZD3L 3FT3A 4FZ8L 3C6LA 1YUHB 1Q9WB 4KRMB 3JVGA 5I8KL 2G5RA 2JELH 2ITCB 1K6QH 3NPZB 1FVDA 3MLWH 4GG6E 3P0GB 3S4SB 3BKYL 1A6ZB 2VLRD 4YPGB 1W0WA 4KGLA 5FM8A 3F12B 1FCCA 3VFWA 4PRAB 4NQDE 1RHFA 2H32A 2R15A 2CUMA 1GZQB 1HYSC 1A6VH 1CE1L 4B7IA 2YC1B 3PHOB 3JV5A 3V4UH 4PJ8A 4HCRL 1J1XL 1I4FB 5CD5C 5JXAL 1RVFL 4XC1L 2QSVA 4UDTA 4CMMB 4D0DA 2ZUQB 4HKJB 3VFTB 1FLRL 1UWEH 4RWYH 3PL6A 3V6OE 1BBDL 4HF5H 3REVA 3TA3B 4QEGA 4MNGA 4JFYA 2ZP0T 4JHWL 3KS0H 2W9LA 3QXWA 2YA1A 5DWUL 1ZGLM 3DX8B 4NQVA 1U8KB 3MJ9L 1EBPA 1FFOB 5FHBH 3QPXH 4JO4L 3BO8A 4ZFZB 3B9VA 3D3VD 4BK4A 2VDNH 2QQKL 1ZHBA 2X4UA 3CMOL 3LKSB 2H26B 4A2LA 5KG9A 5HGBB 1DBKH 1UG9A 2H9GA 3S98A 1EAJA 4Y1AD 5DK0A 3SQOL 1SBSL 4NSKB 3VFPA 5CEZE 1YMMB 1RZGA 2BSRA 4PR5A 1MCKA 2MKLC 3SO3C 2R23B 4UINL 4UV4L 3H9SB 4DN4L 3BPLB 1WISA 3ULVL 1CWVA 3OB8A 4ZUSB 3QRGH 4G8EB 1CF8L 3ZKMD 4L4TB 3LN9A 4OZGA 1ZXQA 1BIIB 3VGEA 5H37G 2BXYA 4UT7H 4YDVA 5I17A 3QDJB 2B8OT 4M43L 1JL8A 3EFDL 4Z0BH 5E4EC 3BH9A 2NY6C 2VH5L 1XH3B 4J4PC 2W07A 3T1FB 5IFHL 1JI2A 2ATKA 2DQFA 4XP1L 4D0CB 1OTUC 2B1HL 3QIWD 3T8XB 2UZIH 5GGVY 4LSPH 3WEXB 1MHEA 4A6YB 3SE9H 3BP5A 2IMNA 1T89A 4BQ6A 3SGEH 4IIQA 4EEEA 5K9OA 3H42H 1UXSA 4JRXD 3AAZA 1KEMH 4UTBH 5ACZA 2GK2A 2OSLB 3QUZA 4KTEH 2Z8RA 1T6WA 3GMMB 4ZD3H 3L95A 2GW5A 2JKXA 2MCG1 1U8HA 1G7IB 1CIUA 4R97C 2W59A 1FG2A 3CZJA 3WL9A 5B38G 2HVJA 3W9DB 2NNAB 5I8KH 1I7RA 4M5YL 1HHHB 1S7VB 1DQLL 3EZJB 3BKYH 2RFXB 5D2NB 2R9HD 1MRCL 5GRUL 3UBXB 5GS1B 1FZKA 1I8LA 2KZWA 2Q7YB 3L6FA 3TPKA 1H8SA 3FB5A 1T1ZA 4LRNL 3I3DA 5EU3A 4G5ZL 4F37K 3B2UC 1AIFA 4HHAB 2AGJL 4RMVA 4XPBL 1NCUA 1CE1H 1KPRB 5EIQA 1LO5A 1R5VA 3CFJB 5TGBB 5IW6A 4HCRH 2Z31C 4CMHC 1J1XH 1BF2A 5JXAH 1RVFH 3DVNA 1A7RL 4XC1H 3CDCA 3MA7B 1CFSB 3BSZL 5HHOD 3O45B 5IESL 4Y5VA 1FLRH 4L8DB 2YUVA 3OB0H 3BRGC 2QADC 1BBDH 5L6YL 3J8F7 3B6SB 3JV4B 1OP5K 1GL4B 2SEBA 4JHWH 3S35X 4Z7OF 1CFNA 1J8HA 2EEDA 1B0GA 5DWUH 2JB6A 2A0LD 3MJ9H 5F9WB 4LGSB 1ZAGA 4U49A 1KJ3L 3ARZA 4BQ8A 2QQKH 5IMMB 5JLZB 1SEQL 5F7MC 3RL2B 5CEYA 1FPTL 3W0WD 2NXZC 2EDNA 3P4LA 1OGAA 1Y6MR 2P5EA 3BGMB 3SQOH 4MQXD 4ZMAT 1SJXA 2VLLA 5BW7C 4IOIB 2V2WA 5D1ZB 1IEHA 4PRID 4JFFE 4POZC 5DGRA 4NZJA 5F7UA 3QI9D 2PR4H 4IMKC 2J1KA 4UV4H 1ZGLA 3MBXL 1PYWA 2DQUL 4DN4H 3ULVH 1ODAA 2V2XA 3DTXB 1INQB 3LAFA 1IC5L 5F8QC 1IKNC 3RPKA 4IHOB 2HT3C 1BFOA 3LN4A 3ES6B 1CF8H 2CLZB 1S7SA 1JMXA 2NW3A 4OKDA 2RJMA 1Q94B 1ZT1A 1UGNA 1VDGA 4M43H 4WW2C 5MI0C 3EFDH 4P5MA 3R0NA 1MCCA 5CEXB 3IXAB 5F8RC 4OUUA 4XRCB 2VH5H 2AK1L 3KYAA 3MV8E 4OD2A 2XNAA 1MJJB 1F6AB 4X7TB 5IFHH 4XP1H 2B1HH 3QEHA 5E08L 3KPLA 5CJXC 5EUKA 4JZOB 3V52L 3UTTB 5E6ZA 3ZHDA 3LQZA 1FNGB 3QZWG 3ZE0E 4MJ6A 5IIEB 3IVKB 2F54E 1TVBB 3MUZ1 1BWWA 2CQVA 4PJ5B 1T20B 4X80L 3MRKB 4P46A 1LE9B 3WO4B 5BMFL 2P42B 1ZA3B 1NAML 4OCNC 3ZDYE 4GXUM 4M5YH 4HUVA 4FQJL 3L7FA 4HK0A 1DQLH 4F7MB 4C56E 2AXFB 2IWGA 5TE4L 1DQML 1MRCH 5F1IA 5GRUH 3OKEB 1K3ZA 1G7PA 3D69B 4LRNH 2NX5B 4Z8FL 2H6PA 4G5ZH 3SCMD 2ZSWA 2DKSA 2AGJH 4XPBH 1DQTA 1UC6A 4YLQT 5FYJD 3JTTB 2CDEB 1ZLWH 1AJ7L 1X5KA 1NUFA 3V5DA 3IJHA 1A7RH 3KDMA 3NIDF 4PB0L 3BSZH 5DC4B 5IESH 5FYKE 1DBML 1IBGL 3AXLB 5C0BB 1MY5A 1PY9A 4XGZB 3QEQE 5L6YH 5D5MB 4Z18A 4F2MA 3IGAA 4JQVA 4NQCE 1C16B 5C07A 3CU7A 4Z95L 5H2BA 5ESAB 2X4SB 4WW2F 3X14A 3BQUC 5I18L 1HINL 4P2CG 3L3IB 2DI7A 5GS0L 1KN4L 5TPWL 1U95B 5E1AA 3ROOB 5MEOA 1JWUB 1Q72L 5D2NC 1KJ3H 5GS1C 3UAJD 1SEQH 1DUYA 1FPTH 4LLWA 1AXTH 4XVJL 3P9MA 4QRTB 4Y19B 4WRLA 3O2DH 5LAXA 4YH6A 5T3ZE 3G6AA 3T0EE 2XZQL 1PX4A 1T83A 4TUOB 3WXWL 4XB8A 4GLRI 1QFWL 1ZANL 1GPOL 5CD3A 3QNZB 2GK0A 2GJZA 2OL3A 3RPIB 3MBXH 5IMLB 1MCJA 1FNAA 2DQUH 3VXUD 4HS6A 3I6LD 1IC5H 4N1CA 2HFEA 2YWYA 4NRXB 3AM8A 3GSQB 2FO1A 4JHBA 3DECA 5GZND 4CJ0A 1BD2E 5F9WC 4P5KB 5LBSL 4M1DL 4LCWE 2DLHA 2XN9D 2BVQB 3DWTA 4MD0B 4OB5L 1FJ1A 5ANMB 3GK8L 2AK1H 1CFTA 1TPXB 4Z78B 5E70A 3VDCA 4ZS6D 3MRIB 2FH6A 3LEXA 3FT2B 3CSGA 1P6AB 4QRSA 1IEBA 5MEPA 2D7NA 3STLA 4KJWD 5D1ZC 5KSBF 5E08H 5IJVB 3FFCB 2ICEB 3V52H 4OLUL 3FRPA 5E00A 5BJTB 1U93B 4LEOA 4WUUB 4FRWA 3JWDC 4NKMB 1CGVA 1AO7D 4M61A 2FO4B 4X80H 2VQUA 3R4DA 2O93L 5BMFH 1KIRA 3FONB 1S9WB 1NAMH 3K8MA 4M6NL 1HHIB 2NXYB 3LS4L 5IW1B 5DMYA 3MYJA 4FQJH 5DRNA 2PN5A 1HXMA 2GI7A 4JFQB 4XZUA 5DURD 5A40E 5TE4H 4G6FD 1WFOA 3QDMA 4PRDB 5TJWK 4DN3L 3KYKH 4Z8FH 4JVUA 1KJ2B 1UVQA 1FH5L 4UBDD 1FAIL 2HJLB 4FQCL 4PRNB 3DROB 1AJ7H 2EYRB 2ID5A 3RTQD 2YD9A 5L7XL 5D72L 1A1NB 4PB0H 3RWIA 1DBMH 3L5JA 4OD3L 5F89B 1GCFA 1IBGH 4G8GA 4DZBA 4Y2DD 4NQDD 3VJ6A 2PCPA 3RL1B 4KKBD 3TFKC 4Z95H 4PJGE 3U7YL 4AEHL 3ILPA 3CC5A 3KYMB 3FO2B 5I18H 3TPUB 5HYFA 5C08E 1HINH 3UJJL 2PYFA 3VRJA 2JJSC 4U0QB 3Q48A 3SDAB 4NC0B 5GS0H 1KN4H 5TPWH 1Q72H 3EO1B 5C09B 2A9NL 1GGCL 4PJFB 1I3GL 3GIZL 5ACLA 3DMMB 4LQ1A 4XVJH 1S9YB 4APQB 4QCIA 1BGXL 3MUJA 2PW2B 4P4RB 3VH8A 5BCAA 1AXSB 2XZQH 4RRPG 2EKSB 3NN8A 1ZHLB 4P2QE 1CLCA 3WXWH 2APVA 2AEPL 3DLQR 1QFWH 2FEDC 1ZANH 3V6BR 5CIPB 1GPOH 2CUHA 3MLRL 2Y72A 3G6DL 4NQXB 5DJZB 3U79A 5F71A 5A2IH 4OZ4B 4BA8A 2GY5A 3K81A 5TH2A 4OF7A 2ZUYA 1MF2L 4Z7WB 3D0LB 1DQQB 3OL2A 2B0SL 2GSGB 4CU7A 1NANH 3DUUB 5CEZD 1QHPA 4QHNB 4WENB 5JHLL 5LBSH 4M1DH 2Q3ZA 4GOSA 4YPJA 4BH7B 4DCQA 5IEKA 5DD5L 4OB5H 2CRMA 4ODVH 4XNQB 2ZUTA 2ZJSL 3GK8H 4Y5XB 5AD0B 3ULUC 5D7LE 4YDLB 4MQTB 2BOBB 2X4NB 4H1LH 2MFNA 5JQ6L 1F6FB 1NBYB 3HE6A 4QHLB 4NFCA 4FG6C 1RUKL 4J23A 5AWNL 1H9VA 5E2UL 2WWMD 4LLQA 4OLUH 4I0PB 4X0KB 1WAAE 1FZJB 2PTTA 2LAGB 5ACMA 2WLZA 2DQCL 3VXRB 5EOTB 2ESVB 1S7RB 1OB1B 2M2DA 1RAMA 3LV3A 3IDMB 5GS2H 4HDIB 1JGDA 3GKZA 3EYFB 3BKML 2ILLA 1TJGL 4R7DA 1YMHA 4DK6A 4M6NH 3MO1A 5A2KH 3LS4H 4EN3A 3LKNB 5EUOF 3OR7B 4FQLL 1C7TA 1N8ZB 1EGJA 4GXVL 1OLZA 4QHKI 4G9FA 1S5IL 1MCWW 4EBQL 2P8MB 1N2RA 1NLBL 4N90E 5F44A 3MJ7A 3IXTA 2VB5A 2GCYB 1B3JA 2HMID 3U30C 2EC8A 1FH5H 2IPKB 5CLTA 5I1JL 1FAIH 4MAYA 4FQCH 5TF1L 4L8CA 2EDYA 5J1AA 1QFHA 1VFAA 1EXUA 3H9HB 1RY7B 4GFTB 4F7TB 2PTUA 1T03L 5L7XH 3M1BA 5D72H 1CICB 5MENE 4X4YB 2ZOLB 1C5CL 1TENA 2D9CA 2EZ0C 4OD3H 3DI3B 5IB3A 5C7XL 4GBXD 5IUSA 1W72A 2EIZA 1XGTA 3HS0B 3OGCB 3MV7E 1KT2B 2J6EA 5IROA 1KLUA 5IG7A 4D3CL 4PTUB 3U7YH 4AEHH 2NXYC 2VTFA 5AG9A 5D9SA 2E8ZA 3UJJH 4RMSA 3S97C 3VRLF 4IDLA 5A2LH 2NLJB 2Q76A 1A2YA 2A9NH 1M05A 2RGSA 1I3GH 2DKUA 1UCTA 3BZ4B 5F3BB 3GIZH 1TIUA 1A1MB 2N1KA 1BGXH 5HI4C 1K2DB 2XWJA 1NMCB 4GG8B 3RVVD 3L5WB 1LO0H 3C8KB 5FGBA 5I0ZA 2AEPH 2Y07L 1FV1A 3MLRH 1YEHL 3G6DH 1LEGA 4Z7VA 2FBJL 4PJAA 4TUJB 2FR4A 1MF2H 1J11A 4UIMB 4XBEL 2B0SH 1IAII 3MGTA 2AJSL 1JPGB 3L5IA 2DJSA 4KDVA 4JFFD 3MV9E 3SJVB 1CXIA 3MXVL 3SDAC 4KROD 2NY0D 5JHLH 4IOFC 4UU9B 4FOMA 4WU7A 1J86A 5AUMB 5DD5H 3TT1L 2ZJSH 3G6JF 5JW5A 2OTUB 1L4IA 4APQC 5GXBB 2AP2A 4ZAKA 2F8OA 4WDIB 5TDOA 5JQ6H 3C9NA 4WHYG 2Z92B 3A0OA 3VFMB 3G5YA 3G5VA 1KPUB 4PYHA 3ULVC 4X8XA 1RUKH 3RBGA 5AWNH 3MJGX 3ARBC 1VCAA 4N0UA 4QRQB 4L4JA 3DI2B 5E2UH 2AK4A 5F7LB 4Q0XL 1FFNB 5DMIL 2XG5A 3MV8D 3E6HB 3BHBA 1U2CA