4XPGL

X-ray structure of drosophila dopamine transporter with subsiteb mutations (d121g/s426m) bound to beta-cft or win35428
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dopamine transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpgL01
5FKPB 5J1AA 4HC1A 1XCQB 2VXVL 1BJ1H 1DN2A 4HK3J 2YUZA 2QHRL 2XKNA 4TSAH 2YRZA 1OAUL 3RZCA 1JN6A 3AVEA 1YEFH 2XNAB 3KPSE 1RUAL 2JB5H 1N59B 5EU3B 4NM4H 2CLRB 3MRDB 4XP9H 3PWNB 3HZVB 1JIBA 1UXWB 4MJIE 3PWJA 1RZ7H 4WV1C 1FYTB 1G6RA 4I3SL 3ARPA 5KVEH 1MJUL 2BNRD 1YNTA 3UROR 5C3LD 3BPOB 3BQUA 3LV3A 3LD8B 5J6GB 3S3PA 4EXPX 3O2VH 3C09C 3CVHL 3IRZA 4K71C 4TTDD 1L7TH 3FQTA 5DR5L 3ARBC 1A1NA 4X9GA 2CDGB 1QFWL 1N5AB 2ZPKL 3NA4A 3NIGF 4OGAD 1CD0A 1WJ3A 1FLTX 1KLGB 3QIWD 5B8CB 2I26N 3ZL4L 5J6HA 3MFFA 2NY1C 4OCRH 1YY8B 3VXRA 1P4LB 3L5WA 2VZOA 4GRWE 4ZXBB 2DQCH 4AK1A 1OSZB 2IH1B 2IAMB 1N6QL 3JSSA 2F19H 4Z78B 4OTXL 5CINH 5D1QA 3U7WH 4UIKL 5HDQL 4J8RA 2Y7QB 2YD7A 2X4OA 3WHE0 4X8JB 4Q6IC 4HUVB 3VD4A 2NYYD 5KJRL 3ULUH 5T1LA 1TVDA 1HEZA 2K9UA 2XZQH 2FATL 5DUBA 1YPZB 4TUJA 3MRLA 4KJPC 1LO3L 5FUOH 1RUQH 1GIGH 1IAIM 3ARDB 5FYJE 4G9FA 1AO7A 1U8PB 4WRLA 3VGBA 4PJ7E 5DSCA 4RWYL 5E1HB 4ETYA 4K94L 3SGKC 1IGTB 2XN9B 1IAKA 1YPZF 4LKXA 2D2OA 1S7VB 2NW3B 3AUVA 4PJ5D 1FAIH 5HHMB 3MNZA 3P4MA 3RU8L 4M02A 4PY7A 4DN4H 5DA0B 2ESVA 4QLRA 2EE2A 2QSVA 3Q6FB 3WL9A 3U9PH 1EO8L 5FO9B 3KXFD 5I8EA 2P44B 4GRMB 4M62L 2YUWA 1FHGA 2D03H 4OD2B 2VXUL 4R96A 4JDZA 1B0RB 5L2KB 1X44A 1P7HL 2EH7H 4PTTB 4NO0B 4HD9A 4L8SA 4MDJB 2EYRB 2J8UE 4RWHA 2DMCA 2QR0B 3WHXA 3BP5B 1MWAH 4PR5B 4M00A 4XCYA 1AKJA 4AIZA 4H0GA 3I75A 3T1FA 3D85D 1FNLA 2GCYB 1T3FB 5KSAA 4LGPB 5EZJB 4U6XB 4O02H 2A9ML 3PP4L 4AL8H 2W65A 4OT1H 2Z91B 3OKOA 3RIAF 4RMTA 5F8QC 1C5CL 1CQYA 4MCZA 2FSEA 3CC5B 4RRPA 5TDOA 4LDLB 4P49A 4XPHL 4ZFGH 2AW2A 1MCFA 2GK0B 4UT9L 1DUZA 2FZ3B 3GI9H 5EIVA 3D0VA 4LLDA 4I0PC 3QFJE 2QQLL 4P5TC 5I8CB 4CU6A 3WMSA 2NY0C 2MQ0A 4FHBD 4YNYB 5DJYA 5D7JA 2AQ3A 5TPWH 4MA7H 1H3GA 5T3XD 4H8WL 3LEVH 1IEAA 4WEBL 2VERN 3NFPA 5IROC 1HKLL 4R6UA 4FXKA 3ILPB 3DMMB 2D7NA 3C5SA 1T03H 1JPTL 3T0AA 2UZIH 2ZUXA 4YPGB 3RTQD 1HSBB 3EYQD 2HVKA 1K9TA 1Q0YL 2NY2B 5CGYC 3GSQA 1FORL 3EJYC 5TQ0L 2YBRB 2VZVA 1IT9H 1UC6A 4KPHH 2GT9A 3T8XB 2Q1EA 2FH8A 3TPUA 3O9WB 5ITFA 4CAGA 5IFHH 1F42A 4W6XB 2E9IA 5LGHH 2OMNA 2HYMA 4E5XA 4XMKL 5ALCH 2LAAA 5T3XE 1IQWH 3SDDC 4RAUB 4L1HA 1INEH 3BKYL 2FIKA 3E6FA 3LKSA 2BMKB 1HHJB 4LFHD 1A7QH 3OGCA 4I18A 4O58H 1HHIA 4WI4A 1WFUA 5BO1L 3ECBA 1PAMA 1RURL 2F53D 5D4QA 1I7TB 3LKRB 4NNPL 4QRRB 3LPFA 4Y89A 1MCPH 2CKBB 3ZTNL 4ERSH 4OGXH 3WUWG 3CIQA 1ZT7B 1QD0A 2X4TA 1LK2B 3MCG1 4JG0H 1EHAA 1UQSB 4JJ5A 4L4VA 4JFEE 2FX9L 3SKNB 2OL3H 2E7LC 3IDIB 4WHYH 3I2CH 1YMMA 4EIGB 3UBXI 3EHBD 3L7EB 4M7JL 1NGZA 5F72S 3UXFA 4QWWC 1SEBA 4P9HC 4PG9A 4KK8D 4UTAL 5FYKH 4NZDA 4YDIH 1MF2H 4KRPB 5TE7H 2F53E 3RVXD 3L7FA 4P4RA 5HHNB 4N0FB 1ZLUK 1NGPL 3LOWA 4RGNE 3B9KA 3FQUA 3PIQB 2P5WA 1N5YH 4HUKB 4MVBD 5D8JH 5D7SL 3IXAB 3B9EA 3QPQC 3DUSB 2VR5A 3VD5A 3WJJA 3QA3B 5ETUA 3W9EA 4P3DA 1FO0H 4M03A 1R24A 3BEWA 2JB6A 3OB0H 4KXZI 1LE9A 5ICXB 2CGRH 1T22B 4KK9D 1HILA 1CR9L 1G7PA 4JQIL 5C6TH 4EQ3A 3GMQA 2PNDA 2GITA 4XBGB 1NBVL 4AM0B 3BGMB 3BDBA 4MXQC 3X17A 4PREA 4KROD 5JTWA 1B90A 1MI5A 1CFSB 5E8NA 1HYSC 3TCLA 1DVFB 1T83C 3R06B 1H15B 1F4AA 1Q94B 1RJLA 5EO0B 3RVTD 4NRZB 3D39A 3I3DA 4B0MM 3FQWA 5F7WC 5IHUH 2HT3D 4DGYH 5JPMB 3O6ML 1FZKA 2CK0L 5ANMB 5IMOB 3IDGB 3MXVH 2VKWA 3MOBL 3QIBD 5D71L 3OKLA 2FBJH 3QQ3B 4JFYB 4WFFE 4E0RA 3V4VH 1I7RB 5FECA 1AJ7H 3GSWB 2GIYA 5HGGS 5EH1A 5K9KA 3VRJA 5ICZB 4LCCA 4LP4A 3EYFB 5DJ2B 5EU6A 2ITDA 4CVZB 4EN3D 2EDHA 1V5JA 4ZD3H 1FN4A 1CI5A 2HJFA 2VYRE 1QTYT 2XQYK 3I6LD 4G6KL 2A6IA 1B4JH 5HY9A 3S96B 5CD5C 3W82A 1R3IH 1AQDB 1A6UH 4ALAH 1CE6A 3D0LA 4JO2H 1YEGL 2IALB 3V5HB 1U8MB 4YK4B 5C0RH 4TVPD 3QIUB 3H9SD 3AREA 4X6FA 1ZMYA 1ZS8B 2QSTA 1FVEB 3MNWA 4R4FL 4X80H 2DQFB 3HN3A 3RUGF 4PJIB 1D5BB 3FCTB 4MAYA 1TQBC 2AXFB 2GJZB 5C09A 4IRSB 2QKIA 2VL4A 1C1EL 3MJ8B 1AFVH 3IJYB 3HE7D 4CNIB 3EYOB 4QF1B 3S36H 1YNKH 3HZYB 4KQ3H 4C55A 4GRLA 5HYJA 3NFNB 2BY0A 1KJ2H 4PJIF 5AYQA 3VFGL 4Y19E 3ZKQD 3KPNA 5IB1A 5TFSL 3TO4A 1J0KA 5CSGA 1TPXC 3EGSB 5LXGH 3KG5A 4ONHB 4TYUA 5LBSL 1T04A 5DQJA 5K9JL 5D72L 3TN0D 2BNUB 4WHTA 1Z3GH 1I1AB 4MB5A 2YK1L 4XPFL 4KI1A 1BWMA 5C3TA 1JPFA 2J8HA 4NO5A 2J88L 2KKQA 1SJHA 1YA5A 3CFBB 1B88A 1J86A 2O5ZH 3HNTL 2HT4D 5F70A 2XWJA 5AD0A 1IC4H 3WD5L 1DQJB 1BZ7A 1MRCL 4JZOA 4KKAD 3VGDA 5GGSY 1OAYH 1QYGH 2XXMB 4I13B 4JB9L 1QSEE 2ZSWB 3VG0L 2FR4A 4QRPB 1SQ2N 2R9HD 3MUGB 1NMAL 3FO2B 1UJTA 1PZUB 2YD4A 5IW6A 1MAJA 4M61B 4OLVH 4LIQE 1XF4B 4HAFA 2V2TB 4MD5A 2Q7YA 4K3EH 4LPCA 4PJHF 1OTUC 2XKNB 2XQBL 1WF5A 2FJHB 5SWSE 7CGTA 3P30H 1FFRA 4LVEA 4YHZH 1NKRA 2RIKA 3MA9L 4C56D 2QV2A 2DM7A 3RKPA 1IFHL 1ES0B 2MSPA 2BNQD 1UWGL 3WYRA 5IEHB 5KS9A 2GJ6D 4TRPH 3RX8A 3PGFH 1HNGA 2I27N 1WFOA 1X4XA 3LV3B 4FMFA 1G6RH 2ZNXA 4RX4D 5KSBE 3RNKA 2IFFL 3W11D 4R7NB 1A1NB 3PQYE 4F2MA 1CVRA 1NFDB 3VFWA 4GUPB 5TDNA 1OM3H 1SJEA 3PG2A 1CDCA 2J8UF 4O2FA 3BUTA 5D93B 4HKJA 5E24E 3MJ9L 4Q9QL 4PJ9C 4X6CA 3L5WB 1NFDF 5BCAA 3MROA 5GRUH 3M1BA 2KUTA 3AMLA 2N7AA 2HKFL 4KMLB 5EU4B 4YFDB 4S1SH 3IJHA 1F3DJ 2A9NH 3VI4F 4J8RB 4YR6B 5JNYA 4LU5H 3CLEH 1KN4L 1HH6B 4Q9RH 1JUFA 1JNHA 1JNNL 1M7IA 3T2NH 4LCIH 5T1LB 2EC9T 1HEZB 1ND0A 5C71A 3HKFA 5DUBB 3MRLB 1IGYA 4LSPH 2K7QA 3NCMA 5JW3H 5KVMC 4X99B 3QUXC 4GAFB 5DSCB 5TJWK 2XWTB 2DIBA 1KCUH 5KG9B 2DQDH 3D3VA 3TIDA 4Y5XC 2XG5A 3VFTB 1JP5A 2E7MA 2VISB 5GRVL 3VXSD 3P4MB 4YXLH 4L3ED 3QEGL 3C9NA 4G3YH 4PY7B 4JM4L 1K2DA 4FQQA 3U0WH 4YEEA 4RIRA 4L1DA 1E6JL 1PG7L 1RAMA 4ESKA 3QUMA 3LRHA 2X05A 3N9GL 4KDVA 4R96B 4NIKB 4JDZB 3HMXA 3GSUB 2APXA 5BS0D 1QA9A 4P9HH 4WWKC 1GC1L 2EEAA 3MV9A 4ODHH 2YS4A 3ARSA 4L8SB 4ODVH 4PLJD 4WFEE 3MPCA 1JZ3A 2IPUG 4GOSA 3WHXB 1DQTA 4QRTB 3V4PL 2V17H 4OLXL 4AIZB 2D31A 1AKJB 1BEYL 4NQSA 3T1FB 1ADQH 4IOFC 1J0JA 2ATPA 3B9VA 2FX7H 2MFNA 1DFBH 1RFDL 4LPUA 4ONOA 5EORL 3MXWH 4OFKA 1AGEB 1E4XL 3LS5H 3AY4A 4W4NA 5IB2A 2OQJB 5CIPB 3X14A 3OKOB 4QHKJ 3WN5C 3LEYL 3VXNA 5TDOB 1BVKB 3CK0L 4NQDA 5E00B 2NY7L 2Y9RT 1Z5LA 4KRLB 3V2AR 5EZIL 3OKMA 1DUZB 2ZCHL 3GEWB 1ZTXH 4LLDB 3IETA 4TQEL 4JDTL 4O2CB 5GS1A 4LSTL 5I66B 4JVUA 4NRYA 3RWJA 1QP1A 4Z7UA 1B3JA 3TH2T 4GS7B 4BSVA 1MCSA 3WUWA 5DJYB 5D7JB 3ZLQC 2VDOH 15C8H 3D9AH 2DWEA 3MODL 5HGHA 4NYLA 5T3ZD 1UFUA 4X4MA 3G5XB 5JQ6L 4PP1C 4NUGH 2DM3A 5D1XC 1NCTA 4HGWB 3OMZA 3U82B 4FXKB 4NO2A 1DQQB 1S5IH 1PSKL 3RFZC 1ACZA 3C5SB 5DI8A 4GJTB 3WFDH 4NFCA 2DMBA 2F9BT 5EBGA 1FAKT 1NAML 5E6ID 2HVKB 3ET9F 4X7DC 3WKML 4F9LC 1CXEA 3GSQB 3GBML 2P24A 5DEFA 2WZPD 3GNMH 3BO8A 3O3EA 3WXVL 1BF8A 4YO0B 5AZEH 3WE6A 3TPUB 5ITFB 2A74A 5IV2A 5I30L 2R23A 5CFHA 1RSFA 3B2VH 5EC1A 1F3JA 3E6FB 1M05B 5FF6B 3OGOE 4CDGC 1BD2D 1I3VA 5IW1A 3UPAA 3OGCB 2DF3A 4E41D 2R0LH 2VLRB 3MREA 5C07E 3RWHA 1T1WA 1P9MC 3ECBB 3DGCR 3SOBH 4ZSOA 2OS7A 3ZE2E 2X6MA 3C60B 4JLRA 4XVTH 4FTVD 3CZFA 1T21B 1U3YA 4JRXE 2ZZUT 5HJ3B 1ZWIA 5GGRY 1BFSA 5FCUH 1MIEL 1NBQA 3KPQA 1QLFA 1YMMB 2BVQB 3ZYZA 2E27H 4P2RA 4YBLB 1TLKA 1ZLUH 1SEBB 3U2SA 4PG9B 5AUMA 1KELH 1BBJA 4MMZC 1WEJL 4XVSH 2UWEB 3LEXA 1I7UA 4U1MB 4DCQA 1H5BC 3PL6D 5KAQG 3CZJA 4P4RB 5EBLA 3HPJA 3FQUB 3SQOL 4ELME 2KQMA 3BFOA 3RA7H 1KNOB 2FEDD 3DUUA 5FFLA 4P3DB 3BN9D 2UWEF 3A0OA 1OWRM 3HPLB 5JOPE 2Q6WB 4LSSH 1RIHL 3BEWB 4OIIL 5DURB 3OTTA 1WTLA 4NN7C 4K8RD 2NY5C 2OJZH 1D5IL 2QQNL 1C5DB 2A77L 1AR1D 3MFGB 5DD5H 1W72L 1KC5H 3GMQB 4WDIA 2AJSL 3K46A 4OB5L 1U93B 3F7PC 1TNMA 2P5EA 4PREB 1FYTE 2IAMD 1MI5B 4U1SB 3TCLB 4MQ7A 4NGHL 3D39B 1YQVL 1FDLL 4RCAA 4YFEA 4LRNH 2R1WA 2ZCLL 1FZKB 4MHHG 5CJ5A 4OCSH 1P2CB 5GS0D 1T4KA 2P8PA 2RAMA 1G7QA 3O3BB 3OKLB 4E0RB 1ZA3B 5EUOB 4PJAB 1UXSB 3ILQC 1MREL 2E8YA 3MRNA 1A7PH 2QSQA 4HPOH 1AY1L 3KPRA 2EE6A 4K55A 3ULSA 3LN5B 4MLIA 4MD0A 5K9KB 2EH8L 3VRJB 2VN7A 1U8KA 4GW4A 2HMIC 3UTTB 3B9DA 1UCBL 5EU6B 4P23A 3FFDA 4HAGA 4OCYH 2XN9D 1S7WA 1XT5A 1JPGB 9CGTA 4IJ3C 2HJFB 2XA8H 1VPOL 3E1F1 4PJAF 4WI8A 3LZFL 4M5ZL 5HHMD 5IBUB 2LTQC 5HY9B 1H3PH 2X4QB 1KEGH 3HI6L 3ULUE 4U0QB 1GSMA 2XZCH 2EYSA 2BVOA 3D0LB 3IFOA 3EYVA 5IHZB 1S7RA 3TJHD 3CFCH 4OZ4B 3AREB 1LDPL 4X6FB 2CLZA 4UQ2A 1JV5A 3IFLH 3EOYG 5TDPA 1V7NH 4BZ2L 1U58A 1WAAE 5C09B 4PJFA 4K9EC 4NO0D 2NQCA 2XN9E 1FNSL 5I1KH 4ZTPH 3GJFA 2B8OT 5CBEA 2FIRT 2NNAB 1P7QA 3FHQA 5E8OA 1ORQA 4YIQA 1PDKA 4YE4L 5TH2A 1Q9OB 2IANE 3OR6B 4BH8B 1KFAH 1T04B 5DQJB 4WUKL 4WHTB 4PY8I 4WNQA 2GY5A 3ZE0F 3VWKA 3ZT6A 4J2XA 5IB4B 2R0WH 4HIXL 5CMAA 5ECJE 3WLWD 1BQLL 4NBZB 5CAYB 5JW5B 3A6OA 5EZOH 4ZOAA 5L2KE 3BWAA 2DMKA 2E9WA 2XWJB 5AD0B 3T0XA 2Z93B 4JRWA 3FZUC 3V0WL 1I1YA 4X83A 2J12B 2EDOA 4LOUC 3F58H 4MLSA 4ODWA 3FFCE 3QUZA 1MLCA 2XTJE 3WIIL 2OP4L 3S34L 1NCUA 3MRIA 5HVHB 4F7MB 4QTIL 4RMWA 2ICEB 4IOIB 4NUJA 4Z7NE 3DMMD 5E99L 2W92A 1OAZL 4K94C 3ARWA 2A1WH 5IW6B 4LEXL 1FLRH 3LS4L 2PYEA 2J1KA 2Q7YB 2NY2D 1P7KA 1TZIA 3TYGH 1BF2A 1CU4H 3TESA 1TMCB 3ZTJH 4LAJH 2RCSL 1JF1B 3BZFA 4LSVH 5MP6L 2OZ4L 1QKZL 4PJDE 3MGAA 5KS9B 2VJXA 5F9JA 2F5BH 2A6DB 2ED9A 3PP3H 1MJ7H 1RZFL 1EZVY 3C5ZA 2GAZA 3NZHL 3RNKB 4JR9L 5DMGC 3AROA 3NFSH 1YEJH 5KVFH 2EDRA 3V6BR 4Y2DB 3CAFA 2OI9C 4YZFE 4F2MB 2GSGB 4F7TB 5D7LA 2NTFB 5I1JH 1SJEB 5CZXC 3KYNA 3IDXH 1KPVA 3D2UA 1CFBA 2BERA 4O2FB 4F58L 2FH6A 4GSDL 5L2JB 5SX4I 4HKJB 5H35B 4Z95L 1KB5A 4X6CB 1SBSH 3OKEA 2CDEA 3FOLB 5H94A 3QEQD 1X5ZA 4PGJA 4FFZH 3FN3A 4M8VA 5D5MB 3DXAA 4KZDL 4U1JA 4F37K 3JUYA 4JFQB 3ULVH 2CIIA 4HGKC 4PLNC 3MRHA 4IDLA 3BPCA 3G6DH 1NFIA 4HHAA 4X9BA 1BJ1J 5E9DA 1JNHB 1ND0B 4U3XA 2NCMA 5C2BL 4KRPD 4M7KL 1IGYB 1J88A 3BAEH 5D5MF 3SCMB 4QRRE 2PTUA 1U3HA 3L3IA 2V2XB 3OB8A 4XP4L 2VXSH 3FQXB 1RMFL 1YYLL 1ZOXA 4O00A 5FYJL 2ZWLT 4PBWD 1MUJB 1MJJB 1KENL 3ZE1E 3D3VB 2DLHA 5CD3A 4LPTA 2C3XA 3Q5YA 3O6FC 5FYLD 1E27B 4F7PB 1GGIH 4K23H 1YEKL 4FQQB 5EO9A 3DRTB 3OXSA 2X41A 2JF1A 2CDFB 4RIRB 3MA7B 3MBEC 4KK5C 1CLYH 1MCDA 2CRZA 2P7TA 2O26U 4AY0A 2DQIL 8FABB 3MLPA 1BQSA 4XVUC 5CKGA 1NC4B 3ZT7A 3V8OA 2R2HA 4R8WL 3VXUA 3WO4C 2AK1H 3T09A 5GHWH 3QUMH 4WW2F 3CMOH 5C08A 3RL2B 5IFJB 2ZJSH 4NQEB 2Q20A 1LP9A 4O51A 5CILL 4TPRL 4MAUL 1KIRB 1KBGH 4S1DC 1KTRL 4EBQH 4WW1A 2D31B 2X4SA 5GISH 4NNYB 2ATPB 5DHVA 4D3CH 5DHYA 1GZPA 3O2DA 4I9WD 4WTWA 4HLZH 5CEZH 5I1IH 5GPRA 2X1QA 3F8UB 3GMPA 3OKKA 2Y06L 5GGQL 4OM0H 1KULA 1VGKA 3X14B 1S7QA 4JQVC 1SJVA 3CU1A 4RBPH 3CDGA 3RI5F 4JY4A 4XMPH 1A22B 3VXNB 3ZE2F 1FFPB 4NQDB 4Z7WE 1EMTL 4F15C 3VGHA 1W0VA 4FXGB 4N0YL 2QJDA 3MCLH 4MQXD 3GZKA 4NRYB 3MRQA 5MEQA 4Z7UB 1FIEA 1I9RL 3TN0C 2Z35B 1YEDA 3WUWB 5ANME 3ROOB 5IKCB 4HWZB 2HTLC 3QIUD 2DJSA 4QYOB 1CT8A 4I9WE 2W60A 5F7KC 2WBJA 3H7BB 4RFEB 1KCLA 4J4PC 4HZAA 2J6EH 4LCWE 3UC0L 4F7CA 2J4WL 2ID5A 2VR4A 4HJJH 3VH8B 5AEAA 5DI8B 3IVKA 3GSRB 4HWEL 4APQA 4YXKH 4GG6A 4Q6YA 3FB8B 4P57A 1NGXB 4PRBA 4HWNA 1BIIA 2P24B 1X6NA 1JI1A 5I75B 1UM6L 3O3EB 2X89A 5CUSH 3WIFA 4ODBD 1ORSB 5CWSA 1QSFB 4Y7MA 1IAIL 4KJYA 1OTSC 3GKWL 1HI6A 3WE6B 4G6MH 1U95B 5KOMC 1M7DA 4P5TA 4X7EC 2VUYA 1VFBA 3PGDB 5J8OA 5E4IA 5GIRA 3KJ6L 3RX5A 3DIFB 4PIRF 5IMMA 1G9ML 3DI3B 4J23A 3RKDC 5EC1B 4JY5L 2VXVH 2BCKA 3GMOA 4NHUA 3DX8B 5F6HJ 5JZ7D 3PHOA 5IW1B 1DLHB 2FLRT 5T3XL 3MREB 1U42A 4PJGA 4LCUA 3RVUC 1T1WB 1XGPA 4X7CC 1GGTA 1EEYA 4J3UA 3CLFL 3MR9A 4L9LC 3FB5A 1UM5L 1TFHA 3HFMH 1FJ1A 5A2KH 4JPWH 4JLRB 4GXVL 3CZFB 4UQ3A 3VGAB 4QRPD 1KG0A 3CVHH 2OR9L 5DT1L 5F1OB 3NN8B 3L5HA 1ZWIB 3O8XC 4LARL 5I1CL 4PJCF 3M17A 4K3JL 1MHCB 1QFWH 5FGSA 3KPQB 2ZPKH 4B53A 4OZFB 4F7EA 5CGTA 5E8PA 1UB5B 5F89A 2IPKB 3U2SB 3ZL4H 3CSYA 1NDMA 4HCRA 5AUMB 5TF1L 5E2TH 4G6AD 1U8IB 5D6DA 2HFFB 1MCRA 1OF2A 5EU7E 1I7UB 2CO7B 2BHUA 3K1KC 3RVVC 1MJ8L 3KNBB 3TLRA 5DHXB 4OTXH 2W07A 1NUGA 1I9JL 3EJZC 2XWBA 5HDQH 3GSNA 2WWMC 3TYFB 2IJ0C 4XAKE 4U1LB 2Y4SA 4AQ1B 3BXNA 5KSUA 5MI0C 2KZ1B 5KOVC 3UBXG 5FA3A 4QRUA 2FATH 3QZWG 1UVQA 2G2RB 1LO3H 1WAAF 2DI7A 4BFIB 4X6DB 3RQ3A 3FTGA 2HT2C 3LQMA 1CFQA 2FL5A 1K3ZA 5F7HA 4PJ8D 2AJXH 3HE6A 3NIDE 1TQCB 1WCQA 3B43A 3HR5A 4RWYH 1F4HA 4K94H 4JFFA 5JXAL 3WUZA 4YUEH 3G5YA 2IWGA 4X6DF 4MQ7B 1CFNA 1ZV5A 2PCPA 3JWNC 4G6FD 5DJ6A 1P4BH 4KWUA 4PRPD 4DK6A 1DANT 3AB0B 3DGGA 3PGCA 1EO8H 1QBAA 5GRVK 4X6EA 2GY7B 1R5VB 4KKBC 5EU5B 1G7QB 4M62H 4Z7QE 3C08H 1KCVL 5EPMA 2DI8A 1YJDC 2DI9A 4IRJA 1VKXA 3Q0HA 3ULSB 1UWEL 2DB8A 1KPUA 2C4FT 5HDBF 4GW4B 2EYTA 2YPVL 3L3GB 3VXRE 4JM2A 1LEGA 1ZSDB 3FFDB 3FT2A 5C0CA 5DD3L 3QXTA 4GW1B 5J1TC 5H37G 4JFXA 4GKNA 3WEXB 3MLRL 3RWEA 3F6LA 2FEEL 1CXLA 3QXAA 4ACPA 4MA1C 4JFDA 1A0QH 1ZKAA 2BVOB 3GRWL 1T83A 3IFOB 1XFPA 4Y2OA 1EUTA 1RI8A 4H26A 1T7XA 5HI4D 1BOGA 2HTKD 5E5MA 2P4AB 1EAPB 2M2DA 2CLZB 4UQ2B 1QRND 1WICA 1JV5B 4UT9H 2HG5B 4G9FE 4PJDF 4S11A 2E7BA 3SDXA 1AO7E 3OF6A 5TDPB 2QQLH 1U58B 3AS3A 4XVJH 1NC2D 5CJQL 4K7PY 5ICYB 4LF3B 3MYZA 2QADC 4AEHL 5IT2L 5IP4A 3V52L 5DF0A 2VLKA 4H8WH 1KLUA 2IG2H 3SGDH 4N1CA 5A16A 4WEBH 3GJFH 4Q74A 5CJXA 1QR4A 2X4PA 1HKLH 2ESVE 2DRUA 5D6CB 5A3IC 4K2UL 2JCCA 3ZKMD 2ITCA 5FHAL 3VWKB 1JPTH 1R0AL 4Z77A 5F3BA 1Q0YH 4R2GB 2HFGL 3SDAA 5TQ0H 1FORH 2RQ8A 4TVPL 1FFQA 4HIIA 2F58L 3BWAB 1F11B 2L7JA 2Z8VC 2P43B 3MV7B 1JF5A 3ARFC 4PGCA 4KUZL 1KTLB 2BSRA 3BZ4A 1I1YB 4OCXL 2APWA 1QHPA 4XPTL 3U30C 3GJEA 1MLCB 3TVMB 1E4WL 3ARYA 3GFUA 3MRGA 1W0WA 4OZHB 1KJMA 1MCWW 4GW5A 3AM8C 1BIHA 5ACLA 3B83A 4GBXC 4NUJB 2W1NA 2LVEA 2NX5D 3PXHA 2YD5A 4KKCC 5T33L 2DD8L 5BO1H 3VRLE 1RURH 3PWPA 1P7KB 4NNPH 3C6LA 4NFDA 4OZHF 5DO2C 1HDMB 1N0XL 3ZTNH 4LIQL 4PJEA 5JR1L 1C16A 1JF6A 3BZFB 3MGTA 2IBZX 5ITBL 5GZNC 4B7LA 1YC7A 2FX9H 2BSSA 3HG1D 5KZCB 5EO1A 4QT5A 4MWFB 1ZHNB 3C5ZB 2GAZB 2VE6B 3HRZA 1X5AA 1EJOL 2VLRD 2A6JA 3QUYB 4UTAH 3GKZA 4X5XB 4M8QA 2Q3ZA 3KYNB 1NGPH 4UV4L 1KPVB 4ODTL 1O5DT 3C60D 1K4DA 2D7TL 1KB5B 5C0AA 4HQQL 4NBXB 2AEPL 2XV6B 1N3NA 3GMRA 3V5DA 2R69L 5F93C 3DXAB 3QDMA 2DL9A 2CIIB 4WV1B 3L9RA 4LVNC 5BV7L 3MRHB 1RJYA 5D70L 4EDWL 1OCWL 2CQVA 3BPCB 4Z7WF 4JQXC 1H3XA 4HHAB 3BZDA 4L8CB 3UMTA 1FNGB 1U8LA 1CR9H 4JQIH 1YDPA 3C09B 4K71B 3L5IA 4Q97A 5LQBL 4V1DA 1NBVH 5ID1A 3ARBB 1XGTB 1UA6L 4OGYL 1BZ9A 4FQXC 1AXTH 1B0GB 1U3HB 4RDQG 3LQZB 3L3IB 4P2CG 5CJOL 3BYTA 1UYWH 2O93L 4JFPA 4BZ1L 2ZUVA 4L4VE 1AC0A 3TNNB 2NY1B 4AEIH 3O6MH 2CK0H 5CD3B 1FFNB 4H25B 1A2YB 4R26L 3MOBH 2BY2A 1YMME 5DURD 3DO7A 3X11B 3CVIL 4LFHG 5EO9B 3OXSB 2W0KA 3VXPB 2F8VA 2C9AA 1EIBA 4QXUL 2ICWJ 5LCVL 2EIZA 3TBVB 5I15L 1EEZA 3KPTA 4LSQL 1L4IA 3CX5J 3RJDA 3VXUB 5K9QG 2P5WE 2W59A 2FRGP 3FO1B 5J9PA 1OP5H 4CKVX 3P9WB 3QJFB 4Z8FL 1LP9B 4O51B 1F90L 5GS2H 4NSKA 3LKPA 4R7DA 2CMRL 2VUOA 4BQCA 2BVYA 5DHVB 5CP3A 3T3PE 1QZ1A 4KY1L 5BMFL 1XCTB 2HLFC 4R4FH 2V7HA 1P4IL 2VDPL 3GMPB 1JYWA 1BBDL 1RK1A 1VGKB 3FB7B 1NBZA 2D9CA 3CDGB 4JY4B 1C1EH 3UTTD 3H3BC 4S0SD 2D0FA 3V6ZA 4KJQC 3CNKA 5I16A 1MI5E 3VMOA 2AJZA 2FO4B 3EDFA 1W0VB 4Q0XL 4M6NL 1J8HA 3VFGH 4ETQA 4ZOEA 3MRQB 2J7LA 3D39E 1JZ5A 2UYLA 1KSRA 1T2XA 4X4XA 3L3JA 5TFSH 1YEDB 5LBSH 3AGVA 5K9JH 5D72H 2D7OA 3WLWC 1N6VA 2EXYD 2Q8BL 1KT2A 1FG2B 2VXTL 2YK1H 3H0TA 1CT8B 4NQVA 4XPFH 5IVZA 3O11B 2W60B 3S5LG 3H3PL 2J88H 5L0QB 4RQQA 3P0GB 1A4KA 1YY9C 4BQ8A 3OKNA 4NN5C 4F7CB 3A6BH 1U6AL 1YN7B 4FFYL 2EDBA 3T0EC 5EU6E 1MRCH 1XMWA 2H26A 3C87A 3S37L 1J1XL 4GG6B 4JO4L 4P57B 3WN5A 4DOHB 4QTHA 2A38A 5L8KB 3HCVA 4D9RE 4Z7OE 3WIFB 1DR9A 5CWSB 4RMQA 4JB9H 4UNUA 3VG0H 1HI6B 4MJ6A 1M7DB 4I0PB 4MA8H 5JHLL 4P5TB 4MNGA 1VFBB 3FO0L 2NXZD 5ISZA 1NMAH 3FT4B 5GIRB 3RGVA 2NY0B 2YZ8A 4IMKA 3P0YL 3ISWA 3JWOL 1OD9A 2BVPB 1S9VA 3UBXA 3CH8A 4J3TA 4FQ2L 4Y4HA 3G6JA 1I8IA 3QZWA 4NHUB 4OV6F 4KI5C 3QCUH 3PHOB 4M7LH 1CL7H 2XQBH 4U6YA 4IIQA 5C09E 4U6VH 5I74C 3MUHL 4PJGB 2ICWB 2AEIT 1PG7W 1R3HA 2E6JA 4JHAL 4LCUB 3SJVD 3UDWC 3U9UA 1XGPB 3UX9B 1EEYB 2Z31A 4DKFL 1UWGH 3MR9B 3QT2A 3FB5B 3HC4L 5HYJE 3ZKNC 5KVGL 1S78C 2WLZA 2QQKL 2FHFA 5D2NC 2VC2H 1A47A 5SWQA 4F9LA 4WCYL 4U1KA 4C58B 4XXCA 2Q76B 1KG0B 4G43B 3DVGA 4JN2B 3MLVL 4LP5A 1GGUA 3TFKD 3O4LB 3DRQB 3M17B 2Z92B 1S5HA 2YXFA 3QDGA 3UZVB 3VWJA 1BFTA 3RWIB 4AH2A 2E9JA 4PV9B 2YMXL 4F7EB 3QCTL 5F89B 1XGYL 4ZFZA 3SDDB 1JHTB 4FA8A 3BD5A 3MJ9H 3I85A 5BZWB 4HCRH 4XI5D 3VE0B 4P2YA 3WKNA 3IDYB 1WBZA 1LEIB 1E4KA 3P9LA 3WIHA 1JYVA 2HKFH 1P9MA 3VI3F 3BW9A 1UWXK 5A2JH 2BNRA 1KN4H 5KSUB 1BQHG 4N90E 2YA1A 1NH6A 4Y2DD 2VRAA 4XNZC 3ZZ1A 2WBWB 3Q2CA 2BHYA 4ZDHA 3LB6D 1PGRB 1UVQB 2WV3A 3S4SB 3QNYA 3MRKA 5C0NC 3OSKA 3QIWA 3FTGB 1CFQB 2VR9A 1CBVL 4KJWD 3OKDB 1PJ9A 2DLIA 2EIEA 4A2MA 3HE6B 3KWWA 2VLLB 3HR5B 2JB5L 5BOZG 4JFFB 4ZS6D 5DGQA 1KXVC 1MFBH 5KS9E 1KLFA 1KIPA 3VXTB 3TA3D 1CFNB 1LILA 1TZHA 2YWZA 1NGWB 4JM4H 5DJ6B 4C57C 4FRWA 1Q8MA 1PEZA 5GGTA 3O2VL 4B7IA 3SHSA 1A6AA 5SX5K 1P84K 3BMVA 4X6EB 4Y5YC 5ESQA 5D9SA 4OFYD 1JZ2A 1OWWA 2GK2A 3N9GH 3SCMD 2FO1A 3CFEA 1VKXB 4DAGL 1JWUB 1KPUB 4PJXA 1GC1H 2EYTB 4JM2B 3V7MA 4X6CE 4UTBH 4XHJD 1JBJA 1J0YA 2C1PB 5CJBA 4HW6A 3ULVE 4ZPTA 3V4PH 3S3SA 4OLXH 2DQCL 1BEYH 1N8ZB 4POUB 4PJ5A 3RWEB 1RFDH 5C0EA 3QXAB 5EORH 2DAVA 2YSSB 3SDYL 5CINL 4JFDB 1Z9OA 4Q2ZB 2HA1A 2H2PD 1E4XH 2OJEB 2HLAA 4BFGA 2AXGA 1DQML 4OGZA 3VXMD 5DFTA 2FHBA 4K3DL 3ULUL 3LEYH 3CK0H 3BGFC 3KXFA 2NY7H 3D48R 1NC4D 5EZIH 2R4SL 3DURA 2ZCHH 4MQXC 1R3KA 3SDXB 5GS0L 3OAZK 4JDTH 1RZIB 4R0LA 5E5UB 4NNXA 4LSTH 1TTGA 4ZFOA 4YJZL 1MOEA 1Y6MR 1JRHL 4PTUB 4NQED 2RR3A 1T0PB 3J8F7 3G6AB 3D3VE 1WV7T 4LVHC 5IMLB 2A0LC 1YEEL 1HQ4A 1GH7A 3D85A 3CSBA 3G5ZB 2NW2A 5FB8A 2I24N 4EDXA 2X4PB 3H8NA 3UPRB 1PSKH 2ITCB 4NQDD 1LO4H 3QG6B 4Z77B 1NAMH 4DZBB 2NZIA 5F3BB 4MQTB 5DFVD 1GPOL 1WWBX 3WKMH 1U41A 3GBMH 4HUUA 1D9KC 32C2A 3WXVH 2EDKA 3MV9E 4PGCB 1BMGA 1TQBB 1IGFL 1QFWM 1NGQH 2X5PA 1U36A 5MHSE 5FM5O 3RL1B 1I7ZA 5F9WC 1MWAL 4LHUB 3GJEB 5I30H 1ODAA 2VDNL 2NR6D 3VGFA 3MRGB 1LO5B 1NLDL 1V3LA 3NMEA 4YBQC 1LQSR 5F3HB 5I1DB 4IHOA 4OT1L 5C0GA 1TPXB 1CK0L 4ODUA 4OIBA 2AABL 4NQDE 3T1WA 4OUUB 3WFBL 4JZJA 5IF0B 3QWRD 2Z0BA 4NKMA 5BJTA 3REVB 4Z0XA 2DYPB 5FHBH 1T6VN 4PJEB 1QSFD 3O6LH 4Z7UE 3MGTB 4JFHE 4POZC 2QEJA 3BSZL 3DWTA 4NCC1 4GH7B 4CN1A 4H0HB 4HS8L 1MIEH 4Y88A 3EO1B 1OGTA 4X4ME 5EO1B 4I5BA 3RWFA 2JJUA 2YPLD 4PB0L 4UUJB 4G6AC 2OTWB 4X9IA 4KUCF 2A6JB 3TJEL 4MA3A 1WEJH 4M8QB 4X6BA 3S9DB 1BP3B 2UZIL 4N0UA 3ROLA 1HH9B 3Q3GA 1K4DB 2CKNA 2ERJC 3K3QA 4JY6A 2V2WA 5EWIL 3SQOH 4HULB 1FV1A 5BRZD 1IT9L 5C0AB 4P2OC 4AJ0A 5IFHL 1RJZB 1N3NB 2VZ1A 3C5JA 3GMRB 3V5DB 2XZZA 1RIHH 3KPLB 4WHCA 4OIIH 5I8KH 3UP1A 3EOAA 4Y5VA 4PJ8C 4RNRA 5E6ZA 1D5IH 4LHJB 4PGBA 1AH1A 1JI2A 3OR7B 2A77H 1BVLA 4XNUL 1JGLL 1U8LB 4O58L 1W72H 1J7VR 1FL3A 1UZ8A 2C4XA 4OB5H 1OP3K 3NBNA 4NQCB 1ZLWH 5M95B 4ZSOE 1T1ZB 4U2ZA 3BEVA 3QJHB 4HSQA 5C6PB 1NCWH 3SEPA 1SVCP 1J9CT 3BJLA 2V5SA 1YQVH 1FDLH 5IBLC 1FGNL 2CKBL 4JG0L 4JRYB 1DUYA 2ZCLH 1QQDB 3UZEA 4N5UA 1QBML 1MH5A 2YN3A 4OAWA 4P2RE 1MREH 3PF2A 4GKZA 1AY1H 5MEOA 2Y23A 1WLHA 4Z7VA 4FZ8L 3MLZH 5GGRA 1UCBH 2EIZB 1VSCA 3NZ8B 1MF2L 5IOPA 1EEZB 2OM5A 3S35L 2NY3D 1G9MC 25C8L 2VAAA 1VPOH 3LZFH 2AK4A 1DE4A 1N5YL 3HI6H 2B1AH 3I3BA 3QUXB 3V6FA 2DBLL 2X4UB 4H88L 1FO0L 1F97A 1LDPH 4KQ4L 4Y5XB 1H0DA 5DC4B 1UENA 5CP3H 4PRAA 2A83A 2FWOA 1NBZB 1PLGH 5FYLL 1T7YA 3CMGA 1RZGA 5HYSB 1CDUA 2H8PB 3W5NA 3VMPA 2P5EE 4HH9A 4X7SL 1FNSH 4XBEL 4DVBA 4EN3A 5I16B 4YX2H 1VADA 4N9GA 3NA9L 4MNHA 4ETQB 2AEWA 4P46C 5IVXB 4X4XB 3L3JB 4A6YL 4YE4H 2N56A 3N85H 4DGYL 3QPXH 4WUKH 3H0TB 4NQVB 3H9SA 1XR9A 1BQLH 5C70A 3KPRE 5I0ZA 4K7FA 3OKNB 5IVXF 2AAVA 1AJ7L 3V6OA 1R5IA 1QFUL 2D7QA 5CCKL 4RGNC 1NQBA 4WO4D 1QFOA 5IIEB 3WN5B 4U1HA 4QTHB 4ENED 1J12A 1ZLSH 3OKYA 2B5IC 3HCVB 4RGMC 2KL6A 3ES6B 2XZAH 4RZCA 3WIIH 2OP4H 3LY6A 3S34H 3BUYB 4MJ6B 4QTIH 5DMKA 1CS6A 5A2FA 3H2WA 5ISZB 1OGAA 4M93C 4EI5C 4JO2L 4U05A 2BOBB 3TN0A 5FGRA 1MCCA 3DBXB 2GEEA 2JK5A 3WFZA 3QZWB 4R2GD 4HUXB 4X80L 3VFPA 3OJMB 4U6YB 3FN9A 4IIQB 5HHVL 4PJFE 3MV7D 2RCSH 3MRMA 3STBA 5MP6H 1R3HB 1QKZH 4DTGL 5IJKC 1QPPA 4WU5A 3TVMD 2H2SD 1N4XH 5C0FA 1MY5A 1KJ2L 1TJIL 4I2XB 1RZFH 4JR9H 2WANA 2XRAL 3DVGB 3ZKXC 3NACL 1D3CA 5EZLA 2XI9A 5JXED 4MJ2A 3RZWA 3UO1L 1S5HB 1OW0A 3F6IA 3QDGB 1SY6L 1Z3GL 5FYKD 3VWJB 1CDHA 5JUEL 2ZKHH 4JHWL 1LK3L 1GL4B 1A7NL 1ZVSA 5IHBA 4F58H 4G7VL 1UWXH 4JO1L 3VG9C 4KXZH 4Z95H 1CN4A 4U1NB 3KYKL 4XWOD 4C56A 3MYJB 4Y4FD 5KZCD 1WBZB 2XA3A 2BNQA 4X9FA 3BW9B 2BFVL 2GJ6A 4KZDH 3KPOB 4CW1B 3STLB 4P5KA 4XTRD 4WGVB 3R1GL 1A6VL 4RX4A 5T1DH 3AS1A 2ZSVA 1GCFA 3DVFA 3B8SA 3DTXA 3QUYD 4RSVA 5C2BH 2PYEE 3QNYB 4K7PX 4M7KH 2Y6SC 2NXYC 4LHQB 4TUKH 4XP4H 1KIQB 1NMCC 4HC1L 4LLUA 4XNXH 1QG3A 2WUBL 1B4RA 1RMFH 1YYLH 2V5RA 1ONQA 4YHZL 5FYJH 1IGJB 4NJ9H 2F5AL 2IH3B 2VSDA 1KENH 3OXRA 5SX5H 3VFUA 1CICC 4HIEA 4WFHD 4G8GB 3E8UL 1H5BB 2XXCB 3PGFL 3UJIL 1TZHB 2AJ3B 3PWUB 5F1NB 4U0RC 1YEKH 2CXKA 4WU7A 1G6RL 3N06B 5E2VL 3FONA 4Z76B 6FABL 3O41B 3MLUH 2DQIH 5MENA 4PRDB 3AAZB 5D7LE 5ELIA 5ESQB 3ARBD 5JHDA 2NZ9C 1DEDA 1WFTA 4NN6C 4U6HA 4R8WH 1HN1A 3T0WA 4PJXB 4NN7B 1UJ3C 3VD3A 3STZA 4OI9A 5J57B 3S88L 5EOTB 3X12A 5CILH 2NY1D 4TPRH 1QO3B 4MAUH 4ZPTB 2BRRH 3WJLA 3MUY1 5GRUL 1ZA6A 4ZAKC 4ZNCD 3DXAE 3IU3A 5A40E 1EA9C 3VXSA 4Q7DA 2V7NA 4L3EA 2HLAB 2Y06H 2AXGB 5EFIB 2V5TA 3OAZH 1IM3A 5E9DE 1FZOA 4Q9RL 4W4OA 3I6KB 4MMXC 4LCIL 4I48A 3QQ4A 1GOFA 1EMTH 3IFPB 3R8BB 4NQUA 4LBEA 3DURB 1YNLL 3VXUD 3O0RH 4EI6A 4N0YH 4R0LB 4NNXB 2X9YA 3KLDA 1G9NL 1LWRA 5BS0A 4GQ9L 1MRDH 5L88H 2RFXB 1I9RH 3CH1A 2V9TA 1EDQA 2EXYC 1TTUA 4Y16C 1RZJC 4X7TA 1UM4L 1D5ZA 2DQDL 3F5WA 4KC3B 3ZSSA 2SEBA 5FB8B 3EJJX 3O3DB 4IJ3B 3GMNA 1QR1A 3UC0H 3NCEB 3AC0A 1KXTB 4PS4L 4HWEH 1A1MA 5DTFA 3QR2A 2EDEA 3QUKA 1WBYA 1MHPL 2EDYA 3QEUB 5JIIA 4PRNA 4OZIF 2FDBP 1FNEB 5C0JB 3QNZA 4HUUB 32C2B 5BV7C 4H1LH 5C08E 4XC3L 3VGEA 1LP9E 4H5SA 1EHNA 1GYAA 5F1SA 4ODVL 2HJLA 3FO9A 1NAKL 4UAOC 1A9BA 2R1XA 4XNQA 1DFBL 2X10A 1RPQA 4HS6B 4BKLA 5F6HI 1JGEB 4ONFL 4WFGE 3CFKB 4NO3B 5T3XH 4OF8A 5C0GB 4ODUB 1ETZA 4WENB 5FDWB 4JZJB 3QI9C 5E6IA 1UM5H 4NKMB 4LL9A 2ARJQ 4Z0XB 4YAQA 4KRNA 1D5XA 3LRGA 2OR8A 3PHSA 1ZTXL 5E03A 4GXVH 4PP2A 3VFOA 1GHFH 3D1MC 1U2CA 4I0PD 3EFDL 4P5TD 5DT1H 3QEHB 5DDHA 1PZ5B 2NY0D 3GIVB 3RVWC 3CX2A 4K3JH 3D9AL 4L8BA 3LPGA 4M6AA 4MQSB 5EBMA 5KBNC 4I5BB 4OD3L 3RWFB 1QOKA 4Q9BA 1BD2A 5D2LA 5TF1H 3MRRA 4MA3B 1IZKA 4E41A 1S5IL 5ABDE 3K80A 2LFGA 4GG6E 4N9OB 4P5MB 3RRQA 1MJ8H 3HTLX 4N0UB 3GGWA 3K7UA 3LKOA 5DA4A 5F8RC 43C9A 5FEBA 4MZ2A 5D7IF 4DVRL 3GNML 2QQQA 2PN5A 5CGYD 3EJYD 1FBIH 4FTVA 2LU7A 5AZEL 1PYWA 1TJHL 3EOBA 5IVOA 1YUHA 4ZUSA 3VFVA 4U3CA 4IBLT 3DSNA 3O4LD 1MEXL 3C5JB 5IESL 3PNWA 2ADIA 2F15A 1OP3H 2R0KL 4G8EA 1XCQA 2DQEH 4Y5VB 4FZEL 3PWLB 4LRIC 3SDDD 3CFDA 1BVLB 4PJGE 2R0LL 3V7AE 3OJ2C 1H9VA 4NKDB 4C83A 1FL3B 1UZ8B 3IYLW 1N59A 5JXAH 5CEXB 5J13C 2OI9B 4LEOB 3PWNA 3HZVA 3ZHLA 1UXWA 3TA3C 3PL6A 3SOBL 4O5LL 3BEVB 3QDJB 3V95A 1TVHA 4XVTL 2VTFA 3L3OA 4KHXH 3UYRL 3PDGA 4WI3A 1UB6A 3ZYJA 2CDGA 3NIFE 4PRHD 1N5AA 5IJVB 3TWCH 3UAJC 4GKZB 4OKVB 1WFNA 3HAEG 5MEOB 1L0XA 1UWEH 3S5LB 5B8CA 2Y36L 4QWWD 2YPVH 4JFFD 1YY8A 5DD3H 4X98B 4DFIA 5I6XB 3K4AA 4KROB 2VAAB 1I85A 2AK4B 1DE4B 1HIML 2IAMA 2IH1A 2XICA 4Z78A 4ZUWB 2Y7QA 3GRWH 3EYSL 4X8JA 5DMIH 2FJFB 3GBNL 3QPQD 3JBG7 5JLZB 1YPZA 1WZ1H 5K59F 1CG9A 1H0DB 2JKXA 3O6FB 4PRAB 4HIHB 2A83B 3MLYH 2FWOB 1HWHB 1YECL 4AEEA 1U8PA 3G5VB 1KTDB 3KDMB 1RZGB 3OWEA 4XCFH 1KYOK 1V05A 5CJQH 4HH9B 4M5YL 1IGTA 5DJ0A 1T1YA 1U3ZA 4MXQD 5IT2H 4JGMA 1VADB 4RFNB 2NW3A 3U6RB 4N9GB 1J1OL 3V52H 2ICCA 3FAXA 3L1OH 2VZ3A 2QSCL 1HYSD 4WUUD 3ZDYF 4NT6B 4KHTL 3ALPA 3QXUA 4LRNL 2ADGB 3ARVA 1DBAH 4K2UH 5GRZA 3Q6FA 2C26A 4RAVB 5FO9A 5FHAH 2H45A 1R0AH 4GRMA 1XR9B 4P9ML 1T2QL 3GIZL 1DBML 1UH3A 1A3RL 2HFGH 1CGYA 4K7FB 4HPOL 4TVPH 2X4NA 2F58H 1WZLA 1R5IB 2WAHA 1FZMB 4P59L 4KUZH 5C0CE 1WK0A 3DYOA 2EYRA 4OCXH 2X1WL 4P2QD 5F7MC 2BJML 4PR5A 1AIFB 4F15B 4BQBA 3AFLA 4N5ED 5IHLB 4ORGB 2C7UB 4RZCB 4C54A 1T3FA 1E4WH 4JFDE 3CDFA 2Q86A 2FD6L 3MV8D 5EZJA 5CD5D 5DMKB 1IE5A 2XYCA 5DJCB 1OGAB 4DKDC 4LPYA 1CGXA 2Z91A 1G7JA 4FG6C 1BQHB 1HKFA 3TN0B 3CFCL 2DD8H 3CC5A 2DQJL 1V3KA 2V5MA 2GK0A 3SDXE 3IFLL 2FZ3A 2OSLA 1WIPA 2E6PA 4AMKH 1N0XH 1WIUA 2VLME 3DV4A 2HWZH 3BPOC 5DUPL 3NCBB 4WU5B 1T5XA 4LHUD 1YQ2A 2VLKE 5C0IB 1X5YA 2XKUA 4KGJA 1AI1L 4UOW0 4F37F 2AVGA 2BC4A 3L6FB 5I8OL 5JMRA 1EJOH 1VFOA 2HH0H 4YHIB 4GMSL 2JCCE 3ILPA 3DMMA 1A21A 1CGTA 2X9XA 4MS8C 2B1HL 3M8OL 3JVGC 2R0WL 3A67L 1IC7L 1HSBA 5I18H 4UV4H 4ODTH 2DYPD 1AXIB 2YBRA 1EGJL 4I1NB 1SEQH 4JKLA 3IB4A 3SGJA 4KUCD 3N1FC 4C56B 4HQQH 2AEPH 1L0YA 3I6GA 3ULUC 2BNQB 3C8HA 1IBGL 2GJ6B 4L9LB 5D7KE 5DVMA 4ZYKB 5BV7H 3B3IB 3D25B 4EDWH 1EO7A 3L3KA 5T5FL 2BMKA 2N1KA 1HHJA 3ARDC 4XP1L 4G5ZL 4YDKL 1S9KC 5LQBH 3AU1B 1EK3A 1KOAA 4HFUL 5JMOC 3O8XB 2I25N 3PWPE 2P47B 4OGYH 2CSPA 4XNYL 1I7TA 3LKRA 1JL8A 5CJOH 4PJEE 4KH2A 4LLUB 1CU4L 1W0YT 1GRWA 1I4FB 5EN2B 3TYGL 4U1IA 4BZ1H 1RY7B 2X42A 3PHQB 1LK2A 3DX9B 3OXRB 1IAMA 4LLVB 3SKNA 3AMKA 4R26H 3H7LA 3QEQA 2HFTA 3IDIA 2F5BL 4GXUN 3L7EA 3CVIH 3WNOA 4WU7B 4CL7A 4PBVC 3FONB 1BFOB 2DKUA 3KLHC 4QXUH 2AQ1A 4QOKD 3KS0H 5MENB 2ICWI 5MI0B 5AZ2L 4NQCD 5JHDB 4GAJH 1KTKE 2B2XL 2IQ9L 4KGLA 4UI2A 5I19L 1AD0A 1BFVL 3SDCC 1EHLL 3QQ9C 3PIQA 2YXMA 3STZB 5C0AE 3IXAA 4Z8FH 2XTJC 3VU2A 1F90H 4JRYD 3DUSA 3X12B 3QA3A 2CMRH 4PJ9D 4R3SB 2JJTC 1ZA6B 1VACA 3IU3B 5F1IB 4FFZL 4KY1H 5BMFH 3QDME 3ULVL 1P4IH 2EDJA 2VDPH 3QNXB 5DRNA 1BBDH 5LWYL 1IM3B 1FZOB 4OCMC 1L0QA 4V1DE 2YA2A 4JO3L 3JV0A 4AM0A 3BGMA 1HCVA 1S7SA 4Q0XH 5C0DB 1MFDL 1CFSA 3EFFA 4M6NH 1K4CA 4EUPG 2PW1A 1HOCB 1H15A 1Q94A 3QUXD 3HI1A 4NKQB 3CH1B 5HGBB 1CGSL 3KPMA 4X7TB 1D5ZB 1YZZA 5JPMA 5LGKA 5IMOA 2Z8RA 4ZPVA 2VXTH 5ILTH 1F6LL 3CJJA 4JFYA 2B4CL 3DPBA 4UILL 1I7RA 2PW2A 5HGAA 3GMNB 1N2RA 1FPTL 2MKLC 4MA1B 3GSWA 1U6AH 1CLYL 4FFYH 1KGCE 3TC9A 5ICZA 3EDKA 3EYFA 4WY7H 4ENEC 5DJ2A 3S37H 1CDYA 1J1XH 3QUKB 3TNMA 1REIA 1WBYB 4CVZA 4JO4H 1XGQB 5MERA 4ONGL 3O9WC 3OL2A 2AV1B 5BXFB 4W70A 4WIQA 4PRIB 1JHKL 3QUML 3RUGA 3S96A 4DK3A 4HKZA 1KJVB 1UZ6E 3CMOL 1AQDA 4MJIA 5JHLH 1TENA 4WWKD 3HMXL 1FSKC 2CUIA 5GGVH 2HJLB 5F97E 3P0YH 1A9BB 5GISL 3QIUA 3JWOH 2R1XB 5TE6L 3BMWA 1ZS8A 2QADB 4IOFD 1B6UA 4BKLB 4PGEA 4PJIA 5T3ZH 1D5BA 3FCTA 4KRMB 4QNPF 4IM8A 3VFNA 4QGTA 1GGCL 4JHAH 3LKQB 3WS3B 3MRPB 4HFWB 4CNIA 4QF1A 4ELKA 1MY7A 2H2SC 3VFRB 1XGRA 1D5XB 3ARQA 3NFNA 5FUZL 1J8HE 3K8MA 2BXZA 3MCLL 3VFOB 4UDTA 4WCYH 4JKPL 5M7QA 4ODXB 1AD9B 5HVFB 3MLVH 1YMHA 5SX4H 3EGSA 4P4KC 2AXJA 4ONHA 4KMQA 3U46B 5F7UA 5GSVA 2CRYA 2BNUA 1B0WA 4XPAL 1XIWC 3U30B 3W81A 3JV5A 5LG1A 5JA8B 1DLFH 4M7LT 3TIEB 3QCTH 1KJ3L 4PP1D 1BD2B 3ARGC 5D1XD 1SHMA 5D2LB 3HAEA 4E41B 1L9MA 1K8IB 3BIAX 1G1YA 4GBXB 5J11B 2WBKA 3LQAL 3GMMA 1FGVL 1MHEB 43C9B 1T66C 1GVIA 3O6KL 4HF5L 5CUSL 4PJHA 4FTVB 3SO5A 3S8WA 1CDIA 1G7MB 2ZSWA 4MNGE 5DRWA 1YUHB 4QRPA 4ZUSB 5ISZE 2GQHA 4X9HA 4IMLA 3V5KA 4OV5B 3MUGA 3FO2A 4KDTC 3QDGD 1T89A 2ADIB 4M61A 3SBWA 4G8EB 5IFAL 2H6PA 3G6JE 1CLZL 1XF4A 2V2TA 2XIDA 3UJJL 5JIHA 1BAFH 4MNQD 5ESAB 4JG1L 3CFDB 1CBVH 3JV6B 1F6AA 4KTDH 2A73A 3U36B 2FJHA 4XGZB 4C83B 1DVFC 3FRUB 1ES0A 1FL5B 4MXVF 1TITA 5IEHA 5JPNA 3PL6B 3CPLA 4MJ4A 3HFML 3RY6C 4U49A 5GRJL 3GB7A 2E7CA 4JPWL 1TVHB 5B38G 2EICA 5DK3A 3L3OB 2BSED 4R7NA 1UB6B 4NJAH 1AGFB 1NFDA 5D1ZC 3IU4L 4GUPA 5FYKU 4GAGL 3E2HB 3GUTB 4DAGH 4YQXL 1QBLL 1QLRB 3OPZL 4PLKC 4HK0A 4QKXB 1IGCL 4LVNB 4PJ8A 5E2TL 2CH8A 4B41A 1ZGLB 3H9HA 3THMH 4NKOA 5HHXL 3WNPA 1RZ8A 3NCJL 4QY8B 4EOWL 3DYPA 4G8GD 2I9TA 35C8H 3QHFH 5EU4A 2BNRE 3SDYH 1RVFL 1A3LL 4N1HB 5HD8C 4YR6A 4J7RA 1DQMH 3CX5K 3RPIA 4PRPA 3QRGL 1HH6A 2VZTA 3FJTA 4K3DH 4FABL 5JDSB 1RD6A 4CVUA 4IRSC 1WT5A 1CG9B 2R4SH 1NAMB 2B0SL 3WFCL 2H32H 5GS0H 1F00I 4X99A 2OXHA 4ZG1A 2VDLH 1I9EA 1CD9B 1UH4A 3K8KA 1JRHH 2AJXL 3F7RA 1A5FL 1ZHBA 2XWTA 1CDGA 1PY4A 4YUEL 5KG9A 1I3RB 3QDAA 1IAOB 2AJYL 5DJ0B 3BPNC 1T1YB 1X5GA 1VCAA 3VFTA 1YEEH 1K5NB 2VISA 4FQPA 2JCCF 1I1AC 3SE4C 1RUKL 3TPKA 1IEBA 1P4BL 1QSZA 1X6LA 2W9EL 1P5VA 4M1DL 1XF1A 1T20B 4DJMA 1LO2L 1KEMH 3F7VB 4JREC 4UDUB 3ESVF 1GPOH 1QRNA 1CFTA 3C08L 4OFVA 5EU7C 2X4NB 1P69B 3ILQD 4MB3A 4HJGB 4PJXE 4YWGH 1LNUA 4LSRL 3GSUA 4Z0BL 3K8LA 3WFEL 4I8DA 1IGFH 3C6SA 2ZNWA 4YHOL 1NC2A 3W0WB 4FQHB 2UY7A 1YEHH 2HMID 3JTTA 3TM6A 4QRTA 2BP3A 4PJ5E 4QO1A 3M45A 4P3CL 2VDNH 2Q86B 2R1YB 1NLDH 1AGEA 1A0QL 3BRGC 4YHNB 4CMHC 4ZMAT 2OQJA 5CIPA 2YD8A 1G7JB 1CK0H 2MTPA 2AABH 3KXFE 3RZCC 1U8OA 3WFBH 1LDSA 1BVKA 1F4YH 2BRQA 5E00A 1JNLL 4KV5F 5CZKA 2OSLB 4JAMA 4HBCL 5DFWH 5IQ9A 3PUCA 4O2CA 5I66A 4XVJL 2D0HA 1TVBA 3DV4B 1M71A 3BQUC 4BQ9A 3BSZH 3CCHB 3T0EB 1XF2B 4HS8H 1T5XB 1VFMA 2VLJB 3BISA 1JFQH 3HC3L 3G5XA 1NCDH 3VXQA 2IG2L 4PB0H 3FRPG 2OMBA 2BC4B 4HGWA 4LCYA 3TJEH 3HI5L 1DQQA 3IFNL 2VQTA 2NX5A 5D93C 3IDUA 3WDJA 4OCLC 1HXMB 4EJ1C 2I07A 4K7PH 3C8KA 1R3LA 5EWIH 1IJ9A 4YO0A 4FQ1L 1UCTA 1DQDH 5J3HD 5D1QC 5I74B 4W81A 3I6GB 5I1HL 5IJKA 3HG1A 3FZUD 1MFCL 3GI8H 3G9AB 2BOCB 4LOUD 3ORJA 1TCRA 3SO3C 2JE8A 4QGYA 1ZXQA 2H3NB 2F8OA 1M05A 3L3KB 5FF6A 1VDGA 5E94A 4KI5F 1CTOA 4HKXA 1G9NC 3VA6A 5DD6B 3B8YA 4XNUH 1JGLH 4BUHA 2VLRA 1RUPH 3BE1L 3CGTA 3IDNB 2OYPA 1TETL 2X44D 1CIDA 2KBGA 3C60A 4U1IB 3P77B 1T21A 4JFZL 4L9DA 5E1AB 3T04D 1FGNH 2CKBH 1DTUA 4EUPA 2EDFA 5HJ3A 4J3WA 4R4BB 2IQAB 4V2BA 3QEQB 5K9OB 1QBMH 2RHEA 2YRLA 3PV6B 2BVQA 3REWA 1C12B 1NL0H 5KSVA 3VH8G 1FC2D 4CN6A 4FZ8H 1H3VA 2E5EA 1NEZG 5DMGD 4M48L 4ODSL 1MFEH 4D9QD 1MPAL 2UWEA 1Q1JL 4U1MA 3S35H 4N0UE 1EEQA 25C8H 1U3JA 1AD0B 3QDJD 1NSNL 4LMQI 5CZXD 1U8HB 2J3SA 5H2BB 3IDJA 5DEZA 2KH2B 5KSAC 2DBLH 3INUL 4L29A 2OTUB 1KNOA 4H88H 1KB5L 3HPLA 1VACB 3MLTB 4KQ4H 5I71C 2Q6WA 1IZJA 4BA8A 1J1PH 1X5FA 5DRNB 3UTSB 1FVDA 5FYLH 1C5DA 3MRJB 3FQNB 4I3RL 2HN7B 4X7SH 4XBEH 1U93A 4PV8A 4Y5YB 1MCKA 4OZGB 1S7SB 2AK4D 4GKSA 1AXTL 5I1AB 3EFFB 5D7JC 4U1SA 3UTQB 1P84J 1K4CB 3WSQL 3NA9H 2PW1B 3I84A 1UYWL 4A6YH 4BFEA 3HI1B 4D8PB 1D5MB 5B3NA 1JTOA 3KPMB 5E95B 4AEIL 4TSCL 3WS6A 4ZPVB 1W2KT 3T77A 1P2CA 4ISVA 2DIJA 1VFAB 4KK6C 3W39B 4OZFG 3O3BA 4OZGF 1ZA3A 5EUOA 4PJAA 4ZAKA 1UXSA 2ZUUA 1P6FA 3O6FD 2PW2B 5HGAB 2XT1B 4Z7VE 1N2RB 4PJBB 1XF3B 5HI3D 3LN5A 1QFUH 3BPLB 5CCKH 3T3ME 3MBED 4KK5D 3TNMB 2V5YA 3UTTA 4QHLA 2M1KA 5MERB 4N0RA 1JPGA 4N5EC 3TGXA 2AK4E 3BGFB 4XVUD 3ARXA 4JDVB 3RUGB 2X4QA 4HKZB 4PJBF 3MACL 5DVLA 4JVPA 5LAXA 2VSCA 4MJIB 4LLAA 5E4EC 3GM0A 2BY3A 3EZJB 5IHZA 3UTOA 4OZ4A 4I18C 2GKIA 4S1DD 4LVHB 4L8DB 4PGEB 1HINL 4OFPA 1C7TA 3KYAA 3B5HA 3O2DL 5HHVH 1FNFA 3VFNB 5GSRB 1G7IB 4DTGH 2I5YH 4J1UB 3SQBA 2CIKB 2IFGA 4ELKB 1FZJB 4YHPA 1ED3B 3UTPD 1XGRB 2ZG3A 3I6LE 1RK0B 2NNAA 3VFMA 4UDTB 1IARB 1TJIH 1EXUB 4RMUA 5L6YH 4GRWB 2XRAH 1Y0LB 3NACH 1YMHB 1OGAD 1Q9OA 5FOBA 5B38A 4Y8AA 3OR6A 4BH8A 3OJDA 5GSVB 1IKNA 3UO1H 3OQ3B 4TVPE 1SY6H 3H9SE 5JUEH 2YWYA 5F71A 5IB4A 1EGJA 2HTLD 1T0MA 5F9WB 4BELD 4KAQL 4NWTH 4YDLC 4YDJB 4JHWH 4XZUB 1LK3H 5JW5A 2W0PA 1VEMA 1A7NH 1OT2A 5GGSB 1KUMA 5KVDL 4G7VH 4GRWF 3V6OE 4OQTL 4JO1H 3HAEB 4J4PD 3A6BL 4TULL 3B9KC 3KYKH 1L6ZA 3SJVA 1T0NB 2Z93A 3GMMB 2W91A 3WJJC 3K4DA 4I4WA 4PJ7B 2BFVH 1A7OH 1UGNA 3DARA 4PJHB 2ATKB 3ZDZE 2VH5L 4TNVK 3R1GH 1A6VH 5DRWB 4F7MA 4MA8L 1OGAE 4J6RH 1OTSD 3QB7C 2ICEA 4IMLB 4IOIA 3V5KB 1MLBB 1S9YA 1MRFH 1O7VA 3BP6B 3W2DL 3DETC 2H6PB 4PJ7F 3U7AA 4NOBA 3RKDD 3FHAA 3QCUL 2BY1A 4HDIB 4M7LL 2XFXA 1F6AB 5E7BA 2ARJB 4HC1H 1CL7L 2A73B 1HK6A 4XCEA 5T1MB 4U6VL 2WUBH 1KPRA 1JF1A 2ZOLA 2D4FA 2F5AH 1XAUA 3RVUD 5DJDA 4EVNB 5F96H 1K3IA 5JPNB 3CPLB 5SV3A 1PKQA 3I50L 3IS0X 3E8UH 5DEGB 3UJIH 3GB7B 1BGXL 3RWGB 2VC2L 2A6DA 3DROA 2J8UB 3NGBC 5EB9A 2ERJB 4U1GC 5E2VH 4RAHA 6FABH 1A14H 3MZGB 4Y2DA 3RWDB 4P2OB 2HJKB 4R4NC 3O8XD 1NJ9B 1OHQA 1ZK9A 2GSGA 4F7TA 2WUCL 5C7XL 4LCCC 4JHBA 3T0DA 2NTFA 5HBBA 3PP3K 4YC2C 3QAZB 4HK0B 3PWVA 1FG9C 4PJ8B 5L2JA 3MRFA 5H35A 1TTFA 3H9HB 5T1KB 4NKOB 4C56E 3S88H 3G9VA 2V9RA 4HCRL 2BNQE 3FOLA 1YC8A 2XPGA 2K1MA 4WHYG 1RZ8B 2GJ6E 4NWUL 2I9TB 3RVVD 5D5MA 5E56A 2DQUH 3TA3A 1Z0MA 4JFQA 4L3AA 4G6FB 3RPIB 2VOTA 3EJZD 4PG2A 4PRPB 2CLVB 2WWMD 2OR7A 3GSNL 4MAYC 2QLVB 5IM7B 5MEND 4GAYB 5JHDD 2MJWA 4OFYA 3VJ6B 1YNLH 3SCMA 1KV3A 2V2XA 2HT2D 4GRLC 1NANI 1G9NH 3FQXA 4GQ9H 4TNWK 4FQIL 5K9QI 2DLEA 1ZHBB 1MUJA 3SE3A 1MJJA 1MFBL 1UM4H 5LVEA 3TO4C 3TBYB 5GXBB 1G84A 2A6KA 3HS0B 5CEYA 2R2CA 3FT3A 1E27A 4F7PA 1KCSL 4QHUB 1IEBB 1MSPA 3BH8B 2IBZY 4WW2A 3DRTA 5DK0A 1I8KB 5F9OL 2BHZA 2CDFA 4M6OH 4LLQB 3MA7A 1F4XL 3FRPA 5HGDB 5I17B 4PGDA 3VXMA 4PS4H 5MENE 1BLNA 3JTSB 4UT7L 2JELL 8FABA 1LEKB 4CMMB 1MHPH 4OFIA 4XNMA 1QRNB 4KKBD 1CFTB 3MRBB 1NC4A 1OT1A 1ZAGA 3KLAB 5C1MB 2MWCA 1LNUB 4NM8L 4XC3H 3RL2A 5IFJA 4X5WB 2FJGB 3C6SB 1NC2B 4NQEA 2PYFA 4UTBL 5HDLA 2NLJB 3T2QA 4ZUTA 3JTTB 4F8QA 1YEIL 1KIRA 1NAKH 3FOMA 1RHHA 3EDJA 4NNYA 1S3KL 3VXSE 4KVNL 4CUCA 4L3EE 5D96C 2L0DA 4JFEB 2EKSB 5E8EB 1EPFA 5M94B 4NC1E 4ONFH 4P46B 4BZYA 3CSGA 1H8OA 1X5JA 5DMJB 4GLRI 1U8OB 4TN9A 1FFPA 4NP4L 5CIPH 3K81A 4HLJA 1OTTC 4PRID 4JAMB 4FXGA 3BIKB 4DZ8B 5IQ9B 3S36X 3MSPA 4XX1G 5BS0E 1JK8B 4RBPK 4G9DA 2LU4A 2Z8SA 4JN1L 3X3GH 2MPAL 1TVBB 3EFDH 1M71B 2Z35A 4RGNB 2P46B 3OHXB 4JCMA 3ROOA 5IKCA 3WFHA 4HWZA 1T7WA 4QYOA 3T4YA 4EIZC 2QADD 4OD3H 1J0HA 3VXQB 5IWLC 4LQ1A 2B5IB 4RGMB 2YD1A 3H7BA 3O4OC 4RFEA 1A3QA 4DQOL 4LCYB 5DC0A 3BP7B 3HUJE 4LLMB 1KACB 3VH8A 2NX5B 5A3ID 4M93B 3GSRA 4EI5B 1LO4L 1T1XA 1NEZA 3MNVB 3S7GA 2QL1A 2I07B 3FB8A 1NGXA 4ZUUA 3QWRA 3C8KB 5KANG 1R3LB 3ULVC 4DVRH 2P8MA 4TTGA 3CFIC 1ORSA 1QSFA 4OLYL 1TJHH 5IQ7H 1N6UA 1U95A 3ARFD 4UINL 3BT2L 1NGQL 1MEXH 3PGDA 2BZDA 3DIFA 3HG1B 5IESH 4ZO8A 2JJSC 5T3ZE 2R0KH 1TCRB 1KN2H 4FZEH 5IB5B 3BP4A 3PDOA 5E94B 2CJUH 3DX8A 3HMWL 2YPLA 4HKXB 2J2ZA 1DLHA 1XGUB 4GBXD 3WXWL 4YHYC 5CZVL 4PJCA 4KKCD 3LAFA 4HPYH 2YD2A 1NBYB 4O5LH 2B4CC 3N1PC 5FHBL 4XCNA 4OCWH 3O6LL 3DHJA 5BRZA 5DO2D 4IRZL 4EUPB 1MCBA 3UYRH 3CXHK 4FFVC 3NN8A 1I8MA 5AWNL 5GZND 1MHCA 5ID0A 3IJSB 4Y1AD 1VESA 3R0MA 3REWB 2XOTA 3T3MF 3WO3B 1N0LA 2VIRB 4LDEB 5HYIA 5KSVB 1BD2E 4OZFA 4JKKA 1ITBB 1UB5A 4U7KA 2IPKA 2Y36H 2VQ1A 4E41E 4P0DA 3ZDXE 4O4YL 1U8IA 2HFFA 3U7YL 5CBAB 4WI5A 1QLEL 5E2WH 1I1RA 1HIMH 2NXYB 1RULH 3KNBA 4OIAA 3MGOB 3IDJB 1Q0XL 4FTVE 1JPSL 1SYVA 3TYFA 4L29B 4U1LA 1NMCB 5HHOD 5T5NF 3EYSH 3GSOB 4OF0A 3GBNH 5F7DB 3AY4C 2YKLL 5DD1L 3BZEB 2X4RA 4R9HA 2G2RA 4BFIA 4X6DA 3IRPX 4FFWC 5I8KL 1CICB 1OL0A 3K1DA 3MZTA 1YECH 4L4TA 3EOTH 4U0RB 1FVDB 2P42B 3TO2A 3FKUS 4F9PC 2FYYA 1BX2A 2F54D 5CJ8A 3VDBA 1JZ4A 5GS1C 4HX1A 2AP2A 4M5YH 3E6HA 4PV8B 5FGCB 1MFAL 3OG6B 12E8H 5FGBC 3NIGE 1H8SA 2H1PL 3QFDA 1AC6A 2WMPA 4GKSB 2VWEE 2I9LA 2C3GA 5IGXL 2EDLA 1A1OA 1J1OH 4NN6B 1NCWL 4FQXD 2QSCH 1PEWA 2DBJA 4DUVA 4KHTH 1UJ3B 1VGEH 1S7XB 1CWVA 2QBWA 3T77B 4ISVB 4M43L 1R5VA 5EU5A 1QSEB 3Q1SL 4P9MH 1HHKA 2JJTA 3KS0J 1OQOA 1T2QH 4ZAKB 1DBMH 3GIZH 1A3RH 4F33A 4N1EA 3CDYA 4P59H 5I75C 3MLZL 4P3WA 3L3GA 4E42A 1ZSDA 4QHLB 2XACC 1MQ8A 1F8TL 1BWWA 4GW1A 1NLBL 3RPKA 2BJMH 4YGVA 3WEXA 4U2YA 1JGVL 2FD6H 1GGBL 2B1AL 2NY6C 5LAXB 2VMFA 3S4SG 3MJGX 1YPZE 1FE8L 4Y16B 1DBKL 5ENWB 2DQJH 5KSBB 1EAPA 5F6IB 5C9KA 2HG5A 2JIXB 2HLFD 3PQYB 4R97C 1PLGL 4JVWA 3W0WD 5DUPH 4XHQA 4WO4A 1CD1A 2JJVA 4ZO9A 2H41A 4YHPB 1SBBA 5ICYA 5KSBF 4LF3A 4YX2L 1C7SA 4X7FC 4KJQD 5HHME 1AGDA 3N0PB 3LPWA 3VFMB 4WVRA 4LGRB 3N1QC 1T7ZA 1AI1H 1J87A 5F21B 3P4LA 5I8OH 5B38B 5FOBB 5D6CA 3N85L 4GMSH 2NXZB 3OJDB 3QPXL 3IF1B 1IGML 2R0ZH 3P4NB 2B1HH 1JWSA 3M8OH 1T0MB 4UAOB 3PABB 3ZYOA 3A67H 1IC7H 3GJFK 5GZOC 4S0TD 4UNTA 4Y4KC 4YHKL 1EGJH 5DZOA 1F11A 5J3HC 1YY9D 2ZCKH 2ZUQC 3MV7A 4JGUA 1KTLA 3SJVB 3T0ED 5FOJA 4M6MH 2VLJD 3Q5OA 2YZ1A 4I4WB 1ZLSL 1IBGH 5ERWA 3TVMA 6CGTA 1XF5B 5I1LA 2XZAL 1GGYA 3T0VA 4LQFH 5EA0L 3SE9H 2AGJH 4L4JA 4OZHA 5T5FH 1F13A 5HHQB 4XP1H 4G5ZH 5JXEA 4YDKH 1S9YB 3MJ6A 4HFUH 4OBRA 3ZKSD 4YFLF 4CRPA 5EIIB 4LKCB 4JANA 1FIGL 4Z5RA 5BVJB 4XNYH 5JIPA 3GHEL 3HB3C 2XFXB 2ZG2A 1IM9D 5GGUB 3I9GL 4XCEB 1HXYB 1KB9K 2AV7A 4KI5D 1HDMA 1FRGL 4QRQB 1CVSC 1KPRB 2ZOLB 3ARGA 1Y18B 4BFBD 2NMSA 4G7YL 4Y4FA 5DJDB 1PKQB 3AB0C 3TT1L 2MHAA 5J12B 3LMJL 2IEPA 1N4XL 3DROB 1ZVHA 3ZKND 1S78D 3WNNA 3ZHDA 4MWFA 1ZHNA 2W0FA 2VE6A 1ZLVH 4BSWB 3KYOA 3QUYA 1SYSA 1WWCA 4X5XA 5AZ2H 2B2XH 3JWDL 2ZKHL 2IQ9H 4KDTA 1ZT1A 4P23C 1FNAA 5I19H 3BVNB 1BFVH 1EHLH 3PWVB 3H9ZA 3S98A 2RBLA 4Z6AT 3MLSH 3MRFB 2X40A 3LIZL 2DTSA 4LHUG 2XPGB 4G8IA 5EOCH 5J13B 2R2EB 4ZUVB 2HRLA 3TA3B 4WV1A 3WIHL 3KJ4C 5LWYH 5T1DL 1A6TB 4L8CA 1HHHA 2R29L 4YXHH 1FNGA 3IS1X 4JO3H 4U4BA 3VD9A 3ARBA 1JE6A 1XGTA 2R8SL 1JVKA 1U8QB 4NPYB 4M7ZB 4TUKL 5C0ND 1B0GA 1MFDH 3LQZA 4H8WC 2Q7NA 3GHBH 4XNXL 4KKLC 5FM4A 1H3UA 1VEPA 3L3DB 4NJ9L 1CGSH 3TNNA 4F8TA 1FFNA 3QEQE 4H25A 5C0BD 3F7QA 4WJ5A 1A2YA 5FUCE 3BESR 2FX8H 3HUJF 4G8FB 2A6KB 2B4CH 5CEYB 3X11A 3FT3B 4UILH 3VWKC 1XH3A 5HI3C 3O3AA 1KCRL 5DK0B 4WW2B 1FVCB 3UTSD 1FPTH 1RIVH 3VXPA 5GGVY 5JW4Q 3QQNA 4PGDB 3MLUL 3VXMB 4NQXA 1BLNB 5GGTL 4Q6IA 3TBVA 1F2XK 4XNMB 4ONGH 4AENB 5GRYA 1UH2A 1MQKH 1JHKH 1X4YA 4IDJL 5C07B 3FO1A 3QUZC 1AQKL 4LSUL 2PYFB 3QJFA 1JGUL 2AEQL 5HXMA 3HMXH 5CHNA 4ZUTB 1WZKA 1F3RB 5I2IA 2NY5L 2BRRL 4ZO7A 4OLUL 2IGFH 3FOMB 1RHHB 1MVUA 4ZS7L 3SGKA 5TE6H 1AGBB 3DOSA 5FYLE 1KYOJ 1XCTA 4JRXB 1OP5K 1VENA 2XQYG 4F80A 2EECA 4ZNEA 3FB7A 1GGCH 2GSIA 4MB4A 2FO4A 1R3JA 3KPSD 5FUZH 3GSXB 3O0RL 2IBGA 3SKJL 4G9DB 4U33A 4JKPH 5DVOA 1MRDL 4MJID 5L88L 5IEKB 2O5XL 4M1CC 2YEZB 1EFXB 3C5ZC 4ZFOL 3WFHB 2GTWA 2DL2A 4NKIL 1G7HA 3T4YB 1FG2A 3O11A 2A0LD 4OQTA 4XPAH 3O2WL 1MHHA 1S7UA 1KJ3H 3QO0A 3KPPA 3RIFK 2WNGA 4DW2H 2GI7A 1YN7A 2W9DL 1T1XB 3LQAH 1NEZB 4ELMF 1FGVH 4ZUUB 3OX8B 3O6KH 2P8MB 4HF5H 3RUGE 5JOFA 1WCBB 1D9KD 4I0PA 2AJUL 4D0CA 3FT4A 5EUKA 3C2AH 5BVPL 2BVPA 3QCVL 5IFAH 1CLZH 5BOPA 4K9EL 3UJJH 4TSBL 3BP4B 2BXYA 3PDOB 4PJIE 2YPLB 4JG1H 2PTVA 2IBBA 5HYSG 1U3HC 1NCNA 4YBQD 2ICWA 5IROA 4LGSB 1E4JA 5FYJD 1IL1B 4PJCB 2RJMA 4ZODA 3QP3A 2NPLX 1A9EA 4CN4A 1AP2A 2DLGA 1QNZL 3IXTA 4U7MA 5GRJH 4OF3A 4XCNB 1GHFL 3TZVC 5BRZB 2Q76A 1FH5L 4G43A 4JN2A 1EV2E 1I8MB 43CAB 4POZD 3O4LA 3DRQA 2Z92A 5ID0B 4LLWB 2NY4C 3IU4H 2ZG1A 3RWIA 4GAGH 4MJ5B 4PV9A 4YQXH 1QBLH 3OPZH 2H32B 1IGCH 1JYXA 3ZTJG 2VQ1B 3SDDA 1JHTA 4RGOL 4Y8DC 2WM0A 5BQ7B 4XH2B 4OZFH 1T2JA 5B39G 4ZFFB 1D6VL 5BZWA 5HHXH 4NZUL 3VE0A 1CXKA 3ULUF 1EERB 3NCJH 1LEIA 3EO0B 4EOWH 2GW5A 4PGZA 3GMLB 3LDBC 4PJHE 1RVFH 1A3LH 1SYVB 3GM8A 1FBIL 5E8DL 4J12A 2W38A 4QRPE 3QRGH 4XC1L 3LN9A 1YN6B 1WTGT 4FABH 4P2OD 2X4RB 1MCLA 2BVTA 4PRHA 3S4SA 3K2UH 5E2UH 3HZMA 1F02I 2IANB 2WK2A 2B0SH 2DQEL 3WFCH 2E7LA 5DYOA 4L4TB 1QFPA 1UACL 3OKDA 3TO2B 2FYYB 1BX2B 3SN6N 1O7SA 5T1KD 2VLLA 4HX1B 1A5FH 1T6WA 3E6HB 4Z9KB 2AJYH 3QFDB 3QFJD 2NY3B 2I9LB 2KQNA 1MWAB 1A1OB 3VXTA 2PUQT 1ADQA 1C8PA 1EJ6A 1RUKH 1TJGH 3O45B 3SDCB 1NGWA 2EDDA 2EE3A 2W9EH 2WBJC 5L0QC 1OAQH 4KHXL 4M1DH 2CR3A 3FFCB 3VW3H 5IBLD 2XTJB 1LO2H 1NFDE 3U48A 1HHKB 3TWCL 4F33B 4APQC 3VI4E 3A6CL 3U4BL 4LSRH 1JWUA 4Z0BH 4N0CC 3WFEH 4E42B 4W6WB 4YHOH 4MDIA 2PO6C 2C1PA 4H20H 4KMTL 4YGVB 2BSTB 4HIJA 1N8ZA 3EZ8A 4P3CH 3V4UH 4PJDB 4Z7NF 5IMKB 3OZ9L 3RDTD 2YSSA 4Q2ZA 2OJEA 4PRPE 2Y07L 4WUUA 4HXAL 5DMIL 4HT1L 1VFUA 5I76B 1NCBL 1DZBA 3NH7L 1WZ1L 2DTMH 1Z9SA 1JNLH 5ACZB 3ZSTA 2X2YA 3MLYL 4HBCH 1EFQA 1RZIA 1KF9B 5EG6C 3N1MC 4XCFL 4PTUA 4XPBH 4WO4B 5FKAB 3ALXA 1CD1B 3G6AA 4P2QA 5IMLA 1AGDB 2ARWA 3HC3H 4LLYA 4HLZG 5CSBA 2DQTL 1N64H 3BD3A 3G5ZA 2FBOJ 3L1OL 4YZFF 4JFED 3IKKA 3MV8A 2GTZA 5FIEA 4P46D 4QCIA 3MV11 3V0VA 5IR1B 1FCCA 1U91B 3HI5H 3UPRA 1DBAL 3IFNH 4AT6B 1FCGA 3B2UC 4RFOL 1FSKB 4LVOC 1JWSB 3QG6A 5D6DC 1QRNE 4DZBA 1WISA 3IDYC 4FQ1H 4DN3H 2X7LA 4U7SA 1X7QA 1GOHA 3TP4A 3OAYH 1JZ8A 2XY2A 4RGND 3QXWA 5I1HH 5ADOL 3RL1A 1QEWB 1MFCH 4LHUA 2OL3B 5ERWB 1RJCA 4RMRA 5GQBA 5C86A 2X70B 5I1LB 3LHPL 2C1OB 4RISH 3VCLA 3S3JA 5FV2A 2CPCA 3LVEA 1LO5A 2PTTA 5DJXB 1X9QA 2EDWA 5F3HA 5I1DA 4HXBH 4B50A 3BE1H 4P4KB 4EI5D 4OUUA 5SWZA 3FQRB 2XG4A 3HE6C 3QSKB 4JANB 4Z5RB 1P6AB 1TETH 5IF0A 4DFHA 3REVA 4UBDC 1XIWB 2DYPA 3ZE1F 5KW9L 4JPIB 2AV7B 3BN3B 3KLSA 4AMKL 3WLBA 4JFZH 5DVKA 3ARGB 1OY3B 2HWZL 3ETBF 1BPVA 4Y4FB 2G5RA 1TIUA 3EO1A 2MHAB 1FO0B 2APVA 4S2SB 5K33A 1A6WL 4D94A 3BWUC 2W0FB 2ED7A 4UUJA 1GC1C 1VHPA 2OTWA 4IRJC 2HH0L 3MLWL 3KYOB 4M48H 1OLLA 4ODSH 2DM2A 2NX5E 1SYSB 4WFFD 4Z18A 3WNKA 1MPAH 4FNLL 1Q1JH 4JM2C 4AG4L 1ZT1B 2COQA 5I18L 3EAKA 4PYHA 1NSNH 1HH9A 2MQ3A 1SEQL 4Z7WB 1CDBA 3INUH 1QACA 4YDVA 3F12A 4NRXA 4A6YB 1D6EB 1RJZA 4LDOB 4YH6A 2F8XC 1KB5H 1RHFA 3HG1E 4G8IB 2KDGA 2PKDA 3KPLA 7FABL 1J0ZA 3HLAA 4XXDB 2Z4QA 4URTB 3TBTB 3AXLA 3U1SL 1HHHB 2VLRE 4F3FB 3OR7A 4I3RH 4QOKA 4WI9A 2XY1A 5KN5A 4NQCA 4LCWB 1T1ZA 5D1ZB 2Y6SD 2NXYD 3QJHA 1X5XA 3WSQH 2PETA 2JTDA 1JTTA 1UKSA 4S1RL 1ZLWK 4JRYA 5CJXC 1WQVT 5IVNA 4TSCH 5C9JB 4PJ9A 1CLCA 4WJ5B 4Y19D 4HEPG 2ORBL 5BZDB 1QQDA 1RIUH 1CICD 1XH3B 3O3AB 2CR6A 1PW3A 3SDAC 3L5XH 3HZKB 4NQXB 3QRFM 3D6GA 4Q6IB 2UWEE 3I02A 3NZ8A 4GAJL 4D0BB 1ZVYA 3P0VH 5FAAA 1I1CA 3PV7A 2NZ9D 3BKCH 2EZ0C 4WTXA 4NDMA 3U0PA 2DQGH 3MACH 1KJ2B 1INQB 1G0XA 3QUXA 2X4UA 3T65A 5CHNB 5I2IB 1G6VK 1MVUB 4KVCL 3QO1A 1QSED 3BPNB 4FMKA 1NCCH 4Y5XA 4ZAKD 1HINH 5DHVH 3SPVA 3O2DH <