4XPGL

X-ray structure of drosophila dopamine transporter with subsiteb mutations (d121g/s426m) bound to beta-cft or win35428
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
molecule keywords Dopamine transporter
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpgL01
2AXGB 4S0SD 2I26N 3MMEB 4S1SL 2O5XL 4ZO8A 3U1SH 3RL1A 1BVKA 4YHYC 1CL7H 5T1LA 4PY8I 2WIMA 1MQKH 4ZFOB 1A7OL 4TQEH 5IKCB 5C3LD 5DZNA 4JG1L 5FHBH 4C57C 5L8LB 5J7CC 1UKTA 3RUGA 2R8SH 1RIHH 3UTSA 4CDGC 3MREB 4YHPA 2VR5A 2FDBP 4GXVL 4B53A 3VFOA 5I66B 2NY3D 1T03H 1T21A 4BYHA 1QOKA 3SBWC 4CADB 3MBXL 4C54A 1Q0YL 2XN9B 1PKQE 4KC3B 5KSAC 4OZFB 1NEUA 3T2NL 1WBYB 3VXMA 3O3EB 1BM3H 4P9HC 5I8EB 1MELA 4WI3A 5L8JB 2HWZL 3HZYA 5KSAD 2QQNH 3TBSB 5L2JB 3G5YA 1RK0A 3T0EB 3TEUA 3TLRA 4Z78A 2KKQA 5F88A 4RZCB 1ORSB 4LVOC 4U49A 3MPCA 2IH3A 3DETC 5BS0A 2A9NH 2X41A 1M71B 5C08B 1NSNL 1XF4A 2NY1D 3MYJB 3RJDA 1JJUA 2QADB 1PYWB 2PCPB 3FKUS 5E94B 3FJTA 3B2VH 4RFEA 2ZCHL 3W2DH 4LSQH 3MCLH 1KCUH 1ZTXH 3OJDB 2DQUH 5E2VH 4TNWK 1IGFL 1I9IL 4LPXA 1LO3L 2SEBA 5AG8A 3FN9A 4G43B 1MCPL 5E9DD 3RTQD 1A6TB 1SJHA 4LSTL 1GJIA 2Y7QB 4XWGL 1W2KT 1FO0H 4LPVA 3L3IB 3H42H 3QZWA 5FYKH 5CUSL 4Z9KB 2X1PA 2V5RA 4XBEH 3CD4A 4JQXA 3ZDXE 2EIDA 4ONOA 1QA9B 4FG6C 1AGDA 1FVDB 4Q7DA 5JORB 3OX8A 3MTRA 4N90D 2X4QA 5FYLL 1GGCL 1DUYB 1CLCA 5JR1L 3S35X 1YUHB 5IKCA 5D2NE 4P23B 1PLGL 4DK6A 5IOPA 3KLAA 5I18H 3F7VB 1HHGA 2AJVH 1LDPL 4HBCH 1CTOA 2B20A 2OSLB 3QUKA 3GSWA 3IGAA 1NFDF 2NY2B 3E2HC 3Q5OA 5ACMA 3BUYA 1FNGA 5CJOL 4EXKA 1ROWA 4XBPB 7FABL 3EHBC 2ZCKL 3O8XC 4OLYH 3CSYA 5HVGB 3OGCB 5BZDA 3EYSL 4F7EA 2DRUA 2CLVB 5BZWB 3VXNB 1PSKL 1CFQA 1GGTA 3HN3A 5F96H 4BUGA 1TTUA 3O9WA 5D7LE 3U0TB 4JPWL 4NP4H 1VKXA 4C4KT 1J1OL 1JCKA 5EBWB 3VWKB 5E0QA 1T2XA 3GHEH 1XZ0A 3GJFH 5D71L 3ARDC 1UKQA 3OKNB 2HT2C 1YMMD 1NGPL 2WZPD 4MMZC 5GS0C 4ZFZB 3BT2H 2DQFB 3H2WA 1RJCA 3BGMA 3V4VL 5KSVA 4L4TB 1FN4A 4CVZA 4NKDA 4M5ZL 4KTDH 4AM0A 1K5NB 1ZT7A 3HFMH 3QO0A 5CZKA 2NY4C 1QR1B 2VQ1B 2EXWD 2P7TB 2WBJA 1MEXH 3LN5A 1JYXA 1NC2A 2YC1A 4TVPE 3FQRA 4NBZB 1D5BB 3FONA 1CTNA 1U8QA 5TQ2L 1OY3B 4QRUA 2EE3A 3VXMD 3DUHA 5DD3L 3LKOA 2CXGA 3GSVA 3C6SB 5FA3B 1HINL 4YBQD 3IJYB 5KG9B 5D7KE 4XPHH 5B38G 2VLLB 4Z8FH 3VFRB 3C5JB 3IU4L 5FV1L 5CBAB 2BNRB 3AB0B 2DQJH 5T1KD 3UCRA 5LG1A 2P7TA 1S8DA 1FNHA 2OTUA 2Y9RT 4PJDE 3TM6A 1A1NA 4JN1H 4LBEB 3W0WD 1UYWH 5FF6B 3FQRB 1TCRA 1OCWH 5C07A 4MB4A 2YPLB 3QFJA 1JPTH 4TOYH 1BD2E 3HNVL 3LPWA 5AG9A 4XP5L 3QULB 5CINL 2Q6WA 2ZOKA 1S7QB 2FYYB 3S37H 2D7NA 2AQ3A 1T6VN 5DUPL 3OKLA 3TVMC 3S5LG 2NY3B 4JY6A 1D9KA 2GIYA 4YQXH 3LS4H 4RRPG 3C8HA 4P2OD 3P4NB 3S8WA 4LBEA 3UBXI 2JK5B 5D5ME 4X0KB 4RWYL 2I9TA 2X4TB 1RURL 4LSSH 3PP4H 1CD1A 3FMGL 1VEPA 4PRHA 1CLOH 4Q0XH 4BKLA 1KIPB 2A6DB 2JE8A 3F7QA 1KC5L 3IS1X 1I9EA 3QIBC 4JHAH 5LGJA 3LRGA 5D2LA 4MVBC 1FGNL 4KI5C 1MVUB 1CICC 2ZUQB 4ZTPL 3BE1L 1EFXA 3QXDA 5E6IC 1QSED 2LU3A 5DO2C 4X6BA 1VFBB 1W0VA 2I07A 4Z78B 4PJDF 5J0BA 3FFCA 4RGMC 3TZVB 1QLRB 3MV7A 5ICZB 4JRYB 3CSGA 1CICD 1JPSH 2VITB 4PRHB 4JDVA 5JA8B 3D39E 4JO4H 1FG9C 5DJ0A 3SO3B 3GRWH 1CE6A 4JB9H 5SX4I 1F4XL 3IDXL 3LQZB 1EO5A 2EC9U 3WS3B 1FG2B 4Q9QH 3C87A 1P53A 1J1XH 2OL3L 5E6ZA 4FQQA 2PW1B 4AT6B 3B3IB 3P40A 4IRJA 3BIKA 2A83B 4NWTH 2VITA 3SPVA 4MCZA 4G5ZH 5JW4Q 2X4NA 3M1BA 1GOHA 4EZMA 1LWRA 4G8EA 1D5IL 5ETUB 5DHVH 1T2QL 5HD8C 2A6JB 4HS8L 3QIBB 1X5YA 3MLZL 1INDH 1A1NB 2FH8A 4HWZA 1U6AH 2HKFL 5H8DA 3VCLB 4CAGA 2IWGA 1N26A 3RP1A 5I16A 2AXFA 3FN0L 3HG1A 4KTYA 4RDQG 4GRLB 2HVKB 4JQVA 1OLLA 2DQTH 1AXSA 4AIOA 5DMGD 2WNGA 1FH5H 4OD2A 3W11D 4F33B 4TPRL 4XZUA 5D2NC 4P9ML 1IVLA 4WFED 4TYUA 3RTQC 1I9JH 4JDZA 2H6PB 4PJFA 2VXTL 5F7FA 3MOBH 3TN0C 5FFLA 1E4XL 1U58B 1WZ1L 1UH2A 3D85B 3O3AB 5KJRL 3QWRA 1CXKA 2XT1B 2I25N 3RWJA 1INEL 1OSZB 2AKRB 4G8FB 3HS0B 4J8RB 4RGOH 3VRJA 1MHHA 5BZWA 3VXNA 2DQGL 4R7NB 3U9UB 5IFHH 1ZVSA 5E2UL 4H88H 1WT5A 3UYRH 1D7FA 4KZEL 3I2CL 4ZUWA 3WUWA 4FQIH 1BMGA 3ROOB 1AFVL 4YGVA 1DBML 3DO7A 2MKWA 3MV7B 3W0WE 1AXIB 1LVEA 4PRHE 3K80A 3KJ4B 4PJBA 1R5WA 4PS4L 1UJTA 2VZOA 4Y5VA 3V5KB 4APQC 1EO8H 3RWHA 4H20H 4OV6F 2X7LB 1WWCA 3PWUB 4H25B 1INQA 3U7WH 2CK0H 4IRSA 5IVXF 4PLJD 4RMTA 3REWB 1U8PB 3OX8B 2IPKB 5IW6B 2X5PA 1YQVH 2H3NB 1SVZA 3V5HB 3MV01 2NX5B 4XMLL 3ARGC 2R2BA 1MIMH 1JBJA 4F7MB 3SCMD 2YN3A 1N0LA 2OS7A 1T04B 1WIPA 2G60L 5BV7L 5FYLD 3RY4A 2VQTA 4LASL 2GYSA 4G3YH 4NQXA 1H15A 5IHUH 3ARYA 1NCCH 5DQDH 2YPLD 4JQVC 4EI6A 3S36L 3CSYB 1LK3H 3PL6B 5TDNB 4F7EB 1CN4A 3FOLB 4PJXA 5D2NA 8CGTA 1UACL 1VKXB 1RPQA 4YDKH 3KNBA 4JDZB 5C0AA 4LDOB 4Y2DD 3HAEB 5D9SB 2NXYD 2R1WA 1KIRB 3KPNA 1IC7H 5DQDL 2AERT 2F53A 5FK9B 1DFBH 3MRLB 3UJTL 3STBA 1VADB 3QSKB 1TJGL 4ZSOA 5J3HD 2OR9L 1GL4B 1JRHL 1CXEA 2CKNA 2XNAA 3F8UB 4KXZH 2JJTC 4GAGL 4U7KA 5E8PA 1Q9WB 2W65B 5IMMB 1S7WA 3BKYH 4HC1H 3MJ8A 1NC2B 4MSWA 4ODSL 5GGRY 3THMH 5IJKA 4KRMB 3BJ91 2R2EB 4HHAB 4G6AD 1X5KA 4ZO9A 1IC4H 3LMJH 2Z9TA 4AK1A 3UAJD 4Z7WA 3W9EB 2X7LA 3LD8C 3IAPA 1W0WB 3DHJA 3U0WH 3GI8H 3OKOB 5TDPB 2MOVA 4I18B 3ESVF 3B9VA 4HLZH 1S7WB 2DWDB 3HI1A 4M93C 3MRMA 1UJ3B 1BAFH 1RU9L 2FO4A 3FB6A 2XZCL 4M7JH 3CCHB 4WI8A 1T0NB 5CMAA 3AFLA 4JFFB 5GRUH 2E7LC 4P9HL 4PRIE 3QXAB 4YO0B 5C9KA 2AI0H 3BPLB 5I9QB 3QB7C 3QDJD 2Q3ZA 4KRPC 3RHWF 2AEQL 4ODWB 2F58H 4ZD3H 5FOJA 2QV2A 4WGWB 5BV7B 5DGRA 4HG4J 1CLYL 3TESA 1CT8B 3SO5A 1QBMH 2YD3A 4NQUA 2AV1A 3LQAC 4FFWD 1KCRH 1WGOA 1AO7A 4WTWA 3V7MA 3BFOA 1KCSL 1N6QH 3G6DL 1KJ2L 5F9OH 2EE9A 4WRLA 1KENH 5EU6B 3GRWL 3N9GL 2XY1A 1OAZL 5GZOC 4YHOL 3GSUA 2AEWA 5F7EL 5D1QC 5IM7A 3QCVL 4NQCB 3ZE1E 3VFOB 4GBXD 1IC1A 5BOPA 4K3HA 1BIIB 2ARJB 2Y5TA 2VL4A 3B2UD 4Y5XA 3OQ3B 4P57A 3TIEA 4YHKH 2CPCA 2G2RA 3TJEL 1G6RH 4K8RL 4OFPA 3QIUB 5D72H 2PXYC 1RY7B 1S7RB 3WIFB 4U1MB 4P2QA 4G8IA 3A6BH 2DM2A 3QUXB 1F58L 2AK4B 4PJEB 4HX1A 1N7MH 1D5IH 3QIWC 4P5TA 5CS7A 1NAMB 3JZ7A 1Q9WA 1U8LA 2W65A 3L5JA 1MFAH 3FQWB 3UDWA 3G9AB 1TENA 2E7MA 4PRBA 3S97C 4YIQA 4ODTL 2ARJA 5BRZE 1K4DA 1T80A 2J8HA 2BCKB 3RY6C 3MLWH 4M7LT 1RVFH 4G6ML 3RWIA 1C08B 2C5DC 3OKMB 4NZRH 4I0PC 4Y4KC 3RVVD 4RFEB 1FDLL 3P4LA 2H2SD 4X4XB 2F8VA 1W0YT 4JZJB 3NABH 4YEFA 2VN4A 3NIDE 5I1JH 5D1QB 1IAIM 3RUGE 1BZ7B 3KGRA 4I48B 3PWPA 1GVIA 4PD4K 5EU6E 4NQVB 3REVA 3QT2A 5J6HB 1C08A 1J88A 4HK3J 2W60B 3LMJL 4FQHA 1IMHC 1FGNH 4ZTPH 1RULH 4OF7A 4K07A 2HFGL 5ENWA 5GS1C 2C7UA 3GI9L 3QHFH 3LB6C 4NWUH 5ISZA 5A3IC 1DE4A 1JGDA 3QI9B 1ONQA 4I77H 1MCOH 3BQUC 4Q0XL 2G75A 3PIQB 4DFIA 4UU9B 3MRRB 3N50A 3HRZB 4TUKL 2R56H 1F3JB 1HWHB 5DK0A 3ZHDA 2R4SH 2GJ6A 1MH5A 4JFDB 1EV2E 3MSPA 4JM2A 5IJVB 5IGXH 3VWJC 5FEBA 2H8PA 3GHBL 2ITDA 4XVJH 2J8UA 2CUHA 4R3SA 2J12B 5HHQA 5AEAA 1QRNB 3T3PE 3T0EA 3ZL4L 1DTUA 4XBPA 2WANA 2DJ4A 3VG0L 1JGUL 4JN2A 2P4AB 4YXHL 3EFFA 4R2GC 4NQDA 5DD6B 2VDKH 1JNJA 1RZKH 4BQ6A 2Q8BL 1DQLL 1HCVA 1NC2D 1G0DA 4X6CE 4HWUA 5DJCB 3WBDA 2AJSH 2OI9B 3FQUA 5IHUL 2FRGP 3SY0B 1PX4A 4KV5E 2B2XL 3UTZB 1I8KA 3NCFB 4NOFA 5LGHL 1CF8H 3GIVA 3IDMA 3TO4A 3O0RL 1UXWA 4P5MB 3O41A 3NA9H 4KK6D 4FFVD 1DVFA 1A7QL 1IARB 1TDQA 4RFOL 4L8SA 1FGVL 1LDPH 2NY3C 2Z93B 4QOKE 3W9EA 1YN7A 3AMKA 4YDIL 1T04A 4U1KA 2OP4H 5DRNA 1N59B 1NH6A 5I74B 4LP5A 5KSUA 3O3BB 5GRJH 4NQTA 1MIEH 2VLME 4CN6A 5FM5M 3DROB 4I48A 1IJ9A 2DTSA 5SWQA 1TITA 4L4TE 2KH2B 2HT3C 2V7NB 3ARGB 3MROB 1I1YB 1WTGT 4DWHA 1NGWA 2Y36L 1PEWA 4R4ND 1KEMH 4MXVE 1FFQA 3AGVA 4PRIA 4DVBB 4S0TD 2M2DA 4NP4L 2YPKA 4NN7B 3T0ED 3RPKA 4EN3B 4L3AA 3RWEA 5F71A 2NY7H 5KW9L 1VA9A 1UVQA 3O0RH 1MHPL 1RZ7H 3O2VL 3QUMH 3QWOB 2V5YA 3HCVB 2QQKH 4NM4H 4Y4FA 1JZ7A 4NO2B 5D1ZC 4PJHB 4W68A 5IJVA 4M00A 5CIPB 3S6CA 3NFPA 3FB8A 1P2CB 2H9GA 1NBVL 2NY7L 3BN9D 1UADC 4HW6A 4E41D 2VDKL 1FVEB 4CRPA 2K9UA 3L5WA 1NKRA 1F6AA 3BH8B 5EFIB 3JV6B 5EO0A 2YD4A 3VFPB 2QR0A 5H2BB 5HVWA 1MFCH 3ZL4H 2ESVE 4MZ3A 1F4HA 3Q5TA 4DTGL 4KJWC 3R1GL 2X1XR 4HIXH 5IUSA 5EIQA 1XGPA 3QUXA 4AENA 4PYHA 1YECL 4LCWB 3WIHH 5D2LB 4LSUH 3W0WA 2FX9L 3IJSA 1DSFL 1UEMA 4LCUA 4OCRH 5I1CH 3V6OC 2OX5A 5FHAL 3HNTH 4H8WL 1A0QH 4PB9H 1J5OL 2VE6B 5F1NA 4JPKL 3SKOA 4XXCC 4X80H 4Y19E 2HH0L 2YD7A 5C9JB 3O4OC 5DFTA 1Q9OA 1RIHL 3C60B 3N1FC 5BS0D 2VR4A 1IGFH 4AENB 3ZE2F 2E6PA 4JG1H 4HKJA 1JGEA 5J6GB 3MJ7B 3HUJB 2ZUVA 3WXVH 3KXFB 5JHLH 4WU5B 1Z3GL 4U0RB 2IPTH 3L3GB 1YEFL 4CVWA 3S3SA 3EOTL 3OKKB 4NT6B 3MUHL 3PWNB 4ISVA 3VWKD 1BM3L 3ZHLA 1B4JH 4KRLB 1I85C 1WFOA 4ONHB 5GGRB 3O4LA 4YHIA 3TBYB 4DKEL 1D3CA 2APWA 2RCSH 4G7VL 4G80B 4HXBL 3FB7A 2R69H 3MRJA 1QSFD 4NZJA 4ZFOA 3WL9A 1QFUH 1AXSB 4U3XA 5JTWA 1NUFA 5IK3B 3TO4D 4KGLA 3VGAC 3VFSA 4TNVK 1GIGL 3NMEA 5JUEL 1MSPA 4PJAE 1XF1A 5ERWA 5DI8A 1U36A 1WCQA 4HXBH 2HFGH 4YJZL 4DKEH 1O5DT 2IQAA 1BEYL 1BBJA 1V3JA 4XTRC 1A7BA 3S35H 2EDKA 1EAJA 1ZHNA 4LLDB 4N0CD 1E0OB 4HIJB 5E99L 1T20A 2EKJA 3AC0A 1EK3A 2W0FA 4GKSB 1FN4B 1T7YA 4CVZB 4PG9B 3W0WB 3ZKND 5KAQG 3N9GH 3GBNH 5DC0A 4BELD 3VD5A 3QPXL 1I9RL 3VXPB 2JELL 4LAJH 1KLUB 2QADC 4Y0GA 4M7KL 2OL3A 1EA9C 5C07E 4J2XA 3NCJL 3GSNB 15C8H 3WXWL 5D1ZA 4L8CA 5E94A 4OAWA 2IG2L 4DW2L 5GIRB 5JLZB 3WD5L 4HT1H 3HG1E 2Q86A 5KVFH 4Y4HB 3IGAB 4E41E 2V7HB 5I6XC 5F8RC 3DUSB 3L3GA 1H3XA 1NL0L 3DX6B 1OWWA 2XIDA 3DLQR 3TPUB 2QTEA 5DDHB 4QRRD 3K4DA 2XRAL 5IV2B 3AS1A 2ATKB 4BZ1L 2VLKB 4IRZH 3IJHB 4F7MA 1K8IB 4Z7OF 1ZHLB 1I7RB 5ISZE 5F3BA 1FCCA 1CFVH 3CX5K 4IMKC 1CXFA 4OLVH 4UAOB 3VU2A 4ELMA 5C0IA 3QDMB 1UKSA 3LSOA 1LGVA 3BP5A 3CFCH 1WAAF 1NLDL 1A1OB 5IG7A 4HUWA 1CD1B 2VZ1A 1I3RB 4NKOB 2NW3B 4O51A 5GGVY 3C5SB 3O6MH 3QH3A 4QOKD 3QCTH 4FFYH 4R9HA 1IILE 3N1PC 3SY0A 3MJ9A 4CNIB 2OXGA 1QSEA 1G1CA 1TFHA 2D7QA 4CL7A 4X6EA 4Y1AD 3MFGB 4XXDA 4JRYA 3L3KB 4ETYA 4XC1H 2EDTA 1FBIL 1IC5H 4EDWH 3BWAB 2CDGB 3LKSB 5GRYA 1YJDH 2R1XB 1JWUB 2C3WA 3NPSC 4J1UB 3SE3C 4J4PD 1M4KA 4KDTC 1SYSA 2IPTL 3RVTC 4MDJB 4M7ZC 2APVA 2VE6A 4LRIA 1XMWA 4XVUC 5HYSG 3SKMB 4FTVD 4M48H 3KXFD 5F9AC 4MLIA 1PW3A 4XC3H 1G0XA 4JY6B 1KTLB 1NMBH 4XBGB 2AEPL 5T5FH 1UM6H 1K4CA 5GGUA 5B8CA 2FO4B 5HGAA 4XNMA 3ULSB 3RNQB 5IFAH 2BHYA 2XA3A 1DFBL 1N64H 3G04B 2O5ZH 3GIZH 1MY7A 1U95B 3R0MA 5EWIH 1OT1A 1E4WL 3RUGB 1U8MB 5JHDE 1NAKH 5E6YA 4QRRE 2ZPKH 5EU4A 3ZKNC 1Y6MR 3CU7A 1M7DB 5CJQH 1SY6L 1A47A 1FNGB 2P47B 1S78C 3RWGB 1OSPH 3M17A 4O2FB 4PJGA 5F6IC 1MCHA 4M7ZB 1AGFB 3B9AA 3C09C 4PLNC 2O5ZL 1GGBH 4Y19D 1N64L 1WWBX 4OUOA 5JHDB 4KZEH 1RFDH 3LKNB 2MSPA 3EO1B 4JZOA 4IM8A 2UWEA 2DMCA 4R4BB 2VERN 4RMRA 4ZOCA 5GJSH 3QUML 4KMTL 3O2VH 4O5LH 5GGSY 2WWMD 4KK8C 4AYFA 4XGZA 3HE7D 3L3OB 4K7FA 3BRDA 1VFAB 3O6KH 4XXDB 1L7TH 1VHPA 1YMHB 2LFGA 4KJYB 4QCIA 4NPYB 3HLAA 2W92A 3Q3GB 3MRKB 1MRFL 3WSQL 4PJ7F 2X4NB 3M1BB 1JWMB 5E2TL 3Q1SL 1YEHL 4S10A 1A64A 3KHQA 4NNXA 3QIBA 3OG6B 5DYOB 3MZTA 1DN0B 1E28A 4I2XA 5ID0B 1CVSC 2PTTA 4YZFE 4PGJA 1RUAL 3ULUH 2XZZA 4NDMA 1KULA 4WU7A 3GSNA 2FJHA 3MLZH 4AJ0A 1YNKL 2BOCB 3R06B 5GGVL 3U30C 4KDTA 1QHPA 3IFPA 4RX4A 5AUMB 4UT9H 5CBAA 2R56L 3EGSA 4MD0A 1CF8L 3SHSA 1MCOL 5INDB 1CXLA 4KRNA 3DUSA 4M8VA 3S5LB 3T2PA 1HSAB 2XFXA 4WTXA 1W72H 1A7RL 2R4RL 4PJEF 3JVGA 3O6FB 3IYLW 4PBWD 1FYTA 3T4YB 1KJ2A 2WBJD 3DMMC 3PWLA 1RQ5A 2GCYB 1KG0B 4MGXA 4DZ8A 4XPTH 4TUOB 1U42A 4FMFA 3LRSA 3WNKA 1W72B 2PO6D 5GSRB 3VGBA 4OT1H 2BVPB 1U8KB 4Y2DA 1VACB 1VENA 3NIFE 2ZJSL 4U31A 5IG7B 5T3XE 4K2UL 4BH8B 3KPPB 3WO4B 3P11H 2DF3A 4M4RA 4QXTB 1S3KH 4QOKB 1J18A 1ZHKB 5DHYA 2Q7YA 2UUDK 3C5SA 3ECBA 1I75A 1FFNB 4JFFD 3LS5L 4MJ6B 4NSKA 3IU3A 5ESVB 4DN3L 1JV5B 3CXHK 3VXRE 2K7PA 2YZ8A 5IW6A 4G5ZL 1RURH 2EO1A 2R2EA 5KTEL 2YRZA 3UTTE 2YBRA 3R8QA 5B39G 2ZSWA 4X7TB 3W5NA 3EFFB 2WWKT 4GQ9H 2A0LC 4NHCL 5B22A 2D4FA 5HYFA 5I71B 1EXUB 1U8IB 2R23A 2CDGA 4K3EL 2PR4L 2Z92B 43C9B 4M6MH 3BKML 3QPXH 2ED7A 4G8GB 2XZCH 4M7JL 4RA0C 4RNRA 2Y1VA 5HI4C 4HS3A 5DSCA 4IRSC 5DJZA 3QG6B 4JFOB 5LKNA 1CDGA 2JCCE 3TNNB 1IGTB 5CMAB 3WJJC 1S7VB 3PL6A 5E95B 5TDNA 2B0SL 4GOSA 3CK0H 5DR5H 2ADJA 1CGYA 2PW2A 4PJ8A 4WHTA 1S7XA 2VSDA 2XICA 2X05A 5TFSL 1AC0A 1A4KB 4N68A 3QHTC 3NN8B 4X5WA 5BJTA 2IADA 2F8XC 4P59L 3PIQA 5FKPA 3OR7A 4PLOB 3JTSA 5DK3A 3RY6A 2VDPL 4XP9L 2J8OA 4LCCB 5D96B 1SBSH 3CNKA 3GSOB 2J7LA 5I1LB 4UT9L 4WDIB 1CFQB 3B5HA 5JMOC 1YNKH 5IHBA 1X5FA 3QXTA 4DVBA 2CDEB 1BGXH 2F74B 3VGHA 4LOUD 3WIIL 4YHKL 3U2SA 4AEIL 4PJ9D 4H0GA 2MHAA 5C08D 2I9TB 2OYPA 1KCKA 1FIGH 4HULB 1EHLH 4F9PA 5C09D 1B9ZA 2HLAA 2OMNA 2JCCF 4CVXB 1K9TA 5CIPA 5M94B 3CX5J 4QXTA 5SWSB 1J0KA 2XWTA 1BFTA 1MF2L 4JPWH 3KYMB 5BRZD 1BWWA 3BPNC 3TA3B 1N6QL 1I1AC 3U46A 4OKVB 5DJYA 4NUJB 2LU4A 3FZUC 1QFWH 2N56A 3VFNB 5SX5K 1C7SA 4OLYL 3KAAA 1I8KB 1MHEA 1TLKA 2FJFA 3CCHA 3GMPB 4M43H 4BFBD 3DVNA 1UA6L 3P3YA 3S88L 4ZD3L 2Z93A 3UJTH 1NCTA 1GGBL 2R39A 3NPSB 3V7AG 5JOPD 3SJVB 3MLTA 1NCBL 4JZJA 4OCSH 4M62H 3U79A 4AIZB 1PD6A 4HUUA 4XMPL 2VDNH 1IGJB 2EH7H 1NJ9B 1QSVA 2XG4A 1UH4A 2Q1EA 5ANMB 5FYLH 3QXVA 4GAJH 4ZFGL 3DHMA 1ES0A 1PG7L 3PWPE 4PGBB 4KUZL 1XIWC 5J4MA 2FB4L 2QHRH 3O6LL 3N06B 1BJMA 3Q1SH 1B0RB 4U3CA 2BY0A 1BBDL 4X99B 4MD4B 4RAVB 4PJ5D 1TCMA 5HYJA 1UZ8B 3C6LA 4O2FA 1NJ9A 1BPVA 4U3HA 1WEJH 4LHQB 3HG1B 1BECA 4P0DA 1FFPB 2FX8L 4XH2A 3WUZA 4GG6A 1K6QH 4ISVB 3FTGB 4KDWA 4YK4C 4ONGH 4GW5A 3TV3L 1CD0A 4LLYA 5I8OL 3RVTD 4KK6C 4QGYA 1RZKL 5IB4A 1NSNH 4MQTB 2UZXB 1YMMB 4FABL 1UM4H 4PJFF 4KUZH 5EUOE 1AKJA 2VRAA 3RGVA 3V2AR 1KEML 4PGCB 1ZOXA 5SWSA 3QFDB 2CK2A 5C0CA 3V8CA 4OZGB 5TJWK 1S5IH 3WDIA 4JFPA 3MRQA 1E4WH 3V6OA 2A2QT 3QDGE 2ADFH 5FGBA 4ZG1A 2ADIB 1NGXB 3LQAL 4ZPVB 3GEWB 3K2UL 5KS9E 5I8OH 2CKBL 4HKXA 1A3RH 1MRDH 5JDSB 5HYSA 3BJLA 3QUXC 3OHXA 3WNOA 5T1MB 35C8L 4OCNC 4EUPB 1JNNL 3I6KA 4H0HB 1DQML 4UDUA 3IRZA 1XCTA 3F5WA 4TTGA 4Z0XB 3QG7H 1I7TB 5FKAB 4I77L 4LEXH 3MMEA 3WS6C 4M48L 1UA6H 3TBWA 3CFCL 5I1AA 3BSZL 5I17A 4P46A 2HMID 1SEQH 3CAFA 4JGUA 4JFFA 4JFYB 4JANA 2A9NL 4PJFE 1FIGL 4HS6A 4JB9L 1PG7H 1UENA 2VR9A 1X7QB 4U6VH 2AVGA 1C5DB 2Y25A 2ADJB 2PW2B 1YN6A 2VDQL 2C3GA 2X70B 1JNLL 4OSUH 1EEYB 5F8QC 1IC5L 3RNKB 4YHIB 1L0YA 4ZTOL 3T1WA 4M62L 3BKMH 4P4KC 3DV6A 1IM9B 5FYJD 1X6NA 4L8BB 4P46B 3MOAL 2CIKA 3MRPB 4XNUL 3N1GC 3QUYA 3JWOL 1T66C 4HS6B 4WWKC 6CGTA 2GITA 5EN2B 1T7WA 5IVXB 3VRLE 3NFPB 4FFYL 2R4SL 4KKBC 4L4VB 2X09A 4HZAA 4LKCA 1B0GB 4ZUTB 5TE7L 1MCWM 1KACB 4AG4L 4DZBB 4JRYD 1TVHA 3VI4F 1NFDA 1V7MH 5IVOA 5E5MB 3ORJA 1LEKA 4PJAA 4LLWB 5SWSD 1IM3B 5DUPH 1BOGB 4LHUD 5DR5L 3TA3D 4NKOA 3UP1A 4WFGE 4XP6L 2IAMA 4TOYL 1SM3L 1U8LB 2XTJC 5C0BB 5F7EH 1CQKA 4BJLA 3U83A 2ADIA 1CBVL 4LCUB 1HKLH 2EC9T 4HJ0C 3IKKA 1ZGLB 5L8KB 3BVNB 4OB5L 4BK5A 5JXED 1INDL 2VZSA 3DXAB 3D3VA 1SEBA 4HH8A 2NX5A 5IP4A 1S7UB 1Z0NA 3QFJE 2DI8A 4NHCH 3TIDA 4M4PA 4ALAH 3K8KA 1QKZL 4YX2L 4NWTL 4WW2A 1F2XK 3ARQA 3VH8A 2I5YL 2C4FT 2IADB 3VGFA 1CDYA 5MEND 5IF0B 1QSFB 1KPRB 3JWOH 1BJ8A 2WBJC 4G7VH 4A6YA 3VXUD 3FRUA 4GRLD 4JDTL 4KMLB 4P9HH 1F42A 1QFHA 4GBXA 3U7AA 4FFVC 1A9BA 1P84J 4ODXA 2L7UA 5DJAA 1CVRA 3IJYA 5KG9A 4IEFB 1IKFL 3OV6A 1U2HA 5EZJB 2WMPA 1HKLL 5J12B 1A6ZA 4XPTL 3ARDA 4ZYKA 32C2B 5TGBA 2FZ3B 5AYUH 3GI8L 1NGPH 2N7BA 3DVGB 2EDWA 4X8XA 2DQJL 1N2RB 5GQBA 1T7ZA 1IC4L 2X9YA 1DR9A 3CFEB 2V7NA 3BMVA 2OJZL 1L7IL 1W72L 1KENL 1EBAA 1VPOH 2PETA 1GXEA 1EZVY 1AI1H 1H9VA 1MCLA 2NYYC 5EU7E 5TE7H 1OHQA 2ZOKB 5J11B 3QH3B 2XQYG 3QZWG 4HDIA 4JREB 3DECA 3I6LD 1CLYH 1J5OH 3MV7D 1XZ0B 1TJHH 2HG5A 4OCRL 5I1CL 2HN7B 2WK2A 3SGJC 1MRDL 1A3RL 1ED3B 4LP4A 2FX7L 3FQTB 4O00A 2DTML 1XF4B 4YDVB 3QAZC 3BP4A 4NQDB 4TTDD 5JXAH 3QHZH 1I3GL 3EZ8A 3EOBB 1WITA 1YEEH 4OSUL 1IEHA 5IB1A 4NRXB 4R4BA 2YOCA 2UZIH 2JLLA 2YC1B 1S9YB 3EOTH 3D48R 1KSRA 5E2JA 2VLKD 2APFA 1E4KA 3H7BA 1HQ4B 3EJZD 5A3ID 5EWIL 1HHJA 5I1EL 3MLRL 1U8JB 1CFBA 1C12A 4ODWA 3X11B 2FHFA 4GS7C 1M7IA 4JPVL 2XZAH 4NOBA 5BW7A 4Y5YB 5HI5D 3X12B 2AJYL 4JREC 4IIQB 1Q1JL 1OL0A 3AREB 1I9IH 4H8WH 3UDWC 1KPUB 3X3FL 4QHUA 3WL9B 3ULVC 3G5VA 1LEGA 3AXLB 5DXWA 2H1PL 3ZYIA 1H0DA 3MCLL 2FX9H 3D0VB 5J1AB 4I13B 1T1YB 3X11A 1G9ML 3GSUB 4GSDL 1YECH 2JB6B 2ADFL 1VFMA 5K9JL 4PJHF 5FYJU 4HKBB 5JOEA 3DVGA 4HWBH 3W9DB 4AEEA 3QI9A 5H37G 1MI5E 2NXYB 5F3HB 1SY6A 3TT1H 3W81A 2NY2C 1G7PA 1UACH 1HHIB 1BF8A 1MRFH 3JV4B 3MBEC 1Q9LA 4NQDE 4QGTA 1A7QH 1FLTX 1N5AA 1EZVX 4G6KL 4RFOH 1JZ5A 3EYSH 1NBVH 1LHZA 4NNYA 5LXGL 4WW2C 1MCPH 3OPZH 3GDBA 5CJ8A 2QR0B 4X8JB 2B2XH 3K46A 4MWFA 1UG9A 1Z9SA 1K4DB 1QNZH 1QUNA 4HJGB 2GQHA 4PBVC 1GGYA 2W9LA 3RWIB 1QO3A 3LEXA 3UZVB 4UNUA 1S9WB 4KJPD 2EYRA 3RGVD 3WYRA 1MHHB 5C0BD 2HFEB 5C0FA 2GK0B 3GSNH 3MNWA 3RIAF 3UBXB 1AY1H 3SGJA 3PABB 3UJIH 2D4DA 5I76B 3VFMA 5DMGC 2FB4H 4UUJA 2BVTA 4LK4A 3DXAD 4WTZA 3UTSE 2XN9D 5E7BA 1E4JA 5KSBE 3OG4B 4JFYA 2EICA 3EJYC 4AEIH 1C5CH 1FL6B 4P2RE 5K9JH 4OI8A 4O9HH 5E8EA 2OLDA 5CJXC 4XB8A 3NCBB 5I8KH 3ZKQD 5E03A 1SYVA 4Y16C 2Z0BA 2QSCL 43CAB 2BY3A 4NQSA 4OLZH 2XYCA 4A6YL 5KSAB 1NL0H 3OJ2C 4OF3A 2DLTA 1ADQL 1RUMH 2I24N 1IE5A 4MZ2A 5LGKA 5EG6C 2DBLL 2WUCH 3DROA 2OTPA 4TULL 1S7TB 4Y19B 1A7NH 5E2UH 2IBZX 4XWOC 5HYJD 5JHDD 1DBJH 5HPOA 2XZAL 1H0DB 4NO0D 4L3CA 4JE4B 5CD5D 4GAYB 1CDHA 1RULL 3KR3L 5GIRA 1NCDL 3SDAA 1J0YA 2EO9A 1EVTC 4X6DA 4X4ZA 5I30H 1MCIA 5HHOE 1DQJA 1FO0A 5D2LE 5SV4A 2BNUA 5IMLA 5TDOA 3NH7H 1AGCA 3L7EB 4JO2H 1NLDH 1GOGA 2V7HA 3CPLB 4K71C 3MLUH 1E4KC 1FNFA 3RVUD 3JUYA 2WQRA 3RWJB 3SKNA 3E6HA 3QUXD 5F9WB 5J3HC 1FBIH 5CEYA 1K2DA 4OZFA 2A74B 2GJ6D 1QSFE 5SWZD 4M02A 3TN0A 4L1DA 5IVZB 4OCLC 3ZDXF 4YXLH 1HNGA 1U6AL 4R0LC 5EO1A 2YXMA 1GZQB 1UWGH 4P23D 1T03L 4H1LA 4HJGA 2EDFA 3MV9B 1LDSA 1BQHB 2KUTA 1QFUL 3DOSA 3F62A 4ZSOB 1CGUA 3QQ4B 4PFEA 5FGBC 3WXWH 3CLEH 4WV1B 1G6RL 5EIVA 5EO1B 3FOMB 1NLBL 1OAYH 1UB6B 4OD3H 4Z7VA 2JELH 4MQSB 4UINH 1JUFA 3KPLA 1JPTL 2ICWJ 2V2TB 4L8CB 4BFIB 1I8MB 2VLKE 3L7FB 4ODHL 1AQKL 3L5IA 1VERA 3EFDL 1HH9A 3IDYB 4N1EA 4OF6A 1MJUH 1P6FA 4G8EB 4OGYH 3LEVH 4R2GB 2NY5C 4NYLA 1Z3GH 2VO5A 4EVNA 1UCBL 5DJXB 1QBLH 3Q5YA 3T65A 1A7RH 2R4RH 2Z35A 3KYNA 1J0JA 4BQ9A 1G84A 5ECJE 3WD5H 3H9ZA 1T6WA 1A7NL 3FOLA 1X44A 3PHSA 4IDLA 4NN6B 1QKZH 3RBSA 4YX2H 3HB3C 4WO4C 3AAZA 4JPKH 2AI0L 5GRVK 5CCKH 3NGBB 1YC8A 4ELKB 4HDIB 3RBGA 2BNRA 1X4XA 3HFML 1JP5A 2QLVB 1FJ1B 4MAYD 5D72L 2RB8A 3H0TB 4LCWE 2XQBL 2XKNA 1NBYA 3FQXB 5GSVB 3C6LB 4JHZA 1LO2L 2LE9A 4IS6A 1YMHA 5F89B 5BV7C 4XP6H 2BFVL 1YEFH 5DK2A 1T89C 1D5MB 3QP3A 1A9EA 3BSZH 1AY1L 1RJYA 3SE8H 3VXSE 4P48A 4O4YL 2CRZA 1BIIA 2PTUA 1K3ZA 4AT6A 1KCRL 2ATPB 3QDJA 3RGVB 3S3JA 4FFWC 2YD1A 3SOBL 1JNNH 3I02B 3DRTB 3RIAK 4OJFL 3BGAA 3B8SA 1MI5A 4TUJA 1MJ7L 2V2WB 4GKSA 3MLTB 4Q6IB 4C56E 1S9KC 3H8NA 4OZGE 1RUML 3QEGH 5EU5A 3HNTL 4GT7A 2A6IA 4HS3B 1OAUH 4M3KB 4ZNCD 4ZAKB 3R1GH 2GHWB 1QLRA 2X1OA 4JPIB 3TNNA 4P4KD 3OWEA 5ICYA 1S7VA 4RIRB 5LVEA 1KV3A 3L7FA 4M1GL 1Z0MA 3VFRA 1XCTB 3VFWA 3MRGB 1FNAA 2R0KH 4NQSB 1UM4L 4PJ9B 1NC4A 1W8NA 4HK0A 3FO0L 4PJFB 3KPSD 3MOQA 5GRJL 1NCCL 3PP3H 1CICB 1QZ1A 2ZUQC 3BEVA 1ND0A 5HYJB 3DX6A 1JNHB 1FAIH 3MRJB 2RFXA 1P7KA 3X3FH 1N5YH 1BD2A 1FO0L 5FYKL 3V6BR 5GGTH 5FB8B 4HGMA 5C8JB 4KH2A 3QO1B 2VNCA 1NMBL 4LSTH 1JGVH 4XNQB 4O5LL 2A6KB 1MRCL 3GUTB 3ECBB 5FHAH 3D2UA 4XVUD 1VGKA 3ROOA 5J89A 2MCG1 3MRRA 1IC7L 5I1EH 1NAML 3I50H 3BZDA 4UQ2B 4Q6YA 4D0BA 5SWZB 1KJ2B 3G9VA 4LCWD 2A74A 3QIBD 4P2RD 3SGEH 1SY6H 1HXYA 4QKXB 3WN5C 4JRWA 4JZNA 5J13C 4ZFFB 4ZPVA 3RZCD 5IFJA 1EGJH 2FWOA 4S1QL 1CDBA 4OZIE 1MJJB 5DTFA 4JKKA 3T77B 3CVHA 1IGTA 4ELME 3SGDH 1TVBB 5EZIH 4RFNB 3ALWA 4QHLB 2LVEA 1Q72L 1BOGA 3BGMB 5KSVB 1SJEA 4RGOL 1MRCH 4MJ2A 1LO5B 1AGDB 4K9EC 1MHPH 1UGNA 5IROA 3MV8D 3TN0D 4MNHB 2GTWA 4I18A 3NZ8B 1NCWH 3C9NB 3IXTA 3PWJB 3SCMC 3MOBL 2G5BA 1VPOL 2JB5L 2EEDA 1KNOA 1G9EA 1T0NA 4WU7B 4WUUB 3VG0H 3W2DL 2QHRL 3O6LH 2IMNA 2X4PB 4Z76B 1EHLL 1RJLA 3U7WL 3QPQD 3VDAA 3DBXB 3LV3A 3IS0X 5A43C 3UTTD 4UT7L 4HWBL 4LPTA 5C0BE 1RZIA 4OD1L 1JGUH 2PYED 2C4FU 2G75B 1LQSR 2HJKB 3OJVC 2HKFH 2YSSA 1EHAA 3OKYA 5DJZB 4XAKD 3ARBA 4LNRB 5C8JA 3GSRA 5DRWA 3H9YA 5CZVL 4KVNL 3NA9L 1P1ZA 2DTMH 4OZHA 3MBXH 3QDAA 3QNZA 4ZS6C 2GJJA 1MCWW 4EIZC 1NEZA 4MAYB 4OKVA 5DJYB 1OGTB 4F9LC 1B0GA 4N0RA 2XPGB 3O8XA 1V3KA 1LILA 5HVHB 1LD9B 2ICEA 3PXHA 5IVXE 1BLNB 1T0MA 1IGYA 5F9JA 4I0PD 4Y4KD 3VWJA 4O2EB 3SCMB 2JCCB 3VD4A 4PJGB 3A6CH 1AGFA 3B9KB 3LEYH 4WVRA 2B0SH 4QRPE 4ODHH 1L7IH 3V9FA 1A7OH 4OZGA 4ORGB 4P9MH 1KGCD 1OTTD 3PDOB 1NDMA 5MEPB 4U33A 4NQCE 5FAAA 4HUVB 2O5XH 3MRMB 3S35L 3DV4B 2PR4H 3X14A 5C0EA 3PL6D 1ZEAH 4YUEH 4ZDHA 4IRZL 2JJVA 1TXKA 2DS4A 1S7UA 3BZ4A 3I85A 3QNXB 3TCXA 3WE6B 4WUUE 4MXWL 3I9GL 3BN9C 2BRRH 5D1ZD 4Q9CA 2GSGB 3BZEB 3HE6A 1U8OB 1CE6B 1GGUA 3G6JF 4CVUA 1IM9D 3ULUC 2DB8A 1NDMB 4K94H 1S9XA 5ADOL 1CG9B 5I1GL 1U8PA 4OIAA 2HTKD 4DK3A 2RJMA 4RWYH 1N7ML 4KKAD 1S9YA 4NWUL 3RVXC 2NX5E 4JZJC 1GGIH 2XACC 2AEQH 4L4VD 2OJZH 3FFDA 3WKMH 2NPLX 2GTZB 4JFEE 5CINH 1U8JA 4L3EE 2G9HB 2BSRA 3QCVH 3KPSB 4PJ9A 1CQYA 4YHOH 5FUCE 2CH8A 3WJJA 3U36B 1JYNA 4AZ8A 3M17B 1IGJA 4IHOB 4LHUB 5FDYA 4EUPG 5B4MD 3IFOB 4OD3L 4W4OA 4Z7VF 4LEOB 1MH5B 5I30L 1BEYH 3GFUA 2NY1C 4Z8FL 4LSVL 4G6MH 4JKLA 1RUQL 3MRFA 3HR5A 2DL2A 1Z5LA 4K8RC 3MYZA 3VDBA 1CDIA 2QL1A 3O9WD 1RJYB 1WFNA 1Y0LA 3G6JE 4AEHL 2H6PA 3MUJA 1WT5C 4X98A 1BFSA 1VFBA 2I07B 3TC9A 3LKQB 4JFHD 5GSRA 2Y07H 4OZHF 5BQ7A 4XGZB 1UZ8A 1QSZA 1TVHB 2D7TL 4GBXC 3QDJB 1O7VA 4GKZA 1JRHH 3GMNA 4P2RB 2I60L 4X7EC 5ITFA 4LHJB 2UVFA 1S3KL 4OGXH 1A5FL 3S98A 4YXLL 1ZXQA 5IB2A 5I8KL 1PFCA 3MRFB 2UUDH 1OP3H 4LGRB 4LCYA 1NFDE 3RZCB 5H94A 1UB5B 3BGFB 2EDBA 4XP5H 5JPMA 3MJ8B 4JKMA 4M5YH 4MSWB 1WICA 3BI9X 2Z91B 3GJFB 3HHRB 3D18A 4CGTA 4JPIA 4WWID 3LEYL 4MCZB 4YHNA 3UMTA 1TMCB 2X4UA 4MA7L 4PG2C 3R06A 3O6KL 3TIDB 1QEWA 1YN6B 5T1DH 3K2MC 3OKDA 4GAGH 3W11C 4KMTH 2Z31C 3V0WL 4LASH 1A7PH 4UOJA 4FZEL 2XTLA 5D7JA 4E41A 3ARWA 4Z7NE 4L9LB 3KDMB 5ACZA 5DJ8B 2HH0H 4RAUB 2F8OA 3BEWB 4JM2B 5GRWA 4CUCA 1R3LB 4WW1A 5CZVH 5DJ2A 3KJ6H 5GZNC 3GSXB 3D9AL 4MX7B 4X4ME 2CMRL 4YHPB 5EUOF 2D7PA 2Z8VC 5I66A 3WLWC 4YAQB 3DSFL 3ULUL 4U1GC 5SWSE 2C1PA 3LCYA 1Q38A 3DX8B 5CSBA 5CGTA 1AO7B 3U9PL 3SGKC 4CKVX 2ERJB 2PYEE 4KQ3H 4XPBH 4OGZA 3VFSB 3MV7E 5FGRA 2P24B 5J56B 3BD3A 1H8SA 4NM8H 4OQ1A 4BH7B 1NGZB 3T0BA 3O45B 4IMKA 3BW9B 1IM9A 4MNQE 5F9JB 4KK8D 1OW0A 3KLSA 1BJ1J 3F7YB 2HRLA 3S88H 5IEKB 3E6HB 5DHXB 5FK9A 2OR9H 2M1KA 1RFDL 2ZUSA 3UTQA 5DFVD 2AJSL 3DIFB 1UWEL 1AE6H 2P8LB 3LQAH 4WFHE 2WM0A 4HFWA 5D5MA 2JTDA 2CRYA 5IMKB 1BVLA 1CZ8L 2Q76B 4NUJA 1OF2A 4DVRH 1T22B 3N85L 3ZTNH 4U1GB 1MHEB 2FJFB 1T1ZA 3H3KA 4F7PA 2VLJE 4K55A 3QNXA 1T5XB 1Q9OB 5CGMA 4FFZL 2EIBA 4H20L 5DFWH 1JPGB 2VMFA 4HCRH 4G7YH 5HHMD 1G9MH 5FM8A 4FQIL 2JF1A 32C2A 1WBZA 1JGEB 4HIIB 1L0QA 3UYRL 3WN5A 2OP4L 4Y5YA 3X12A 5T33H 4HS8H 2B5IB 3KJ6L 5AD0A 4PJIE 4KHTL 1U8QB 3B5TA 5ANMA 3OF6A 4PRNB 4WHYG 1K8IA 4FQXA 1MUJB 1XGTB 5E8OA 5IW1B 4D9QD 2AS5M 3TO2A 4N90E 3P73B 3FT2A 1BBDH 4HMEA 2PO6B 3GKWH 3LVEA 3PHOB 5L7XH 3W5MA 3JV6A 2FL5B 5KS9B 4AQ1B 1FH5L 1T21B 4HBQA 1ZWIB 5TQ0H 5H37H 4D8PB 1GZPA 4YDJB 4BZ1H 3HI5L 3MXWL 2EH7L 4BFGA 3NFNA 1I1AA 4PG2A 1U3HB 5IESL 3PWVB 3P73A 5MEPA 2HP4A 4F7TA 1HOCB 1YEKL 3IAQA 4HXAL 3FN0H 2PO6A 3CUPA 4LLYB 4XVJL 2AJZA 1NGZA 1Q0XL 3BE1H 2VJXA 5BVJB 4UIKL 1BP3B 1GGIL 3O8XD 1LE9B 4PJAB 1M6OA 3B9KC 4FP8L 4PJHA 15C8L 4I3GA 1CR9H 3C8KB 3KS0H 1D5XB 4EN3D 2F53D 5DC4B 1T20B 3QO0B 4WV1A 4G8GD 4GG6E 1AI1L 1R3HB 1JWSA 3BH9B 3P9LA 1I9RH 4AH2B 2AJ3A 4AL8H 2E7CA 4IMLA 3QXDB 1JL8A 3CFDA 1MQKL 4NO0B 3PNWB 1J86A 5DWUH 2BCKA 4RWHA 1YQ2A 3OHXB 3STLB 1ES0B 2GJ6E 2J5LC 3WHXA 2LAAA 3BP4B 4PJXE 4V2BA 4Y1AA 1IEAB 1XF3B 5A40E 4NNPH 5ANME 1IL1A 2MTPA 4J7RA 1EPFA 5AWNH 2Z4QB 1AR2A 1UJ3C 5DHVA 4LHUA 4LQFH 4FQQB 1MCFA 4JDTH 2NZ9C 4LEOA 3D5OF 3PGCA 1X3DA 4C56B 3WHXB 4RRPA 4GG6B 1RI8A 4WI5A 4LGSB 4GRMA 1VSCA 4NO3A 4Y5YC 3NCMA 5I1GH 1MFAL 4GW5B 3NCJH 1EVUA 3U4AA 2FL5A 4Q74A 4LQFL 1J1PL 4MWFB 4RFNC 4PD4J 2FJGA 4PP2A 5GRUL 2HJFB 2UVEA 3QWOA 5C09B 4U4BA 1L6XA 5I16B 5BS0B 4UB0H 3FHAA 4HLZG 2HVKA 3VH8G 4ZS7L 4RISL 2FSEB 3ARFA 4PTTA 4I5BA 4K2UH 4KXZI 4PJBE 4U2YA 5J1AA 1SM3H 2C3VB 2ZUWA 4OCMC 2ITDB 1ACYL 4K3EH 2R29L 4N0CC 5E7FA 1ETZB 1DQTA 2PF6A 4WUKH 1HHKB 5F3HA 2HJFA 1V7ML 5GZOD 3ULUF 1AR1C 3MBEB 1KJ2H 5F9OL 1UWXH 5C6PB 3U0PA 3HLAB 1BZQK 3Q3GA 1ZSDB 3VFTB 2EEAA 1LP9F 3QG7L 1DN2A 4R2GD 2J3SA 4LMQI 4QRQB 4WHCA 2YA0A 2EDHA 3SJVD 1HHHA 2A73A 5F9DC 5JPNA 2Q86B 5DD3H 3P2TA 1R5IB 1G9NH 2X44D 3BYYA 4AEFA 1KCVH 2Q7NA 3EYOA 3O3DA 1C1EH 2CKBH 3GM8A 3VRIA 4MNGA 4XNUH 5CP7A 3BT2L 3UTOA 2E9BA 3B9DA 4EDXB 3CVHB 1IGMH 3GIVB 3TO4B 4LLUA 5DMKA 1B4JL 4FQ1L 2BVQB 4X4MA 3LKOB 1Z6JT 2OCFD 1S5IL 1C12B 1MWAL 1R5WB 4LVEA 4JO3H 4X6DE 3I6GB 3IFPB 5CKGA 3OJDA 3OMZA 4ZUVB 2BJMH 4KHXH 2GFBB 3VH8B 3R8BB 4JVPA 1UCTA 3L3HA 2CLZA 4K7PX 5D71H 3KPRB 1FZJA 2QBWA 3BZFA 3I50L 1Z2KA 1V8HA 3DX7A 1X5ZA 2FLRT 4OBSA 3NVQA 2NY4D 1YDPA 4UV4L 7FABH 1CD8A 5EN2A 3ROLB 4G9DB 5BW7C 3H42L 1DBJL 3WV0A 4K7PY 5TQ2H 1EJOL 2AEPH 4JVWA 2FX8H 3LV3B 1I8IB 1S7QA 2FYYA 2W9EL 4OCYL 4R3SB 3O4LB 5EU4B 3OKLB 4MNQA 4EUPH 3OR7B 1ADQH 1Q72H 5HI4D 3SDXE 1YQVL 1JE6A 1KCUL 1Q9KB 4XHJD 2VYRE 2WP3O 5EZIL 3V4VH 5DJ6B 3K2UH 1DDHA 5EBMA 1EUUA 4KI1A 1YDPB 1CE1L 3HUJF 1U3HD 2Y36H 5E6ID 3RWCA 2IAMB 5CD3A 5F6IB 3NFNB 4Z7UA 4PGDA 5EOCJ 5DJCA 4KQ4H 4Y2DC 1A9EB 3SKJL 3ALPA 1ETZA 2F19H 3QUMA 3OAYH 1FSKB 3H9HA 3O8XB 3QRGL 3CPLA 4QRRB 5F9WC 3VXQA 3MRCB 1NAKL 1NC4D 1W0VB 2CUIA 2R1WB 3KPMB 1WZLA 4FABH 4S1DC 1UQSA 2JJWA 4XTRD 1FGVH 1PSKH 1T1XB 5F96L 3S36H 2ED9A 4XWGH 4OKDA 4P2OC 4Q2ZB 1FP5A 3EJJX 3G6JB 4HV8A 3C5JA 2GJZA 1MCDA 5IB5A 4H25A 3PWUA 3QDGA 4H88L 4X6CB 3KYMA 4ZXBD 1QNZL 3QDMD 2P5EB 3U4BL 1K6QL 3EOBA 5T5FL 1PZUB 4JFQA 1RZ7L 4J3SA 3NFSL 4PJ7B 1XR8A 2LTQC 1QFWL 4UAOC 2H2PD 3RNQA 3EYQC 3C5ZC 1XF2A 5LQBH 3G04A 5D2LF 4IDJH 2WBKA 3IDGA 5E2VL 1MWAB 3T1FA 5KSAA 2GI7A 4N0YL 3FT2B 4LPCA 2HVJB 5CJQL 1RZIB 3DVIA 1GGCH 1IL1B 1EX0A 4KKCD 5ISZD 3ULVH 4PJGF 4MLSA 4F7CA 1BVKB 1XH3A 1XIWD 5IBTL 5KSBB 2NXZC 3DSFH 5HTSA 4NQEA 1URLA 3LKRA 4IS6B 1X9QA 1HEZB 4KRPD 3CDFA 3IDGB 2VABB 2CMRH 3G08A 1C8PA 3EOYG 1FAKT 4NC2B 1V7NH 5JZ7D 1J12A 3MLSL 4XZUB 4YNYA 2CD0A 4GXVH 4TUKH 1CGWA 5KVFL 1S9VA 2PN5A 1S8DB 2OTUB 2MCPL 1MJ7H 5BVJA 4X99A 5MENE 3HZVB 4FTVE 4JPVH 4NJAL 5C0RL 4NN6C 4FTVB 2I27N 3BUTA 3FQTA 5DVKA 5BO1L 3FT3A 4MDIA 3KJ4C 4NZUL 1VADA 3O2DA 4M7KH 3MODL 1DLHB 3RJQB 1E4XI 1JRHI 3K0WA 4J4PA 5FUZL 5I0ZA 1AGEB 4YXHH 1U8MA 3QUMB 4MB5A 5I8EA 5LWYL 4OCXL 2YEZB 2APTA 3NABL 1JPSL 4WUUD 3MBED 4HGWB 1Q94B 2ICWA 2NZIA 2PW1A 1DUZA 3GK8H 4M1DL 4M6ML 3T3MF 2XZQH 4LU5L 3GMNB 4I4WA 3ARBC 1LO2H 4NZRL 4YFDB 3QDJE 4CN4A 5C0NC 3N1MC 4OFVA 4HX1B 1R0AH 4GMSH 4MXQD 1M7IB 5MENB 5IVNA 2Q3AA 1TPXC 4WU5A 3PABA 3QUZD 5DD1H 3AVEA 4MJIA 1YY9D 5I8CA 4HG4K 5L2KB 2FR4A 4H26A 5CILH 3TZVA 1P7KB 4UTAL 1B6DA 5I2IB 3SKMA 1RJZA 3NOIA 5IR1B 2ZG2A 4YQXL 1J1XL 5MERA 4FHBD 4KTEL 1FNSH 3V6ZA 4GRWB 1IGCL 1I85A 1KF9B 5TFSH 1EEUA 3U6RA 1B0RA 2BY1A 4NKIL 4Z18A 4K23L 4UNVA 4DUWA 3LEVL 4CDHA 4XPGL 2YS4A 3HE7B 1F4XH 3GB7B 2UY7A 1HZHL 2CR6A 4QHNB 1OAXL 3JTSB 4MXQC 5I1JL 3QJHB 2XRAH 1LK2B 1N4XH 3CXDL 5SWZA 2F54E 3GSOA 5MHSE 5E99H 3BKCL 1OP5K 3T3ME 2W60A 4HWNA 3SPVB 1HN1A 3FTGA 4K23H 5D96C 4E0RA 4JKPH 4PJ7E 4NGHL 5JHLL 5HGBB 3DURB 2F9BT 1A6VH 1DQJB 1KXTB 1FNSL 4GQ9L 4K3JL 3ILPA 3PQYA 3O81A 5BVPH 4QF1B 5LJYH 2E6QA 4JM4L 4E42B 1IAIH 2CLRB 3S36X 4NRYA 1MFNA 3QDMA 5DURD 1ZGLM 4O2CA 3V6FA 1QO3B 5E1AB 1S7RA 5K9OA 4NKMA 1ZSDA 4MAUL 5FB8A 4RGNC 4OD2B 1A0QL 2AW2A 2ZZUT 4F33A 1F58H 2OJEA 5ILTH 4M5ZH 1FC1A 2D2OA 4YHMH 2D31B 4P46C 3D69B 1DSFH 5H94B 2P24A 43C9A 5I1HH 2VSCA 4ZUSA 4MNHA 1H3TA 4FXKB 4HZLA 3G5ZA 3TWCL 3U0WL 2H3NA 3B9EA 4RQQB 1E6OH 1IKNA 1NFDB 3AROA 1IZJA 5GJTL 1QPPA 2CIIB 1V3MA 1OTUD 2PO6C 2XWJB 3OAUH 1WAAE 2E7LA 3WSQH 2M8XA 3O2DH 5IHLB 4NKDB 1U8OA 4JO2L 4YFLF 2DJUA 5HI3D 1LO0H 2IC2A 3O2WL 4QRPD 2Q76A 1P5VA 5JUEH 5IFJB 4LHUG 3ZT7A 4WNQA 3WXVL 2CJUL 3UPCA 3FRPA 5ESQA 4IRJB 5DJ8A 4P23A 5IOPB 4RMQA 4WW1B 2FJHB 5D1XC 2F58L 4POZD 4TSAH 4RBPK 1IQWL 4OZ4A 4JLRA 4PB9L 2VUYA 2Z92A 1XIWB 2PUQT 1ZANL 1HSBB 2ZG3A 3TF7C 5C7XH 4OLZL 4A6YH 4ELMB 3MGTA 3V8OA 4JR9H 2XWBB 1NEZG 3GMOA 5HXMA 4PLKD 2JCCA 4XNMB 3KPSE 2EIEA 3P9WB 4O9HL 4DCQB 4U0RC 5IBLD 5JXEC 1XF5A 3BIAX 2AJUL 2YWZA 1FFPA 2CO6B 3D39A 3T4AB 5IQ7H 1KYOK 5IW1A 4OZIF 4H8WC 1NUDA 2PXYA 3PJSA 1RZJL 1U93A 3HMXA 1QRNA 2JB5H 1U92A 2I9LA 5BV7H 3VXQB 3MGTB 3SDXA 1UM6L 2VDML 5EIIA 4U05A 5LQBL 2FO1A 3THML 5GSVA 1C16A 2BSTA 1NBQA 1PG7W 5IROC 3TT3L 1PY4A 3T0DA 2WSKA 3GSRB 1BQHA 4MJID 2MMXA 2YD2A 1DQMH 4P2RA 3MV8E 2Q8AH 1BWMA 3MNZB 4M1CD 1ZHKA 3U4BH 4XAKE 5D5MB 3MUZ1 4CMMB 4W4NA 4ZFFA 4LSQL 1OGAE 4LSUL 5EU7C 5KW9H 3GMRB 1GCFA 4JM2D 1EGJL 4YEEA 2YK1H 5HSFA 5DJDA 4O2EA 4X9GA 1UXWB 4P5MA 4RDQF 3CZJA 5KOMC 5J11C 4K71B 2MFNA 1MFCL 1F2QA 3ZLQC 4S1RH 2VLLA 4U1LA 4F80A 4ZNEA 3HPJA 3UPRA 4D9LL 4KK9D 3LY6A 1I7TA 2YRPA 4XNZB 3GMLA 4JCMA 4X5XB 2VWEE 3P9LB 1ZT4B 2W91A 1YY8B 4Z7QF 1OM3L 2AV1B 3R0NA 4N0UE 5L2KA 2FR4B 4NQEB 5F1NB 2VDRH 5DD5H 4GXUN 4LPUA 1LO4L 1NCAL 5BRZB 1H8OA 1MAJA 1WF5A 1RIUH 3C60A 2ZNXA 3V0AC 3GJEB 2BNQB 3IKCB 5EZLB 4I3RL 5AUMA 5DRZA 5ETUA 3HAEH 3G5XB 3VD9A 1DE4B 1JGDB 5K59F 2HJKA 1W8OA 4K7PH 2HFTA 2NTFA 4CU8A 4WV1C 1ZT1B 4OLVL 1YJDC 5DK0B 5DA4A 5D7IE 1PJ9A 2WBWB 2GJ6B 4MQ7A 4TVSa 4PJ5E 4YBQC 3QUYB 4QTIL 5FM5O 4PS4H 3GUTA 3PWLB 3ARRA 2W1NA 1R3JA 3E3QC 1QQDB 2XQYK 1KXVC 2J88L 2EDEA 4G6AC 4HGWA 5AZ2L 5EUOB 1IGML 3MV9D 1DBMH 3O45A 3HMXH 4YPGA 5C0JA 5E5MA 2VOTA 4JN2B 2OBGA 2V17L 5ALBL 5HHMB 1GSMA 1IM3A 1Y6NR 3ES6A 4GQPH 4KAQH 3UTQB 3QCTL 1EFQA 3MLVH 2IG2H 4DW2H 4U7SA 3TA3A 5GS2H 1N0XH 1JTOA 1HXYB 1NMCC 5HYIA 5B4MC 3HZYB 3TBSA 5I8CB 1P4IL 3CFDB 2E9WA 5DEFA 1E4XH 1WZ1H 1G7LA 1A2YA 3BPCA 4M8QA 4RQQA 1MF2H 3HMWL 4XHQA 6FABH 3TJEH 2E9IA 1RHHB 2VLMD 3P0YL 2ZSWB 4WJ5B 4TPRH 4LCIH 2VAAB 5IB2B 5DZOA 5TE6H 5E2WL 1WUNT 2C7UB 3EHBD 1T5WB 2N7AA 4LVOB 3MNWB 1U9KA 3SN6N 5C09E 1R5IA 4Z7VE 5DRXA 3GHBH 3OKEA 4HUUB 4MJ5A 2C1PB 4RISH 4PJDB 4V1DB 1MAMH 1A2YB 3BPCB 1D9KC 2XXMB 1OP3K 3L6FB 1KNOB 5BRZA 2BXYA 1L9NA 2ICCA 4EOWL 1FZOB 4HWBA 3EDKA 2UV3A 4X4XA 2BOBA 4DEPC 1KG0A 2GY7B 4Y7MA 2FZ3A 1H8NA 2P5WD 4HUNB 1UVQB 4BA8A 5J12C 1G9MC 3RA7H 1BZ7A 4JM2C 1UCBH 2PYFA 2AK4E 3DMMA 3F7YA 1KELH 1QPXA 5C0ND 5H35A 1XF5B 4OB5H 3WFDH 4PIRF 3KVQA 3QCUL 3QI9C 4EBQH 3ARSA 2F74A 4U6VL 1EEYA 3M8OL 3RGHA 3VMNA 1FFNA 2N1KA 4NSKB 4RMUA 2H32B 1OAYL 3PQYD 3MBEA 5DWUL 2RQ8A 2GSIB 3T8XA 1WC7A 5J9PA 1K3IA 1OAZH 3QIUA 1ED3A 2FGWH 2KDGA 3U0PB 5ITFB 3C60C 1JFQL 5EBMB 3QQ9D 1K2DB 2WWKO 5D7JC 5D8JL 3PGDB 4MA1B 4QNPE 1PKQA 5EOCH 3CSBA 1GIGH 4WCYL 4P46D 2QEJA 3LS5H 5E8PB 4DN3H 1NUNB 1MEXL 2AJ3B 1KN2L 1HWGB 1U91A 4PJIA 35C8H 5CBEA 1T0PB 1F4AA 5HHNB 3A6BL 4P4KB 5A16A 1XCQA 2ZUYA 5T1MA 3QZWB 1WC7B 5J9PB 1CFTA 2DI9A 4GRWH 3SE9L 5A2IH 4ODXB 1EUTA 4YC2B 1IAKB 5HGHA 1P4LA 4Q2ZA 2EKSB 2OI9C 4WHTB 4NHUB 2HKHL 3ARDB 3V52H 1FYTE 1HSBA 3ZKXB 1JHLH 4WGVB 3JWDL 5D1QA 4NQED 1IZKA 4GRLC 5CEZL 5TQ0L 4F37F 5FYLE 3HC0A 1C5BH 4JQIH 1WIUA 2DQCL 1JTPA 4OZHB 1FPTH 3GKWL 1TZIA 3QNZB 4QHMB 2X70A 2NY6C 1PBYA 2P5EE 4GKNA 3MRNB 3BWUC 2G60H 3KNBB 1KT2A 5F1SA 1JK8B 3BKYL 4ODSH 1WAAA 2B4CC 2XTJB 3WHE0 4EVNB 1NCUA 5HDOA 5C3TA 1WEJL 2HN7A 2NMSA 1FL3A 2F53E 4L1HA 4M61A 4XMLH 5DJ6A 5CP3H 3F6LA 1YPZF 4BK4A 1KB9J 1T7VA 1JI2A 3CIQA 3P9MA 4G6FB 4OUUA 5I18L 5HGDA 1F4WL 1GC1C 3MRBB 4ZXBA 2OMBA 3U48A 1OB1A 4KK9C 2BY2A 4YC2C 4QHMA 4HJJH 4G7YL 3VXUB 3MLYL 1G7QB 4GW1B 3H6JA 4D94A 5ERWB 4Y5VC 3MA9L 4BH7A 5FYJH 5E4EC 1FJ1A 1JZ8A 4YPJA 3B6SA 3SJVE 1LEKB 1KOAA 1BBJB 3EW3B 3N85H 5I1KH 4XPFH 4RSVA 2GJZB 4PGEA 1K8DA 1YEJL 2KL6A 3MV8B 3EO1A 2VC2H 3SQOL 1UB5A 3VXUA 4ONGL 1OP5H 1XGQA 2NY6B 4OZIA 4FQ2H 1NGXA 4PRBB 3O3DB 2Z91A 5DHVB 1XCQB 3BO8A 3DXAA 3OPZL 3OKKA 4EDXA 3QXAA 4YO0A 5L88L 1IAKA 5KJRH 4YDVA 5HHXH 1F3DJ 4HWEL 2AJVL 1IBGH 4FG6D 2OZ4L 5CEXA 1QEWB 1I9JL 2PYEB 4MCYA 2HKHH 3BIBX 3MREA 4L9DA 4D0CB 3FO1B 2BSSA 2MWCA 1BHGA 3CVIH 5MI0B 1S7SB 1DEDA 4EI5C 5E4EB 4NQDD 1S7TA 2VQUA 5CEZE 2IAMD 3T2NH 1MHCA 2FSEA 1RJZB 3ARFB 3EDDA 4GSDH 4NIKB 2D9CA 5KS9F 1R6VA 3V4UH 3IETB 3JV5A 2DJSA 4GKNB 5ENWB 1EBPA 5HDQL 5MEQA 1NC4B 1S9VB 3MACL 3MR9A 4HSQA 3OBAA 1SBSL 4FXGB 3T04D 2ADGA 1FFOB 3B9KD 3MRPA 1H3VA 4O58H 3PGCB 2AABL 4L4VE 4PRPE 1YEIH 5HJ3B 4TQEL 1WQVT 1U3HA 3OTTA 5L0QC 3MJ9H 1RZGA 3UBXA 3QUZA 3MRQB 2Q8BH 1NAMA 2DKUA 5IMOA 3RVWD 5HGBA 1ZLWK 4HKBA 1AQDA 3ARED 2M26A 2ITCB 3UEZA 5JXEA 5H2BA 2R0WH 4I0CC 4ZNEE 1DUZB 2VDLL 4ORZC 4XNYH 4YFLI 5BMFL 5D7SH 1NUGA 1U3YA 2X9WA 3AREC 5C0AE 3F7RA 3QHZL 5D1ZB 4D0BB 4YHNB 2DQTL 1QYGL 4FNLH 2DQFA 1S5HB 4R7NA 3IDJB 4KVCL 4X4YA 5IMOB 4JFEA 2BK8A 1A5FH 3TBWB 4IMLB 5IGXL 5F7LB 3DI2B 4HIEA 1F6LL 1TJHL 4HZLB 2A38A 4ZUUA 3O6ML 4Y4FC 4KPHH 3RAJL 3OF6D 3SKOB 3MO1B 3RI5F 2E9JA 2L0DA 2V2XB 1CFTB 4NQEE 2NW2B 5BXFA 3SDCA 2E3VA 3E6FA 5DQ9B 5I75C 2GY5A 3LH2L 2HJLB 3DTXB 1JPGA 3IDNB 2IQ9H 5F3BB 2OZ4A 3TBTB 3P0VL 5F7DB 3IAGC 2MQ3A 2DDQH 4Q9QL 1S7SA 1CICA 3BEVB 4JG0H 1DJSA 3VFMB 2H2PC 4F57L 2XKUA 1BFOA 4OCWH 3ZSSA 4R8WL 1MHCB 3WKNA 3KPOB 3T2OA 3CU1A 5FYJE 2VIRA 3KPQA 1RZJC 1IKFH 4KFZC 3O9WB 4LVNC 3DGGA 4J23A 1QBAA 1H3UA 1S7XB 4R0LA 5HHPB 2YPVL 2XTJD 1GPOH 1CGXA 3MC0A 3HRPA 3PV7A 4Z5RA 5MEOA 1M7DA 1WTLA 4JFHE 4XPHL 5KS9A 2H32A 4N8VA 2FH6A 1X6LA 2F5AL 4ACPA 1B2WL 2AKRA 2VL5A 1CLOL 3OZ9H 3R4DA 1E6JL 4UTBL 4TVPD 3PP4L 5DK2B 4FXLA 3QDGB 4X6CA 3QUZB 4YGAB 5LGJB 2JKXA 3PJSB 4XPAH 2AV7B 2BRRL 3BOVA 4JZOB 2DM7A 3LDBC 1G7QA 2IALB 4PJCE 4XB7A 2XPGA 1BFVL 1REIA 1EEQA 1BLNA 2DMKA 3S37L 4K7PL 1M6OB 4PB0H 1MREL 1ZA6A 4D0DA 3HNVH 5CEZD 4MAYC 1IGIH 4NN5B 5CSZB 2CUMA 2ILLA 1U8NB 2NY6D 4RMWA 5JA9A 2GT9A 2D9QB 1YEDB 2ZKHH 2NLJA 3JUZA 1LO4H 2X4SA 5D7LD 3WDJA 3VW3L 4HC1L 1TCRB 4RGNE 5LCVH 4QHKI 3FMGH 4ONFH 5EZOL 5ICXB 2ZCKH 1KJ3H 1U95A 5DA0B 3EO9L 5GS1B 3ULVE 3QULA 4OZ4B 1FV1A 4ZQKA 3BQUB 1ZLWH 3LZFL 5CEXB 3IFLL 3LS4L 5DURB 4POYA 3HUJA 4F2MB 1C7TA 3MX0A 2DQDH 5C6TH 4URTB 3K1DA 4R97B 4IRSD 4PJ7A 4Z7VB 5I0DA 1H5BA 1JI1A 2YK1L 1ZWIA 4ZTOH 1HIML 3KPQB 3M45A 5JR1H 1QSEE 2VDQH 1ZLSL 3D39B 4J6RH 3T4YA 3T4AA 4OIIH 4LIQL 4NC0B 5T3ZD 3CMOL 2BDNH 5FCUH 1J8HD 2BNQA 4YDLC 4AQOA 3VGGA 3GBML 3CXHJ 4ODVL 2DQIH 4M7LL 5DUML 4W6WB 5JQ6L 1KBGH 1H5BB 1CDJA 3L1OL 3DUUA 5FV2A 3FB7B 1CL7I 4KV5F 1HEZA 3QISA 4MJ4A 4ETQB 4BH8A 2HTLD 4WFEE 4B41A 2DYPD 2P8PB 4QTHA 5IK3A 5JOPE 2DWEA 5CJOH 1P9MC 2D0GA 3GNMH 1ITCA 4HIHB 5CP3A 1D9KB 2BDNL 5DLMH 5FCUL 3VXME 3KLHD 3JVGC 3P4NA 4X98B 1RZFH 3GMPA 1AGBB 1ZA3B 1J8KA 2VXUL 4R97C 1CFSA 3BIKB 4OLWL 2X4OB 3NCYP 4MDIB 4NO5B 1LE5A 5ALCL 5L9DH 3IFNH 1MAKA 5B3JF 5TE4H 1RD6A 1T1WA 3KYKH 4YDKL 4H0IA 2HRPH 1OGAA 4HGKC 1EXUA 1U8IA 2R23B 5D7KD 5MHSD 2PKDA 2ZPKL 3C6LD 1O7SA 3QIUC 4MHHI 3NIGE 4DGVL 1MY5A 4KY1H 2AQ1A 5DF0A 3TYFB 1T83C 1DEEA 2C9AA 3EO9H 4MNGB 4MJIE 4QRTA 4GRLA 3AY4C 3LKPB 5JW4M 3JV0A 5SX4H 4GRWF 4XVSL 3PXJA 2DLFL 3EO0A 1SYVB 3F5WB 4FN0A 2J4WL 5JIIA 3X13B 1T7XA 4YXKL 3MR9B 4XC3L 3T0VA 3RDTC 4DOHE 3FRPG 1DN0A 4F58H 1KPVA 3S4SA 3HZKA 2X4QB 2VXTH 1KN4L 4UBDD 2UWEF 5C71A 4X7FC 5E6IA 3B3IA 1QR4A 1RUKL 1J0IA 4OV5B 2ZCHH 5D1XD 3AAZB 2FIKA 3FB5B 4G9DA 4MX7A 5DHYB 3U1SL 3BHBB 1JMZA 2J5LB 3QXUA 4S1SH 3X13A 3T0EE 5AYQA 1EO8L 4XPAL 5B21A 4H1LH 4ZAKD 4YGVB 2Y5TB 4IOIA 4OZGF 5C0IB 3P0GB 2ENYA 5C86A 3HZKB 3BKJL 2IH3B 3T77A 1HXMA 3DMMB 5CUSH 1ULVA 1DVFC 4X9HA 2F53B 3WS6A 3QDGD 3ZDYF 2HLAB 3NIDF 3RWHB 1SJEB 2B1AL 4ZMAT 1J05A 1GPOL 4HUMB 5GGTA 3S7GA 4G9FA 1GAFH 3RWFA 1BIHA 2IALA 2RAMA 4HQQL 2H41A 5DFVC 4CNIA 3CFBB 4U1JB 2CKBA 4K9EL 3VFGL 1FYHB 2COQA 3MV9A 4WY7L 1FC2D 2KPNA 1PAMA 1J8HA 2BNQD 3CMGA 2WAHA 3MRHB 1I3UA 4ZOBA 4YWGL 1UM5L 1QRNE 5KN5B 4FZ8H 1AO7E 4JO4L 4L29A 3WJLC 4N5ED 3QAZB 3DRQB 3TH4T 5FECA 1QA9A 3WUWB 1ZGLP 4DUVA 5JORA 2A9ML 3LD8B 3EDFA 1KIUA 2FGZA 4DKAA 3QUYD 3HNSL 3BVNA 3QR2A 4C56D 5HDBF 1YNTA 4I18C 1X5LA 4CMHB 2W9DL 3GSXA 5HI5C 1DVFB 1FNLA 4BFEA 5FGCB 1ITBB 1OW0C 2LAGB 4WI4A 5HHVL 4YK4B 4NBXB 1BQSA 1I7RA 4N0UA 2EE6A 4XI5C 5L2KE 3DRQA 4J3OC 5EU3A 2K1MA 5FECB 5KVMC 2BNUB 5IMLB 5EZLA 4IRSB 2DI7A 3IDUA 2D0FA 3HNSH 4HT1L 2A0LD 2I9LB 4XCEA 1T0MB 3C9NA 3IXTB 1VGEL 4U6HA 1JNHA 1PDKA 4G9FE 1R24B 4UDTB 3QJHA 2IFFL 3V5HA 4XP4L 1FRGL 4HPYH 4X6CF 3VGAB 3OR6A 3GRWA 1A9BB 1QFWI 3FN3A 4YHZL 1EEZB 1R3IL 2J6EH 1LEIA 4YWGH 3MRDB 3TN0B 2K7QA 1JHTB 2DMBA 4EQ3A 1OQXA 3DYOA 2YMXH 4YHZH 4C83B 2EYSB 1QQDA 3EYFA 4KKNA 3S34H 4U6HB 4C4KO 3AY4A 3RWGA 1RV6X 4EI6B 1AJ7H 4LNRA 3VA2C 2DYPB 3MLXL 4TVPL 4LARL 3UTTB 4EN3C 3BAEH 5HGGS 4R4FL 1KLGA 5DMYA 3KWWA 5EBLA 4V1DD 4Z95H 4BSWB 2NY0C 4J3TA 3L5WB 5KTEH 4DKFL 4U1SB 4ZS6D 1RAMA 4APQB 1JN6B 3AB0C 4AMKH 4NUGL 4F8QA 4QHLA 3FFCE 4KKLC 4LL9A 3ILQD 4W70A 4NPYA 4L29B 4S11A 1P84K 1K8DB 3IKCA 1VFOA 1KEGL 4QRPA 2VISA 4I0PB 4Y4KB 4LFHG 1JGLH 1R3HA 4M3JA 3KPRD 4POZC 3GKZA 1P7QA 2YUVA 3FRUB 3QG6A 4JFOA 1X5JA 3HC0B 4PLKC 1EFXD 1HILB 3G6AA 4K9EH 1UEYA 3ARGA 3MROA 4BZ2H 3H7BB 1R5VA 4WWKB 3LKPA 2CDFB 3RIFF 5DS8A 4DGIH 4JFDE 1CD9B 3GM0A 2DLFH 3D3VD 5FA4B 1KCSH 1VESA 3STZA 4UMGA 3UPRB 1C5DA 4LSPL 3F58H 2B1AH 3SE4A 1NCDH 1A6WH 3OKOA 4XCNA 3KR3H 2VC2L 2XA8L 4N5UA 2XV6B 3C08H 5KANI 3O4OB 1OTUC 4FA8A 1RUPH 4CN1A 4N8CH 4R7DB 5E6IB 3QRGH 2CDFA 2B8OT 4PJEA 3PWNA 1P2CA 4RGMB 3TZVC 4W4OC 1AD9A 1OVZA 4Y8AA 3STZB 3HKFA 1BAFL 1RU9H 1RMFH 4L8DA 2YZ1A 5FUOL 3D25B 5EIIB 5E1HB 5F44A 3FFCB 2E27L 3CLFH 5HYSB 3ARZA 2ADGB 5ICZA 3MRLA 4S1DD 3GHEL 4KJYA 1VEOA 4OQTA 4NKMB 3ARDD 3CC5A 3DVFA 2P5ED 3MGOB 1FIEA 1OPGL 1MJ8H 2XI9A 2Q7YB 2EYTA 5K9KB 1Z9MA 3IJSB 5IJKC 1MFDL 1RIVL 4OLXH 2DLGA 4LLVA 5KZCB 4PRID 3VGDA 4NJ9L 3VE0B 4MJ6A 3HB3D 5LGHH 12E8L 3NPZB 4MS8C 3TYGH 5HHNA 4BZYA 3TJHC 1U3ZA 4ZODA 4JQIL 1JZ3A 2AJXH 5C0CE 1T5XA 3IF1B 4GXUM 4M6OH 4QRQA 2BVYA 4M93B 1S5HA 3B2VL 1YPZB 2W59A 2IBGA 3O11B 5C0FB 5ISZB 5D7IF 3W39B 2E5EA 4LLVB 1MOEA 4G8GA 5FCSH 5I15H 4J3UA 3S4SB 4G6FD 4LAQL 4KRPB 2DQDL 4R90H 4PUBL 5EOTB 4L3EB 1YY9C 3LZFH 1WFTA 3SDDD 2VLRD 3BX7C 3LOWA 2CQVA 2A6KA 4DGYH 2P5WE 2P42B 3F12B 3NCYS 2FEEL 4WEUD 5EU3B 2WIIB 4RAVA 5I1AB 1A8JH 4FXGA 2HAZA 5ID1B 4F9LA 1VEMA 4KKLD 3DX7B 5J1SC 2CRIA 2N4IA 1BJ1H 4F15C 2V5TA 4K94C 4XXCA 4LARH 1SQ2N 4N5EC 4ODVH 2DLHA 5A2JH 3CFKA 5D93C 1FZOA 2D31A 3VXSB 3E0GA 2CDEA 1FZMB 1I1AD 3F12A 4ZUWB 4F8TA 3IVKB 2ID5A 1RK1A 1DQLH 4DJMA 1YA5A 4XMKH 3I3BA 3HE6D 3UTZA 3HRZA 1MCSA 1EMTH 1A22B 3CDCA 4LNVA 3O41B 4U1MA 2UZIL 1YJDL 4OQTL 3RX7A 3VJ6B 1SMAA 1J0ZA 4GS7B 4QRSB 3MNZA 2IFFH 3OZ9L 4AIXA 3CH1A 2BP3A 4JHWL 5E08H 1FZMA 1Y18A 5D7LA 1FDLH 4JKWA 4MA8L 3WIHA 1AO7D 1AFVH 4PY7A 4G43A 5L2KD 4JGMA 1KLUA 3ARFD 4KDVA 1FCGA 4NO0A 1IFHL 3O4LE 3ZT5A 5CWSB 1HCFX 4LLUB 4X9BA 2YPVH 3SDCB 1HQ4A 3CFJA 3PDDA 2X4UB 4PJEE 1G7MB 2HJLA 3DTXA 4FQXB 3LN9A 5CSZA 4N0UB 4NNPL 4LLQA 4UILH 2D03H 5D93B 3RWEB 3H3PL 1X4YA 4LSDA 1PX3A 5F1IA 3RL1B 1J9CT 1TQBC 3GMOB 3MRIA 4NBYB 4KJQD 1QFOA 1JF1A 1XGYH 5I1LA 5IV2A 1UM5H 1CL7L 1J0HA 1RSFA 4KKCC 4EJ1C 2EDYA 4R26H 5GS1A 5EOQH 3B83A 2IPUG 3QIWA 4P5TC 4IOFC 1JF5A 3MUGB 1A6UH 5IWLC 1PEZA 1ODAA 1BX2A 4UU9A 3L9RA 4HMCA 1BQLL 4FP8H 2VDOH 3I75A 4WI2A 5GRXG 3VWJB 3VI3F 1L6ZA 5FO7A 2NTFB 5IT2H 3BXNA 1A1OA 1YMME 4OF8A 2DYPA 3QNYB 1KCLA 2FBJH 2I5YH 2YUZA 1OWRM 1ZMYA 2VXVH 4CMMA 3HPLA 4M9PA 1RZGB 1JWSB 3BH9A 4B7IA 4GLRI 4OZIB 1BF2A 4QRRA 1A4JB 1IAOB 4JO1L 4JM2F 2RR3A 1JHKH 4RZCA 2YN5A 1DQDL 2DICA 4Z7WF 2R8SL 1TVDA 3K7UA 4GUPB 2FEDC 2P5WA 1NFIA 3H9SA 3JWOC 4PTUA 3HPJB 5DVMA 5GGQL 5KZCD 4QRPB 1DLFL 2DWEB 4O58L 3RZCA 2VQ1A 4DAGH 3PUCA 4P49A 4XCCH 2Y72A 2NLJB 2AJZB 2NR6C 4WFHD 3HZMB 3EYOB 4P4KA 4IIQA 2JJSA 4TN9A 5A16B 5BCAA 1AGBA 1ZA3A 3NAAL 4GMTL 3G6DH 3ZO0A 1CGSL 1VFAA 5DD0L 1KB5H 3A0OA 1SBBA 3ZE1F 4QCIB 4F3FB 3M07A 2IFGA 1XGPB 2OQJB 2B1HL 4P5KB 1T5WA 4XVTH 5GGRA 5GISH 2R69L 4RMSA 1CK0H 5EC1A 4ELMF 4PUBH 3EJYD 1DEEB 4L8SC 4Y4HC 3REVB 3N1QC 2Y06H 4PV9B 2DM3A 5E56A 5EU6A 4H5SB 5ALCH 1Q9LB 5IHZA 3V6ZB 2YPKB 5KAQF 2HT4D 1JNLH 1OTSC 5HHXL 3MRGA 4IOSD 4XRCB 4X6DB 1I7ZA 1R3JB 1XR9B 3EGSB 3KXFA 1MFBH 4JN1L 1LK3L 1I4FB 5C0AD 4UOW1 2VZTA 4GKZB 1XGUA 2R9HC 5F7HA 1FL5B 4I9WD 3VFTA 4OUUB 1HINH 3S9DB 3G5VB 2WWMC 3VDCA 4BKLB 1OB1B 5EC2B 5IBUB 3WUWG 5IB3A 2J2ZA 1I1AB 1B3JA 2FIKB 3FB5A 5HDQH 4EQ2A 4LEXL 1CS6A 4YZFF 2H8PB 4Z7NF 3VXSA 4Z7UB 4R6UA 5IVZA 4GW1A 3D0LB 4NKQB 1RZJH 3ILPB 2ZP0T 1QRKA 2CGRH 5DMIH 1JZ4A 3E1F1 3VXPA 2HG5B 4KROC 1ORQB 2ICWB 4RBPH 5EO9A 1JPST 3L3OA 1TJGH 5CZXC 4M8QB 4JFXA 5T1KA 3SE3A 4GUPA 2MQCA 4J6RL 5IIEB 2B39A 3WIHL 4J3WA 3C8DA 3K8LA 4HIXL 3UXFA 2MPAL 1EAPA 1HYRC 2HLFC 2VH5L 3D69A 1IBGL 2R1XA 1I7UA 1J05B 5IW3A 4J1UA 3FQUB 1NFKA 4OM0H 1RK0B 3ULVD 3PE9A 4HMDA 5IEHA 3FONB 5E8DH 4FQXD 1T1ZB 4PRDA 2GAZB 1T2JA 4GAYA 3TV3H 3F58L 4Y2OA 5T1DL 2BVUA 1MFDH 2Z31B 1QLEL 5EA0L 5EORL 1HNFA 3NIFF 4MA7H 4Z5RB 5MEOB 2OK0L 3RFZC 4V2CB 1INEH 5CEZH 3L95A 1XH3B 3PGFL 3QEQB 3BDYL 3VFUB 3FAWA 4HUWB 4QHUB 1VDGA 2QHLA 2IGFL 4OV5A 4HCRA 4KUCF 3WFCL 1X5HA 3BDBA 1X5IA 3DNKA 4HPOL 4Y5XC 3QFJD 2E27H 2X10A 1L0XA 1QP1A 3AUVA 3CFKB 5AAWA 5CD3B 2P1YA 3L5XH 4WEBH 3A67L 3TBTA 2P49B 1F45A 5FM4A 5I73C 2CK0L 1RK1B 2ZOLB 3HC4L 2YUXA 4NUGH 4JO1H 2Y5EA 4IIQC 4HUXA 2CRMA 1U0QA 4PY8J 4XMPH 4RX4D 5HI3C 4PTTB 4TSCH 2YUWA 5EC2A 1I1RA 5IB3B 5EOCL 4YDIH 4LKXB 2YA1A 1AP2B 3MUY1 5KVDH 3LKSA 1ZHLA