4XPGL

X-ray structure of drosophila dopamine transporter with subsiteb mutations (d121g/s426m) bound to beta-cft or win35428
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dopamine transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpgL01
3KYKH 2F74A 4NCC2 1VPOL 1X5YA 3MNWB 2HRLA 1QFPA 4WIQA 1MREH 2HT4D 5E03A 2EDDA 5A2LH 4BELD 3U7WH 4M6OL 5HJ3B 1U91B 1BJ8A 4LPUA 4R6UA 1VFOA 1CD1B 1FNEA 4J3WA 4PJCE 3SQOH 1W72L 2P8MA 3P4LA 4JFYA 5DMKB 5E95B 3AY4A 1P4BH 4LVOC 5D2NC 1K9TA 2Y5TA 5F96L 3ZKQD 5FA3B 3QIBD 1CU4L 3I84A 1FE8H 3M1BB 3QFJA 5EDXA 3G08A 4YIQB 1CWVA 3D0LB 1MCNA 1TMCB 1LO2H 4ZTOL 5KVFL 5AUMB 2J7LA 2F58L 3BD3A 5GS1B 3AM8C 4LLVA 1P5VA 4K3GA 4BM7A 3KHQA 2ORBL 2ZG3A 4F57L 3OHXB 2GUOA 1OGTA 2WWMC 2WIIA 3A6OA 4OI8A 3O2VL 1CL7I 1I1YB 5EC2A 3UTQA 3WJLA 1YEIH 4WW2B 3TYGH 2A73B 5KVGH 3NFSL 4LCWE 5CEYA 1R3HA 2YKLL 5I71B 2KPNA 4Y16C 3L5IA 2MTPA 2HVKB 3V5DB 3ARGD 4OKVA 5L2KD 3L7EB 3EYSL 3V7AG 1LD9B 3S9DB 2APWA 4EXPX 4MAUH 5FV2A 5GS0C 3ULUF 2FO1A 1I1AB 1SJXA 3MRJB 1JI2A 3Q3GB 2CIKA 3DSNA 4ZUTA 1KEGL 1D5BA 5DUBA 4EN3A 1IT9H 4JR9L 2BVOA 1JRHI 5ICYB 1JZ4A 5JHDE 3TN0D 4OZIB 3HNTH 2VABB 1XGYL 5E94B 1U8KA 2VDQH 3OF6D 2O5ZL 1WT5A 4FN0A 4C83A 3RTQD 4U49A 1XR8A 3SCMA 1XGPA 4NDMB 1NMCC 1X4YA 4G9DA 1EHLL 4LFHD 2DYPB 4KKLD 1A7PL 4KDWA 4L3ED 5GS0H 3CH8A 5ADPH 1QFWI 1VFUA 2YN5A 1JRHL 3GSUA 5DK3A 2E7CA 2FD6H 4J4PC 3ZDXF 3MGAA 1G7HB 3O6KL 1K4DA 2YWZA 1WBXA 1YN7A 5DJZA 2Q8BL 4CDGC 2A9ML 2VDNH 5F7FA 3QUXD 1MRCH 4ETYA 1X5XA 3BISA 4XNQA 4M7ZC 1N5AB 15C8L 2YD1A 4E42B 2UZIL 3X13B 5DEGB 5J1AB 3MJ9A 1JZ8A 1K8IA 2AXGB 2HJFA 5JA8B 3DHMA 1QFWL 1OT2A 3HMXA 3W2DH 3WHXB 5K9OB 1YECH 5I75B 5CEZH 3BP4A 4JN1H 4UQ3A 2N56A 4NOFA 4JRWA 4JRYE 5DGQA 1U92B 2HT4C 1JPFB 2W9EL 1KJ2L 4M1DH 3VFSA 4JGUA 5F93C 4ZAKA 1LO4L 5DLMH 4XNXH 5M95B 1RJCA 3Q6GL 2YD8A 5TGBA 3JWOC 1ES0A 4OV6F 3TO2B 1W8NA 4B7LA 3B2VL 1CZ8L 1J1XH 3QIBC 5DF0A 4FQJH 1KBGH 3C08H 1IGYA 1CICD 2ZCLH 1WZKA 1OP3K 1EAPA 1AE6L 1T6VN 4UTBH 5FO7B 5FO8B 4MJ2A 4PJDA 3QEQD 5CIPH 4RISH 1J9CT 4FQXA 4I18C 4NNYB 4IRSB 1R5WB 1DBBL 4LSTL 5GISH 1A14L 3S36X 4IDJH 2IEPA 3VD7A 3HE7B 3LSOB 2DIJA 3ZKXB 1JGEB 4Z76B 5JLZA 3IB4A 1G7PA 5DFVD 1QO3A 3ARBB 3EUUA 1CDHA 3JWOH 2YD2A 5HHNA 4LASL 3IJHA 4MDIB 3SE3A 2ATPA 1B9ZA 3T2NL 1A0QL 5I0ZA 6CGTA 4PB0H 3ARGC 2YEZA 4CVZA 1NSNH 4PJBB 8FABA 3STBA 5T1LB 4ZNEE 4LK4A 4OF3A 3DMMB 3S3PA 1JPGB 3TZVD 3GKWL 3FRUA 1BHGA 3MBEB 5BOPA 1YEKH 1WZ1L 4R4ND 4E0RB 2A74A 4P9HL 1A9BB 1KCUL 1M1SA 2XKSA 3TN0C 2XY1A 3VRJA 4FFZH 3PV7A 1Q8MA 4GKSA 1QSFA 4G8EA 3RTQC 4NQDA 4EI5A 2DWEA 1PDKA 3GSVA 3X12B 4A6YB 5DFWH 1YEJL 1NCUA 3V7MA 2R0LL 3FQXA 2BCKA 4FQCH 2R2HA 3S5LA 4Z7UA 3VFGL 5B3NA 5CWSA 5DQJA 3UXFA 2CKBL 2Y4SA 2IGFL 3GSOB 3H2WA 3TT3H 4WHYG 4CW1A 4MNQD 1T20A 2E6PA 3HI5L 2BNQD 3QUXC 2D0HA 3X11B 1Z9SA 4FZEH 1MH5B 1AKJB 1OPGH 3RWCA 2MMXA 4EDXA 4BH7A 2VYRE 1F02I 1P4LA 3X17A 4PJEA 1RUKL 5FA4B 1LE9B 5TQ0H 3G5ZB 12E8L 1W0YT 2DTMH 1HSBB 1ZA6B 1EK3A 1UM5L 3G6JA 3GSQB 2FGWL 4PRHD 4N8PA 1T0MB 2H1PL 3MGOB 4BK4A 4IS6B 4DUVA 3FCTB 3EO9L 1X6NA 2X4NA 5INCA 2G5BB 1MVUB 3FTGB 3SO3C 3DECA 3DBXA 3WE6A 2YRLA 3PWPB 4ERSL 1BZ7B 1L6ZA 1CICC 3T0AA 2FWOA 3P4OB 1DL7L 1QBBA 1P9MA 2C3XA 4OCRH 3BRGC 3CMGA 1HQRA 3QYCA 3GMOA 4R3SA 2OCFD 2XA3A 5D2NE 1UWXH 1T2XA 3ZTJH 1UQSB 1CK0H 3QDJA 3ULVF 1IAOA 4JY6A 4R4BB 3V2AR 1CL7H 2VQ1B 3VFUB 4ODTH 4YDKH 1P7KA 1A3RL 3OTTA 4HH8A 3VWKD 1N3NA 5DFVC 1OARL 4YR6A 1BP3B 1BM3H 1BBJA 2GI7A 1OW0A 4JZNA 5HHPA 3GSNB 1HHHB 3FOMA 2NXYD 2QQKL 4OCSH 3SPVB 3RU8H 3PDOA 3ZYZA 5E2TH 2NY1C 3SKNA 4X4MA 2D7TL 3ARTA 4KZEH 5FYJD 3TZVC 3U46A 3MNVA 2XWJA 3B5TA 2VXUL 4R4NC 5TJWK 5JMRA 4PB9L 5E6ZA 4NP4L 1VFMA 3UTPD 1YNKL 4HG4K 3OB8A 4R9HA 1K85A 1MCLA 4CVXB 2NXZB 3RNQB 3G6DL 2FX7H 4AM0B 1QP1A 2WINB 2ZOKB 4NZJA 4R26H 1HHGB 1CDUA 5HVWA 3D69A 3OJ2C 3JV4A 4X80H 1CBVL 4QOKE 4EDWH 5F7UA 3DOSA 1G9ML 5T33L 4IMLA 4XP6L 3GNMH 5I17A 4ZPTB 2QBWA 3BH8A 4QYOB 3WUZA 4HJJH 1KV3A 3WIFA 1W8OA 4IIQB 4YFLF 1GCFA 2VIRA 2JJWA 2EDBA 4EZMA 3BZEA 5DJ0B 3LKQA 1S9WB 4I8DA 4UUJB 4F8TA 1RUQL 2V2WA 2J12B 3D87B 1L9MA 3MJ7B 3FT2A 1MJJB 3TBWB 3SGKA 3QDHA 3BSZH 3H6JA 3K4ZA 4X4XA 3LKOB 3GI8L 3BVNA 1WBYA 2X41A 1T2QH 2VDRL 3IF1B 3RA7H 5BS0E 2OZ4A 5E2WL 1AD9B 1PEWA 1ZVHA 4WUUA 5IGXH 3CGTA 2GTWB 3SBWC 4JY5L 5D6CA 2E9WA 5F3BA 1SBBA 4P9HC 5DHVH 1ADQL 1OSPL 4ZUUB 1R3LB 4HIJB 3BWAB 1MJ7L 2ZPKL 3UTZB 5GPRA 4KAQH 4CADB 2RFXB 3SDAB 4I3GA 4QRRE 3GFUA 4LCIL 5ESAA 1AP2B 2DD8H 4XAKD 5D1QB 1U8QB 1MHHA 3SO5A 2O26U 3VU2A 3WLWD 2Z9TA 4HZLA 1JHTB 3NZ8B 3SKJH 2WSKA 1I9RL 3MLUH 5DJ2A 3GBNL 1IM9A 2KH2B 3BAEH 4HULB 1FZMA 1N6QH 1X5LA 2Y36L 4XC3H 4N9GB 3UO1H 3V6OC 1EGJA 2V2XB 3HNVL 3O3AA 2DOCA 3O2WH 3E6FB 3FN9A 4Z7WE 5EWIH 2F54E 2SEBA 2XACC 4YJZL 4XCNB 3WNPA 1TFHA 1RURL 5T1KB 1T7YA 3NBNA 3IXAA 2P5WA 5IF0A 4WI8A 4KRMB 3BRFA 1HXYB 4C54A 4OQTH 1MCRA 4JFFA 1YEGL 1JL8A 3QUZB 1JBJA 3MLZH 1HKLL 2NXYC 5I1AA 2H32A 5D7IE 4BFBD 4JDZA 3U30B 4NUJA 2PR4L 1NQBA 4PGZA 1GYAA 1IGFH 4U0RC 6FABL 1S5HA 4ODBD 3ZT5A 1QFWM 3GSXB 1T4KA 5HDLA 4AT6B 4LF3B 5B3JE 3VXMA 4PJAF 3U48A 3Q1SH 3MUJA 1B6UA 3KPSA 5L2JB 4PREB 5L2KE 2JKXA 2ATKB 2ZUSA 1UZ6E 1A6VH 5CZVL 1ZS8A 2PO6D 3A67L 4G8IA 4XXCC 1FZJA 1UC6A 4Y8AA 3UJJH 4U7KA 3SKOA 2OS7A 4LLDB 4PRPA 5FXCH 4PP1D 4C57C 3MRFA 3GM8A 1MCWM 1J10A 3SDDA 2OP4L 3BHBB 1S9KC 5FYJH 4NCDA 1TJIH 5ERWB 4OV5B 2ZCKL 3MRQA 4W70A 3WXWL 1QSED 2EDYA 1DLFL 4KVNH 3U0TB 1J0KA 2W9DH 1DFBH 3BKMH 4GW1B 3SDCD 2ITCB 3MXVL 4K23H 3R8QA 2P1YA 4J23A 1BPVA 4JPIB 3L3OB 4XWGL 3D2UB 4QRTB 5EOCL 3Q5OA 4L8CA 4EOWH 3DLQR 2ARJQ 2A6DA 4KUCD 4PJ8B 4PRNB 5E99L 4P46D 4Z95L 4GKNB 4NOBA 1B0WA 1KACB 3CPLA 4HUXB 4U33A 4V1DB 5TE4H 5IMLB 1MIMH 3QUMH 1K3IA 5BO1H 4I0CC 1I8KA 2FIRT 4I13B 5EB9A 1WSST 4LQ1A 4LMQI 4U4BA 2I07B 3X3GL 3HE6A 4KQ3H 3QB7C 2VDOL 4KC3B 4J1UA 3NIGF 1XCTB 4K94C 3WLWC 4GRMB 5CJOH 5D93C 3UYRL 5I71C 4WHYH 1CXEA 1WWAX 3WKML 5DMJB 4O51B 4NFBA 4WGVB 3LS4H 1JYVA 3T4AA 3OKLA 3VXSD 1HXMA 1JZ5A 4QXUH 3PNWA 3MOBL 2AJZA 5K59F 1AFVL 1T0NB 3OV6A 2D9QB 4XHQA 5GJSL 5SWQA 4JPWL 4GAFB 3JVGC 1WUNT 4OSUL 1NC2A 3WJJA 3RWEB 3QEQE 4LARH 2YOCA 3ZT6A 4Q6IB 5JO5B 5KZCD 4LCYA 3M45A 1MF2L 4MAYD 5MERA 4K94H 2B4CC 1Z2KA 4GBXD 1A2YA 5I15L 2NY2D 4HWEL 3UTSE 5C0IB 4L8BA 1JWMA 1L9NA 4LDEB 1MRDH 4P4KB 4CU7A 3BPNC 3HG1E 2X9XA 1GZQA 2JIXB 5I1GL 1OAKH 2QV2A 1RULL 3PWVA 5CUSL 4U2YA 1LEGA 2DI8A 4M1GL 2PTTA 1CG9A 1QFUL 1RV6X 4BJLA 4NKQB 1WEJH 2PO6C 3O6FD 4TPRH 2K9UA 2X09A 5I8CA 1ZANL 2J8HA 2B0SL 4CJ0A 3CFBA 5J11C 2UUDH 2B4CH 4JQIL 3GSNL 4QOKB 2AGJL 4PP1C 4AEFA 2XA8L 3RBGA 1R6VA 4LL9A 1FZKA 5C92A 1RZ8A 3GJFH 5HYSG 3ULUL 3ZKSD 3L6FA 1MHEA 3EGSB 2CRIA 3FOLB 4MA7L 1A3LL 3KPMB 2JCCA 3CZFB 2YSSA 2AKRB 4P5KA 3LN9A 3SDCC 5F9OL 4N5ED 1G7LA 2VDMH 1RPQA 3GO1H 5CZXD 2WW8A 4HFWB 2YXFA 1YMMD 4EI6B 3QHFL 3WHE0 5M94B 3K2UH 2PXYB 3MMEB 4KRLB 5JXAH 1VKXA 4MNQE 3LRSA 5L7XL 4MJIB 1M6OA 4YXHH 4M48H 3I6GA 3T1FB 1IJ9A 2BNQE 4P46C 1ODAA 4RDQF 5EOTB 1RZIB 2YD7A 1YUHB 4UQ2B 5E5UB 3RX7A 1EUUA 4H1LB 4IRSC 5ALCL 5IVOA 3MV7D 4QRRB 3VA6A 4U1GC 4HSQA 4TSBH 2AJSH 4OCWL 3ZKXC 5H2BB 2BZDA 5JOPD 1LILA 3JWDL 1UZ8B 1LDPL 4HIHB 5GSRA 2CXKA 2I9LB 3B3IA 4JO1L 4PRHE 3OX8B 4OM0H 3VG9C 2B39A 3SGJA 4L5FH 3WMSA 3QG7H 5TDPA 5EU4A 3ULUD 1AIFB 5I30H 3MLSL 5DC4B 2F54B 2Q8AH 3DMMC 5JDSB 5EU5B 2AEPH 4H5SB 4PTTA 2EO9A 5D1XD 4RGMB 3PGFH 1ZT4B 1DN2A 3TA3A 4ODHH 1SBSH 5HI3D 1RMFL 4F2MA 4FXKA 5EZOL 3GIZH 3V0WH 3F7VB 4YZFF 3VMNA 4MAYC 4HS8L 5E8DL 4GBXC 4JFPA 4J7RA 5FO9A 4NGHH 4QRPE 5K9QI 3FFDA 4OFKA 4ONGH 2Y23A 4FFWD 1T7WA 1N7ML 3KHOA 1NCDH 4PGBA 3K46A 4LOUD 4PJAB 4QRQB 2DQJL 1CLCA 1T03L 3ZL4L 1N4XH 1NLDH 2FRGP 5J1SC 1D6VH 5IBUG 3D39D 3QIWD 5I8KH 1ZK9A 4YFEA 4ZODA 4UT9L 4QRSB 1HINH 5FYJE 3S37X 1QA9B 4X4YB 3O6FC 1MCCA 5DQ9A 3IKCB 2LABA 4DAGL 4CN1A 1HNFA 1BD2B 3NACL 2FATH 4JQXC 5ITBH 2NLJA 2Y1VA 3MA7B 2YMXL 3IDUA 3MFFA 1R3KA 3S98A 4KVCL 4LCUB 5JOFB 1HWHB 5JQ6H 2AQ3A 5IJKC 3H7LA 4IMKC 5C0BA 4PJDF 3G5VB 5KVDH 4LIQE 3LN4B 1BQHG 3NAAL 1FAIL 3RDTB 4N5EC 2DI9A 2QKIB 4Y4FA 5GQBA 1J8HA 2I60H 2LQRA 5CZXC 1Z0MA 3DIFB 2YPKB 4JHWL 2MPAL 1DQDH 1JGLH 3Q5YA 1NUDA 4ZS7L 1CFVH 3MV8A 3TP4A 1T5XA 5SX4I 3ARDB 3EAKA 2X05A 2YBRB 4CRPA 1MQKL 4L8DB 2CMRL 3WO4B 4G7VL 4QHLA 4U6VL 3N85H 1JK8B 4OFIA 1UXSA 2J88H 3MRRA 4QF1B 2XZCL 5FGBC 2EKJA 1MAMH 3GIVA 1GIGL 4HX1B 1H3PH 1FYTD 3DVFA 4ENED 4CJ1A 1XGRB 1A6WH 2IQAB 2V9QA 5J13B 3EFDH 2H9GB 4QT5A 4QXGH 2G2RA 1LEKB 5LBSL 4PBVC 4KDTC 2CLVA 5D72L 5EZLB 3HRPA 4YHNB 1A1OA 2WNGA 4YAQB 1CDCA 4XNMB 3ULUC 3CXDL 4HC1L 5E8NA 4KKNA 1A4JA 3C5SA 4WI3A 5CP3H 4GQ9H 4Q6YA 1F6LL 2YC1B 4ZMAT 4Z7UF 2CGRL 5D1XC 3WNLA 1GXEA 3HUJA 3GZKA 1PG7X 1RJLB 2GK0B 4ZUVA 5HI3C 2ZNWA 4JVWA 3NN8B 3N06B 3GI9L 3UTSB 5AAMA 5B8CC 9CGTA 1VFBA 3MZTA 2J5LB 1DBMH 3QO1A 4L3AA 2Z93A 5TE6H 4WUKL 3QDAA 3T65B 2NZIA 2WWKT 4FFWC 4JHBA 5ADOL 4KPHH 1EX0A 4LOUC 1UCBH 4PJEF 2MQ0A 4LEXH 3NIFF 1EFXB 1S7WA 1JP5A 4WV1C 5JW5B 2NY3B 3QIWC 4P48A 5KAQF 3HFMH 4O4YL 5C0CD 2X4RB 1FNEB 1N5YH 3G6JF 1FC1A 2IBZX 2P8MB 3LQAC 3X14A 3OR6A 2EXYD 5AYUH 4POYA 3W9DB 1JGVH 2Y5TB 4M3JA 5ENWB 3W81A 2P42B 3IU4L 2OTWA 4Q9RL 1TPXC 5CD3A 3I6LE 3L3GA 3O3UN 3DXAE 2X9YA 1D5IH 2L7UA 5GGUB 4E5XA 4GXUM 2YPVH 4X9HA 4HLJA 2C4XA 32C2A 2YD9A 1UKTA 2R0KL 4XPTL 5HHOD 3VGEA 3H9HA 5T1DH 3EOTL 1HI6B 3UPCA 3LQAH 5EC2B 1Q72L 4YFLI 5J4MA 3E8UH 5CEYB 3LQZA 1XCQB 1CXHA 4L1HA 1R0AH 1QSEE 3EDKA 4XNUH 1NAMA 3F5WA 4OKVB 4I9WE 2YR3A 3AS3A 2JJVA 1F11A 2JF1A 1R3IH 1XGTA 4MJ5A 4D9LL 4BQ8A 4XPAL 1NMAL 2VC2L 4P3DA 5EN2B 3ULVD 2VE6A 3MV9A 3D0VA 1D5BB 5DUBB 4IDLA 1SVCP 2BVOB 3VFTA 1JN6B 1UWGL 2X44D 2NCMA 4TTDD 3ZHKA 2XWBB 4ENEC 4BSVA 3MGTA 1U8KB 5CGYD 3I9GH 4YXLH 3AFLA 5T5FH 1LDSA 1SJEA 1R5IA 4WU5B 1NKOA 1XGPB 4GAGL 5JDJA 1IEBA 4YHLL 2W0LA 1N6UA 1RUAH 5I1JL 1HQ4A 2ENYA 4NO0B 1UM6H 3S35H 4FXGA 3CX2A 4PJ7F 1AGDA 4TUOB 4F9LC 2JB5L 5D5MA 5I1EH 5CJXC 4U1IA 4FQJL 1MIEH 3HZVA 3D48R 3K8LA 4KROD 5DTFA 3SDYH 3T0DA 2KQNA 4FNLH 5F1IA 5F71A 4M7KL 4JM2A 1KPVA 2BVPB 1T0PB 4NUGL 4NHCH 1XGQA 4U3HA 4PJIE 1WBXB 1EMTH 5DJZB 1HHIA 1PVHA 4QRPB 3WN5C 2OBGA 1J1OH 4NQUA 5F88A 2P8PA 4X8JB 5MEOA 4CL7A 3T77A 4U1JA 4NQSA 3VH8G 5KVEL 1CDYA 2IALB 1QKZH 3IDNB 4HUVA 3GHEH 3BW9B 1NEZA 1HYSD 3IDJA 4MCZB 4YHML 5FHBL 1CIUA 2NY0D 5MHSD 2ED8A 1RZJC 3LPWA 4KHXH 3ET9F 4MZ2A 4XBGB 3FQRA 1ONQA 1Y6KR 3TIEB 4ZAKB 4Z0BH 4OCNC 1HK6A 4Z7VA 4KGLA 2D31A 4Y5XC 2EXYC 4H25B 4JZJC 4M6NL 1GPOH 3MO1A 5TDOA 3R8BB 4LSSH 2ZG2A 4OCXL 4XNZC 3MRMA 4J12A 1EAPB 4ZFOB 4MNHB 1BVKA 1TJGH 3SJVD 2VERN 5HPMA 3NA9L 4DOHE 3TJHD 1PKQE 2HKFH 3KPOB 2X2YA 2F5AH 3U0PA 4FQXB 1MNUH 1RZJH 4TUJA 3EYUL 2MQCA 4M8VA 3RVUD 3VXUB 4U1LB 5JLZB 2P44B 2X4TA 3I85A 3QUMB 3EO1B 4PJ5D 2AS5M 1A02N 1ZHBA 2W0FA 1KCSH 5SX4H 5F7HA 4L9LA 4U05A 4KV5E 4FZ8H 4NFCA 3HRZA 1ZSDB 1NCWL 3D3VA 2YZ8A 3FT3A 2YEZB 43C9A 4RFOH 8FABB 4L4VA 5F44A 5C0DA 1OTTD 2H26A 1U3HD 5T5NG 1IAMA 2Y07L 4ZUSB 3LZFH 4QCIB 3FRUB 1LO0H 3ULVC 5GRJL 3VD9A 1ITBB 4LGSB 4U1MA 5IK3A 3U7YL 1E4KC 4F33B 1FDLL 1DBKH 4TTDC 1FO0H 3VRJB 1TVBB 5L6YL 2B1AH 2R23B 3EZ8A 1FV1A 5CGYC 1MI5E 2RJMA 4GKSB 1JF1B 5GGRB 4G8EB 1EAJA 3RRQA 1RHFA 2ARJA 4HK0B 5C0EB 3NFNA 2WUCH 5ESVA 1YEHH 2WBJB 3I2CL 3LMJH 1FL5B 3U9UB 1DUZA 2ICWI 4XMPH 3MRBB 1IGJB 3VGBA 3OMZA 2R2HB 3IETB 3ULVH 4FFYL 4Z7UB 4KROC 1CIDA 1YNLH 3ARZA 5CWSB 2VLLA 4JREB 3PP3H 4FXLA 5EPMB 1BGXH 3ZHDA 2IFFL 3RWGB 4RA3A 1T20B 4PPTA 2ZUQB 1X5AA 3ZO0A 2BOCA 3FQUB 3CDCA 2A2QT 4G6ML 5I2IB 4PV9B 4LRNL 3WDIA 4U31A 3QEGL 3RWCB 4Y5YA 1JPTL 2AJYL 3GUTB 5SWZA 3RGVD 5AZ2L 2R15A 5I1IH 1K5NA 1CQKA 1CFNB 2B2XH 4WVRA 2NY0C 3O11B 4G8GE 4Y5VC 3TF7C 3ZTNL 4RFEB 3G6JB 2F19H 4L4TD 4WI4A 1KB5A 4RMWA 1DQJA 4LAJH 4O9HH 5FUCC 1YPZE 3DRTA 1WCBA 1ZGLM 1GHFH 1H5BC 5EZJA 5INCB 4KK9D 3RX8A 2GJJA 4KMQA 2EE9A 4GMSH 3CDFA 1HILA 5FKAA 4Y4HB 1DE4A 4JO4H 3W9EB 1BFVL 1FVDA 2OI9B 3INUL 4LSUH 2B8OT 4JM4L 4JY4B 1HQRB 1R5VA 3TJHC 1TZHA 2EICA 3OXRB 2VDLH 5IB3A 4M93C 1JFQL 4JDTH 4PTUB 5FM4A 2BP3A 1IAOB 4JY6B 3BN3B 5DVKA 1JJUA 3RVUC 1QRND 1RY7B 4JFDA 1SJHA 4PUBL 1P1ZB 1YEDA 1FFPB 4S1QL 5D7JD 3RVXD 1TTFA 4R2GD 1BBJB 4JZNB 5HHPB 3QZWG 4LLUB 1OVZA 3FOMB 4M03A 2GJ6D 4FG6D 1I7UB 3IFPB 4DKDC 5C0ND 3GK8L 1O7SA 1OTTC 1U3HC 3LS5H 3MLWH 1RIUH 2C4FU 4I0PD 5ILTH 1KEMH 5HHMB 1EHXA 5HYIA 3OSKA 4Q9QH 4KXZH 5F6HJ 4Y19E 4J3SA 3UBXA 1T2QL 3BKJH 1NC4A 2VL5A 2XQBH 4Q7DA 4XPGH 1DBJL 1UXWA 4G42A 4P2QA 5JW4R 3QQ9D 1I8IB 4Y1AD 3P9LA 4JFOB 1U8OB 4PJ7B 1LO5A 3CMOL 1FYTE 4X8XA 5D71L 3D69B 5E9DD 4HKZB 3ZE2E 1G1YA 4XHJD 5CD5D 1F6AA 1HEZA 2NY4B 4IMLB 3VXOB 4LSRH 1B88A 4M62H 5CCKL 3X3FL 4LSQH 3BDXA 5I74B 3BAEL 1IC7H 5E8OB 5LXGL 4KMTH 3NPZB 2XKUA 2O5YL 3P9WB 2JCCF 4JO2L 5A43C 4U1HA 5D2LF 4LAQH 1AHWB 3SGEI 4A2LA 3FT2B 4XRCA 2V2TA 5I19H 2OR9H 4LDOB 1D9KD 4X4XB 3U9PH 3MLRH 5IB2A 5HVHB 2FIKB 1GH7A 3FB7A 3RGVC 3QFJD 1N6VA 2EIZA 3RWFB 4PYGA 5KG9B 4WUUB 3VWJA 5BJTA 3U6RA 1MUJA 5F3BB 1P53A 3P9MA 1DR9A 1NANI 3PWJA 1VADA 4K7FB 3O4LE 5C9JA 3BP7A 1KIQB 2N1KA 3MRDA 4KK9C 5DJYB 4LNVA 4P2OB 4RAUB 2L0DA 2DLGA 3V6BR 1OAUH 4MD5A 2BRRL 2BXZA 1S7TB 1MHHB 4HKBB 3H9YA 1AQDB 2DQEL 5EZIL 5C0CE 3PGCA 4XPHH 1T89C 4JFEA 1IM9B 4GSDL 3SE8H 2GHWB 3MJ9L 4LP4A 1MY7A 1FZMB 2EDLA 4GXVL 3DVNB 4PJ9A 4DKFH 1K2DA 4TNVK 5JORA 3HR5B 5EORH 4PJXA 1S9VA 2XN9A 3D25A 4EN3D 4NIKB 2LVCA 4K07A 2DTSA 5D7JC 4LHUB 3RVXC 4PRDA 4R2GC 4MB5A 4IOIB 4G9FE 2BHYA 3RHWF 2UWEA 1AR1D 3HC4H 4PJGA 3S5LG 5C08A 3SCMD 4JDZB 4FG6C 2X4SA 5C0NC 4X6DE 5I6XB 2CUIA 5KS9A 1ZGLP 1FG2A 4OFPA 3MXWH 4MXWH 2BVQB 1AO7A 2IC2A 4I0PC 3OGCA 4Z7QF 4LIQL 5KSAA 4XI5D 5JTWA 1MI5B 5KSBA 1A5FL 1TZIB 3BPOC 2V7HA 5C2BH 5I1HH 3QQ9C 1S3KL 4XB7A 2P5EB 4JFXA 1ZS8B 2KDGA 3SGDH 1FZJB 3QPXH 1NCCL 5GRWA 2Q6WA 5FECA 4QKXB 3MZGB 1NGZB 3ETBF 2F53E 5FUZH 2VZOA 3P0YL 3SDXA 1RAMA 3VXNB 3DYMA 1OGAA 3SDDB 1J05A 5F1KC 4XHJC 5CD5C 5ISZA 3BI9X 4DW2H 5I16B 1LK2B 5B39G 2G60H 5ELIA 5BMFL 3DX7B 1XH3A 3DROB 3EZJB 1F2XK 3MYZA 5CGTA 1FFNA 4C59B 4XMLL 4G6FD 4LSVH 4F7EB 1H0DA 5F7WC 3AY4C 2VDKH 4JLRA 4XP9L 1GAFH 4OZFG 4N0FB 1KCKA 4UT6H 1ZEAH 1D9KC 4L8CB 4PJHA 3EYFA 1VSCA 3K1DA 4G8GB 1SY6H 3AU1A 1HIMH 2A6DB 5IFAH 4BQ6A 5ACMA 2DIAA 3BGFC 5AZEH 4OLYL 3PDDA 4X6BB 4DTGH 2Z8RA 5JHLL 1LP9A 2CLRB 3DRQB 4MJ4A 3GRWA 3MRNB 2WUBH 3IDYC 4BZ2L 2VLKA 1A1NA 2ICES 2CIIA 4U1SA 1U95A 4UINL 4G3YL 5EOQH 1IC5L 2V6HA 3WJLC 4YUEH 1CXLA 1IEAA 2XTJD 1NUFA 4WTWA 5EU7E 5EIQA 4X7TA 3GMMA 1IC4L 1WZLA 2CJUL 3DVIA 1QBLH 1YNTA 1IBGL 2A6IA 5GRVL 4YDIH 4OZGA 2AJZB 5SWQB 5KOVC 4EN3C 4JFHD 1R24B 3QXWA 2R0ZH 4RX4A 3I75A 3HUJF 4BQBA 1UT9A 4LCYB 5IHUH 1QSFD 4DFIA 2ADFH 2AK1H 1RFDH 1WWCA 5MERB 3SOBH 1WT5C 3ZT7A 1AR1C 4AZ8A 4B53A 5BZDA 1A2YB 4NQDD 3SCMC 4EI5D 3P77B 3MLYL 1JWMB 1MFEL 1AY1L 2RIKA 4PJ5E 2NTSP 1V3KA 2Q76A 2P46B 5L88H 2R4SH 3EDJA 1RUML 2IPUK 1GZQB 3H9SA 1NBYA 3B8YA 5BCAA 1CLYL 4NO3B 5FM5O 4XI5C 3OKDB 3WD5L 2Z31B 1Q1JH 2JJTC 1LEGB 1EPFA 1KTRL 1XF4A 2JLLA 2PTTB 5DA0B 1CG9B 2MOVA 5JQHC 4ZOAA 2BOBB 4RMUA 5I8CB 2EC8A 1EEYB 3CFBB 5GGQL 2C3WA 1QBAA 1JF6A 5BQ7A 4I3RL 3DUUA 1W72A 1MHPL 3STZA 2R1YA 3T2QA 2HJLA 4X4ZA 1Q9LB 4RMVA 1FGNH 4R7DA 5J1TC 1SYSB 2VLRA 3MROA 1VFAB 1G9EA 4KRPD 4P23D 5D2LB 1SEQL 2C1OA 2R4RL 4MNGE 1A6UH 5LGJA 4TRPH 4M7JH 4ZAKC 3QXAA 3VFWA 3MRHB 1UWEL 2G5RA 1YEEL 3AVEA 4NKMA 3CAFA 5E2VH 1FIEA 4UU9A 3UJIH 1VKXB 5IEKB 1DQML 3FFCE 2Z8SA 4XC1H 3UPRB 1H3VA 3HMXH 2DIBA 4UV7H 5DRZB 3O4LB 3HMWL 4WCYL 5IMKA 5DHXB 1F4XL 2ICEA 4FQXC 3QDJD 4N8CH 4R96A 1L0QA 3UC0H 3E1F1 1XF5A 2FGZA 2MCG1 5D1ZB 2DM7A 2XFXB 4HV8B 4GJTB 3TVMB 4P5MB 4LQFL 1YMHA 2XTJC 3F6IA 2FSEB 3JV0A 3JXAA 3LH2L 4JB9L 4D3CH 4X7DC 5C0FA 2EDWA 4L4TE 3SE3C 5L0QB 2R0WL 5BXFB 1T1XB 2XQYK 2VXQL 4NJ9H 2W9LA 4NRZA 3LDBB 3IAGC 3ORJA 4WWID 5DRXB 2FATL 4JDVA 4HUUA 2OZ4L 2GJZA 4DGYH 5J56B 5C0JA 3IRZA 2HFTA 4M6AA 4OGYL 3I50H 5D5MF 5E70A 5MP6L 1A1MB 3BGMA 4G9FB 4QHKJ 3UDWA 4JM2F 5HDOA 3VGFA 1SHMA 3V79C 4N8VA 3CFCL 1S7VB 4FXKB 4UT7H 5H94A 4P2RA 1PW3A 2VH5L 4XVJH 1QRNE 5FO9B 2G9HA 4CVWA 3BP5A 5C09A 3H9ZA 3M8OH 3UROR 5D9SB 4EI5C 3FFDB 3FO9A 4UV4L 1I1FA 5IEHA 2BERA 5DHYA 2ZKHH 1OM3L 3NMEA 3CLEL 5C70A 5IW1A 2NY4D 3ZYIA 1KNOB 3FB5B 4FQQB 1EGJL 3E2HC 3O6ML 4IJ3B 1VESA 1INEH 1CT8A 4Q2ZA 1U8MA 2H6PA 2F53B 3T0EB 4ISVA 5DQ9B 1TLKA 4Z7VF 1INQA 2IANA 2D4FA 1NPUA 4PGCB 3J7HA 3OKEA 1ETZA 3ILPB 3MFFB 3SE9L 1TZGH 2XZAL 4Y1AE 5KJRL 4OCMC 3O3DA 4QHNA 1RHHB 5JW3H 3RWIB 4WUUD 1KTLA 2DQIH 1FSKC 1V5JA 4DFHA 1JIBA 1Q94A 2HH0H 5JIHA 4KRPC 2JK5A 3WSQH 3H0TB 2ED7A 3IU3A 4GQ9L 3ZSTA 1TXKA 1YN6B 1QLRA 4TVSa 2WLZA 1DCLA 1K3ZA 4NO5A 4XP4L 5F3HA 5EC1A 4FTVE 2W1NA 2DQUH 2VUYA 2IBZY 3D9AL 2IH1B 1P9MC 1FORL 4QHLB 1QLEH 5DZOA 1UXSB 1RK0A 1CCZA 4FABL 4KHTH 1EZVX 2LU3A 5DXWA 5EBWA 5LCVL 4K3HA 3QFJE 2H8PB 4F7PB 3VFOB 2P5WD 1A22B 4Z9KB 1F4YH 2RCSH 1PZUB 4FQIH 1I8MB 4O58H 1OW0C 2BSTA 4JFFD 3FN0L 3I6KB 3GMPB 5HGBB 4IHOB 4GMTH 4NM4H 4R97B 5SWSA 1MCWW 4DVRL 3OAZK 2IMMA 5I66B 1KB9J 4BUGA 1XIWA 2DKUA 3C6LA 4OAWA 4BKLB 4OZFH 3V5HA 2BDNH 5JPNB 3VXMD 3HUJB 3KPSD 4HJGB 2GSGB 3ARFB 2CRYA 3MRKA 3H3KA 3F12B 1U8HB 3T3ME 1ZLVH 1TQCB 1QHOA 1UWXK 3QI9A 2CKBA 1YQ2A 3WFCH 5E6IA 3PHQA 4PRPD 4GAJL 4Y2DA 3PHOB 4MA8H 1SYVB 3VRIB 2C1PA 1XZ0B 5A2JH 2LVEA 2F5BH 2AABH 1MHCB 3QEUA 2AJ3A 4DN4L 1SJVA 2NY4C 3J8F7 3S36H 4APQA 3KPLB 2OJZH 5TQ2H 1LQSR 4YC2B 1LWRA 4L9DA 1CGSL 2PCPA 1M7DA 3QRGH 3IJSA 1OY3B 4MB3A 3WCYA 4NJAH 1J0YA 1J88A 4OI9A 1IAKB 2ERJC 3SGKC 3VI3E 2XICA 3EYQD 1KC5L 1RVFH 2BY2A 4MD4A 2XRAL 4DKEL 1OT1A 3QNXB 4EJ1C 3DJ9A 4PRIB 1EO8H 1U2CA 3OAUH 4QTHA 4JPVL 1YJDC 1GGBH 1C5DB 2EYRA 3B8SA 4QHUA 5EIIB 2EXWD 1FP5A 1I1CA 1KFAH 3HE6D 4QRUB 3MNWA 2E7LA 3C60B 3T09A 3FFCB 3VDBA 4ZFGL 1NAMB 5HJ3A 1U91A 3R06B 3ISWA 3NGBC 3VG0L 2HKHL 2B7DT 1CD1A 2EDXA 4OZHE 3LN5B 4P3DB 1XF1A 2VE6B 3MV9B 2R69H 3PQYB 1AI1L 4MGXA 3PV6B 4DN3H 3WBDA 3TIDA 1YJDH 4S1SL 4WFHD 4TYUA 4I2XA 4WFFD 3D0LA 1NC2D 4I3SH 2H41A 5F8QC 5AUMA 1ZT1B 5GS1A 1FN4A 1KIRA 3L1OH 5F7LB 4F3FB 4HIXL 4W4OA 1HQ4B 3KR3H 4UAOB 5IESL 3OHXA 4FXGB 5I6XC 1A6PA 4ZSOA 1I1YA 1AGDB 3NZHL 5LKNA 2NY5L 1DVFD 2XTJE 2A73A 1A6TB 4D0BB 2X89D 3N9GL 4GOSA 3E0GA 2X4PB 4WWKD 1UM4H 2HVKA 4FHBD 3DUSB 3V5DA 1XGQB 3DWTA 3S88H 3L7EA 1LD9A 1HHIB 1MCJA 4YEEA 2VLJE 1I1AA 3QXDB 3EYOB 3MRJA 3Q3GA 2DLIA 3BPCA 1AXIB 2P8PB 5CILL 4KKCD 3WXVL 3U4BH 2XTLA 3FO0L 3BEWA 4OZIA 1IKFH 1M05B 3TCLA 2VABA 4P49A 5E94A 5GRZA 1QSFE 3JTSB 1VCAA 3KLSA 5MEPB 5DFTA 1OTSD 3RNKB 2FX9L 1JGUH 4JGMA 1I7RB 5F7MC 3NABH 4NQDE 4NDMA 3CLFL 3LKNB 2LU7A 3MLTA 4XPBH 3RZWA 2DYPA 5BV7C 4HCRA 3N1FC 4O2FB 4Z7VB 4M4PA 5EU6E 2X5PA 3EDDA 4NN7B 3OKNB 4QWWD 4ELKB 5EUOF 4UIKH 1H3WM 1JGDB 1E28B 1KENL 3HZKA 1FL3B 2NZ9D 3KS0H 3OKOA 4ZO8A 3OL2A 3EYQC 3VW3H 1X5GA 4YHPB 4QNPF 3REVB 4LKCA 3DV6A 3L5WB 1NBZA 1LK3L 3U0PB 4TUJB 1UACL 4E42A 5TF0A 4Z7OF 5A2FA 1BZ9B 1F90H 4M7LL 2F8OA 3BZDA 5MENE 2A77H 1FC2D 4MA1C 4X5XB 1ZLSH 4DWHA 3BKYL 5BV7H 4U7MA 2AXGA 3SY0A 2RBLA 4PJXF 2RQ8A 2X4TB 1S8DA 1F3JB 5K9OA 3KJ4C 4RGOH 5DMGD 3MACH 3NIFE 3HE6C 3F58H 4FTVB 4AMKL 4AQ1B 5DR5H 2J8OA 4DGVH 1CLZH 1U92A 4R0LA 2CR3A 3KPPA 3P2TA 3D3VB 4YHZH 3FT3B 2J6EA 3LRGA 5DJAB 4L4VB 2UWEF 4O00A 1B90A 5C0DB 1ACYH 4NRYB 1CXFA 5DD6B 5IBTH 3MLVL 3L95B 5KS9F 1NGQL 1EJOL 2QADB 3TO2A 1OAZL 4GUPB 3PL6B 5GS3A 4U1MB 4OLWL 1F6FB 4RFNB 4URTB 4X7EC 3N0PB 3O9WB 3Q6FA 1L7TL 5FO7A 3WJJC 5CJQH 2L4OA 4H8WH 3TA3D 5KSBF 4M4RA 3DO3A 3O8XB 4OCYH 5B21A 1MWAH 1NBVH 3NFNB 1R5WA 3QDJE 1RZ7L 4DJMA 3QDMB 5ESVB 2W60B 2UZYB 4BFIA 2OQJA 3QQ4A 3HE7A 3LSOA 4JO3H 1M4KA 4Z76A 1DUZB 2PF6A 1S7XA 5IBLC 3ARBA 3GHBH 3HPJB 5AWNH 1DVFC 4ZO9A 2XG4A 2MKWA 4ZTPH 1RIHL 4RMTA 4YE4L 3GMQB 4P57B 1J7VR 3HHRB 4DQOH 1FRGH 4OIIH 4WWKC 4O2CA 4F15B 1JWUB 1IAIH 4PJBA 5T1LA 4OT1L 1I3GL 1HH9A 1H3GA 4X4ME 5AG9A 1JPGA 2IPTL 1QLFB 1C16B 2BOCB 4KKCC 4Y5YB 1EV2E 4E0RA 1A9BA 2V17L 4OCLC 3MODH 4XNYH 4M6MH 1MJUL 1NUGA 4AEIL 1YEFH 4PJHF 4FQ2L 1Q38A 1N59B 1SQ2N 2I27N 1AXTL 1JE6A 1OTSC 1WAAA 2VQTA 3E3QC 1UJ3B 1LE5B 5C0BD 3KPRD 3QZWB 5E4EB 2OR8A 1DQJB 5DT1L 5ETUA 3IDXH 4A6YA 2VLMD 1LP9F 4KY1H 1OTUD 5ICXB 4Y4FD 5DURB 1J8HD 4QWWC 5FKAB 4H0HB 2R56H 3P30L 1HHKB 5FYKL 4UZGA 1NCBH 4OB5H 3MV8D 2NZ9C 4ESKA 1SM3H 5IVXA 5JNYB 1BZQK 1XGUB 4O5LH 5E08H 1R5VB 1JNHB 2NY5C 4QEGA 5IB3B 4JG0L 1IVLA 5IJVB 4LHJB 3VXQA 4RIRB 5GRUH 3X11A 4Z7NF 1GC1H 4XP5L 2VRAA 1Z9LA 4K8RD 2UUDK 1AKJA 4IRJB 4OZGF 3P73B 4JFDB 5JUEL 1YEDB 2IWGA 2WP3T 4NN6C 4S11A 4FP8L 1A7OH 5FA4A 2JTDA 1CGWA 4BSJA 5DMGC 5F1SA 1JZ6A 3G5ZA 2IH3A 3FZUC 1HSBA 3S34L 2D4DA 3EW3B 4OZHB 2BNUA 4P3CL 1ZA6A 5FFLA 3GSQA 5FHAL 4WTXA 1T0MA 4UB0H 3MGOA 4IS6A 2K1MA 2DQHL 4Z18A 3SGJC 1GVIA 3FCTA 1ZHLB 2AEQH 1WFTA 4NO2B 3WIHA 1NMBH 1EVUA 4UILH 1KOAA 3FTGA 4WEMB 4OLVH 3PWPA 5D7SL 2D03L 1BZ7A 3VGAB 1NC4B 2VL5B 4KQ4H 2EH8H 3P4OA 3RKPA 5IKCB 1NGPH 4G42B 3ME0A 4P2QB 5LQBL 3AMKA 3TA3C 4MDJB 3P9LB 2YD6A 1CXKA 1X5FA 3MNZB 2OL3B 4R4BA 4J2XA 5E2UH 4YXKH 1NAML 1N0XH 1KB9K 1F6AB 3CVHA 5GGVY 3WYRA 1HEZB 3E6HB 5D7LB 3IDMB 5C7XH 4JFFE 4K9EH 3GSNA 5F7EH 1HHHA 3KPQB 3VXTB 2YA2A 1EBPA 3CSBA 4UTAH 1J0HA 2HFFA 2VLJB 2DQCL 3SPVA 3VRLF 5LJYH 1KELL 4OD1L 2CK2A 1U2HA 3DI3B 2DLTA 1GL4B 5DD5L 5HVFB 4U1HB 2VXSL 2BNRB 5JHDA 4PP2B 2B1HL 4YEFA 5B38B 1KN2L 5KANI 4XRCB 3WNMA 4Y8DC 4XAWH 1WFUA 1DTUA 4PJFE 1G6RH 1U58B 4LKXB 1IGCL 1SMOA 2AI0H 4CVXA 2X1WL 3RNQA 2HAZA 3KNBB 3IFLH 5BJTB 1MUJB 2WINA 3RZCA 3JWNC 2ZOKA 4J8RA 1P6FA 3LB6D 1AC0A 2VDPL 5E1HB 5EU6B 3IRPX 3R0NA 3U1SH 3PWJB 2XXMB 3BE1L 3OJMB 3BP7B 5H8DA 5EUOB 2CDEB 1OTUC 5T3XE 5CHNB 3ROLB 4Y4FC 4MD5B 1CGUA 3S4SB 2XKNA 3PXHA 1CTNA 4ZPTA 2NYYD 2BY1A 4QYOA 5DRNB 5FM5M 1U6AH 4JFZH 4RSVA 3VFMB 5B39A 3T8XB 4JFEB 3QSKB 4W4NA 1P4IL 4NQEE 2BC4B 5DJ0A 5MENB 3LPGA 1NH6A 4RGND 3LAFA 4LSPH 4PJ9B 4RMRA 1FIGH 4UUJA 5JORB 3B9KB 4K8RC 2EYSA 5F21B 1MJJA 1Z5LA 3D25B 1RQ5A 4S1RH 3LKOA 2AJVL 4F7CB 1UVQB 3IF1A 3NIDE 3UYOD 4PRDB 3L5XL 5C0AD 4U1NA 1CE6A 2R29H 4EVNA 2AVGA 4YWGL 1DQTA 4ZUUA 2X4SB 1X44A 5KS9B 1R3LA 4HIJA 3BWAA 3UTZA 2YXMA 3H8NA 4LU5L 3TGXA 4H0IA 2RFXA 3BEVA 3SDAA 1IC1A 1XFPA 3LIZH 4IM8A 1HDMB 4K8RH 5D1QA 1U8QA 3D85A 5F9JA 3W0WD 2P45B 4JM2D 1JHTA 4OZFB 3OPZH 3NZ8A 2V7HB 1G9NL 1OP9A 2J1KA 4JFXB 3VMPA 2ZNXA 3CFIC 4N9GA 3CC5B 4P9ML 2V2XA 4LPXA 1BFSA 4WEBH 4OLXH 1X5ZA 2WUBL 3E6FA 4WFHE 1BECA 4XCNA 4WFFE 4OZ4B 1OGAB 5T1KA 1J05B 5F9WB 5ISZB 4TVPL 3EDEA 3ZDYF 1HXYA 2EYTB 4OLEA 2YK1H 3QUZA 4ZNCD 1J86A 5FAAA 5FYKU 1XH3B 4ZNEA 3GSRB 3TT1H 2EDJA 1A6AB 1QBLL 2VOTA 3WFBH 3FN3A 1B2WH 4ALAL 4YDIL 5F8RC 3C5ZB 1JTPA 4NWTH 2HMID 5FCUH 1PY9A 1H0DB 4KTEL 2H45A 4AT6A 4LF3A 4WHTA 5I9QC 1KLUA 3UJTH 4G6JH 5L2JA 4PREA 5HGHB 3AUVA 3EYFB 5KN5B 3THMH 1JNNH 2ATKA 3NCJH 3UTTB 1J5OL 2E3VA 4X6CB 1QR1A 3B9EA 5HDQH 2HN7B 3LB6C 3PABB 4LLDA 5I73B 1A7NL 5DK2A 4XX1E 2FHFA 4JHZA 2EDQA 2VLKB 4JJ5B 1V3MA 1BBDL 3BHBA 1U95B 3SKUD 1INDL 5E8EB 3TH2T 3TESA 3GJEB 5ERWA 5CINL 4OV5A 2NYYC 5CKGA 2VR4A 2JCCE 1EHAA 4OTXH 5F7DA 3U0TA 4M61B 4GW1A 2ITCA 3UBXG 4P5TA 3UZQA 1GGIH 1YNTB 3AB0B 3TC9A 3CSYA 2QHRL 4RGNC 4JPIA 4K2UH 2R2BB 3L3OA 4HT1H 1CFBA 4OZGB 2H3NB 3D2UA 4XH2B 2IG2H 2PTVA 4HF5L 3ZMRA 1BWWA 5J9PB 1EEUA 3G5YA 3T0XA 4MCYB 1YQVL 2VISA 1WWWX 4HC1A 5HD8D 3I75B 1KB5L 3LEVH 4PJ8A 4HS3B 3S37H 4PRNA 4KWUA 4BZ1H 2ADGB 3AGVA 5IM7B 1G7MB 3OB0K 4HUXA 4V1DA 5IMLA 5D7KE 1E4XH 3T4YA 3MREB 5BZDB 4HAFA 3MRGB 4NNXB 3IGAA 2GY5A 4FS0A 3DETD 3UYPA 5J12C 4P59H 2Q76B 2ZUYA 2I07A 1OQOA 3U2SB 2CPCA 2ZP0T 1HYRC 2R2EB 1ZWIB 3VGHA 1MEXH 4X5WA 1XCTA 4YQXL 4GRMA 5LWYH 4JM2C 2CRMA 5D2NA 2NX5E 4O51A 2A9NL 3BZFA 5T3ZE 1H15A 1HCVA 4NZRL 5HDBE 4HUNB 5IFHL 4KK5D 3UBXI 1KJVB 3TBYB 1T0NA 5GHWH 2AW2A 1DLHB 3ES6B 3DX8B 5BQ7B 3DUUB 1BX2B 2QSVA 1F00I 2R1YB 2HJLB 4PS4L 1RUPH 35C8L 5SWZD 1EBAA 3DNKA 1QRKA 4N0UB 1FZOA 3BT2H 4FOMA 4Q6IA 5HHVL 5JO5A 4NQVB 2GY7B 3BESR 4GW4B 2I5YL 4GG6E 2J4WL 4LNRB 3MROB 3V0VA 3WIIL 1FH5L 5IT2H 5C0IA 3CUPB 1XR9A 3JTTB 4P4KA 3QXAB 4C4KT 1ZAGA 2HMIC 4X9BA 2JIXA 1AD0B 3GBMH 4PJFB 3GSWB 1EH9A 5ESQA 4D9RD 4H20L 2OL3L 4ZFZB 3DGGA 3VCLB 1JUFB 4WJ5B 3N1GC 1Q0XL 3CZJA 4FQPA 4TN9A 1BQLH 5F6IB 4CGTA 2YA0A 3BIKA 5IMKB 1JHKH 1FPTH 2ICEB 2XZQH 2C3VB 4QOKA 4E41B 3GM0A 2DQGH 5DD0L 2O5XL 1PG7H 3V4VH 4JFDD 5I1KL 5BW7A 4CVUA 3QCTL 3QAZC 4I77L 5M7QA 3MRIB 5D96C 1YMHB 3EGSA 1X5IA 3VA2C 2DLEA 3KPRE 4L9LC 5EUKB 4ZD3H 3FOLA 4NQEB 3LKRB 5HBBA 3CZFA 2DQTH 3HC3L 2AKRA 3PGDA 1LEIB 4NRZB 2A38A 4N5UA 1ORSA 4GKZA 5ECJE 1J8HE 2DJSA 1JCKA 4LLMB 4U3XA 4HFWA 4G6KL 2Q3ZA 4AL8L 4D2NA 4QHMB 1J1PL 5BS0A 3MV8E 1XEDA 2BY3A 2PXYA 3MMEA 5EO9A 3ULSB 3FMGL 4RFNC 5HD8C 3CVIL 1YDPB 4XMKH 4HZAA 1FBIL 4MJIA 1I9JH 4JHAH 4YK4C 3T1FA 2GCYB 2A1WL 5IQ7L 5EOTA 2P7TB 1RZIA 4UQ2A 1EZVY 2YS4A 3V4UL 4U6YB 4H1LA 1L0XA 2IQ9L 4QRRA 2Y6SD 4ZOCA 3RPKA 1MWAB 1H3XA 3ECBB 5H2BA 3S7GA 5IEHB 4UIMA 2H2SD 4FQ1L 4OZIF 1NDGA 3GMLB 3U4AA 3O0RL 5IW1B 3SKMB 2I9LA 3OX8A 3IDIB 3IT8D 1MCOL 1U8MB 1VEMA 2H6PB 3LKPB 1AIFA 1CLOH 1VEOA 4U0QB 4KK5C 3TH3T 2F54A 4XCFH 4KUZH 2IANB 5TPWL 5JDSA 4LRIC 5EU5A 2JELH 4H5SA 4CBPA 1MFCL 1HCFX 1ETZB 1ZT4A 1BQSA 5TFSL 2X1XR 2YPLD 5D7IA 3O3DB 1GGCL 4I0KA 5KTEL 3KJ6H 3VWJD 1KTLB 5F89A 3KYAA 1I9IL 4K3EH 4HUKB 2VXTL 4YHIA 2JK5B 1RU9H 3NCYP 5D6DA 2O61B 2FYYB 2QJDA 3P11L 1D5XA 2FJFB 1QZ1A 3ARGA 3U82B 4QRQA 3RFZC 4M00A 1V3LA 3ZE0F 1E4WH 3VMOA 2DQDH 1EHNA 2E6JA 1VACB 2YUVA 2X42A 3ARWA 4CAGA 1E0OB 2FB4L 2M1KA 4QRSA 4XCCL 5GGTH 4X4YA 5TE7H 3TN0A 4BA8A 1HH6A 2IBGA 2XWTA 1IRAY 2Z92B 1F4WL 2XN9D 1ND0B 5FUOH 4LCUA 4NKOB 1DEDA 5JOFA 3FRPA 2EDHA 1LNUB 2BSTB 2LTQC 1NFDF 4OGXH 4S0SD 5I8EB 4EUPG 3G5VA 5TQ2L 3RDTA 3WFDH 1J18A 5C08D 3KG5A 1BEYL 4PG9B 5FOBA 1S9YB 4K7PL 1XIWB 3DIFA 2YPKA 4OAWB 1AO7D 4H88L 3K3QA 2E7MA 1S9XB 4J6RL 4HS6A 5KSAD 3QUXA 3ARDA 3VGAC 1NL0H 3VI4F 2DJUA 2YBRA 5C6TL 4L8DA 4RGNE 3OZ9L 4NQXA 3KLDA 1JK8A 4PJBF 3ZDZE 1IZJA 2ZCHL 4QF1A 2HG5B 3PHQB 4Y2DB 1FGVH 5BVPL 2FX8H 3QQ3B 5CBEA 2G75A 2Y6SC 1RZFL 2X70B 2IQAA 5C0AE 4XBEL 2KL6A 4M9PA 4Y0GA 2H2SC 2R8SH 4AG4L 2AJ3B 2NX5B 3KGRA 3U0WL 4YHNA 5EZLA 1URLA 4APQB 1FNSH 4F8QA 1D6EB 5IB1A 4YAQA 4XNMA 1QVOB 3TV3L 2EZ0D 3FKUS 4HBCL 1ROWA 3HZYB 1PJ9A 5ANME 5K9KB 1DQLL 4Z8FH 3W0WE 4NWUL 2YC1A 3QEQA 1YC8A 2NY6B 5C0RL 2AK4E 1G7QB 4J4PD 4YDLB 4OD3L 1MFDL 4GG6B 1RJLA 2GK0A 4MD4B 1UH2A 5IVXF 1CE1L 1TENA 3NN8A 4R8WH 2N4IA 5A40E 2BSED 3UTSA 5JW4Q 3VWJC 3CH1B 3WUWB 2MCPH 4JPKL 3SE4A 2EYRB 4QHUB 3HG1A 3T65A 4ZDHB 1DP0A 3QCVL 3VXRE 1MJ8L 5FGCB 5E8PB 2VLKD 1WBZB 2C3HA 5GGVL 4LVNB 5AG8A 2QQLH 4HWBL 4HHAB 2QQNL 3HAEH 1EFXA 4EQ3A 4KKAD 5JW5A 4MD0B 1WWBX 3QCUL 3QUKA 4RA0C 2A6KB 2X4RA 4KTYA 2C7UB 3PF2A 4GLRH 2EEDA 1P2CB 4LSDA 3ZKMD 1X5JA 2VWEC 3F7YB 2IFGA 3W9DA 1DANU 4PJ9C 4N8VG 1I9EA 5K9JL 5ENWA 3FONA 3TIDB 3BPLB 2OJEB 3V95A 2AAVA 5DO2D 3V52H 2BVYA 3EFFA 4M43H 4I2XB 1T3FB 3H3PH 5FGSA 4MSWB 2YWYA 4ODSL 4RX4D 5GGUA 4D9QE 3AS2A 3MUHL 2CXGA 1BFTA 2HTKD 2ZUVA 5L9DH 5DQDH 1FN4B 5D70L 5GIRB 1KIRB 3RIAK 5JR1H 1KJ3L 4G7YH 1IQDA 5LAXA 4TUKH 3QJFB 1HI6A 2QHLA 1QBMH 2IF7A 4RBPH 5HHXH 4ZSOB 5DHVA 2ZJSH 4WO4B 1NJ9B 5EO1A 4IOSD 3MRPB 1XCQA 3BDYH 4MNQA 3TJEL 4JKWA 3H9SD 5D8JH 2OMNA 3QIUB 5KSAC 4CN6A 5T3XL 1UYWH 2KZ1B 3QRFM 1JZ3A 3NPSB 3EBAA 3FAWA 1LO3L 5EN2A 1FJ1A 3QNYA 2IAMB 3BPCB 3RWHA 5LGHL 2Q20A 2CDGB 1OAQL 3KYNB 3MCG1 3IDGB 4HXBL 2BJML 1JN6A 5MI0C 4P2CG 1OCWH 3BEWB 5CKAA 2XWBA 3TCLB 2EIBA 2I9TB 2MSPA 4PRHA 1BIIB 2YUWA 2IMNA 1ZLWH 1WTGT 4JKPH 4LVEA 3BGAA 5FB8B 4WU5A 5I18H 2PETA 5DZLA 3V4PH 3NH7H 3T1WA 4B0MM 1IKNA 3MLTB 5HGDB 2VLRD 4NO0A 2WK2A 3QDGB 4NM8L 4R90L 2EZ0C 4TUOA 5FIEA 1X4ZA 4N0YH 1YY9D 2PYEE 2VXVL 3B6SB 1JHLL 5DEFB 3HZKB 2BVPA 1N64L 4K3JH 3BQUB 1QNZH 5JXEA 1WIPA 1I7TB 3OKOB 1H3TA 2OK0H 4M5ZL 4MX7B 4LCCB 5KW9L 4LKCB 3DV6B 4FQLH 1NBZB 4QRPA 4UMGA 3VWKA 4TSAL 1J11A 3BD4A 1NCAL 4X8JA 2HWZL 4JO3L 1V7NH 5I73C 2EC9T 2W59A 2K7QA 3ARPA 3RAJH 4KI5E 1W0WB 5AWNL 2IALA 5DRWB 5SWZE 3SY0B 3IDNA 1S8DB 3BW9A 1Z9OA 5JPMB 4MCZA 4TNVF 2XG5A 4YHKL 1PSKH 3V6ZB 4R0LB 4ORZC 4KKAC 3KPPB 4XBGA 4NZUH 3TIEA 1CVSC 2UVEA 3C2AH 4ODVH 4Q0XH 4OUUA 1FNAA 4ONOA 1NBQA 1PEZA 1AGFB 3ZKMC 4QGYA 5IMOA 3AROA 4H25A 1FNLA 1T04A 1JTOA 4KJWD 1I7ZB 4XPFL 5DO2C 3W39A 4HWZB 5J6GA 3Q6FB 2ZUWA 2DBLL 4ZFOA 4MNHA 4PYHA 3GRWH 1NFDB 2D7NA 2APVA 4ZXBB 4ZG1A 3KPOA 4HPOL 2HTKC 4OLZH 1HZHH 1IGMH 1EFQA 4P2RD 1CR9H 5DD1L 4AIZB 3ARXA 1TJHH 5E56A 2OQJB 3VXUA 4BFIB 4U1LA 3QQ4B 5HYJD 5C09D 3O6LH 1S7XB 2FECL 4HIEB 3QUMA 5FYLL 1Z3GH 3EO1A 3PP4H 4NN5B 1IFHH 1V8HA 5ACZB 4AEHL 3C9NA 5CLWA 1IARB 2WMPA 3FQNB 1C5BL 1ZSDA 1WCQA 4O2CB 25C8L 3P0VH 5BRZE 2NY1D 5F1NA 1HH9B 2EO1A 4ZUSA 4QCIA 1OSZB 3G5XB 4XVSH 1YYML 1E6OH 5LVEA 4OM1L 4ETQB 4F33A 5J6HB 2Y06L 3MV01 2GQHA 3DSFL 3MLXH 4C58B 1TVBA 2R23A 3M07A 1HOCB 3MPCA 1JF1A 2VO5A 4EEEA 4JGJA 2V5MA 5GGRA 3KAAA 1A7BA 3U83A 5DUPL 3JBG7 3MOAH 4EUPH 4EBQL 4YHOL 4HK0A 3HNSL 5C0EA 5HYFA 1KCRH 1MFBL 1C12A 4NRXB 5ETUB 5GGSB 1MPAL 1QR4A 2WBJA 1ZHKA 1FL5A 3U9UA 1VPOH 3MRBA 4C56E 1IGJA 2AK4B 1C5CH 1YY9C 3IETA 4G5ZL 5H37H 4Z77B 4F7TA 1QEWA 2BHUA 4M6OH 1RSFA 2FL5B 4F58L 5IVXB 2ESVD 4LEOB 5EPMA 1S7UB 1W72H 5J57B 3RWGA 1FCCA 3MX0A 2MJWA 4RMQA 3KXFD 4AIOA 4YGVA 5F96H 3VXQB 5ACLA 3FQUA 3VXRB 5I2IA 4PV9A 4TSCL 1CU4H 3EOYG 4PRAA 2Q86B 3RVTD 3KS0J 1AJ7L 5T3ZL 3GUTA 4JG1L 4ZTOH 3K8KA 5KVFH 2YPLE 2F58H 1MELA 4NQCE 3VD5A 5DD3L 1CFNA 4XP1L 2IH3B 2ORBH 3T3PE 1IGIL 1WGOA 3O11A 2AERT 4F57H 4PJCB 2BNUB 1FVCB 3WEXB 4RFEA 3MRLB 1FG9C 4Y7MA 3L3JA 5SWSD 3O2VH 1MRFL 3IFOB 4LPCA 5IW3A 3NFSH 1M71B 2YKLH 1IEHA 2M8XA 3C6LD 4Y4HA 3DXAA 4XGZB 4KJWC 1CF8L 2DF3A 3W9EA 3BDBA 3EYSH 2BXYA 3HI6H 3H42L 3O4OC 1IQWL 5EBLB 3IFLL 3UDWC 3OKKB 4JY4A 2QR0B 4X9FA 5C8JB 3OXRA 4Y2OA 3CFDB 4WY7L 1UG9A 3QUYD 4PTUA 1KEGH 2XI9A 1AQKL 2FLBT 2W65A 4JR9H 1WV7T 3QI9D 1BMGA 2AXJA 2X4OA 4PJXE 5C07D 5E6ID 1BAFL 4YDVB 4GRWH 4Y4KB 1XGYH 1P1ZA 4LCWB 1FFPA 2EDFA 3TYFA 3CVHB 2QLVB 3KVQA 2O5ZH 3SDCA 3NFPB 2QSCL 4LLUA 3VDCA 1MCPL 4QXWA 1EHLH 2UWEE 2HFFB 4PJGE 5C08E 2BMKB 1I7UA 3IFPA 1P6AB 1A7PH 4R4FL 4Z78B 1I85A 1DJSA 2CR6A 1RZKL 3C8KB 5IROA 3Q0HA 1JRHH 5JHDB 4JRXE 3NTCL 4GW5B 1PGRB 4PIRF 3A6CL 3O6KH 4NKIL 5KSBE 2Q8BH 2A9MH 2DLFL 2VITB 4PFEA 1AGEB 3O2DH 1I8IA 1TQBC 3R4DA 15C8H 4CMHB 3RZCB 4ODWB 4XVTL 2UZIH 4J8RB 3MBXL 4HQQL 2J8UE 3IAPA 4LVHC 4JFOA 1U8OA 5C1MB 3RUGE 4PJ7A 3SDXE 4HKZA 3QBTB 1QFWH 4GRLB 1U8LA 3FHQA 2R39A 1Z0NA 3KYMA 5IUSA 3GMRB 2W9EH 2XKNB 1KJ2H 3VXOA 3LQMA 4ZS6D 2B5IC 5JW4N 5HY9B 4OLUL 1KLFA 5DSCB 5ID1A 1LO4H 5DMIL 5E8OA 1C1EL 4EIGB 3Q6GH 1Y18A 5CEZE 3VD3A 3AREB 2HFGL 3L3KB 3B2VH 1AHWA 1CZ8H 2EYSB 1Z5LB 1WC7B 2FLRT 3RVTC 5I1DB 1BFOB 5DMYA 1AE6H 2FIKA 4JRYB 3LV3B 3RWFA 1F58L 4Z5RB 4U7SA 4U1NB 5KG9A 4HCRL 1CE6B 2I24N 5CEXA 4EVNB 3MQIA 1DBBH 4LSTH 1A14H 5I8OL 4K7FA 1OLLA 5DI8B 3MOQA 4NC0B 4W6XB 1KIQA 2KKQA 3TO4B 4HFUL 5DVLA 2GK2A 5C2UB 5DJYA 3BYYA 4NNPL 2OTUB 4P2OA 4LASH 4U6XA 3BEVB 3MUGA 4RAUA 4GG8A 2BFVL 3C6LC 2FBJL 3T2NH 1A0QH 3D85B 1S7TA 5F9JB 4HKBA 1AQDA 1PKQA 4JQXA 3ZLQC 2FDBP 4KTDL 4YX2L 2PKDA 4Z7NE 3GKWH 4YHYC 1QYGL 5F9AC 3DVNA 5HYQA 1ZV5A 3QUYC 5I76A 3CK0L 1WZ1H 1I1AD 4OFVA 2KZWA 2YD5A 3S35X 3HR5A 4P9HH 4X5LA 1KCUH 3OJDB 3QI9C 5E6IC 1UH3A 5KSUB 4OJFL 4Y2DC 2J6EL 4LHUA 1YYLL 1TETL 5CJ5A 4IOIA 5BRZB 2EDOA 5D7IF 2NW3B 2EIDA 5EBMB 2EDNA 2CK0L 1KCVL 1YEJH 2K7PA 4APQC 3LHPL 4YBLC 2DYPD 1JV5B 3C09B 2R0LH 2BVQA 1MCEA 3VFGH 5B3JF 3PXJA 4PLNC 4WHTB 1KLUB 1MI5A 2AXHA 2IGFH 4Y88A 2A83B 1TZIA 4G43A 1UZ6F 3RQ3A 5FGBA 3IS1X 4YPGB 3HI5H 1UCTA 1QFHA 3O3BB 4UDUA 4NZTL 2P5EA 1QR1B 4U6TA 1ZLVK 1HKFA 4YLQT 1NGZA 2LE9A 2AJUL 3BUTA 4C56B 5DK2B 2Z8WC 3MJ8A 3VXNA 1NAKL 1RUKH 3RBSA 3RI5K 1JPSL 4KZDL 4OF8A 12E8H 5I16A 1LK2A 5FF6B 1FL6B 4HPYL 3DX7A 1UM5H 4S2SB 4ZS6C 1JNLL 2FGWH 5K93A 2E7LC 1V3JA 2H1PH 2VLRE 1UJTA 2FH8A 3DROA 2B20A 4RQQB 5F7DB 3EO9H 1XAUA 4L3EE 4P5TB 3MA9L 3HAEB 3UTOA 1UEMA 1S5IL 3CSYB 4MQXD 3JV6B 3HS0B 3QNZB 4F7EA 2DMBA 4P0DA 4ERSH 3LKSB 1AXSB 4N0FA 4NQCB 3GEWB 3G5YB 3HZMB 5GSVB 3TLRA 2VISB 1DL7H 5EA0L 4G8GA 1CD9B 2YUZA 5DJ6B 4A6YL 3FJTA 1A7RL 4BFGA 1DBAL 1YPZA 3QHZL 4X6BA 5GS1C 1ZTXL 1N2RB 3EO0B 3T4YB 3IGAB 1A3RH 4IRSD 3CFJB 1OAXL 2CLRA 2RHEA 4V2BA 3DRQA 4W4OC 1OARH 3MRNA 5K33A 1NLBL 3HE7D 1PLGL 5ALBL 4JFQB 2ARWA 3ARBD 3U4EA 5KSVA 4WW2C 5E1AA 2EIEA 3MYJB 2QQKH 5E7BA 4X5WB 4XWOD 3FQTB 2V5SA 4LVOB 4GRWE 5D2NB 2EH7L 3WS6A 4M1CD 3BZFB 2D7TH 3GBLA 1H15B 1G9MC 2UYLB 1IL1B 3F7PC 5T1LD 2C9AA 5DUML 3MUY1 2VXUH 1DSFL 3DMMD 1I1AC 3OWEA 2DICA 4Z6AT 1CYGA 1P7QB 4TULL 4PB9H 3MBED 4NP4H 1R24A 1YNKH 2Q7YA 1CFTB 1KPUB 3G6DH 1FZOB 1L7IL 7FABL 3BKCL 4UOW1 5CS7A 3WIHL 5HYSA 4P2RE 2MKLC 2HJKB 2AJXL 1WVZA 1PZ5A 3MCLL 3V0VB 5HYJE 5C09E 2DDQL 4HKXA 2DM4A 1CBVH 3P77A 1PQZB 1XR9B 4JRXB 3K74B 4Y16B 1G9MH 4HBQA 1OWWA 1ZHNB 4Y19A 5T33H 1ZXQA 4XP6H 1PKOA 4OGAD 4NO3A 2CO6B 4YO0B 3OKDA 5ESQB 2Z31A 4K3DL 2PW1B 3DO7A 3DGGB 4UNUA 2J8UB 4U1KA 4HAGA 3WNNA 3RUGB 2BOBA 3IJYA 4Y89A 1RUQH 1OAYL 3CVHL 3BIKB 4DGIL 1EEYA 5IP4A 1BVLA 3IFNL 1E6JL 3GI8H 3V7AE 4TOYL 1AKJD 3U79A 1RIVL 2VDRH 5E2WH 1Q9LA 1NMCB 4MZ3A 2VZ3A 4B7IA 4JY5H 5I75C 2QL1A 3HTLX 1ADQH 1OSPH 4PBWD 1SYSA 4HUMB 4F9LA 1MAKA 3CIQA 4R0LC 1T2JA 1VFAA 3PGDB 1MJ7H 1TIUA 2ZPKH 3BH9A 5D2LA 1JWSB 1KN4L 2WZPD 1ORSB 1S7QB 3LD8B 4GKZB 3MRHA 1BQUA 4MQXC 4UI2A 4LCIH 1FLRH 5BS0B 3PWPD 3HB3D 1CGYA 2ESVE 5EO9B 1I9RH 3GBNH 5IEKA 1O0VA 1X5HA 3KXFE 4MXVE 2Y36H 4ODUA 3UPRA 2ZSWB 4B50A 3O45B 2P24B 3HNVH 5DRZA 5FOJA 3A6BL 3O4LA 5DS8B 5K9QG 3S97C 3QHTC 5CIPB 3ZKND 1A8JH 1RURH 3BO8B 2FEDD 3P4NB 3FO1B 1F2QA 3HE7C 1GRWA 2D7QA 5D1ZA 3DHJA 2NY7L 2XFXA 4HXAL 4UIMB 4HV8A 4CU8A 3TVMA 3ARBC 1YEGH 4O02L 4P5MA 5F7NC 1Q0YL 1NDGB 1VB9A 1HKLH 1T1YB 2FSEA 4XWOC 1F8TL 3FQWB 2PR4H 1PBYA 5BXFA 2OYPA 5SWSE 2V5RA 1T1XA 4M1CC 6FABH 5IOPA 3QIBB 5FDWB 1DDHB 4TQEL 4Z7WB 5DRXA 2Z4QB 1F3DH 4M5YL 5GZOD 3MBEC 2A6JB 4LGRB 1MCKA 2FEEL 3QXUA 1A1MA 4G9FA 4I18B 4MXQD 2R1WA 3WDJA 2X1QA 2ZUUA 5CZVH 2LAGB 5GJTL 3A67H 4WRLA 3ARVA 5D7IB 1S7VA 3V6OE 2NXZD 1UA6L 2D7OA 4X6DA 3TWCL 3OR7B 4M7LT 5F89B 3WFDL 1KLGB 5C07E 5IVNA 4YHIB 5I1CL 5D9SA 2OP4H 4YPJA 4HMCA 1D5XB 3VFVB 3ARGB 5L2KB 1K6QL 3UZEA 2ZCKH 4OGAC 3WXWH 1KNOA 3FB5A 3BXNA 4FQQA 1DLFH 4MS8D 2WQRA 3MXVH 3WFEL 2F53A 1CFQB 4XWGH 3T0EA 3TN0B 4AIXA 4HGKC 2E27L 1HH6B 3DYPA 2XWTB 5EOCH 1MFAL 1NFIB 4PGCA 3OBAA 1DN0B 3UTPE 1J8KA 3AMLA 1WIUA 1V7ML 4JN2B 3ILPA 3RTQB 1N8ZA 3C8DA 1A3QA 5E99H 4Z95H 1KXQE 1RHHA 3RWIA 4L3EB 3L3IB 1MLBB 5A16B 3LEYL 4I48B 5FOBB 3X3GH 3OXSA 2FCBA 3H0TA 3RVWD 1MFNA 4ONFL 2VDOH 2W0KA 4PGDB 5IWLA 4WW1B 1YN6A 5CSZB 3SDAD 3KPNA 3ALXA 4HS6B 3UYRH 2D3VA 5DK0A 4RNRA 3HB3C 3QUXB 5D1QD 3WKMH 4DUXA 2IH1A 2HRPL 3C6SA 3R1GL 4M02A 4NQXB 1EEQA 3MOBH 3I3EA 1AFVH 1WFOA 5GJSH 1I3VA 4BFEA 1KT2B 1ULVA 4JPWH 3ZKNC 3WO3B 4OSUH 3KYKL 5CBEB 2G75B 2FEDC 4Y5VA 4XXDB 2O93L 2H8PA 4F7PA 5T1KD 3VFOA 1MREL 5HSFA 2Z35B 1I8MA 3U7WL 1MF2H 4PR5B 1FNFA 3I6KA 3GMPA 3QUZD 5HGBA 5I15H 1YZZA 4IHOA 4HWEH 3SQOL 3TH4T 3SO3B 4RZCB 5IB1B 3QO0A 1P4BL 1X5KA 4I5BB 3RWDB 3RY6A 5I66A 2OXHA 4ACPA 1CICB 5I1GH 1RULH 4BKLA 5GGRY 4XAKE 5GZOC 5CUSH 1FE8L 1BWMA 4U2ZA 3AXLB 3QEQB 5JPNA 4OIAA 1LO2L 4M1GH 3W11D 5DJDB 4MXQC 1QFUH 4HJGA 2GSGA 3OKMB 3ARFA 3VDAA 5DC9B 3F12A 1U8HA 1ZANH 2B0SH 2NXZC 5MEQB 4JQIH 3GSNH 2AGJH 1I3RA 1QBML 1QPPA 2XA8H 3HG1B 3JZ7A 3PHOA 3IKKA 1YEIL 1SYVA 3VRIA 3ULUH 4NKDB 3TYGL 4D0DB 5KVGL 1XZ0A 4MWFB 1MHCA 4MA7H 1A3LH 1JYWA 1U3HA 3TZVB 5IHZB 4MS8C 5F9OH 3KPLA 4MAUL 3QUKB 2F9BT 5EULV 4IIQC 4QXTB 1F97A 5C3LD 3JWDC 4X83A 1IT9L 5J06A 4HDIB 4M3KB 3QHFH 3D2UD 3FONB 3HNTL 1IAKA 3EFFB 3KLAB 5L7XH 4H1LG 1X6LA 3RL2B 2VDQL 1XF3B 1MSPA 5HTSA 4PJ8D 3V4PL 3QNXA 4XCEB 4PRIA 4MNGA 3C5JB 5ALCH 1IQDB 5LAXB 4V1DD 2OTPA 3DPBA 1C5DA 4BQCA 2E8ZA 3IAQA 5E6YA 5EIIA 3TBSA 5GS0L 4OCWH 5SV3A 5DHVB 3RVWC 5ADPL 4AY0A 1A6ZB 3JWDH 3ZE1E 4QRUA 2BX5A 1LDPH 1CTOA 5EO1B 3SDAC 2FD6L 4MNQB 4JO1H 3C60A 3FFCA 2FJGB 1IGTB 4OKDA 3BIAX 2BNQB 5D1QC 4D94A 3R06A 1BIHA 3KWWB 3CSPA 2VDNL 1MRCL 3MLSH 3S8WA 1QOKA 3LN5A 1NGWB 2J3SA 3JUYA 1U8NB 3TNNB 1FJ1B 5TF1H 3QNYB 3RWHB 3PQYA 5IR1B 3PV6A 1UB5B 3QP3A 3DURB 3W2DL 2MQ3A 4KUCF 4ELME 1YECL 5CEZL 4JN1L 1RMFH 4JZOA 4PRHB 5EZOH 1ZT1A 4M1DL 1S7SB 1MVFA 2NW2B 4HS8H 5E8DH 4ODVL 4PY7B 3QUZC 4F3FA 5DLML 4XNXL 4YGAB 3U30C 1N7MH 2DQJH 4P4KD 1T03H 3C09C 1J1XL 2N7BA 3ZL4H 1KBGL 1H3UA 1A6TA 3C08L 3K8MA 4LLQA 4D0BA 3AAZB 2ZCLL 2JIXD 4KK8D 4UTBL 5F6HI 2X4PA 3G9VA 3W11C 3DUSA 4UT9H 3BFOA 4RISL 3VXSE 1X7QA 2XIDA 1QRNA 3K80A 4DAGH 3QXDA 3EYOA 4WFGD 5GISL 4WTZA 3NACH 3VWKB 3FRPG 4IDJL 5D7JA 1ZLUK 4QOKD 2W38A 3JWOL 4KVCH 1X4XA 2NXYB 1M05A 1T22A 4XCYA 3JTSA 5MEPA 1WAAE 4U0RB 3RNKA 4PB0L 1I7RA 1NSNL 3NAAH 1FAIH 2JJUA 3LKNA 1MCIA 5FV1L 2DB8A 4OUUB 1IILE 4PGEB 2P8LA 4O2FA 4JHWH 4P5TC 2MPAH 1YEKL 4ZS7H 5IMOB 3OKNA 4LLWB 4ELKA 2RR3A 4MYWB 2ZOLB 1T04B 1EDQA 1JGDA 3H3BC 1E28A 3QT2A 4BH8B 3VXPB 4FFZL 3W39B 2DJ4A 5J6GB 1FL3A 3D6GA 2BSSA 1MQKH 2PXYD 2EE3A 2CMRH 4YHPA 4G7VH 3REVA 4U6VH 3MJ6A 4MJID 4PJ8C 3L5WA 1AGCB 5CP7B 2XZCH 1SY6A 2VR9A 2HVJB 4QY8A 1BZ9A 1GIGH 3ZHLA 4MJ6A 4X5XA 3ZYJA 2XPGA 3U36B 1C5CL 4ZQKB 3ROOB 4FQCL 4QRRD 1CI5A 4AENB 1F3JA 4UNVA 4KV5F 3C9NB 5DC0A 5LBSH 4FTVA 3DX6A 5IB4B 4OFDA 5D72H 4LMQE 3TT3L 3RY5A 1I8LA 4MLSA 3CXDH 4KKBC 1KF9B 5DJAA 1MLCB 4HC1H 4KRNA 4NRYA 5F1NB 1D9KA 5DD6A 1PG7W 2FO4A 4FZEL 3L95A 3JUZA 1OPGL 1T5WB 2F54D 1YMME 2E8YA 4GUPA 3PL6A 3PWPE 2CGRH 3VFPB 4L4JA 1Z9MA 3PWNB 3O9WA 5TQ0L 1ITCA 1RJYB 3K4DA 3UP1A 3GI9H 2DTML 5KOMC 5FM8A 3O8XA 5EH1A 4Q6IC 4XZUB 1XF2A 4OGZA 2Y7QB 4N0CD 4WUKH 1C12B 4KMLB 3QDMA 1KXVC 3MV7E 4OD2B 2CDFA 1U8IB 2PN5A 2W60A 2MFNA 4ZYKB 7CGTA 5ADOH 1ZHKB 2HYMA 3LEXB 5JOPE 5D93B 4P4KC 4OFYA 3HPJA 5HXMA 4UDTA 1JI1A 4F7TB 8CGTA 1F5WA 1QEWB 2MWCA 3GMQA 3HI6L 3BOVA 4P57A 3PJSB 4WNQB 4KK8C 4OCRL 4O4YH 4Z0XB 1JWUA 3ULUE 1H8NA 2YD3A 1CK0L 4YGVB 1CL7L 1QLFA 1C16A 4ODTL 1JYXA 3IU4H 4YDKL 4Q9RH 4PRAB 3V6FB 3LOWA 1BD2D 2VAJA 4GKOA 2LFGA 1HNGA 1BM3L 2P4AB 2VZSA 43CAB 3RJDA 2Y72A 5BW7C 1BOGB 2VTFA 1N59A 4OCSL 1GJIA 4MHHG 1UJ3A 1LE5A 3GJFB 3BPNB 2R0KH 4XPTH 3RU8L 3QZWA 1VERA 3EOTH 1XT5A 5E2TL 1YPZF 2DM2A 3L3JB 4KZEL 3RDTD 1Q72H 4DZ8B 5ICXA 3LD8C 4RDQG 2JJTA 3PDGA 3ZDXE 3DXAB 1HHKA 3D39E 2PO6B 2JJSC 5EFIA 5EU3B 5DDHA 5E7FA 2PXYC 4PY8J 5JNYA 2FX7L 3O2DL 5J11B 1XGUA 4D9LH 3ARDD 4PG2A 1TVDA 4XPAH 1NMAH 1JNHA 2VC2H 4J3VA 5DJXB 3Q5TA 4R26L 4OBRA 5IJVA 4EKXA 5JMOC 1QQDB 4RIRA 2XNAA 2W65B 4X80L 1UWGH 4AK1A 2X4OB 3BIBX 4IRJA 4OF7A 1HSAA 3P73A 4WI6A 4FRWA 4EDWL 2JE8A 4RMSA 3TYFB 1QSEB 3A0OA 4WHCA 2I26N 2P48B 1KIPB 3GNML 1U93A 3SDCB 3VD4A 4P4RB 4HJJL 3CX5J 4GAGH 1RK1A 5JIPA 4YHLH 4OZHA 5I1JH 5IVZB 4MHHI 4OF6A 2BY0A 2EKSA 4W6YB 1ZHLA 1T7ZA 1UEYA 2JB5H 4NO2A 3HC0B 4XBPA 4PRBB 1VA9A 1MQ8A 3BSZL 4ELMB 4M7KH 4P46B 4NUGH 1BLNB 2X1PA 4H1LH 3RA7L 2YZ1A 5DYOA 5IKCA 4RGMC 5IGXL 4MQ7A 2ZUTA 4DCQB 2ZWLT 1P84J 4MDJA 4F37K 4U1GB 3QULB 5IB5B 3MNZA 3UTSD 4N0CC 1NDMB 2OL3A 5H35B 3ZE2F 5KVEH 1RJZA 1T21B 4BUHA 4KAQL 3HG1D 3SHSA 1U8LB 4K7PX 5D6DC 4YHMH 3VG9B 5FHBH 3KYMB 2DD8L 3E6HA 5D7LA 3IDMA 3OKYA 3KPQA 3VXSB 4PJIB 3VXTA 3SKJL 3UPAA 3MLUL 3DI2B 2VLJA 1EFXD 5ID1B 2VB5A 1N6QL 2NY3D 4XC3L 3UO1L 1Y18B 3CDGB 1JYNA 2KBGA 5JA9A 4M6NH 2BNRA 3O2WL 4JAMB 2Q3AA 4I4WA 4PP2A 5B38A 5EWIL 4OCXH 4X7SH 2EE2A 5KZCB 1E27A 1EVTC 5I0DA 3RPIB 4H26B 4EXKA 4HEPG 4OQTL 4MAYB 3NA9H 3QJHA 1U58A 2R1XB 4GBXB 4LKXA 5TH2B 2NY2B 2ADJB 3KNBA 1DANT 3MLZL 5CEXB 3EYUH 1IM3B 4KKLC 1D5ZA 3SEPA 1Y6MR 3G6AB 5EU6A 2WP3O 4FA8A 4HUWA 1IGFL 1MCBA 1M7XA 3TEUA 3RDTC 4L8SA 5EUOA 2CDEA 5BVJB 3OAYH 5CHNA 3ROLA 4U6XB 3MUGB 2C26A 4GG8B 3Q1SL 1K4CA 3S4SA 1NCWH 3WL9B 5F72S 3O6FB 3QH3A 4DOHB 1PKQB 5DRNA 5JOEA 2CQVA 5E5MB 1A6VL 3VFMA 3T8XA 5HI4D 3ARDC 4N1EA 3UJJL 2Y07H 2BC4A 5MENA 5HYQB 5I76B 5GRJH 3WO4C 2COQA 2E9IA 3NCMA 2HTLD 3U7YH 3B9KA 1FDLH 4OBSA 4BQ9A 5L6YH 5FYJL 3TPUB 4F7CA 1TJIL 1UVQA 1P7HL 5J13C 4P23A 1OLZA 2DS4A 4NSKB 3OAZH 4KVNL 2FZ3B 2W9DL 1U3YA 1DFBL 1DZBA 3BKML 4V1DE 4X98B 3DVGB 5HHOE 2DBJA 3I3DA 4K23L 4X6DF 1U8PB 2Q7NA 1C7TA 3GB7A 3CFEA 3I2CH 4R7NB 2ITDB 1YMMB 4NO0D 2VSDA 2X4UB 3ARRA 4MMZC 4ZFOL 4FFYH 2APFA 2BSRB 4EOWL 1HDMA 5CSGA 1DQQB 3V8OA 5BZWA 2VN7A 4OZFA 2IFFH 4G43B 4G80A 2R2CA 4QHKI 3K81A 1Q9KB 5JXED 4UDUB 5HGAB 3DGCR 1UH4A 3MV7B 5TE4L 3ULVE 1MIML 3QUML 4G6MH 3CC5A 2HLAB 4QRPD 2X7LA 4LRNH 5BO1L 2BVEA 3QEGH 1JPTH 1FNGA 4CNIB 2AJYH 2J5LC 5KAQG 3MJ8B 5AZ2H 3SE4C 3B9DA 4KJYB 4KQ3L 4OZ4A 4AQOA 2UV3A 2FNBA 1DEEB 1ZA3B 2EYTA 3NOIA 5I1LB 5CJOL 3ZTNH 3TFKD 3G04A 2VJXA 2QQQA 3LS4L 2XZZA 3GSRA 1A6AA 2NY3C 3NCBB 3GGWB 4ZAKD 4QXUL 3C5ZA 5D1XB 3P4MB 2WM0A 4YBQD 1X3DA 2D7PA 3QXVA 4NPYB 1NCTA 1BFVH 3INUH 1UGNA 4WU7A 5HGHA 4LARL 4JM4H 5B8CB 5HYEA 1M7IB 1VGEH 5KN5A 4S1DD 4HLZG 3UTTA 3VFNB 4X6CA 4WFGE 3UX9B 1JFQH 4K94L 1YPZB 4NT6B 2HN7A 4FQXD 4DUWA 3PABA 1MRDL 4PUBH 3VXUD 1J0IA 2Q1EA 4S1QH 1I1RA 4WV1B 4JJ5A 4F7MB 1VGKA 2ZSVA 2VKWA 3D39B 1OAKL 1ZT7B 4GO6B 4NHUA 3V9FA 3QIWB 5JIKA 3U4EB 5KSVB 5E1AB 5MHSE 5E8EA 3GJEA 1PYWB 2FR4B 3GK8H 5FUCE 2N7AA 1ZMYA 4M61A 1WEJL 5HI4C 3L3HB 4TPRL 2QSTA 2X4QB 1A4KA 1TPXB <