4XPGL

X-ray structure of drosophila dopamine transporter with subsiteb mutations (d121g/s426m) bound to beta-cft or win35428
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
b'ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dopamine transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpgL01
4RMWA 3DURA 3AMLA 1Q0XH 5JXED 4OIIL 2X7LB 3QDGD 3M45A 3K81A 1MFAH 3NCJL 5HVGB 5EC2A 1A6AB 4D0DA 2DD8L 3KAAA 3D39B 1BZ9A 1TITA 4JCLA 5EUKB 1I1YA 2R1XB 4M6OH 1WAAE 2Y25A 3DLQR 1DQQB 3M1BA 4A2MA 4Z7WA 1NLDL 4XP5H 1I1AC 3C09C 3O3AB 5T1DL 4Y4FA 2AJVH 4NQDB 3MV11 4ODHH 3SBWA 3IDUA 4QWWC 1U41A 3GSVB 3VRJB 4LLMA 1EEUA 1EUTA 5MHSD 3KS0H 1VPOL 4E9LA 1NFIB 1HK6A 3SKOB 5H37H 4X6BA 4EXKA 4RBPH 3QUXD 5KVGH 4LSUL 1P1ZB 4YDKL 2BJML 3FT3A 4NQCB 3UJIH 5C6PB 5HHXH 4MJ6B 5IOPA 4KJPC 3FT4A 4WJ5B 4JQVC 1ULVA 1X4YA 3L3OA 3S88L 2NW2A 1MH5B 3ISWA 4G9FB 1IEBA 1BOYA 1PKQB 3LEXA 4LF3B 5CKGA 4G3YH 1W8NA 2DQIH 1UJ3B 2DTSA 4DW2L 2WWKT 4JY5L 1Z5LA 3P40A 3GSRA 3PDDA 3VXUE 4ZDHA 4HSQA 4FQHA 1G1CA 4P2OB 4R4FH 4RWYH 3CK0L 4DEPB 3LQAL 1C16A 1G9NC 3MLYL 4OFIA 2DDQH 1BJ1J 1FNGA 3TA3B 4OLYL 1C1EL 1XGQA 4Y7MA 1PFCA 4MDJB 3VFTA 2HG5A 3B6SB 1F3DJ 5GZOD 5DFVC 5DRZA 1KJ3H 5FYLD 5ILTL 3VI4E 2L7JA 3BP4B 2F58H 1DZBA 3CXDL 3E6FB 3IU3A 3UTZB 3KPMA 2OL3A 5IESL 5M94B 1KENH 5HGBA 2VL4A 5TFSH 4B0MM 4TSBL 1JZ8A 3WDIA 1DN2A 1FGVH 1MQ8A 2Y5TB 3LS4L 5H2BA 1UH4A 1CTOA 4N90D 5KANG 1FL5A 5I15L 4XXCC 3MGOA 4TTGA 3IKCA 1KULA 1QBBA 2EH7L 4LDEB 6FABH 4XH2B 2FATL 1TJHL 3GSXB 2O5ZL 1OAYL 1NUDA 2VDML 3BO8A 3HNVH 5D9SB 4GG6B 5HHME 1FZOA 2HFFA 4NZTL 2Q7NA 4XMKH 1PG7W 3G5XB 3C6LB 3JV6A 1P5UA 1IC7L 4YC2B 3LN5A 1I8KA 5IKCB 1RK0B 4QRPB 1SJHA 2X9WA 5D5MB 3ZSSA 4FFWC 2AJYH 2ILLA 4M1CC 3FL7A 3C6SB 3GBNH 1NAMA 4MXWL 3EGSA 3QULA 4BUGA 2XA8L 4L29B 1OTUD 1HSAA 3OKOA 3VFNB 1BVLB 5IBUB 2PTUA 5K9JL 3ULVC 3ARBA 4ETQA 4K71C 4N0YL 2EE6A 1H0DB 3IJSA 2I25N 3VXOA 4UU9B 4XMPL 2WBKA 4Z5RA 5C9JB 4IOFD 2CPCA 2EC8A 2D4FA 5F7UA 3LRHA 4LLWA 3BGMA 3VWKA 2XQBH 3SDXF 5I1GL 2IH1B 3UCRA 5CJ8A 5HHPA 2QADD 2IADB 3D3VD 4KKLC 2XICA 2OJZL 3ILQD 4U2ZA 1I1FB 1AQDB 3HMXH 4TVPD 2UUDH 4UBDC 3FTGB 3SE4A 1WZ1L 2ATPA 4UAOC 4YE4H 5CEYA 1LO5B 1A22B 3MJ7A 3T77A 1G9MH 5JOEA 5IMMA 1TETH 3GSOA 4DKEL 4OD2B 2QSCL 2WINA 1F42A 2FEEL 4Q97A 5D2LF 1HCVA 4UNTA 1X5KA 2XZCH 4OBRA 3P0YH 1XR9B 1I7RB 3QEHA 2F8OA 5M95B 3R8BB 4RIRA 4AZ8A 5E2UH 1OGAB 4WO4A 1PD6A 1F11B 1MFCH 3CNKA 3V6OC 3JUZA 2LU7A 4RAVA 3C2SA 1ZTXL 3UYRL 3NFSL 3VW3H 2OZ4A 3A6CL 5ADOH 1CD8A 3B2UD 3UPRA 1N4XH 4K7PH 1KJ2H 5CZXC 1MIML 2ZSWB 1PBYA 4PR5A 4CVUA 5JHDB 3WIHL 4NGHL 3ZKXB 3PNWA 2OYPA 1HDMB 3QNXA 3MYZA 4L8CB 2DI7A 1XF2A 2VITB 3I02B 3DSFH 1HNGA 2J4WH 3KPRA 4OZHF 1PKOA 3FB5B 1XIWC 3ABZA 1YEIH 3OAYH 5JW4N 2JF1A 5E6ZA 1DLHA 2X4OA 1DANT 5I1IL 1KIPB 3HC0B 4F2MB 4QOKB 3ZYZA 5K9OB 1OVZA 4X6CB 3RQ3A 3FN0H 3CFEA 3DX7A 1T0MB 3NIDF 4RA0C 2VXSH 3W11D 3FMGL 4KUZH 3SDDD 1R3HA 3VXQA 3KYOA 1TENA 2UYLA 4FNLH 5LCVL 1NKOA 4F7PB 5E2WL 2BXZA 4ETYA 4KTEH 2FX8L 2VN4A 4QRRA 1RK1A 2W0PA 4R7DB 5IM7A 3DUSB 3BPCA 1T5WB 2DQHH 1WZKA 1ADQH 2WIIA 1N5YH 2Q86B 1G7IB 3D48R 5I8KL 5INDA 1A6PA 3T4AB 5IW6A 5DQJB 5L2JA 3BWAB 4RMTA 4TSCH 4OZ4A 1E6OL 3QUMB 1W72L 1N7MH 4H1LG 5CD5D 4LSTH 1FZKB 1R5VB 3FO1B 3GHEL 3BIKA 4ZAKA 1CLOH 5B8CC 4Z76A 1G7QA 1D5MB 3G08A 5DD6A 3RL1B 5L2KD 1ZKAA 3CJJA 4L4TA 3BKCL 4U7KA 1MLBB 4NYLA 3BPNB 4JFFE 4LLVA 3HN3A 2FYYB 3BPLB 1U58A 3HLAB 3D69A 2AGJL 1A1OA 4PRDA 2IBGA 4QXTA 2R69L 3OKDB 1G0XA 4S1DC 3N1MC 3S35H 2H6PB 4OZFG 4P5TC 2VDPL 5BO1H 3LHPH 2NPLX 4NKQB 2E6PA 3CLEL 4R97C 1T5XB 3QZWB 3QEGL 4M7JL 2CGRL 3WL9B 4L8SB 1BPVA 1H3TA 2BXYA 3W39B 1OTSC 5ICXB 4HIHA 1AHWC 5HDBE 4OGZA 4JM4L 1UZ8A 2V7NA 4M62H 3MXVH 4PYGA 2IAND 1S9WB 1XCQA 2APBA 3PQYE 4M1GH 1PAMA 3BVNA 5FKPA 4MXVF 2APVA 1WTGT 2BC4B 2EKSB 3NN8A 5C07D 1FVCB 3VFVA 3SJVA 3MUGB 3QXAA 4KK5C 4G8FB 4QXGL 3VGBA 4KK6C 4UNUA 4RX4A 4WW2C 3HI6L 3MV9D 4MNGA 2VISA 3CLFH 1YEHH 4BFEA 3VFGL 1C5DB 5DD0L 4KRPB 1TZHA 4YHNB 3R06B 3QEQD 1KFAL 3FO0H 4JY6B 3VMNA 2IF7A 4HWBL 5FHBL 3JWDC 4Z7UB 4P4KB 1TVDA 3MRDA 3L6FA 3L9RA 4J8RB 4S10A 4QF1B 2FGWL 1E4JA 1QSFE 1CGYA 4P9HL 2BOCB 4NO3A 4M4PA 4YHML 5DLMH 2IGFH 4UT9H 2YC1B 2X4UA 1A6VH 5F1OB 4LCCA 4LPWA 3GMOB 2VLKA 4NCC1 4G6MH 2B4CC 4M8QA 1ED3A 1NEZB 1J0IA 4N8CH 3QUZB 3WJJA 1RZGB 3D2UA 5DMGC 2CXKA 4K23L 4QHMA 1GGIH 2HLFD 3LPFA 4FTVA 2HTLC 1S7RA 2HJFB 2V5MA 4LGRB 2Q87A 2BSRA 3QIBB 2EIBA 3BRDA 4WFED 3CFJA 5EOCH 3U0WL 3MA7B 5C0NC 5AYUL 1BD2E 3ZMRA 1JHLH 5DD1L 4WI5A 1CGVA 3G6DL 4PJFF 3QUYC 2DIAA 4U6YA 1K9TA 3LPWA 1I4FB 3C60D 4PG2C 5BMFH 1T21A 1MLCA 5EU6E 5I1AB 1CDHA 4B7IA 5F7MC 4F7TA 4ISVA 4ELMB 3P4NB 3SE8H 3WEXB 3GGWB 5D93B 5IB1A 1UJTA 3EYUL 3F7RA 3P77B 4OLXH 5E9DD 4GG8B 3BP6B 1OF2A 1P69B 3BKJL 3WS3B 4YPGA 5C8JA 4OZGF 3GBML 4OQTH 4A6YL 2NY6C 3O6ML 5IFAL 4JO2H 5BVPL 3KPPA 3KYMA 3CCHA 2WW8A 4E41A 3D18A 4GAYA 4Y4HA 5HHQB 1AR2A 2NY5C 4GRWH 1HH6A 4CN4A 5FGCB 1BQLH 5IBLC 5BJTA 1B0GB 1GZQB 4MX7B 4NQUA 5DZLA 4JQXC 2ZNWA 1KUMA 5FV2A 3NFPB 1Q9OA 4JM2C 2P47B 3RRQA 3RVXD 1AP2A 1VACA 1D9KA 5CEZH 4I0PC 1M7IB 3VE0A 4NKMB 3WYRA 4F8QA 3VWJC 3MTRA 2EYTA 5HGGS 4ZFFA 4JE4B 3UC0H 3IDIB 3QQ4B 1RFDL 4LKXB 2VLJA 4PJDB 5KSAA 1ZHLA 4YZFF 3QDAA 2AJXL 4OSUH 1IEAB 4LPVA 5HI3C 2A1WH 5TH2B 5C0IB 3O45B 3SDDB 3ULSA 4K94L 1TZIB 5E2JA 5I2IA 1I3UA 4DFHA 1YY9C 3EAKA 2NY2D 2YPLB 4NT6A 4EI5C 2EDEA 4S0SD 2JB5L 5CLWA 4N0FB 2PYEB 4HHAB 1B0RB 3JV5A 3P0GB 5IWLC 1HQRA 3RWDB 5C0CE 3MROA 2B1HH 5GZND 1WBYB 4R4BA 2V6HA 5B3JF 2N7AA 4O4YH 3J8F7 2FDBP 4MMXC 3T1FA 3GIZL 5CIPB 4ODSL 1TJIH 3T2NH 3LKOB 1A9EA 1IVLA 5IF0A 3NZHH 3LRSB 3V52L 5KVGL 4QRSB 3UJIL 1NFDB 1IRAY 3HE7A 4OLUL 4YHKL 1UEMA 1S9VB 5C0RL 3L3JB 5C0BD 3NCEB 3OTTA 3HI1A 5L2KB 1IGML 1NKRA 1YYML 5EU7E 3TJEH 1BVKB 2DKMA 4LQFH 1FG9C 3WDHA 3HZVB 1HYSD 4PRHE 3DMMC 4Y16C 1LEGA 2OL3H 4KGJA 1F8TH 3MX0A 3NPZB 4PJXA 5GS1C 5LQBH 4Z95H 4GKZA 4X8JB 5SWQA 3U4EA 1S7VA 4PJBA 5MEQA 2ICWB 1QFWM 2YRZA 3KLAA 2A0LC 2C1PB 2NLJB 4PJHE 2X9XA 2YD3A 2XWTB 2OI9C 1ACYL 2BHZA 4DVRL 2DIJA 1E28B 4M4RA 3TO4C 4OF8A 3IXTA 4LEXL 5HPMB 3EYSL 1QR1A 3G04A 1FFPB 2CRZA 3FQWA 5DO2D 3MV7D 5C07B 4N0UA 1NMBH 3HPLB 4LSSL 4UUJA 3V6FA 1LE5B 1BFVH 1EAJA 2AEQH 1BOGA 5E2VH 5FDWB 1A7RL 1FGVL 1FVDB 4LNRA 4ZQKB 1UXSB 2WBJD 4XNQB 1P7KA 3STLA 4IOIA 3EDJA 4LHUG 4XBEL 4XBGB 1NAMH 2XQYK 3O2VL 3O9WC 5IJKC 4NRZA 4PRPE 3MRJB 1LP9F 1G9EA 3JTTB 4HDIA 2P5EA 3EYOA 2IFFH 3MYJA 4MYWB 4H5SB 3MV8B 3HNVL 1IGIL 1LK3H 3IF1B 5FYKL 1MI5E 5ANMB 1OCWH 4MQXC 4YDIH 5E6YA 1RMFL 1T66C 2F74A 3UDWC 4LP5A 2FR4B 1J8HD 3FB6B 5F72S 3GKWH 1NH6A 4U1NA 5CCKH 3I6KA 2ZJSH 1IAOB 1TLKA 5D7LD 3CDYA 1OLZA 5DJ8B 2PO6B 3NVQA 2DBLL 3Q5YA 1ZHNA 1OB1A 4AEEA 4P46D 4TYUA 1P9MA 1Z0MA 3DX9A 4U6XA 1JGDA 4MZ3A 5KSVB 5BRZA 1AI1L 3QIWA 4KQ4H 2I07B 5C6TL 1A3LH 4LSRH 1WISA 1UCBH 3BQUD 5FEBA 1EERB 5JZ7C 1OP9A 1QD0A 2X4QB 4OF0A 4P23C 4WWKC 4KK9C 4KVNH 2ZG1A 5GGQH 5JPNA 5CSBA 1NJ9A 1A4KB 3KNBA 5IBUG 4QO1A 3DTXA 2XPGB 1X5LA 1VGKA 4W4OC 2GQHA 5F3BA 1B4RA 5C3TA 3RJQB 3STBA 1Z9MA 4YQXH 1AC0A 1TQCB 1UWGH 1J11A 2KZWA 3ESVF 1F45A 4P3WA 4TULL 4UV4L 4ZSOB 3VMOA 1NANI 2XN9D 1WK0A 4PTTA 1BZQK 3T0WA 4UINL 3MRBA 4XNXH 5E9DB 4G7VL 1NL0L 5FYJH 5DYOA 1UKQA 4OI8A 1BQHB 2OZ4H 4L8BA 1MIEH 1KPUA 5DQDL 1BWMA 3ME0A 3BD5A 1U3HB 4YBLC 4H8WL 2RBLA 3EKCA 1MHCA 4PJCA 5LGJA 1I1AA 4JRXD 2QEJA 4OGAD 2E6JA 1CFQA 4FABL 4MS8D 4PJIA 2F5BL 2ZUYA 5ICYA 1YYLH 3H7BB 1CK0L 3OAUH 3QCVH 4YDLC 3QDMD 4KKAD 3TCXA 1DDHA 4ZFOB 2ZUUA 3PP4L 3TC9A 3QDJE 4KC3B 5JA8B 3CPLB 2ESVA 5F9WB 3QPXL 3MPCA 4NUGL 4K7PL 2DWDB 4X8XA 1B6DA 1WF5A 4XVUD 4GRWF 4JQVA 1IT9H 1OGTB 3ARGB 3U7AA 4MHHI 1RUPL 5SWSD 1OQXA 3X3FH 3SDXB 1IAIL 5DJDA 1VHPA 1YMME 4KXZI 1MFEL 5EULV 3RUGF 1G0DA 3KYNB 4YHLL 4PP1C 3BEWA 5E5RB 3VXSA 3PWPE 1JHTA 5IUSA 5IB2A 3MBEC 5L8LB 3GMMA 3CC5B 2CKNA 2LFGA 2L0DA 1N6QL 5HJ3B 2CIKA 4XCCL 1WCBB 2V2XA 1T04A 2MQ3A 3DXAE 4MDIA 4YAQB 1T6VN 1HINH 3U6RB 4HH8A 2D0FA 1BFSA 2VZTA 3N1GC 4MD0A 2NY7H 4CMMA 1EGJL 3P9LB 2FHBA 1DQLH 2WLZA 5D2LB 3OR7A 2HWZL 5HHOA 2Y06L 2XFXA 3EHBD 5E1AB 3KYKH 3B9KD 4XB7A 5BV7H 2HVKB 2P24B 1IARB 2G2RB 1IGTB 1LK2A 2A6JB 4G43A 3HZYB 4P2CG 5J1AA 1IJ9A 5FKAA 1F00I 3UZQA 4LKCA 5CBEA 4OAWA 1UA6L 5F71A 2NY0C 3CGTA 3MRGA 5E00A 4OCYH 4AT6B 1LDPH 4KMQA 1ZA6A 2YD5A 4XXCA 4PJ8B 2CMRL 1AQKH 1NCNA 4PFEA 4H0HB 1ETZB 1R3JB 1YJDH 5JOFA 2YUZA 4N8VB 3BMWA 1UACH 5C0BB 3T0EB 1AD0A 4G80B 3BZEB 1DVFD 5EO0A 4GRLD 4BH7A 5IHLB 4C56E 1FIEA 4ODXA 1Q8MA 4FQLH 2BX5A 5DA4A 4OZHB 2VZOA 1A9BA 2QQNL 3DBXB 3HKFA 4X5XB 1DQDH 4MA1B 1CCZA 3EJYD 3RVTD 1YEFL 2VDKH 3QAZB 4HIJB 2YRPA 3LOWA 4WNQB 3S35L 3VFPB 1HHKB 1M6OB 4OGYL 4ZNEE 3KJ4B 3C8KA 1WICA 4IMLA 3BJ91 4G7YH 3FONA 4KDWA 5F7NC 1MCWW 4K9EC 5ITFB 1A1NA 2W9EL 5J3HC 3PHOA 3DYOA 4KKCC 3WXWH 3VD7A 4HUVA 1X5IA 3V0AC 1BREA 3MXVL 3FN3A 4JFDA 3B9EA 5E8EA 1FCGA 1UWEH 2E8YA 3NFNB 1CFSA 1JPSH 3X14B 1YNTB 4ZUVB 3VFMA 4FN0A 2P4AB 5JQHC 3PWLA 2BNRE 4UILL 5J13B 1CVSC 1HHHB 2PR4L 2WBJB 5C08E 1ZLWK 1YEHL 5A16B 4D94A 2PW1A 3SQBA 2DQCL 2FBOJ 1JF6A 5E0QA 4KI5E 1Z9OA 3LEYL 5IMKA 4RQQA 3IFLL 2VLRE 5C2UB 4BA8A 1CFVL 3W9EB 1KIUA 1ZANH 3TVMB 3WFHA 3QO0B 3MRLA 3BT2L 3FQTA 1UVQA 5ACMA 4NQXB 1J8HB 3RWJB 4XPHL 3OJDA 5FYKE 5MEOB 4L8DA 4HJ0D 4ONOA 2IGFL 3DETC 1K6QL 3IETB 3VJ6A 4BM7A 5C0EB 3WFDH 4XCNA 2F54D 3O6KH 2FIKB 2JK5A 5B39A 3ARFD 1S7XA 1I8IA 3UJTL 3S34H 4OD1H 3V6OA 4X9BA 4JHWL 2HKHL 4HC1A 4L5FL 4MNHB 2IG2L 3MRIB 1H3XA 3MGAA 2GITB 4OFYD 4JFYA 2IMMA 2MCG1 4UDTA 4PREB 1I7ZB 3BKML 1CXFA 3BQUB 3VDBA 4LL9A 2HFGL 2YEZB 5DEGA 3TN0B 4DWHA 4YGVA 3DROA 1NGPL 3CZFB 3GM0A 1RUAH 4AMKH 3HAEB 2DQFB 1DQTA 4U1JB 3D0VB 3TH4T 1XIWA 3PXJA 5EA0H 3BDYL 3H3PL 3NAAL 2O5XH 3MGTA 5BMFL 3UJJH 5DWUH 4IRZH 1KCSH 1XGUA 4LPXA 5T1MA 4O00A 4ZFZB 2CH8A 3RX8A 4GW1A 3PDOB 2NY4D 4I9WE 3SOBL 3BIAX 3C5ZB 4YIQB 2J5LB 1B88A 5D7IA 4JRYB 2OMBA 4MD4A 5E95B 4KKBC 1A7PH 5CWSA 4NKOB 3E2HC 3BE1L 5SV3A 2HT2D 4LCUB 4IJ3B 5GGUB 3O11A 1VSCA 1RURL 1ZEAL 5K9KB 5A3IC 4U6VL 3ROOA 5F97E 4LSPH 4HIEA 3ZHLA 1CFNA 1H15B 2XNAA 2W59A 1IC1A 2Z8WC 4PUBL 5DJXB 4EBQL 5E5MB 1CXKA 4Y19B 3LIZH 4JKMA 1IEHA 2GI7A 2F53A 2YSSA 3SDCC 1K5NB 2BSTA 4GW4B 2BFVH 5FB8B 1V7ML 1QVOB 4BFGA 4CAGA 1BGXH 3D39E 5HTSA 5DRNA 1CDIA 5I73C 1UG9A 4GQPH 3GMLA 1A02N 2DQEH 1YEJL 4JZNA 5EUOF 3S36H 32C2A 3G6JF 3QWRA 1H5BB 2BY3A 3DVNB 4M7KL 5F89A 3VFSB 4C83A 3S97C 3UC0L 4ZXBC 2NTFA 1VADB 4ODUA 3PV6B 4PJFB 3QI9D 4XBPA 5JR1H 5DRXB 2NCMA 3GZKA 3VU2A 3BXNB 4Y2DD 4NQCE 4Q74A 4FQJL 5ERWB 4ZOBA 5DJZB 3TIDB 1JYWA 4G9FE 2VE6B 1AXTH 1E4XL 1NBQA 1Q1JL 3WIIL 1PKQE 1NSNH 1TIUA 3NACH 4HUWA 2GJJA 3U9UB 3H0TB 3D9AL 1AHWA 4NCDA 3BP7A 4NJ9H 4OZGB 4GAGH 5KSUB 1IM9D 5FXCH 3B9KB 2CKBB 5D7SL 3GNMH 3BHBA 4U7MA 1YN6B 5IEKA 2B1HL 3ARZA 1VEOA 3GSWB 2CO7B 1RJYA 3C8HA 1CE6A 3T8XB 3B5HA 1GPOH 5KN5B 3PGCA 1FH5H 4ZPVB 5EO1A 1VERA 12E8L 1MCPH 1H3VA 1NMAH 4EEEA 1X5ZA 3RZCD 2NXZC 4HIXH 4UOJA 3RIFF 1XGYH 1HEZB 4HW6A 1F4HA 5ESVA 3SN6N 1XH3B 2FSEA 5FO9A 4MQ7B 4HMCA 1TCRA 4NFCA 4XP6L 4F9PA 2I9TB 2NX5A 4PGBB 5DJ6B 4ZS7H 2F5AH 5GRJH 1HXMB 1KB5A 2CSPA 4KROB 4MJIB 4O51B 4PJ7A 1OAQL 2QADC 5HYQA 4YEFA 1HWHB 4AH2A 2EXYC 2JKXA 3MREA 4NDMB 5FIEA 5CEZD 2Z93A 3MCKB 3RWFA 4HGKC 5LQBL 4BSWB 3MLVH 4ESKA 3C8DA 3L3IB 1XEDA 3BZ4A 5JDSA 4U3CA 3ARSA 1RVFH 3QA3B 1VENA 4GG6E 5DRWA 3GRWA 4JPWL 5SWZA 4M6NH 1L6XA 4L9LC 2VXUH 4I4WB 2LAAA 1NCUA 5JW5B 4QRPE 3MSPA 4FP8H 1HHIA 4JKWA 4JY4A 4M5YL 4Y4FD 4HFUL 5AAWA 2XY2A 4LFHD 5CD3B 2VQ1A 4WFGD 5IK3B 3KPOA 1NCAL 1BFVL 5GSVB 5DJYA 2HMIC 4UV7L 1H3UA 5E2VL 3DV4B 3QUYA 2OX5A 3C5JB 3O4LA 4PG2A 5AZ2H 2O61A 1HHJA 2LE9A 5F70A 2WUBL 3VG0H 5CHNB 5TQ0H 2KQNA 3QXDB 4XX1G 5F7WC 1KPRA 2IFGA 3L3KA 1U8LB 2CLVA 2HH0L 5JMOC 3TF7C 1UADC 1YEGL 1CXIA 3LRGA 2IFFL 2P5WB 4F7EA 1HH9B 2WWMC 4KPHL 4CKVX 5A2FA 1MFBH 4LP4A 5BQ7A 4ODTL 4YDIL 4W81A 4M48L 1FV1B 1T1XB 3DX6A 4MA3B 4Y5YC 5IJVB 5AEAA 5HVHB 3GMQB 4I2XA 2EO1A 4Q9RH 2Z92A 3ARFB 3U7YH 1R24A 2W60B 5HGHB 4JZJC 4Z7NE 3MOBH 2ICEA 3HE6B 4ZPTA 2Y1VA 5EIQA 1H8NA 5CUSH 4FQ2H 3HUJB 4OZIE 5MERA 1U8IB 4KQ4L 3EJZC 2FJHA 2B5IC 3OKLB 3OZ9H 4JM2A 3JVGC 4D8PA 1B4JH 1A3LL 1D6EB 1QFWI 4I0PA 5F88B 1FNFA 4M93C 4PB9H 1KELL 1GXEA 3F7YB 3QYCA 4P5KA 4XP9H 2R9HC 1PQZB 1VESA 43C9B 1AGCB 1UWXK 2XZQH 3VWJA 3X3GL 2DIBA 1ITBB 4CVXB 5IVZA 2ADIB 2AXJA 1QFUH 5GGTA 1JV5B 3W9DB 4LVOC 3BUYB 3EOBA 3QR2A 4YQXL 1TXKA 2NY4B 3CDFA 1EPFA 1QRKA 3GFUA 4ZOAA 1LP9B 5ITBH 4M9OA 4XNXL 2HRPL 5C0JA 5JHDE 3DYMA 2R0ZL 1XGTB 3RAJL 1K2DA 2W9DH 3SY0A 1J1PL 2V9RA 3AREB 4JFPB 3H9HA 3L5WA 1A6WH 5DMIH 5MI0C 3IDYC 2NMSA 4P3DB 4LGPB 5IWLA 1S8DA 2DI9A 4JPVL 4PGCA 4QOKE 4DN4L 1A5FH 1YYLL 43CAB 3ARBD 4NKDB 4X6CE 1EEYB 3MNWA 1PW3A 4ODWB 2YN5A 3T65A 1T89C 1WJ3A 2ORBH 2VABB 3R0MA 4E5XA 3V4PH 2WSKA 4CVZB 3HI5L 5F6HI 4I1NB 3Q6FB 1URLA 4I3RL 1MHPL 3EOTL 3VWKD 3PGDB 4ZMAT 4BZYA 3UMTA 3VFWA 3GB7A 4D3CL 5F1NB 2MHAB 2OQJB 3GMPB 4HLJA 2OTUB 2HFEB 5EFIA 4LNVA 1FNEB 2YD6A 3OKNB 4PJ5E 3QI9B 3UTQA 4FQQA 4OUUA 1OARL 1TNMA 4GBXC 3DMMA 2IH3B 3NIGE 3FQRA 4Y16A 5B4MC 4NC0B 1EJOH 5ISZA 4Y2DB 4FXKB 5GS1A 3NABL 5JA9A 2EZ0C 1AKJA 4RISH 3V6ZB 4OFVA 3K8LA 4JEGB 4G8GA 2FEDC 3QO1A 1CD1A 2P1YA 2XWJA 4X6EB 1YNKH 4ALAL 4JQIH 3RY4A 1KJMA 3TO4A 2ARJB 3N50A 1CBVH 3C08L 1I1CA 4WO4D 3KYKL 5DQ9A 3BW9B 5EU7C 4GQ9L 2VZ1A 5C7XH 3WE6B 3BZFA 5EORL 2W0FB 4NQVA 4PRNB 4U6HB 4OIAA 5FYJD 3DRTA 3MRMB 4PJEA 4OM1H 1U8MB 5C09B 3BH8A 4LLAA 5T3XD 4HT1H 4U05A 1A3QA 5DTFA 2FB4L 2AABH 2AK4A 4QCIB 4OCYL 3A0OA 5LVEA 4JFXB 3O9WA 5IJKA 3QHZL 3RZCB 1FAIL 4PG9B 2ZUWA 3TFKD 5IB5A 4UQ3B 5BZDA 3DRQA 3F5WA 4YUEL 1UACL 3QWOB 8FABB 3GMNB 1CGSL 3ULVH 3GSQB 5F7YC 3HMWL 3Q1SH 4URTB 1RZJH 3RIAK 1AGDA 1UZ6F 1CTNA 2YPVL 4FQLL 3UDWA 2W9LA 4PJXF 1K4DB 1V5JA 3RUGB 1DFBH 4XNUH 5BZWB 5FUCE 2AW2A 4DKFH 3C60C 3T0XA 3WKNA 1FYHB 1Q94A 5CGYC 5FGBC 3WLBA 5HYSB 4GKNA 4NBXB 4DCQA 2GTZB 3JWNC 3WN5C 1MVUB 1ORQB 4N8VG 1FJ1A 4G7YL 1ZHBB 1YY8B 1I1YB 3QXWA 5DJ2A 4E42B 5HYJE 3TGXA 1CF8H 4Z7UE 3ZYIA 4NM8H 1J0YA 4HUUB 4QRRD 1FFRA 5E7FA 4HULB 3DGGA 2CIIA 4WWKA 2BVEA 5EZJA 4XC1H 5I1LA 1MCHA 1KLGA 2B0SH 4MA8L 4U1SB 2XTJB 4ODBD 4DK6A 5DHVH 2VJXA 4X6BB 3KXFA 5JUEH 4W4OA 5FYJU 3MR9B 3V7MA 1RHFA 2H2SC 3FT3B 4MNQA 5FV1L 3RNQB 5CFHA 2DLFH 1LGVA 1CU4L 3VFUB 1JPGA 4ZAKD 3KPQA 1FBIH 4V1DA 4BFBD 3TZVD 1WFTA 1INDH 2ZUQC 4JREC 4JO3L 4DTGL 2P8MA 2VN7A 4PV9A 3UYPA 4HC1H 4L4TD 1BZ7A 1O7VA 4MJ5B 4LVHC 1RHHA 1ZANL 3MJ6A 4ZDHB 5D1XC 1U9KA 3QG6B 4XZUB 1U8PA 3X13A 3U4BH 3BSZH 2CRYA 1X5HA 1MSPA 1FNGB 1U0QA 3WFDL 1NFKA 2VXVL 2AV7B 3OKMB 1XGQB 4ELME 2ED9A 5DUML 2GHWB 3SDAC 5HBBA 1E6JH 1CE1L 3T04D 3RI5K 2YD2A 2V7HB 4TNVF 1C5CL 2NY2C 2Z9TA 1W0VA 2PETA 3PGFH 5I1KH 4JRWA 2QQKH 4N0CD 2XXMB 5H37G 4AM0B 1HE7A 1EZVY 4JDVB 3BFOA 2WNGA 3BKYH 2OS7A 3SJVD 3DVGA 5D6CA 3HFML 3M8OL 4ZFOL 5F9DC 4ZTPL 2CLZB 1WAAA 4NRYA 1QSVA 2YRLA 4M6MH 1FL5B 5EA0L 5DHXB 3UJJL 5FUZL 4LU5L 5GHWL 2V5TA 4HEPG 5C1MB 2FBJL 1Z3GL 2DTMH 3OXRA 3PIQA 3MBEA 4OCSL 2FZ3A 4NQED 4WFHD 5H94B 5TF1L 4F15B 2HFFB 4LSQH 4JCMA 5F96H 3JV6B 5FOJA 3WNOA 1A14L 1WQVT 5CGMA 3CX5K 1TDQA 3O2DH 4OJFH 4P5MA 2DN7A 3D0LA 4NNYA 3LKPB 1RIHL 1YPZF 3MJ9A 2JCCF 1HXYB 5CMAA 1NEUA 4DUVA 1TVHB 4LSPL 2XXCB 4EVNA 4NO0A 1HSAB 3UBXB 4OKVA 4F8TA 4R7NB 5IB3A 1P6AB 3NGBC 2VLKD 4CW1B 5HGDB 1XR8A 3IVKB 3D2UD 2RB8A 3LKSA 4L4VB 3VXUA 4Z5RB 1C7TA 3SKUD 5HGAA 2JJSC 3ZDYE 3CUPB 3S5LA 3JBG7 4OCWL 2YPLE 3PWVA 2CK0L 2ITCA 2XYCA 2P7TB 3BGFC 3RKDD 2DQEL 4NSKB 2VC2H 2DLGA 3S36L 2MSPA 4HPOL 2PYEE 1J0ZA 1FSKB 3GK8L 2YS4A 1JUFA 3MFFA 1BM3L 5E8PB 4JN2B 4K94C 4M5ZH 1OP3K 3B3IB 1WUNT 3WFEH 4GXVL 4DGIL 4NUJA 3O3DA 1EFXA 1JI2A 4QTHB 2YKLH 3RDTC 5DJ0A 4GMTL 1U8HB 1EO8H 1NFDE 2KH2B 3ARDA 5HHNB 1YA5A 5D7KD 4FQCH 5IHUH 5GJSH 1AXTL 4TOYL 2VZVA 3E1F1 3RVVD 5L2KE 2GYSA 3RHWF 4R0LB 1JGEB 3D85D 3ZKND 1PGRB 1F6LL 4HZLA 4QHNA 3W2DH 3BN9D 5IMOA 4YXLL 1MCJA 4FFZL 3ZO0A 4E41D 3FOMB 2Z31C 3JWDH 2ZG3A 5JO5A 1UGNA 4OD3H 4PBVC 3HPJA 3MLTA 1KB5H 1LD9A 1SEQL 5I8CB 4NBZB 4R90L 1D9KD 1MCPL 4KQ3L 5AZEL 1EXUB 1AO7E 2MWCA 2E7LC 3I84A 1G7HA 5DHYA 2B4CH 3FO2A 5EUOB 4UMGA 3G6JB 2VKWA 3GRWH 2VLJD 4M43L 2I24N 4O2CB 5KSAD 4Q9QL 4PYHA 1KTLA 4NO5B 4XI5C 2IPUK 5J1TC 3CFEB 2EH8H 1ZWIB 1NGYA 1X5AA 2LQRA 4NN7C 5DT1H 4HKBB 4H25B 3VXQB 3BPOC 3S9DB 1U8JA 3MRCB 3V95A 2DQGL 1XCTB 3MV8E 1NAKH 4M6NL 4KI5C 4N9GB 2ADGB 4I18B 1G7JB 4S1RL 5EC1B 2R2BA 4PGDB 1RZFL 2FX9H 5HHVH 5L2JB 3OWEA 1MCOH 1I8LC 2QR0A 1QLRB 5CSGA 3CX5J 3HCVB 5CJOL 5I8EA 1EEZB 3HC4H 4HKJA 4CADA 4MAYB 4EJ1C 1F4WL 4OLZH 1OTTD 4BZ2L 2IAMA 4YBQC 2X1XR 3HE7D 4P3CL 3P0VH 3TZVB 3DO7A 3G08B 2C4XA 1L7IL 2JELL 5E7BA 3RPKA 1NDGB 2H1PL 2ID5A 3RL2B 1EHXA 4JKKA 5GGVY 1D5BB 1U42A 3BP5B 4QT5A 5DFWH 4LLVB 4HWZB 5D1ZC 4IRSB 5ESQB 3H6JA 4L3EE 4R96A 4G6FD 5I71B 5J9PA 1OAZH 4YX2H 2CUIA 3G5ZB 4HWEL 3QXVA 1BF2A 1MJUH 3TEUA 4G9DA 4G6AC 1HCFX 3P30L 4EKXA 3KJ6L 5F9JA 1RV6X 2NNAA 4LCWB 4ZSOE 1UXWB 5I9QB 4QRUA 2BOBA 3SDCA 4HIHB 5GGTH 1UM6L 5E9DE 2Z4QA 1KEML 1DL7H 2V7NB 1L0YA 2HKFH 4TNWF 3MLZH 3KLDA 2OXHA 2BVPA 2AJZB 4GW5A 2I5YH 4JG0H 1B4JL 5FKPB 4J12A 3BD4A 1OW0A 1HQ4A 2Q3AA 2VZ3A 1PG7H 4JGJA 5FUOL 3HZMA 1NBVH 1GGCL 2R1YA 2G60L 1NCCL 4LLQA 1FFOA 1NGWA 4WHYH 5FCSH 4HUXA 4WEUD 1TZHB 2R56H 1CN4A 1U6AH 4NQEB 2P5ED 3O3BB 1JRHL 2KZ1B 1AJ7H 1T1WA 1KIQB 4JDTH 5HYIA 3RWHB 3OR6A 1DVFC 4NO3B 4GRLC 3QT2A 2BMKA 3JUYA 4PGEA 3SDXE 2E7MA 5EU3B 2X4UB 2DLHA 1A6WL 4P49A 5DMIL 1KT2A 5L88L 4LCCB 1M05B 4KGLA 4GSDH 2BSSB 3SCMB 1X7QB 2R2EA 3MLWH 4W4NA 2VWEE 4JFFA 3U48A 5I19H 5BRZD 4K3EL 4BSVA 1R5WB 3ROLB 1QQDB 1MJJA 3QIWD 4OM0L 4MWFA 1V7NL 1NC2B 1C08A 2EXWC 4WTZA 1NCBH 1RZ7L 1Z0NA 2CKBL 5GPRA 4ZYKB 4I3SH 1VEMA 3UTOA 5D2LE 1FFNA 1C5BH 4M8VA 1JPST 4HS3A 4LLDB 4AEIH 3FFCB 2R4RL 3CX2A 5JLZB 2YWYA 1MQKH 3GMRB 3DNKA 3F12A 3IT8D 1T21B 4IBLT 1RJLA 4O58L 4XPGH 1BJ1H 4F7TB 2ICWJ 3PQYA 4ISVB 2MKWA 2HTKD 2WUCL 3NZ8A 5IB1B 5CSZB 4XXDB 1Q0YL 3LH2H 1F3DH 4X4YA 4DJMA 3ZE0F 4U1MA 5E6IB 4ZO8A 4BJLA 1WBXA 5C0BE 4YPGB 3QDHA 2UWEF 3P9MA 4X9HA 3T0EE 1YUHB 3V0WH 1T7XA 1OLLA 5F7KC 2DYPA 2X41A 3D85B 4L3CB 2MCPH 4L9LA 1WFNA 3DV6A 2AEIT 1I1AD 2EDYA 4OZHE 5JW4Q 1R3KA 3L7FB 3QFJB 4M3KB 1FG2A 2DQUH 1F4XL 4GAYB 4WW2F 4Y8DC 4JDZB 1R5IB 4NKIH 5C7XL 2ZKHL 1U8QA 25C8L 1QSFA 4KAQL 4NFDA 4OT1H 3S96A 2QHRH 4LLUB 1FIGH 2ESVD 3NIDE 5I1HL 5DD5L 5I1DA 3ETBF 1WLHA 3LN9A 4NZRL 4KJPD 4Z7QE 3WS6A 3VMPA 3KHQA 1OHQA 4WDIB 3VGFA 4ZFFB 3THMH 2J88H 4D0BA 2ZCHL 3C6LC 4JJ5A 5KSAB 5K9QG 1MJ8L 1ZHLB 4Q7DA 3VXSD 1CD0A 4ZUSA 3DIFB 3VCLB 1A7NH 2H45A 1JFQH 4Y5YA 2J6EL 1II4E 3VXRE 1D5XA 5IIEA 1BD2A 5C92A 3ULSB 3MQIA 5ALBH 2IC2A 2FH6A 5GS0L 5KOVC 1TPXB 1WC7B 4POZC 4JZJA 2R29H 4NT6B 5EOQH 3VXMB 1H3PH 5DFVD 5EU6A 4PJ9B 4K3GA 5HHOD 2X4PA 1RIUH 2QJDA 1A0QH 1N0LA 3JVGA 4EIZC 3LDBC 1J8HE 2AI0H 5JXAH 1U36A 1ORSB 4RGNE 2KUTA 2MMXA 3VI3F 5D72H 2DQDH 5GRUH 1J0HA 4DZ8B 5DJAA 2A6DA 2ITDB 1GAFL 3PJSA 5JUEL 3PV7A 1XFPA 1DUYB 4U0RB 4LRNH 4JKLA 1LNUA 1IBGH 2BVOA 3CFBA 2O5YL 4UIMB 4PTUB 5EBLB 2D0GA 1FNSH 1YDPA 4WY7H 4UZGA 5FM8A 2HJKA 3WXVL 3LS5L 5GGSB 3VRLF 1W0WA 3WO4B 4LFHG 3SGDI 5I8OL 1A7QH 3K8KA 4TUKL 5D70L 4G6FB 5L6YH 1AE6H 5KS9B 1A6TA 3SPVA 4UI2A 4FFWD 4PRIB 5SX4H 3U82B 4M1CD 1EFQA 3BSZL 4PJXB 2R2HA 2PCPA 5A2JH 3KVQA 5SWQB 2VL5A 3BGAA 3SKNB 3MRNA 3WIHA 3ULVD 3KLAB 2RJMA 3Q6GL 2AXGA 2VIRA 4GUPA 4PY8I 3JSSA 3EO9H 1P84J 3BN3B 4JM2F 4EXPX 3RWGA 4EOWL 2RFXA 4JRYE 1T89A 3RGVB 1VA9A 3KPNB 1ZLSH 1QR1B 1DBMH 4JFDD 3PGFL 4PRAA 5F3HA 1I9RH 1GHFL 3WUWB 4KTDL 4D9LH 1FFQA 4UUJB 1IC5L 3ZKXC 2GY7B 1KEGL 1DEEA 4Z0XB 3NTCL 1AH1A 1BOGB 4X6DF 3IDGA 2I9LA 3FQXA 5D7JB 2RCSH 4KKLD 4LARL 4JFZH 3O41A 1P7KB 2C26A 4X9IA 3STLB 3MJ9H 1R3LA 5CILL 4Y19E 1J1XL 2CXGA 1SM3H 5C0CA 4GBXA 6CGTA 5DK0B 1Y18B 2P5EB 2KDGA 3BIBX 3UTTB 5TDNA 3H9YA 1ZVSB 1NDMB 3I6LD 3Q5OA 1HKFA 3OV6A 2PW2B 3U1SH 5F96L 3FQUA 4HGMA 3O2DL 4UQ2B 4O5LH 2CR6A 2QQLL 3QJFB 5A2LH 1PZ5B 1RQ5A 1W72A 1OSZB 2AQ2A 1IKFH 4MHHG 1A2YA 4PJFE 2GSIB 3UYOD 3IJYB 3TT1L 2B1AH 1JN6A 5GISL 5JQ6H 1IZKA 1OB1B 1S7TB 3GSNB 3IS0X 1RU9H 3L7EA 2WZPD 1NCDL 4BKLA 4PB0H 1VFAA 3UTPE 4XWGH 4PRHA 2W0LA 3O8XA 1CZ8L 4S11A 4XNMA 5CBAB 1TZGL 4G8IA 5TGBB 5BW7C 5DDHA 5CZXD 3BYTA 3IAPA 2K7QA 4PJAB 3U0TA 3KG5A 4BFIB 5KG9B 1S7QA 4PGZA 4OZGE 4XCYA 1BBDL 3MODL 4EN3A 5E2TL 5JPNB 4M7LL 1ZGLP 1MVFA 3LKRB 3KNBB 3K2UH 4PJHA 1I9JH 3DTXB 3FRPA 1XIWD 4K9EH 1VGKB 1JZ2A 1DSFH 5D96C 4WU5A 3TIEA 3WHXA 3VXPA 1AD9A 1RAMA 1BX2B 3BPLC 3QNYA 1AXSB 2EEBA 1E27A 3I50L 3VRIB 3WJLC 5FGBA 3EUUA 3QCTH 3QNZA 4Y2OA 1OSPH 2NY3D 5J6HA 1AC6A 3TH2T 1IL1B 3T3PF 1EO8L 3AB0C 4LCIL 1ZVYA 4L8BB 4M7ZC 3IDJB 5B38A 4QRQB 1KPUB 2UZYB 3AXLA 1KTDB 1QFHA 4FS0A 2Q3ZA 4FFVC 1K4CB 5EU4B 4PRPA 3QFDB 1I1AB 1YPZB 1QNZH 2DB8A 2JCCB 4MJIE 1LWRA 2W07A 4YDVB 3RVUD 1EH9A 1MI5A 3UXFA 4DVBA 4YZFE 5SX4I 1LQSR 3FT2A 4Y5XB 3UZVB 2F53D 4QGTA 1CT8A 2ZSVB 1MF2H 4HWBA 2ESVB 4P99A 1OQOA 5FUCC 2ATKA 1J05B 2VQUA 3QG7L 2YD7A 2YMXH 4KRPC 1U8KB 2C1OA 5FA4B 5C71A 2DKSA 1S9YA 1MREL 5L9DL 3QWRD 5C0AE 1FE8H 3MBXH 4MGXA 4P4KC 1JNLH 2OR7A 2FWOA 3N1PC 3SGEI 5D1XA 4WUKH 2GAZA 2EE2A 2R0WH 5B3JE 5IB2B 2BVUA 1CDBA 2WBWB 5I1JH 4Q9CA 5C70A 3TYGH 5IHBA 4S1DD 5A43C 4XNYL 3DECA 5IQ9B 3S8WA 5DT1L 3IJHA 3IDNB 4MD0B 5D1QB 3WNLA 5E4EC 3SDAA 5GJTL 4CMMB 2EIDA 4WWID 3QUZC 2P5WE 3OR7B 1OTSD 3B9AA 2GTWB 1FZMA 1CICA 3O3UN 4K7FA 1AGBB 1X5YA 2WQRA 3LY6A 4LRIC 5IV2A 4AJ0A 3CSBA 1LO2L 1DBBL 3QIBC 4JR9H 4U3XA 4G43B 2FX9L 5KVFL 4EDWH 5CBEB 4JLRB 1CL7I 3LSOA 4JFQA 1UYWH 2VXTH 1ZA6B 4JANA 5EWIL 2C7UA 4ZO9A 4OLZL 2AEWA 3HUJE 2NXYB 3P11L 2G9HB 4GMSH 3L3GA 3MUHL 2QV2A 3S98A 3TPUA 3MA9L 1LO0H 2NX5D 2AJ3B 4ODXB 3VWKC 5EDXA 2HA1A 3QDJA 2A73B 1JGVL 1I3RA 4NN5B 4NWUL 1KPVA 5E08H 3O2WL 3H9SE 2QKIA 3QIUC 1UM4H 2VDOL 1X4ZA 4U1KA 4OTXH 1OAZL 3B9DA 5HY9A 2OLDA 5FOBA 4D0CA 3C8KB 2J8HA 1JWMB 3FONB 4OIIH 4K71B 1YMMA 2X4TB 3ZE2F 1FO0B 1BLNA 3NCBB 15C8L 1KB9J 2X42A 4X6FB 2DD8H 3PWPA 1LP9E 5SWZD 5DMGD 3MRKB 4HF5L 2JJSA 2HTLD 1F6AA 2K1MA 4JFDB 3MLZL 1NLDH 4YNYA 1CFSB 3DXAA 4L1DA 4S1QL 4NQSA 1MY5A 1I7TA 1WAAF 2EYRB 5C0ND 1SJEA 1OAXL 1NGQL 1PG7L 3PWLB 5T1DH 4NPYB 4XNZB 1D5ZB 3QUYD 3O4LD 5IFJA 4HKZB 3M17B 3EOAA 2PW1B 3FQNA 4APQC 3QCUL 4UAOB 3ZKSD 4WW1A 1T3FA 1TVBA 5IMKB 4YDKH 2BJMH 3K4DA 3RDTA 1O7SA 5IHZA 3S88H 1MRDH 3RPIA 3AUVA 5TF0A 3V9FA 4CU7A 4Q6IA 4XCFL 4XWOD 3IFPA 4P9ML 4L8DB 4DW2H 2NY6D 4JY5H 5EPMA 3VJ6B 2A77L 3V4UL 4QRTA 2CR3A 1QLFB 3E6HA 3UROR 4ZG1A 3CK0H 3LQAH 3MLYH 4QYOA 4YXKH 4C56A 2Z31A 3MLWL 2Y7QA 4JFYB 5J11C 4OLYH 5IBLD 2VB5A 5FF6A 4Z7VE 4I48A 1CLYL 3NBNA 4YO0A 4I77L 4JM2D 4DN3L 3OXSA 1MEXL 4ZNEA 3L95A 3NA9L 4I0PD 4I3SL 1AGEB 1M71A 4YGVB 3CXDH 3B2VL 5IESH 3VWJD 1NUGA 1RSFA 4Q6YA 2B39A 5TDOA 4AQ1B 2A9NL 1IM3B 4PRBA 3O0RL 1Z2KA 4JFOA 3LS4H 1XGUB 3MLSL 1F4YH 4AIZB 5C09E 5I15H 5HI3D 4M1DL 1FC1A 4R6UA 2EH7H 2BNRA 2ZZUT 2X40A 3K7UA 5CWSB 4YWGL 5JPMA 4AL8L 3MMEA 2O5ZH 4MD5B 1OAYH 5C08A 1YY9D 4NZTH 4EI5D 1CDYA 2EEDA 2V9TA 4IMKC 1U92B 4HIEB 4KDVA 5H8DA 2E7BA 2W0KA 1NBYB 1VB9A 1FYTB 5T5NF 1YZZA 5IMLA 4MXWH 2VLRA 2DQUL 2W65A 2XA8H 4EUPA 2CDGA 4NKIL 3LEVL 1I8LA 5MEPA 2F53B 2YSSB 5K9JH 4BUHA 1CGWA 4OKDA 2HN7A 2QHRL 3I75A 1FIGL 5GGSY 4Y5VB 4YHOH 3PABA 4XMPH 4XC3H 2CDFB 5TDPB 4X0KA 1DCLA 4YHPB 1HKLL 3U83A 2YD1A 5B8CB 1T4KB 5L7XH 4QNPF 3WKML 3VGGA 3IGAA 4NC1E 1T20A 3LV3A 4XHQA 2NTFB 1LEKA 3TYFB 2X89A 1YECL 1T22A 4ODUB 4WFGE 5HVWA 5I1GH 4O2FB 3VXTA 5D1ZA 1MHEA 5CP3A 5E8OB 2XTJE 1G7PA 4KHTH 1AIFB 2J8UF 2UY6A 2OJZH 3DMMD 2JLLA 3U7WL 4Y16D 1BFOA 4HUMB 5I76A 1WIPA 5ISZD 4P5TB 2IPKB 1WZ1H 1J5OH 1FL3A 4HUNB 4R97B 1AKJD 2PO6C 1KXTB 2VLLA 1CIUA 4DUWA 4G8GD 3VGHA 4OLVL 2A0LD 4DKEH 1NC4A 2QSCH 35C8L 4HUWB 1WV7T 2HLAA 4Y88A 5EIIA 2UWEB 1QBLL 3OBAA 1S78C 3DSNA 3PWNA 1B9ZA 2OR9L 3TO4D 2AAVA 1HOCA 4X7TB 4WGWB 3MRFA 3KPLB 2EIZA 2N4IA 3BESR 1RJYB 2OJEA 1QA9A 4KV5E 4F3FA 4WW2B 3ILPA 5EO1B 1ZTXH 3UYRH 4R8WL 2AK4D 3NFSH 1P7QA 5J89A 1XAUA 3A6CH 1N0XL 3O9WD 1U2HA 3TNMA 3V8CA 1MIMH 5J56B 4JHZA 4ZUUB 5ESVB 2PUQT 1JF1B 3WIHH 4NGHH 3P4MB 1OT1A 1ZT4A 1XZ0B 2GFBB 3ULUH 3T0AA 1A6AA 4MQXD 1T66D 3D39A 3WBDA 4KHXL 1Z9LA 4E0RA 4IDJL 5EUKA 2D7MA 4F7MB 2R1XA 1QSZA 5I1IH 1U3HC 2Z93B 2IPTH 2WM0A 4LPYA 4WUUB 3O3AA 3WLWC 1NQBA 3EYVB 4CDGC 3FMGH 3ARVA 5CKAA 4XAKE 3GSVA 3VRJA 4ENEC 1ERNA 5LCVH 4X7SL 4L4JA 3I2CL 1JF5A 1NFIA 3MFGB 4GO6B 1NUFA 2FX8H 5JZ7D 4XPFL 1P1ZA 1RJZB 4NQCA 3GDBA 2VQ1B 4MJ6A 4P23D 4WWKD 4WJ5A 3HHRB 4G9FA 3ARGC 1VFBA 3TNNB 5I8KH 2ERJC 4Y4HC 1PKQA 3O4LB 4X4ZA 2HT3C 2X4RB 4LF3A 4XHJD 3KXFD 1UJ3A 4UDUB 4Q58C 1JWSB 4MNQD 1E6OH 1KXQE 1W72H 2APWA 4P2YA 4L4VE 1EGJA 3U30C 2QHLA 2ZUSA 3EBAA 1FAKT 2CLVB 5DVKA 4V1DD 3GHEH 4X80H 2VWEC 4YJZL 3V5KB 1OWWA 1K3ZA 4DK3A 1RZ8A 3BKCH 4MDJA 2NY6B 3Q3GB 3B6SA 3ELAT 5FGRA 2X4SB 3BP4A 3TLRA 5FA3B 2RHEA 2AGJH 2APXA 2B1AL 2R69H 3RNKB 3UTZA 2CUMA 1B0WA 2VLMD 2SEBB 3QQ3A 3GUTB 4PB0L 3CLEH 3QEGH 5MERB 1RPQA 2H32H 5BS0B 2X6MA 5HI5C 3HG1B 2AEPL 3VG9C 4PP2B 1XF4B 2F15A 4JM4H 4PJ8C 5EN2B 4XH2A 3VWJB 3GSXA 4HFWA 4IDLA 5IVZB 4GFTB 5D9SA 4GG6A 3CXHK 3G5VB 2DWEB 4X6DB 5INCA 3G5XA 3C6LA 4PP1D 4DFIA 5IKCA 1RK0A 3HI6H 4QRPA 3OL2A 3VFGH 5FM5M 3FRUB 4FXGB 3MBED 1WIUA 5HSFA 5DD0H 4MA1C 3C6SA 2VUYA 3QAZC 5BCAA 2D31B 4DOHB 3HE7C 4L29A 1U93B 3ARUA 4GOSA 1BVLA 3G9AB 3MCG1 1KFAH 1C8PA 3B5GA 4HWBH 5FHBH 4EI5B 3L5WB 4ZTOL 2M2DA 1H0DA 5EUOE 2H9GA 3OKEB 4OBSA 4P9HH 4UU9A 3G6JE 1S9KC 3AM8C 5C2BL 5C9JA 4NO0D 4YHMH 1S3KH 4PGCB 4J3TA 3ZL4L 2EYSB 3WNNA 2L7UA 3ET9F 3VXUD 2IH1A 3R1GL 1WEJH 4KRMB 1CS6A 1FCCA 2IADA 4X99B 2NY0D 3C9NB 1VKXA 1PEZA 3F65A 4K55A 4TRPL 5C9KA 3D25B 4K23H 1I1FA 3VA2C 2DMBA 4HXAL 2FJGB 1IKNC 2ZOKB 3S3PA 3VFWB 3RY6C 3G6AB 2FRGP 1QFWL 1P2CB 5EFIB 5AYUH 5T5FH 2AV1A 4OD2A 4OZIA 5DD1H 1GC1L 3TVMC 3G6DH 1HSBA 5T1KB 1UKTA 2XKUA 4WUKL 5IVOA 4Y16B 2R0WL 1I7RA 4JG1H 4AIXA 5IQ7L 3DUUB 1RIVL 3F6LA 1IGCL 4J7RA 4RGNC 3TYGL 4XP4H 4CMHC 1KBGL 1CFBA 4GRMB 3ARDD 1F11A 4G8GB 3QO1B 3EYUH 4UT7L 5J3HD 2BHYA 4G42B 4KKCD 3BKJH 3TO4B 1KJMB 2FO1A 1ZSDB 1HWGB 3GBMH 1I85A 1ES0B 3O6MH 2ZSWA 5IFAH 5HHMD 5JHDA 1KCRL 1ZGLM 1JP5A 4KY1L 1T1ZB 3TN0C 3DUHA 1CWVA 2XV6B 4P2QE 1R6VA 4P4RB 1HDMA 3DRTB 1CG9A 4L8CA 1FVEA 2VITA 3I02A 3UTSD 4H1LH 3IDXH 4PY7B 1E4KA 1EUUA 5HI4C 2OXGA 5DTFB 4WU7B 4LCWE 4LPCA 2VXTL 2D7QA 3GJEB 3WHE1 1CGTA 1KIPA 4F2MA 4QOKA 3F5WB 1HILB 4IHOB 3WDJA 4NFBA 4YXHL 5K9OA 4X6CA 5I16B 2WQ8A 2VZSA 4Z8FL 4RMRA 2NW3A 1T0MA 3C5ZC 5T33L 3AAZA 1SMOA 3JV4B 3HRZA 1BFTA 4IJ3C 2CDEA 2ENSA 2D7PA 4F7PA 1Q94B 1GZPB 1RFDH 3WLBB 4PLKC 4GKNB 3DETD 4JB9L 1WVZA 1KN4L 1U91A 4R7DA 4DCQB 1TFHA 1T5WA 4P57B 1NGXB 4YFDB 4LASL 2Q86A 3MV01 4LSVL 1PY4A 4NQEE 5DJ2B 4PJ5A 1INQB 4K94H 3CXHJ 5DQJA 4NN6C 4PS4L 3QUMA 2MOVA 1DR9A 2IQAB 3BDBA 5BW7A 1A6ZB 1FZKA 5IP4A 3KPTA 1R5VA 3FHAA 1GGTA 2JB5H 3FO1A 4P23B 1WWBX 4WI4A 5EZJB 3GSNL 1DANU 1KLGB 3D87B 1D5MA 1ZA3B 2J12B 4FZEL 3E8UL 1A7OL 1KTKE 3RL1A 1YEEL 3KXFB 1MLBA 3GIZH 3WFBL 1WTLA 5F1KC 4ODSH 4CL7A 1I3GL 4ZUWA 1JPGB 2IAMD 2FYYA 4JN1H 4J4PC 4UB0L 3WJLA 5E99L 3V52H 4PV9B 2OSLB 3OKDA 2Z8SA 1OAKL 1HZHL 4OLUH 4YHKH 1FLRL 2H6PA 1ZLWH 5C0RH 4FQ1H 4KKBD 3LAFA 1ZT7B 1MRDL 1IGMH 1YYMH 1T5XA 4J1UB 3QZWA 3FFCE 1U8PB 4HH9A 3WL9A 3IYLW 4L8SA 3V6BR 1JE6A 4CDHA 4YBLB 5A3ID 3W39A 3LKQB 5ICXA 4Z18A 3QEUB 1MRCH 1S9WA 4UTBL 3IRPX 2IMNA 1J18A 2PTVA 4YXKL 2EKSA 1W2KT 3OX8B 3MUGA 4WFFE 4G8FA 3MRQA 3SDCD 5I1EL 1RY7B 1J1OL 1G7LB 4LHUB 1ACYH 4U2YA 4JO1L 4DVRH 1C5DA 1N6VA 3NCFB 1C12A 3J7HA 4LEXH 1MAJA 3EYSH 4YHNA 3R06A 4FQIL 4FRWA 2AXFA 5E70A 5B39G 4DAGL 3QFJE 5TQ2L 5HYJA 4LSSH 3W5NA 4Z7UA 4P4KA 4ZXBD 4J8RA 4QF1A 3MOQA 3RTQB 1I9IL 1A7RH 4LDOB 2BOCA 5ALCL 3PIQB 2JTDA 1VFUA 3MBEB 2FZ3B 3BWUC 1F4YL 4MQTB 4XBEH 4JAMA 1N3NA 3O2VH 2YC1A 5F21B 3HC3L 1QSEB 4EUPH 1MUJB 5I6XB 2LU4A 5T3ZL 3UO1L 1N6UA 4P5MB 5KVDL 4NNYB 1IGIH 4FQXB 4IM8A 5FYKH 1NEZA 1UQSB 3QUZA 1RZGA 5CMAB 2GEEA 1RMFH 3OJMB 2ZUTA 4EVNB 4NO0B 2YXFA 2FD6L 4HAGA 4OKVB 1S7SB 5IB3B 4LRIA 5FCUL 2HJFA 4HKXB 3MRHB 3T09A 3QIBA 3WIFB 4PJGF 1HN1A 2QL1A 3V7AG 3MA7A 4JFFD 1A4JB 1XF1A 2PF6A 3P9WB 3TJHC 3TBSB 2XG5A 5DJCB 2DBLH 4WHDA 3TT3L 2EC9T 5CP3H 1SVZA 3S5LB 1RZJC 1I4FA 5JIIA 3CFKB 1U95B 1AI1H 2DMCA 4YHOL 4XC3L 3VXME 3KHOA 4KK8C 2HVJB 2KBGA 2NXZD 5C6TH 4S1SL 4ELMA 5L7XL 1JZ4A 3W0WB 1AGFB 2ZG2A 2VDRL 4AEFA 5GS0C 3P77A 1W8OA 4F9LC 3B4NA 3BP6A 4O2EB 2BNQD 3WS3A 3PQYD 4P0DA 4NUJB 4KHTL 3QIUA 4LAJH 1S9XB 2EXYD 3MNZB 3L3HA 1DQML 4ONGL 3ESUF 1J5OL 4TULH 2Y6SC 4UV4H 1WCQA 4UINH 3U36B 5HHQA 4MQSB 4G7VH 1NL0H 3HE6C 2DYPD 3K0WA 1B0GA 1GZQA 4MX7A 4KJQC 2Y5EA 5DQDH 3L5HA 3REVB 1OAUL 3NFPA 5BVJB 1K8IB 5KS9E 4H8WH 4N5EC 1ZLUK 1B2WL 1IGFL 1JVKA 2FH8A 1HI6A 4PRIE 1M7IA 4NKMA 4M61B 1FO0L 4FABH 4Y4KC 3F7VA 1QSFD 1DBJH 2F5BH 3UTSB 1CK0H 2HMID 1LD9B 2HFTA 4LCYB 2CLRB 5MENB 2WLYA 3IDIA 2Q76B 3QQ4A 3PP4H 4RAUA 4LKXA 4APQA 2EDJA 2JIXB 2YBRB 3QPXH 1UM5L 4NUGH 1IEAA 5TE4L 4U4BA 5TH2A 3FO2B 5C0IA 2WWMD 4HX1B 1BBJB 5C0DA 3RZWA 3ULUL 4TPRL 2APFA 1FLTX 5IT2L 1RUPH 1YQVL 3ECBB 1KTLB 1IAIH 2YPLA 1MFEH 4YHLH 1FC2D 1MJ7L 5ENWB 1BD2D 2IPTL 2J8UB 4N0FA 2E27L 4NM4L 4K8RL 3X12B 2PYEA 1B0RA 2EDBA 3DX8B 3RWDA 1DUZB 1WBYA 2DM2A 4HGWB 1N6QH 1GOFA 3QDGB 2P8PB 4XCCH 2XG4A 3T0VA 3UTTE 3RA7L 1QG3A 2NY3C 5EU6D 5CIPA 1Y6MR 3LKOA 3LPGA 3EJZD 1EGJH 4K2UL 4NP4L 4MXQC 2HWZH 2Y06H 3LRSA 4HMDA 4QRSA 1NFDA 1S9VA 2R9HD 1EO5A 3ZDXF 4UTAH 1R0AH 5L2KA 1NGZB 5I74C 4HKJB 3RVUC 1BVKA 3F62A 4XT1C 5I30H 3H42H 4DGYH 5ADPL 1WWCA 2OR8A 1GGUA 5K33A 3WFZA 4OF5A 3HZVA 1UA6H 5KSBB 3DO7B 4EI6B 2A83A 5SX5K 3QUXB 2VR4A 2CMRH 4X80L 4PJAE 4X8JA 3E2HB 3IFNL 2ICWA 4R96B 4NHUB 2C1PA 5J9PB 2NLJA 3AY4C 2XWTA 4IMKA 4CNIA 1AO7A 1MNUL 4X98A 5EG6C 1A47A 1E28A 4Z9KB 1U8OB 2QQNH 1N2RB 1Z6JT 1M4KA 2A2QT 1D6VH 5HPMA 1MCIA 1T0PB 1YEFH 1FFPA 3RVWC 1XGPB 3HPLA 4OGYH 1LE5A 2BOBB 2EE9A 4IRJC 3HZKB 1ND0B 5FDWA 5EBMB 4ZQKA 1UXSA 2GJ6E 2W9EH 4GW5B 4P2RE 5I73B 3RWCB 4XBGA 1ZS8A 3LB6C 5C3LD 4XAWL 2X1PA 3MACH 3VGAB 3OKYA 1YPZE 2AKRB 4LQ1A 2JCCE 4TNVK 2H26A 4H5SA 3MV8A 4ZXBB 3IF1A 1NGWB 2CO6B 4UILH 2PR4H 1KCVL 2FR4A 5C0CD 4GBXD 3FB6A 3QHFL 4RGOL 5B4MD 1UWXH 2DQCH 3N9GL 5D6DA 2HJLB 2EZ0D 1SEBA 3LEYH 5DJ8A 1T1WB 2PO6A 2R39A 3OR6B 3AROA 4EDXA 1UB5B 4HEME 2MPAL 4YR6B 3IFLH 4KI5F 2FEDD 3WSQH 1CFVH 4F9PC 4KJYB 3BT2H 3FN9A 5T3ZE 2P44B 3U46B 5ID1A 5LXGL 2I07A 1P4BL 3LN4B 4XPHH 4F57L 1MRFH 4NC1C 1S3KL 5HDOA 3K74B 1K6QH 2R2EB 2X4QA 4JFFB 5TE6L 1WZMA 4KMTL 4BSVB 4L3EA 2XTJC 3UJTH 1N59A 3IS1X 4JHWH 4PRHD 2HKHH 1WEJL 4L5FH 4OQ1A 2IG2H 4WI9A 4TUOB 4I8DA 2XPGA 1JCKA 5CZVL 5E4IA 5HVFB 2YUWA 1OP5K 3BKMH 5HXMA 2NXZB 4XPTH 8CGTA 5EU5B 5IVXF 1IFHL 4ZSOA 3MRRB 2HFGH 1OWRM 2A38A 3F12B 5E9DA 3ARXA 1CQKA 1NGPH 5T5FL 1U8NA 1WWWX 4MA7L 3UPCA 2BNQB 2W92A 2QADB 1BQHA 3D3VB 3BDYH 5DVOA 5CJXC 3H3PH 3NAAH 2IQ9L 4X4ME 5D2NB 1U3HA 5CGYD 1QRNE 1CFTB 4JG1L 2FX7L 4QHUB 4X4YB 4XP4L 1KGCE 3EZJB 4LDLB 1GIGL 4LAQL 3SOBH 3H7BA 1UH3A 3KPSE 5JOPE 3JWOL 4WVRA 4ZFOA 3BE1H 4PLJD 5EBWA 4PRPD 3VXNB 1KNOB 5C0GB 5GIRB 5F6HJ 1RURH 3G5YB 4XWOC 1Y0LA 1R3KB 1ZEAH 5FM4A 3RWIB 1S5IL 1P4IL 4U6VH 3P3YA 5ABDE 1BHGA 2WP3T 4U1LB 2DWDA 2YA2A 5BXFB 5CEXB 1MI5D 1FGNH 4PUBH 1OGTA 4XVSL 5E8NB 3HB3D 5CINL 3ARGA 1D7FA 4WEBL 1EDQA 3RHWK 2BCKB 1QPPA 4EBQH 4D9QE 3GI8H 3IDXL 3QWQB 1MWAB 3N0PB 1F90L 3SDXA 2OTPA 1KACB 2H2SD 3KYNA 1MPAL 3WHE0 1V7MH 1GOGA 2C9AA 3VGDA 3KR3H 4ZFGL 5FECB 4XPAL 3QP3A 5CJQH 1KTRL 2FO4A 2X1QA 2XRAL 1YEJH 4F15C 5HJ3A 1WCBA 2A74A 1EVTC 4OCXL 4XTRC 1KCLA 3ZTNL 2WIMA 3U6RA 4M7KH 4ZUSB 2DF3A 3QUMH 5D1XD 3S37L 2GCYB 4Y5YB 3NMEA 1J10A 3P9LA 3ULUE 5D2LA 5IIEB 4OCRH 3QUKB 5E1AA 3TBWA 4WI7A 5JHLL 4KVCL 5DGQA 3BH9B 2P24A 2G2RA 1IGTA 3SDAD 4FQJH 2A6JA 3HZYA 5K93A 2X4PB 2DRUA 3MO1B 1VGEL 2G5BA 1E4XH 1Q1JH 2B5IB 1P4LB 3AS0A 4UIKL 3WIIH 3P73B 3D9AH 4AT6A 3CSYB 4R3SB 2F8VA 5J57B 2OTWB 4PJ8A 4M93B 4EIGB 4Z7OF 2NY5L 1R3JA 5D7SH 1PSKH 5C0BA 4NHCL 3T0EA 5CGTA 2VH5L 3GJFB 1G6RB 4G80A 3BZEA 3LQZB 2A6DB 2YA1A 3IRZA 3QRFM 3PJSB 2VSCA 5H35A 4LVOB 3ZE1F 3TCLB 4FZ8H 5AWNL 1GRWA 2R23B 4OZHA 5I18H 4JN1L 2BVOB 2X44D 3DBXA 4X5XA 12E8H 4WI3A 5KVEL 4QEGA 1W0WB 4RAHA 1RD6A 4HIJA 4WNQA 3VFPA 1HHKA 1M6OA 4FQ1L 3QDJD 1IQWH 3JTSB 4NOFA 5DI8B 1KSRA 4XP6H 5ITFA 1MHHB 3A67L 4YGAB 4R0LC 2R2HB 3AM8A 3U2SB 4K3HA 1L0QA 1OAQH 4P59L 1MRCL 3MRNB 2Y07L 1YMHB 3B83A 5DMKA 3NFNA 1YMMD 3X14A 1YNTA 4LEOA 4MVBC 2RFXB 3PWPD 3P4OB 1H8OA 5JNYB 3VXRA 4BZ1L 1HHHA 4JPWH 4PRAB 5F3HB 5A16A 2R4SL 2IALB 4ELKB 4LBEB 3DXAD 4MZ2A 2IANB 4UT6L 3TV3H 4B50A 1IKNA 2QQQA 3RY6A 4M5YH 5K9QI 1RUQL 4HFUH 1FYTE 1KG0B 2EDHA 4TNWK 5AG9A 3W9EA 1NCAH 3BEVB 1R3LB 4GLRH 4UV7H 3TVMA 3QO0A 2YPKB 3MV9B 5GS3A 3W82A 1J8HA 3L3DB 4U1IB 3RWJA 1O0VA 5MEOA 5TDNB 2WUBH 5C0FB 4BQBA 3IETA 3BX7C 3RDTD 3ARRA 2VAAA 1T1YB 5C0EA 1ZXQA 2VZUA 4H20L 1FRGL 2HH0H 3IU4L 3QEQB 4BK5A 1X5FA 1YEGH 2ZCKL 3P4LA 4KPHH 5LBSH 1V3JA 1KIRB 2QSQA 3MRIA 2GITA 2EDWA 1W72B 1ZHKB 4DQOL 4ODTH 2BRRL 4M48H 1BEYL 1FNAA 1EV2E 3OQ3B 2EIEA 4I18C 2A6IA 3L7EB 2YEZA 5IG7B 4C56D 3TN0A 2Z31D 1VFAB 4MCZA 3QRGL 3CZFA 4WV1B 2ZCLL 3HAEA 4GS7C 4XNMB 2DQFA 4U1JA 3D0VA 3KDMB 1F4AA 4U33A 4MAYC 3EO1B 2UWEE 4XCYB 4ZFZA 4OZIF 3CMOL 1KOAA 1HYRC 4RFEB 2ARWA 3PDOA 5DSCB 5E8DL 2NY1D 3C5ZA 1E4XI 4YIQA 1KELH 4JRYA 1OM3L 2NQCA 3WHXB 4JO4H 4K3JL 4F33B 3X3GH 4LCUA 5GGUA 4IRSC 3CDGB 1A8JH 4XHJC 3C60B 4XI5D 2D7TL 3S5LG 4AIOA 1CLZL 2J8OA 3PL6C 1H15A 3WN5B 3AS3A 2MJWA 1FDLH 1OP3H 2IEPA 1PY9A 1C7SA 5DJXA 5C08D 2Q8BL 5E5MA 2HRPH 4YEEA 1TTFA 5L0QC 2GJZB 2R0ZH 2J1KA 3RAJH 5I9QC 4Y19A 4PRPB 5ECJE 2YHGA 1K5NA 1J1PH 2BDNL 4GW4A 2GK0A 5GRZA 4KI5D 1QVOA 1MCCA 4OI7A 2FIRT 3MUJA 2VLRD 4ZUTB 1MI5B 4Z0BL 4D2NA 4JFEE 1WBZB 4JPVH 4WUUE 4YHYB 4PJGB 4DN4H 1DBJL 5KZCD 1H5BA 3DVNA 3VFSA 1M7DB 5FYKD 1Q9WB 1JNHB 2X70B 2UV3A 3PV6A 4PJFA 4YBQD 4J4PA 2FJFA 5DRXA 2YUVA 2FNBA 2ZUQB 2AK1H 3HI5H 3HNSL 4RZCB 4I3RH 1MHPH 3OHXB 3EOTH 3SE9L 4LVHB 2X89D 1PJ9A 5GGRB 5ERWA 4D3CH 3TWCH 1LE9B 5CIPH 5D1ZD 5DJZA 5T5NG 4JKPL 3PP3K 3TIDA 4OV5B 4QXUL 1QEWB 5EZOL 5D4QA 3VI3E 3U9UA 3H0TA 1JPTH 1UB6B 4OZGA 1OARH 1JZ7A 5KSUA 2HP4A 3B9KA 2CKBA 4HCRL 5EZIL 4WTXA 1JYNA 2OK0L 4G6AD 4GLRI 3IJHB 4S2SA 3SDAB 4ODVL 3REWB 3NABH 1JZ3A 1WT5A 3NIGF 1A1MB 1NC4D 4HLZH 4RRPA 3T8XA 2NY2B 4Z7WF 3PWJA 1DE4B 4WCYL 5KN5A 3VRLE 1VCAA 1G7MA 5GXBB 5IV2B 3RIAF 4I9WD 4F37F 4ALAH 5BOPA 3EYQC 1GYAA 2F19L 4Q9BA 3U79A 3C08H 4MLSA 4RFOL 3NCYP 3BAEL 3DO3A 4W6YB 1HEZA 4GQ9H 1AR1C 5EORH 2QSTA 1XH3A 4UTAL 1R0AL 4JFQB 3ALWA 4MQ7A 4PGBA 4ONHB 5I30L 3CVHB 3H42L 4DGYL 4JFHE 1HXMA 3FZUC 1P7QD 2VKXA 5FYKU 4MJIA 4O51A 4A6YB 2DM7A 1J0KA 2FB4H 5BS0E 3ZKMD 3HG1E 3QHZH 4NDMA 1FAIH 3MCKA 4TSAL 3RP1A 3VFRB 4XPBL 3QDJB 4YUEH 4BSWA 2EDNA 3QISA 1CGSH 5E6IC 1F3JB 3C2AL 3HMWH 3QA3A 2YR3A 1D5IH 1TTGA 2YPVH 3ZYJA 4X6DE 1REIA 1QBML 5KOMC 5AG8A 1WGOA 4DKAA 1TTUA 5FOBB 3F58L 4D0CB 3T4YB 5JW5A 5C0AA 1SBBA 3VH8A 3AC0A 3IXAB 1D6VL 2VOTA 5DUBA 1P7HL 2ADJB 2E8ZA 1BLNB 5CD3A 1DQJB 5E94A 1S5HB 5ICZB 5IK3A 2VR9A 2AJSL 4KUCD 5GSVA 3ARDC 4DOHE 3V5DB 3DV4A 4I3GA 2EXWD 5J12B 3C5JA 4YH6A 5TE7L 5FGSA 4F7CB 3MUZ1 4NQCD 4TQEL 5CHNA 2J6EA 3QXDA 3GIVB 4Z7UF 4GKOA 4HS8L 1U8LA 3MACL 3MV7B 2P5WA 4WHTA 1HH9A 1XGRB 1RUKL 3EO0A 4MA8H 3LMJL 4F9LA 3FQNB 3D1MC 4JPKH 2KPNA 2H8PB 1CL7L 4WW1B 1T3FB 4MA3A 2NYYC 5IJVA 5E56A 4KZDL 3QSKB 3RDTB 1CU4H 2CJUL 3GMQA 2ZPKL 4K7PX 4JO3H 4DTGH 3I3DA 1TPXC 5F9OH 2W60A 5I66B 2ADFL 2XZAH 1EMTH 3WSQL 3HE6A 1MAML 1Q9KA 4OFYA 4OLWL 5EPMB 3ALXA 3HUJA 1CYGA 5DHVA 4OLEA 3OKLA 4JGUA 1EBPA 2NR6C 2XKNB 1MRFL 3WD5L 1DBKL 4C56B 2Z31B 4XP1L 5D7LB 3RX7A 3PXHA 2EEAA 1G1YA 1INEL 4Y4KA 3F7YA 2VXVH 4I0KA 43C9A 3GSUB 5DUMH 1AGCA 5LKNA 3H9SA 4P46B 3QQ9C 4N9OB 1JNNL 2ADIA 1CE1H 2YN3A 2EDKA 3OXSB 1JV5A 3W9DA 3L95B 3T3PE 1C5CH 2VDQL 3V4VL 4YHZL 4XPTL 4U6TA 2B2XL 4PLNC 4G8EB 4BH8B 2XTLA 1LP9A 4ORGB 3HFMH 1XGTA 3M8OH 3C6LD 5I75B 4ZTPH 4QRPD 2VO5A 2BNUB 3AREA 4JFPA 1JPFB 4RWHA 5DF0A 3A6BL 2X05A 3VA6A 4Y1AE 4WTZG 5FUZH 4LU5H 2A6KB 5DK2B 5GHWH 2IAMC 5A2KH 3GI9L 2FBJH 1Z3GH 2Z35A 4P3DA 3BPOB 4OCSH 1IGJB 2XN9B 5TF1H 4POZD 3CFDB 1EEYA 2G75B 2PYFA 1LO4H 1A14H 3EFFA 4ODWA 1HNFA 3RGVC 2VABA 1JK8B 1RIHH 4HJJL 4HQQL 2VLRB 4H0IA 4HZAA 4CVZA 4IEFB 3TBYB 4EUPB 2CDGB 3HR5B 4JRXB 1EJ6A 5MEPB 3PGDA 4LMQE 2V5SA 1FGNL 1MCRA 4YK4C 2MHAA 2OQJA 3GMPA 3EFDH 5F1NA 3QDMB 2OTUA 2HFEA 3RWEB 5D7JC 3GI8L 3S35X 1FNEA 2JB6A 1Q9LA 3O2DA 3OKNA 4OCLC 2OP4H 4OCWH 3KR3L 3CMGA 2IH3A 3PF2A 5IBTL 1GJIA 2CK0H 2ICES 3LV3B 5CJQL 3V0VA 5GS2H 4PGJA 4FXKA 3LZFH 1OW0C 1IQDB 5IVXB 1A3RL 1T22B 4XRCB 4Z7VA 4HPOH 3ARPA 3VXTB 1QYGH 3GK8H 3V6ZA 1ZT1A 5SWSB 1BM3H 3T3MF 3QUML 4U1HA 3CD4A 3EIFA 3AY4A 4NQDE 1ZLVK 2P48B 2ICCA 4OCRL 4GXVH 1SQ2N 4DGIH 1FL3B 4QHKI 1KF9B 3BW9A 7CGTA 2E9JA 3EDEA 2R1WB 3WE6A 2W0FA 4GMTH 5IB4B 4IRJA 4U6HA 4HPYL 1I75A 3QBTB 4HV8B 1U8MA 4TOYH 5C09A 3MRFB 1HHGA 5IR1B 4QCIA 2OJEB 3MJ8B 5JHDD 4JFXA 3EDDA 4H88L 2B8OT 4PG9A 3RZCA 4YXLH 1M1SA 4FFZH 1PSKL 3ILPB 4UQ3A 2PXYC 3QWOA 3GMNA 4XMLL 2LABA 2ZWLT 1N5AB 1JHKL 4X7CC 1SEQH 5TJWK 4ZOCA 5FO7A 5FYLL 4FZ8L 5I18L 4HG4K 1K4DA 2EDOA 4QOKD 4AEHH 4R90H 4QHLB 5BZWA 3CU1A 5AD0B 1ZT4B 5JMRA 3V5HB 1T2QL 3LKNB 4KQ3H 1XMWA 3T08A 5AZEH 5HYSA 2GTZA 2AJUL 3O3EB 4AENB 1MVUA 1ORQA 3LQAC 1DVFB 5JW3L 4GRLB 2DQJL 5CP7B 1IQWL 3KWWA 4E0RB 1ZHBA 5HYEA 1YY8A 5DD3H 5IW1B 4E42A 1ONQB 4M43H 4R26H 5F7EL 4HUUA 4Q9QH 4ZD3L 4JHAL 1KJ2B 5GRWA 5B3NA 4RNRB 4DKDC 2ENYA 3FCTB 4PJ5D 1A21A 1V3LA 2LTQC 4U1SA 1QSEE 4Y5XC 1QACA 4PLOB 4J23A 1GOHA 1A6UL 3SEPA 2DQGH 3MR9A 1J9CT 2B7DT 2DM3A 2H2PC 4MSWB 1FZJB 3RNQA 5DEFB 3VFUA 2DJUA 3TV3L 3O4OC 1YQ2A 2QBWA 4S1RH 5ACZB 1R3IL 1VFBB 3GO1L 2C4FT 5D5ME 3MCLL 4D9RE 1QO3B 1RZFH 2RIKA 4TTDC 4K3DH 4N1EA 4MJ5A 3AU1B 2AQ3A 1JZ5A 4IS6B 3ZDZE 5CJOH 2X10A 4O9HL 3QG6A 4XZUA 5CJXA 1V05A 4J3OC 1F4WH 4BZ2H 4FA8A 2L4OA 4P3CH 4PY8J 3WS6C 1L7IH 1EAPB 2JELH 2AV7A 1RZ8B 2LV4A 3OKMA 2H1PH 3HAEH 3OG4B 3W0WE 4NZJA 5D1QC 5DR5L 2VR5A 5KTEH 5LBSL 1H9VA 4FFVD 4YHIB 5HDQL 2V7HA 4TVPL 3U0PA 2D7OA 4AM0A 4HWEH 3IDMA 2B20A 2V5RA 4G6KL 4JDVA 3LD8C 2F54B 3QQ3B 5FAAA 1Y6KR 2P8LA 2A9ML 1L9NA 3P30H 4R2GC 3KJ6H 5EO9B 2FL5B 2CLZA 1UEYA 1I7UB 1UM6H 3PWUB 1KEMH 1BIIA 5GGRY 4HJGA 4KRPD 3SGJC 2D03L 3DI2B 2NXYC 2UZIL 5I17B 3PUCA 2C3VB 4HFWB 5H94A 4H26B 5HYJD 5JIPA 5FUOH 5INCB 1S7WB 1MWAL 5EZLB 4P4KD 3FFDB 2R0LH 1S7UB 1GGCH 2G60H 1NCCH 4NZDA 4JO4L 1OGAE 3UTSE 3OKKB 2XQYG 2Q7YB 4NN5C 3LKPA 4Z78B 3NCYS 2GUOA 4RDQF 5F44A 1HXYA 5IFHL 5MENE 1TVHA 4NO2B 4HIIB 1XF5B 1E4WH 3UBXA 4Y0GA 3QJHA 4R7NA 3RJDA 1FDLL 3OJVC 1ITCA 4C58B 3QPQC 1JRHH 4CW1A 3TBTB 5HGDA 4RMVA 3IVKA 2H9GB 4U1GC 3QUZD 4QNPE 1IAMA 3FRPG 4I13B 5KJRL 4L4VA 1AFVL 3SQOL 5J6GB 2JE8A 3CUPA 1SYVB 1VFOA 3FOLB 3LDBB 2C5DC 4HG4J 3QIBD 1KN2H 1H3GA 2P7TA 5L88H 5TPWL 2BVTA 4FXLA 4BQ8A 3VFOA 4NSKA 2WK2A 1K3IA 2J8UE 1T7ZA 1CD9B 4XNZC 1F3RB 5JORA 1VFMA 4DZBB 1VKXB 3CVIL 1Y6NR 4N5UA 4M3JA 3ULUC 5E1HB 5E8PA 5B38G 4JHBA 4JN2A 3QDGE 3NPSC 4K3EH 4J3UA 4OM0H 1V7NH 3B3IA 4YDJB 5KW9L 1RZIB 1RZ7H 4AG4L 2CKBH 3VDAA 3EYFB 5ETUA 4GKSB 4LVNC 2AK1L 4BSJA 1ZGLB 4QTHA 3PG2A 2H3NA 4K8RC 5F6IB 1G6RL 2Z91A 2AV1B 4OZIB 1KYOK 3V2AR 2R4RH 1U8HA 1QKZL 4HBCL 3TWCL 1HSBB 1CXEA 5HHNA 3MLXL 4FHBD 4M02A 3FHQA 5K59F 1FPTL 3FO9A 4NNXB 4X4XB 3QIUD 4NC2B 4R0LA 3KGRA 4O58H 1JGEA 1JPTL 5MHSE 1XF3B 2V17L 2WUCH 5F7DA 2FGZA 5KSBE 4Q0XL 1Q0YH 3ES6B 1MCFA 3FOMA 1QFOA 2PTTA 2BZDA 4I0CC 1IC4L 3N1FC 3SDYL 5I8CA 3I9GL 4RMQA 2CD0A 1FN4B 1IM9B 5FO8B 4WHCA 1EXUA 1CG9B 1FVEB 3HS0B 5FK9B 1F4XH 5LWYL 5D8JL 1QP1A 4X5WB 1YNLL 1N8ZB 2ZKHH 2VQTA 5EUOA 25C8H 3G6JA 1LEIB 4KAQH 3N85H 1X5XA 3X11A 4APQD 3O8XC 4O2CA 4KZEL 5I1HH 5DD5H 3S4SA 4NO5A 2NW3B 4NZRH 1ZWIA 2E9IA 4R4NC 4JPIA 5FYLE 1Q72L 3AAZB 1B3JA 4HKBA 3X17A 4EN3C 4H25A 3HRZB 4Z7QF 3TO2B 1JGUL 2CDEB 3KPRD 3MRCA 4GRWB 2ZCHH 2YPLD 2FECI 1D5IL 1XCTA 1MJ8H 5AUMA 3UPAA 1U91B 4LIQL 4G6JL 1NCTA 2J6EH 2PYED 1L7TL 5DVLA 3DURB 4N9GA 3FB8A 2ADGA 4LSDA 1L0XA 4I18A 1G7JA 4N90E 4PJBF 1GSMA 5EC1A 5JW4M 4PJ5B 4PGDA 3VD4A 5EC2B 5GS0H 3OAZK 4D0DB 3MLRL 1QLRA 1QLEH 1TQBC 1BZ9B 3HCVA 3U9PL 1EEZA 1GVIA 2YK1L 4MAYA 4Y5VC 3M1BB 4PLJC 1NCWL 4Z7WB 1T03L 1JRHI 3IFOA 3O6FC 5JIKA 3TZVA 4Y4FB 1NDGA 3RL2A 1RZKH 5D96B 4MCYA 4FFYH 1D5BA 4BELD 4LLMB 3BP5A 2V2WA 4ZUWB 3SKMA 2K3TA 3HB3C 3NA4A 2YXMA 4HWZA 4IRSA 5ESQA 1ACZA 4JPKL 1GAFH 4CN6A 4P9HC 3PL6A 5IOPB 3G5ZA 1BAFL 4P2QA 2X1OA 3FT4B 3K46A 2O5YH 3L3OB 4PBWD 1YEKL 2NW2B 4X9GA 3AB0B 2Q8AL 1JGLL 1IEBB 4M7ZB 3WXVH 3LS5H 5F9OL 4HH9B 3LEXB 4LCWA 3C5SA 2XZAL 1EMTL 1UXWA 1QHPA 5I8OH 3OB0K 1Z5LB 4TUKH 5D70H 4PPTA 3GSRB 1AO7D 5F1IA 3SO3C 4X9FA 2BNQE 2VTFA 2EDDA 4FQHB 5FM5O 1GGBL 2AJZA 3D3VE 5DK3A 1C16B 5D2NE 4TVPE 2HAZA 3MRQB 1KYOJ 2FLBT 3Q6GH 1RUML 4HBQA 2M8XA 3VFTB 2HG5B 2YD4A 4EOWH 1AXIB 2P46B 5DRZB 2LU3A 5DFTA 1CICC 3N06B 1C12B 5GGVH 3IU3B 2AXFB 3KPMB 2OL3B 1GHFH 4NQEA 4KTDH 5HYJB 3O3BA 5HGBB 1IC5H 1KEGH 3KLHC 3MV8D 3NTCH 4F58L 2HYMA 3OPZL 1KIQA 1F58L 4RX4D 3RWHA 3MRPA 4LARH 2GK2A 5H2BB 3JWOC 2XKSA 4JAMB 4NBYB 5CILH 1N3NB 1JIBA 1X4XA 2Z8RA 1J1XH 3MGOB 5EU3A 5FGCE 3IKCB 1KCUL 4GAFB 4ZOEA 2ZOLA 1M05A 2BSSA 2PO6D</