1XF3A

Structure of ligand-free fab dna-1 in space group p65
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
213
Chain Sequence
ELQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHYGTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab Light chain
publication title Evidence for Structural Plasticity of Heavy Chain Complementarity-determining Region 3 in Antibody-ssDNA Recognition
pubmed doi rcsb
source organism Mus musculus
total genus 53
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf3A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf3A01
1FL6A 3OAZH 4HMDA 2A6JA 2Q6WB 1PG7L 3VU2A 1I7TB 1K4DB 3QEGH 5GISH 4LLAA 1MWAH 3QFDB 4BZ2L 2EKSB 4OTXL 4L1DA 3FAWA 4A6YH 3QNXA 1V7NH 2OZ4A 4HK3N 4JKWA 3B9DA 5EN2B 1T2QL 3O4LB 4HIJA 2PYFB 3OX8B 2PTUA 4I8DA 1S7RB 3CFJA 3S5LG 2X4RA 3O6LH 4WUUD 4AIOA 1H3GA 3JV6A 5LGJB 1XGPA 5D71L 4FQLL 4UT7H 1GPOH 5EZLB 1KB9K 4UTAH 3BH8B 1JPSL 3G08A 1RIHH 2CRIA 4NQUA 5IBLD 3MLPA 2D9CA 4LBEA 5FDYA 1QEWA 1JRHL 4Z76A 5D9SA 5DXWA 1QVOA 1IBGH 1SM3L 4DUXA 3O4LD 1AY1L 3P30L 5EU6A 1MAMH 4JFEE 2G9HB 3ARGC 2Z8RA 4WWKC 3BMVA 3W0WA 3O0RH 2FX9L 5HVWA 1FPTH 2F54E 3VFOB 4JGJA 4OGAD 1OT2A 3S98A 3CXHK 3FB7B 3REWA 1HSAB 2DMBA 4QRSA 1IAKA 4K9EL 5IVXB 1AP2B 1KTRL 2AKRB 1TXKA 4EQ2A 3HMWH 1GOGA 4U1SA 2FECL 3AREB 1TNMA 3MLVL 4IMLA 3H3PL 4NZTL 4G8GB 4M1DH 2FO4A 3PDOA 2YXFA 3RWGA 1EXUB 3ZTJH 3KLHD 4ONGL 3UPRA 2W0KA 2G75A 3W9DA 5IGXL 3D39E 5T3XL 4LAQH 4HPYH 3HB3D 1MNUL 2EDRA 5JIKA 4IBLT 1T21A 5IB4A 1AXSA 3WS3A 1G9NC 3O6FC 2UV3A 5BRZA 1Z3GL 1ZEAH 2VAAB 4S11A 5MENB 3T3ME 3DOSA 3AB0B 2UUDK 1OAYL 3BPCB 5E5MA 3VFPB 3MRNB 3MA7B 4DAGL 5I1JL 4P0DA 4IMKA 3ARED 1DQDH 2DI7A 4NOFA 2H41A 4Z7VE 4G8GD 3SGJC 2EECA 3P9MB 1MIEH 5E4EB 1A7OL 1NCCL 3SDAB 5H8DA 4HWEL 3WEXA 4NC1E 1NSNL 5KW9H 1UCTA 3GI8H 2M26A 3ZHLA 1IZJA 3W11C 1K3ZA 4ZD3H 1FC1A 5DD0L 2CUMA 4Q9CA 4Z78A 4OCYL 5E8OB 2Y36H 4E42B 3MREA 3BD4A 5HGBA 5MEND 1LK3H 3RPIA 1C1EH 1DBJL 4GLRH 1W8NA 5C0EB 5I71B 3WBDA 1BBJB 1SQ2N 5CZKA 5KAQF 4NIKB 4UQ3A 3SGDI 3BAEL 3HI5H 4H1LH 3LAFA 1A7BA 1JFQL 5HTSA 4R3SB 4MD5B 3SDAD 5E6IA 4MJ2A 3W0WE 4P9MH 5AUMB 4FTVA 4IRJB 3UC0H 3GMRB 3RAJH 1F2XK 1U8JB 3IETB 1AHWB 5ICZA 5DD3H 1A9BB 4RAHA 3VGEA 3B8SA 5FOBA 5I1CH 1UJ3B 5E8PA 4XVTL 4Q9RL 3U7WH 3GSOB 4WU5B 1OGAB 1Q94B 5KAQG 1WC7B 5SWQA 5I1HH 3JTSA 4JM2F 3EYFA 2P8MA 1ZGLM 3QIBA 1D6EA 2VOTA 1BVKA 1T04B 2R0LL 4WJ5A 4F7CB 5HHNA 1BJ8A 1G7HB 3BRDA 5DJ8B 4KDVA 3FQWA 4YXHL 1OQXA 3TBSB 5ID0A 3TESA 3PGDB 4IRJD 2J8UA 3GSWB 1GC1H 4L9LC 5C0BB 4HF5L 4RSVA 5FYLH 1AXIB 4NQXA 3RVWC 3LDBB 3GUTA 3PF2A 3U0TB 3UYPA 2P7TB 2HT4C 4W6YB 1NBZA 3NN8A 1OGAD 5GIRB 5AZ2L 4EUPB 3K74B 1JN6A 1HNGA 3M1BA 2JKXA 3OHXA 1OCWL 1YPZF 3MO1A 2DLTA 5E8EB 4LIQL 5SX4H 1KG0A 5JR1L 4OJFH 2R2HA 3MV9B 4X5LA 3VXPB 1N26A 2DKUA 2IBBA 3G04A 5E94A 3V4PL 5HI3D 3LIZL 5HJ3A 4PBXA 3UJIL 4KTDL 4MXQC 4Y4KC 4H5SB 1DQQB 4FQCH 4KROC 4QHMA 4DVBB 3QXUA 4L4TE 3V4UH 1YMHA 2AEWA 5F7DB 4DTGL 1DEEA 8CGTA 4HG4J 5FECA 1U42A 2FZ3A 1YEEL 1XR8A 1RY7B 2OJZH 3O2VL 1PZ5B 12E8L 4I3SH 5K93A 3DV4A 5FKAA 3VWJB 3T0DA 3OQ3B 3QO0A 2PR4H 4JVWA 4HWNA 3MV9D 3TN0A 4X9GA 5C0FA 3TF7C 2WBJC 3DX9B 3RIFF 1PEWA 2O5XH 3KYMB 1MCBA 4I2XB 3PNWB 4OFKA 1TJGH 4YBLC 3KJ6L 3G5VA 3C08L 3OKEA 1DL7H 3T77A 2GT9B 1GGBL 3MJ8A 1E6OL 3BXNA 1MEXH 4NGHH 3N50A 3PL6B 2DIJA 2AEQL 3GBMH 3KWWB 3D87B 4WHDA 3IAQA 1G6RL 2VLRB 5IFAL 3UXFA 3UTSB 1T1ZA 4XP9H 4DN3H 3PG2A 3UO1L 3T65A 1X5ZA 3QZWB 3QCUH 4BFBD 3VWJD 3DECA 2JCCA 1K4CA 4QHKJ 1FGVH 1FBIH 4LLWA 5DYOB 5E08H 5EU4B 2WP3O 4ZPVB 4HX1A 2E9BA 3DBXA 3ALPA 3JWOH 3KYNA 4G9FA 4PLKC 3ILQD 2IPUK 2VITA 4PG9A 1KENL 2HFFA 3CZFA 4R90L 2JJWA 5FO7B 2X7LB 3PL6D 2PUQT 4WV1B 4X83A 4NKIH 2VLRD 1X6NA 4M7JH 3UTSD 4X8JA 1IKFL 4EDWL 1RIVL 3TH2T 3OKMA 5E2VH 5HVHB 4DVRH 3PHQA 4LPYA 4F57L 5DJCB 3DARA 5CJQH 3I3DA 3HRPA 4GXVL 2AK1H 4JPIB 4U6VL 4PJ5A 4CJ1A 4P5MB 2R1WB 3VFSB 5IWLA 3NFNA 2J5LB 2JLLA 2ARJA 2FR4A 3S97C 1YEFL 4X9BA 4LSRL 2PW2B 2AI0H 1X5KA 3VG0L 3MGOA 3T4YA 5EFIA 1I8LA 2UWEF 2R1XA 4P9HH 1TZIA 3QULA 1ROWA 4YHLH 5I8CA 3BN9D 3T8XB 5IB1A 3VRJA 4HEME 3VE0B 4PP2A 2FBJL 1VFBA 2DI8A 5J6GA 3IXTA 4XH2A 1SBSL 1ZSDA 3JSSA 3MV7A 3KYOA 1JGLH 2AV7A 3DRTB 2G60H 3VFTB 3STBA 1YECH 3JTTB 2ADIB 1T20A 5HXMA 5DFWH 4XCEA 1RQ5A 3L3DB 4ORGB 4X98A 4F2MA 4Y5YA 1XR9A 2GY7B 3SBWA 4H25B 1H8OA 4Y2DA 1PVHA 4HFUL 1LO4H 1IGIL 4JFDB 1R3IH 3KPSB 4G5ZH 2LQRA 5JXED 3QCTH 1FZMB 1OTTD 5ACZB 3SKNA 2C3VB 3QAZB 3HR6A 3S96B 3WSQH 4OQTL 3QG6A 1KIPA 3LS5H 3O6KH 3QR2A 1CD1B 4WNQB 3QNYA 3FQTA 1G7IA 3OB8A 1HKLL 1OGTA 2F19L 5GGSY 3UZVB 3OKKA 1GVIA 1R5IB 3BZFB 5IHUL 2NXZB 5I1DB 4AIZA 2GCYB 1EUTA 1MJJA 1HQ4B 3PWNB 4JFDD 7FABL 4TVPH 4YXKH 3KPSD 2OLDA 1RUKH 3FOMB 1NEZA 3HUJA 4F3FB 1FH5H 3F5WB 4PJDF 4WGWB 5DR5H 4QRRE 1ZV5A 1GGCH 1ZHNB 3IU4H 1U91A 3WL9B 5BV7B 2FYYA 2Z0BA 2ZKHL 4OKDA 2LTQB 4CBPA 1AQDA 1FFPB 3VCLB 2AXGA 2A74B 1HSBB 2ENSA 5C0GB 2NXZD 4IDJL 1KB5B 4I18A 1U8NB 2BSTA 4B5EA 4CAGA 5D8JL 3KPMB 4N9OB 4UOW0 1TQCB 3HZYB 5C0BE 1UM5L 1GCFA 1D9KC 1NANH 1G0DA 1FVCA 1N6QL 1NC2A 2NY1C 5IF0B 3CVHB 1IZKA 2LE9A 5HDLA 5D2LF 4K3DL 4PJ7E 5C07B 3HN3A 1I7RB 3ARRA 2QSVA 4JCMA 5DRWB 3SY0B 4DZBA 3CH1A 2WBWB 1F8TL 4IHOB 1N3NA 5DJXB 1LE5B 4BZ1H 5F1KC 1BIIB 1CLYL 5FHAH 4FABH 5I1KH 5LCVH 4LCWB 4EZMA 4HLJA 3G5ZA 1I3RB 3LZFL 1A7RH 1A1OB 3GKWH 2A0LD 2QSCH 4HJ0C 2RQ8A 2JJSC 3S35X 5J9PA 2Y7QA 4KKCC 1KACB 4PJ8A 1MQKH 1SY6L 3MSPA 3MJ7A 4FXKA 5DK2B 3TZVB 4C56E 3ETBF 1CZ8L 2FSEB 2W1NA 2JB6A 4FFYL 2B7DT 5C07D 1ZLUK 1X5XA 2P8PB 4NN7C 1HHJB 4TNVK 2C4FT 5D7IB 1DZBA 3RKPA 4YHYC 2R4SH 1CLOL 3HA0A 3RVUD 5H94A 3VWKC 1AD0A 4JFYB 4XTRD 4HDIA 1GHFL 3DRQB 4UV4H 4ODWA 1QYGL 1MJUL 3ALWA 4LCWD 3NIFE 2X4SB 3QQ3A 1I1YA 4P3DB 5CP7A 2EE9A 3JWDL 4HBQA 3THMH 3LN9A 1OPGL 5L7XL 1TFHA 2WWMD 4X5WA 7CGTA 4M6MH 3H8NA 3TZVD 3KPLA 4JFFA 5DVNA 3H7BB 5IB3B 4WW2F 4KI5D 4M7ZC 1S7VB 3CPLA 3RWJB 1HOCB 5KZCB 1FDLH 3O3EB 1NCAH 2WNGA 2YKLL 1BWWA 4JRYE 1FYHB 1MUJB 1IARB 1UB6A 2V17L 1MHCA 2UZYB 3B83A 4TSCH 5C2BL 3FTGA 4MNGA 3WO4B 4MNQB 1XCQA 1NBYA 1OD9A 4BSVA 2OYPA 4HAGA 5D1XB 2BDNL 2RAMA 1HXYA 4HFWB 4HBCL 2EICA 3BKJL 5KJRH 1G0XA 1PGRB 1Z2KA 3ZHKA 1MHHB 4UNTA 1FZKB 3D85B 4JVPA 2HFEB 2VABA 3SCMB 4YHOH 4C4KO 4F15B 5JO5A 1T7XA 4YHZH 5KZCD 1JPTH 3B43A 3K2UL 4XT1C 4R8WH 3OB0K 2YD6A 2XZAH 5EOQL 4MA8H 3QEGL 4N0YH 4OZFA 4OGZA 5GISL 4NQCE 1P9MA 1RJCA 3BDBA 1Q9WA 2A77H 3C5ZC 4KZEH 1WZKA 4E41B 1X7QB 1Y6NR 4A6YL 2JE8A 1CF8L 4R4NC 4NN6B 4Z7UE 5FK9B 3WUWB 3BISA 4QF1A 1SVZA 5D1XD 1KIRA 5GGVY 4HJJH 3VD7A 5F9JA 4Z77A 4WFEE 1EBAA 3SDCC 4MB5A 5J0BA 4KTEH 1U3YA 4FFWC 3UP1A 3D85D 3SCMD 3WYRA 3F7YB 3O6LL 5F97E 5EUKA 4AEEA 5I74B 4QXGH 5CMAB 3LKRB 3V7AE 1UG9A 3TBWB 1S7TA 4UT7L 1GPOL 1PKQA 2VLLA 3W9EA 4J4PD 5KBNC 3CMOH 1B2WH 2DQHH 5I75C 4UIMA 5B8CC 3I6LD 1CL7L 4QOKE 4E41D 2G2RB 4HH9B 4UTAL 2XWTB 3WIFA 4RZCB 3T2QA 1RIHL 2ITCB 2M8XA 3K4AA 2Q7YB 1K8IB 4OBRA 5D4QA 2YZ8A 4GW5B 1KJ2B 3EO0B 3FRPG 3SO3B 4JQIH 1MAML 3MRBB 3KPRB 4RGOH 4GRMA 2HVKA 4U0QB 1L9MA 3RY4A 3O0RL 5BZWB 1NGXB 2E27H 3IDGB 3V52H 3WD5H 2C26A 4OGYL 4EXKA 4PJBB 4JDZB 5T33H 4FNLH 4K23L 4PFEA 3VI4F 3HMWL 5E03A 1WSST 2CIKA 2A83B 4PV9A 1AGBB 4NO5B 4ZFZB 4FQQA 2VLME 3WXVH 4GJTB 4ORZC 1T7ZA 4LLDA 3UTZB 4LAQL 4H26B 3PV7A 5IVXF 5HYQA 4HPYL 3P40A 2H2PC 3KPRD 4P46B 5C9JB 1JHKL 5DURB 5CKAA 4U1KB 2IANB 2WINB 1J7VR 3DYMA 1INQB 3QXDA 4QRTB 1F00I 4LNRB 1HHKA 2VDRH 5T5FH 4KKBD 4GKNB 1DQDL 4M6NH 3N1GC 2F74B 3UTOA 4CN4A 1DQMH 3MUZ1 3CZJA 1K5NB 3L5HA 4MDJA 5K9JH 3BPOC 3GM8A 2ICEA 5EOCH 3OR7B 4DCQB 4HZAA 3O9WB 2BERA 1EO8H 1XZ0B 4ZD3L 4WCYH 5DMGD 5ENWB 2N7BA 3RTQA 5B4MC 5IVZB 4RAVB 1BD2B 4JHZA 2LU3A 2Q1EA 4LCUB 5D7LA 5DURD 2Y36L 3BIAX 3MLXH 2IAND 4BSWB 4D9LL 4WW1A 1LK3L 4QHUB 5I76A 4XC3H 1B0RA 3BD5A 3HI1B 2MWCA 5EC2B 3JUZA 1FNGA 4OLUH 3MYJB 2UY7A 4PGCB 2MKLC 1CR9L 4HT1L 1A3QA 3EKCA 1PW3A 3VXOA 4PJGB 4UV7H 3WJLC 1F45A 1XGTA 4U1GB 4AQOA 5BV7L 5FYLE 5EOCJ 4XZUB 1FCCA 2CXKA 5FM5O 1YY9C 1CXEA 4I0PB 5CHNB 4P9ML 1J8HB 1GL4B 3O9WD 1WWCA 4I4WB 2EH7H 1C08B 4PJAF 4KAQL 1WIUA 3UC0L 3RAJL 3WCYA 4U6TA 1KB5L 2GITA 5IJVA 5DD3L 1BD2D 4U6YB 4L8SA 2B39A 3IFPA 3WNLA 3FOLA 3WO3B 2HT3C 4L9LA 5KANI 2VN4A 3CVHL 5I1HL 5DI8A 1LHZA 2ADGA 2EDBA 2LU7A 5E4IA 4JY4A 4Y0GA 1J0KA 1FAIH 1VA9A 1TITA 3WV0A 2GTZB 1CFSA 5IB5A 3S88H 5I16A 3MUHL 1QRNB 3SE3A 1MFEH 2VLJB 1T0MA 3CSYB 3PABA 1HHIB 4I0PD 1F4HA 5DJZB 4LCIL 4AL8H 4UZGA 1GC1L 3HAEA 5FYLL 1A9EB 4TULH 3WKNA 2YPKA 1H5BB 3STLB 3MRMB 3MR9A 5HHQB 1UH2A 3V95A 2L4OA 5HYJE 3K4ZA 1IGYB 5F6HJ 1G7LB 2R29H 1ZWIA 2BFVH 5EOTA 3OAUL 2BK8A 1SJXA 3TFKC 3BKCH 4MNQE 1QRND 4OJFL 2VLJD 3ROOA 3C2AH 1A7PL 4Y19E 4KJQC 3L95B 1KXQE 3ULUD 1OAZH 3SQBA 4FQCL 4ODBD 5D5MA 1IKNC 1JV5B 1WZ1H 1A0QL 4PPTA 2O61B 2ZUQB 3B3IB 1Q9OB 1A6AB 1S7UB 2CUIA 4XVJL 1F4AA 4RX4D 3H9ZA 2VUYA 1P2CB 3JWNC 3GJFA 2DWEA 2VRAA 2CRYA 1JTTA 1CG9A 1U8OA 1LO3H 6FABL 4I3SL 4FP8H 5C0DB 1JYNA 1LEIA 2B1AH 5HYSA 1OQOA 3WDIA 4B50A 3O45B 2ZJSL 5GRJL 5IT2L 3MRIB 3C9NA 2O5XL 4YZFF 4D9QE 5FGBC 5HY9B 5GS1B 3HNTH 4NHUA 1TJGL 2HH0H 1DL7L 5ETUB 3QDHA 3CC5A 4JRXB 4YDLB 5JZ7C 4XBPA 1LD9B 4NGHL 5GGVH 5FA4B 3NABH 3UZQA 3CFEB 5E70A 2CIIB 5A3IC 5IKCB 4HK0A 4N8VG 4ONHB 4LSUH 5C7XH 2IC2A 4NQDB 4HUXA 3QCUL 5FGSA 4ONOA 2DKMA 4NCDA 2PYEB 5DEGB 4QXWA 4OFYD 5EO1A 3CGTA 5BMFH 3FB6B 1S9WB 4LVHB 3HG1A 3JWOL 1WAAE 4P2RE 2OTUB 5DMIL 5IB2A 4FFZH 1T83A 4U1JA 4YJZL 4JRXD 2MOVA 3QNXB 1ODAA 2WV3A 4W6WB 1L0YA 4NRZA 2DLFH 4NQDD 3ZE1E 5EB9A 5E2VL 3VGBA 4HIJB 1REIA 2CSPA 4DVRL 5LJYH 2PYED 2ZUWA 3CFJB 1UEYA 2OR9L 2X4RB 2K3TA 3MZGB 2HT2D 4P48A 3JV6B 5HI4C 1XGPB 2QLVB 3CDFA 4FXGA 4NBYB 4DGYL 5JPNB 3K4DA 5IROC 2DLGA 3L3JA 1FORH 5ID1A 1J86A 4AH2A 2AI0L 1KJ2L 4UNUA 4WI9A 1CGWA 3G08B 4KHTH 1OAXH 4P9HL 4YHLL 1QEWB 4LLYA 3KGRA 4Z76B 1QVOB 1RU9H 5C0AA 4GOSA 2APTA 4LNVA 2EIEA 2HYMA 5EU6B 3GSNA 1CI5A 4MGXA 3I9GL 4NO0A 1UZ8A 1YECL 1OWRM 1Q9LA 4TVPE 1NFDB 4R7DA 3S4SG 1ERNA 4QRSB 1IAKB 3RWEA 1OTSD 1BM3H 4ZXBC 4Q0XL 5KG9A 1LO4L 4KI1A 4U1SB 1R3IL 4M1GH 4IMLB 4G5ZL 2QQLH 2MSPA 1UKSA 2ZG2A 1OAKH 2FO4B 3PDOB 4KDTC 3RWGB 3HCVA 4G80B 4PGBA 1YQVL 3UPRB 4OBSA 2G75B 3W9DB 3AC0A 3WSQL 2BVTA 1M7DA 1MLBA 2VH5H 3LS5L 5E9DE 3O6KL 5EU6D 4XPGH 3PWPA 5D6CA 1T21B 4NC2B 5IB4B 1AXSB 3WS3B 8FABA 3GI9H 1NJ9A 3V7AG 4KDWA 3ELAT 1J8HE 1RZJH 4KK9C 2VQ1A 4OIIH 5DJ2A 1I9RH 5E5MB 3WFCL 4O51A 4X7FC 2F15A 4YXKL 1RUKL 1HHGA 5MEQA 4BH8A 35C8L 4MHHI 1FH5L 3U7AA 5DR5L 1TVDA 1GGCL 4KJYA 4Z7NF 2DI9A 3WEXB 3HTLX 5F6IC 4U49A 5FM4A 3TM6A 3WHE1 4Z78B 2HJLA 4JVUA 3S3PA 3RI5K 5H35A 5BRZD 5D2NA 3MRQA 1T4KA 2F8XC 5DJDA 1LGVA 3DYOA 2CKNA 5ALBL 3MREB 5HGBB 4HIEB 2XICA 3GSUA 4YEEA 5J12B 5IR1A 2YD7A 3X17A 1N4XH 5IV2A 5C09E 3BP5A 3NFPB 4KJPC 4LL9A 5C0AE 4UQ3B 4DEPB 3T0EE 1A2YA 2R56H 3MLZH 3MZTA 2Z4QA 3TT3H 2N7AA 3HPLA 2BHUA 1Z9MA 1A1MA 2NPLX 5E6IB 1YEDA 4XP6H 3IDYC 1SYSA 3KXFA 4OCNC 4P4RA 3A67H 3GHEH 4OLZH 5FHAL 1OB1B 4FABL 5ICZB 5LCVL 4C4KT 2WUBH 1MCCA 5FOBB 3MODH 1MCJA 3ARFC 5E8PB 1N7MH 2QSCL 4N5EC 4H1LG 5D1QC 5HHME 3VMPA 5EZJA 4NPYA 3RGVA 3VFVA 4AY0A 3U83A 3UEZA 3DVIA 5FO8A 3JTSB 4G7VH 5SWQB 3EYFB 1MJ8H 4RGNC 4O02H 1MQKL 3QIBB 1D6EB 2EDQA 1BVKB 4WJ5B 2JB5H 3L5XH 5HHNB 1NEUA 3FHAA 2R4SL 4JFOA 4W81A 4HUMB 3FQWB 5E6ID 5ID0B 1BQLL 2LAGB 2PXYA 4FTVD 2J8UB 4UB0H 4UV4L 1RIUL 4XP4L 3WNMA 4NQXB 3FFCA 5J3HC 3GUTB 4FMFA 1RK0A 4KI5F 5D7IF 5IHZA 1NBZB 1FL3B 2CR3A 3G5XA 2FJHA 1RUPL 4M6ML 3QIBD 1JN6B 3TWCH 3M1BB 1OAUL 1VFUA 3LKSA 3OHXB 4PV8A 5J7CC 1KG0B 2D03H 2DQCH 1FDLL 4MQXC 5LGHH 3MFFA 3G04B 5E94B 1C5CH 2VXQL 5D2NE 4LSQH 4M1CC 1YYMH 3VGAC 4AJ0A 5IG7A 1XIWB 4TSCL 4QHMB 1A02N 4XPHL 1YMHB 3H9SE 2BVOA 2W38A 3C8DA 4BK4A 5FECB 4Q97A 4XXCC 4WW2C 1JGDA 2FZ3B 1PD6A 1P5VA 2J8HA 3VH8A 1XR8B 1J05A 1CGVA 3HPJA 3RWIA 3VXRA 3DV4B 1ZLVK 5K9OA 2ERJC 4ZG1A 5GPRA 2B4CH 5FKAB 5ESAA 4YHOL 1YEKH 1A3RH 4WFGE 3QO0B 3SDCA 5JMOC 3TN0B 1LDSA 5C0FB 4R8WL 1X5HA 2HWZL 2XZAL 3VFUA 4OZIE 1AQKH 4MA8L 4TUOA 3QUXA 3NIGF 4PJIE 3ECBA 4KZEL 1BOGA 1XIWD 1CXHA 3SKMA 1KTKE 2HJKA 1WBZA 3T77B 2WIMA 1DE4A 5ANMA 1WEJH 3MJ8B 3BXNB 2Y6SD 2XY2A 4GUPA 4N1EA 3LPGA 5CBAA 4HJJL 4HEPG 5F3HA 5BCAA 1RI8A 5CZVH 3FB8B 4GRWH 3CSPA 4M7KL 1ZT4A 3STZA 5CBEA 2BVQA 4GRLC 5ALCH 3V6OE 2VB5A 3ROLA 2JCCB 1K4CB 2XIDA 1BFSA 4JN1L 5T3ZH 1P84K 1NFKA 1MI5E 2BNRE 2ATKA 2FD6H 4LLWB 4QXGL 3TN0D 5FA3B 3VD4A 2APXA 4MJIB 4HX1B 5F72S 4RWHA 3DBXB 1GSMA 3KYNB 4G9FB 2WSKA 2EC9U 2OZ4L 3L9RA 2VITB 4PG9B 5DFVD 2X4UA 4DOHB 2HFFB 3CZFB 4LGPB 5CD5D 1WT5C 1NFDE 1YY8A 3S7GA 2D7PA 3OKLA 4GMSL 2HG5A 4BFIA 4GMTH 5JQHC 4J3OC 4NZDA 2IADA 1AO7E 5IBLC 3WUWG 3S36H 3PHQB 4JO3L 5IFJA 2E27L 3SOBH 2KUTA 3SJVB 4MJID 3SE4A 3HC4H 3OWEA 1OL0A 3ZE2E 3F7QA 2F9BT 4G9FD 4PJ5B 1XH3A 3T09A 3HKFA 5TGBA 4ETQA 2ARJB 2FR4B 5D93B 2FO1A 5J11C 4QHLB 5I0ZA 4K3EH 4Z7WE 3S34H 1P5UA 3M8OH 3MGOB 3T4YB 1P7QA 1T22A 5EFIB 2XN9E 4U1HA 1CIUA 1TZIB 3QULB 1DP0A 5I8CB 5IB1B 3VRJB 4XX1E 3RWHA 2R0WH 1FFOA 1TMCB 4PP2B 1C5BH 4C57C 1VFBB 3ARDC 2FEDD 5J6GB 3IXTB 4XH2B 5LAXA 1ZSDB 3MV7B 3KYOB 4KK8D 1G9NH 1BIHA 4KGJA 4H88L 3T2NH 2YA0A 2CDEA 1T20B 3GK8L 4XCEB 4OF8A 3TPUA 1EVTC 4PJ5D 1LDPH 2VDRL 5T5FL 4X98B 4Y5YB 1XR9B 5D7JB 5L0QB 4Y2DB 1IM9A 1R5VA 1DQML 3ME0A 4P2QB 4HQQH 3IDNA 1KEGL 2E7MA 2R39A 2FIRT 5EOCL 3QPQD 1X5IA 3SKNB 1EO8L 4OF7A 5TQ0H 4PBVC 1I85C 2GK2A 3MV7D 4MXWH 1NDGB 3FQTB 3QNYB 1EERB 3N1FC 3QDME 3V0AC 1IAIH 2V7NA 1OGTB 1OW0A 4CW1A 1WBXA 2P48B 4S1DD 1TCRA 4R6UA 4XC3L 3RHWK 5C2UB 5D7JD 3QHFH 2HLAA 1MJJB 1I3UA 3CLFL 4RFOH 4Y2DD 4OLUL 4EOWL 5J6HA 2W65A 2I27N 3B2VH 3BMWA 2DLIA 5FUCC 4NNXB 4LLVA 2ESVA 4HZLA 5HHVH 4UV7L 2ZCKH 1NEZB 3HUJB 3ZDXE 3MLUH 4XCCH 2XZQH 3PXJA 5AYUL 5FYKH 4QY8A 2EH7L 1I3GH 1U91B 1AGDA 1I9EA 1W0YT 4LK4A 3OAZK 2FYYB 1KFAH 3SDAC 1AQDB 1G1YA 2AXGB 1WK0A 2Z31A 1CQKA 4YHML 2BSTB 4P4KA 4OM0H 1HE7A 5GGQH 3QUMA 3HC0A 3NIDE 2Z8VC 1NC2B 3TPKA 2QHRH 1UM6H 1MFEL 4CDHA 5I71C 2Y06H 3CH1B 1YMMA 3MV8A 1HZHL 1G7JA 1X6LA 4C58B 4AL8L 1N3NB 1L9NA 5ELIA 1UEMA 2EDLA 5L2KE 4MA3A 2QBWA 2ICCA 5KTEH 4NZJA 5HDBE 5B39A 5A40E 2VZTA 1KSRA 3G5ZB 4ODTH 2ZUXA 4YFDB 2VZ1A 3ZKXC 4MVBD 4BFGA 2Y7QB 4LHJB 4LLQA 3KLDA 3FO0L 1UJ3C 5F93C 3ULUF 4M62H 1A4KA 3I2CL 4NWUL 4FXKB 4PJ8B 3MJ7B 1NC2D 3NZHH 1HINH 4MD4A 1OLZA 3IYLW 2RIKA 1JWUA 2ZUSA 3HAEH 2B8OT 3TYGH 3G6JA 5EO0A 5CGYD 5H94B 1LP9E 1AD0B 4HDIB 2P46B 4DKEH 4Y89A 3E8UL 1RJLA 4ODWB 2QSQA 5LWYL 1IGML 3LRGA 3QQ3B 2VDOH 1I1YB 1BBDH 3UTPD 1JNLL 1N64H 2VDLL 4KRLB 4NP4L 1L7IL 1BZ7B 4M6OL 4YDIL 3GFUA 5JHDE 4O2CA 4X5WB 1JUFA 1MFCH 1T66D 1UWGH 1FVEA 4PJ8D 5KSBA 4X9FA 1IFHL 3GGWA 3KPLB 4HWBH 4JFFB 4LAJH 4Q6IB 4U31A 3ZL4H 2B1AL 3WFZA 5L6YH 4MDIA 4NBZB 4WEMB 1MCPH 4IJ3B 2XA8H 3Q1SL 4M9PA 1QG3A 1KELL 1MCFA 4NQSA 4QKXB 2HH0L 1UB6B 1CLCA 1MHCB 1FYTA 3RVXD 4MCZA 5F7EH 3IDUA 2OR8A 3TJEL 5GGVL 4UTBH 4MNGB 5ISZE 1JWSA 1L0XA 1X4XA 4PJXA 1XCQB 4G9DA 1NBYB 5CJBA 4BSVB 2J2ZA 3NCJL 2APBA 4LSUL 5C7XL 2QL1A 1N2RA 4JFFD 3FONA 2Q8BH 3QT2A 3CVIH 1VFOA 2VDNL 2FHBA 2VABB 5BMFL 5JO5B 3P4MA 3QQNA 3RWDB 1XCTA 2NZIA 2ARJQ 3MRHA 3VWJC 4OZFB 5IFHH 3PGFH 4PG2C 1MF2L 4FFZL 1IL1A 1Q9WB 5JW4Q 3HR5A 3SJVE 1VERA 1QSFA 4HWZA 1JNNH 1ZA3A 2V9QA 5LKNA 1KIRB 1KJVA 5F9JB 4ZPTB 3PQYA 1DQJA 5SV4A 1EJOL 3BEVA 4XCYA 1CBVH 1MY5A 5EUKB 3OAYK 2FJGA 1CXFA 2UZIL 1S7TB 3WNOA 1S8DA 1HEZA 1PKQB 2VLLB 1DDHA 1IT9L 1W2KT 5I66A 1OP3K 4W4OA 5JPMA 1M6OA 4JO4H 1UKTA 1DANT 3WIFB 1JK8A 4KHTL 1OAXL 4ZXBA 5KSBE 3RKDD 2DRUA 4OQ1A 2J7LA 4Y2OA 1RU9L 5L8KB 4QRPE 1TTFA 4UINH 4PJCE 3SDYL 3OGOE 3O81A 4P2QE 4GRMB 3BIKA 3BN9C 2J4WL 2HVKB 2QADC 1J1OH 2HLFC 4LLUA 3ZDYE 1ORQA 2XV6B 5CEYA 2OK0H 5HVHC 2NY4C 2JK5A 3X11A 1BM3L 1NAMH 3O6FB 4HG4K 1F3JA 4PV9B 4M1GL 5C9KA 3AXLA 2QQLL 2JIXA 1OAKL 1VADB 2WAHA 4FQQB 4MMZC 4MZ3A 4DQOL 3BSZL 1QHPA 2VO5A 4OZGE 1U3ZA 1WBYA 3DX8A 4YR6A 2E7LC 4LLDB 4PJHA 3SGEI 5HYQB 4XPGL 1E4KA 4QGTA 5JXEC 5FIEA 2DD8H 2V5RA 3IAPA 1CCZA 1OTTC 3GI9L 1RZJL 4GW1A 4OD3H 3VGHA 3QXDB 3X12A 1HHKB 2JTDA 5FF6A 5HDOA 4FS0A 4WFFD 4LPUA 3UPCA 4XHJD 4MDJB 5FGCE 1BX2A 5IIEA 4DKDC 4O5LL 2ICEB 3SHSA 4OD2B 1IAOA 1WWAX 4XWGL 3RTQB 5IVOA 3KNBA 3U7YH 1XEDA 2E7BA 3W11D 5D7LB 5TDPA 4HC1H 3QAZC 4NZUH 4QRQB 1TVHA 2KBGA 4WW1B 3QI9C 2VKWA 3K80A 1CLZL 1MIML 4G6MH 1B0RB 3OMZA 2AQ2A 4PGZA 3ARFA 1N4XL 1KT2A 1JHLL 5D1QA 3UJJH 5IMMA 1FNGB 5DZLA 2NXZC 4XMKH 4OB5H 1A64A 2CXGA 3M17A 3VXOB 5EORH 2EYTA 3CJJA 1NH6A 1XGTB 4LHUG 1Y6KR 4XX1G 3DVGA 4XP6L 1ZT7A 4HCRA 5L9DL 3EO9H 3A67L 3GHEL 1TLKA 2HKHL 3RTQD 2GITB 1NMBH 3JXAA 4X6DA 5IJVB 3NMEA 4JR9H 4WTXA 2WUBL 4QO1A 5D7LD 2BNUA 3MODL 4L8SB 3IFPB 5KS9A 4JFZL 1N7ML 3FOLB 4L9LB 5IHBA 2X9WA 1Y18B 5DJYA 4LDLB 4FQ1H 5DI8B 4Z7OE 3RX7A 2Q7NA 1Z0NA 2ADGB 4HS3A 4K7PX 4E5XA 1JHTA 4YBHA 4OLEA 1QSEB 4HIXH 3L5XL 1CFSB 1GRWA 2OCFD 3IB4A 3A0OA 5IB5B 5I16B 1TQCC 5EZOH 2X4NA 1T0MB 2ADJA 3CD4A 3QPXH 1QFHA 3ABZA 1WUNT 3CU1A 3PP4H 1MCQA 1ZGLA 3HAEB 4PUBH 1H3XA 2VZ3A 4YPGA 3MLYH 3PWLA 2YPKB 3RVUC 4K71C 4U7MA 3TA3C 4XTRC 1FFQA 2IMNA 4X7DC 5IMLA 1C16A 3MR9B 4P57A 4KROB 3G6AB 4FFVD 3RVWD 5F9OH 3EYSH 2HT4D 2BP3A 3TWCL 1ZWIB 2J8UF 5EOTB 1JTPA 1RK1A 1QSED 4PRHE 1P4IL 4ELMA 4RIRA 4XXCA 1TJHH 2OS7A 3WNNA 5DRZA 5BW7A 5C86A 1JF1A 2ED9A 2OBGA 4RMRA 2WWMC 3AFLA 3ROOB 5TQ2H 2Q86A 1KYOJ 4OCSH 4G8EA 1N0XL 2CPCA 4KTYA 3BWAB 1EJ6A 5D5MB 4JCLA 1PBYA 4GRWE 1KEMH 4L3CA 2IAMA 4MXQD 5DTFA 3MJ9H 4KROD 4J6RL 5C0CA 4YBLB 1RAMA 4X6BA 5T3ZE 3GJFB 2DWEB 2O5YH 1U8OB 1CG9B 4MCYB 3GJFK 5EU7C 4K3JH 4L3EE 1LEIB 5FUZH 1A3RL 1WFTA 4CVZA 2KH2B 1FG2A 3U48A 4GRLA 2YUZA 2YBRB 4XB8A 2IFFH 5KS9E 3C9NB 3AU1A 4BUHA 2NTFA 4NHUB 4G7YH 5JNYA 4I3RH 2DWDA 1D5ZA 3CC5B 2B1HH 2D7NA 3QDAA 4KJWC 1EGJA 4U1MB 1WT5A 5CZVL 4LVNB 1J1XL 3UBXG 3WO4C 4HUXB 1R3KA 3MBXH 4N1CA 1HI6A 4JHAH 2MCG1 1TZGL 5D1XC 3B9KA 1MRDH 2FD6L 3DXAE 4OZHA 5EO1B 1KPUA 2D31A 3GMOA 5I8KH 1K2DA 3V8CA 3HG1B 2HMIC 4APQC 5BS0E 4F15C 3GMMA 1CIDA 4OUOA 1AGCA 5IB2B 3AS1A 1U9KA 1YUHA 4GQPH 1J18A 3MOBH 2JCCF 3AM8A 4LFHG 2DICA 5HD8D 2VISA 3WKML 5T1LB 5CEZH 4UBDC 1QRKA 4GMTL 1FNEA 4NRZB 2AJXH 4XBGA 4NN6C 2X10A 1FLRL 1NCNA 4R4FH 4IRSA 4N0CD 3S36L 4JY6A 5E2TH 4HKBA 1CFNA 4Y5XC 3SOBL 2X1XR 3QA3A 5DDHA 1QR1A 1R3HA 1KPVA 3ARDA 1T1WA 2I9TA 2ENYA 3HC4L 3QO1A 2ZSWA 3HG1D 2EH8H 2CDFA 3WS6C 5HPOA 4FXGB 1I9IL 4O2FB 5CP3A 2OTPA 3L3JB 3OR6A 4EQ3A 5I74C 5ID1B 2COQA 4K3EL 3BPNB 4XMPH 4AH2B 2YRLA 3M8OL 1QFPA 4OFDA 1ZXQA 5C8JA 1NGZA 3X3FH 1MRCH 2DQTH 4LLYB 1DLHA 4PY7A 1QKZL 3P4NB 1M4KA 3GSNB 5CJ5A 5KVDL 1G9NL 4N0RA 4URTB 4NO0B 1UZ8B 1B9ZA 3R8BB 1Q9LB 3CCHA 1CICC 1MCWW 1MOEA 3VGGA 5DVOA 4HUWA 3RWEB 2J88H 1TETL 1ZMYA 4X5XA 2XKUA 4ZS6D 5KG9B 5FYKE 4D9RD 4AEFA 4YLQT 1MCWM 2E9IA 3D1MC 5JUEH 3E6HA 1IEAA 2A1WH 3IJHA 5GHWL 3R8QA 5KVFH 4FZ8H 3HCVB 4PGBB 3VFWA 4XP1H 3O8XA 3S35L 3TIDB 2OJEA 1M7DB 1MLBB 3RRQA 5LBSH 4MXWL 5AEAA 1IAIL 4LF3A 4O9HH 5D6CB 4NO0D 1U0QA 2CLRA 4ENED 2P5EA 8FABB 3E0GA 4OV5A 1NJ9B 5DMGC 1PYWA 2VQ1B 2EYSA 2XNAA 2BY1A 5DJ2B 1Y6MR 4O51B 3B2VL 5DZNA 5HHVL 1HHGB 2ICES 5MEQB 4BH8B 3R1GL 3T0VA 1ZK9A 4Q9QH 2ZCKL 3NFSH 4XCCL 1D9KB 1P4BH 2XZQL 4K2UH 3RHWF 5FYKL 5EU3A 4KJYB 1BHGA 1FNAA 5C6TL 1KLFA 3H6JA 1QSEE 4HS8H 3QEQE 3PWPD 4L8CA 4R0LA 4YDVB 1DBMH 2YUWA 4JAMA 2HJLB 4K8RD 5H35B 1EAPA 3O9WC 4YEFA 3MRQB 1T4KB 5DJDB 1UC6A 4L1HA 3HUJF 4N0UA 3OV6A 5ADPL 4OM0L 1UWXH 5GGQL 3GSUB 5CEXA 2X9YA 5IR1B 1QA9A 1YJDL 4P59L 4ZFFA 4I9WE 3L3IA 1CTNA 1M71A 4RDQG 2X89A 3CDCA 4RISH 2QHRL 1UM6L 3BP5B 2GJ6A 5DLML 2DYPA 3T0BA 1A2YB 3IKCB 2ZNWA 4JZNA 5INCB 1OTUD 2Z4QB 3HPLB 5EUOE 4G8IA 1KJ3H 1YEDB 4NN7B 1SYSB 1MCKA 3QDGE 4P4RB 4YHYB 1KULA 3VW3H 4U1GC 4NJAH 3OJMB 4QHNA 5KTEL 4I0PC 1KGCD 5CJOH 3JZ7A 4AEIL 4TUJA 4S1QH 2VE6A 4XPFH 5EZJB 4R96A 4NPYB 3RGVB 4RGMC 3VFVB 4A2MA 3EOAB 4KRMB 3BOVA 3QJHA 3V4VL 4M62L 4HJ0D 5F7YC 4PJ9A 2NY7H 2CLVA 1LK2A 4KKCD 3OXSA 3L7FA 3K7UA 2F53A 4JFOB 3MJGX 4BK5A 5DD5H 3KXFD 4GW4A 4DKEL 2PXYB 4X6CA 1RULH 5DSCA 1YYLL 3PGCB 1MELA 4GAJH 1AGEB 1X5YA 4OD1H 2VWEC 1A3LH 1J0JA 2VDOL 4XXDA 3FFCB 4PJEB 4G6JH 3ULUC 1RK0B 3H9HB 5IHZB 3RGVD 3G5XB 1WZLA 2FJHB 1UWGL 1EHLH 4HS6B 2RB8A 4EXPX 4OUUA 3LKSB 4MWFA 1NUFA 1FG9C 1R24B 4PV8B 5HHXH 1MCPL 1T7VA 4FN0A 1Y0LA 2QSTA 3MFFB 4CMHB 2PXYD 1XGQA 3WNKA 4JDVA 1ZHBA 2ZG3A 1E4XI 4YBQC 1KPRA 5IG7B 2NY0D 1WICA 5F7EL 1A1NA 3DSNA 3FFCD 3TYFA 4UTBL 4XVSH 4KK6D 3F7PC 2BVOB 4RA0C 1I1CA 2BNQA 2DS4A 3QCVH 4Y5VA 1T89C 2L0DA 3VI3F 5IESH 3U30C 1F11A 1JGDB 2MPAH 3VH8B 1J05B 3EFFA 2Q8BL 3RWIB 4WI8A 3VXRB 3OKOA 1BZ9A 1JYXA 3CVIL 3T2PA 5ESAB 3E2HB 4XC1H 3EBAA 2FRGP 3SDCB 2OP4L 3BJ91 3H0TA 5CUSH 4TUOB 1DUZA 3QUXB 5IFHL 3PGFL 5JOPE 3ULVD 3ECBB 1BOGB 1KOAA 4PYGA 1DQLL 1YNLH 2HJKB 5DQ9A 1WBZB 3BVNA 4PRBA 1DE4B 5ANMB 4XPAL 5B8CB 4GQ9L 4GUPB 5CBAB 4R4ND 5F3HB 3NBNA 3HMXH 1P1ZA 2W9EH 5FYJH 3STZB 1RUAL 1ZT4B 1PG7H 5GXBB 5CBEB 5HPMA 1EZVY 2BVQB 3MRCB 3VXRD 3CFDA 1UH3A 4KV5E 1CBVL 5SWSA 3L7EA 3SDCD 2ATKB 4KMQA 3K8LA 5I1GH 3BP4A 4P99A 4KXZH 1YN7B 3UPAA 4IS6A 2UVFA 3QUXD 2ZUTA 1QLRB 3BT2L 3W5MA 4M03A 3L9RB 1QQDB 4JO4L 2APFA 2X4UB 1U8IA 5IVNA 4LVHC 2HT2C 2RR3A 1A7NH 1YY8B 3OKLB 1BFOB 3LB6D 5FV1L 2XZZA 5C0JA 1NUNB 1FN4A 4FQLH 4BFIB 3QIUC 4PLOB 3EYVA 4UINL 3BPLC 2IADB 3HZVA 1F97A 2DQDL 2VSCA 3WFBH 4EN3A 1KCKA 2E6QA 4FMKA 5IFJB 1J1OL 1ND0B 4HGWA 4L4VB 4KVCL 2OK0L 1Q38A 1LE9B 1QSZA 1JRHH 3VXUE 1VEOA 4NC1C 4PRDA 2BNQE 3Q6FB 4M48L 3RZWA 4AMKH 4ETQB 5CIPA 3VRLF 5J8OA 2YN5A 4IM8A 1P7QB 1T22B 1OTSC 2GJZA 3TNNA 4U1HB 3GSNL 1M7XA 5DS8A 3MLSL 3RWHB 1ZLSL 1FFOB 3BN3B 2DD8L 5LAXB 4MJ6A 2BSRA 1FZJA 4NZTH 4PRPA 4L4VD 3IFOA 2LABA 1I4FA 2CDEB 1JGVL 2HFGL 4ONGH 3CK0H 2VQUA 5IGXH 4JM4L 5E2UH 1IM9B 3QI9A 4L29B 4OCWL 3K2MC 1QFWI 1E6JH 4ISVA 4D0DA 3VFRA 1P7QD 3IDNB 1DBAL 1N6UA 1JGEA 5I2IA 4Z5RA 3TCLA 4N9GA 5F7HA 3RNKA 4OGXH 4OCXH 5ERWA 3F7VB 2C1OB 4K7PY 2FGWH 5EIVA 4HC1L 1CDYA 2V7NB 5K9QG 5GZOD 4CW1B 1H3PH 1WBXB 3OGCA 1A7OH 1TCRB 5GRVK 3C09B 1NCCH 2IQAB 4HWEH 5DUPL 3V0WL 3V9FA 3UJJL 1H8SA 2HLAB 2ICWJ 2J6EH 5J6HB 3S5LA 1IM9D 3W81A 4QCIA 2R69H 4XMKL 5L2JB 4LLVB 4DGVH 2ESVB 4HZLB 4JN2A 2AJVL 2W92A 1W72A 2PF6A 3MROA 5EWIH 4WENB 4OCYH 2KL6A 1GGUA 5DRNA 4QY8B 3EO9L 4LPWA 4ODSH 1AGDB 1QBML 1TENA 1NMBL 3R06A 4JR9L 3VXSA 4GAYA 5GRUH 3BAEH 1EMTH 4PRIA 1JFQH 4YGVA 2Z31B 2M1KA 4FQ1L 4Y1AE 4P4KB 3TBVA 1QHOA 3MUY1 3TA3A 2KZWA 3QUMB 3MYZA 4D3CH 2P24A 3HC0B 1P6AB 3KR3H 2GW5A 2EXYD 2GYSA 1H3TA 4JJ5A 4HIXL 3TEUA 4OT1H 1KCSH 2ESVD 4PS4L 3EJYC 5J12C 3QPXL 1YMMB 3MV8B 4J3XA 3PP4L 3DSFL 4DEPC 4PUBL 1KLGB 3H3KA 3GSQA 4ZSOA 4MA3B 1AR2A 3GRWA 4X9IA 4G3YL 5MI0B 2YPLA 1PX3A 2Z31D 1MREL 2OQJA 1LO0H 2FLRT 4P4KD 5F9OL 1IMHC 2EKJA 4V1DE 4YXHH 1YEJL 4XP5H 1IGFH 1NBQA 5GRZA 2I24N 5C6WH 1EPFA 5I30L 1TJHL 5DMKA 2I25N 4HF5H 4MD4B 1GZQB 1JWUB 4HXAH 2A6IA 2R0ZL 1HNFA 3PE9A 1YMMD 3MV8D 1MLCA 3G6JB 3WJJA 1AD9A 1J0HA 5F7MC 5AZ2H 3KPNA 2MCPH 1RJLB 5LQBH 2ED7A 1KEML 4XAWL 4KJQD 3SDXA 1DR9A 4F9LA 3DYPA 1SMAA 3TCXA 2ZCHH 1I3VA 3VXMA 3HAEG 3V4PH 2BVEA 1U92A 3QWQB 4O2CB 2C1PA 3LCYA 4KTDH 1JUFB 1FVEB 3GGWB 3H7LA 1MY7A 5FUZL 5D5MF 4U2YA 2LVCA 3ULVL 2NXYB 3UTTE 5LVEA 4AYFA 5ITFA 4GG6A 2IFFL 5EBMB 3WIHA 5C0RL 4BKLB 4OI9A 4CJ0A 2AXFA 1U6AH 3C6SA 3D18A 5FCSH 5J1AA 43CAA 2BC4B 4OF0A 1YEEH 5CEZE 4G7YL 3LS4H 3L3HA 2K9UA 12E8H 1I1AA 1KNOA 1FYTB 4MCZB 3FN9A 4OLXH 1JWSB 1SJEA 4G9DB 2IBZX 3BRGC 3RZCA 4CKVX 3A6CH 2GY5A 4MQTB 4I5BA 5I15H 1N2RB 3MBXL 2Y6SC 5A3ID 2FEEI 3FONB 4JHAL 4W70A 3KJ6H 1MRDL 3O2DA 4FG6D 3UYOD 2DBLL 2NXYD 3C08H 5I8KL 3P4MB 2X1QA 1E6OH 2P5WE 1XCTB 4XAKD 4Y5XA 4YNYA 4M02A 3X14A 3MRHB 3NA4A 3U0PA 5IFAH 5M95B 1IL1B 5C0IA 3TN0C 3MOBL 1FYTD 4W6XB 1FE8H 3HR5B 2BRRL 2H1PH 4ZFGH 4LHQB 1QSFB 2DL9A 5CEZL 4HWZB 4G6KH 1ZA3B 3CFBA 5DFVC 2JELL 2AJXL 5CD5C 2QJDA 1S7XA 3QDJA 3PQYB 3X3GL 1DQJB 5GGTA 1FRGH 3DGCR 3RIAF 3BEVB 1DN2A 3P4LA 2FJGB 4R26H 3TP4A 4E0RB 1S8DB 1HEZB 1F90L 4LSPH 1JZ5A 1IKFH 5CCKH 1CICA 1NAKH 3RNQA 3HZKB 5I66B 4LEOA 4XMPL 1KV3A 3OL2A 5JPMB 1IGJB 4D0CA 1JK8B 1J87A 2XKSA 5GS2D 4ZXBB 5HHOE 3GNML 1QSFD 4JFQA 2HVJA 3X3FL 4OF3A 1MRCL 3EW3B 3RX5A 5TDNA 5SWZE 2A9ML 4KC3B 2QQNL 2EDNA 2NY6B 3PQYD 3BIKB 3LEXA 4J3UA 3OTTA 3VG0H 3BD3A 4Z8FH 3H3BC 4LLUB 3O2WH 2FEDC 1ORQB 3QFJA 5CEYB 2GSGA 3VA6A 5GS0C 2J88L 3X11B 4KK8C 3RUGA 5HI5D 4AG4H 1F3JB 4Z0XB 2R2EB 1IE5A 3AXLB 1SBSH 5JUEL 5F1IA 1FVDA 2JIXB 4CN1A 1KB9J 2VYRE 4ZXBD 2A1WL 5D96B 4P23A 4FZ8L 1NBVL 3BE1H 1WBYB 3DX8B 5D93C 4YR6B 1CDGA 3BGFB 3DWTA 3MNZB 4PJHB 1MFBH 3JBG7 1I8LC 2NY6D 4K7PH 4O9HL 4HFUH 1IGIH 5E8NB 4CUCA 2I9LA 1X44A 3CU7A 3WMSA 4YHNA 3MACL 1C8PA 4GW1B 1JYVA 2QR0A 3BH9A 1J5OH 3V0VA 1QBLH 1DEDA 2VJXA 3X12B 3CXHJ 2OSLB 2UUDH 5FF6B 1JIBA 3BW9A 4OQTH 1JPFA 4S1DC 1KLUA 3CLEH 3MNWA 2JIXD 1DTUA 3CFCL 3QJFA 1FC2D 4OLVH 5IW3A 3VXQA 4EVNA 3NFSL 5C08A 3CDGB 5B38G 1FIGL 1P4BL 1F3DH 4K2UL 1BX2B 3B6SA 3SBWC 3EDJA 5IIEB 4Y2DC 1F2QA 2IF7A 5B22A 3L3GA 3O11A 4P2OC 3DI2B 1IAOB 1N5AA 4HS8L 4TOYL 4ZUWA 2ZSVB 1DFBH 1IEHA 1DBML 3KNBB 3ZHDA 3TV3H 5TDPB 1ZHKA 4HIIA 1BECA 1PX4A 1TVHB 2YRPA 4NKDA 4OZ4A 3ARFB 1KT2B 1R6VA 5D1QB 5IMMB 3GSVA 2NW2A 4BQCA 4DUVA 2ZKHH 4X4YA 2ARWA 1F3DJ 3M17B 4RGNB 2EYTB 3FT3A 5HBBA 3WNPA 4IDJH 4NKMB 1ZT7B 2DM7A 4NNYB 4JGMA 3VW3L 2BHZA 3MXVH 1UM5H 1WTLA 4X6DB 1YPZE 2WK2A 4TQEL 3QUML 3U2SA 3RUGE 3NACH 3IFLH 3P3YA 4WI2A 1T5WA 2BNUB 4K3DH 1WQVT 4PJFA 2D2OA 4NQEE 4JHBA 1H15A 4HUNB 5DJYB 4TTDD 3ARFD 4E5XB 4XRCA 5D1QD 4KUCD 2NY7L 1JHTB 5GJSH 4XWOC 4PD4J 1CLYH 3FN0H 4I18C 3BWUC 3LVEA 5EA0H 4AQ1B 4KXZI 4OF6A 4RGND 2H6PA 4XPBL 1U8HA 2X4NB 5D7KD 4B0MM 2ADJB 5DD5L 1MCNA 3QH3A 4FQXA 3VDBA 3LV3A 1VGEH 3QG7L 1ZGLB 4OD1L 4YPGB 3PWLB 4GKSA 4LPTA 5CGYC 1BQHB 2GHWB 2OL3H 2W07A 4FFYH 4HIHA 3JUYA 4HUVA 3ARBA 4G6JL 4J8RA 1C16B 3I85A 4P57B 1BLNA 1JZ7A 4QLRA 2Q20A 4RNRA 1KC5L 5JMRA 1X3DA 1GHFH 2AJ3A 3VGFA 1RK1B 4C55A 3FN3A 4ELMB 1MJUH 4RIRB 3CDYA 1T89A 2OR7A 5EULV 1PZUB 1JF1B 4EUPH 5KVGH 3C6LA 1T66C 5CSBA 4PJ8C 1UYWL 2Q86B 1CN4A 5L7XH 1E27B 4HKJA 4HMCA 4NRYA 4GFTB 3QEUA 1IC4L 4M1CD 5FYJE 4L3CB 3ES6A 4YC2C 2DOCA 4YWGH 1CE1H 4EDXB 5C0CB 4X6BB 3QCVL 2GUOB 5FFLA 5D7SL 5IESL 2HTLD 2MPAL 4JFEA 3RVXC 5JXAH 1VESA 2FECI 4L5FH 3ULVF 1JBJA 4M4PA 4TYUA 2V17H 4XC1L 4CL7A 5C2BH 3ZE2F 1JGUH 1ADQH 1FG2B 5GRWA 4GRLB 5CUSL 3MNVA 5DD6A 4LASH 3VA2C 3Q3GA 2GFBA 1EHXA 1X5JA 4NCC1 3AU1B 4HBCH 2VDPL 1ZANH 5ICYA 5JNYB 1BMGA 1D5ZB 2IAMD 5C0CD 3D39A 4WUUB 1Q0XL 1YEIL 3F58H 3HMXL 4JFHE 3K2UH 2W9EL 4KQ3H 5FYJL 5FHBH 5EOQH 1R3KB 5J1SC 4I48A 2UWEE 1HI6B 1JZ4A 3QIUA 3D69A 1CF8H 4Y4FA 5I1GL 4OZHB 2D31B 3EOBA 1KTDA 3OBAA 1A5FH 4GRLD 4X4ZA 4ZUVA 1K2DB 15C8L 5CSZA 3RQ3A 3PHSA 4Z7VA 1NQBA 3GMMB 1AGCB 3IDXH 3N06B 4YX2H 4QRUA 1A7NL 1XF5B 1P9MC 2VISB 5J11B 4DFHA 1FNEB 5FCUH 3GSRA 1I8MA 4XBGB 5BOZG 3VD3A 3WFBL 1R3JA 3RKDC 4IRSB 3HNVH 1CL7H 4JY6B 1CFNB 3B9KD 3QA3B 5T3XE 1QR1B 1R3HB 1KPVB 3ARDB 2I9TB 1HYRC 2HN7A 3QO1B 2ZSWB 2FBOJ 4LPVA 1JPGB 5HVFB 5MHSE 1EIBA 2CDFB 2FB4H 5TJWK 1NC4A 1R3LA 4L4JA 2K7PA 3OXRA 4MQ7B 4AMKL 2PW1A 2FH6A 3RL1A 2W0LA 3NCYP 2Y23A 4F7MA 3P11H 2NX5E 4G42A 3FQUA 5C8JB 3N9GL 3FCTA 4OGYH 4EIZC 2R2CA 4K23H 3IU3A 4PY7B 3D3VE 4IRSD 2AK4E 5E2JA 3HHRB 4JO2H 5I1AA 1DCLA 4C54A 3HFML 4OSUL 4PJDE 4TN9A 1UB5A 1C5DB 3ARDD 32C2A 3TGXA 2BCKA 5DVKA 3CCHB 1X5FA 4HUWB 3CK0L 3J7HA 5E2UL 3ARVA 4X5XB 1DVFA 1FQ9C 1DBBL 1E6JL 5D70H 1QPXA 2AJYH 2XWBA 1V7ML 1HDMB 3E6HB 1IEAB 1JHKH 2YPVL 3IJHB 3VFWB 4ALAL 4LRIA 4U1NA 4OGXL 3C2SA 3B5TA 4XHJC 4OCXL 5D2LE 2FGWL 3RBSA 1H3PL 1I8KA 2CLRB 2P5EB 1X5AA 4OV5B 2AQ1A 4Z9KB 1PYWB 1NLBH 2EYSB 2XNAB 4PRNB 1AI1H 5GSVA 1FNFA 2J6EL 2CRZA 2D7OA 2R69L 4FQPA 1VGKA 2RCSH 2BMKB 5CFHA 3V79C 4DGVL 3DROA 1TVBA 5EWIL 4NHCH 2IGFH 5K59F 3BGAA 4D9LH 2CLZA 2AJSL 3O8XD 4ODSL 4PJAB 5JOFA 4L4TA 5J4MA 1G6RA 1S9KC 3OKYA 1LEKA 3BDYL 4L8CB 4R0LB 4AM0A 5GRUL 4JAMB 3OG6B 4XB7A 1EMTL 1CR9H 1FO0A 4HT1H 5IQ9B 1EAPB 2P5ED 1G7MA 4X6FA 3MRGA 5I8EA 3RTQC 4EIGB 4N0UB 5BV7H 2C3HA 3D5OF 3WXWH 3FRPA 4M7LL 1OSPH 4UOJA 5A1AA 4D3CL 5CEXB 3KR3L 2VLKE 1R0AL 4KAQH 1QA9B 4ZFFB 2X2YA 4OT1L 1KB5H 1KCSL 3L3IB 3ZKXB 1M71B 4JY5L 5FKPA 2X44D 3TO4A 4MMXC 5CGMA 2GJ6B 3ZLQC 4KKNA 2DYPB 2XFXA 5F70A 3RVTC 4JZNB 1UJTA 2PYFA 5F7FA 3I6GA 5EO9B 2DM2A 3CVHH 4LIQE 4NSKA 4WHTA 1MSPA 2G5BA 3LHPH 4PLJD 3AGVA 4RQQA 3DTXB 2BOCA 1YJDC 2P45B 3LRSA 4S2SB 4QHNB 2XTJE 4I77H 5ADOH 4TUJB 3DVNA 5JIPA 2VE6B 1LO0L 1AGFB 1ZHLA 4R96B 1OAQH 4XP5L 1IGFL 4JB9L 3QJHB 4LCIH 2OL3B 4EJ1C 4L8SC 3HC3H 4PJ9B 2X89D 2D0HA 2GJ6D 2DYPD 4FFVC 3FT4B 2CLVB 4HXAL 1RUQL 3T0WA 1YEGL 3OXSB 3KVQA 1FSKB 5LG1A 2C3WA 3L7FB 3EOTL 2F53B 1ZLUH 4U6HA 1JF5A 3EYUH 1XF3B 3VFGL 4OLWH 5DQDL 3NPSB 4GW4B 2MCPL 4X6CB 3SKJH 3JV4B 5DSCB 2IBZY 4XCNA 3SE3C 4RA3A 5LQBL 4J7RA 4HK3J 1MCRA 4N5UA 3OAUH 3VJ6A 3DO3A 4NT6A 4XXDB 3WFEH 5EBGA 2ZCHL 2AQ3A 3CFKA 1A7PH 3G6JF 3PWUA 3RWCA 2CJUL 4BQBA 1EXUA 5E99L 3I02A 4PJ9D 2XKNA 4OUUB 3DMMA 4MWFB 2ZPKH 1MFAL 1T7WA 1A0QH 3WIIL 1JNHA 4WUUE 2F53D 2FX7L 2ORBL 4XVJH 2IH3A 5ICXA 3MJ6A 1U6AL 1XGQB 1U36A 3ISWA 4GT7A 1ZHBB 3LS4L 5H37H 1QBAA 4M8QB 6FABH 1G1CA 1GGYA 4J3SA 5KSBF 3BPCA 4O58H 4QNPF 3U4AA 3QXVA 2BVYA 3MRNA 4ODVL 1AC6A 3TYFB 1EHAA 1RSFA 4OLXL 2ZJSH 4RRPG 5GRJH 3A6CL 4Y5VB 5IT2H 1EEUA 1NDMA 1F11B 3O4LE 5I15L 3HZMA 3EFFB 4MLSA 1W0WA 1OP9A 5GSRA 3OKOB 1BZ9B 4J1UA 2UY6A 4MA7H 4UILH 5CSGA 3UTQB 4PJXF 1BZQK 4WU7A 5B3JF 1DUZB 1ETZA 1D6VH 5E8OA 4E42A 1EGJL 1J1PL 1EEYA 1FE8L 3NCYS 2H1PL 5DQ9B 3BVNB 4PRBB 4ZFGL 2Z8SA 4JFPA 1PQZA 4POUB 4G6KL 4LQ1A 5JDSA 4PBWD 3VI4E 2E8ZA 3FQRA 1FIEA 4LKCA 1P1ZB 3C8HA 5DK0B 3ALXA 5DMIH 5HD8C 3CFDB 3SKUD 1NPUA 1FRGL 4LVNC 5AUMA 5SWSB 3TBTA 3BUYB 3L7EB 4IRJA 3DNKA 4RBPK 3WLBA 4BJLA 3BP4B 4R26L 4N0CC 1AHWA 4IS6B 5IVXE 4X8XA 2Q3ZA 4LSPL 1T1YA 5CCKL 1HXMB 1NAKL 2BOBA 2QADB 2R0KL 4G8GE 2NY4B 4WU5A 1IRAY 1WC7A 4QRRA 4YFLF 4NKOA 2HJFA 4ZNEE 1F5WA 2OR9H 2KPNA 2ZOLB 2D7TH 1T04A 1T83C 3AUVA 5C0JB 1FN4B 1AIFA 3BI9X 3T1WA 3EYVB 1JJUA 4DGYH 4BELD 2WUCH 3UYRH 1NCDH 1SY6A 5SWSD 2V5TA 1KJ2H 4Z8FL 4HGWB 3WHXA 5FUCE 4XNYH 5MENE 3O2WL 5C0BA 1VACB 5MEPA 2VQTA 3INUL 4AG4L 3T3PF 2QADD 2HLFD 1LWRA 4PJ7A 4PRDB 1BOYA 2NY4D 1EH9A 5CIPB 5GIRA 1HH6A 3UX9B 3I9GH 3IF1A 3Q5OA 1NMAH 5EDXA 2GJZB 3TNNB 2XWJA 3OF6A 3BE1L 4ZS6C 5DS8B 2DN7A 3BPNC 4BUGA 4O4YH 2NY3C 4N8CH 3EDFA 1MFBL 1U95A 4K7PL 3VD9A 4EN3D 4Q0XH 3RJDA 4XMLH 4P2OA 3MRRA 5JA9A 2YD4A 2BSRB 1FZJB 4PRPB 4Q2ZA 5D72H 2DQJL 3IFOB 4N8VA 3T0EC 5A2JH 1J5OL 3BIBX 4JG0L 1QBLL 4C56A 1YQVH 3MCLH 1SYVA 4PJHF 4ENEC 3CLEL 4PP1D 1LO2L 3QI9B 2Y5TA 4OLVL 4XBEH 4ISVB 4KRPB 3SDDA 3IDJA 4D0DB 3VFRB 1JGEB 3MRPA 2BY0A 1DUYA 3GMLA 5A43C 3TCLB 5I2IB 4N9GB 3RNKB 3WFCH 1ACZA 1DFBL 5FYKU 3RDTA 3VFNA 5ERWB 5IW1A 5IM7B 4TTGA 3TV3L 4PRPD 3U79A 35C8H 4KZDH 1VSCA 2E8YA 3OGCB 1OGAE 2GT9A 4QYOA 1G7QA 4K8RC 4QTIL 3RFZC 3S5LB 1MWAA 3QI9D 4QCIB 3ZKNC 3KWWA 5TPWL 4WWID 3QXTA 4KRPD 1A7QH 1UACH 1W0VA 4A6YA 4JN2B 3MROB 4JKPL 1N5YH 4JRYA 5ALBH 1TTUA 2VNCA 5DRNB 3DLQR 4N0FA 1WITA 3MXVL 4NBXB 3R06B 4ZPVA 1OTUC 4KUCF 4N90D 3VXSB 3NACL 3IFLL 4GAYB 4CVXA 3O3UN 1XT5A 4LP5A 4F37F 2FNBA 4PRIB 2E3VA 1CWVA 4X6EA 3WHE0 4YGVB 4B53A 5FOJA 3P4OA 5IBTL 3DUSA 4K71B 3SGKA 3TBVB 3S3JA 3TA3B 3U4BH 1HHHA 3P77A 5D2NC 4NN5B 5GJSL 2QTEA 4JJ5B 3FN0L 4X6DF 5EA0L 3MV9E 3S4SA 4NUGH 5KS9F 5KVMC 4NQCA 5BO1H 3OKDA 5HGDA 1YQ2A 1VGEL 5DJCA 4MX7A 1V8HA 4Z7UA 1F4YL 2R9HD 3GSQB 3LKOA 5TH2A 4ZSOB 3VXSD 3O6MH 3QUZC 2OL3L 4JPIA 2FJFB 3RY6A 4IDLA 3GIVB 4PRID 4E9LA 2R1WA 3ULUH 2YPLB 3ARPA 1P69B 3K81A 1CDCA 4GG8A 4K55A 2R1YB 4P49A 2OQJB 1O0VA 1YA5A 4YZFE 4ESKA 4JZJA 5DD1H 2DM3A 3TA3D 2PW2A 1U93B 1CL7I 4LEXH 1BQLH 3T04D 1LEGA 1RIUH 4XP4H 2WBKA 3W5NA 2BX5A 3T8XA 5DMKB 2EDFA 1DQTA 3RGVC 1CFTA 4F7EB 5KVGL 5MERA 2A6IB 3L1OH 2YWZA 2WIIB 1MLCB 1F6AA 4FQ2L 1AD9B 4QOKA 3E3QC 3LQMA 4LP4A 2NZ9C 2PNDA 1RUPH 4I2XE 3KPNB 1AC0A 4GKOA 1QFUH 3TC9A 1OAUH 5I73B 3AAZA 5IQ7H 4ELMF 4LMQI 3SDXB 2HKFH 4NUJA 2YPLD 5HGHA 2PXYC 4YWGL 1CE1L 4H25A 4YK4B 5JW3L 3VXMB 1D5XA 2NY0C 4JFDA 1ITCA 2VLRE 2DQUH 3UTSE 4S0TD 5JXAL 1OP5K 2VXQH 4Z7QF 4L5FL 4X4ME 5F1OB 1UWEL 1ZVYA 2HFTA 2VZSA 2XQBH 1BQHG 4KK6C 1FZMA 1S7WB 1JGUL 4XPHH 3VDCA 1KN2H 1ADQL 5ITFB 2WWKO 2NYYD 4LASL 4GG6B 1WF5A 1CGSL 1XMWA 4BYHA 5IBUG 2AXFB 2VZUA 5J1AB 3C6SB 3D18B 43CAB 4C83A 3H9YA 3P9LA 1ZANL 1WWBX 5FDWA 3L3HB 3MGAA 2AAVA 1I1AB 5KSAC 1J11A 4PY8J 1IEBA 1KNOB 4APQB 4JO1L 4CMHC 3R0NA 5FAAA 3ULVC 1HH9A 3VXMD 3PWNA 1SJEB 1H0DA 3F58L 3RWFA 4ERSL 3GMPA 4KQ3L 2HWZH 4HPOH 3RZCB 5FHBL 4F3FA 5AD0A 2H3NB 4R4BB 4I5BB 4KJWD 5K33A 3T1FA 3PHOA 3U6RA 3KG5A 4H1LA 5F1SA 3QP3A 3ZE0F 1A5FL 5DC4B 2AJUH 3MBEA 1T6WA 4JGUA 4FZEH 4Y5XB 4YNYB 3X14B 1Q9KA 3E2HC 1A6UH 1UWXK 4M7KH 4LMQE 3U0PB 3B2UD 2A74A 3IDXL 1I1FA 4ZUSA 5C0IB 2AEPH 4YX2L 1I1AD 2HMID 4APQD 3KPMA 2YR3A 3QUXC 4X99A 4JN1H 1EEZA 4OZHF 2MFNA 4GLRI 3CFBB 5FCUL 3X13A 3RZCD 3FMGL 2N4IA 5C07A 5TFSH 1MVUA 1S7XB 3QDJB 3FJTA 4P3CH 3HNVL 4UBDD 2OZ4H 1I9JL 3LB6C 1ACYL 3ULSA 2VXUL 4G8FA 4LCYA 4ZO6A 5KSVA 2BJMH 4GMSH 1JWMA 2FB4L 2X70A 3P73B 3U9UA 1UQSA 1I3RA 25C8L 4NM4L 1A1OA 1CICB 3RNQB 4JFDE 1UM4H 3KPSE 4O2EA 2DF3A 2EDXA 5K9KA 1OD7A 2VC2H 3P11L 1QFWM 4JO3H 4DZ8A 3ZT5A 5CINH 1IVLA 2BZDA 3TZVA 2EYRA 1F58H 3TNMA 5TDNB 1HHJA 3QDJD 4S1RL 4JO2L 4MLIA 2B5IC 3SEPA 1RV6X 4WFHD 4ZYKA 3ZT6A 4Z7NE 4K3GA 4LU5L 3QFJB 3LD8B 1ZAGA 3QUYC 3SE9L 3JV0A 5HGGS 1QFWL 4HW6A 4P3DA 5F44A 1CICD 4OIBA 5D70L 1ZE3C 2AJYL 4FQHA 3SE4C 5F9WC 5F1IB 1FVDB 2X1OA 4MZ2A 3N1QC 4P23B 4OI7A 1QO3A 4H88H 3VXTA 3GK8H 4OM1H 5DHXB 2O5ZH 3KYKL 1S7VA 1BWMA 1F42A 2LFGA 3DURB 2CDGB 3O3EA 5SX4I 3NCCB 5HYJA 1WCQA 4DJMA 2I9LB 1UZ6F 3ZSTA 1KEGH 4YHNB 1NLBL 3QFJD 1KCRL 2QR0B 3MQIA 1AI1L 1AXTH 1VPOL 5DHVA 3ARZA 3O4OC 4TUKH 4MNQA 2DLEA 2RCSL 5GZOC 2GSIA 3BW9B 1JPFB 1F3RB 1KLUB 3DUHA 2ZOKA 3MNWB 5C07E 4NHCL 3VXQB 3VDAA 2FCBA 4Y19A 4EVNB 5DZOA 5C08B 3RIFK 2IGFL 5C71A 4P23D 5EPMB 3MUGA 3QB7C 3B6SB 2QKIA 3L3GB 3IXAB 3O11B 4QT5A 3G9VA 4WIQA 3AY4A 1N5AB 3PJSA 4OIAA 3CLFH 3SGDH 4EOWH 4ZUWB 4QHKI 3V5HA 4LCWE 4MAYA 5T1MB 3FFDA 1J88A 1AKJB 5I9QC 1CE6B 4J4PA 1LILA 1ZHKB 4HIIB 1DLFL 3WXWL 1OSPL 4NKDB 4OZ4B 5AYUH 1OW0C 1AE6L 2C7UA 2AGJH 3GSVB 2NW2B 3C09C 4RGMB 4X4YB 2X05A 4KI5E 4POYA 5D7IE 5C08D 3LEVL 4JANA 4F7PA 3FT3B 2EXYC 1QD0A 3W82A 2VL5A 4YHMH 1FO0H 3F7YA 3LHPL 4L8BA 5DGRA 4R2GB 3PWVB 3EGSA 4I77L 1AKJD 5ADOL 3U2SB 3LKQA 1NUDA 1T5WB 3P9WB 5EU7E 5MP6H 5FB8A 4V2BA 4PJFB 3RA7L 1OAQL 5DT1H 1H15B 3O3BA 4K94L 2Y07L 1HZHH 1RZGB 3HC3L 4JPVH 2BY2A 4XRCB 4J12A 4TPRH 2Z31C 3CUPB 4P4KC 3CSBA 1QP1A 3DIFA 4U33A 5IMOA 4GW5A 2WP3T 2H6PB 1WAAA 1U8HB 1EK3A 3RBGA 3V6FA 4P2RA 5F7KC 3EYUL 4OLWL 3BHBA 3GRWL 2W9DL 1H8NA 3QH3B 5BZWA 2D0FA 3SKJL 3FO0H 4R2GD 5JORA 2A73B 4PJBA 1Z5LA 3I2CH 4NWUH 4GKSB 3WFEL 2DJ4A 4HUVB 1ZA6B 4J8RB 4OFVA 2VR5A 2B0SH 3V5DA 3NIGE 2MHAA 1BLNB 4MB3A 1RZ7L 4M4RA 3T08A 5MI0C 3KPTA 3MRFA 1SJVA 4X6CF 3D2UA 3E8UH 4KKLC 1G7PB 4Y8AA 2ZPKL 1MH5A 3UTZA 3U30B 5LWYH 5CWSA 1IGMH 1Z9SA 3ZDZE 3I75A 1U8LA 3C6LB 1JNLH 2VDLH 4P46A 4NP4H 1L7IH 1XGRA 4FQXD 4M6OH 4YDIH 4U1KA 3I6LE 4E41E 4NRYB 1UVQA 4O58L 1IFHH 4MA1B 5DFTA 1BJ1H 1OLLA 2GTWA 2ITDA 3ARBD 1WIOA 3ES6B 4YBQD 3QRGL 2F74A 4EUPG 5KN5B 5KOMC 2E7CA 2YEZA 3Q1SH 1T7YA 4JFEB 3MRLA 1KELH 3QWOB 2QQQA 1TPXC 3OR7A 1A14L 4OCMC 2F54B 4NQTA 3IRPX 4MA7L 1XZ0A 4M93B 4UILL 1ZLVH 3PDDA 3TJEH 1P7KA 3C6LD 2EDDA 3NZ8A 3B9AA 1RJZB 1CT8A 2Q87A 3NCJH 1D6VL 3Q3GB 4FG6C 2NXYC 1GAFL 4J3WA 5EC1A 4BQ9A 1GYAA 4QEGA 3AMLA 3P0VH 3D25A 1BJ1J 5ICYB 4QHUA 3MA9L 3LKNA 3HLAB 2VDNH 4DFIA 1FP5A 3D39B 1NFIA 4JJHA 5E9DA 3O2DL 3ZSSA 1Q1JL 4JFED 4OCLC 1FL6B 2A6JB 4PJGA 4F80A 1MFNA 3KPRE 1MF2H 2E9WA 3F12A 2F54D 1J8HA 3BZEA 4I48B 5GRYA 2P4AB 3QIUB 3D69B 4M5YL 3V7MA 2Y25A 4PJBE 3BPLB 3EOBB 1KTDB 2YS4A 4MB4A 1A6WL 5AYQA 4ZUVB 2Z8WC 5CSZB 1MQ8A 2HAZA 1S5HA 3CMGA 4LQFL 4Z7VB 5HDQH 1JI2A 4ZODA 4WTWA 2CO6B 4LPCA 1KXVC 3P0YL 3CIQA 3BX7C 5LGKA 4QRUB 1YC8A 2YMXL 1EJOH 3D39D 3CX5J 3QXAA 2D7TL 3GB7A 4R97C 1B0GA 5GGTL 2GTZA 1NANI 1NLDH 3GSRB 2UZIH 3QZWG 1GGIH 1I8MB 1IT9H 1R3JB 3CSYA 2WUCL 1HHIA 4HD9A 3UYRL 1NCDL 4H8WC 5CJXA 3QIUD 2IANE 4LSSL 4XNYL 3GO1L 2HN7B 1MAKA 2IPUG 5GS0H 1A9EA 4LBEB 1H5BA 5C09A 5D9SB 4DGIH 1A8JH 1NC4B 1R3LB 3LQAC 3T2OA 3OXRB 3T0EA 3KDMA 2PW1B 5CJ8A 3SDYH 3TO2A 3RL1B 2EXWC 1TZHA 2J4WH 1NMAL 3W0WB 4V2CB 4F7MB 5HI5C 4G42B 3FQUB 3FCTB 4W4OC 4O4YL 4W68A 4LKXA 4N8CL 3ARYA 3MX0A 3REWB 4FQIL 3OSKA 2Q76A 1SEQH 3V2AR 4XMLL 1BD2E 1B0WA 5I1AB 5D72L 1UB5B 2AXHA 4DK3A 4DQOH 32C2B 3BSZH 2BCKB 3OPZL 2MQ3A 4F9PA 2NY6C 3QHTC 3MCLL 2YHGA 1NC4D 2O61A 2NLJA 1IM3A 5E5RB 3TVMA 4U3XA 4XBEL 3WDHA 3AVEA 4PJGE 2XWBB 3W0WD 4QWWD 1B4JL 5BRZB 4X7CC 4ZTPL 1X5LA 5HSFA 4U1NB 4LDOB 5D96C 4PY8I 5BQ7A 4KZDL 2VAJA 1PG7W 1NUGA 3BGFC 5GS1A 1I8KB 4GAFB 3U82B 2PTTA 3VXNA 1E4KC 4XNZB 4O5LH 1H3VA 1QR4A 3HI6L 4WI7A 5ETUA 1ZOXA 5GSVB 1IGCL 1LD9A 4XWGH 2OXGA 2PKDA 3CFEA 1B3JA 1URLA 5DUML 1A7QL 1UACL 3DROB 1TVBB 1QRNE 1N5YL 3L5JA 2VLJE 1IC5L 2WW8A 4ZO8A 2VWEE 3N0PB 43C9A 1QPPA 1S78D 2CLZB 1UXSA 5DEGA 3RPIB 3ULUE 1CLZH 1MIMH 2DLHA 4KGLA 5JOFB 1INEH 4GH7B 4L4TB 4RFNC 1G6RB 3H9SA 1LEKB 1JHLH 1MHEA 3D9AH 2D4DA 4AM0B 3RX8A 2WWKT 1FO0B 3N1MC 3EYQD 1LQSR 2C3GA 1G7MB 2OTUA 4X6FB 4U05A 3MRGB 5I8EB 3QUZA 3PWJA 1ZS8A 5GJTL 3U4BL 4RMWA 5L9DH 4FTVB 1VENA 2HKHH 3NAAL 1C7TA 5FKPB 3TO4B 1U3JA 4NUGL 2XFXB 4OZIA 4TTDC 4PJIA 5E5UB 4JFZH 4I13B 2V9RA 1A4JA 2CR6A 4ODHH 5BO1L 3I6GB 2NY5C 3EJYD 4L4TD 4NSKB 4WHTB 2P8MB 3DX6A 2G5BB 4RQQB 3O6ML 2BOCB 3GJEA 3LRSB 2ID5A 4G6AC 3WN5A 4F58L 2RFXA 3ULUL 2KKQA 5JPNA 2DIBA 3ZO0A 3DVNB 3HS0A 5DD1L 1ZHLB 3V6OA 1BEYL 1YNKH 4AENA 1UGNA 4LEXL 4NKQB 1CFBA 3FO1A 1MI5A 2BNRA 2AS5M 1P4LA 2EDJA 3TO4D 5DK3A 3WE6A 1NCBH 2EE2A 4TNVF 6CGTA 5SX5K 4HH8A 1GIGL 3L1OL 4EBQH 4U6HB 4OLYH 2YA2A 3NN8B 5TE4H 1QFUL 2V5SA 3KPPA 1NFDA 4X80H 4XCNB 2AP2A 5I1EH 4JRXE 5IQ7L 1I7UA 5GGSA 1P4IH 2HKFL 2A2QT 3VJ6B 3MO1B 4NT6B 1Z6JT 1CS6A 3PXHA 4YPJA 2R2HB 3QIWC 2DDQH 4M6AA 1CXKA 5KSAA 2DQUL 3CFKB 1AO7A 3BZ4A 3S37X 5D6DA 3PWUB 4NQDE 3RWCB 5HJ3B 2XQBL 2KQMA 3MFGB 3I02B 1N0XH 4IOIA 2XKNB 4G80A 3DMMB 2PYEE 4ZUTA 1U8QA 3HE6A 1KN2L 3SDXF 2HTLC 1CFQA 4QTHA 1JNHB 1DEEB 3LQZA 1RFDL 4F7TA 5I1IH 2XZCH 4J6RH 2IH3B 5ICXB 4JKKA 5TF0A 5BW7C 1QOKA 4Z7WA 3NGBB 2XN9A 4DKFH 4ONFL 4RWYL 1NCWH 3GMNA 4LHUA 1CK0H 4UT9H 2ZZUT 3ARUA 4UDTA 4GG6F 4HPOL 5JLZA 4UAOC 1NDMB 3MCKA 4NC0B 5C3LD 2IAMC 4OFIA 3DMMD 1R5WA 3HZMB 3BYTA 1W0WB 3G5VB 5GSRB 3OKEB 5FYJU 1VFMA 2EE6A 4J1UB 3QISA 5H37G 2YZ1A 4HKZA 2AJUL 1MAJA 4IIQC 4FZEL 1GXEA 5E6ZA 4LSTH 4ZO7A 4WU7B 1A6UL 1ETZB 4YHKH 1J1XH 3FO2A 1DANU 5F88A 1T1ZB 1RZ8A 3D6GA 3IJYA 2AEPL 3W39A 4CVUA 3T65B 1GOHA 1KJMA 4HIEA 1EEYB 1YEHL 4C59B 4HAFA 1TZGH 4OZFH 4JFPB 1PQZB 1XGYL 4PD4K 1SEBA 1J0IA 1V5JA 5JDSB 3NFPA 5ESQA 3FQRB 5TFSL 1F4WL 4LKCB 3QDMA 1UKQA 4P3CL 4ZUUA 1F6FB 2OMBA 5EU6E 5DC0A 1E4JA 4J23A 4M3KB 2VDKL 1KCVH 3N85L 3TBTB 1FAKT 3WLBB 1OB1A 3OZ9H 2BJML 5C1MB 3WKMH 4L9DA 1CTOA 1JCKA 3V5KA 5JA8B 2V5MA 3OAYH 2IG2H 5I19H 1UADC 5IMKA 4ZOBA 1T1YB 3B9KC 4X8JB 2B2XH 1FLRH 2BOBB 1UM4L 3OKMB 4G6FB 1HKFA 3QUYA 3MRDA 3DHMA 5EG6C 1MHPL 2VC2L 4QRRB 1VKXA 1OP3H 1PFCA 4NKOB 2HJFB 3C5SA 5CINL 5D1ZC 5F6HI 1F58L 4BQ6A 2DTSA 2OMNA 3UDWA 3AM8C 1I9IH 1AIFB 4NDMA 1UENA 3NFNB 1X5GA 1AFVL 4KRNA 3CXDH 4KMTH 5BRZE 3B5GA 2VZOA 3Q6GL 2C4XA 3WHXB 5IOPA 2R1XB 4LLMA 5HVGB 4IRSC 5MEPB 2CKBA 3D48R 1ZKAA 1SHMA 4PJ7B 3UJTH 1CGYA 1QKZH 1FL3A 4G6FD 5GS0D 4QRRD 5KVDH 2AV7B 4HLZH 1HH6B 1KIQA 3IF1B 2AXJA 4OCRH 3OG4B 2BRQA 2XWJB 4OM1L 5L2KA 2O5ZL 3H42H 4WRLA 4F2MB 1U95B 2IPTH 3RUGF 1TETH 3U9PL 4P2OB 3MRRB 5F96H 1U41A 4K07A 3V6ZA 1SJHA 4Q2ZB 3GDBA 4R7NA 5C0BD 4N8VB 1XIWA 4LSDA 5GHWH 2FX8H 5F7UA 2V9TA 3UBXA 2K1MA 4ZFOA 1AXTL 3C60A 4C56B 4TUKL 1M1SA 3S35H 2H2SD 3FT2A 1SYVB 3QG6B 1KIPB 1N6VA 3LEYL 2Y5TB 2AV1A 1G7IB 3Q5YA 3SDDB 4KK5D 1LP9A 3IDJB 5GGRA 2H8PA 3OF6D 3MRPB 3OKKB 1DUYB 3GMLB 1ORSA 4AIZB 2CD0A 4FTVE 4NNPL 1U8KA 1NL0H 1QSVA 3DETD 3O3DA 3RDTB 4P2OD 1DN0A 5IW1B 3VFNB 1RHHA 3R1GH 5DHVH 3UBXI 3O8XC 5DO2C 1MCOH 4Y16A 5JHDA 2Y1VA 3KLSA 1AR1C 2EDYA 1QLEH 3UCRA 4C56D 5C6TH 4QYOB 1G7QB 4JREB 3GHBH 2AGJL 1MWAB 2R4RL 4GKZA 3SDDD 2GK0A 4JQVA 1BVLA 1W0VB 3FB8A 4A6YB 4EI6A 4JRYB 2P47B 1MVFA 4I18B 2YN3A 1FO0L 5ADPH 2J8UE 4N0FB 5FA3A 1YJDH 4MJIA 4P59H 3RDTD 4U7KA 1XF2A 5ISZA 1FVCB 2W9LA 4XNUL 4PB0L 4CVXB 5DLMH 5MP6L 5DGQA 5AG9A 5E1AA 4DZBB 1RMFL 4MXVF 4X6EB 2Z91A 4PLJC 5DT1L 1IQWH 1MFDH 3B9EA 3P4OB 4R0LC 3DUSB 4JPVL 3BESR 3IAGC 1HHHB 3P77B 2L7UA 4TPRL 4XI5C 3DX7A 4FHBD 1YC7A 4JRYD 4AEIH 3S4SB 4PJFF 4XWOD 4NQCB 5T1DH 1B90A 3OKDB 5HGDB 1FJ1A 5KSUA 5J9PB 4UDUA 2ATPA 3SJVA 4MX7B 3TBYA 3V4VH 4Z7UB 5TH2B 3LKOB 3IJSA 3QYCA 3EJJX 3S6CA 2JB6B 5L8JB 2B0SL 2BSSA 4NWTH 2EO1A 4GG8B 5J1TC 4JFXA 4JZJB 4QHLA 4PIRF 4YC2B 2X4QA 3ARXA 1HN1A 1LEGB 1PY9A 1YYLH 2IH1A 5LXGL 4PB9L 5ACMA 4GBXC 4LVOB 1CFTB 4P5KA 5MERB 2M2DA 5CP7B 4NQCD 4XCFL 1CDJA 4PJ9C 1F6AB 4QOKB 3IFNL 4R9HA 1XFPA 5IEHA 1A47A 1OM3H 4YFEA 1FSKC 2EEDA 2XPGA 4DUWA 3AAZB 2D7QA 5FM8A 3NPSC 3F65A 3U0WH 1KTLA 4NUJB 4WVRA 5D7JA 3IS0X 4CU8A 5HGHB 4LCCA 3CPLB 4QRPA 4WFED 3I84A 4PJCA 1D5XB 4P2QA 2I26N 5E56A 1PKOA 1RZFH 1QLFA 4Z6AT 2JCCE 2R23A 3GJFH 3FTGB 4MJIE 2WLYA 3IDIA 2F58H 5TF1H 1NDGA 3DVFA 4QOKD 4G9FE 1E28A 1HXYB 3OJ2C 1YNTA 4IOSD 4DOHE 4C83B 3P0VL 2MJWA 3P9LB 5FDWB 4OZGA 4HV8A 1IEBB 3D0VA 2OI9C 1WWWX 3S36X 4YO0A 1HH9B 5JIIA 1H0DB 3QUKA 3RWFB