1XF3A

Structure of ligand-free fab dna-1 in space group p65
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
213
Chain Sequence
b'ELQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHYGTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Light chain
publication title Evidence for Structural Plasticity of Heavy Chain Complementarity-determining Region 3 in Antibody-ssDNA Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 53
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf3A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf3A01
2PUQT 4I2XB 5HTSA 4QHKI 4NRXA 4K3GA 1A1NB 1BZ7A 5IWLC 1JMXA 1B90A 5IMKA 1NEZG 3KPOA 3SGDH 4TNWF 4XCYB 4D0BA 1AGEA 1L0YA 4JPIA 5DC9B 5IB2A 2AV1A 1Q9KA 4JGUA 4ENED 5C8JA 4NPYB 2UWEF 4JVUA 1ES0A 4RAVA 5I66A 3RWHA 4E5XB 2UV3A 2J4WH 3QJFB 5GGSY 3D25B 5B8CA 1YYMH 3SCMA 4KUCD 2NY6B 5C2UB 2NY1B 2ZUXA 1A7OL 2YD1A 4O51A 2D03L 5B39G 4MAYD 5HVHB 1PG7W 5J9PB 3ET9F 4RQQA 4MA3B 4F57H 5DT1H 1NC4D 4I3GA 1IEAB 5C71A 3QIWA 1CFVH 4HKJA 1NCCH 4AL8L 1NLBL 3ESUF 3OKMA 4WW1B 1CFTA 4MWFB 1ZGLM 4YK4C 5I6XB 3RWJA 4ELMB 3QHTC 1E28A 3GI9L 3RWDB 4XNMB 4FQ2H 4GUPB 5BRZB 5JO5A 3UTZB 5DJ0B 25C8H 1S5IH 4GQ9H 3HR5A 4PGBB 1G7QA 4OZGE 3MV8E 4S0TD 5DD0L 4X4YA 3I6KB 2BSRB 1DN0A 3O6FD 3PGCA 1ZT4A 2AI0H 3AU1A 3GNMH 1BD2D 1MWAL 4F8TA 1MCBA 2HJLB 3UZVB 3FQUB 3S7GA 3S36X 4JM2D 1U8IA 1KN2L 3MV9D 4J1UA 3WHE1 5C7XL 2FD6H 3CH1A 1TJIH 3VFVB 1LK3L 3BYYA 1QNZL 1J0ZA 5I1GL 1J5OH 4ZPVA 3B9DA 4FQ1L 4Z95H 3D3VE 5GISH 3MLVL 5FF6A 4LFHG 2WINB 5E2TH 3QFJD 4JN1H 5DZNA 4RAUB 5EOQL 1LWRA 4PRIA 4I77H 3VFUA 4F2MB 2RQ8A 5I8KH 3DVNA 2VSCA 1SY6A 4J3OC 4P9HC 2NYYC 3NIFF 3CC5B 1FL3B 3MRMA 1P69B 3FQWB 2HG5A 4PJDE 5EUOA 4M7KL 4N1CA 4NCC2 4YHKL 5E8NB 1MCPL 4GXUM 4PY8I 3VWJC 5CLTA 1HZHL 3QHFH 4K8RC 4G6JL 3PABA 3UDWA 4AQOA 4HUVA 1OAUH 4H5SB 1K6QH 1RURH 3FZUD 1SYVA 1J8HE 1PKQB 2CUIA 2Q3ZA 1UQSA 4I18A 5D2NC 5E8OA 4PR5B 2OL3B 4A6YA 4PRNB 3STZA 2BSTB 3LB6C 1C5DB 4WUUD 4PJ8C 5LBSL 4MQSB 4FFYH 1U93B 4XP9L 2X4QB 3WKMH 4FABL 5DD3L 3GUTA 2YMXH 4YE4L 4K23H 3BXNA 5DWUL 4ZFOB 2FZ3B 2YPKA 2VITA 1FCGA 2EO1A 4KTDH 2CK2A 4YHIA 5JW3L 2FJFA 4I0KA 4R0LA 2QSVA 1YEIL 4K9EC 4PYHA 4KMTL 4UT7L 4Z6AT 4YHYB 5C0DB 3OJMB 5ID1B 1KCSL 4ENEC 2H9GA 4M7LL 4WTXA 43CAB 3TPUB 1QTYT 2GT9A 4ODSL 4TUKL 2W0KA 5ACMA 2C7UB 3ULVE 2HWZH 3PL6D 3ZKNC 1IC5L 5B38G 5DD1L 5I2IB 3TIEB 3ORJA 1T2QL 3IRZA 1OGAD 3OXRB 3O9WB 3CAFA 1RPQA 2C9AA 4JKWA 2EYSA 7FABH 1C12A 1MQKH 2CLVB 4MAYC 1EGJH 2Y23A 2V6HA 2H8PB 1DEEB 2IAMD 1J1XH 1FZKA 4G7VH 2AW2A 3EOBA 3FB8A 3TT1H 5F7FA 1R5IB 3VMNA 4URTB 2VXSL 4OGZA 4R2GD 1G9ML 4JB9L 4N0YL 4JM4L 3MV7B 4M7LT 4NQVA 1O7VA 5T1DL 1U8QA 4RIRA 5JORA 4JRXA 4E42B 4TYUA 5FYJH 2AJZB 3HZKA 3JTTB 4NJ9L 1KJVB 1VESA 1AD9B 2ADGB 5HYQB 4HK0B 1IQWL 4L29A 4LQFH 3O6FC 1TZHB 4WU7A 3ZSSA 2ZNXA 2YBRB 1FFRA 1HCVA 5F9WB 1EFXD 4U1JA 1ZLVH 2JLLA 4GRLA 4MGXA 3ARGB 5JDSA 3VFSB 4CMHB 4LKCA 5IG7A 3WO4C 5JA8B 3VWKD 3BZ4B 2A1WL 1LO0L 5JOPE 4M6NL 4APQA 2XFXA 5DF0A 1V3MA 2PO6A 1Z9LA 4NQEB 3DTXB 1JNHB 4KVNL 3WNKA 2FX9L 3OKKB 4P57B 3O4LD 4M62L 1OP9A 3QO1A 1Y0LB 4M5ZL 1U8JA 3DURA 4FQQA 4K2UL 5GSRA 1BPVA 3OJ2C 4KAQL 3TJEH 5F6IB 1KG0A 1RSFA 4Z0XA 3GMQB 2OK0L 4D3CH 3MJ9A 4C59B 2FSEA 4MD0A 4Q6IB 2MHAA 2HYMA 1HILA 3VXSD 3O45B 3TO4A 5F7WC 2XWJA 4PJCA 3O0RL 3TIDA 1XGQA 2GIYA 4R6UA 2YPLB 4WV1A 4ZSOE 5L2KE 1ED3B 1JN6B 1I3RB 2YD2A 1T4KB 3C5SB 4CN6A 1IFHH 1CXKA 1HSAA 3RIAK 1WWCA 1D5XA 4KK5C 3OG6B 4LLUA 5GGUB 5BJTA 4JFDA 1IC4H 1QBAA 1R0AH 5DRZA 5C0EA 5FUOL 4QRPB 5E6IB 3GB7B 4ZFGH 1XH3A 5DUBB 1X7QA 2PW2B 4I0PA 1JL8A 4O4YH 1YC7A 4YXKL 4AMKH 1CWVA 4NN7B 4C83B 3MGTA 2XTJC 4PD4K 1G9EA 2X4NB 5C0AE 5C0JB 2YZ8A 2RCSL 2Q76A 1P7KB 4NKIL 3SE9L 2E8ZA 5HJ3B 4YZFE 3AB0B 5KSAC 2DL9A 4HGWB 2VLKE 4CVXA 4PJHA 1K5NB 3PL6C 5IQ7L 5EA0L 2MMXA 1OVZA 3IVKB 1CGWA 3D5OF 1C08A 4I9WE 4KGJA 1RUQH 1NBVL 4OM0H 4JZJA 4NHCH 4E0RA 3RZCB 4AT6B 1DLFH 2KQMA 2Q6WA 4ONHB 4XWOD 2R1YA 1KPRB 5IW1B 4DFIA 5FYKL 2VR9A 1UJ3A 3EAKA 5JW4R 2D4DA 2DMCA 5D2LA 2W60A 2VR4A 4NQCE 3D0VA 2B20A 1UM6L 4N1EA 3QNZA 1T7VA 4KH2A 4QT5A 3U7AA 1G7LB 3KPRA 4B5EA 5FO7B 2AJUL 4UI2A 1WT5A 4XPHH 4ORZC 4Y4KA 3ECBA 2X1XR 2XICA 1RI8A 1HYRC 1AO7D 3GMOA 5T5FH 3VXME 2W0FB 1WWAX 4HPOH 2Z93A 1X4XA 1YN6B 4HKXA 4X6CB 1IGML 4PP2B 4CU8A 4ZTOH 5KN5A 5FHAL 4FXGB 4JFEE 2H45A 4JPKH 5CJXC 4HS8H 4WUKL 4PJ9A 2O5ZL 5DI8A 2R39A 4Y5VA 4GS7B 3JV5A 1GL4B 3BDXA 3NPZB 3VGBA 3TN0D 3V6OC 1ZXQA 4Q58C 4D94A 3WHXB 3SQOL 1A6ZB 5LGHH 2X40A 1ZHKB 3IKCA 2P8MA 2H1PH 5TH2A 2P46B 1T1ZA 4U1SA 2EH7H 4MCYB 5DO2D 1V05A 4PJ7A 3IDNA 1CE6B 4TSCH 1CZ8L 4TTGA 5DD5L 3KDMA 1ODAA 2XQBL 2MCPL 3RY4A 5I1EL 3B5HA 2IMMA 5D7JC 2X70B 3MRCB 1RJZB 4LGRB 4LPTA 3QXWA 1CXHA 5INCA 3DO7A 3FJTA 5CJOL 4OJFH 3V8CA 4UV4L 4WIQA 4RISL 2F53D 3MRQA 1OTTC 1HH9A 2V7HA 1TMCB 3DV6B 4BKLB 4Y5YB 5AD0B 1DBMH 3RU8H 3FMGL 4V2BA 3OG4B 3FT4B 4LNRB 1UWEL 4PJXF 2HT2C 1QLEL 4XRCA 1TDQA 3BEVB 5EO0A 5J11B 5HYJA 2EDOA 5DEGA 3JVGC 5IWLA 1U92B 1NFDA 3WSQL 3ZTJH 3SDYL 1OAQH 1MCWM 1YNKL 4MXVE 3NIDF 1NMCB 3VFNB 5MERA 3K2MC 4NQUA 4PJ5B 43C9A 3PWUA 2D0FA 5K9OB 3LQAH 4LP4A 4JEGB 2DQEH 4XAKD 2EDQA 4P9ML 1KTRL 1LP9E 3V9FA 2VDOH 5L6YL 3BKCH 1BBDH 1T83A 3X3FL 5ISZB 3M8OH 4QRUA 3MLWL 3WJLA 3QXAB 1DVFD 1QSZA 2QSCH 4U1IB 5JHLH 5E4EB 3T1FB 4ZFFA 1EUTA 4Z9KB 1D5ZB 1IKFL 1X5AA 1O0VA 2MKLC 2X41A 3QQ4A 1KEGL 2IBZX 1D7FA 1EVUA 2HFTA 4XWOC 1QOKA 4BUGA 4BFBD 3LRSA 4HCRA 4LVOC 4DOHE 3MLXH 3WFBL 5J6HB 1S7SA 1MPAL 2BMKA 3MMEB 1ZT1A 2LAGB 1KGCE 2DTSA 3UYRL 1JYNA 4Z5RB 4N5ED 2EYTA 5JHDD 1IARB 4MNGB 5GS3A 3DJ9A 4MNQB 1A4JA 1KXVC 1GGBL 4KMQA 3L1OH 1F4HA 2ADFL 2R2BA 2ZG2A 1LO3H 5BMFL 4Z78A 4EUPA 4LHJB 1M7DB 4JO3H 3HFML 4DQOH 4KRPC 1WZLA 4HKZB 2NNAB 4ZUUA 4P48A 3VRJB 5BVJA 4LLVB 1TVHB 1FDLL 2XI9A 3TBVB 2WIIA 4N0UB 4U1NA 4MQ7A 4JY5L 2EDNA 5BXFA 2HAZA 3E3QE 5C08D 3TWCH 4AENB 4FFWC 4GBXD 4GAYB 5KSBA 3MXVH 2QSTA 4KJQD 1CGTA 4LLQB 4QOKD 4PP1D 1G0DA 2VXVL 5MP6H 1D5MA 4PY7B 4YFLF 1NCWH 4M43L 2OS7A 5T1KB 1MFBH 2DLHA 5I1IH 4A2LA 1NUDA 5DR5L 1JWMA 1HNFA 4IRZH 1P84J 3BKJH 4KTYA 4LMQE 5DQJB 3DMMD 5EBGA 5DO2C 2K3TA 4JRYE 3TH4T 1IAIH 3NACL 2Y7QB 3KYNA 3GK8L 4WO4D 3GJFK 3MUHL 3GSQA 3JUZA 4JE4B 1I7TA 4WVRA 4XNQB 2GKIA 2XZAL 4XHJC 3VWJA 3ARSA 8FABB 1O7SA 1BAFH 1KFAH 2DQJL 4M5YH 5DJCB 3KPMB 2HH0H 4XMLL 1SY6L 3EOAB 1JV5A 1I7RB 1X5JA 4GMTL 1RZ8B 3DSFL 1RFDL 4WEMB 5IBLD 5D2NA 4UTBL 5GS2H 1A64A 3B83A 4HXBH 5KS9E 4F58H 5D7IA 5F89B 4NNXB 5J1AA 5DZLA 2Q3AA 3LPGA 4OBSA 4PGCB 1E6OL 2B0SH 2ESVA 2H6PA 3I6GA 3WD5H 5L8KB 2R23B 1F4YL 4HUNB 1XF1A 1SBBA 2Y06L 4A6YL 2NR6C 5HGAA 5CAYB 4GG6F 1Q38A 2HKFL 3ZDYF 4LP5A 3HMWH 4NKMB 2FYYB 3FOLB 1NBYB 3LIZH 5FM5M 1JTPA 4Q9CA 5HXMA 1S9KC 3JTSB 3QQNA 4IMLA 4WWKB 1AR1D 5JW5B 1HNGA 4YUEL 1RZFL 1ETZA 4Z7NE 5AWNH 1OAZH 1X5ZA 4UDUA 1WCBB 1ND0A 2Z91A 2EIDA 1FHGA 4MAYA 1A7RH 3QHZL 5D71H 2O5XH 5DHVH 4LPXA 3NPSC 4V2CB 2IQAA 4R26H 1NC4A 4LPCA 1OOAA 1ADQH 1VHPA 1NDMB 4GSDL 4DK6A 5JR1L 4NHUB 5GS0D 3ELAT 4HBCH 4LARH 3QA3A 3X17A 4U6XB 3SPVA 1X6NA 1RJCA 4KZDH 4N5EC 5CZKA 2HVKA 5F3HB 4DWHA 5FKPA 2M1KA 2Z92B 1U95B 2VAAB 2XZQH 1VFBA 2RFXB 3BJ91 5JPNB 3QRGH 4O58H 1S7RA 1TZIB 3L5XL 1IAKB 3FCTB 4P4KD 4G6FB 2EDHA 3O6FA 4JREC 4N0CD 5D5MA 1R24A 1PSKL 2IAND 3VFWB 1BD2A 4OBRA 2Y5TA 4N8PA 1I9IL 1NC2B 1N4XL 3GMRB 4NRZA 2CRIA 3BGAA 3E1F1 1BFOB 2ZCKH 3MV9A 1H3XA 2ADJA 4J12A 5KSVB 4X6CF 4GMSL 3N1GC 1MFCL 4JZNA 2PNDA 5F1KC 1MOEA 2WMPA 1JHLH 4GBXC 1N3NA 4N68A 4NNYB 3V5HA 2V9TA 5TE4H 1AJ7H 4K7FB 3C60B 4PP1C 1ZWIB 3QIBD 1NQBA 2B1AH 4P2OD 3UTQB 2PYEE 4HC1A 4BFIA 1MRCL 4JDZB 3QFJA 1HHIA 1N8ZA 1ZSDB 4G80B 2VDNH 3K1KC 1MHHB 4L4TD 3OB0K 2VDKL 4KI1A 3CFEA 1HHHA 4PJIA 5TDNA 3HZMA 2W9DL 1PZ5A 4WO4C 4HH8A 2BJMH 5IB3B 2BVOA 2DQTH 5LAXB 5F1IA 1SJEA 1AHWB 3G5VA 4WGWB 1FNFA 1NGPH 4RAHA 3SQBA 4JG1H 4YHNB 4ONOA 3CSYA 4YWGH 3TVMD 3TBWB 1GYAA 4ZD3L 3FT2A 4J3UA 1NAKL 3F62A 2UYLB 5IBLC 3MA7A 3WIFB 5DURB 1A14L 3MJ9L 5FK9A 5AZ2L 1M71A 3FAWA 4Q2ZA 1WCQA 2OQJB 4WUUA 1WBXA 4QYOA 3L3HA 3K74B 2BXZA 3LRGA 3QUZB 5HHNA 3SE4A 2WIMA 1CXFA 4TULH 4KI5E 5CEYA 4Y16D 2BY2A 5F96H 3V79C 3OJDA 4M1DH 1BQHG 1NGYB 3EO0A 1NMAL 2JELL 3LKNA 1JZ7A 4CRPA 4OCYL 4XCEB 3PHOA 4KZEH 2FHBA 5F1SA 5DUPL 3H2WA 3NH7H 4POZC 1YEFH 3HE7D 5I76B 3NCYP 1F6LL 1IM9B 2I60H 3FB5A 1T5XA 5ANME 1DQTA 4OIBA 3GSOB 1BJ8A 4QNPE 3PL6A 4ZS6D 1R3IL 3NABL 1NBZA 4UIKH 4S1SH 1EERB 2E7CA 3VFMB 1OGAA 5FYLL 3IB4A 1I8KB 1IGTB 1QSVA 1Y18B 1WFNA 3RGVB 3WUWG 1MEXH 3EUUA 2IAMA 2FO4B 1CD8A 2BNUA 3QI9C 4KV5E 2BY1A 4NKOB 1IGFL 4MD5B 3HNTL 4KKNA 5J06A 1MHCA 3CVIL 4NO0D 3D85D 5GS0C 4JO4H 1LD9A 3M17B 3P4MB 1G7JB 1FGVH 4AIZA 2FBJH 3GBNH 2O93L 4LPWA 4HMEA 3GEWB 1PZUB 3PJSB 3MV01 4D9RE 3V6BR 3ZHDA 1ZLSH 2OTUA 4NUJA 4P4KC 3E2HC 3BIKB 1ZGLA 4WWID 3NGBB 4HK3N 1EFXA 5E94B 1H15A 2VC2L 3ARPA 5CJXA 3T0DA 4PGEB 2G75B 1DBJH 1FG2A 1G6VK 3U30B 3LPWA 2VZ3A 4V1DE 1YEJL 3ILQD 1QLRB 4Z7VE 5JA9A 2IFFH 1KTKE 3OX8A 4P2OC 3QIBC 3BN9C 4OZGF 1MWAB 3O4LA 1GZPB 1MSPA 2BC4B 2VDPL 5CP7A 3NA9H 4MD4A 1A1MA 1L7IL 5LKNA 3NCEB 2WK2A 2N56A 4LSUL 3P0VH 2RAMA 3IDYB 3O2WH 1UCTA 2CLRB 1FNGB 4OFDA 3U1SH 3V6ZA 5BQ7A 2E7BA 4X99B 4C54A 1FPTH 5JOFA 4L8BA 4I0CC 5HYIA 4TPRH 5HY9B 4ELKA 3MROA 3TEUA 1YECH 5GZND 2JB5L 3ARFD 4TRPL 1WGOA 3CMOL 1SEQH 3WS3B 4TUJA 4HIIB 1DE4B 4J6RH 4P59L 5DRXA 4QHMB 1U8LB 3SGJC 4H0GA 1QSFB 2NY3D 3OAZK 1KJMB 3C8HA 3ARBC 1S7XB 1NANH 2X1QA 1AXSB 4HWBA 3KWWA 1CICB 3JVGA 3EKCA 1IEBA 4HT1H 4XPTH 4PJDF 3ULVH 5EOCJ 4IBLT 3BP6B 3GMMB 1YMMB 1UYWH 3B5TA 4MNHA 2IBZY 4OFVA 2AEPH 1DN2A 3U4BH 1UACH 1DQDL 1A2YB 3ZTNL 1J10A 3C5ZB 5L88H 3STLB 1QP1A 4XC3H 4IOIA 1KCRL 5E2JA 4J3TA 2YD6A 2J8UB 1LEIA 1QA9A 3SDCB 1R3KA 1UM4L 3QQ9D 3FQNA 4Q6YA 4UDTA 3NFSL 4Q9RH 3RWCB 1QFPA 4U3CA 4QGTA 5HHQA 1A6AB 1E27B 3UTSE 1H3VA 3E6FA 2SEBB 5BZWB 4ZS6C 1W8NA 1T89C 3QDGB 1MI5D 1B0RA 1KN4L 1CF8H 3LS4H 1VGKB 2UY6A 5FXCH 2NY6D 3S37L 3C09C 1LHZA 4W6YB 2YC1B 2GJ6B 4IS6B 1QLFA 3REWA 1X4ZA 2P5EB 3G6JE 3V0AC 4P46B 1KBGH 4K94H 3GHEH 2VLJA 3OHXB 5DHYB 3B4NA 3E0GA 3NVQA 2AEQL 4HCRL 3TF7C 3RVXD 1A6PA 5AYUH 1B3JA 1AO7A 3BP4A 3LH2H 15C8L 1EZVX 3MCLL 1CLYH 4ODVH 3RTQC 5IV2A 3SKUD 1AI1H 2LTQC 2NX5B 5I1LA 3RPIA 4PRAB 3AS3A 4PG9A 1DBBH 3QEQB 3MNVA 4H88L 3B3IA 3F58L 1MCLA 4XP5L 2VLLA 1F3JA 4RZCB 3ILQC 4Y2DB 3TN0A 2AK1H 1KIPB 1N59A 1NDGA 2CO7B 3NFPB 3S34L 1BEYH 3WNPA 5I75B 2GAZB 2YRPA 5F21B 4OD3H 2FWOA 3RFZC 5LVEA 1TETL 2IGFL 4Q74A 1N2RB 4DCQA 1BIIA 3BWUC 3NZ8A 4PRDA 2DAVA 2NW2B 3AS0A 3JWDH 3OJVC 2CIKA 1SJVA 3FKUS 1KEMH 3WO3B 5E8PA 5T3XD 1UM5H 4UQ2B 5EBLB 3CX2A 5GZNC 3ARFC 3SDXF 1CDYA 3BRGC 1BFTA 1IGIH 2N7BA 5ACZB 2F53A 4K3EH 3GSXA 1I9JL 1F4XH 3P73A 2NXZB 4EN3C 2X4OB 5IP4A 2HLFD 4FQIL 1KCUH 3MOAL 5IT2H 1JE6A 4X8JB 4FP8H 3FTGB 2VQ1B 2ZKHH 4K8RL 5F7EL 3HUJA 1WV7T 1BQUA 3LMJH 4YJZL 1IAIM 4KHTL 1YEHH 4YBHA 2W9LA 5T33H 1XR8B 4NYLB 5KVFL 4YX2H 1PJ9A 5INDB 5GGRB 2V2WB 2V2XA 3W0WB 4OCRH 4YFDB 3NAAL 4KMLB 4W6WB 1XCQA 3BH9A 3S35L 1YEGH 2J12B 1S9YB 2DM4A 3T0WA 5C07E 5C0BE 3DBXB 3FFDB 5ALCL 4XBGB 1YPZE 5MEND 2MNUA 1E4JA 5JLZA 4K9EL 4MA8L 4O2CA 1XF2B 4BH8B 3O8XD 4PLNC 4XP6H 1KIRB 2WANA 4Y2OA 3MLZH 3FN0H 4UAOB 1F90L 3ZT7A 5CD3A 2Y36H 1WLHA 4HGKC 3KS0J 3KPNB 3B9VA 3REVA 2WLYA 3CNKA 3H0TB 3PWJB 3CDYA 2ICWI 3UROR 2Q8BL 1LO5A 5FFLA 4L3CB 3N1FC 4MJ6B 3WXVH 1OTUC 2C3VB 4EI5B 4X5WB 4R3SB 4YDKL 4YZFF 5B3NA 2QLVB 5HHXH 1J8KA 5IMOA 2XNAA 1CDIA 4Z7WE 5CWSB 2APWA 5JHDA 1JPTH 5EFIB 4W4OC 3AGVA 2FX8L 4WHTB 4QCIB 1BX2B 4M7ZC 3TV3H 1IM3B 3RPKA 1N0XH 3RVXC 1FYTB 3VG0L 1VGEL 4RDQG 1QFWH 4TVPH 4LSDA 3LEVH 4U6HA 5ERWA 1QVOB 5AAWA 3O3BB 1EMTL 3QCUL 2A77L 4ZO9A 4XVJL 1I3VA 3D69A 4WCYH 4YDLB 4C57C 4FHBD 1FAIL 4PLJC 4K7PX 4CMMB 2XXCB 2EYRA 3UBXI 1CDHA 2V5TA 4NM4H 5C08A 3RWEA 3ARGD 5DLML 3U0WL 4DZBB 4WDIA 4GBXA 2NTFB 1F13A 4QOKA 1MREL 2IADB 4UQ3B 1RJYB 5T1LB 4FTVE 4TNVK 3KXFD 1U91A 1BOYA 5EUKA 2XA8H 1C1EL 5KANI 2BDNL 5ALBL 4HMCA 5LGJB 4RGND 2HTLD 2C1OB 4WO4A 4HC1L 4LASH 4JJ5A 1MCQA 2P5WD 5MEOB 4YDVA 4FQLH 1B0GA 4KKAD 3K4DA 1LO2H 1DUYB 1F02I 1UXSA 3PHQA 3IDMA 3CUPA 3LDBC 5CEZE 3BGMB 1B88A 3TP4A 4AEIL 4Q9QH 4DKDC 1RVFH 4EI6A 1JWSB 4DZ8A 1DDHB 3T8XB 4YGVA 1FN4A 4C56D 3V5DB 3RWIA 4DAGL 4NO2A 2AAVA 5DC4B 5EN2B 3RX5A 3MA9L 4JANA 3QFDA 3FO9A 2HRLA 3IF1B 1KLUA 3QUXD 3SEPA 3R8QA 2R0ZL 4D9LL 1YA5A 3CXHJ 5ADOL 1MJJA 1K4DA 3BWAB 2ZCLL 1Y6KR 2VDML 4Y1AD 1K4CB 3VFPA 1KXTB 4K3JH 5GJSL 2RIKA 1QRND 2UWEA 4G8GD 4NWUL 2IPKA 3BQUB 5TF1H 1I7ZB 1BBJB 1GPOH 3EYVA 1PKOA 5IEKB 1Z3GL 2A6DB 1U8NB 5EDXA 1BOGA 1EA9C 3T0EE 3T04D 2HTKD 3RVWC 3O8XC 4NRXB 1OW0C 2H3NA 1BZ7B 4MXVF 3O2VH 4PJEE 5IMKB 5E08H 5CGYD 4IJ3B 3MX0A 3ULUE 1D6EA 1JP5A 1LP9F 2VWEC 3QI9A 1AGEB 4D0BB 1JZ2A 4JPIB 4XTRC 5IB2B 1AE6L 2AV1B 4G8EA 3RZCD 1TIUA 1MJUH 3QUYD 1Q9KB 3IETA 1VPOH 3AXLA 5C8JB 1KENL 1G6RH 4RAVB 1ES0B 3EJJX 5I66B 3RWHB 2LU7A 2LU3A 2NPLX 2ZCHH 2AK4B 4MS8D 3CU1A 4OIIL 3SJVD 1OAKH 2NY4B 3IT8D 5F9OL 1KB5B 2VDQL 3STBA 3LQAC 3RVUD 5B8CB 4LDOB 3SCMB 4LRNH 3QDME 4K71C 2ZP0T 3MXWH 4O51B 1U3HC 4P4KA 3WYRA 1GHFL 3QIUC 1CFSA 4KTEL 1ZHBA 2AJVL 4MVBD 3C2AL 3IU4H 4RQQB 1J11A 1HKLL 4Z0BH 3MQIA 4W81A 2ICWJ 3QXDA 3HNSL 2IQ9L 3QIWB 4YDIH 3NBNA 4HKJB 4KPHL 2PKDA 1FVCA 2VLRD 3OKMB 1QFWI 1CFTB 2CXGA 4M8QA 2V2TA 4P2OA 3QIBA 4Q97A 1QKZL 3RWJB 2A0LD 4P2RE 5E70A 3UP1A 1E28B 3IFLH 3EYSL 3GBLA 4L4TA 5JO5B 2WV3A 1F42A 4KQ3H 1T03L 3HR5B 1G7QB 1XF5A 2BNQD 2PCPA 3IDXL 3WN5A 4FNLH 1DN0B 3PGCB 1ZT4B 3QCTL 4RGNC 3AU1B 2Q8AL 3FFCE 3T08A 1I3GH 1FVEA 4BJLA 2VDLH 1FLRH 3UJIL 3LY6A 3UC0H 4J1UB 4IIQB 3CH1B 2QSQA 4PGJA 3LQZA 5J1SC 5KTEL 2CDFA 2C3GA 4ZPVB 3WIHA 4JN2A 3TVMA 3DETD 3Q6GH 5FF6B 5EZIH 3QUMA 3I3DA 1JHKH 4O02L 3MLYL 1BREA 3SGJA 5DUML 1ZOXA 4S10A 4PJGA 5IMMA 1EEZA 4XXCC 4MLSA 2VL5A 1FH5L 2FX7L 3HMXH 4PRIB 4YO0A 1XF4A 3MRJB 4JR9L 3VFUB 1EXUA 4BQ9A 1MFAH 1CE1H 3DVNB 3QULA 2FDBP 2CRMA 1CLOH 3MRMB 1F6FB 3N1MC 3QUXC 2HG5B 3MJ7A 5EUOB 2JIXB 2OR8A 4HWBL 2V17H 2FLRT 4L3EE 1U8PA 5MEQA 3FRUA 5KS9F 3PABB 5I1KL 3TYFA 2GUOA 4HUVB 4PJ5D 2B2XH 4PREB 1RUPL 4NZUL 1SYVB 4TQEL 3D9AL 4XPFL 1WEJH 5JQ6H 5I8OH 4FQXD 1UQSB 4AG4H 1QBBA 5E8OB 3EDFA 4A6YB 3I02A 4ZS7L 1WZ1L 3STZB 3RVVC 1DLHA 3HLAB 2HTKC 5E0QA 5ISZD 5T3ZD 4ZAKD 5F7YC 3FO1B 5E24E 1EZVY 3JV4A 2QQKH 2C4FU 5CGYC 2YPKB 2HFFA 2VITB 2CK0L 4YHIB 1XGUA 2FJFB 4OGXH 5DA4A 1A6UL 2VXQL 4LEXH 5TE7L 4OT1H 3KLAB 4O00A 5K9JH 3QUYC 4NO0A 5EB9A 1A7QH 1NLDL 3D85A 5TQ0H 3VCLA 5HHME 5KVDH 2GT9B 4WEUD 1TQCC 2LAAA 5GGQH 5JW4M 4NKDB 4Z7NF 1LDSA 4P2QB 1Q0XH 3OV6A 4LCIL 3NFNA 4ZTPH 3RVUC 1QHPA 4YIQA 4MNQD 5DJZA 1J1PL 4G7YL 4PG2C 3T2PA 1PD6A 4H0IA 2EYSB 2XXMB 5L0QC 4RMRA 1L6ZA 4DUXA 3RTQA 2EE6A 1GIGH 4DW2L 3AVEA 4MA1C 4LLWA 1FZKB 3ZL4L 1UZ6E 3EOBB 3FB8B 5E9DE 5HYSG 3RIAF 3SN6N 2APXA 1ZHNA 1JGLH 1BF2A 3A6BL 3INUL 6FABH 4NQVB 4F7EA 2ZPKL 4WTZG 1U8QB 4LMQI 5JORB 4QO1A 1VFMA 4JRXB 3KLDA 5E99L 1RU9H 3DX7A 3L3JA 2EDFA 4IRSD 3MRLA 1UZ8A 1XIWC 1GC1H 2KL6A 3U0PA 1J12A 1N64H 2DKUA 4CU7A 5TFSH 3SDAD 4L29B 4WU7B 1ZAGA 5DJXA 4J23A 1HHKA 2YA0A 4U1JB 3WFCH 3D3VD 4GRLB 3RI5K 4LKCB 4PRPE 3LEYH 3QDHA 2XKNA 5IG7B 3ARFA 5GGTA 4APQB 1U2HA 1MRDL 2EIEA 2AABL 2XFXB 4PBVC 2PO6B 1U8HA 1UWGH 4ETYA 4EOWL 4EN3A 4H8WH 4OB5H 3GBML 2W0LA 1JFQH 5DMIH 3QO1B 2D7PA 4XHQA 1JYVA 1U8JB 3DURB 4FQQB 4W4NA 5CKAA 5GSRB 3TFKD 4OCMC 2VXTH 2DQDH 1RZGA 1TJHH 1XEDA 4R90H 3CDFA 1KG0B 4Z0XB 1BQLL 3AUVA 1M4KA 1J8HD 1R5WA 2BHUA 3E6HA 3VFRA 3QEHA 4UU9A 3L3DA 2FSEB 3LV3A 4JCLA 4MD0B 1CXEA 2MHAB 1HILB 2ZZUT 4OFIA 3EYUH 3TO4B 5H2BA 3GZKA 2XWJB 4PJCB 3TIDB 4W68A 3U0TA 5I18H 5I15L 4WV1B 1JGVH 4FQXC 4KRNA 4WGVB 4R8WL 3VXTA 1HSAB 3MBXH 4LLUB 1D5XB 1W0VA 3LKRB 4U3HA 5GS1C 5BJTB 4JFDB 1LEKA 1AKJD 2FATL 4XB8A 5DRZB 1MI5A 5C0EB 1RZKC 4JG0H 4Q0XL 1CL7H 2PR4L 1ZLUH 1XH3B 4LCUA 1X7QB 4GKNA 4I0PB 4LSPL 1LVEA 3LKPB 3PWPE 1M6OA 3DI2B 2G60H 1NEZA 1EV2E 5L7XL 1S9XB 3MGTB 3V0WH 2BVEA 1JI1A 2HLAA 3KPSE 4EQ3A 4JY4B 3PGFL 4KROB 5A2FA 5EBMA 2YKLL 2Q76B 4QLRA 4XC1H 2ED8A 4QNPF 3GGWA 1X4YA 3IAGC 5B3JE 4W4OA 4AJ0A 1GSMA 3MRHB 1S7QA 1INQA 5DK2A 4PJHB 4CVXB 3WFEH 1ACYL 5DMKA 5LQBL 4FXKA 4M9OA 1J0IA 1C08B 2GJZA 5JPMA 5HDLA 4KV5F 1W72B 2QADB 4JZJB 5C0GA 1IBGL 4ZQKA 4E0RB 3QO0A 1Q9LA 2Q6WB 5B39A 2R1YB 1UJ3B 4YQXH 2XG4A 2VXUL 4CADA 3IDGA 5D2LB 2PXYC 2W60B 2YWZA 4M4RA 4NQDE 3D0VB 3QNZB 3B9EA 4LCWE 1CTOA 1LEGA 4QT5B 2NY7H 2O5YL 1A9BA 4HG4K 3OZ9L 3KR3H 5I19H 4U4BA 1UB5A 3HS0A 4Y4KB 3ECBB 5AYQA 4BFGA 4IRSC 4DGIL 4LU5H 4XPBL 1QFWM 1SJXA 3T1WA 4UTAH 5CD5C 3GMOB 4LPVA 3SDAC 5JOPD 3V6OE 2Z93B 3I3EA 1A6WL 4HKXB 2G5BA 1QPPA 1RV6X 2W9EL 2FIKA 1INDH 5C2BL 5KN5B 4Z7VF 3QH3B 3PG2A 1M7IA 3B9AA 4JO1H 5F8RC 4PJ9B 2A9NH 4Y5VB 1OY3B 5GXBB 4ZUWA 3KPQA 5L9DH 2CDGA 1J9CT 3VFGH 1T3FA 1PY9A 5SV3A 3HI5L 3M45A 1IZJA 1O5DT 4NN5C 1QBLH 1UVQA 4N5UA 3AFLA 3MLSH 3H3PH 3X13A 3IKCB 2P8MB 2ICCA 1LMKA 5TH2B 5IF0A 3WV0A 1T1ZB 4NNPL 4QF1A 4U1SB 4G6AD 4HWEH 2MSPA 3BDBA 4WW2F 3EJZD 3JXAA 4PJ7B 2NY2B 3IDNB 4OSUL 3RNKA 3TFKC 4M1CC 1JNNL 2R9HD 3KDMB 5HHOA 2BNRA 4R4BB 4AM0A 3ME0A 5CCKH 4LIQL 2I26N 1H8SA 4KK6C 4R7DA 4S2SB 2BK8A 1T6VN 2Q1EA 5L2KD 2AJXL 3ILPA 3OPZH 5INCB 3FB6B 3DO7B 4OCSL 3F8UB 2P8PA 3QPQC 1HH9B 3KLSA 3WXWH 2V7HB 3VI4E 4X98A 1BWWA 1I1FA 5MENA 32C2B 3CFDA 1G1YA 3OQ3B 4XRCB 2R1WA 5EO0B 5GQBA 3O8XA 1DFBL 4YBLB 1OW0A 5HYJB 5DEGB 1IT9H 1NFDB 4LPUA 4OD1H 3S3SA 1A4KB 5CUSH 2O61A 4N9OB 1V7ML 2GEEA 4GW5A 1TQBC 1CT8A 3GSNA 2X42A 1EHXA 3W9DA 1U36A 1IEHA 5MERB 4X7SL 43C9B 3PWUB 4OZFA 1KB9J 1S7VA 3DXAE 2VZVA 4OZ4B 3ULVC 2VLKD 4G43A 4L3AA 4HH9A 5DGQA 3OBAA 4LHQB 1G0XA 4EBQH 4HF5L 4X6DE 4I9WD 4KKBD 1CVSC 3WLWD 1CL7I 1DQML 3ARRA 4O5LL 1CG9A 2WBJD 2YD5A 4QRUB 3EYOA 3OKDA 5A2KH 5IHBA 4ZFFB 5DVMA 5GS0L 2VDRL 3MZTA 1BIHA 1VKXA 2DQUH 3QQ4B 3G6JF 3QIUA 1F58H 1U6AH 3BSZH 2FEDD 4P99A 2APFA 2R4RL 4NQCD 1RIUH 3LRSB 2DIAA 1S7SB 4O2EA 2BMKB 3VXRD 1ZT1B 3TT3H 3VDAA 1V3KA 3BEWA 4PBXA 2EYTB 2FGWL 2NXYC 5I16A 1NCDL 2CRZA 2DWEA 4YK4B 1RIHH 2J4WL 5CZVH 2APVA 2ILLA 1A4JB 4D8PA 3GKWL 1NGQH 3WNOA 4MHHG 4E41E 1XZ0A 3BPNB 3KXFA 4K94C 2R2BB 4QXGH 3O6LH 4JFED 4Z78B 3Q0HA 4KJPD 1FIEA 4RBPK 3GHBL 5T5NF 4GRMA 4HAGA 4NQTA 1B6UA 4LCYA 4R97C 4F57L 5BVJB 2WWKO 3HA0A 1W0YT 2WIIB 2XY1A 2VE6A 4U1NB 5H94A 4MQ7B 5BXFB 4Y4HD 5D7SH 1UWXK 5EU3A 3W2DH 4HJ0D 1Z2KA 4HUMB 2ADIA 3VRLE 1JWUA 4PV9A 4LLYA 2EZ0C 1N0LA 1D5MB 4X6EA 4FQ2L 1K85A 1JWMB 25C8L 4XCCH 5F6HI 1S5IL 4GQ9L 4C56A 1MNUL 1QSFD 4G6AC 3ZE2E 5LXGL 1JCKA 3OB0H 3WIHL 3T0XA 1OARL 3KYNB 3QUML 5D7LD 2R9HC 1MCSA 1ITCA 3QUXA 3BW9A 4GG6A 3GSQB 1I7TB 4LHUD 1QFUL 3K2UL 5I8EA 3VWJB 1BJ1H 1J5OL 4Y1AA 5CZXD 3KS0H 4F3FA 4OF8A 1U3YA 1QRNA 4KU1A 2YPVH 1UEYA 1JV5B 3RY6C 5E2TL 2I9TA 1A6TB 3JWDC 4X6FA 5D2NB 5F70A 2Z9TA 2Z0BA 2VISA 2JCCB 4I77L 4GO6B 5D7IB 3PNWA 5CEXB 5DS8A 4RMUA 5J1AB 4JFFE 2ESVB 2H6PB 5I0DA 3MOBL 2CJUL 4M7JL 5FA4A 1XGTA 3SO3C 4B7LA 5EO1A 2I07A 1ZA6A 4XMKH 1PX3A 5EC1B 2B4CH 4ZODA 1JPGA 5HGAB 2FGZA 3SKMA 4C4KO 5FDWA 1CIUA 5J12C 1PG7H 2BCKB 1YPZF 2MFNA 3QUYA 1OAUL 1I1AD 1RURL 2DS4A 4XNUH 2P5ED 3PP3K 2DYPD 1Q94A 3SY0A 5IKCA 3SJVA 1XGRA 2WBJC 4UB0H 4MQXD 5CJQH 4IMLB 4M1GH 3VW3H 1CCZA 2CXKA 3OKNA 4N8VA 4PG2A 3LHPL 1ETZB 3TZVD 1J0JA 3BMVA 4UDUB 2RGSA 2AK4E 1ND0B 2Z91B 4K23L 4WI3A 1R3LA 4MAYB 2D7TH 4X5XA 5E1AA 4KTDL 1KGCD 3P77A 2IQAB 1NC4B 5FGCE 2DF3A 4Z7WF 5I1HH 4FZ8H 1UADC 3DV4A 5FB8A 1KT2A 2VLRA 3QA3B 3QEQD 1ERNA 1DBKH 1BVKA 1FL6A 2HVKB 3HE6C 1QQDA 5FKPB 1WQVT 2MQ3A 5CEZH 2HWZL 1ADQA 1F8TH 3FQTA 3DYOA 4HV8A 1VFBB 4FMKA 2XA3A 1LE9A 2P43B 1NJ9A 4KJPC 3U4AA 3EJYD 1S7RB 4LAJH 3BH8A 2VZOA 2BNQA 1MQKL 3RHWK 3O6FB 5D5MB 1R24B 3IDIA 1BD2B 2Y5TB 4GLRH 1EK3A 4NRZB 4JM2B 3HG1E 4ONFH 3TT1L 2IPUK 3WO4B 3MV9B 2ADJB 2AGJH 2F74A 1A0QH 4Y4HC 4L8DA 1H3WM 3EO9H 2KPNA 4HJ0C 3V5HB 1N3NB 2BOCB 1FAKT 3KJ6H 3PQYE 3ZHKA 4JQVC 5HI5C 3OB8A 1A3RL 1KELH 2AJYH 1WVZA 4OUOA 4BFIB 3QFJB 1HHIB 1N8ZB 5FGRA 4MSWA 4CU6A 1CGXA 5GGTL 5LCVH 2Z31C 3CFEB 4PUBH 4HUKB 1HHHB 4PJIB 4LQFL 5IVXE 5TDNB 3UZEA 3HZMB 3WE6A 4G9FE 1PZ5B 5I9QB 5DVNA 2FR4A 4NSKA 2BVOB 2QQLL 5IM7A 5F1IB 1P2CA 4JGMA 1SJEB 4ZNEE 4GOSA 3ULUH 2BRRH 4XX1G 1BF8A 5T1MB 3CSYB 4ETQA 1QSEE 5KW9L 5EORL 2R0KL 2DQCH 2OTWA 1MIML 4BSVA 4FQXA 4JHWH 1E4KC 3MA7B 5A16A 1EBPA 5C0RH 5FK9B 4QRSA 2E9JA 1OQOA 3V8OA 1M71B 4Q2ZB 3OAZH 5F6HJ 4PB0H 1KV3A 4WUUB 4ZOAA 1YY8A 1WBXB 1ZA3A 5C92A 5CSBA 3L3HB 1QUNA 3K3QA 1TLKA 4L9LC 5HHNB 4Z7QE 3TJEL 1BFSA 1MCWW 3DI3B 4GXVH 3N06B 4Z7OE 1DL7H 2ZWLT 4OCWH 4KXZI 5CEYB 5EU6E 4LQ1A 1F97A 3OJDB 3K1DA 3EO0B 3LKNB 4JDVA 4YHLH 4IM8A 1CDJA 3PHOB 3OR6A 1I1AC 2X4RA 5ICXA 3DECA 1IGCH 5E5MA 1T5XB 2EXWD 3QUKA 1IFHL 2R0WL 4PJEF 1WICA 1A6VL 5EO9A 5GRJH 4J3WA 4WNQA 3DOSA 1IC4L 1NFIA 3PL6B 1R0AL 4GJTB 2HRPL 4Y8AA 3ULUF 1ORQA 4OZHE 1OGAB 4ZDHA 5J3HC 1I1CA 5F7LB 2H41A 3WCYA 5FECA 5HI3D 4ZFGL 1T22A 4P2QE 5TGBA 4EDWH 4IOFC 3VGFA 2DQHH 1AFVH 5DEZA 2IAMB 4AMKL 2BNUB 2Y6SC 2OMNA 1FSKC 3S5LA 4LKXA 4XP4L 1MHCB 1UB6A 2OJZH 4LSTH 3WFDH 4R2GB 1LD9B 3HC4H 4LSSH 3QCVL 3PDOA 4GAFB 4RGOH 4OZGA 3MV8A 4AIZB 3VXQA 1T20A 4HLJA 3UXFA 4IRSA 1JHTA 5DC0A 2FRGP 4MJIE 1RUQL 3EJYC 2OTUB 4NUJB 3SDAA 1NMBH 5E2VH 1ZGLB 2MPAH 1EFXB 4JFYA 1H15B 1W2KT 3D3VA 4LNVA 3TH3T 3QSKB 3ARYA 2PYED 4FQJL 3WEXA 3HB3D 4N9GA 2OJEA 5C09E 3S97C 3Q6FA 5IW6A 1WBZA 5D93B 3PF2A 3OX8B 4M00A 3MBED 3O4LB 4GLRI 5T3XL 5CP7B 4MD4B 5KSBF 2J5LC 1A1MB 5DDHB 2VH5H 1NAMB 4PJDA 5T5FL 4WY7H 4HPOL 3AMKA 3U46A 3V6ZB 4ERSH 5BQ7B 4ZTOL 4L8BB 3VXOA 3H3BC 4JPKL 1N5AA 4HS8L 3NTCL 3ZE0F 1ROWA 1J8HA 2CLZB 4ELKB 1D9KD 3MROB 4HQQL 1CVRA 3VXSB 1DTUA 2B1HL 4UIMA 3QEGH 4TUJB 3CZFB 5LJYH 5D70H 2F9BT 5IROC 5LGHL 5DRXB 4F80A 5I71B 4G8IB 4B7IA 4GRWE 3TNNA 3IAQA 4BZYA 3UCRA 4ODBD 2DM7A 2BVTA 3KWWB 1AKJA 4PJCE 1IEBB 4GW1A 4TSCL 3EOTH 5IESL 3C9NA 1YNTA 1EDQA 4MNHB 1A7OH 5D7IF 3BE1L 4F7PA 4K3DH 3F7RA 4IOIB 4Y19E 1OGTB 3BPLC 2V5MA 1LEIB 1QA9B 5JIKA 1FFNB 5I74C 3FQNB 3DRQA 4UDTB 4OLZH 1DBML 1UFUA 3DYMA 5HHQB 3HCVA 1QFHA 2EXWC 1NCAH 2D2OA 3GSNL 3BKML 3V4VL 3OF6A 3E6FB 5EWIH 3GI9H 3ES6A 2NY1C 3T3ME 1W8OA 1OB1A 3CFJA 5CBEA 5K9KA 3SCMD 3WMSA 5IR1A 1EUUA 4S1RL 2ICWA 1QLFB 3REWB 3O41A 3P9WB 3LQAL 3BIAX 1FNAA 4KKCD 2VNCA 4U05A 3QAZC 4JVWA 1HDMA 1RULL 4HS3B 3UPRA 2VDOL 3BKCL 5C0FA 3AMLA 5BCAA 4XT1C 1ZVSA 3M8OL 5I6XC 4NIKB 4N0FA 2QSCL 2V9QA 5JHLL 3EW3B 5F3BA 1QR1A 4OZIE 3WFZA 4OF6A 5EOQH 4RNRA 1C5CL 4RMQA 2EO9A 1AO7B 3BP4B 4XI5D 3HN3A 1UZ6F 2AJSL 4MCZA 4V1DD 5IV2B 5K9QI 5I1LB 3RPIB 4PG9B 3K80A 2A9MH 3IS0X 2W91A 4GFTB 3B3IB 4XNYH 4M7KH 1TFHA 1MCPH 2VLLB 3MRNA 3DWTA 3HB3C 1HZHH 3TN0B 1HH6A 1EO7A 2P44B 4UUJA 1NDGB 1G0YR 3ARED 5ADPL 3MBEC 1BMGA 4X80L 2DQFA 2E6JA 1LO3L 4ZO7A 5FYJE 4JO3L 5IVZA 2FWOB 2H2SD 5DSCA 4DCQB 1BIIB 5LBSH 2FLBT 3NZ8B 4PRDB 2XRAL 1CYGA 4FABH 5DD3H 1X5YA 2A6IA 2CIKB 2IH3A 4YE4H 5E8PB 1FZMB 4ZSOA 4ZNCD 5L2KA 2YA2A 5JW3H 4WU5A 2Y07H 1GC1C 1YEIH 3MLUH 3T2QA 2WUBH 5EZOH 2F53B 4OM1L 3GSXB 2YEZA 5GGSA 2E8YA 3RY6A 3P73B 1NCWL 1KCSH 5HDBE 1MFBL 3MSPA 1FJ1A 4LVNB 5IJKC 2GSIA 3ZHLA 4KI5C 3BKJL 4HUWA 1KJ2H 1QYGH 4OV6F 2R8SL 3HUJB 3IXAA 4ODXA 2P49B 1Z6JT 1IC5H 4XPAH 5I1AA 3V7AE 1S5HA 5C0AA 2R0LL 1GOHA 4OLWH 4H8WC 2P7TA 2N4IA 5HD8C 3IGAB 3MNWA 1KFAL 3S6CA 2V2XB 3ARXA 3UTSD 1U9KA 2HH0L 3ARTA 1XCQB 3BH9B 1MJ8H 1KJ3H 4TNVF 2VLKA 4NFBA 1HYSC 5JZ7D 2VYRE 2JJTC 4TTDD 1I8IA 4JB9H 4N0YH 4JM4H 4XWGL 1OSPL 5T1DH 3WNNA 2WBJA 3O3EA 1GZQA 4O2CB 1DVFB 2APTA 3GIVA 2DTML 3HAEB 5A40E 1ZEAL 2B0SL 1OP5H 1H9VA 1CLCA 3UAJC 4NJ9H 3RWFA 3WD5L 5DJAA 3RGHA 3O9WC 4JJHA 1E4WH 1U42A 5CD3B 4D0CA 4NQCA 3REVB 3NPSB 1V7NH 1LO5B 1G7HA 2HN7A 3HMWL 4KKCC 3WUWA 5B3JF 4XVUD 1D5BA 3C8KA 1LO0H 5IMOB 2XNAB 2FEEI 3ZMRA 4MMXC 5JHDB 3CIQA 1T1XA 3MRIB 3NMEA 4JFZL 4P0DA 1VFAA 5KZCD 3AM8C 4JFEA 1OAZL 5ERWB 4U6HB 3VD4A 2A73B 2ZUQC 3VG9C 1A7RL 1UKTA 4L9DA 1LNUA 3D69B 3L5WA 3BFOA 3GSUA 1ADQL 2EYRB 4Y7MA 1VA9A 2R69H 4Y4HA 5C08B 4LARL 3RWEB 4WDIB 4GBXB 2ZNWA 4BSWA 1MCDA 4KZDL 4JQVA 4QOKB 1V5JA 3NZHH 4X7CC 3QB7C 3O0RH 2XZQL 3AREC 4IMKC 3V5KA 1R6VA 1U91B 3L7EA 3TGXA 5EUKB 3QDAA 1AGCA 4WW2C 1I8LA 2H2SC 2Z31A 3I9GH 3D39E 1FNEA 2BFVH 4WO4B 1YN7A 5FUOH 2COQA 4U1KB 4YDVB 2ZCKL 4LHUA 3KYOA 1Z5LA 4YXKH 1YQ2A 4R96B 3I75B 1UXSB 3PHQB 5TE4L 3IDMB 4HHAA 1AJ7L 1WTGT 1FIGL 2F8XC 4ACPA 2RCSH 4LCCC 4EI6B 1E4KA 5GSVA 2OTPA 4YGVB 4ZUSA 1T21A 2VDNL 3QYCA 4LAQL 1FN4B 4JKMA 4M3JA 4YHOL 4OQTH 3RWIB 4P5MB 4NO2B 4L9LA 5EA0H 3VDBA 3O3AA 4JANB 3QFDB 5BS0E 3W9EA 1KLUB 5E6IC 1B6DA 2BJML 2HJFA 5C07D 1LP9A 2JCCE 4H26A 5C0BD 4RWYH 1SQ2N 1MJJB 1K4DB 1NGPL 3VI4F 5FYKH 4JG1L 2DDQH 2YD7A 3VFPB 2IEPA 4YWGL 5E2WH 1I1AA 2I9LB 2Y5EA 2UWEB 4XCFH 1RZKL 2IPKB 5JZ7C 2DYPA 2HT3C 4U0QB 1WFUA 2UVFA 3EYVB 2HA1A 4TTDC 2XN9E 3IDUA 4XXDA 1UM6H 5FYLD 1BOGB 3DGGA 1KPUA 5DJDA 2AJUH 3S4SB 2H3NB 2FCBA 3TNMA 1F45A 4TULL 1EJOL 4ODTL 4EDXA 2ZG1A 4YH6A 2F5AH 3PV7A 4M1DL 3HI1A 1JIBA 5IBTH 1D6EB 1IGMH 2GHWB 3QI9B 3RIFK 1REIA 4HEPG 4X6DF 4KZEL 4G8EB 5ID0A 4WHCA 1PQZA 3IETB 3AXLB 5IEHA 1YEFL 2OYPA 4XVUC 3C87A 3Q48A 3ULSA 1RQ5A 2I60L 1RUAH 4NDMA 3EHBD 2PTTB 5IOPA 4YR6A 3BT2L 4DVRL 2V5SA 1CLZH 1HQ4B 1X44A 1CR9L 4UIKL 4S1SL 4U1GC 4JKLA 3RAJH 3KPRD 1G6RA 2DOCA 4P4KB 3E2HB 4KHXH 5SX4H 1CZ8H 1ZHBB 2XQBH 5TDPA 5I1EH 1K3IA 4QWWD 3RKDD 5EC2A 3VGDA 1CGUA 4FTVD 4GKOA 1ZGLP 4JO4L 1P1ZA 4W6XB 3T3PE 2FBJL 2DKSA 2V5YA 4M8QB 5DXWA 1BGXL 2XKSA 2V2TB 4P2OB 3QIBB 4JRYA 4K7PH 4RISH 2YUWA 3VXNB 3P4NA 2VUYA 3QWOB 5IGXH 4L4TB 2P24A 1WAAE 3V6FA 1UWEH 2L7JA 1ZTXH 1XF5B 2RHEA 2PCPB 3MRBA 5GIRA 3WN5B 1TJGH 2EDBA 4ZXBD 4XPGH 3SDYH 1FNLA 1FVEB 2PETA 3VRLF 5JUEH 1YNKH 2F54E 4PPTA 3TC9A 2KZWA 5KS9A 3LQZB 2HT4C 4K3HA 2CDFB 2IFFL 3UTOA 2R2EA 4JN2B 3TVMB 1DQJA 4PJAE 4DKEH 3QUMB 3I2CL 1HWHB 3I85A 3MC0A 4JPVL 1QEWA 5IMMB 1QHOA 4PJGB 1EEZB 3OKLA 2VL5B 4O9HL 3X3FH 2OZ4H 5HGBA 4YO0B 1MH5A 1XF4B 3MLWH 3O2WL 4BZ2H 1EXUB 2IC2A 4HZLA 3U1SL 3WDJA 2B7DT 3QULB 3D0LA 4CNIA 1IKFH 1FPTL 2W0PA 3BAEH 4OQ1A 1GGCH 5D9SA 4TPRL 3JWNC 4PV8A 3ZYOA 4Y16B 3UEZA 3MJ7B 4ZUVA 1YECL 4KRMB 4ISVA 1NMCC 3MGOA 1KB5H 1U8PB 5MEQB 3FRUB 4C55A 4PTTA 3DVFA 4L8SA 5E00A 3TYFB 2GUOB 3WFBH 4ALAL 1C7TA 3T0ED 1MPAH 1F00I 2X4UA 3UYRH 1L0XA 1FQ9C 5KBNC 5E95B 3I02B 1NCBL 2BY0A 2BZDA 1NPUA 1GGBH 3ULUD 3RI5F 1DLHB 5HPMA 4HT1L 3ULVL 3DARA 5A3ID 2DQGH 1UYWL 3DX8A 3TBSA 4TOYL 2AEPL 2R56L 1G7IB 3P4OA 3U4BL 1F2XK 1UACL 3JV4B 3C09B 2ZUVA 3G5ZA 5IQ9A 2HFFB 2Q86A 3Q5YA 4X9FA 1XGUB 5KAQG 3KVQA 3MRKA 3ROLB 3H7LA 4NO0B 2YOCA 4JY5H 2VOTA 3D85B 3WUZA 3VCLB 5DRNA 2V7NA 3RUGE 3QDMD 3BDYH 3EHBC 2B4CC 3B2UD 3H9HA 3BESR 3P30L 5MEPA 4X4ME 3NFNB 4FQCL 5IHLB 1N5YL 4M43H 3T0VA 4YIQB 5DJZB 5DR5H 2WZPD 1CF8L 1A22B 3VA2C 5DRWA 3U7WH 4Q7DA 2LTQB 3GK8H 1HIML 2HJLA 4LLWB 1I8MA 1KBGL 4QWWC 3RKDC 4MMZC 2PYEA 3GHEL 2J7LA 4P2RD 2XZAH 1FV1A 2DQJH 3TCLA 1ZHNB 5E8EA 5DFWH 5GGVL 5JIHA 4J8RA 1TNNA 3MBEA 2WINA 4BQCA 3DSFH 4UBDD 1RFDH 3QNXA 4FG6C 1TVBA 5BOZG 1DANU 3FFCD 3D2UD 3L3JB 1KIUA 3G5XB 2YUZA 2AEWA 3MRLB 1UZ8B 3C6LD 1VACA 1QBMH 3EBAA 3U0PB 5GRVL 3LH2L 1T0MB 2B5IB 3OMZA 3O4LE 5DJXB 3PDGA 1OAYL 1HHKB 1KYOJ 4ZXBC 4QXTA 1DBBL 1F4YH 4KVCL 4A6YH 2XKNB 2NYYD 1D9KA 5FGSA 3ARFB 2IPTH 5ETUA 2AK1L 3CU7A 2HKFH 4X7DC 1FVDA 1U8HB 5D7KE 1WFOA 3F65A 1CTNA 4HIXH 3SKJL 1BEYL 1YJDH 2QHRH 3HRZA 2NY3B 2YK1H 3QG7H 1I1YA 5IVXF 1B2WH 3UO1H 1ZHLA 1H3GA 3VXSE 1OCWL 2DJ4A 3RZWA 5FCSH 1RZJH 3LB6D 3UTTE 4L3ED 4YFEA 5E7FA 4PJ8D 4FA8A 5HVGB 2DQIH 3NCBB 4HIJA 1KEML 2ESVD 1UM5L 4KKLC 3E6HB 3QHZH 3VFRB 3QEHB 1EEYA 4UU9B 3L3DB 3LV3B 1G7MA 1IJ9A 4Y4FD 5ANMA 1P6FA 4H1LG 5C0DA 4K3EL 5ID1A 5H2BB 4M6OL 1F4XL 3BZEA 3T0EC 2K7QA 1MCCA 5JR1H 3U0TB 3BZDA 1H3PH 2JJTA 2Y9RT 4LK4A 4ZOEA 4EZMA 1KCUL 5IT2L 4FP8L 3LMJL 1W0VB 3ULUC 4Z7OF 1LEKB 1YEHL 1YYLH 5A3IC 4MAUL 3TIEA 2LVCA 1MI5B 5T33L 2R2HA 3ZKND 2GI7A 3L5XH 1B4JL 3IRPX 1MCKA 4YX2L 4LCUB 4NBYB 5HHMD 3EFDH 4GKNB 4AYFA 1CGSH 2H8PA 3TBTA 3V0VA 1N4XH 2B8OT 2HLAB 1A47A 5EH1A 4POYA 3MCG1 1Q72H 5FUZH 5EBMB 4NN6C 4GKZA 4OGAC 5SWSE 2VUOA 3GGWB 1T0NA 3CFBA 4OZHF 3PUCA 4X9IA 1S7QB 3B2UC 4M7ZB 4E42A 1INQB 5ENWA 5DK2B 5KG9A 1MRCH 3AM8A 5DMKB 4AEHL 2AJZA 5EBWA 1LGVA 1NGXA 4FXKB 4QHLA 4XP6L 2GJZB 2MJWA 5JPMB 2VDKH 3FN0L 4YHPA 5E9DD 3F7VA 1T7YA 2Y36L 4ZQKB 4V1DA 2RJMA 4Z7VA 3QO0B 1Q9LB 1G9NL 1R3JB 5B39B 3EIFA 4LSQL 5C9JA 4JFQA 2WQ8A 3TBYB 4NKQB 4CADB 3GIZL 3IDGB 2X10A 4UMGA 2JF1A 2CO6B 1JNHA 1I7UA 5FUCC 3RA7H 3C60C 1LEGB 3AREA 4IMKA 1A9BB 1N0XL 3PWVA 4UBDC 1N26A 3HS0B 2D9CA 5IVOA 1QFWL 4WW2A 4GRWH 3C6LC 2XQYG 3HZVA 4PRPD 4QTIL 3ZDZF 2CUHA 2XYCA 3G04A 4RBPH 3MACH 4WCYL 2G5BB 4ONGH 2GTZB 5IFHL 2DB8A 2FIKB 4HXAH 3TO2A 5I73B 2VZ1A 2DJUA 3SE3C 4NM4L 1AGFA 1M7IB 2Z35A 4U0RB 3O6KH 3RRQA 4ZUWB 3KPQB 1T3FB 4OCYH 1RK0A 1OAXL 1UWXH 1RMFL 2BVPB 5C0CE 4LCCA 1TITA 5FGBC 1UVQB 3X13B 3C08L 4PJXB 3RJQB 5IF0B 1MCFA 3QPXH 5TJWK 4MXWL 1R3IH 3RNKB 4RSVA 4PJGF 4KK5D 5HHOB 2BNRB 5E6IA 4AM0B 3GB7A 3QQ3A 5EU5A 2PW2A 1D5IL 2GQHA 3WDHA 5L2JA 2FJGA 3SOBH 3ILPB 5F93C 3UTSA 4Y4FC 4GRWF 4Q9QL 1IGFH 3HNTH 1OHQA 4CBPA 2P8PB 1IE5A 3CVIH 5IFJA 1OF2A 2XTJD 3A67L 1HE7A 3H9SE 3OWEA 4WFGD 5DGRA 1W72H 3IS1X 1MRFH 4X98B 2AS5M 1JGUH 1I1FB 5MENB 5HJ3A 3GJFA 2QTEA 1T0PB 3CFDB 3QRFM 3E8UL 2R1WB 1K5NA 3O8XB 3SGDI 1UKQA 3HNVH 3PWPD 5KSAD 3G6JA 3ESVF 3KPSD 2O61B 1MIEH 1MCOH 4QHKJ 4F8QA 1FRGL 4GW5B 2CGRH 5KSUA 3L9RA 4AT6A 1CT8B 3GSNB 1P84K 3RGVC 3EFFA 3L95A 1CU4H 3LSOA 3EGSA 4MB5A 1DBAH 1IKNC 4YXLL 4Z8FL 4OZFB 5FO8A 1S7VB 1AC0A 2NZ9C 4G43B 4JQXA 2FHFA 4CJ0A 1U0QA 3OGCA 2JE8A 4S1DC 1YEJH 3OKOA 4S0SD 3PP3H 3HPJA 3T3MF 1FBIH 4PGDA 2WWMC 3QT2A 3EYOB 2C1PA 1BLNA 3OKDB 3FONA 3HR6A 3ZKSD 3O2VL 4JAMA 4XMPH 3K7UA 4LSUH 5E08L 1VKXB 5C6WH 1MELA 3O2DH 4H20L 2YS4A 2X4TA 4PP2A 4NQDD 1M05A 1Y6NR 4LCWD 1DQQA 4S11A 3G6AA 4QRRE 4O2EB 5FCUL 1G6RL 4JQIH 3U30C 5BV7B 2DD8H 3BEWB 4YBQC 2ZCHL 4OZIF 5HYSA 5I16B 3TESA 2DWEB 4OAWA 5AAMA 3FAXA 4D8PB 1RUKL 2ARWA 1XZ0B 3KXFB 3GO1L 5FOBA 4LRNL 1IAOA 3I50L 3MXWL 4CVZA 4HJGB 2VLME 3IDYC 4UILL 4MLIA 4GRMB 4RGNB 3IXTA 1UENA 3EDDA 4P5TD 2MQCA 4LCYB 4Z0BL 2P5WB 5F8QC 2VE6B 2XWBA 1IGYA 1DQDH 4KK8C 5H94B 3BIBX 4M6ML 4PJFE 1EHNA 3G5YA 5D7JD 4X4XA 5D6DC 2DLFH 5EU3B 3MJGX 2ADIB 5DFTA 1KTDB 3WNMA 1JWUB 4PV9B 3FN3A 2R4SL 4OF5A 2Z8SA 3DUUA 4BKLA 5EZLA 2NTSP 2E7MA 4X6EB 1OTTD 1Q9OA 4LNRA 5CINH 4KQ3L 4C56B 1FFPA 4HWUA 5E8DH 1Q8MA 3BEVA 4FNLL 2JB6A 2FH6A 5HDQH 1YQVH 2HT2D 2D0GA 5FIEA 1I3GL 4H1LH 4YC2B 4PRHE 3QUXB 5C07A 3BW9B 1OTSC 5C0BA 4GG6B 1FLRL 3UC0L 1M1SA 1YPZA 3C5ZC 5HDBF 4UINH 2IH1B 4Y1AB 2N7AA 1OM3L 4F3FB 3SKOA 1QRNB 4G8GB 4IHOA 3VFOA 5EZIL 4PY8J 4JFOA 2I9TB 4X6FB 3RHWF 4TN9A 4JPWL 4HZAA 2CPCA 2VISB 2CKBA 5D72L 3PNWB 4CDGC 5DS8B 2AEQH 3OSKA 1MFAL 4JDTH 2OLDA 1YUHA 2WWKT 5FA4B 1CIDA 1WF5A 1XGTB 3L3OA 3DXAD 5EO1B 5DEFA 1NCUA 2I07B 1ZA6B 5B4MD 15C8H 3MCLH 1JPGB 3T0BA 4Z7WA 2V17L 5IUSA 5FDWB 5CKGA 4P46C 3QUYB 5J6HA 5ITBL 3UTPD 4H88H 2B2XL 2IG2L 3F58H 4XP5H 1P4IH 1Q94B 3SY0B 5I8OL 2ZUTA 3M07A 4XAWH 1TQCB 4J2XA 3LVEA 2VLJD 5IKCB 5TDOA 2YD9A 3SJVB 1XGRB 3DYPA 2BXYA 4EIZC 3OKNB 4N8VB 1X5XA 5L0QB 1GVIA 2IGFH 4PBWD 5E1AB 2I5YL 4OGXL 4KRPD 5F7UA 4LEXL 5JMRA 3P77B 4OT1L 4FTVA 3UZQA 1JMZA 3VXPA 3DV4B 2VLRB 3B9KD 3WBDA 2BVYA 1T66D 1KPVA 2IANE 4HLZG 3U9PH 4JFPA 5GGQL 4Y8DC 3W82A 1BVKB 1FL6B 1QQDB 4FFWD 1WWBX 4QHNA 5I17A 4HV8B 3FQTB 1LE9B 2VL4A 2XPGA 3BH8B 2BNQB 4TVPE 3N9GH 4C4KT 1GIGL 3IDIB 3Q3GA 3QZWA 3BUYA 4XP1H 4P5TC 5IJVA 1XFPA 4ZXBA 1JTTA 4G9DA 4JZOA 1DP0A 5KVFH 12E8H 1N6VA 2F74B 1AXTH 4L8DB 3NIFE 4U3XA 1BP3B 4XHJD 3HHRB 3FT3A 3S35H 5KVMC 4EXPX 2DLEA 5ALCH 5K93A 4U7MA 1RU9L 3WS6C 1I85C 2Z8WC 3TYGL 4XNZC 1N64L 4MA8H 5TFSL 3V4PL 3BYTA 1P9MA 4XCNA 1GXEA 1HK6A 4KJWC 1WUNT 4PGCA 3WE6B 1VEPA 4G6KH 3WFCL 4OLVL 4Z7UE 3U2SA 4MDJA 3LEYL 1PG7X 1F90H 4LEOA 4NSKB 1ZLUK 5IM7B 2GJJA 4HWZB 3PP4L 2QQNH 1CN4A 1VSCA 5DJ6A 2A6JA 2NR6D 4D9QE 2H32A 2R29L 4YDKH 3RL1B 4ETQB 3T0EA 3S36L 4LBEA 1V8HA 2EDTA 2OTWB 3ALPA 3VH8A 2KKQA 4FQXB 2P47B 4PJEA 5A16B 5KJRH 5DMIL 4QRSB 2ZUUA 2FX8H 1FYHB 1YY8B 1ZA3B 2DQDL 1TJHL 3VG0H 4ZAKB 2K1MA 3DIFA 3ZE1E 4R90L 1WCBA 1Z9SA 2AKRA 1EMTH 3QCUH 2A77H 3THML 5F97E 4UAOC 5B4MC 3JSSA 5DQDL 2UZYB 3V52L 3EYUL 1FAIH 5HYFA 3R0MA 2MKWA 2HFEB 3GDBA 3OR6B 3VXUE 4MYWB 2X4RB 5ICXB 5I18L 1EO8L 1JGVL 3U7YL 4X7FC 5DLMH 5E5MB 3U0WH 3QDJE 3QDMA 5F3HA 1AXIB 3F6LA 3QUKB 2X9WA 3MBXL 1T5WA 5EO9B 1FO0H 1NFIB 5SWZE 4J4PC 4X6BA 1ORQB 1INEH 4G5ZL 1C1EH 4I8DA 1CL7L 1T22B 4J7RA 2BDNH 5ALBH 4U33A 3VFWA 3ZSTA 4YDLC 1NC2A 1T1WB 1ZKAA 3V0WL 4HC1H 3P9MB 3S5LB 4MZ3A 1MCHA 4P2RA 3L6FA 1Z9OA 3KPLB 1UB6B 4PJBE 3B9KC 1WWWX 1T66C 3PDOB 3PIQB 5H37G 1EIBA 1UCBH 4OZGB 3H7BA 2D4FA 3VXQB 1T20B 2J1KA 2VERN 3WFEL 5E5RB 3KPTA 3FFCA 3D2UA 4G80A 4IRSB 4M48L 3B6SA 1JHTB 4JGJA 5F9AC 3C6LA 5DD6A 2CIIA 2RBLA 3HG1D 4NFDA 5D1ZD 3SDAB 1IC7H 4DAGH 3U36B 3WLBA 3CGTA 3GJEA 1SVZA 4JFYB 3B2VL 3KJ4C 2VQTA 3D3VB 2ITCA 4YQXL 3SE3A 3T3PF 8CGTA 1JNLL 5IB3A 3OKEB 5DQ9A 4D9LH 4ODHH 3H9YA 3WEXB 3LS5H 4DTGH 4N9GB 1D3CA 5F7DA 4HPYL 2OJEB 2VDMH 5IW6B 3Q6FB 4M8VA 5GJSH 1WAAF 2UUDH 1WBZB 1T04A 3RX8A 4UT6L 3KR3L 3NOIA 3L3IA 4G9FD 5I19L 4LU5L 4R4NC 3GSVA 2WLZA 4F37K 4PJDB 3R06A 1FLTX 1UA6L 1SM3L 3VD3A 4L3EA 3U46B 4PJ8A 4ZYKB 5FM5O 4UZGA 4ZOBA 3VXOB 3WFHB 1QSED 1C5BL 1YY9D 1N5AB 1J8HB 2A9NL 4PJAF 3UMTA 3KHQA 4Y4FA 3VFGL 4I2XE 5LWYL 1BZ9A 4UIMB 4TVSa 1AE6H 3C5JB 1GOGA 5CILL 5I76A 4FFZH 1KENH 3MLSL 1IM9A 4POZD 1VENA 3HAEG 1KSRA 4U6YA 5EU6D 1ITBB 4LF3A 1MVUB 1AKJB 2VDQH 4GW1B 3AY4C 4MJ4A 1U8KA 3P2TA 3VFMA 3BHBA 3C9NB 4DGYL 2NY5L 5CCKL 3FQXA 1L7TH 4Y0GA 1J0KA 1TQBB 4MXQD 3IJHA 3LKSA 4F7PB 3IFOB 3OPZL 3JWOH 2AJVH 3SO5A 3C2AH 2E27H 3BOVA 2CQVA 3F7YA 3HNSH 5KVGL 2IQ9H 3QI9D 5HGHA 3DRQB 4KPHH 4UV7H 2HFGL 5IB1A 1G7JA 4XVTH 1T7ZA 4F7MB 4FZEL 5C3TA 3N85H 1FORL 1QKZH 3LD8C 4KDWA 2NY4C 3VGAB 5FEBA 1IT9L 4ZFZA 4S1QH 1HWGB 3CVHH 3EYSH 3ES6B 2EIZA 3JV0A 4OD1L 2DBLL 5CUSL 1T03H 1OB1B 3CFJB 5CBEB 5K9KB 5E9DA 1SEBA 1KIQA 5CLWA 2VN7A 3QCTH 5IR1B 4JHZA 2ICWB 2Q8AH 3VJ6A 4HLZH 4DVBA 1Q9WA 5SWQB 2W65B 3O41B 4QY8A 3RUGF 3W39A 4ELME 1MAJA 4I3RL 5BRZE 1HDMB 4LLDA 6CGTA 1NAMH 3UPRB 5CIPH 1OP3H 5GRUH 4BQ8A 5C0FB 2VB5A 4F7TA 5KTEH 1YZZA 3ARDD 1HEZA 1ZVSB 4NZTH 4N0FB 3MLYH 2E7HA 5CMAA 2EH8L 3BN9D 4QXWA 1QR1B 1TTUA 4PRPA 2DQUL 4RNRB 4LOUD 5D1ZC 1LE5A 4MQTB 1TPXB 5C09D 1RIUL 3G6DH 1U2CA 3UBXB 1S9WB 3SDXB 5HY9A 1U3JA 2XZCH 4IIQC 5D6DA 5B21A 3MRNB 3TT3L 1H8NA 4HWBH 3WS3A 4ZMAT 3OAYH 1HH6B 4UUJB 3OR7A 1RIHL 3L3KA 4X5LA 4CL7A 3B43A 5D1XD 5CZVL 4NZUH 1NGQL 1TZGH 2VAJA 3K0WA 4TQEH 3SGEH 4AY0A 4XPFH 2XKUA 1IAII 2DQFB 3O6LL 1TTGA 5AEAA 1I75A 4KQ4H 1C16A 5IVZB 3L5JA 1WZ1H 3ARBD 4Z18A 4UNUA 2X44D 1RZ7L 4WI4A 3EYQC 2A6IB 4PJXE 1PKQE 2IH3B 4B0MM 1YY9C 4GH7B 4ZSOB 3C5ZA 4PS4H 5L2KB 2KZ1B 1A6UH 4WU5B 5FHBH 3W2DL 3FO2A 3ZKMD 1ZANH 1HI6A 3NIDE 2YEZB 5GGSB 1NLDH 5AG9A 4MA7L 2J8OA 1FJ1B 4XCCL 4UOW0 5ESVA 4XVSH 3FB7A 2VKXA 1J88A 1QD0A 3S4SG 4HUWB 4P3DA 3AC0A 3IXAB 5JW4Q 4NC1C 4ODXB 4OLYL 3PWPA 5KSAA 4RMVA 1J1PH 4G7YH 4Y19D 3KPSA 3SO3B 1YJDC 1XMWA 3Q5OA 3OAUL 2E9IA 3QEUA 2P7TB 4MXQC 4XNXL 2CKBL 4YXHL 4DW2H 1KJ2A 5J12B 1FZOA 5AZEH 3GM8A 2YPVL 4QHUB 3ZL4H 1RZJC 2VLKB 2AQ3A 5GRXG 5HBBA 2BP3A 1I8IB 3MUZ1 3V4UL 5FA3B 4N90E 3BO8A 3A6BH 3TA3D 2WBJB 3O3EB 3N1QC 3ZKQD 5A2IH 3CK0L 3MNZA 3GIVB 3O6ML 5E99H 5C70A 5E7BA 3U6RA 2CH8A 3RWFB 5KVEL 5DJAB 1J1OL 5J1TC 4XMKL 4A2MA 1A3QA 2AXGA 3DSNA 3R0NA 4D0CB 4NQCB 3MV7E 5IB4A 4NQDA 5H37H 2VZTA 3CXDL 3MPCA 1NEUA 3FL7A 3RTQD 1G7HB 4LCWA 2HN7B 4L1DA 4WFFE 1I9RH 4ODUB 2EKSB 3WUWB 2G5RA 3VXRB 1D5BB 3C8KB 4RZCA 4WFEE 1S3KH 1MRDH 2WP3O 1Q1JH 2AABH 2LU4A 3ARDC 1T1XB 3ALXA 3CXHK 3V6OA 5D1QD 3NFPA 4M1GL 1T7XA 4DKFH 3HC3L 1VFAB 3GBMH 2GAZA 4JFEB 1CDBA 4DUVA 5FV1L 1S7UA 3X14A 3I84A 4LOUC 2RB8A 4NQEE 7CGTA 5I8CA 1LNUB 4P5TA 1QZ1A 3GSUB 5I1HL 2QL1A 1A7PH 1BQLH 4F15B 4HX1A 5D7JA 4Y4HB 3CFIC 1A1OA 4APQC 4BSWB 5FYJD 1DBKL 1HHGA 2PO6C 1K2DA 2P5WE 5D1XC 5CEZL 5J4MA 3T77A 3V5KB 1I85A 1RJLA 1VFOA 3L7EB 5HHVH 4EN3D 1AGCB 3RIFF 4R8WH 2Z31B 2FATH 1FNEB 5D7LB 1X5HA 2NY0D 1YN7B 1WBYA 3Q1SH 5A2JH 2YPLE 4ONFL 3S98A 4LHUB 3KYOB 1A0QL 4L4VD 1Z5LB 3P9LA 2AV7A 3HAEH 3KJ6L 3ZKMC 5L7XH 3TO4C 1RD6A 3MRGA 1KELL 2AJYL 3PGFH 5ITFA 1MHPL 5FYJU 4QRPE 5GSVB 1FNSH 2NW3A 4XBGA 3MLTA 4ZUSB 1T21B 2X09A 1MAML 2OX5A 4G8GE 3HKFA 2XWTA 2X1OA 1DQLH 5TQ2H 3ARZA 3TH2T 1EHLL 3O3AB 1GRWA 3DXAA 3W9EB 4HUUA 3MV11 2HJFB 1LP9B 1OLZA 4H26B 1IBGH 3KPNA 4X6DA 4M93C 3ROOA 3BKYH 3ULUL 4OQTA 3IFNL 1F5WA 4R3SA 1I1AB 1XCTA 1EBAA 2DYPB 1OTUD 1GAFH 5C0RL 1CBVH 3WJJC 2UY7A 4XXDB 3TA3C 4AH2B 3ULVF 3BN3B 3UPCA 3G08B 4AK1A 1WIOA 4XBEH 2O5YH 1R5VA 3DPBA 5D8JH 2P48B 1KPUB 1YEEL 3OZ9H 4RFNB 3TNMB 1UG9A 4DOHB 4XPBH 3TZVB 3GI8H 2P1YA 4EDXB 4CVUA 3G9AB 4OCWL 2J88H 2QADC 4JZJC 1A6WH 3HI1B 5MHSD 3MODH 2W9EH 1DSFH 3W11C 5C2BH 4CMMA 4BYHA 5ID0B 3GSRA 1SJHA 1PQZB 4NUGH 4CN1A 1IGCL 4E41A 4PLJD 2VKWA 3B9KA 5IEHB 3ULSB 3KNBA 4NQSA 2PF6A 1RUMH 4GKSA 5IOPB 4N8CL 4X6CE 5D1QC 4ZO6A 3DHMA 2YR3A 1MJ7L 1WISA 5IIEA 4TUOA 4Y5XC 3AAZA 1F11A 4NNPH 1G6RB 4DEPC 2CUMA 2WAHA 5SV4A 4OSUH 2G2RA 4JKPL 1AFVL 2LABA 1TCRA 3P0GB 1N7ML 3L5HA 4OLUL 4LIQH 5MEOA 3O4OC 4LSTL 2OJZL 4LLMB 3WFDL 1ZLWK 4L5FL 3BP7A 3TJHC 4LSSL 1P1ZB 2AJXH 1BQSA 4RGOL 4RFOH 4OCSH 1LDPH 4R4FH 5LG1A 3D39D 3ARUA 2J6EA 3P4NB 3T8XA 4P9HL 3PWLA 2J5LB 1CK0H 2BRQA 2IFGA 2P24B 3V6FB 4LFHD 1NMBL 3MRBB 5E2VL 5GIRB 1DFBH 2NY2C 5EN2A 4PJFF 4UOW1 2MPAL 2NY0C 1A9EA 5TE6H 3UJTL 1P7QA 4RRPG 5HHOD 2BNRD 2ARJA 3P11L 5FDYA 5KS9B 4HJJH 4KUZH 2JJWA 4KK9C 1KUMA 4X7SH 1K4CA 2EIBA 3PE9A 4QXUL 2MQ0A 2R2EB 1DQJB 1NANI 4HEME 3UJJH 1J05A 4I13B 4JFFA 4JHAH 4HF5H 5GZOC 1QEWB 5BS0D 3OL2A 3OKLB 1U8NA 4O5LH 5HGBB 4WY7L 1MH5B 4PJ5E 3QXVA 2Q87A 3HTLX 3AY4A 4YBLC 4HZLB 1ORSA 4PB9L 4HIHA 3D18A 4M3KB 4ERSL 3D0LB 1DUZA 2DN7A 4CNIB 5GS0H 2VDRH 3RVWD 3MUGA 4ZPTA 5D9SB 4PV8B 1SYSA 2OBGA 4ZUVB 4ISVB 2R4RH 2XN9D 1C8PA 2OZ4A 5ISZE 2P4AB 5T3ZE 2A2QT 3MGOB 3QEGL 3BPLB 5D70L 4YHML 1ULVA 3N0PB 4PTTB 5E00B 4L8SB 5C0NC 1GCFA 1L9MA 4XTRD 5I74B 3VE0A 4MDIA 1XGYL 1X5FA 2QBWA 2X4UB 4BSJA 5MI0B 5J89A 2AK4A 2FGWH 1T83C 1NCDH 1E6JL 1BM3L 3NN8A 3WJLC 3SE8L 1KB5A 3GKWH 3KYAA 1NSNL 5HPMB 3EOTL 2GFBA 3DX8B 3TBSB 4FMFA 3GHBH 3P4OB 4WJ5B 3NA4A 2OM5A 1OSZA 3G5ZB 5IQ9B 5KOVC 2Q86B 1U3HD 4MNGE 4K3DL 4MNQE 3QNYA 3QIUD 5ILTH 4MZ2A 3MRKB 3QAZB 3SKNB 1K8IA 1J86A 2EXYC 4OLZL 3RP1A 5DRNB 2V7NB 4U7SA 2QKIA 3K8MA 3UPAA 4CW1A 4J3VA 5AG8A 1NCAL 3I6LE 4YEFA 3H9HB 4GAGH 5EWIL 5MEPB 4FQPA 3BPNC 5EZJA 4N0UE 4B53A 2UZIH 3HG1A 2FEEL 2XIDA 1MNUH 2UZXB 5D1ZA 5DRWB 5LXGH 5M95B 3WIHH 1OARH 3R4DA 3QUMH 3PQYA 3CLEL 1I8MB 2IALB 2ZG3A 4PLKC 5CGMA 2PYEB 4IIQA 1QFUH 3K2UH 1S7TA 4NJAL 1A3LL 1FV1B 3TCLB 2X4SA 5E8EB 2X7LA 2KH2B 4J8RB 1HOCA 2P42B 5IVXA 2CRYA 3MBEB 4RGMC 4G9FA 5JXAL 1HSBA 3QNXB 3GSWA 1TVBB 1VACB 1XR9B 3MRJA 4NWTH 2F54D 1JZ5A 4ZNEA 3ZZ1A 2EDWA 3MOBH 2CJUH 4M7JH 1QSEA 4QXTB 1YEKL 2A9ML 1QG3A 4JCMA 4XNYL 1G84A 1D9KB 2JIXA 2PYFA 1QO3B 5ETUB 3H42H 1IAMA 4ZG1A 2EKJA 5DYOB 2GK2A 1FVDB 4PREA 1S9VB 3HRZB 1I1YB 1UEMA 1ZHLB 4P23D 1MCEA 2L4OA 5GJTH 2PN5A 2NCMA 3MTRA 5EU6A 3NCJH 4U7KA 1MCIA 1LO4H 3HLAA 4Z7UF 2WM0A 1CXLA 1J0HA 3RVVD 1OP5K 1XGPA 3LHPH 3FO1A 4HIJB 1HQRA 3O3UN 4KY1H 3BRFA 3U79A 4OZFG 1EEYB 2Y07L 5GS2D 1G7MB 3MLUL 3ZTJG 3KPOB 4H25A 35C8L 3KLAA 2WUBL 5ANMB 5EZOL 3CCHA 4WEBL 4P4RA 3BZEB 5H8DA 3KPPA 4OZHA 4FOMA 3BZFA 4NKDA 3ZE1F 4P2QA 1KJ2L 1T2XA 1QYGL 2ZUWA 4HFUH 4PLOB 4XPAL 3MOQA 2I25N 2P8LA 3FHQA 2R2HB 2G9HA 2W38A 3U9UA 3J8F7 4OLWL 3TPKA 4CVWA 4BZ1H 2FL5A 1MFDH 5A43C 3QG6A 3TBTB 3MFFA 5C3LD 1MJ8L 3V0VB 1KJ3L 4M61A 2DRUA 4YLQT 4GKZB 1N6UA 4MJIA 5CP3H 1T0NB 4BQBA 5DVOA 3ARDA 3VMPA 3CFBB 1HXMA 1A3RH 4JO2L 4X0KA 5ENWB 5KG9B 5EBWB 1NGXB 3MREA 4QHLB 4TSBH 3T2NL 5GGTH 1BZQK 2ZUQB 4YHPB 3VG9B 1E4WL 3F7VB 4M03A 1XIWD 4V1DB 5FUCE 4Z7VB 1MF2H 2X05A 4PJBF 4X4YB 1GGIH 5C09A 4U6VH 1V7NL 5C9JB 4JFQB 4OF0A 4JM2C 2AQ1A 2QQLH 3K8LA 3NCFB 5I30H 4P2YA 4NP4H 1U8IB 4MJ2A 2AJ3A 1I7UB 5D1XA 5KW9H 1AQDA 5EORH 1WTLA 2R0KH 3AREB 3SDXE 1MIMH 3PWVB 4HAFA 3WKNA 1KB9K 3EZ8A 2OR9L 4WW2B 2ERJC 2BVQA 3HZVB 3ARBA 2FHCA 3LZFH 3G04B 2A6KA 1A7NL 3T09A 5D7KD 5I9QC 3TO2B 3RJDA 3FRPG 1AGFB 2R69L 2R2CA 2Z35B 4OUUA 5D96B 1FZJA 4NC0B 3F12A 4FXLA 3EDKA 1RK0B 5DVKA 3NZHL 3FZUC 4LCCB 1QRKA 4F9LC 3UTTD 4KDTC 2FBOJ 4P23C 1PDKA 1XF3A 3X3GL 2R0WH 4I18B 1UH4A 3I9GL 1A6VH 1JPFA 3LKRA 5C6TH 4M6AA 2HRPH 1W0WA 3SE4C 2BFVL 4Y19A 2YZ1A 1JGDA 4GAJL 1T89A 2IWGA 3QQ3B 3OTTA 5EU5B 3EDEA 5DJ2A 3GUTB 5L2JB 4PGZA 2FJGB 4P5KA 3LKPA 2LVEA 3BXNB 3UTSB 1S9XA 1D6VH 3CX5J 4CN4A 4JY4A 2WUCH 4XP4H 1L0QA 4R0LB 3ALWA 5BO1L 5IFJB 1OF2B 2A83A 3MYJA 3BP5A 3QCVH 3WJJA 1YMHA 1WFTA 3TA3A 3GJFB 5GGRY 2DKMA 3MRHA 2H9GB 4OQTL 4N8VG 4KJYA 1I9EA 3L5IA 5I1CL 3G6JB 2EDXA 2C26A 5GHWL 4D2NA 2XV6B 1W72A 5F9JA 3DX9A 5KSUB 2F19H 5SWSD 3L9RB 4RWYL 3DROA 1KCVL 2WW8A 3EFFB 2XOTA 3L95B 1C12B 4IRJD 2IAMC 3LSOB 3EGSB 4HULB 2DDQL 5E2WL 4TSAL 5FO8B 4XCFL 4NT6A 4FQJH 5J56B 4R2GC 4ZOCA 4OZIA 3OGCB 4L4JA 2ORBH 3MZGB 4PFEA 3CFCH 1KULA 3OKOB 3MJ8A 2PXYD 3HPJB 5D1QA 3JWOC 4PGDB 1M7XA 1MUJA 3MV8D 1EGJA 2C1PB 2E3VA 5KZCB 1BLNB 3VXRE 3FONB 5T3XH 5EIIA 4RIRB 4U1GB 4Y5XA 4JAMB 3HZKB 4ELMF 2F5AL 5IBTL 2ATPA 2X4TB 5CD5D 3EDJA 1M05B 1NGZA 3QH3A 4P3WA 1MFEH 5HGDA 5TPWL 4M02A 1DQQB 3NTCH 1BWMA 3G6AB 3VWKC 4RDQF 1VDGA 1V3JA 1R3HA 5JDSB 4HQQH 2OL3H 1JZ4A 2B1HH