3TU6A

The structure of a pseudoazurin from sinorhizobium meliltoi
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
127
structure length
127
Chain Sequence
MEEYRVEMLNKAADGRVMAFEPAVIRAQPGDTVTFVAKDKGHNSALMKGGAPEGAETWKGKINEEITVTLSKPGVYMYQCAPHVGMGMIGAIVVGEPANLEAVKGIKYPGKSKAAAEKIFAEIESGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Pseudoazurin (Blue copper protein)
publication title The X-ray crystal structure of a pseudoazurin from Sinorhizobium meliloti.
pubmed doi rcsb
source organism Sinorhizobium meliloti
total genus 33
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3tu6A00
1MZZA 1WA2X 3FQ1A 2PPAA 4E9QA 7PAZA 1M57B 3S8GB 3S3CB 2DV6A 2R7EB 1N70A 1T5KA 1AZNA 2JFCA 4YSEA 5FC9A 1BYOA 2VSKB 2ZONA 1ILUA 1WAEA 2OCCB 2YAPA 3FPXA 3H56A 3OQRA 3UABA 1KYAA 4NAJA 1CC3A 1PY0A 3ABKB 3T6ZA 2QPDB 3QJVB 4Q89A 5I6OA 4AX3A 4DPCX 1J9SA 1BQRA 2UX6A 2ZOOA 3T71A 2IDUA 4L0PB 2BP0B 1ET5A 1AG0A 1ETJA 3X1FA 4G71B 3ZX1A 4M4RB 2ZXWB 3ERXA 3NP3A 1GYCA 3NJLA 2IDQA 1KBVA 5LDUA 4YVUA 2Y1AA 3DKHA 2JXMA 1RZPA 4F2FA 1XB6A 4HIPA 1HFUA 1PZBA 3OMIB 3FPYA 1JXFA 2CUAA 3V9CA 3X1EA 4BDVB 1SF3A 1XB3A 3AG1B 3FYIB 4BWUA 1IKOP 2FT8A 2BW5A 3WKPA 5IY5B 4M3HA 3CG8A 3WNJA 3NYKA 2FQGA 1JZJA 2EIJB 2QDWA 4AKPA 3PCYA 2QT6A 2J55A 1PCSA 2PPEA 3CVDA 1ZIAA 2W8CA 1IBZA 2GC4C 3JT2A 2XLLA 3UAEA 1AZRA 2GBAA 4BXSV 4A2EA 3N55A 2FNWA 3TBCA 3CVBA 3WKQA 4ZK8A 3FQ2A 3T6WA 5F7BA 2EILB 4KNUA 3MBWB 2BWIA 2FQEA 2MTAA 4TXVB 1BQKA 4JHUA 2EIMB 2DWSA 4KOBA 4FA7B 8PAZA 3FU9A 3FSAA 1WS8A 4E9VA 4X4KA 1J5CA 3S8FB 2PP8A 2H5UA 5PCYA 1UATA 1WA0X 2PLTA 2H3XC 2IWFA 2VW6A 3ABMB 3KW7A 1ET8A 2YAHA 3NJHA 2FT6A 2HRGA 1PNDA 1MG3C 2JKWA 2CJ3A 5I5JA 5I6NA 3MX0B 1DZ0A 4HALA 1IUZA 4F7KA 2PPCA 1ZIBA 2BW4A 4KO6A 2P80A 4DP8X 4YSCA 1CYWA 1J9QA 1A4CA 1JVLA 2XYBA 2XVBA 1MDAA 6PCYA 4G7RB 3QPKA 3PAUA 2MRYA 1AG6A 1JZHA 4QLWA 4DP0X 2AVFA 3T9WA 1JXGA 1KCWA 2VM4A 3PAVA 1RZQA 1GY2A 1OE1A 3ZIYA 3AW5A 3AY2A 3ZBMA 2XV3A 1PLCA 3QJQB 4E9YA 2FQDA 1QHQA 2GC7C 1SFDA 3HEIB 3NSCA 1MG2C 3NT0A 4EF3A 5I5IA 4DP2X 2B3IA 7PCYA 3CVCA 3EH3B 6PAZA 3PXLA 1NIEA 4KO5A 1FFTB 1SJMA 1L9OA 2GI0A 2WO3B 1OF0A 2EIKB 3S3DB 1J9RA 2Q5BA 1IC0A 2X88A 2AZAA 1A4BA 4PCYA 2IH9A 3S3BB 4KO9A 4BWWA 1XMEB 1X9UA 5F7AA 3FQYA 1YLBB 2PCYA 1GR7A 4HCIA 4DP4X 5B1AB 1V54B 3QJSB 2HZHA 5AZUA 4WTQA 2I85A 2PCFA 3UADA 3NJKA 4HAKA 4YSDA 3X1NA 1PZCA 1V55B 3TA4D 4A68A 4AZUA 1OE2A 2TSBA 4UAHA 1L9RA 2BP8A 1JZIA 1JZFA 2BZ7A 2RACA 4YSRA 1QNIA 2VW7A 1XB8A 1JERA 2DY2A 1JXDA 1BXUA 2TSAA 1GW0A 1NIBA 2YXWA 2FT7A 3HB3B 2I7OA 2IAAC 1JOIA 4JKNA 1NIFA 1NPJA 4DPBX 1CYXA 3IEAA 1WS7A 2HX9A 2IWEA 3SQRA 2BZCA 4GP5B 1HAWA 1NZRA 4YSAA 2YAFA 4UANA 1NTDA 3RYMA 3SBRA 4HHWA 1E5ZA 1AR1B 3WNIA 3TBBA 5D4HA 1BEXA 2HXAA 1N68A 3H4HA 4YSQA 2H47C 2ZWNA 1GS7A 1MZYA 1NICA 3N2JA 4AKQA 4DP7X 2J57A 3ABLB 4F2EA 2XXGA 2HLEB 2QPEB 1AAJA 1ASQA 1TEFA 5I6KA 3ABGA 2YAEA 3CZUB 3D12B 3NJIA 4DPAX 2J56A 1A8ZA 4BWTA 2YAMA 2YXVA 3X1BA 4BXVA 4A2HA 1AS6A 3SBQA 1ILSA 3IE9A 2YAOA 4NERA 4E9RA 2CCWA 4YSSA 1RCYA 1GS8A 4K9JA 1W8EA 2NRDA 5I5MA 1AIZA 5I28A 3UAAA 1KDIA 5AKRA 9PCYA 3NJJA 3PAZA 4A67A 3IBOA 3FT0A 1HAUA 2J5WA 1NIAA 1M56B 1ASOA 1SDDA 3OMNB 3QJUB 2YARA 1J5DA 4QKTA 3NP4A 4N8UA 2XUWA 1JZGA 2UX7A 4P5RA 1RKRA 1ZV2A 3PPSA 2DWTA 1E30A 2PP7A 4KO7A 5D4JA 2IWKA 3CDZA 4GXFA 1M9WA 3T6VA 2Y69B 3BVDB 2AANA 1ZDSA 1ID2A 1NPNA 3FSVA 3H4FA 1TU2A 3NSDA 5I6MA 1X9RA 2VSMB 3AG4B 2FWLB 1PAZA 1PLAA 3ASOB 2OJ1A 4G7QB 3AG3B 3KW8A 5B7FA 3EH5B 3QJRB 2IDTA 1GS6X 4YVNA 3X1GA 1BXVA 1E65A 2R7EA 2XXFA 1OCZB 2P80D 2UXFA 1ZDQA 4GP4B 4E9TA 4CSPA 3NJGA 2EINB 2CAKA 1BYPA 3UGEA 1KGYE 3FU7B 5E9NA 2BO0A 3EH4B 4HZ1A 1NIDA 1SHXA 1IBYA 2BP0A 4A2FA 1NINA 4GP8B 4E9WA 3AG2B 4NB7A 3FYEB 5D4IA 2VMJA 2UXGA 1ET7A 2YQBA 3DIVA 3UACA 1OCCB 5B1JC 2PPFA 3SBPA 2WSDA 4YSUA 1W6LA 3NJFA 3GDCA 3FU8A 3TASA 3OM3B 2DYSB 3FS9A 2IDFA 1AOZA 2GIMA 3QJTB 4DP9X 2VM3A 4HHGA 4PAZA 1KDJA 1SHWA 3WIAA 2N0MA 1GSKA 1ZPUA 2GB2A 2XU9A 3EF4A 3X2QB 2AFNA 2GHZA 2XV2A 3T6XA 4WKXA 1BXAA 3L45A 4W1TA 4BDVA 2I7SA 3AZUA 1AZBA 4YL4A 1E5YA 4KOCA 3NJMA 5B3SB 1VLXA 2GSMB 2AZUA 1JVOA 4MFHA 1KCBA 2CBPA 1EZLA 3GXUB 3WG7B 1AACA 1J9TA 4JHVA 1E67A 2XX1A 2XV0A 5TK2A 2BHFA 1FWXA 3NSFA 2UXVA 1W6WA 4Q8BA 2YAQA 3NJNA 1AS7A 2FTAA 1OCOB 3DTUB 1BAWA 3IN2A 2BP8B 1NDTA 1DYZA 1V10A 5B1BB 3NSYA 1KBWA 1F56A 1KV7A 4E9SA 1PMYA 1GY1A 1NWOA 2PPDA 3JTBA 3TU6A 3C75A 2CALA 3EHBB 2IH8A 1AZCA 4CSZA 4HCFA 4YSPA 4DP5X 1L9TA 1OCRB 1AQ8A 2Q9OA 3QQXA 4ENZA 4A2GA 1L9QA 1PNCA 1WA1X 2DYRB 2XWZA 3OD3A 2WO2B 3U25A 2VN3A 4YSOA 5B7EA 1A3ZA 5I6PA 2BWDA 2XX0A 1L9SA 4DP6X 1TEGA 1L9PA 2LLNA 3OMAB 5A7EA 3BQVA 1AS8A 4KNTA 1OV8A 1AZUA 2HX8A 1TKWA 2X87A 2VW4A 1PLBA 1B3IA 1CURA 1JZEA 1PZAA 5PAZA 4G7SB 5B7MA 2A3TA 4UF7C 4AKOA 3V9EA 4DP1X 3GYRA 1OE3A 1PF3A 4A66A 3IN0A 3ASNB 1A65A 1AANA 1CUOA 1BQ5A 3WI9A 4GY4A 4AI7A 3FSZA 3PLYA 5I6LA 4G70B 2IDSA 5ANHA 2QDVA 1OOWA 3FSWA 4YSTA 1SNRA 5AFAA 4P5SA 1QLEB 5B1KA 4KNSA 2FQFA 2UXTA 1I53A 4FAAB 1SDDB 2E86A 2B08A 4RH4A 1ASPA 3FU7A 4BK5C 4A2DA 1URIA 2HRHA 4E9XA 2FJSA 1FA4A 5I26A 5TK4A 1EHKB 1ADWA 1R1CA 3CDZB 4N4YB 4W9ZA 4G72B 4HCGA 2W88A 1NWPA 3G5WA 1A4AA 5B1JA 2PP9A 2OV0A 1SF5A 1SFHA 2HX7A 5EHFA 4GYBA 3ZDWA
chains in the Genus database with same CATH superfamily
1ADQL 2JCWA 1AKPA 1WA2X 3LKQA 2VXTL 1EZUA 2JF1A 4F7TB 4D0BA 4DERA 2OLDA 1BIHA 4E9LA 1W91A 5H94A 4DUVA 5KVEE 4X5QA 3QXVA 1TENA 3WTWA 4ATWA 3OF6D 3HG0A 3D69A 1D9KB 4OTXH 3FPXA 3GKWL 3OC5A 3DA0A 3IDXH 4HWBA 1UHVA 5I1CH 5J11B 1KBGL 1VFMA 3U6RB 4YHOH 3H0TA 3QJVB 4ZNEA 2H2PD 3HZMA 1WZMA 2J3SA 2WXJA 3EYUL 4OI9A 1BQRA 1U9KA 2GSGB 3EJRA 2YGVA 4YNYA 3GSVB 4WJG3 3WUWB 3VAEA 4X8JB 5C08D 4QRQA 2EVFA 1DQMH 5HYJB 1JF1B 4MCMA 3EH2A 4HPHA 1RZ7H 3D39D 2E47A 3FT2B 2WCPA 5GJSH 4Z7UF 4K0OA 4JFPB 2WLLB 5E6IB 1NGYB 2DQIL 3GJFK 1U91A 3HC4L 2AJUH 3LKPA 4NHCL 3SHSA 1IIIA 4IBZA 2NYKA 3SKMB 5T5NG 4D9RD 2QSCL 2L4OA 4QXUH 1M7IB 3F58L 4EQ3A 1DBJL 3ALXA 3F7QA 4BDVB 3DSFL 4NI3A 4JDEA 3QDGB 1IKOP 4MQTB 5ERWB 4P5KB 3ZUNC 4FQ1H 2G5RA 4MNGA 1N6UA 4YBLC 4XMWA 3NYKA 1JZJA 4YX2H 1XGZA 3PCYA 4AKPA 1CD9B 4PJDF 1LJMA 3CMOH 3RWIB 4OFYD 1S3KL 2EIZA 4FQCH 4ONFH 4B9CA 5KVGL 1JCVA 3JT2A 4NN5B 4PUBL 4AC2A 1MRFH 4WU7B 3AMLA 4YN3A 3L3OC 4AQEB 2XKNB 2WZPA 4OLXH 1B6DA 4PGCA 3F7PC 4E0RB 4NNXB 3CVBA 4ZK8A 2LE9A 3NCWA 3QDME 3WE6B 2OQJA 3FRUA 2FQEA 3BP6A 1LNUB 2VDNH 3GSNB 3LKOA 4GG8B 5DF0A 3EJTA 1LO4L 4OJCA 4B53A 2AJYH 3VE0B 2CR0A 3H1ZA 3D7PA 3S8FB 4XPBH 1LTXA 3NJVA 3L7EB 1LO3L 2XC8A 2HRGA 4MKMA 3D05A 4JGJA 3NZ8B 3HG1B 3NOIA 4W9CC 5JHDE 5JA8B 1IFHH 5C07A 1IUZA 4IGBA 3UZVA 4CVXA 4LT7A 1BDYA 4LHUG 1FFPA 2IH3B 5D2NB 3WLBB 5IFAH 1G6VK 2H26B 5SWSA 1MDTA 3UP1A 1WBXA 3MLXL 4DEPB 2MOQA 3P54A 3DO7A 3TA3A 4J3OC 2F2HA 4JPSA 2Y36L 4L8CB 3KPLA 1FN4B 2IDCA 4XBEL 5F3HB 1E43A 1JN6B 1KY7A 1RHFA 1W16A 2BIPA 3OKLA 3RPKA 4JG9A 1A4JA 1MDAA 1TQBC 2F1EA 2O6FA 4R2GB 3RZWA 1JZHA 1N8ZB 4ZRGA 4P59L 3S34L 4JPWH 2HJLB 2EEXA 4OGAC 2R0KL 5DSCA 1GY2A 4Y7MA 5D5MF 2KQNA 1BGXH 2WTOA 2OI9B 4FG2A 4P3DB 2YGQA 1Z9OA 1QI5A 3B8SA 1SDYA 2JB6A 4GSUA 4F8TA 1W0WA 3ZKMD 2C3GA 3E9TA 4N2OA 4KDVA 4F5CA 4TL4A 3BEVB 4EF3A 3KAAA 2UWEE 5ICZB 4FNTA 3RUGF 2AABL 3P3SA 4JRWA 5E2WL 2J1WA 4JO4H 3PXLA 2PYEE 1KJVB 3GRWA 2NNCA 3ILEA 5GS0D 3FH7A 1QKZL 3PWLA 2D4DA 4RGNE 2Q5BA 4HZLA 2ETWA 1IEBA 3WNPA 2EUWA 2FR4B 1CI5A 1A7OL 5JHAA 2Q6WB 1P6AB 4L48A 4XP5L 4CW1A 1U8OB 3Q6GH 5CKGA 1UUSA 5T3XD 4JGMA 2X6AA 3GSOA 2VT0A 2R4RH 3KL0A 1V55B 4ZMOA 1EHXA 3PJLA 5GS2H 4HDIB 4QY8A 1DJGA 2A9ML 4CILA 3BP7B 1P4BH 2BP8A 1MUJA 3FB6A 2YK1H 5D1XD 1Q8MA 5GGRB 5FWQA 4LZKA 1EERB 3VFVB 3SY6A 3IKKA 3BEWB 2EAEA 3JQOB 4H0IA 5KUMA 3WN5C 4PG9A 1HXYB 1NIBA 2D9QB 2V6HA 1CDBA 2YXWA 4XNMA 3BCDA 2XOTA 3HPJA 2XZCH 2VR3A 4L8SA 4TVUA 1DUZA 3QZBA 4Q97A 3NTCH 3GMMB 4JFFD 2I27N 4BE6A 3PL6C 5D6CA 3ESPA 4LBEB 4N2KA 3OL2A 5HHXH 5JR1H 3U7WH 3GIVA 3NCYP 4HV8A 3D3VE 3H4HA 4RMBA 5IMMB 2H6PA 4G42B 2ED7A 4PJXE 4PJCA 4NO0B 4ZFOA 3DVNA 3VM5A 1O9VA 2OMNA 3OPZL 1SYVB 1I8IA 1XD1A 3NJIA 3ARDA 4DGIH 4MJ6A 4WGWB 3DUSA 5IBLC 1BBJB 1LMKA 4JHZA 1VACB 4W4OC 5DHYA 3SBQA 5FB8B 2ESVA 4FJZA 2HJKA 5D71H 5ES4B 2IPTH 1F4XL 1MJ7L 2CCWA 4MYWB 5FIEA 4LOVA 1MCOH 4PJAE 4YSSA 2HFFB 5DI8B 1GS8A 2QHRL 5JHLL 1PG7X 2Q7AA 3HR6A 5CCJA 2NRDA 5HHOE 5BS0D 5IFJA 3VMPA 5C0RL 5I2IA 4WFHE 5IEKA 3T0EB 4MVBD 3OB0H 6FABL 4R4BA 3GF8A 2YXMA 3FNKA 1K8IB 5JIPA 3KR3L 1NIAA 3VRLE 2YKKA 3OX8B 4QXTB 5IF0A 2VDKH 3DX7B 2YC1B 4Q58C 2VLRB 4Z18A 2ID5A 4EN3B 1WTGT 4LB8A 3VFSB 2V17L 5DGQA 2XUWA 1TKWB 3MU3A 4MTMA 3VG9B 4KI5C 4PP2B 4AYMC 1E3ZA 3I2CH 5TDOA 4Q7DA 2J6EH 3B5TA 2KLRA 2OPCA 3RZCA 1R9FA 2YN3A 2YXFA 4Y2DB 4U33A 4YLBA 1AIFB 4NCDA 4UT6A 1NPNA 1MWAL 1Z32X 4PREB 3ZT6A 2EZ0C 4IS6A 1CFBA 4NQVA 4Z7QE 3QI9B 1ZWIB 3H42L 3P73A 3STZA 1NJ9A 1EHNA 3EH5B 4KUCD 5IVZA 3FZUD 1ZPLA 1NBYA 3X1GA 2XJKA 3GZOA 4OLVL 4XR8C 1PJWA 4ODHL 3DMMA 1URLA 4MX7A 4OLUL 2XIDA 2HH0L 4EZKA 1HHGB 4BUHA 3ISRA 4GMSH 3V5HB 4RRPG 3BH8B 2BPBA 2OYKA 4G5AA 3RL2A 2NYYD 4MJIA 4XN1A 4G6KL 1MCWM 3J27A 4K2UL 2E7DA 3AWFA 4PJ9A 3ZQWA 5IIEA 5IJVA 3VXPA 4OLZL 1Q72H 1G7QA 4U0RB 4R3SA 4O58L 5IJCC 3ZTNH 5FDWA 4NB7A 4B3VA 2HSIA 1YEEL 2VMFA 1WF5A 3E6HA 1YPZE 4I1RA 1CICC 1X6LA 2IAMC 2WXGA 3MNVB 3IK2A 1L9MA 3GDCA 3B7RL 3FU8A 4N9OB 2B14A 3B1UA 3DURA 3VGBA 5AW2B 3ZHDA 5CGYD 5IJDC 4HUUB 4M02A 2LVCA 4UQAA 2GJPA 5GZND 1BD2D 3AXLB 2DQGH 4W68A 3P3RA 2BNQB 1L0QA 3KEHA 3GSXB 4J7RA 5DFWH 5JNYB 5IB1A 3PGDB 4DGYL 1C12B 4LKCB 2A5UA 4XAWL 1NKRA 4GMTH 3FRPG 5CHNA 1Q9OA 4ZUVA 1JVOA 1F4WH 1UYWH 4OF8A 4ODWA 3TN0B 2H0PA 4ZMPA 1ES0B 2VDPB 5IESH 4ZFGL 4TTGA 3JVGA 3SE6A 2IWGA 1FE8L 4YK4B 4ADIA 2GJJA 4JFWA 4JNXA 5TE4L 1D5IL 1FWXA 4I0PD 4XI5D 2R69L 1DJXA 4N3TA 4S1SL 2ITFA 2UY7B 3TT3L 1CDGA 1R5IB 2X38A 4Z8FH 1ACCA 1WFNA 1XZ0A 3QDMB 4JPKL 4HC1L 3SDDB 4D0CA 3RVXC 5EO0B 1FYTA 5TGBA 1COBA 3BXNA 2YQGA 4NQDB 3DO3A 1T5XA 3C75A 4R0LB 4HWBL 3KLAB 3U2JA 1YMMA 4JHAL 3LEYH 2VWEC 3WKML 5J7CC 5FYLL 4JGUA 2BOCB 4BA0A 5JHDB 3KPNA 3EJPA 2ZUTA 2EUVA 4JRLA 5GQBA 3VD0A 4JRYA 4Q2ZB 3TBWB 3T2PA 2C4FT 3FCBA 1CN4A 3TZVC 3JZ7A 3OMAB 3PWNA 3FUJA 2NPLX 1MSPA 4OZ4B 5AAMA 1T6BX 4NP4L 3IDUA 1I1FA 3QCTH 3HLAB 2L04A 1TQTA 1XGPA 3ZZLA 1FV1B 2Y6TE 4Y5YC 4M6ML 5E1GA 3FQNA 5HVGB 1QMUA 5E99L 4BK4A 2QGCA 4PJDE 1Y7VA 4FTVB 2IFFL 1UADC 2VLJE 2NY4B 3QG7H 3HFFA 4GRLD 5CEYB 3X14B 3ZQ9A 3MCKA 4KV5E 3TXAA 5MERA 1MFEH 3L5XH 4M43H 1F1GA 1DJSA 1WD8A 2HN7A 3AGWA 4JM4L 4R7NA 4ZNCD 3GMOA 1PVHA 3GPSA 1WIPA 1KTDB 3O11A 4FMKA 5IW6B 2J12B 2UWEB 3G5VA 2WD0A 3L08A 1HDMA 3D9AL 1HINH 3FAXA 4WSGA 3M1CA 4RIRA 2PYEB 3O2WL 5K1VA 1A8JH 3WIHL 2IBGA 4NZ8A 5IB3A 4RGNB 3MZTA 3NBNA 1IQWH 1RUAH 4NFBA 1AD9B 5A1AA 2CRIA 1WT5C 2FD6H 1FA4A 1JD9A 1EHKB 3NABH 3TX4A 1BZQK 2Y2TA 3UYRL 4EUPA 3MUY1 3HI1B 3BD3A 3KM2A 2G3MA 3N1GC 4ETQA 5I18L 1GGYA 4WFEE 1ZA6B 4YR6A 1OEZW 1O6SB 4TQEL 1JPFB 2MCMA 2VLKA 1PQZB 3JYBA 4HS6B 4S11A 5DO2D 1IC7H 5I8OL 4R90L 4NP9A 3AREB 3S8GB 5I1EL 1E9QA 5JQ6H 4MD5A 1BFVL 2FO8A 4NQQA 1UFUA 4JE4B 1P7QD 4JVUA 2C1PA 1QSEA 1OSZB 4HUWA 3ARGA 4NAJA 4Q6IA 1MEXL 3V5DB 2V2TA 3ISWA 2NW3A 2Q0ZX 4Q89A 4R7VA 3RBGA 4PTUA 5IQOA 4Q9QH 2CO4A 3NCEB 4JL1A 4XXCA 1AI1L 4OD2B 3MHZA 3T3PE 4TRPL 4WFGE 1MW1A 2AXFB 4W9IC 3ATBA 1MCEA 2ILLA 3IMTA 4ZI8A 1A14H 2YZ8A 5GRWA 4AJVA 5DA0B 5G5DA 5DYFA 4WV1B 5IQNA 4M48L 2YD6A 1U8QA 4XP9L 3DJZA 5F3FA 1SJEA 3D3VB 3UAFA 1UA6L 1MCNA 3LNFA 2CIIB 5DJXB 2J20A 2G0KA 3GZPA 2X9ZA 1XCQA 4LNRA 2NTFB 3X12B 4P2RD 3FQRB 1KTRL 2L7UA 2O6PA 3EDKA 4ENED 4NI6A 1B0RB 5F96H 4HXBL 5TQ0H 3RL1B 1PU0A 3FO9B 2HVJA 2BW5A 3CFNA 3OKOA 2FSEB 3GRWL 2A6IA 4XC3L 4WI3A 4MMZB 1DVQA 2DQJH 3TLRA 3GNML 4KQ4L 5KYXB 5D8JL 1ACYH 3O4LE 1KCVH 2DH2A 1HI6A 3ROLA 4PJAB 5JO5B 5EU7E 3TV8A 1M2VA 4M5ZH 1AZRA 4UQDA 2R0WH 4IRZA 3N43B 2VJXA 1T2QH 1AP2A 2RGSA 4WO4D 3ULUD 3VFPB 1BFTA 1DSFH 1NCAL 5T1DH 2JJTC 1KIRB 2DS4A 1O7DC 2D3JA 2R2HB 3MRGA 4KPHH 5IT2L 4P46A 4LCYB 4F33B 5H35A 2AEQH 4OQTA 1UZ6E 4NBXB 4LU5L 4Y4HD 4WCYL 1BQKA 4P4KA 4YZFF 1T4KB 3PRZA 3FT3A 4G9FD 3EDJA 1J1PH 4LVNB 4E9VA 2H2SC 4LO9A 1ZLDA 1EFXA 1EEYA 4GQ9L 1RXLA 2EEFA 5PCYA 2RR3A 1CGXA 1NFDF 2FATL 4QHUB 3HPLB 2R23B 4HXAH 4G9DB 1U8PA 4OZGA 4IKJA 4AM0B 3MGOB 4FQ1L 3MRPA 1AHMA 4H40A 1UM4H 3LQZB 1FGVH 4ORZC 5HDQL 1H6FA 1BZ9B 2FE0A 5DHMC 1GZHC 1Y1UA 1R5WA 1ZLUK 4MBRA 2WXFA 4X7DC 1ZLWH 2Q8AH 3JV0A 3SDAA 4JDTL 1G4MA 1FIGL 3GK8H 4JZNA 3OXSB 1WC7A 5MHSD 2YPLB 1X9LA 4TOYL 4G8IB 5AUMB 3LN4A 3T4YA 2YQ2A 1QYGL 4XNUH 1TJIH 5T1KB 1AGEB 1B4TA 3GO1L 5ELIA 2QR0A 1KJ3H 5CO1A 2WKOA 3AY2A 4J3BA 4NKMB 1JNHA 3IXAB 4FDWA 2PO6D 3R0NA 2Z31C 3SOTA 2E7LC 3WSQL 1JZ7A 1H3WM 4NXKA 2YS4A 4WJ5B 5EORH 4M7ZB 3BUDA 2R83A 5C0JA 4ZO7A 5D1ZD 3IDIA 2NY7H 4OCSH 5E70A 3SYOA 1ITCA 1NUDA 2GIXA 3ULVD 3EH3B 5GRVK 1VADA 2MPAH 1CF8L 3FB8B 1QBLL 4KK8D 4GH7B 1AQDB 1XQ4A 2CMRL 5JUEL 3UTSE 1YNLH 3DVGA 4A6YA 5BCAA 4OZIF 4R97C 3D0VB 3SDCA 5D72H 5I82A 2EVIA 2YWZA 4UOQA 1JGUH 5DFTA 2FECL 3IWVA 2BS71 4F3FA 4BQ8A 1IT9L 1A7BA 1P6FA 2AJ3A 1FLRH 4R4ND 5AB1A 3SE4C 3SJVD 1J1XH 2F53A 3LZOA 5DDHA 5K69A 3EF7A 3SB3A 1HWHB 3VWKD 3KBEA 1G7PA 1ZV9A 1BLNB 1YA5A 2E7CA 3OJ2C 1L5GB 4GJTB 3NDZE 4Y1TA 2Z91B 4B7LA 2XNAB 2ENSA 4G6MH 1HZHH 5CINH 3UO8B 3GUTA 2VDOH 4EIUA 1IV8A 3AVEA 4PJ5B 1R3KA 1OP3K 2HAZA 3GQFA 4HFWA 3U30B 1NC2B 2F54A 3JT0A 2YO3A 4X5PA 2IQAA 3X13A 4RFOH 4X4ZA 3UTTE 1G4RA 2P5WE 4JL2A 4A2MA 5KYYA 1WS7A 2HX9A 5F9JA 2PUQT 3AY4A 2VNCA 3LH8A 5KVGE 3EGXA 3FCTA 3S5YA 2WXQA 5DQJA 4U6HB 4X5XB 4FLRA 1G9NL 4GLRI 4U1KB 5EO1A 1AHWA 3CFDB 1J8RA 4L9DA 3CNKA 5BXFB 1BEXA 1A1OA 1J0KA 1N68A 4F58H 4E42A 1NICA 4OUOA 4KU1A 4X9YA 5H37G 5EPMB 4RFNB 3FL7A 2B16A 2E6JA 1QBML 1ND0B 2WPGA 4TUOA 3WENA 4J4PC 4XMKL 4XMUA 2VZ3A 2NY1D 2OJEA 2X4OA 2F5AH 2X3CA 1J0YA 2VLJB 5CJXA 5JW4Q 4Y0GA 2ZSWA 1AS6A 3MZGB 3L3DB 5DJAB 4C54A 1J1OL 4DVBA 2YGPA 2DKSA 3BWZA 1ETA1 2NNXA 2YAOA 4FKKA 1AD0A 2AJVL 2YQ3A 4JKLA 2WLIB 4PI2A 2CR6A 3I6SA 5C2BL 2UZIL 4YHLL 5KSAD 1EBAA 3SYPA 2AK1H 4XNYL 3GC3A 4M00A 1OAQH 2DL9A 2ZT9C 4KQ3H 5LUMA 4QXWA 3GM0A 2FBJL 4PY7B 1AXTL 4U7KA 1X44A 5I1LB 1WEJL 5E9DE 2EKSB 1BYNA 4M7LT 3ZTJH 2KQMA 3T77B 4QJ5B 4QJ4B 2WXIA 4P5RA 1RKRA 4GXVL 5EN2B 1XGRA 5ALCH 2DYPB 4TNGA 4PJ8A 3F01A 4QRUB 1KG0B 2NDFA 4ZMAT 5K33A 2HFGH 4WEBL 4D94A 2BDNL 4L23A 2XY2A 3WFCH 1PAZA 2NR6A 4RZKA 5DQ9B 2QTEA 3D0AA 4JE0A 1ZT1B 2P8MA 1R6VA 1WTLA 5FM5O 3TV3H 2A1WH 3OF6A 1ZHBB 3REWA 5JPMB 1FL5B 4GG6F 2QPSA 1CG9A 1ZLWK 4PJ6A 1QD0A 2R4SH 3UO1L 3BPNC 1NKGA 4PWHA 2AAAA 5ADOH 1VGKB 3DMMC 1JV2A 12E8L 5E9NA 3LS5L 3BE1L 1BMZA 4H0GA 5DD1H 3T3PB 4XVUD 5C08A 3IGKA 3FK3A 4R5VA 3S35L 2ADJA 4BH7A 2BSDA 3NPSB 2G75A 4JFED 3EBAA 2NY3C 3NG5A 4IRSD 5GISL 3D39A 3CVIL 4Z7NF 3WE1A 2E59A 3VI3E 4MNHB 5D93B 3GDBA 2K7PA 3IKCA 2Y06H 5EU6A 1AGBB 4I85A 1GSKA 2GB2A 3SYAA 3KWWB 2PW1B 3A24A 4HWZA 1EWHA 4TSCH 3NRPA 4B9KC 4RDBA 5L7XL 1A9EA 3B5GA 3IS0X 3AT8A 1BXAA 2SEBA 1IJ9A 3L45A 4ZPVA 3LJ3A 3K91A 4YL4A 1XCTB 3O6LH 1VLXA 4FQQB 1A7PL 2AZUA 4PRIE 3VX0A 3LSOB 3BQUC 2H1LM 3HNTL 4M4PA 1MCIA 4JFZL 5BOJA 3ZVVA 4FQJH 3B7TA 1QSFD 2XV0A 3BDYL 3II3A 3TYFA 4N0YL 3IGAB 5BPPA 1S5HA 3JVGC 3LAFA 3SE8H 2AVGA 1DVZA 1SUJA 3KWTA 1E7VA 1RZFH 5CLWA 5HBBA 2FB4L 4UAOC 1Q90A 2XA8L 3U1PA 2AERT 1Q9WB 4ZDHB 5IQ9B 4HD9A 2J8HA 1VFBA 1QNZH 3MFGB 4FA6A 1U2YA 5GS1A 5IB4B 1OW0A 4FNSA 3PNWB 1YYML 3WHXA 2D3VA 4MJJA 4EVNA 4F8OA 2IC2A 3B2VL 2OYPA 4XMVA 2XPYA 2WXRA 4QRRE 4HCFA 2CLZA 2LT9A 1QHPA 3VCLB 3OGCA 1JK9A 4H88L 2XPGB 1GGTA 5C0CE 3WLWD 5AVRB 3WS6A 2ZSVA 1CO1A 4OZFH 4CVZA 3W5MA 1CD8A 2XG5B 1ZE3C 4JY5L 2AKRB 4N6RB 1T04B 4JZJC 1PTZA 4HMCA 4DKTA 5B8CA 4GMTL 1YHPA 1PY4A 4OAWA 4YSOA 5KVFH 5LGJB 2BIQA 2BWDA 3FQUB 3LKSB 2E27H 2FLBT 1SLUA 1TEGA 4L3AA 4Y16C 4ZUWB 1ZEAL 5KG9A 1MIMH 4E5XG 2C26A 2TAAA 4K5LA 3TC9A 2OYLA 4FRWA 2BNRA 5FYJD 4LL4A 1QFPA 3V4PA 4M8UA 4AQ8C 4YGVB 1BPLB 1ZKAA 1GH7A 3WJMA 1LXMA 4B3EA 5F72S 2NY2C 3BZ4A 4A04A 3IU4L 4TUKL 1R3HA 1D5MB 5DMKA 2CBQA 3KLQA 3MROB 3IN0A 2JKIS 1OT2A 1CE6A 4RNRB 1Z5LB 4MMYA 3QUML 4ZODA 3P4LA 4QNPF 3MACH 5E4EC 4QT5A 1SNRA 3BISA 3FOLA 5FCUH 4AGOA 1I3VA 2HT4C 2WKGA 4PHZA 3UMNA 4IRZL 4DKFH 1AH1A 3EAKA 1JHLH 1KBPA 1ZVNA 3RLSA 1PGRB 4DKAA 5JIQA 5FKPB 3DI2B 1AFVH 1BA9A 4YFLF 4L2LA 1PEWA 2WOBA 1KOAA 3LVTA 3GFUA 1IBHA 4IU2A 1TQBB 4IOFC 5ICYB 1UOKA 4FFYH 1KN4H 3UTSB 2W81C 1HU8A 4XP1H 3IJEB 5E56A 4AGLA 3PNRB 3CDZB 2NQCA 1I4FA 3LIUA 1AE6L 7TAAA 4YDLC 4BCXA 1ZA3B 3O3AB 1HOCA 3MRDB 4N2MA 2PP9A 3WEXB 3HRZC 4P3CL 1CVRA 2GY7B 5GGTA 1E90A 4L1BA 2PPAA 3NFNB 5I30L 2G5BB 4WWID 1LO0H 1TZGL 5EBLB 3V52L 4WW2B 3WU1A 3LEVH 3BO8A 3RVUC 1EEZB 3ES6A 4P9ML 5E4AA 5TJWK 3SZ6A 3E3QE 4NDMA 4H1LG 3KPRA 4JO1H 2CKBH 1C1EL 1MRDH 2W59A 1PYWA 3KPMA 5CEZH 2Q1EA 3UTTB 4D9QD 3SPJA 1IC5H 2P5WB 4ES8A 1MELA 3ARGC 3C8KA 3V0VB 2YA2A 3A0OA 3K2MC 5GRVL 3T71A 5C6TL 4JFFA 4DN3L 2EO7A 3N85L 3US9A 1GPOH 3TNMB 2FECI 3NK4A 2K3HA 4NX0A 3GRBA 3CLFL 1OGTB 2HPOA 2JCCE 1CIDA 2FEDD 3BUYB 4LCWA 2PR4H 4JPIB 2NOYA 4OD3L 4F8LA 4ACPA 2NTSP 2FD6L 1NPUA 2EUZA 3BKYH 2ZXQA 2APFA 3NABL 2F5BH 3R1GH 3QORA 3NA9H 1A9BA 4HIPA 4G1EA 4B0MM 3OMIB 2GHWB 1J0ZA 2N59A 5AQ0A 2QQLH 2LFEA 4K7PL 1CGSL 1LEIB 3GEWB 4MB3A 3G6JF 2R2EA 3QEHA 4UILH 1MW0A 3HB3D 1T0OA 3X3FH 4JLRB 1EO8H 1U6AH 1V3MA 3B37A 4H5SA 3LPOA 4DQAA 2HPTA 3QIUD 2X41A 5CJOL 3V8OA 4ZNEE 2EXYD 3NJXA 5FYLE 3CVDA 1GL4B 3MUGB 4PYGA 2ADGA 1SPDA 3CUPA 5IVOA 5LCVA 3MXWL 5LBGA 4HK0B 3N55A 3VQ2C 4GW1B 3VH8G 4ZMNA 5AZEH 3WTXA 4POZC 1VERA 2IGFL 3GXPA 4GINA 2ZWZA 3QFDB 1NSNL 3D4ZA 1TYEB 5HYIA 5E9DB 3BH9A 3MFFB 1IGMH 2A9CA 4KY1H 4BKLA 2YRZA 2YSSB 2FX8L 2D7PA 4NSKA 2WZ0A 1HXMA 3II1A 3KGSA 1GGUA 3FSAA 5D7LD 2Z4TA 1WS8A 2R2CA 2GUYA 3F5WB 3G6AB 3G3LA 1KC5H 3GS0A 4XX5A 3HN5A 5DUBB 2FSDA 4MNGE 2F7PA 3GMLB 1E9OB 4FXKA 3WMQA 3VXMD 5I5JA 4J3VA 1HSAB 3IJSB 4IIQC 4Z78A 3BRFA 4F7KA 2OK0L 4P9HL 5TF1H 1DL7L 4KVPA 5E0FA 5EWIH 2CH8A 4X6DA 1Q0YH 1RZIA 1SN5A 1U8HB 5CILH 2ORBL 5IGXH 3QAZC 2J8UF 4BELD 2FVNA 3K46A 3QUYA 4NQUA 2R0WL 4JFDD 5LKNA 2OMBA 2WWKO 3BFQG 2XZAH 3TVMD 3VFWA 2HUHA 1DJIA 5D9SB 5J0BA 3V0WH 2W9DH 4WDIA 3B9EA 2OYMA 4U6TA 4QLWA 3M45A 4XPTH 3QA3B 5J06A 1JYWA 1PPIA 1W72L 5DR5H 1KBKA 2AGJH 4KC3B 4V33A 3T9WA 3TIDA 1IQDB 3A67L 3BFOA 3AW5A 3L6FA 3B9KD 4NBZB 3V10A 1YEGL 3E0GA 2AXGB 4Y4FB 4H8UA 4BQCA 5KVDL 3R7QA 3VI3B 4NUJB 1ZRUA 4QMEA 3LHAA 2AQ1A 4M7JL 5AW0B 5L8JB 5GZNA 3E7JA 5C07E 4DGVL 5AZ2L 1UGKA 2B3IA 4XPHL 5SWSE 1V05A 1YEIH 3DIFB 1FBIL 2Z1PA 4X8CA 3CPLA 1ZVSB 2BS9A 1Q0XL 1WAAA 1Z0MA 5MEOA 1SJMA 2DMGA 1CFVL 1J0HA 2C7UA 4TULH 3A21A 5K9JL 4PRIB 4PFEA 5G2NA 1JNNH 1A4BA 1BP3B 1E4XL 4YO0A 3KHQA 4UM9A 3MRNB 2EC9T 1N59A 4DP4X 2VGLM 4HPYH 4WQOA 5AZUA 2WP3T 3GK8L 4N68A 5DC9B 1HILA 4I0PA 1CICB 2XIBA 2YD9A 2IBBA 2IAMB 5T1LB 3CBRA 3X1NA 5L8LB 2F74B 1HWGB 2E75C 1Z5HA 3QNFA 4PD4J 1GYWA 2VOTA 3EIFA 1H5BB 1KELL 2VJ8A 2WBJA 3EO1B 2XFXB 1XCXA 2ZP0T 1G7MB 3CVHA 3FXIC 4F5CE 2ZD0A 1J86A 3L1OH 2WW8A 3BYTA 4N0UB 3EFOB 2XTJC 1JXKA 1NLBL 1RK0A 1PZ5A 2WZ5A 4QRRB 4TNVF 3QYMA 1CFSA 1VZGA 1K5NB 3MRLB 3L4VA 3E1F1 5B38B 4ZW6A 3FCUB 3QPQC 2OA9A 3SQRA 1WFTA 1MF2L 1W9XA 4JY6A 3MCG1 3TJHD 5IR1A 4YSAA 4WLCA 5BQ7A 1EHLL 4HHWA 2E9IA 1EDQA 4OCMC 4V1DD 2MQ0A 3N91A 5D1QC 1VZHA 4TNWF 4CJ0A 1T22A 3M8OL 1YEKH 2ZWNA 1UXWA 4LLDA 4UT9H 4A7GA 1XMWA 1DEDA 1XIWD 2KC0A 3OJDA 1VFAB 1CU4L 1RJLB 3KS0J 3SGDH 3ARFD 3L9YA 1JZ3A 3I6KA 1SLVA 4ODUA 5MEND 5HGDA 4JQIH 3TL5A 3OR7A 4YHIB 5DJ8A 5CD5D 1EJFA 2F18A 4LVOC 4NOBA 5TH2A 3T6QC 1V3JA 3GTNA 3NA4A 4RLDA 4GRLA 4XBMA 4ZXBC 5FEBA 2AEPL 1MWAB 4O02A 4J12A 4TLKA 4ZFFA 4R7LA 1SN2A 3B9AA 4E9RA 1IL1A 2HVKA 2EXSA 4OD1L 4KTDH 4KWUA 2WQAA 1YSOA 5F7KC 4LLWB 4LPWA 4RFOL 5L4FA 3QFGA 4BZ2A 1AIZA 4POYA 3OAZK 2JKTM 3QWOB 4S1DD 5AKRA 1FDLL 1OM3H 1U95A 3KYNA 4U1GC 3VB9A 3HC0B 5ID1A 3QUZC 3S3SA 1ACXA 2AXWA 2X3AA 4HF5H 5F7MC 1TVBA 2X4TB 4Y5YB 1EJ6A 4PJCE 4QCIB 3L13A 5DMIH 2LLLA 1OAXL 4N86A 4LCUB 3Q01A 3EFDL 3F62A 4Z5RB 3AXIA 1DQQA 1LO2H 1L0PA 3Q8AA 4LMQI 4JM2A 1EPFA 3VFOA 3GHEH 4PJ8C 3EJJX 3EGDA 3QYCA 1TQCC 2EVGA 4HJGB 3G08B 2ESVE 2WUCH 3BAEH 4NEHB 2Y7OA 4YXLL 1YEDB 1PLAA 1U36A 2GY5A 2NZ9D 3EYSH 4HJJH 4HIQA 3ULVH 3RDTD 3VTTA 5D7JB 1N26A 1BJ1H 2PWFA 4GRWF 3MLVL 4ILDA 3ME0A 3OR6A 4IEFA 1NOAA 3OKEB 1UZGA 4WSKA 4NO5A 4X83A 3L3IA 2XXFA 5BRPA 1OCZB 5KSUB 1BAGA 4TF4A 1HJBC 1DN0A 2FIKA 3HG4A 4PGBA 2WLYA 4FL4C 4B27A 5F6IB 1KCUL 4Z0BL 2F8OA 1F41A 2VLLB 2X4PA 5I16B 1T1YA 4Z7IA 3ZL4L 4ZW7A 1ZMYA 4DN4L 1OGAD 1MCBA 3LV3B 2HA1A 4FHJA 4LSVH 2BO0A 4ODTH 2H2PC 3V4PL 2YOCA 2W65A 1HHIB 3PHAA 5E5MA 1EO5A 7CGTA 4LP5A 4E9WA 3FAWA 2X6VA 2JCCB 5C9JB 1M3IA 4K94H 4M4RA 5F71A 1X4YA 5EC1A 5HJ3B 4WNJA 1MHEB 1MI5D 4P5MB 3TO4D 4ZS7L 2DQDL 1RJYB 1OWWA 4J6RH 3BWSA 3CFKA 3LKQB 3O41A 4L29A 1INEL 4BHUA 4D0BB 5EZLB 3ZE0F 2JQMA 4P2RA 3TEUA 3VFGH 1E4WL 4AYBA 3MV11 2H32A 1KTLB 2OBGA 4L2YA 4OGZA 5H94B 5I75C 3T6XA 2BCMA 2CO3A 1Z2KA 2ZYSA 4KKPA 5FO8A 2GJZA 2Z35A 2WINA 5IMKA 3D69B 2WWMC 2YEVB 5GS0L 4JMXA 5E8NA 4JS7A 4FABH 1N64L 3HZMB 1EZLA 4MJIE 4J3TA 3T5WA 1YMHA 4U1HB 4YNYB 4F1SA 1MFBH 4GQRA 4QRQB 4UDTA 4CN6A 4B9JA 5KYWA 4H8QA 2KERA 5T3XL 1BOGA 1IGFL 1KLFA 1L4IA 4LASH 2UYLA 1PKOA 3CXFA 4ZX5A 1OCOB 2VISA 5GGTL 4I18A 5TDNA 4AQ1A 3EBIA 3M7OA 4L1HA 4Y4HA 3WFHB 3LKPB 4MAYA 3RDJA 1X5KA 5F9OH 2CXGA 3G04A 1L3WA 1GY1A 4KTEH 4LHUA 4D8PA 4TSBH 4P5TD 3ZE1E 1FVCA 2ZAGA 4FQIL 4JDEB 3HMXA 1H8LA 1IGYB 4XP4L 3QULA 3JWOL 4EOWH 2Q9OA 4MNGB 5F7FA 4PSRA 5GGVH 3QQXA 3W39B 4EBQL 2K8QA 1B0WA 3KVPA 4NO2A 3K4DA 3MRFA 2NSQA 3S37X 1IM3D 2DYRB 1RZJL 3Q8FA 1U8NB 2EIZB 4HUCA 1GC1H 3UAJA 2UUDH 3MRHA 5I6PA 2XX0A 1NDGB 1RUML 4PJHA 3FN0H 4LF3A 3KJ6H 4PGCB 4FG0A 3VJ6A 1QFWH 4KBPA 4YDKH 4NUGL 4OI7A 1U8JB 4XC1H 2IPUK 2E0PA 1M2OA 5C70A 1G84A 3FRUB 1QZ1A 5HHMD 4UQBA 3EDDA 1HJCA 5CBEB 3BP6B 1JZEA 1FYTE 2QADB 4ERSL 2VC2H 3TJEL 2YKLH 3WFBH 4KK6D 4JFYB 1L6ZA 1YMME 1GJWA 4PB9H 4L8BB 2V9TA 4JO2L 3N40P 1KZYA 1JPEA 3ZDXF 3F65A 1EGJH 5D1ZA 1DLFH 1MFUA 5C07B 4IGBB 4CVXB 4N2CA 3ZKMC 5KAQF 1MJJA 1XSJA 5FF6A 1KCRH 5CZXD 4JRYE 1XVSA 5SWSB 2Y7SA 5IVXA 3NUKA 1CGWA 1WBXB 3DO7B 1A7RH 2Q87A 3TA3B 1T0MA 1JIBA 2JKNA 3Q7JA 1P9MC 2B08A 2V7HA 4P2OC 3KPLB 5E6RB 5IQ7L 3ETSA 4OGYH 4GT7A 1LQBC 1NBVH 3OKLB 4AVKA 5GS0C 1A4JB 3MLZH 4P23C 1OT1A 1PX8A 1JUFA 2DBLH 5DD5L 3MJGX 1B2YA 2JI3A 3R8QA 4AQAA 3UROR 3VSTA 3AQDA 5DRXA 1ZANL 2X0WA 1G43A 5K39B 2QSTA 3UCRA 2WNKA 2O5ZH 2MCPH 1UXSB 2J1ZA 4HIXH 5C0EA 4PI0A 3D2UD 1W0WB 3QIWD 4K3JH 1N70A 1Q4NX 2YLHA 3DX3A 4P2AA 4M62H 5D1XC 2XETA 4IBLT 3OAYH 5KBLA 4DTGL 3UOAB 3ULAB 4R97B 1I3RA 1T1XA 3MBEA 2CQVA 3PWLB 4DPCX 3ZTCC 2ZOOA 3JWOC 3AFLA 3QXWA 4XWGH 4HZLB 1IEBB 1E4XI 1SXAA 2Y5TA 4ISVA 2DI7A 4OW6A 4G71B 3O2VH 4NKOA 4APXB 1NCUA 2ZXWB 3CZFB 1NM9A 5DK0B 5JPMA 2VLKE 1K4DA 5MP6L 2J2ZB 2JXMA 2KH2B 3VWJD 4W9FC 4F2FA 4C56D 3HZYB 1HFUA 2PCPB 3IFNL 4QY8B 2K78A 4ELDA 1MUJB 4LGSB 3K80A 3RB7A 4IRJD 2OZNA 1XR8A 3AG1B 4G59C 4WVRA 1TZIB 4HOMA 4TTDD 1Q94A 5IQMA 1RERA 4HFUL 1C9SA 1QSEE 3EOAA 4HU2A 4XNMB 4LRIA 5FWRA 2EABA 3CBJB 1F8TL 2EIJB 4Z23A 1FFNA 5DD0L 3HN3A 1DBAL 4YIQA 5F0JB 2PPEA 1DUZB 1MVUB 4NPJA 4XXWC 4QDGA 4HPOH 4JN2B 5JOEA 3B2UD 5KSAA 2XLLA 1S7TA 1T7YA 3TBTB 2DJMA 3D87B 2NUTA 4GKZA 2EE3A 1GCYA 5ACZA 2A9NH 3GIVB 3BMVA 3ESMA 4HV8B 1RFDL 2Y1ZA 3SDXA 1TMQA 4MVBC 3PDOA 2ITDA 2RB8A 3FQ2A 4ANKA 5F7BA 1LK3L 1DBKH 2BWIA 2H6PB 4U3CA 3CZGA 4PJCB 4KAQH 3CVHL 3IVKA 3DVNB 3MJ9L 2AQNA 2ZP9A 4OLYL 1GHFL 5ICUA 4HK3N 4OFQA 4LMQE 1IM9A 1I8IB 1BWWA 3OB8A 5I1GH 4J3OF 4MS8D 1JF6A 2H5UA 2XCMC 1SOXA 3V7AG 1AXSB 1RK1A 3N1PC 4F92B 5DHYB 3K71A 3FQ4A 3SCMA 3CK0H 3IMUA 4AMKH 4RRPA 1DDHA 2HJKB 5I71B 5EEUA 2W9EL 5FLVA 1X5IA 2OW7A 5ANMA 5I74C 4OFVA 3PWPA 5HGAB 5GHWH 4PP1D 1CD0A 1QBBA 5GSVB 3VQMA 1RVFL 1QPPA 4M8VA 5I2IB 2WQWA 5IFJB 4PPTA 4U1JB 2V7NA 1PG7W 2XYBA 4GFTB 3D8MA 1UB6B 1N4XH 2W07A 35C8H 2APVA 1P84K 4G7RB 2VKWA 5IF0B 2R15A 3BPOC 5AZEL 3S36L 2AEWA 1TFPA 4C4UA 1INDL 3DHUA 1YN6A 1NDMA 1KCWA 2NYYC 2AITA 3BKML 3PAVA 5C86A 4JFEA 3S88H 3ZMEA 5TDOB 1IGML 3ZIYA 4IRSA 3RZCB 2JK5B 3QJQB 3K4AA 1QTSA 3GMQA 5BOZG 3FRPA 3O9WD 4IS6B 1NCWL 3GXDA 5EIVA 1UWFA 4L9LA 4OZGE 4B0MB 1SXZA 2PXYA 3P73B 2K6YA 2WZ6A 1JGVL 1SEBB 3F05A 4Y8AA 1NJ9B 5I0ZA 4Z95H 1NFIA 2EE9A 4L4TA 3CAFA 5IVZB 4BZ2L 1NBYB 5CGYC 1EXHA 1MXGA 2OTUA 1B2WL 4NQEB 4L37B 1A1MA 3DMMB 4X7SL 3MDJA 3RIFK 4X99A 3EDFA 5CP7A 2ZKYA 4MX7B 4X8XA 2ZOKA 2NX5D 4FTDA 5E8PB 3TNNB 4FE9A 3DARA 2NNAB 3RL2B 4XZUA 4MJIB 1NCBL 4UINH 2PCYA 1QSFA 4M7LL 4Y19B 5IJVB 4FLSA 5D96B 3IFPA 2B8OT 1G7QB 5FDWB 5E2VH 2RCSL 1S7QA 2OJZH 3SGKA 1AGCA 2B3RA 3E6HB 4I0PC 3HCVA 4MA1B 3QNXB 4NXSA 4XI5C 3TWCL 2BIOA 2EECA 4LAJH 1P7KA 3DURB 2PWEA 4OGQC 1SOKA 3V0HA 4KKNA 4OSUH 3BLBA 5ITFA 1OL0A 2DLFH 4UYPA 3QDJD 5CZKA 4GUOA 2DY2A 1Z3GL 1XF4A 1BECA 2CWRA 5DUPH 4D9LH 2CO2A 1YEHL 3OAYK 3ZE1B 4NOFA 4AITA 3AS2A 5IB1B 2IG2L 3MUHL 2VXUL 1XV8A 4HIIA 3IEAA 5D2LA 3MA9H 6TAAA 1Q9OB 2JNZA 3QXUA 4U1MB 3KM1A 1NEZB 1QW9A 2EDKA 4QRPB 5DS8A 3RI5F 1QRKA 5BNXD 4O9HH 2VXVL 3D3VD 3V6OA 4UOW1 3W9EB 5D7EA 1YQ2A 4IOIA 1TTCA 5IEHA 3MREB 4HGWB 1PLGL 2YGOA 2F53E 4MXQC 4OFIA 3I75A 2XN1A 3DRQA 4I7ZC 1GS7A 4S0SD 4HPYL 5I1DA 1JMZA 4W9KC 3BYYA 2XXGA 3NK3A 1OKEA 4JPVL 2WVTA 3QZOA 1DVSA 1XZ0B 1NOFA 1ASQA 4HJEA 1KTBA 3BJLA 1T03L 4HH9A 3L9RA 3V6ZA 1RSFA 2WGNB 1FYTB 3MRRB 5TGBB 1ZVHA 5J9PB 2F54E 1K9TA 4RMWA 3T4AA 4A2HA 5E8EA 2JKSA 2O61B 4WY7L 2IF7A 5HHOD 3V0AC 1WZ1L 2N0KA 3BUIA 4JZJB 4DZ8A 1L7TH 1UJ3C 2A83B 2E7HA 4WFHD 4KI5F 1U3HD 2FDBP 32C2A 5EUKA 1W8EA 1FH5L 3KPNB 3G5ZB 3MOQA 4FLQA 2J6EA 4L4JA 1X5HA 3UAAA 5DWPA 2OSLA 3ZL2A 3RTQA 1FVDA 4NNPL 4U6VL 4PIBA 4JRYB 3ULUL 4A67A 3T8VA 3T09A 3BW9A 3DPDA 2JIXB 1M56B 3BWUC 4QTIH 2EJ1A 1A0QL 1SYSA 2P3YA 4WKZB 1JZGA 4XXDA 1RY7B 2IJ0C 1T83C 1E30A 3MRKA 4KO7A 3FQNB 2IWKA 3DV6B 2N7AA 2CXKA 2DMBA 2ZWSA 2BVUA 1G6RH 3SKOA 5ESVA 2L3BA 5BRZB 2RJMA 3NSDA 5IUCA 1NUNB 2O1AA 3MCKB 2QEJA 3RX7A 1HT6A 3NZHH 2OJ1A 2W94A 1U93A 2CHNA 3GMOB 2H4EA 5DO2C 3JWNH 2IADA 5LBSL 1JGIA 3LN5A 2WB1A 2R7EA 4UZSA 2YR3A 4QYAA 1M6OA 2XVKA 3KLHD 1HDMB 1TOXA 1ITBB 4GP4B 4E9TA 3CZLA 3MV01 3NJGA 4XODA 4MCYA 4RIRB 2EINB 4ZO9A 4DVRL 3GSQA 4EMZA 3BSGA 1XGQA 5FCSH 2H1PH 3OHXC 5IB3B 4QO1B 4NZUH 4LCIH 4HT1L 5EBMB 3LEXA 2ICEC 4H26A 1SHXA 5IHZA 1YEFH 4EUPB 3MXVL 3QFJB 1MVYA 3E6FA 4YR6B 2QQNL 3NIDF 2E7BA 4M6OL 2VLKB 2G5UA 4MZ3A 1V3KA 1MKFA 1RL1A 3DJTA 3IDMA 5LGKA 4IBWA 2X53A 3F7KA 2ZZUT 2IQ9L 2KKQA 3U1SL 1E9QB 3TCXA 1BF5A 4MD5B 1HH9B 2C4XA 2P45B 4B97A 3U0PA 1DCEA 3ULVL 3A6CL 2H8PA 4BE5A 2C1PB 4PJBF 4ENEC 3DUUA 2LHAA 3ARGB 3PJSA 4Q6IB 1S8DA 5T5FH 3QIUA 4PLOB 1ERNA 3DK0A 3QNYA 1C16A 4PTUB 1RU9H 1KF9B 4ZAKA 4R4FL 3ZDYE 1JGDA 3FFCB 3LXAA 5E2TH 1F3JA 3V4VA 4XX1E 1BAFL 3CZEA 1AY1H 1BF2A 5C08E 4OCWL 8CGTA 3VRJB 2BHFA 2BCKA 3C6LD 3O6KL 4J3XA 4DAGL 4JQXC 1SBSL 3D39E 5G5DB 1AS7A 1U8QB 2XHNA 1SJEB 4WO4C 4Z3TA 3W0WD 2Z4QB 1WHPA 3C5ZA 3PHQA 3U9PL 5EU6E 2QBWA 1XCQB 4LNRB 4D9RE 4F7EA 4POUB 3AC0A 1LDPH 3DO4A 4BK8A 4QHNA 2PPDA 4J6RL 3BVWA 3L3JB 1T66C 3EHBB 2IH8A 5K59E 4Y4KC 4W4NA 1B0GB 2AV1B 3ZOAA 4FNUA 4R9HA 3T65B 1LEGA 3OKOB 4UZGA 2OSXA 2JB5H 2Z7WA 2DOCA 3VMOA 2GBUA 4A2GA 1AQHA 1RPKA 1ETB1 3F7RA 5I1JH 3QUMB 1HI6B 4JRXD 3C6EA 4YHKL 1XGTA 3ROLB 3U25A 3TESA 3GSNH 2C5DC 4N2HA 1M2VB 4NUQA 3LTVA 2PWDA 4KZCA 4BCZA 2XT1B 4IU3A 2OTWA 1N6VA 4C59B 4HWNA 4ORGB 4KKAC 1GGCL 4XPGH 3TVMA 3MRGB 2HX8A 4QRSA 5B1CA 3STLB 3B7YA 3PWVA 4P46B 5L4IA 4PJIB 4PJ7B 4AY0A 1XBRA 4N0FA 1B3IA 4PW3A 4W6WB 4UCFA 3ZZQA 1F02I 4H0HB 4HKZA 4GO6B 4OV5A 5DZNA 5KSVA 3QR1A 3B9KA 2WQUA 2IGLA 2CNYA 1EFXB 2AQ2A 1EEYB 1MHPH 2BOLA 3MTXA 5DVMA 1F3DH 4IIQB 5AAWC 4W9JC 4AI7A 4EI6A 2PO6C 4QTHA 5ANHA 1M7XA 4OZGB 4JM2F 1FSKC 5D70L 1EXGA 2D7OA 4H0LC 3SYQA 4URKA 4BQBA 2D7TH 3FQWA 4GEJA 3VXTA 2ICWI 3RTLA 4FX5A 1FZOB 1HNYA 1RIUL 4P07A 1KWKA 3UH8A 1R5WB 3ULVC 3ZKXB 3SDAB 4NNYA 4KK8C 2MNUA 5CIPB 4JZNB 2BNRE 4WWKC 4YH6A 4NRXA 1WC7B 1FC2D 2ISDA 5JW3H 5I1KH 2G9KA 1L3NA 4YMPA 3LN4B 4I2XA 1A6WL 2R51A 3HAEB 4PS4L 3X3GH 2FLMA 1A4KA 3JWDH 4KNQA 4R4NC 1JNHB 4P0DA 4TVSa 4ZW5A 3LXCA 1BVZA 3VWKC 5F97E 5E2UL 5I73C 3S3CB 4JY4A 5C0BA 5C0JB 2EXWD 4PB9L 3IDIB 2JLPA 2ZAIA 2XQYG 4OUUA 4DO5A 1OAYL 4FJYA 4NGHH 4FFWD 4Q6KA 5IOKA 3K6OA 1HCYA 1VADB 1T20A 3FFDA 1KUMA 5C0GB 1CE1L 1FL6A 1V7NL 4XT1C 5H37A 5C09B 3T0AA 3I9PA 4ZMYA 4KRPB 3B6SA 3V0FA 4LLQA 3SDCB 1U92B 3QRLA 5E08H 1JHKL 4GKLA 3V7MA 4RWYH 3W2DH 4Y88A 4V1DA 3SKJL 4F3FB 2AJ3B 2BVOB 3LPFA 2F53B 5DDHB 3LH2H 5LG1A 4I9XA 2Y1AA 3DKHA 4U7MA 3PYCA 2MPVA 1G7PB 1XIWA 2ZG3A 4IOSD 5D7IF 5SX5K 3LY6A 3ZZSA 4CMMA 3ARFA 3K6IA 1CQYA 1DEEA 2WSKA 4G6AD 4AIZA 1WRFA 1WG3A 3EOTL 4X6CA 5JPMC 5MENA 3GUTB 1FUNA 1IC4L 1ODUA 2ZXCA 2AAVA 1MQKH 3DX2A 3KPRE 4UIMA 3HC3L 1JAEA 2WANA 3O4LD 2F54B 2ZUWA 3RIAK 3X13B 2IQAB 1F58H 3BT2L 4F8PA 3CG8A 2VQ1A 1CXKA 1FO0A 1DQLL 4UV7H 3QR0A 4LOFA 4Y1AA 4BINA 3A3YB 4QF1B 5KYYB 2KDYA 4XCFH 1JNLH 5IFHH 3OKNB 3RWJB 5F9JB 4JFFE 4CGTA 3SGEI 4S0HA 5FYKE 2JV6A 3EGXB 3FCTB 1ORQA 5DQJB 4N1HB 4LCWE 1A6ZA 3K72B 1AHWB 4J27A 5EO1B 1RUKL 1A1OB 3D50A 4MSWB 1DQDL 1VKXA 5ESAA 4EZLA 2EILB 3CQFA 2E9BA 4PRHD 2OMYA 2Z8VC 1KN2L 1ZSHA 2MTAA 1GC1C 1MNUH 2Y22A 5LXVA 3F2LA 4BHUI 2VR5A 3FO2A 3AS1A 4TUOB 4LVOB 1W72B 4YHPB 2EIDA 2QGBA 4ZXBB 4EIGB 5AG8A 2B59A 2OJEB 1ECYA 3RWGA 4FFTA 4XNXL 3TBYB 3A4FA 2A2QT 3GBNL 2FT6A 2ZSWB 4DVBB 4CU8A 4UQIM 1AD0B 3RDTA 4KKCC 1WWCA 5HDLA 5JLZA 2O5YH 2CDGA 2V3DA 4OJEH 43CAA 5C7XL 4PS8A 1KGWA 3EJSA 1Q9KA 3AU0A 3P9LB 4YQXH 1F1DA 5FW6A 4AEIH 4Y5XA 4U1GB 3SY0B 5E6ZA 3DV4B 3GLAA 4M8QA 4LLMA 5CFHA 3K6NA 3RU8L 2X2UA 3PAUA 4PJFB 5E8OA 1OGAA 5HJDA 1A3LL 3U7YL 5IVXF 3DX4A 1LP9A 3U46A 3DX6A 1X6NA 4NCC2 1CMOA 4DP0X 1TO5A 3MBXL 1YY9D 4UUJA 4CMHC 4PJ8B 1CDHA 2PTTB 3N1FC 3QRBA 1TQCB 4KAQL 2XV3A 3GS4A 4GS7C 1MI5A 4Q4EA 3QWRA 5AYTA 1CWVA 3A6BH 3D07A 3KZ8A 1YUKB 1ZV5A 2J88L 4PRDA 4GSXA 3DBXA 2X05A 1OT4A 2PCXA 3VFMB 2H0FA 4FI7A 1CFTA 3DTXA 2C3XA 5LB1A 2P8MB 4UNIA 4DP2X 1KTKE 3P0YH 1IE4A 2XWDA 2EH8L 1RV6X 4X6DE 1N19A 2WNWA 3REWB 4FL4B 5JDJA 3FC8A 1CG9B 2DW5A 2V3EA 1HL5A 2YSTA 3QUXC 5EOCL 1L9OA 1Z9SB 5IBUB 5EEZA 1OANA 2EIKB 3I02A 2VAAA 1NANH 3MNWB 2Y1VA 3PJNA 1D5ZA 2ZOTA 4PCYA 5I8KL 2QPUA 1NGXA 1JV2B 2PR9A 3BN9D 4Y89A 5F7AA 3ZDYB 5J4MA 2DEXX 3C12A 4YS4A 4IJTA 5B1AB 5C08B 5HYQA 4AV4A 1NL0H 4HIEA 4NUPA 3SOBL 2G75B 1URZA 2WBXA 4F9PA 3ETTA 1FCCA 2PW2A 3AM8C 3D39B 1KPRB 3CQQA 3QQ9D 3G6DL 4OM1H 5ITBH 2R1YA 1DJZA 2DDQH 4PWJA 5ICXB 2X9YA 3K5SA 4X7TB 2V5TA 1UOLA 5I75B 1I7TB 4LSUH 2VDPH 2BZ7A 1T1ZA 1XSKA 2GCYA 3ZTEA 4Y5VA 1QNIA 5D1ZI 2AJSH 4HWZB 4P5TA 4HZAA 1A9EB 1EQWA 1BMWA 3U0TB 1GW6A 5K9QG 1WAAE 4AH2A 3HFMH 2FNBA 4E5XA 5DMGD 2IWEA 4OCXH 2B1HH 5F88A 5LNEA 5L88L 1IFRA 1TFHA 4FNLL 1IM3A 2HKFH 2YAFA 2Q7NA 4KRMB 3S8WA 3C60D 1I85A 1IB5A 1CZ8L 2CHXA 2W38A 3LRKA 5DWUL 5LBVA 4LXFA 4UOJA 1S5HB 1M7DA 4XVSH 4NUMA 3QRGH 5HTSA 3VGGA 4NM4H 2DM4A 2DWXA 3BVVA 4FZ8H 3BZEA 1KIQA 5HPMA 1MVFA 5KANG 5GS1B 2XWBA 3U4KA 4RMRA 1TEFA 3Q5YA 2C9PA 2QSVA 5E95B 3WHXB 4DK5A 3ECVA 3SO3B 1IVLA 4EVNB 2YXVA 3IBEA 5IHUH 4GSRA 1KLGA 3T1FA 3IF1B 4OJYA 2XV6B 4BGDA 3H6JA 5DUPL 4UWQB 1R3JA 4RMQA 3SGJA 4CVZB 1TT6A 2FRGP 2Y2WA 3EUDA 1ZHKA 1RCYA 3HNSL 3BZ5A 2C3VA 5I5MA 1SRDA 3V4VL 5EEVA 4NZTH 1BIIA 3APMA 4ELKA 4GBXD 3CSPA 3K8LA 4KKLD 4OAWB 4U6YA 4OB5L 4ZOCA 3PP3H 3FT4A 3SPVA 1GYAA 3QJOA 4ZT1A 3VI4A 5KG9B 3WEBA 3ZO9A 3IRZA 1Z66A 3FB7A 1NGQL 1TVHB 3LRMA 5E1AA 5CN3A 5JDSA 5E7FA 3OKKA 5AVUB 4KKQA 4HX1A 3KYAA 3A5VA 5JIDA 1CT8A 3V4PB 3WTUA 4ODSL 1UEYA 4NJAH 3P02A 3H3KA 4GXFA 4H1LA 1MOEA 1KY6A 2AQTA 3R19A 4BCYA 3OZ9H 4FERA 1R3HB 1AOHA 1TU2A 4XPFH 4YXKH 4HUVA 1JNJA 5HHQA 5A2KH 3F7YA 4P8QA 2R8SH 4MXWL 4HULB 5I15L 4MAUL 4MB4A 2MIZA 4LSQL 4FNPA 4MMYB 3H2PA 4G43A 2CIKA 4MMXA 5JXAH 2HRPL 2OXHB 3HC2A 5B39G 4QT5B 2R1XA 3FOLB 1EJOH 3Q1EA 2B39A 4W81A 3CIAA 3SPHA 3HBGA 1H8NA 4ZD3L 2XQBH 1JGLH 3Q2LA 4I0KA 4YOKA 4YLQT 4XP6H 3P4MA 1JRHL 4QTIL 2A7BA 3HR5A 4ADGA 2DICA 2OZ4L 5HYFA 3WTYA 1TTGA 1QFWM 3MOAL 2VMJA 1UG9A 3DIVA 4TSAH 4R6UA 1HOCB 1RZ8A 2CU9A 4GUPA 1J8HA 4H8PA 2FEDC 5DHDA 3TASA 4L5FL 1SN0A 4C56A 2BVTA 3WIAA 4D7PA 3RAJH 3FTVA 4KVCH 5D1XB 5LG6A 4ANWA 2OTPA 3X2QB 2XV2A 1MLCA 2YRPA 1H3GA 1O9ZA 4MCNA 3Q9QA 1CBJA 2XTSA 4NDMB 2I7SA 3AZUA 4KHTL 1D5BB 1E5YA 3VH8A 5DRZA 1PYWB 2YIHA 1HL4A 3HB3C 5KOVC 2ZWYA 1KCBA 3K0WA 3WG7B 3C8KB 1SOSA 4ZG1A 3GXTA 4JFFB 2EXYC 2XXMB 4M1DH 1GJIA 2GIYA 5ABZA 4IBTA 3FU0A 5CLYA 4UTBL 4UQ3A 4K5OA 4QTFA 1PD0A 3UBXB 2OP4H 4OZFA 5I1HL 1YEFL 4FXGC 2YUXA 1DYZA 1A9BB 1NBZA 4G8EB 1K6QH 1OB0A 1A5FL 2D8KA 1EAQA 1F56A 1KV7A 2X42A 3C08H 4G1EB 1G1KA 4P2RE 4QRRD 5FHBH 4CC4C 2BRRL 5C0CD 1F6LL 4XH2A 1JFQH 4X4XA 4WJKB 4MXVF 4BBWA 3QEHB 5IV2A 4WI4A 2BSRB 2DM2A 4H5SB 1ZTXE 2R59A 4FP8L 2EDNA 5DS1A 1FFOA 3F6LA 2NSXA 2MKWA 3AADB 3D51A 2EDEA 4UQ9A 2WO2B 4OJDH 2IFGA 5T5FL 2MTPA 2VN3A 3ELAT 2CGRL 3CUPB 4JHWL 3WGVB 3RJOA 5BS0B 2AJZA 3JV4A 3ULUE 1UVQA 3QJFA 2EDDA 4GKNB 1S9VA 1AS8A 4KNTA 1YECH 1DVFD 4EQ2A 1QAWA 4LKXA 1JE6A 1TJHL 3BH9B 2QKIC 3ZGHA 4GKSA 3ZT7A 2DQMA 3QJZA 1CURA 1SHMA 4X6EB 4W93A 5LGHH 5GZOD 4B9GA 1HXMB 1X4ZA 2Z64C 4EI5A 3ZJAA 1QQDA 5CJQL 3C5XA 2WAQA 1OE3A 4IM8A 4PGDA 1I1CA 2X4NB 1PIGA 3WNMA 2OMZA 3S96B 1AHKA 1A65A 3UTPE 3B9KC 3O9WA 4OZHB 1FO0L 4AOFA 4CL7A 4FXKB 4AZ8A 4LCCC 1PZSA 4DFIA 1T2XA 2VRQA 2WIIA 4UIKL 3FSWA 4Z78B 3LHPL 1N9PA 3MN8A 1MY5A 4XO4A 5IVNA 4NBYB 1KGIA 2R29A 1HHJA 2M2DA 1RZIB 4UBDC 4YFDB 4UT7L 3C2SA 3TOPA 4PJHE 4RH4A 3BPOB 4KFMA 4RMSA 2NX5A 2YMXH 5F8RC 3FMGL 3JWNC 3VFWB 1URIA 3CX5K 1OTUD 4MJ5B 5F6HJ 2YPVA 4W9LC 1IC1A 5CXPA 4F93B 2DQCL 4XPGL 4W9ZA 5FO9A 3LS4H 1MHHB 2CKBA 1KJ2A 3EJZC 4APQD 1A66A 2VMCA 1GKEA 3L6FB 1AKJA 3WJJC 1FPTH 3LQAH 3K74B 2LAAA 3FQ1A 2WBWB 4IK7A 1VFOA 3KXFD 4QI3A 1NCIA 2Y6SC 4RSYA 3VVWA 3QDJA 1QLEL 3S48A 5F7LB 4F20A 1BD2B 1D9KC 3UJJL 1WAEA 3OQRA 1NMCB 5IVXE 3CPLB 5GRUH 5MEOB 1AZVA 1IMHC 2Z93A 2C7UB 1PG7L 2H9GB 5JHBA 2BMKA 3FCGA 1A6PA 3HE7D 1VCBC 1RLBA 4L0PB 4RAHA 2BP0B 4MDJB 3UIYA 2JQAA 3EJYD 4DF9A 3X1FA 3SE3C 5ALBL 3TJHC 1MIEH 3HLKA 3TT1L 5E6IC 4I0PB 3UJTH 3BUBA 1M3JA 3MYZA 5L0QB 1SY6H 2MKLC 5EA0H 2AEOA 1QEWA 2OW6A 2WKLA 3FQXB 3WKNA 4WI7A 2J5LB 3JWDL 5F3BB 3CVHB 2NQ3A 5GJTL 1CR9L 1F3RB 4KROD 1RUPH 3O0RL 4BWUA 1RK0B 4K3HA 3BAXA 4AVHA 1UXLA 3T2QA 5DK3A 5CD5C 4K8RD 3UPCA 4FQXD 1U2CA 4QXGH 2QLYA 3IJYA 1FF5A 1NUFA 1U8KA 3CSBA 1XZWA 3WJLC 4Z3HA 1NGPL 1ZIAA 4G6JH 1LE5B 4GB9A 4PJ7F 4NN5C 2V0AA 4FQHA 3MC0A 3GJEB 3CU7A 3UAEA 2E6QA 2N1KA 5GSRA 5BQ7B 2ICWB 1CFNA 2X2JA 1UM6H 1GA2A 4S0TD 3TBCA 3IU3A 2XRAL 3MRJA 4JFQB 3KPOA 4FYTA 4ZTPL 3OKMA 3MLUH 5CUSH 4OCYH 4PJGA 1UXWB 4LLDB 4ONGL 5D6DA 3CXDL 2GVYA 3OJDB 3C09B 4JPQA 4XVTL 4XMZA 2RALA 1NBCA 5DLMH 4ODUB 2FK9A 2DQEL 2YMTA 4UM8B 3OR7B 5DJ8B 3BP4B 5KSBA 5GRYA 5C0AD 5TH2B 1C08A 4GRLB 4QHKI 4C83A 3MLYH 1BZEA 4ZFFB 1SMDA 3PIQA 1WPCA 4PEEA 1H3PL 4ZYKB 2NZ9C 1E8XA 3AXHA 4BSVB 3O3DA 2WZPD 3O2DH 1YQVL 1U8CA 1WZAA 5JIMA 2R9HD 1MAML 3BRDA 1U95B 5JZ7D 5CGMA 3QG6A 5EZJB 5JW4M 2G0LA 1Q1JL 3SDXE 1QPKA 1RSYA 2JH2A 3I3EA 3WFEH 4NM8L 1QATA 3INUH 4MQXD 3D25A 5CZVL 1JPSH 4Z3EA 3BCFA 1IAOB 1JXGA 4NZRH 2FYVA 2DWDB 1DQQB 1RZQA 1OIOA 4MD4A 1B4JL 3LZFH 3ZBMA 1ZGLM 3L3GA 4WK2B 4H2AA 5DFVD 5CD3A 3EGDB 2HCZX 3MRIA 5CLXA 1YN7A 3HI5H 3TO4C 4BFJA 3BKCL 3C2AL 1A6UH 1Q1PA 2H3NA 3JXAA 4LAQH 4Q9RH 2IALB 5ANME 5C8JA 3IXTB 5I5IA 5HDRA 1IFGA 4LLUA 4K7PY 2EE6A 1OAKH 1YJDL 3JWDC 3ME0B 3MV9D 3PWPE 4MCZB 5JORA 3K6SA 1P7QB 2BOBA 1WVZA 4NO5B 5AL8A 2K1MA 5DT1L 4JB9L 2FIKB 4A63A 4KXZI 3WDJA 4J2XA 4AEIL 3IFOA 1IC0A 4Z0XA 1RURL 2X10A 3TWYA 1BREA 2X4PB 3CC1A 1ZS8A 1T1YB 2X6UA 2KZWA 2CK0L 2VQTA 4JCLA 4PSPA 5J8OA 2NUPA 5EBWA 2W65B 1KACB 5E5MB 4QUOA 4WTQA 3CZJA 2ZKHL 4JFEE 2XG4A 2FX9L 4HKXA 5ILTH 5EC1B 1HHKA 1I75A 3H3PL 1E6JL 4OM0H 2D73A 5CZRA 3W0WA 2TSBA 3FO0H 5AWNH 3RVTC 5KVEL 1S5IH 1JPTH 1G1YA 1A7QH 3E2HC 1Y0LA 3CFKB 3HS9A 1BZ7B 3O41B 4L29B 1FNHA 3GTVA 3RWHB 4P2RB 3MO1A 4L4TE 2H0JA 4N2EA 3OZKA 4Y5VC 2DQUL 2FT7A 5TFSH 5B3JF 5FO8B 5IMKB 2HFEA 2IAAC 2Z35B 4UT9A 4P5TC 4HGMA 4Z7UA 1NIFA 3ARBD 2E56A 3N5AA 1Z1WA 1HAWA 4JRXA 4OKVA 1QSFE 1OLZA 5E1HB 3Q5TA 1B90A 1MHCA 1FNLA 1V5JA 2AMGA 2X6CA 3QR2A 4OLWL 2HXAA 1DR9A 4WO4B 5KYWB 2NT1A 3HG2A 1MZYA 4MAZA 3UYPA 2CJUH 2UYLB 4K5NA 4U1NA 5I1AB 4ICXA 1OTTD 4MYPA 2VISB 2OMTA 4I18B 1OAJA 5TDNB 4AQ1B 5E6YA 4YE4L 4Y4HB 5FKAA 2GTQA 3P77A 3DLQR 3L95A 4ICWA 4N22A 3G04B 3PFQA 4PTTA 1FGNH 5DD3L 4H20L 4F15C 1BVOA 3MSPA 1N8OE 1FVCB 1JCKA 4QD2E 4UV4H 1OSEA 2NW2A 2DJSA 3IE9A 5FUZH 2DLTA 4QRAA 3APDA 4KK6C 4MA8L 5D2LE 4PJFF 4M9PA 4NO2B 3MRFB 4I1NB 5L9DH 4JDZA 3KLLA 1QRND 3BVXA 3VGHA 4PG2A 4WI0B 4AL8L 3V6OE 3T0EC 4JG0H 2VZOA 3QQ4A 4LSPH 3B7SA 3PAZA 4I3SH 4LVHC 5J6HA 5H4ZA 2CHDA 1YJDC 2J1KA 2RBLA 3IBOA 3MRHB 3QHFH 4M7KH 5DK2A 2QPFA 3HS8A 4PJHB 3AT9A 4NLAA 3OMNB 5B3NA 1A2YB 3OG6B 4QOKA 3VJ6B 3ARDD 1ADQH 2Q3XA 2V2WB 1MJ8L 2Y1YA 5FYJE 2VXTH 2RTTA 2NXYD 4HQQL 3CFBA 3DJRA 2RMNA 5C1MB 3A4AA 4HS8L 2IPKA 1JWSA 2ESVD 2IAND 4CJ1A 4Q0XL 4BH8A 5EUOF 3I9IA 3D33A 4W6YB 3GKWH 3QI9C 5K9OB 1E27B 1LP9F 2PO6B 3W38A 4IKKA 2E6PA 1CDYA 1KBGH 4X2UA 4G7QB 1FSKB 1LK2A 2BERA 2V9QA 4LHQB 1KMGA 1ZK9A 3EYUH 2AHIA 2HKAA 1TQVA 4AV0A 2I9LA 1C5CL 3K2UL 4YVNA 3SPIA 5D1ZB 4NRYB 4BUGA 5EG6C 3QIWC 4C4BA 2WYTA 1MJJB 1D5RA 2JVUA 4TMPA 5FF6B 3MRQA 1ZHLA 1MCCA 1FORL 4GW4A 4J23A 5CR1A 3ZDZB 5D5MA 2M83A 2UZYA 2H7WA 5SWZD 4CSPA 1T0MB 4ZFZA 3OQ3B 3F7VA 2V7HB 1AO7A 2DQIH 2UV3A 1BMGA 3HC4H 2MNWA 4U0RC 4NHCH 1UH2A 1P6WA 4AEHL 2F58L 2ZF9A 4JO5A 3V6FB 1WFMA 3ZE2F 1TJXA 2QSCH 2PNDA 1JUFB 4N20A 3F58H 3RUGA 3PV7A 1DBJH 3SJVB 5B1JC 1BM3L 3DSFH 4AQAB 4YSUA 5A2BA 1W6LA 4MD0A 3VWKB 1E4HA 1W0VA 5DRXB 2DYSB 3CZSA 3PP4L 2CLVB 5F9WC 1SHWA 1OZUA 4KZDL 1B6UA 1QO3A 5C0EB 3P3YA 3VWJC 4AXWA 5JQIB 2K9UA 3LKNA 2FL5A 3S2AA 2CNZA 3ZKND 1M1XA 4X9FA 1S3KH 4FQLL 5KVGH 4PY8J 1XH3A 2B9BA 2R29L 2WWOA 4PUBH 4Z7WA 2CO6A 4J3WA 4HBCL 5HP5A 4IRJC 5DEFA 4AGNA 1UD8A 2Z8SA 4ELMB 3LNDA 2CRMA 4PR5B 3TN0C 1CL7L 1E42A 1F11A 1H8SA 4PJ9D 1I3RB 1T1XB 2RD0A 3CTTA 3O3EA 3RWCA 3HVNA 2APTA 1CXEA 3THML 2Z34A 3QB7C 1BJ1J 2YPVL 2P5PA 1U42A 1KXHA 1XHHA 2F0CA 3U4AA 2Y5TB 4ISVB 4YHYC 4NQCD 3MJ8A 2X0UA 3CC5A 4C8XA 1K5WA 3B2UC 1LO4H 1KJ2L 4NKOB 5FW7A 4AL8C 3NJNA 5I0WA 2F7IA 2W1NA 1O7SA 2NXZD 5EB9A 2JELL 2HUEA 4W9EC 2ZXDA 3ECUA 1K4DB 4KX9A 1VGEL 2JXMB 1LO3H 2ZX7A 3NSYA 4PRHA 4TSAL 3SDDC 3B7UX 1BM7A 5CMAA 4LEXL 3EADA 1VHPA 5F7DA 1PDKA 2O6CA 4R0LC 3NSJA 3VXRD 2ZQKA 2EDBA 5FM8A 3ARSA 2X0VA 2EDLA 2NY1B 1F4YL 5EV7A 4BYHA 5GGQL 1JD7A 5IROC 3IDNB 3MLXH 2FJUB 4NZFA 1QR1A 4MS8C 1KEGL 5HVWA 3EOAB 3VFRA 2Y36H 3I9GL 4XBEH 1FFNB 3BRGC 1JHTA 4A37A 1ONQA 2LVEA 1OTSC 1M42A 3FJTA 1KB5A 5KSAB 1G87A 1E9PA 1S7TB 3S34H 4P59H 4HMDA 4UQCA 3GHBL 1U2HA 4OFDA 5BV7L 4GKZB 2R0KH 2GK2A 2QMJA 4PP1C 3CHPA 1A6AB 1KJMA 5KJRL 4AK1A 3SDXB 3PDOB 4O2EA 5DJZA 4CBZA 1SM3L 2D31A 3NIFF 1EGJA 2F6AA 2OP4L 4OF7A 3LDBC 3PGFL 1CI3M 1UOWA 1YMMD 4RGOL 1U30A 1FH2A 2NY4C 3L9BA 4RX4D 3VD5A 1J5OL 5FAAA 4DP1X 3BSHA 1IGJB 1R4XA 2AABH 5FHBL 4KH2A 5E2WH 4HKJA 1RK1B 3BLKA 5IW3A 1UWEL 3K71B 4DSYA 1QKZH 1BVKA 4MHHG 2L7EA 4NKDA 4QYOA 1A7NL 1IIKA 3VO0A 1P5UC 1JV5B 4FCAA 4LIQL 5ANMB 3GMRA 1A7OH 1RUQL 1QWUA 4KK5D 2B77A 4KNSA 4YDMA 1AJ7L 1OCWL 5HI3D 3UX9B 3FTYA 5FUCC 4XP5H 5ID0B 4RBPK 4KH9A 4GW5A 4F27A 1KSRA 4BK5C 2W07B 3M1OA 4KRNA 3QIBA 5F8QC 1OB1A 2XBTA 1JF5A 3VXSD 2FJSA 1UA7A 3BUPA 3P40A 4CU7A 2A9MH 1WO2A 4WU5B 4CMHB 4ZW3A 1YN6B 1NDMB 2DI9A 2IO5A 5HI4D 1BFOA 3CWGA 1OO2A 4J3OG 3IFLL 4JFEB 3CJJA 4KVNL 4OIFA 4NC1E 4U0QB 1D7CA 3X17A 1TZHA 3UCQA 4IRSB 1MWOA 3ULSA 1NAKL 4A39A 1MZZA 2YUZA 3GMQB 3AREC 1GAFL 3B56A 5J6GA 1P84J 3EOBA 5FUOL 4PU2A 5KYUB 4KTGA 1BBDL 2DEWX 4JRFA 3BVNA 3TEWA 3N50A 3ZYJA 4U1LB 3R4RA 3H56A 2OTUB 4IMKC 5I5RA 1PY0A 5L2KD 4LLYB 3KS0H 4UNUA 5I6OA 1GCFA 5CP7B 1AXIB 3P0GB 2R2BA 3MV7D 5IM7B 4XNZC 2GSIB 2YFOA 3C60A 4XZUB 5KS9B 4X50A 1QSFB 3WELA 3ZX1A 1Y6MR 1WHOA 2JTDA 3IFPB 4I2XE 3NJLA 4PRBB 2BFVL 2W91A 1S7QB 4WNQB 4G8FA 1AGCB 1RZPA 5BV7C 4X9IA 3HCVB 3NACL 3OTTA 2X4SA 2ROXA 1WWAX 4FZEL 3CXHJ 3KMDA 1OP4A 1P7KB 5BMFL 1VIWA 3WY4A 1F4XH 1MJ7H 1D7BA 1QSED 2OX5A 5C0BE 4HSCX 5ITFB 3U1QA 2VXQA 4HJIA 3BT0A 5CLZA 2QHRH 5JHLH 2ODIA 2BNUA 1WIOA 4HS3A 1HWWA 4Q9BA 5C0RH 2X1WL 3HHSB 6FABH 2ZCZA 4XHJC 4K55A 2P52A 3K3QA 3KR3H 3UPRB 1XF3A 2J55A 3NIGF 5D2LB 4L0YA 1CF1A 2W8CA 2B15A 2GC4C 4Q6YA 1M71B 2B20A 2E46A 5DS8B 4YAQA 5C97A 2V17H 1U3HC 4GBXA 3WXVL 4NPKA 3ZYOA 4IOIB 4V1DE 4H4NA 2FJHA 2ZYRA 3J2PA 3HI6L 4N2NA 4Y9GA 2F15A 2LU3A 1IKNC 4U3HA 1BEYL 3DRQB 3LPPA 1MWAH 5C92A 2EUXA 3QQDA 3QC6X 5LDSA 4KJQC 3H42H 3V5KA 5SX4I 1GMIA 5MENE 4X6CE 3NFPA 4CDGC 1LWJA 4FULA 2HTLD 3V6ZB 3Q1SL 3RY6A 1YRKA 1UWGL 1IRAY 2MHAB 3H9ZA 1QFUL 4OLVH 1E2WA 4ODHH 2RAMA 5JHMA 5E8EB 3WS3A 3SEPA 4R84A 4OLUH 4S2SA 2HH0H 4Y1AE 3N3EA 5DZAA 4NPYA 4DZ8B 1DSYA 5DJDA 32C2B 2W92A 2DD8L 4RAVA 4K2UH 5DZ9A 1YNTF 4OLZH 1BQHG 4FC3E 2LU4A 4O58H 2OSLB 4C57C 2A6DA 2P43B 5CR8A 4PIRF 1A4CA 1JVLA 3BW9B 1HVXA 2XVBA 1YEEH 2ATPA 4P4KD 3RWDB 3PGCA 3ZPDA 1SYSB 1TITA 2JQZA 5LJYH 4WTXA 3U9WA 1BWMA 1DBML 2WUBL 1IAMA 4RISL 3MR9A 5INCB 5EIIA 3MRKB 4PLJC 4K3EL 3DBSA 3UEQA 5T33L 3SKOB 3ECQA 1R5VA 3M17B 4DGYH 1Z9NA 2HJFB 2IGTA 4A1RA 4HJ0D 2OXGA 4XAWH 2HMID 3BLPX 2DH3A 1U93B 2WVVA 5FFGA 3UTOA 4ZFGH 3CFMA 3LN5B 3CVCA 3DVIA 4AWJC 5DHVA 1FE8H 3LQAC 4PS7A 5KEZA 1LDSA 3DJ9A 3KPQA 4GLRH 5TE4H 1D5IH 1FZKA 1USZA 3QO1B 4PRNA 4I4WA 2R69H 4S1SH 1HQRA 3TT3H 3IMBA 5IJKA