3TU6A

The structure of a pseudoazurin from sinorhizobium meliltoi
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
127
structure length
127
Chain Sequence
MEEYRVEMLNKAADGRVMAFEPAVIRAQPGDTVTFVAKDKGHNSALMKGGAPEGAETWKGKINEEITVTLSKPGVYMYQCAPHVGMGMIGAIVVGEPANLEAVKGIKYPGKSKAAAEKIFAEIESGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudoazurin (Blue copper protein)
publication title The X-ray crystal structure of a pseudoazurin from Sinorhizobium meliloti.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Electron transport
total genus 33
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3tu6A00
4DP9X 2BP0B 1I53A 1KYAA 1GY1A 4DP4X 2HRGA 3EHBB 3QJSB 2OV0A 3OD3A 4L0PB 2J55A 3UADA 1AZCA 2DYRB 2PPAA 1AS8A 1YLBB 2GSMB 4E9VA 2GHZA 3OM3B 4YSDA 2IDQA 4EF3A 2B08A 4Q8BA 2LLNA 2RACA 4GP8B 3QJTB 1J9QA 2FT8A 4PCYA 3X1BA 5B1BB 3CVBA 2HX8A 4YSEA 2PCFA 3N55A 1A4BA 3CVCA 3FU9A 3TASA 4G7QB 4UF7C 2VN3A 3IEAA 3NSDA 3UACA 1NIFA 1BXVA 1MG2C 1L9OA 1ZV2A 1NIDA 3NP4A 1XB8A 2EIJB 1SDDA 4KNUA 3FYEB 2IWFA 1PZBA 2XXFA 3UAAA 1V55B 4F2EA 3T71A 2J5WA 1BQRA 4A2EA 2IDTA 3FPYA 3H4FA 1OCCB 5B7MA 4KO9A 3QQXA 4YL4A 1E5ZA 2PPCA 3S3CB 1ZDQA 3FQ1A 1JZGA 2IDSA 3T6VA 2JXMA 4Q89A 4A2DA 5I6OA 1KCWA 1AS6A 4G70B 4WTQA 1A4AA 3CZUB 3UGEA 3X1GA 4KOBA 2PCYA 1R1CA 2CALA 2YAFA 4HALA 1UATA 1OCOB 1TKWA 3QJRB 5I6PA 4GP5B 3NJNA 1J9SA 2QDVA 1PY0A 1GS7A 5AFAA 1ZIBA 3IN0A 5I5JA 3NJMA 3EH3B 1F56A 1AZUA 2EILB 2H5UA 2AVFA 1V54B 4UAHA 2XX0A 1AOZA 3TBCA 1JZJA 1SFDA 3TU6A 3GDCA 2YAEA 4G7SB 2UXFA 2Y1AA 5TK4A 4BK5C 2B3IA 3T6XA 2HLEB 4K9JA 4W1TA 2XX1A 1OF0A 3H4HA 1HAUA 2ZXWB 2CJ3A 2FTAA 2HRHA 3C75A 4KNTA 1L9QA 1TEFA 4PAZA 4YVNA 4NB7A 2XV2A 1JXFA 1KCBA 1FFTB 7PAZA 3OQRA 4ZK8A 2BZ7A 3H56A 2FQDA 2ZWNA 2YAOA 2DWSA 3AG2B 3D12B 1JZFA 1PLCA 1GYCA 1BAWA 2BP8B 4GY4A 2IH8A 3T6ZA 1RZPA 4KNSA 2PPFA 4A2GA 2IWEA 3NJLA 3N2JA 2GIMA 4DP8X 6PCYA 4P5RA 5I6MA 5LDUA 2VMJA 1NIEA 2WO3B 4F2FA 2BW4A 3NSCA 2BZCA 2XV0A 2XUWA 1NTDA 1E67A 3UAEA 4WKXA 4DPAX 3IN2A 3X1NA 1AQ8A 5AKRA 5I6NA 1RKRA 1ADWA 4YSOA 2CUAA 4DP6X 3GYRA 4A66A 2IDUA 1SHWA 1JVLA 1N70A 4M3HA 3NJGA 3AG4B 4M4RB 1PCSA 1AIZA 3BQVA 3IE9A 9PCYA 1BQ5A 1XMEB 2UX6A 4G71B 6PAZA 3ERXA 3ZIYA 5F7AA 5I5IA 3SBPA 1RZQA 3GXUB 3WKQA 2UX7A 5D4JA 2W88A 2FQFA 3ZDWA 4E9YA 4BWTA 3PPSA 4BDVB 3EF4A 3NJFA 1PLAA 2FT7A 4HCIA 2QT6A 1A3ZA 4FAAB 1FWXA 1X9RA 3QJUB 4NERA 3FU8A 3V9CA 5I5MA 1TEGA 3OMAB 1PAZA 2VW7A 1CURA 1A8ZA 1PLBA 1AACA 3S8GB 1BXAA 3S3DB 2BWIA 3T9WA 2YXVA 1WA1X 1EZLA 4AKOA 4E9TA 3EH5B 1PF3A 4A2HA 1QHQA 4N8UA 3NJJA 1L9RA 1JZHA 3IBOA 4HZ1A 4TXVB 2I7SA 5F7BA 3X1FA 3FT0A 1NPJA 5B7EA 4KO7A 1QLEB 2A3TA 2BO0A 4DPCX 1M9WA 4HCFA 3ABMB 1W6WA 3ABLB 3NJHA 2VM3A 3U25A 5B3SB 2I85A 2IH9A 3FYIB 2BP8A 4HHGA 5B7FA 1FA4A 1PNDA 1VLXA 1AZNA 2TSBA 2GC4C 4E9RA 1GW0A 3S3BB 1PZCA 1E65A 2P80D 1L9SA 4DP7X 3MX0B 1HFUA 4HAKA 4YVUA 2MTAA 3QJVB 2XVBA 1JOIA 5AZUA 1NIBA 2GB2A 2UXTA 2TSAA 4AKQA 1L9PA 1E30A 4E9SA 3G5WA 2EINB 3OMNB 2J56A 4YSAA 1NPNA 2WSDA 2YQBA 1KGYE 1WA2X 4KO5A 3AW5A 1OE2A 2VW6A 4HCGA 1HAWA 2XU9A 1NICA 1SNRA 1W6LA 2UXVA 3T6WA 1L9TA 1OOWA 1ASOA 3NJKA 1MZZA 5IY5B 3X2QB 1JXGA 2Q5BA 4BDVA 1V10A 1MG3C 3FQYA 1IC0A 2FQEA 1J9TA 1XB6A 3FU7B 4DP1X 1SJMA 2DY2A 1PZAA 2H47C 1WAEA 2HX9A 3FPXA 3HB3B 2J57A 3AZUA 1IBZA 3HEIB 4GP4B 5E9NA 2Q9OA 2GI0A 3SQRA 5I6LA 1XB3A 3FSZA 8PAZA 5PAZA 4BXVA 3PAVA 4YSQA 3CG8A 1M56B 2AZAA 4GYBA 4ENZA 1M57B 1CC3A 1BEXA 4P5SA 1B3IA 2MRYA 2OCCB 1ETJA 2GBAA 1DYZA 2BHFA 1J5CA 3TA4D 2IAAC 2JKWA 1KV7A 1PMYA 1ILUA 4E9XA 2FQGA 3ZX1A 1ET8A 2E86A 4BWWA 1DZ0A 2PLTA 4KO6A 1QNIA 2CCWA 3WKPA 2BWDA 3NSYA 1ET5A 1GS6X 1SHXA 4HHWA 1AS7A 2XYBA 2XXGA 3RYMA 3WI9A 1KDJA 3NSFA 3CDZA 4YSTA 1OV8A 2EIKB 2PPEA 3DTUB 3WIAA 1BXUA 1MZYA 2ZOOA 4RH4A 2OJ1A 1OE3A 1TU2A 1OCRB 4AI7A 1ILSA 2FJSA 1JERA 1ID2A 4DP5X 1JZEA 3TBBA 4A68A 1E5YA 1SFHA 4BWUA 2P80A 1KBVA 4AZUA 4DP2X 4QLWA 4A67A 3QJQB 3PXLA 1GSKA 1BQKA 1A65A 4E9QA 1GS8A 1GR7A 1WS7A 4CSZA 3X1EA 5B1JA 2HZHA 3BVDB 2R7EA 2XV3A 4N4YB 1J9RA 2PP7A 4FA7B 2WO2B 1IUZA 1AZBA 4GXFA 4NAJA 2IWKA 2NRDA 2VM4A 2Y69B 5D4IA 3FU7A 5PCYA 4CSPA 1ASPA 2HXAA 2DV6A 3OMIB 2EIMB 1NIAA 2QPEB 1T5KA 1PNCA 2UXGA 3DKHA 1OE1A 5B1KA 1AG6A 1AAJA 2CAKA 2YAQA 1A4CA 1ZIAA 3NJIA 1SF5A 4X4KA 1NZRA 3AG1B 2ZONA 3SBRA 1RCYA 3CDZB 1NWPA 4W9ZA 1SF3A 4G72B 2VSMB 2N0MA 2W8CA 3QPKA 4KOCA 3DIVA 1GY2A 4MFHA 2X88A 1W8EA 3NYKA 3MBWB 1WS8A 1CYWA 3SBQA 4DPBX 3PAZA 4JHVA 3ABGA 4G7RB 3AG3B 3FQ2A 3EH4B 1AR1B 2FNWA 2AANA 2AZUA 2JFCA 3AY2A 3FSWA 2QPDB 1NDTA 1CYXA 5I6KA 1NINA 4AX3A 1AZRA 2PPDA 5I28A 3CVDA 2I7OA 5EHFA 3JTBA 2PP9A 1EHKB 5TK2A 1OCZB 4YSUA 1KDIA 3KW7A 4BXSV 2BP0A 2YAMA 1BYPA 2DYSB 2R7EB 1IKOP 1JXDA 1IBYA 2AFNA 4E9WA 5A7EA 1ZPUA 2PP8A 1MDAA 2DWTA 2YAPA 3FSVA 3NT0A 1J5DA 1SDDB 2VSKB 3WNJA 4AKPA 2HX7A 3WNIA 3S8FB 2YAHA 3ASOB 2X87A 5B1JC 2FWLB 1ET7A 4YSPA 4JKNA 1AG0A 3PCYA 1JZIA 3FS9A 4UANA 3NP3A 3ABKB 3JT2A 7PCYA 4YSSA 4HIPA 2H3XC 2GC7C 2YARA 5I26A 4A2FA 4YSRA 4QKTA 3WG7B 5ANHA 4DP0X 4YSCA 2QDWA 3PAUA 1JVOA 2VW4A 1CUOA 2BW5A 2CBPA 2IDFA 1URIA 1NWOA 1N68A 3ZBMA 3FSAA 5FC9A 3UABA 1BYOA 2XLLA 2XWZA 5D4HA 2FT6A 5B1AB 3PLYA 4JHUA 4F7KA 1WA0X 1AANA 1ASQA 3L45A 1KBWA 3KW8A 3ASNB 3V9EA 2YXWA 1ZDSA 1X9UA
chains in the Genus database with same CATH superfamily
4IU2B 3TA3D 1MCPL 3T4AB 1CFSA 4LPWA 4KHTL 4MCYA 3LNHA 4KXAA 3BHBA 4PJDB 1NDMA 3V5DB 4WJ5B 4MDIB 2H45A 2J6EL 2J55A 4OD2A 3MJ9H 5IFHH 1WAAE 2NSQA 1MCWW 3O6MH 3VQMA 1B90A 4XB8A 3X13B 4B60A 4E9VA 4Y2OB 2VQUA 4DTGL 2ADFH 4M8VA 5HYEA 1EVUA 5KZCB 3RVWC 1JV2A 2WAHA 2EUXA 5JORA 3IJSA 5E24E 2F74B 4GP8B 2AKRA 3QJFB 5CN3A 4PJXE 5J1TC 5I26A 3LNEA 4PCYA 1F6AA 3SB3A 4P46D 4P2OA 4N6RB 4XMTA 3FQNA 2EVJA 2NCMA 5IVZB 3NA4A 4UDTB 1KYDA 2IVFC 3W3BA 5LDSA 3O6FA 4POUB 4XTRC 1QW8A 4TM9A 4V2BA 5T1KB 4O58L 1WPCA 4B50A 3HZYA 3DX7A 4J28A 1ZSDB 2NUTA 3DIFA 3RZCB 1AFVH 1RK0B 1QI5A 2RAMA 1L9OA 3KPMB 1IE5A 3W9DA 1XGPB 1P7KB 5E8NA 4QAWA 5ERWB 3NBNA 2JKXA 1WZMA 5HYQA 3VSVA 3P11L 2VXVH 3MN8A 4AGPA 2ZOUA 3VNZA 3L3IA 4QHLA 1QRNA 2NY4B 4JY4A 1HZKA 4JFDE 1CG9B 2FEEL 2QQLL 4ATTA 2EH7L 3JWNG 4X6FB 2VC2H 4X6DB 1N67A 1A9BB 3FQXA 1FJ1A 4APQB 2DYPA 2XICA 4PJ9D 4X0KA 3IJ8A 3GZOA 4PCSA 3FKUS 4AGQA 1A6TB 4KY1H 4O02A 3A6OA 1I1FA 2GAZA 4LU5L 3TBTA 3X11A 4OSUH 4XXWA 3HN8A 4HPYL 4F1ZA 5F3FA 1N5AA 5FCUH 4X4XA 1AXSB 2MWCA 5EV7A 4JJHA 1JRHI 3NJNA 4P23A 1GGBL 1OD9A 4EMZA 1U8HA 1KPRA 1S5HB 3QI9D 1AKJD 1LWRA 2DMHA 2Z4QA 2BS8A 3OKMA 5CP7A 2BERA 5AAWA 3MOAL 5HI3C 4EN3D 3RVTC 3B9KD 3HRZA 1A1OA 4PWEA 2M26A 3WSQH 1A7PL 4OIIL 3GDCA 4ENED 2UXFA 3AQYA 4JJOA 2YR3A 1S3KL 3EZ8A 3D0VA 3GIVA 3CSFA 4JR9H 1JWMA 3BJLA 2NY0C 1FN4A 1U6AH 3AQZA 2WINB 4I77H 4LKCA 1S7SB 4WNQA 5DJZA 5SWZE 1HL4A 3U9UB 3UZEA 2CCVA 5FO9B 4G43B 3WTWA 3RWGA 4Z78B 1OHZA 1ZT7A 3HZVB 3WMPA 1FH2A 1A6PA 2E6PA 2FEDC 1PKOA 2FEJA 4YGVB 1MLCB 2GKIA 1CWVA 3SY0B 4U0QB 4ZOEA 1HE7A 3GS0A 3LRSA 3OLIA 5MI0B 2QJDA 1OAKL 4LVHC 3S88H 1CCZA 4QTFA 3V5KB 4CMHC 4R6UA 4I2XA 1BEYL 3TFBA 1S7UA 2LTQC 4P8QA 2HJFB 3BCDA 4BBWA 1UUNA 1RHHB 2OL3L 1A5FL 2VXUH 4OLZH 3VYOA 2BVQA 4PI2A 3NK4A 5DVPA 2DQHL 4AWJC 1T04B 1E67A 4R90H 5FDWB 3UBXA 3CLEL 3D2UB 3OQ3B 1XGQA 4LLWB 2F7OA 4XO5A 1YMME 4UINH 1T89A 4JPIA 1ROWA 3RUGB 3VI3E 4P4KB 5IB1A 4RFOL 1U3JA 2QPUA 4IBQA 1EX0A 3V7MA 4ZX6A 2OXGB 2IDUA 4FXKA 3QO1A 1CS6A 1RJLB 2WOBA 5DCCA 1ZGLB 1A7NH 2EO9A 3AWFA 1BBJB 2HKHL 1E8YA 4MA3B 4PJ8B 4KWUA 5A6LA 2Y7NA 2BSSA 1KEML 4ABUA 2A99A 1U42A 4R2GC 5C0BA 4XMXA 4ZOAA 1D7CA 2N1KA 3BESR 3MNDA 4JQVA 3FO1B 3C8KB 2XQ0A 4FCAA 4GRMA 1AGEB 4NQCE 4YBLB 3MRDA 4R97C 3MTXA 5IVXE 1RV6X 5IHHA 2VE6A 3GB7B 3WD5L 1PLAA 4HV8B 1RULH 2J3SA 3ESUF 1JUFB 2WJ7A 3BAEL 3C60C 1AMXA 5F44A 3NCYP 5JNYA 4GO6B 5C0GB 4XMUA 1NAML 2Y22A 4WUUB 1NEZB 5BRPA 2AXGA 5D9SA 5ETUA 1SN5A 1R3LB 1BX2B 2MHAA 5CCHE 5CLTA 2BWIA 3P4LA 4LESA 3L16A 3MFFA 4X5XB 1BVNT 2ITCA 3C6SA 5L2KD 1HI6A 5DEJA 4XOAA 5KVDE 4E9TA 2WTOA 3QUGA 4G6ML 5TDNA 4QEGA 3QYNA 2XG4B 3AU1A 1PG7W 2I7SA 2QVIA 5C0CE 5HHXL 4HJGA 4QUOA 5E08H 4U0RB 5AUMB 1EAQA 1TETL 2A3TA 1SBSL 3KWWA 2L04A 4GMTL 4NO0D 4NZUL 3D3VD 4R5TA 4LK4A 2NY7H 3EFFA 2ENPA 2FX7L 1F6FB 2H1PH 4QRRD 3D09A 2BP8A 5TJWK 1PNDA 3RWFB 4ADIA 2DWEB 3U2SA 1KXVA 1FNLA 5F6IC 5TQ0H 4WCYL 4AE0A 4U33A 3WFEH 2F5AH 3VXSD 4XO3A 3V8OA 1KY7A 3II3A 3CPLB 1QUPA 2BM3A 3WEAA 4NLHA 3TEWA 2VITB 3LKRB 5E2TL 3T8XB 4CVWA 1TTCA 1ACYH 3KPRB 3TOPA 1P4LA 1IEAB 1JOIA 3W11D 2BVUA 3BO8B 5HYJD 3D39B 4FFTA 4E9SA 4B0MB 3STZB 3HCVA 5CIPH 5HDQH 4UQ2B 5GHWL 1HHKB 1L6XA 1VGKA 2X70A 3VE0B 1YRKA 3KMDA 3AY4C 1J0HA 4J6IA 2WP3O 2MNWA 3K5RA 4L05A 4Z0XA 2W0PA 2J43A 4JRXA 4LOUD 4WWKD 1YPZE 3EFOB 3TBYB 5SWQB 4KH2A 3SDCB 4X9YA 5K1JA 2AK4D 1BBDH 2VISB 1IC7H 4DCQA 4X98A 4KJWC 4FL4B 2YD6A 5AOKA 1E4XI 3I6KA 3ROOA 5C08D 2OMUA 1FFPB 1PZ5B 3O11A 2O61B 1J9TA 5DUBB 3KXFA 4Y8AA 1WBZB 3ARDB 2E7LC 1JNNL 2QGCA 3TNMB 2XFXA 4GS7C 4KKNA 5FV1L 1HU8A 1O7SA 2XJKA 4EZMA 2G9HA 3QCUL 4JM2F 4IDJH 2GSGA 2EE2A 3B5HA 2HUEA 4OUOA 1A6ZB 3DX1A 4UZSA 2Y07H 5F72S 4LLMA 1E6OL 4OFIA 1FPTL 4AYEC 3TGXA 2AZAA 3H2WA 1A64A 1W72L 3KYNA 3UZQA 3INUH 1AD0A 1XF3B 3ZE1E 1I8IB 4NBXB 4C56E 3L3GA 3KPSE 1KBKA 2OCCB 1IJNA 2VR3A 3RFRA 2FB4H 1QLEL 2BHFA 2Y23A 4KAQL 5JXEC 4X83A 5DC9B 4Y4KA 3IU3B 1I3UA 4E9XA 1AHMA 3C5JB 1NL0L 1NMCC 1XH3A 4R4FH 1BG1A 2EE6A 2WCSA 4HFUH 2AS5M 1O9WA 3T65A 1SHMA 3VSQA 2K7PA 3CLWA 4P3CH 1G0DA 1H6EA 3MMEA 2J8UB 3HNSH 3NPZB 3VI4F 5HBBA 5A2BA 1WF5A 3JYBA 3QFJA 4MAYB 4ZSOE 3TBVB 2PWHA 1EFXB 1GS6X 4OLYL 1AY1L 1SHXA 4HOMA 3Q9PA 4OZ4B 5CGYD 1MFAH 3PGDA 3V95A 3AMLA 2IPTH 5DWPA 2CO2A 2PPEA 5F1IA 3TA3C 2GJ6A 4IYKA 5JW4Q 3MRKB 3ZDZB 3U0PB 2X7LB 4JFYA 2Q76A 3L4ZA 4M9PA 3C2SA 3MGOB 3V8CA 3IT8D 4TNWK 3GIZH 4LGPB 3HAEH 3KLSA 1OXYA 3P4NB 1I4FA 4JFEE 5D2LB 4J7RA 3KYOB 4LEXH 3TBBA 4Y4FA 2ZXBA 1WYJA 1OPOA 3NZ8A 4IU3B 4BWUA 1M7DA 4AL8H 4Z7WF 1P4IH 2DQEL 4G8FA 4LP8A 1QFWI 1H5BA 2HUHA 1R5WB 1Z5LB 1G6RA 1CXEA 4M8UA 1GC1C 1HK6A 5DJ0B 3LSOB 5HHME 1GZQB 4WWPA 2HZHA 4YHOH 2R7EA 3I3DA 5CAYB 4P46C 4TYUA 2WQUA 2E7HA 5PCYA 1IBGL 4MX7A 4HS8L 1WICA 4O9HL 3Q9QA 4D7PA 2LU7A 2CJTA 2WUCL 2MH4A 4IMLB 1FGVL 3GI9H 4Z7UB 2F1BA 2VMCA 1VFAA 3RPBA 1XGUB 3ARXA 2O30A 4GQRA 4IIQB 4ELKA 3S3PA 1BVKA 3DTDA 5KYXA 2ESVE 4OIBA 5E1GA 3ME0B 2DIJA 3U4AA 4BFNA 3WMQA 1JXKA 2NDFA 2IPUG 2OBGA 3TM6A 3RFZB 1SEQL 1HKLL 4NWUL 3UGXA 3HE7D 1VZGA 3LTVA 2FJGB 2DQJL 2NNFA 1DLHA 4I1RA 4PJ9C 4RFEB 3K6OA 1PX4A 3O6KH 2MQ0A 1KC5H 4FMKA 3EKCA 3T09A 4HS6B 4MJ2A 1UM4H 3D4YA 5AAPA 4NNXA 1G7LB 4M61A 5DFVD 3P4MB 3JZ7A 2V9UA 5IW3A 1DL7L 3L3HA 5D5MF 3EYUL 4DVBB 4PBDA 1R33A 4XNUH 1GKOA 1GJUA 1K5NA 4GKNA 2XCMC 4RAUB 1UB6A 4S1DD 3QI9C 2WWMD 2DH3A 1FYTB 1XGTB 1J12A 5EC1B 3UXFA 2ATKB 4EN3C 3B9KC 3S8FB 3DO7A 2ZICA 3LXCA 3G9AB 4UT9H 5HYIA 1T0NA 4ENEC 3KVPA 3PCYA 5AYQA 4G9FA 3WFBL 5GS0L 3NP3A 3HNTH 4MD5B 4XAKD 4EE2A 3IPEA 3NCFB 2FLRT 5MEPB 1CDCA 4NKDA 2WLHA 2VXQA 3SQOL 1TQWA 2HFFB 2VDNL 3SDDD 3CFCH 2A74C 1YEJL 4A6YB 1HQRA 4GRWH 4FQLL 4X9IA 1XZ0B 3AREA 3SJVD 3TIEA 3EHBD 2A9ML 1I8AA 3PRZA 2EIZA 1MFNA 4BZ1L 2DM2A 5FKPA 1N68A 1BMGA 5I74C 1IILE 1PX8A 5D7KE 1F0LA 2EYRB 3EO0A 3MRCA 3Q3GB 5ALBH 1T5XB 3CQQA 4NQXA 1QFOA 4P4RB 3QCVH 2Z0UA 2I24N 1PS3A 4PY8J 1PZSA 1XXDC 4Z8FH 1A7OH 4J3WA 3LD8C 3QQDA 2G2PA 4IKLA 5I1DB 2H8PB 2H3NB 1I53A 2A7BA 2D03L 2R29H 4OT1H 2ODIA 1K72A 1MIEL 3D52A 4Q0XL 2WY3B 2AJYL 1OAJA 3O6LL 4XHQA 2CRIA 3PHQB 1ND0B 3W57A 5BRQA 4MA8H 1O6VA 3C9NA 3LCYA 4W93A 1HDMB 5GZND 4FG4A 1IGCH 5D1XB 4IBTA 5FXCH 4AQ1C 4EF3A 4M56A 4N0RA 4GG6B 2VSCA 3Q5YA 2V5TA 3KWVA 3KPPA 2VN7A 2P49B 3X1BA 4F8NA 4PJEE 4R96A 1U3NA 1XL4A 3L13A 3A6CH 4ODBD 1J0YA 4MQ7B 2A1WH 3MRQB 2OJEA 4FJZA 2CBQA 2EUWA 4CC1A 3RY4A 4D8PB 3MJWA 5CSZA 2X05A 2WN3A 4OZFA 2OLDA 1EEYB 1U8PB 2ICEB 2Q86A 3II2A 3EUDA 2G75A 4QYOA 1BOYA 1IGJB 3FTGA 1KF9B 5D8JL 5DJ8A 5I6XC 2WB7A 1DVZA 2IDTA 4TQEH 1CE6A 3U30B 5HYSA 4DEUA 2OAAA 4GAGH 4EDXA 4PRDB 5C9JB 3GRBA 3T2PA 3DHJA 3UTPD 2WVSA 4HXAL 2PCYA 3HE6A 5J9PB 4B7LA 3GBDA 3LIUA 3N0PB 4WGVB 1UATA 1A6UH 1OGAE 3H0TB 4JB9H 4P5TB 4Q4IA 5EU6E 5KSAD 1FNEA 3RL2B 3KEDA 2PW1A 2IMNA 3QUKB 4KI5F 5CMAA 3KLHD 2WYIA 1U93A 3OKKA 1X5IA 2NW2B 3MBEA 3FFDB 4HK3J 3D7PA 3U1SL 5AFAA 2CO7B 3VACA 5DS8B 5I76A 3EH3B 3QORD 5IGXH 3BVTA 1NCCH 3QXAB 2XX0A 2WWOA 4OU3A 3ZHDA 1S8DA 5DK3A 5CF3A 2P42B 3VFRB 4A39A 3GKZA 3MCYA 3K72B 3FB5B 1TTBA 2BVOB 3QS2A 1VFBA 2H0EA 1KYFA 4LPTA 3EG9A 3W11C 3BRDA 1WK0A 2ZF9A 3HJEA 1LEIA 3DC0A 4I5BA 3U7AA 4WEMB 3MCKA 2CIIB 2WVUA 3B2DC 4XPTL 1XR8A 2EADA 3RWCA 4LCYB 5K9JH 5DJAA 1GPOL 5KJ7E 1NGWB 2NX5B 5JPMB 1GJIA 1M05B 2E74C 25C8H 2ZWNA 4LOUC 4WWKC 3SHSA 1YEFL 1F42A 4X7SH 3EDKA 1WITA 3UPCA 1UD6A 4RDQF 4AQEA 4F7EB 2UWEB 3MO1A 2N3JA 4KY2A 4KNSA 1JD7A 2FIKB 1KTKE 1MWAL 5D96C 5E95B 1ES0A 3IKKA 2DF3A 1I9RL 5HDBB 5E6ID 4WI8A 5B8CC 4UU9A 2DQFA 3FUFA 1S9YB 1CLOL 5EEXA 5FYKU 3P02A 4FNLL 4ZUUA 3SE9H 4I89A 5JHMA 2FWOB 2GEEA 1U8MA 3KCWA 1X6LA 5KJRH 6FABL 4N8VG 1IQDA 2X9YA 4NZDA 3RDJA 1BOGB 3WIIL 1RZFH 3L1EA 5ICZA 3MNWB 4B9CA 5C3LD 5FA3B 3ESVF 4GAJH 4M5ZL 3FCBA 3SGJA 4TNVK 4ZFQA 1MCLA 2VZOA 5E1AB 4DW2L 1J87A 2CR0A 2VRAA 3G5VB 4AGOA 3ISWA 1FORL 4Y9CA 2GABA 2F8OA 3B7TA 2DQMA 4OZHF 4AK1A 5AD0B 3H9YA 4O2FA 5JO5B 1F4WH 3OX8B 5CFHA 2Q3ZA 5E8DL 3HG5A 3TONA 1QQDB 3V9CA 1JYNA 1A7QL 2R69L 4RNRB 5CGYC 1BGXL 4MMXC 1R3IL 4MQSB 3T0VA 3PWJA 2APXA 4G80A 4Y19D 3SOBH 5BZDB 5CEYB 2OS7A 1RJCA 5EU5B 1Q9WA 1EZLA 3F7YB 2BDNL 2CLVA 4A2HA 2JKJA 5JUEH 4YHKH 3ZTNL 2X4NA 3W0WB 1F4XH 2C3WA 3TESA 4MXVE 3R7QA 5LB1A 2NSMA 1CF8H 4KNQA 4IMKC 4GXVH 4GW1B 1LTXA 5GJSH 4EQ3A 4P2QD 2O4EA 3QUZA 2IAMA 3ABLB 3QUXB 3S36L 4FA8A 4NQDB 1XF1A 3ATDA 3FB6A 5LAXA 4N8VA 3T1FB 2B5IC 1ZVYA 5KBLA 1R0AL 4U1KA 2RMNA 2JB5L 5F6HI 4DUXA 2DQCL 3AGWA 4FRWA 4IEFA 2DMBA 2PWGA 3CZFB 2GFBB 4Z5RA 1E65A 3BPNC 5F7EL 1DUYA 3LRHA 4LSTH 5E9DA 3S0PA 3KZ8A 2ZUSA 5GS3A 3DPBA 3JQOB 3LQAL 2HVJA 2XVBA 1RIHL 2X4OB 1Q8MA 1M3IA 5L7XH 1L9PA 1KTRL 4YDJA 1NKGA 3V4PH 3M1CA 1Z3GL 2NUPA 1MIMH 2ZE0A 3S34H 1KYUA 4OF6A 4KU1A 1L0PA 1YEEL 1YJDL 2F53D 3G08A 3LH8A 4KO5A 1TZIA 5FGRA 1OE2A 3LH2L 4L48A 3ARBB 4ZNEA 2IWGA 4F7CB 4G6JL 2D3LA 5CJOH 1B4TA 1NBYB 1NICA 2IMMA 1MH5B 1TT6A 3GJFB 2EQDA 3HE7C 3VFNA 1AQDA 3JT0A 1DJIA 5BV7H 4ODXA 3BAKA 4HFWB 1YHPA 4NJ9H 3CFKA 1V10A 3Q8FA 5EWIL 5C2BH 3QQNA 1TVHA 3C2AH 5DFVC 1HXMA 3GSRB 4Q6IB 4D0BA 3FDWA 3SDXF 1WDAA 2ARWA 5ID1A 3JWNH 3O3EB 1MFMA 4MYPA 3L3OA 3P9LA 1UFGA 2C8NA 1NCWL 4BFFA 1R9FA 4UYQA 4S1DC 3K6SA 3E8VA 3FB7B 3OC5A 2WWMC 1NUFA 4YSQA 4AMKL 1TITA 3RNKB 1TVBB 3V52L 4GYBA 1OT4A 4YR6B 3JV4A 1JNHB 1P9MA 4AIEA 5EUOF 1MAKA 3WJJC 1LO3H 4U3XA 4X7CC 4K9EL 1UH3A 2XWTB 3ZMRA 5D1ZA 4FXLA 3JWDL 2BNQD 1MHEB 4HJJH 5FW8A 1YNTF 4QRUA 1PMYA 3EJYD 4MDRA 1EPFA 5F0LB 3SDDC 1HIML 3KPLB 5T3ZH 2W9LA 3KGTA 1EAJA 1ET8A 4I18C 4DO6A 1XVSA 4BWWA 4TMPA 4I3SL 2FLMA 1NKRA 3EHBC 4PV9A 2WNKA 5LGYA 2UVFA 5DR5L 2JF1A 4GINA 4XVTL 4RRPM 5D70L 5L2KE 1FZKB 3OGOE 4AYDC 4K55A 1J18A 1J9CT 5I9QC 2WXJA 1CPUA 4RWYH 3PG2A 3CXFA 4NJAL 3WI9A 3CDZA 4IRSD 4EI0A 4HJ0D 2WZAA 1ZLSL 4FQHB 3BKJH 4F7MB 3T0EB 2FJFA 3D3VE 3L5HA 5ENWB 1MCKA 1CD1B 1WE5A 2FJHA 3UEZA 4QRRE 3L08A 2D7TH 4AI7A 1ILSA 3QEQA 1MY5A 1H9DA 2FJSA 2L7JA 3H42H 4BQCA 3NIGB 5DK0A 5AG8A 2C7UB 2JJWA 4WK0B 4F9LA 3VXSE 5E56A 1HC1A 5GZNC 3C6LD 5ADPL 4UIKL 3K1KC 1OAUL 1K4DA 3BH8A 3BISA 4Z7NF 4F3FB 3H2PA 5B1JA 4MBOA 5DD3L 3W2DL 4K3GA 3NZSA 1RLWA 3GXDA 5HYJE 1KGWA 2KT6A 3MRBB 5T3ZD 4P59L 1JPGA 4MVBD 2IWKA 3N85H 4CU8A 1T1XB 3A0OA 2EAEA 2P1YA 3DOSB 3G04B 3HHMA 1AR1D 1ED3B 2B4CL 4ODWA 2C9QA 4J5VA 4WY7L 4PJAF 4OVVA 5SWSA 4NFBA 5DK2A 3EH1A 1ZTMA 1G87A 2AK4E 2DMCA 3N43F 5CEZH 1AHWB 1RCYA 3WN5C 3ARFD 4TTDD 4M7JH 3PJSA 4WO4D 3OLDA 5E03A 2VMEA 3ZUCA 3MYZA 1FP5A 4HEME 1P5UC 1KPVA 3QIUD 5C08E 4QHUB 3PAZA 4WAFA 3LRLA 1OPGL 1LD9B 4P5KA 4TUKL 3WU1A 4HG4K 2CKBA 1BLIA 1TTFA 1FL5A 1MFUA 3N41F 4LCWD 2PXYD 5DD0L 4R0LA 3WKNA 5J11C 3QQ4A 1CYXA 1LE5A 3BUQA 1YA5A 1C12A 3H55A 4PRIA 1X9LA 5T5FL 2LU5A 2X4UB 3NFSL 5F9JA 1S3RA 2OTWB 1KTCA 4F33B 5DJ6A 4WTXA 5KSAC 5T8IA 1KDIA 4XBPB 4TULL 2LW3A 3P40A 4OR1A 43C9A 3KLHC 1ONQA 4ABQA 2YGOA 3O81A 1YNTA 3HR5B 4MMYA 5EU4B 1DSYA 3HBZA 3VDCA 5A7EA 5KVFH 3APNA 2PP8A 3U36A 1H8SA 4HT1H 4MJIA 5MEQA 3QORC 3KNBA 2PO6A 4CJ0A 3Q2VA 4JG0L 1IEBB 1QTPA 3NG5A 4JCLA 4L37B 4OQTH 5LQBH 4Z7QF 5FUOH 2YEZA 5A43C 4JKNA 2UVEA 5ANME 4BINA 1N64L 2JIXB 2KDYA 3OL2A 2FK9A 3R4DA 1I85A 4OH2A 1BWWA 1K8IB 5EIIA 2NQCA 3D9AH 5CEZD 4NO2B 5GISL 1NMAH 5AYUH 4OW6A 2AITA 2V2XB 2VDQL 2XT1B 4TOYH 5K9KB 2EO1A 5JMOC 3TF7C 3AABA 2QDWA 5H35B 3EYSH 5DHVA 2LLGA 1YZZA 3GS7A 4Z3EA 3B8SA 5I1HL 4PV8B 5I1KH 1KNOB 4FDWA 4PJFE 2AK1L 1IV8A 1WA0X 4PIRF 4PY7B 4R26L 3L45A 1KJVA 4WW1B 3FT2A 1OSZB 3KYMB 5AWNH 3FMGL 5FA4A 1ZHBB 4U6XB 2Q20A 1IBBA 1TCMA 3WL9A 2OYPA 2W38A 3FO9B 3MLYL 4N9GB 4EI5D 3KLAA 3ML9A 4NO3A 3ZDXE 2CHXA 2K7QA 4L3EA 3KWTA 2BP0B 4L9LB 4K07A 4HWBL 1KYAA 1OP3H 1T80A 1RQ5A 3KAAA 2YSSA 1TFPA 2V3DA 3QAZC 2WCGA 5E6IC 3OD3A 3BKCH 4AVKA 4L0PB 1TEYA 1QBAA 1TTRA 2XACC 4NHUA 4S1SH 5DVOA 2GSMB 3F01A 2XQYA 3FTZA 1JPST 5T1KD 3RWJA 2R8SH 5JHBA 1H0DB 3VXQA 4PJAA 4AUJA 5C6TL 3BAIA 2IDQA 4UOJA 4ZNCD 1PPIA 3PGCA 1UB5B 2D31B 2PF6A 1N0XL 3QXWA 1J1XH 3N1FC 5FOBB 2PYFA 1EAOA 1LP9F 2ZSVA 1SLVA 3VJ6B 5GS1B 3AUVA 5MERB 3I3EA 3PU7A 1MPAH 3DJZA 35C8H 5B1BB 4B9YA 1SJVA 4HDIB 2WKGA 3QFDA 5T1LA 4ODUB 3FAXA 4A7GF 15C8H 1X44A 4JQIL 5BUPA 3R06B 4HH8A 2GIXA 2G4GA 4U6TA 3TASA 3IMBA 2BC4B 1GOHA 4FJ6A 4PMFA 5BVJA 5EIQA 4ZTOH 5EF1A 2VN3A 4PCTA 4CVXB 2Y0SA 3B2PA 3EYVB 4APQD 5KS9A 4XPFH 2XNAB 2E7MA 4N2DA 3A6BH 3VA2C 4X6CB 4ZZKA 4TS6A 3R18A 4S0SD 4KROB 5A6MA 5JW5A 3QQ9D 3B56A 3IFLH 1P7QA 2P5EA 2XRAL 3BHBB 1NDMB 4MS8D 3W5NA 2WXQA 4OGXL 4YXLH 3QHZH 4TSBL 2L0DA 2OSLA 3FQ1A 4U4BA 3FCTB 2ZJSL 1DJSA 2W60A 2ZWSA 3QWRA 2VLJA 1B4JL 2CUMA 1KCWA 5DGQA 4WTQA 3A22A 3QG6A 5MENB 2BSTB 3KDPB 3G6AB 4MD4A 4NI3A 3MXVL 2DLEA 5B3NA 2E9GA 3TN0D 2JCCA 2AKRB 3SCMA 4LLDB 4NO5A 1DQLL 4MXWL 4P2OB 2OQJB 5CJXA 4HC1L 4XAKE 3MBWA 5KWYC 3P2DA 4U1IA 5DU7A 1YEKL 2BSEA 1V5JA 2IADA 1QMUA 3DX7B 2AQRA 3BIKA 4KZDL 3DIFB 5F9OL 2VNCA 5DI8B 4J8RA 4G7SB 2BOLA 3SJVE 5ACZA 5DMKB 1I31A 1RZ8B 2DKSA 3V7AE 1JP5A 3UTQB 2HRHA 1A7RH 5HYQB 5IOKA 1T1WB 1VZIA 4WWOA 5AVQB 5AOMA 4K3EH 3QZWA 4HKJA 1QPXA 2A6KA 1ZOXA 1S9VA 1QRNB 4JY4B 4PJ5A 2E8YA 3NFNB 2XV2A 4YZFF 1FSKC 3UTTA 5EBWA 2FE0A 5T3XD 4HUXB 4JZOA 7PAZA 3V0FA 1IKNA 2XA8H 5DQ9A 1FJ1B 3K74B 2DYPB 5CJQL 4X0KB 2GVYA 3D2UD 2VDLL 5BZZA 4YXKH 5E9AA 5HTSA 1BAWA 4GY4A 5FGCE 2RFXA 2ZKHH 1MXDA 1CL7L 4N86A 4O02B 2AQ2A 2ZCLL 3EBGA 1U8QA 3DX2A 2V7HA 3A4EA 1LP9A 1N5YH 4IKKA 4P23B 4FN0A 5DFWH 4F2FA 4G5ZL 2W9EH 2BW4A 3CFDB 1XCXA 5JXAH 1TJGL 2BVYA 3IN2A 3X1NA 4BELD 3CLFL 4ONFH 3TIDA 1EJ8A 1KOAA 3J27A 4QO1A 4H20L 3VFWA 1WP6A 5C09A 4DVRL 4PV1C 5KAQF 4FABL 4OF8A 4GRWE 2VZ1A 2I5YL 1VPOL 1HE8A 1NGPH 3L4CA 3FTUA 4MKTA 4MXQD 3IJEB 1VF5C 1JNLL 2JKNA 4LKCB 4OZGA 4WUUD 1UCTA 4GRLB 5ALCH 1GYWA 3RWHA 3SKJL 2FD6H 3WFDL 2IXQA 4UQ3A 1R6VA 1RZKL 5F21B 4G9FD 1YY9C 3EJYC 2DTMH 3EZJB 1T7XA 3POHA 4WU7B 5HXMA 3MJ7B 3D0LA 2B77A 4BCXA 3LRSB 3UZEC 1SEBA 4Y9GA 4OF7A 3ZZ1A 4ONOA 2QVMA 3ZE2E 4D3CL 2BIQA 3QPXL 2WB1A 1WCQA 2WVTA 4FQJH 2XZAH 4I2XB 4PB0L 1IGFH 3QJUB 4G2AA 3BFWA 4FA6A 1NAMA 5D2NC 5D1ZI 3UTPE 3PUUA 4JM0A 4PJIA 1OD7A 5DHEA 3DVGA 4IRSC 2BVQB 4HJ0C 3L6FA 1K4CB 3JV6A 5KVDL 3AS1A 4YFEA 5AAMC 1PJ9A 1KPUB 3JWNC 3UBXB 4QJ4B 1E28B 2UV3A 4J27A 4XMLL 5J6GA 1MHPH 2E9WA 1DANT 4RISL 1CXFA 4GSDL 3WCYA 1NPJA 2N7BA 3X3GH 4DKEH 4JFWA 5EA0H 4FXKB 1DDHB 3L2LA 1TPXC 3DK0A 3KPRD 2Y3AA 5KW9H 2CM5A 3C6LC 5DMJB 1RUQH 2VM3A 1IFHH 2ED6A 3RX7A 1NCTA 2BSSB 2WLMA 3D39D 4K94L 1T5WB 5IMLA 1R3KA 5F89A 4GRMB 5I82A 2IBBA 1F02I 3MRDB 3BD3A 1J0IA 1F3DH 3W82A 4F8QA 2C3VB 4DUWA 5BO1H 4HD5A 4MVBC 3NOIA 1IARB 2YK1L 4U6VL 1JN6A 3SDCD 4APXA 1AR1C 1JV5A 3STLB 1CBVL 4LLVB 1FFNA 1A1NA 1RUKL 4WKZA 5K69A 1KWGA 2B2XL 3N1PC 2DBJA 4IKNA 3TH4T 1THCA 4ISVA 4EBQL 3WJMB 1EVTC 4MASA 4E68A 2MHAB 4YSAA 3ARFC 4TTDC 4WO4C 1FFRA 1UTDA 5I8OH 1TQTA 1WA2X 2FGWH 3O3UN 4TQIA 2BH0A 2ZX9A 2IC2A 3ARDD 3GSOA 4XH2A 2PCXA 4LL4A 3QIUC 2BRRL 1HAWA 3KCPB 1GOGA 3GMMA 3IPFA 3AU1B 4UV7L 3B9AA 1CU4H 1TQCB 2F2HA 5CZVL 4ILDA 4HJGB 3N42F 3U46B 2PXYC 4W9DC 1MZZA 1YQ2A 5C0IB 2XTLA 5BXFA 3APMA 4AXWA 3FQYA 5E2WH 5GS2H 1BLNB 4QXGL 1KULA 1H6UA 5LBSL 4CADB 3AJ7A 3IFNH 1KTLA 2DY2A 3U2SB 4WFHE 3FFCA 4U3CA 1O9ZA 3BYTA 3AXHA 1C5CL 5E2VH 4PJHF 3UZVA 2GUOA 3MUGA 3R1GL 1DLFL 2Q9OA 4Y7OC 3TT3H 4J3TA 3BC9A 4QHKI 2KI6A 4NGHL 5PAZA 2XETA 4G9DA 4LSRH 3L17A 4WNSA 5DA4A 1G5GA 5A2CA 4M7KH 4UUJA 1W72A 1T83C 3DX9A 4MAYD 3FUNA 4OIAA 3ULSB 3JBG7 1EFXD 4F15B 4MRBA 4KKCD 4OV5A 3EJJX 3F83A 3VW3L 6CGTA 1ZD6A 4XC1L 1GIGH 3T4AC 3WXVL 4JANA 2E86A 2P5PA 3IMRA 1O9VA 4Z0XB 4JRXB 2J1XA 4JPSA 4Y19E 1JPTH 2DKUA 2X4SB 4IBLT 3PP3H 3B5TA 4BFRA 3NSYA 1ET5A 2J73A 5G5DA 2YOCA 1OSPH 3JTSA 4JE4B 2O93L 2XXGA 3ROOB 1WBYA 1G7IB 2OMUB 2WNGA 3D18B 1IM3B 3QHFH 5J89A 1OEZW 5GS2D 2EIKB 4EI5C 1AE6H 4QY8B 1BAFL 3ZXAC 4CN4A 2WKOF 4OLXH 4P2QE 5ILTH 2G9HB 1TU2A 2GSGB 2DM4A 4OZIE 2Y7LA 5B38A 5J6SA 1NJ9A 1RXLA 2KZWA 3L8QA 1CFNA 4XCNA 5TPWH 2XKNA 1XIWB 1F3JA 2ADGA 2OMWA 4KV5E 1WGVA 3ATFA 4UQAA 4X7DC 1TO5A 3CN4A 1TIUA 3DXAB 2VL5B 5E6YA 2YS4A 1Y1UA 1WBXA 2X2HA 3HW7A 2W81C 5CILL 2R23A 4LZKA 2DIEA 4AYSA 4RMTA 3BVDB 5AW6B 4XB7A 1J9RA 4XMKH 2WO2B 4NS0A 4A6YH 2V9RA 1NLDL 1X7QA 4NAJA 3T65B 5AKTA 1ASPA 5E51A 2F53E 2IV9A 4HKZA 2A2QT 3X3FL 3JVFC 5GRVL 1IGTA 2G0LA 4AJWA 1D5RA 3V0EA 3MA9H 1QLFB 4APQC 4FLOA 2YRLA 3ARQA 4FFYH 3KHQA 3PGDB 4YHMH 3VWJA 4RGNB 1NWPA 4K8RL 5F1IB 1YQVL 4GUOA 1PG7L 2GJ6B 3QQ9C 2DB8A 4JFYB 4MS8C 2Q76B 1I3GH 4U3SA 3D4ZA 3FQWA 2RCSL 1S5IH 2VABA 4DPBX 4EI6A 4PJHA 1C5BH 1I4FB 1FE8L 3U0WH 2KZKA 4HJSA 4FEMA 1B6UA 1NC2A 3BRGC 4WUKH 3TJEL 3NZ8B 5L4JA 3BI9X 5I71B 5E5MB 1CMOA 5DD5L 3VFPA 3MOBL 3VXMB 1MDTA 4G8FB 4JDZB 4DKDC 1FO0L 4OI9A 5F96H 1OGTB 5FWRA 3ECVA 2PP9A 1EHKB 3M8OH 4O2CA 5IQ7H 3TN0C 1KY6A 4LFHD 1IT9L 3VX1A 2XWBA 5DEGA 3Q0HA 4HULB 1DQVA 3QZPA 2R7EB 4E0RB 2FEEI 3O45B 3ZKXC 3W56A 3G6JA 5KYNA 1H5BC 1RZJH 2AFNA 2KC0A 4K23L 4OCRH 5FHAL 4A7QA 2BNQE 2EEBA 2UY7A 1PFCA 5DD1H 1MCFA 4AKPA 4X50A 3CHPA 1BZEA 1PCXA 5I1LA 2H26B 4XHJD 3BLKA 3TV3H 3P9WB 1CXLA 1HL8A 1L4IA 1Z9SB 3BGMB 3OC8A 2OJZH 5MI0C 4ELKB 2WD0A 4YHPA 5DZAA 3T4YA 1BVKB 2X4PA 3KR3L 2HG5B 1H9VA 2FH6A 3GSWA 1FQ9C 3PGFH 3KYAA 2VGLM 2Z31A 3WN6A 4ELME 5D2NE 4WGWB 1LNUA 4I9WD 1A6VL 2WBJA 4QOKB 4JM2B 1N8ZA 3SDAD 2QGDA 4BUGA 5C07A 3IDNA 2R0WL 1DLHB 3MDJA 3JWNE 3QRGL 1AZZC 4HIQA 1Z66A 3Q2NA 1SRDA 1WJ3A 5D4HA 3QUML 4XBGA 3EOAA 3SYCA 3ULAB 4GO9A 3DMMB 4ODTH 2E75C 4M61B 1RJYA 3V9EA 5D7IA 5EO9A 5D1XD 5HJGA 4L29A 1FCCA 1MFEH 2NT0A 3L3HB 1FAIH 1BQHB 4H25A 1GY1A 2ZPKL 2Q7NA 1MW3A 4GKNB 3UPRA 5SV4A 3V0HA 3G5YB 1CGWA 1X4XA 1AJ7H 3VXTB 3WY2A 2P4AB 1LO4H 1Q9KB 3GMOB 4DKTA 4YBLC 5JQHC 5KG9A 3MV8A 3VRLE 4FI8A 3D30A 3VI4B 1INQA 1IL1A 2H6PA 5T3ZE 1A8JH 1RIVL 4YFDB 3HJ0A 4L1BA 4Q8BA 3S97C 3T3PE 2HYMA 1MVUB 4E5XB 2ZCHL 5BOJA 4Y89A 3GBNH 4NRYA 3MJ8B 4TVPH 3GF8A 1XF2A 2E6QA 4IHOA 4N2HA 4YLCA 4L1LA 2WTRA 2HX8A 1WIUA 2PCFA 3FRPA 1HTYA 4JRYB 3HC2A 4ABVA 4CMMA 1Q0XH 5D7JA 2GK2A 5E4AA 4NFDA 5FK9A 4IIZA 2BFGA 3EO0B 4R7VA 1ZS2A 5I16B 5F1NB 4Z7WB 1MWOA 2FYYA 3FYEB 1PZBA 4LBEA 3Q2WA 4LCWE 1ZGLM 1V3LA 1CZ8L 3MACL 2XZZA 4P5TD 1V55B 4XCCL 3F7VB 4TUOA 7FABH 4I9XA 4A2EA 1ZVHA 2F5BH 2EXTA 8FABB 2QHLA 4ZTPH 1JI2A 1A3LL 3CD4A 4G42B 4GQPH 1BQLH 2XZCH 1G7HA 3C9NB 5BPPA 2FAUA 1RPUA 2MJWA 3VFGH 4X6EA 4UT7L 1W8NA 1OP3K 2MOQA 1T2JA 2AEQL 3WKML 2A9CA 2EDBA 5DXWA 3DX8A 32C2B 3DX6A 1CLZH 1U58A 4M6MH 3IDXL 1RU9H 3FCSA 3ARWA 4TVPD 2AJSL 3KPPB 1J9SA 5LGKA 4GSQA 1OAYL 4YDMA 1U8NA 1PIFA 1USQA 2ZWYA 4P49A 4EOWH 4R96B 1SJXA 5CEZE 3F7KA 1KWKA 2HSIA 1QUNA 4Y1AA 2DLGA 1NC4B 2E3VA 1AOZA 3NABL 4NZ8A 4BSWA 4UAOB 4JFZL 3VD9A 4MA1B 3E7JA 4AG4H 3V0GA 5FYLH 1QKZH 5I0VA 3SDCC 3F00A 3B7YA 2CKNA 4EEEA 4Y2LA 3WNOA 1MREH 2XX1A 2ATAA 2J1YA 2MCPL 2G2NA 3ESMA 3QDJD 3DX0A 1KB9J 4QYOB 3FTGB 4HXBH 4AZ8B 1D5IL 5SWSD 3V6FA 4QKXB 3PUCA 2EUZA 5MEOB 2OCJA 5F7NC 2IBZX 3T77A 1Q38A 3ARDC 1UWYA 4X5PA 1H19A 3OQRA 5IESH 3KGUA 1T21A 1YNLL 4NUGH 1PLCA 3QRBA 3NEXA 3SE4C 2OMYA 2OMXA 3ULUF 2J2ZA 5KVFE 3HE6B 1FDLH 4NKOB 2VH5H 3CHXA 4NZRH 5DUPL 2VDRH 2PPFA 4HISA 3VGDA 1NCIA 2VWEC 3APDA 4B0MM 1MWAA 1BD2A 2P5WA 1U93B 3OKKB 4GEJA 1GC1L 2VMJA 4H4NA 1INEH 3LXUX 5IB3B 3AS3A 3NSCA 1SLUA 4FOMA 1FBIH 1NTDA 2YC1A 4PH8A 1UC6A 3FUDA 3LOWA 4I0PA 4K5NA 4QTHB 3V6OA 5I76B 4KHTH 1E40A 1MQKL 3TYFA 5I6NA 1R24B 2IOOA 3WOVA 4LCUA 2QSTA 2CDGB 3DGDA 5TE7H 1S8DB 4ZFZA 1XF4A 2J6EH 1MJ8H 2RGSA 3QZNA 4X6DE 1JVLA 4UT6L 3IPBA 5DQJA 3MGAA 2CGYA 3N0AA 5GIRA 4G59C 1LEIB 4MAYC 1HJBC 5I0DA 4RBPH 4ZUVB 3G5ZA 3CFEA 3QG7L 1BQ5A 3FU0A 3H7LA 2V7NA 4HZLA 4KKCC 2WLYA 4OM0L 2AJZA 1XR8B 3RWCB 4B3VA 1T7VA 5IM7B 2YMOA 3Q43A 1QA9A 5DJAB 1ZT4B 4GQZA 1D7DA 1HEZA 1OP4A 2UX7A 1N6QH 1T2QL 1CB4A 4UTBH 4NZTH 4J23A 5KANG 4HKBB 5BUAA 1SJEA 1W9XA 4FI7A 4MSWA 4LGSB 3MJ9L 3GJFH 1KTBA 5IFHL 2BPBA 2XWEA 3W0WD 3O6ML 1NANH 1MAMH 2FSDA 3ULVH 2CNZA 4YBQD 1PL3A 2PCPA 1YMHA 3PWUB 2ADFL 2G30A 4YAQA 4DKFH 2R69A 1LQBC 5LGJB 1ZA3A 1BXAA 2NR6A 4JVPA 4MA7H 3M46A 1X5ZA 2E7CA 1U3YA 1ZVSA 5D7EA 5KYUA 1W0YT 4AOFA 2QKIA 4G11A 1KJ2B 3AT0A 4HIXH 3LHAA 2GITA 2EDOA 3WIHH 1R5IB 5F7BA 3VD0A 2EXSA 4HIIB 5GGVY 2WMPB 5IEHA 1FUNA 1ZV5A 2QVFB 2YUZA 1MF2H 3VFMA 1IAIH 1PW3A 4HMDA 3V0IA 4WI7A 3VVWA 1FA4A 3DGGA 3MREA 1WWAX 4IIQC 4F2MB 2F68X 3I74A 3UO1H 4UQEA 3KEHA 4U1LB 1TSRA 3HTLX 5ICUA 3CVHB 2VXVL 1MN4A 3ESNA 2WP3T 2RQ8A 2OYLA 1JWUB 3ARBD 3DDFA 4FYQA 3RFZC 3O3BB 2VC2L 3O3AA 4RGOH 5T3XE 2BSCA 1QWNA 2DM7A 3EH2A 2V17H 3QJVB 1B0IA 2OMZA 3MOAH 4K15A 4PVMA 5E8PB 3ULVD 4F57H 2BSRA 3EYFB 1E30A 2BVEA 2CBOA 2X89A 4KY1L 3AAZA 3MNZA 1RURH 1O5DT 2R1YA 4OSUL 1LYQA 1IBHA 3DNKA 4ZMAT 5F9WB 1XBDA 5FCUL 5BRZA 5JIQA 3L1OH 4GIPD 3V79C 4JO3H 3LH9A 3NCCB 2CLVB 2HMID 4AGNA 1A02N 2X4NB 2B1HH 1ODUA 3ECUA 1W6LA 1KIUA 1IGIL 3RIFF 4UM9D 1FNSH 1IAOB 2IBGA 1QZNA 3WSQL 3LRGA 3QUZB 2IAMB 4LSUH 1DVXA 1IC0A 1WRFA 5DJCA 3ZTJH 2F1EA 1FNGA 4K5LA 4PJGA 4DP1X 5JQIB 4JR9L 2OP4H 1WWWX 1C5DB 1U6AL 4NUQA 1WAEA 4JFSA 3HEIB 4I77L 4LIQH 2KKQA 4HHAA 4Z7VA 1MCSA 4IEFB 4G8IB 1HH6A 4WUUE 2EJ1A 2O5XH 4GG8A 4JKMA 1DUYB 5E9DB 4R8WH 2QHRH 1EEQA 4G9FE 2HVJB 1Z9OA 4XHJC 1U30A 3MXWH 4OLWH 4WENB 4P5SA 4LEEA 1TMQA 4LP4A 1N6UA 4AE1A 3S88L 5CP3A 2GEQA 3IDGB 4RMQA 4F24A 4JFTA 2Q8BH 2N01B 3GEFA 3WYRA 2GCYB 4JDTH 3OHMB 4L1TA 3ARSA 5DRWA 1N59B 5J7CC 1DVYA 4L8SB 3WFHA 4LEOB 3T0ED 2VZUA 4PS7A 5FW7A 2VXUL 3BAWA 4OLZL 2RJMA 4AJVA 1N7MH 3SDAC 2HRPH 2YZ8A 1HEHC 3VFNB 4ZW8A 4R90L 3ES6B 3LV3B 5IHZA 4DZBA 1WT5A 4UINL 1IBDA 1VFUA 2YPLD 4KJYB 4UQCA 3MZTA 3X12B 1RP9A 1CI3M 4HF5H 4NHCH 4Q74A 1GZHC 5D1XC 3GMRB 4DGYH 4BKSC 2VO5A 5ID0B 1VHPA 1BZ9A 4D0BB 2IGLA 4OLVH 4OM1L 4Y5YA 5D7SH 3S37H 1UFUA 3M1BA 1A7NL 1KLFB 3P9LB 3KPRE 4CN1A 4NT6A 4RH4A 1T0MA 3KYKH 2BS71 3D39E 1DQQA 3KM2A 1P1VA 2Z91B 5K39B 1RZJC 2E9BA 3IXTA 1WVZA 5GZOA 5IJCC 4OZHB 1T4KA 2DQUH 2DWYA 4QF1A 3DUUA 3BIBX 5KSBF 4QRPA 3DK2A 4R7DA 3KH4A 1ADQA 2F8VA 4M93B 5DMIH 5DTFB 1SVZA 4Z6AT 1RULL 3US9A 1WUZA 2A73A 4HLJA 5HHXH 3NA9H 5DJXB 1XEDA 3LQZA 1ANUA 2MTPA 2ICEC 4N2OA 4BKTC 4CDGC 1SBSH 1FGNH 4QRUB 5C0FA 2ARJA 3BD4A 3MYJA 1Q0YH 1S7XA 4HUCA 4LPUA 1I8KA 4M6OH 2BJMH 1IUZA 1WWCA 2KERA 3ZKMD 3VSUA 4KZEH 4LF3A 2HXAA 3U30C 1QBLH 1DCEA 5KBMA 3O4LA 5DWUH 4HJ1A 3ZZSA 3MLRH 4WHYG 1OGPA 1UH2A 1PQZB 4FQCH 5HSFA 3AG1B 3RA7H 3RBSA 5E08L 3CDZB 3QFGA 1H8LA 2FO4A 3BWAA 3U9WA 2NY7L 1OK8A 4LDOB 3DIVA 4P5TC 2H1PL 3NQKA 2VWEE 4X80H 3LXAA 2ZQKA 2D4FA 1XSKA 4RMSA 5FWQA 2CLRB 4Z3TA 4I7ZC 3MLSL 2WO4A 5DYOA 2JTDA 5TQ0L 3QNZB 3FSWA 3WFEL 2F5AL 1V27A 2X12A 3IMVA 1NDTA 4RZKA 4OKVA 2OX5A 5AW0B 4IOIA 2IANA 3VWKA 4FKEA 2J6WA 4L3CA 2P46B 2PTTA 4MAZA 3OKEB 5BJTA 4NXKA 5I28A 4ZPTB 3CH1B 1WUNT 5E7BA 5EHFA 2C5DC 2X6CA 1ACYL 2JIXD 4WFED 3FK3A 2NLJA 4RMWA 4MB1A 4AT6B 2QQNH 2GSIA 4CU6A 4HEPA 3NMEA 4G6FB 5HDQL 1HYSD 3ZHNA 1PKQA 1G9NL 1U8CA 1D6VH 3IMWA 4QRBA 1X5MA 2XHNA 3PWLB 4ANKA 3EBAA 3F6LA 4MQXD 5JPMC 3LQMA 3NCWA 4ODWB 3PNRB 3Q1SH 5B1JC 3ZDZE 4F92B 1AG0A 5D1QD 4LCIL 5DK2B 4XXDB 1BBDL 1DBMH 3BDYH 1IC7L 4NDMA 3VM5A 5B4MD 4XP1H 4AGLA 2OTPA 1JVKA 3QA3A 3LPOA 4FTVD 3SE3C 5SX4I 3SDXB 3D69A 4JNXA 4HGWB 3FT1A 4W68A 1KPVB 3WMSA 4NUPA 1QVOB 5ITBH 2ATPA 3TO4D 3DV6A 4PLKD 1JYWA 2O5YH 3D25B 4IDJL 3U1PA 1PFOA 2Q6WA 2FT6A 4R0LB 4Y5XC 3PLYA 4N0CD 5C7ZA 2Z35B 4JHUA 4F7KA 1AANA 2Y07L 3FOMA 1E27A 3EDEA 4PRIB 5EUOB 3SD2A 3OTTA 4IBWA 5DJ6B 4RDQG 2VR6A 3QEUB 3INUL 3MRNB 3OJMB 4V33A 4WI0A 43C9B 4KQ0A 1ONQB 2ZP0T 1A22B 1YNTB 3QJSB 3EGDA 1R47A 5IF0B 2FB4L 1WAAA 2Z34A 5BNXD 4MJIB 5MEQB 5TDOB 1OKEA 4HWZB 2PO6B 3JV0A 4FFVD 5J6HB 1XFPA 3E6HB 1FVCA 4PYHA 4WJG3 4GW4A 3OVUB 4P3CL 1KLGA 1FL6A 3HNSL 4FNTA 4POZD 3ZR6A 5JHDB 5ADOH 1QBBA 1CVRA 2VN6A 4PJXA 5EIIB 4O4YH 4XP6H 2KL6A 1I1AA 2PW2A 4KROD 1YVLA 2C7FA 2ZOLB 1MFAL 5B39G 2Z7ZA 2ICCA 4R84A 2IPTL 4NP9A 5BMFH 2BWQA 3REWA 2YWYA 4U1MA 2XWJA 3LEXA 1HWGB 5EUKB 4MJ6A 4CSSA 4J3XA 5HHNB 3NSDA 4OJEH 2WQRA 5CM1A 5GSRA 1HEJC 3GIZL 1MG2C 1T1YA 2DJ4A 2HLAA 4TNGA 3I6SA 1NIDA 3N40P 4AQAA 3EJUA 4O02H 1G7JA 4OLUH 2EYTA 4GPVA 4FQXA 4LEXL 2IOIA 2YGQA 5FA4B 3RWEB 4YBQC 2NTFA 4P57A 3M86A 1XGRB 1P4IL 3KD4A 4NO3B 4AL8L 4L3EB 1FGVH 2NDGA 4JFDA 3ZR5A 1G7MA 1E4KA 4Z7NB 3E80A 4WDIA 1QG3A 1XMWA 1NQBA 3L3KB 1SYSB 3A67H 4YHOL 5FO7B 1P5VA 3L7FB 5JDSA 2CJUH 1XX9C 3RWJB 1DFXA 3HMWL 4NKIH 4Q89A 4A2DA 5JA9A 3PHSA 3T6QC 1C08B 2DPKA 1AS6A 3MOQA 3VXQB 2YA0A 3G7TA 3MRIB 4PJAB 4YO0A 3B37A 4ZG1A 2CALA 4KGLA 1F6LL 3FCUB 1GRWA 1JGLH 2ILLA 3FT4A 4W4OC 4CN6A 3GI9L 3GEWB 1VJSA 1LQSR 4PVLA 5J13B 5LHDA 1ZIBA 3EGSA 4HC1A 1ZKAA 2H5UA 4FQ2H 4L1HA 3IETB 4EAEA 4HBCH 3ARBC 3I02B 1EO7A 3BZ4B 4I9WE 1AGCB 1OGSA 3N41B 4D0DB 4IOSD 2B3IA 5HVHC 3ECBB 3ORJA 4ZMXA 1NFKA 4PW9A 3X14A 2XWCA 1KELH 2EDHA 2X10A 3O6KL 1T7ZA 1KC5L 4OFYD 5SWZA 3ULVC 5LWYH 3P4OA 3BPCB 4G7VH 1EFQA 4HJUA 4NQSB 4HWNA 1IGMH 1UM4L 1ZLDA 2P5EB 2VZ3A 4Y5VA 2BNRB 4DAGH 4PB9H 5D1XE 4IGBA 4Q6IC 4JZJB 4KZCA 5FM5O 4GG6E 1EHAA 3LS4H 4GLRH 2OSLB 3O2DH 3SQOH 2HMIC 4NKQB 3S4SB 4QJ3B 2XG5A 2VLJB 5I19H 4KBPA 4Z7QB 4FXGB 4K7PH 3LJ3A 1RZPA 3ILQD 2J7LA 3DROA 1BVLA 3E1ZA 4UT9L 2X0UA 2P8PB 2R2HB 3SCMB 3N2JA 4C83B 5KANI 3WDHA 5FKAA 4QHMA 1ZLEA 2ZCZA 4X5LA 1YEHH 1ZHNB 3HNTL 1CR9H 4GRLD 4H2CA 4J4PA 2ZYHA 1MY7A 3GPSA 3MRHB 1YMMA 1KCLA 5T1JA 3QYCA 4KC3B 3CFCL 2IADB 3S98A 3VI3A 5AKRA 1TNNA 1F13A 4R7NA 1JDCA 3U79A 3HA0A 1IEHA 4U4IA 3QXVA 1NGZB 5BZWA 2DQIH 5ACZB 3OXRB 1MIEH 2ZIDA 4XCEA 2VO8A 1RY7B 5KSUB 5ALBL 2D9QB 4PP2B 1UVQB 3DUHA 1OO2A 3TNNA 3QZWB 3IK2A 2NT1A 4HKJB 3QCVL 1EDYA 1S9VB 1LLAA 3AXLA 3CCHB 4PWGA 1M7IA 2HJKA 4PJ5B 3U48A 4IS6B 4Z8FL 1A7OL 4HJIA 4ZXBA 4NQCA 3UTTB 3ZPDA 5EBWB 5GS0D 5IVXA 3U2IA 3T0EC 4GQQA 5I1AB 1LMKA 4XNQB 2W88A 2R29L 3N44F 4E9YA 1NCUA 3HFMH 3SQBA 5IB2B 3BH4A 2BCKA 4HCIA 3DARA 2RFXB 5FM8A 2D3NA 3EYOA 1IKNC 1SMOA 3ZE0F 5FF6A 2V7HB 1IAIM 2H1XA 1K3IA 4XO4A 1YNKH 4WW2F 5GGRA 4L0YA 1IGCL 1LP9B 1ID5I 1OW0A 4AVIA 4HMCA 3EO1A 4X7TA 1RIUH 1N9PA 1KJ3H 1AIFA 1UD2A 3RKPA 1WA1X 1CXIA 3KVDD 3MLWH 3UYPB 3WNNA 4TVPE 4GAYA 3PV7A 1L5GA 2FLBT 4L8BA 4U1SB 5DZLA 3TIDB 5C0CA 1GJWA 2APFA 3KJ4B 2OSWA 3VFWB 4Q4EA 5H37G 3A6CL 3PP4H 2A1WL 2IH1A 4HS3A 2BO0A 5DURB 3NAAH 2V9QA 4HCFA 4S1RL 4XPGL 5AVWB 2ZUYA 1RZ7H 4XZ4A 1AHWC 2EYSA 4HUKB 7TAAA 3BP5B 1CICA 2J25A 3I9PA 3H7BA 1IRAY 3QDJE 1JHKH 2AV7B 3D0LB 2XQYK 5IT2H 2VR7A 4TQEL 3ZKMC 3ISYA 2X1XR 4Y4HB 2LVCA 1SEBB 3NCBB 4JCWA 1GHFH 4BA8A 3FU6A 3DV4B 3GMPB 4N87A 4XVUD 1ACZA 4N8CH 1N8OE 3CDGA 2I32A 3I9AA 4DEWA 3G5WA 1MJJA 3NK3A 5CGTA 4A55A 4NRXB 3DVGB 4N5ED 5ESVB 4LPVA 4EJ1C 2JJSA 4MJHA 5F3HA 4JB9L 4NQVA 4M4RA 2W59A 5TGBB 3TTYA 3AGVA 3UERA 1YPZA 1E5UI 5J6GB 1FI8C 1Z5YD 4NYLB 2XU9A 3DTXA 2CH8A 1SNRA 3VGFA 2X4TB 5IGXL 3KWXA 1OOWA 1NCCL 4MNGB 5AW4B 2XI9A 3R0MA 4DGIH 2EDMA 3WXWH 4R7LA 4XOCA 1U8LA 3FOLB 4F8OA 1OT2A 1UOVA 3D34A 5LBSA 5IMLB 5H37A 5F89B 3BSZA 1CQYA 1VGEH 3NRPA 5E9NA 3HB3B 1FF5A 3AZUA 2MFNA 4ZMTA 2EDQA 2GI0A 1HYSC 4WGKA 3RX8A 2JLLA 3VH8G 1DJGA 4JQXC 5K9JL 1JN6B 2ITDA 3UDWC 4N28A 4APXB 2GK0A 1JV5B 4MQXC 3S4SG 5HGDB 1SXNA 25C8L 4C56A 4RGMB 3KPSA 4PS3A 2UY6B 3D51A 4Y1AD 5D1QC 4X7SL 1BJ8A 1ETJA 4YFLI 2NY5H 2VOTA 3IFOB 3W0WE 1GCFA 1O6TA 3TA4D 5B4MC 3ZL4H 4ERSH 1IM3D 1HL5A 2GJRA 4XH2B 2W0LA 3NZHH 3GMQA 3LAFA 4L9LC 1PSKH 3GMMB 4KO6A 1G6VK 3RY5A 4DW2H 5DLMH 5IQOA 1USZA 2Q3XA 4AW7A 4ES8A 5L88H 2LABA 4NQDE 1UOWA 4ZSOA 3CUPA 3TO4C 4PLKC 1U2CA 1JK9B 3SE9L 3RIKA 4ZPVB 4KKZA 4N0CC 3MNVA 5LG1A 3QJHB 4MYWB 5BXFB 5KJRL 4HHWA 3GKWH 4AXWB 4XCFH 1XIWD 4H26A 1G4MA 3TV8A 2PABA 2ZUQB 1KDJA 1RZFL 3DXAD 4PR5B 1KTLB 2GBTA 2H2SD 4GAJL 4QRQA 1BXUA 5I17A 5J1AB 3GSVA 4NN5C 5FGBC 5HJDA 1A7QH 4JFEA 1UWEH 4ZUWA 1AXIB 3I85A 2UZIH 2FO1A 3AC0A 4UNIA 5CUSH 1SGKA 1UH4A 4FFVC 4ZO8A 4PRAA 4YEFA 5ISZB 2J5LB 2DQDH 4KJQD 2DL9A 1PIGA 4ZFFA 3AT8A 3BPLB 1F4WL 4S0HA 1JTOA 4POZC 1T66D 2Y72A 1IZJA 3VH8A 1GZPB 2XVGA 5ESAA 1G5AA 4KROC 4O2EA 3ULVE 1AR2A 4KXZI 2ZKMX 4N4YB 2PYED 4JANB 3VGAB 4LOEA 3PL6B 3QUHA 1F3DJ 1N19A 2A6JB 3RGVB 3SOBL 3OMIB 3V6ZB 4BQ9A 5HGBA 1E43A 2DBLH 5JUEL 2XIDA 2YAQA 4YHKL 1KENH 2HVKB 2X9ZA 4N0UE 3IFPB 2F8XC 1F4XL 3JTSB 5C3TA 1WBYB 3VXMD 5EDXA 5EOCH 2DLIA 3ENEA 4O51A 1UACH 4W9ZA 1SF3A 2WOYA 1CF8L 4PY8I 5IMKA 5EO1B 1T03H 3F12A 4GXVL 4TF4A 5GJSL 2X88A 5TDPB 3GNML 3R7RA 4ZMVA 3BW9A 4JHVA 3ABGA 1Z3GH 2ORBH 1MVYA 5KYWB 1NJ9B 1TZGH 3WY1A 2FNWA 4I3RL 2HKAA 2QPDB 1YY8A 4XCNB 4PQXA 2XKNB 1QSED 4Q2ZA 1I1YB 2H2PD 5FECA 2OMWB 4LSTL 4JAMB 3MRLA 3CVDA 1YN6B 1FO0A 4YSUA 1P4UA 1P69B 2P28B 3HI1B 1WBXB 1KIQA 3E38A 5L7XL 1Q94B 4MNHA 5LG6A 1I7ZA 3V4PL 3UAFA 4N2IA 4NCC2 1F2XK 3S5YA 1MIML 3S34L 1X7QB 1MDAA 1D5BA 3NT0A 4QOKD 5ICXA 2B39A 3U2JA 3WNJA 4JM2D 2KQMA 4DJMA 3FAWA 5CN1A 4K3JH 1N18A 3T0EE 1ZJBA 2FWLB 5CJOL 3N42B 1BJ1J 1X3DA 3FS9A 3Q13A 4LSSH 3C60A 3CFIC 3NIGE 5BV7L 3CXHJ 1CDYA 2FO8A 3UFIA 3EW3B 2Y6SD 3ILDA 3CMGA 4MTMA 4HKXB 1DN0A 4BHUA 5C2BL 1D9KB 4YSRA 4XZUA 4U3SB 2YPLE 1LGVA 5JLZB 3HC0A 4FLHA 4RX4A 3C2AL 5F70A 5B22A 3IJHB 4PJHB 1RUAH 3OZLA 3T04D 4MJ5A 5FC9A 2G5BB 3FSOA 5IQMA 1CXHA 2OXHB 1ASQA 3QUMA 4ZDHA 4EN2A 4G82A 1SOQA 4PPTA 3APFA 3L2MA 5CZKA 3ILQC 3WS6A 1A47A 2TRYA 2NYYD 4O2CB 5LCVA 2D2OA 3MA7B 4M3JA 5DEGB 1LO3L 3PPEA 1TCRA 3FQUB 2HPOA 4XPAH 2WLLB 2WWNA 4GRLC 4TVSa 1MOEA 1RJZA 2CPUA 4K4KA 3NIFF 4HJJL 3GDBA 4JRYD 2UY7B 4N25A 4ORGA 5IOPA 5T3ZL 2NW3A 4X5WA 3GUTA 4JKPH 1KYOJ 2A6DA 3P0GB 1CL7I 4N85A 1HSAA 1QO3A 1U33A 4PJ7E 1MHHB 5EO0A 2X5PA 2X53A 1A14H 2D9CA 5DO8A 4RWYL 1HHGA 2YIHA 2Z31B 3FQTB 3I6GA 1DFBH 4PJEA 1LNUB 3K8LA 3AY4A 3BKJL 5GS0C 5GPRA 1F11A 1VZHA 2QSQA 4V1DB 4HIEB 1NGQH 4TQPA 3HR6A 2D7TL 4JM4H 1BXVA 1KGJA 2ED8A 3B3BA 3EOAB 1CYGA 3H42L 2WLZA 4IKIA 1UXMA 2EIJB 1RJYB 4KNUA 1R3HA 3L2NA 3BWSA 3KGSA 3QDGB 4OCNC 3GMNB 1P4BH 3BT2H 5IB5B 2AP2A 1FZOA 2YD0A 2WYZA 1NCGA 3IDMB 4P2RB 1MCHA 1PZUB 4Z7UF 2E7LA 3US1A 5FB8A 4WFEE 2AV1B 3O2WH 3LZQA 2QGBA 4I4WA 4XI5D 3BDXA 5KG9B 4NLAA 3MV8B 1NC4D 4KDTA 5F7KC 3THMH 1A4AA 3CZUB 3N85L 4X8JA 3W39A 4C57C 4KOBA 5EU6A 1OGAA 3CAFA 4PSRA 3NCXA 1T22A 1KN4H 4OAWA 4NRYB 3OAWA 1EK3A 4QR7A 4X9HA 5D1QE 1P84K 1A66A 1GS7A 2WTRB 5CEZL 3IDIA 3QR1A 4KRMB 4TQHA 5JXEA 3W81A 3FRPB 5BW7C 4LP5A 4M7JL 5F7MC 3WEMA 1F56A 4MCZA 5L9DH 4FTVE 2AVFA 4UAHA 5TTRA 4H0IA 1X5JA 2NXZD 2EP6A 3PDOB 5TK4A 3ZIMA 3MUUA 2ZUTA 1YAZA 3QIBA 5K59E 1GOFA 2FYYB 2XFGB 4XVUC 2K3HA 3OBAA 1QSFB 3FU3A 4PAZA 1FZMA 4TUOB 4F7PB 2HN7A 3TX4A 4N5EC 1JZ5A 2W92A 3UAJD 3TA3A 3WO4B 3DBXB 4MAUH 2VZTA 1KJ2H 1G7HB 4ATWA 3DDGA 4X6EB 3PWPD 4HT1L 5IKCB 3QC5X 1BSIA 1F8TH 1XTLA 2DI8A 4JFOB 1BJMA 3DSFH 3DX8B 5LQBL 3DX6B 2APSA 3HS9A 2R1XB 2CK0H 3FC8A 1JPFB 5FUOL 2IWEA 1Q72H 5ELIA 2B14A 2X3AA 4P5RA 1EXHA 4BUHA 4DKAA 4F15C 1HCYA 5E94B 2BZCA 2N4IA 2XV0A 3D9AL 4LDLB 4X6CE 3MRRB 1NMAL 3CVHH 5AYUL 4P46A 1AQ8A 4HWBH 1ADWA 1ORSA 2C4XA 4OCXH 3EYSL 2CUAA 4TNVF 5JMRA 3GYRA 3W9EB 1DJXA 5I1KL 1MCIA 3MV9D 4M3HA 2QELA 1ZANH 4UT6A 4EDWH 1P2CA 2FR4B 2JH2A 3REVA 5AWNL 1RZIB 4FFWD 5DVMA 43CAA 2CK2A 3GGWA 3ERXA 1E90A 3VMPA 2R4SH 2AQQA 3JSSA 4OIFA 5TH2A 4MJJA 4CNIB 3BLPX 2Y7SA 3IDUA 4XX5A 5D4JA 5DJ2A 2HTKD 1KCKA 3S37X 4DGUA 2CMRH 3L9RA 3BKCL 4K2UH 4BCZA 3I75A 3MJ9A 3QNYA 2ROYA 4PJ9A 3H9SD 4S1SL 3B2VH 1ORQA 3NIDF 4ZMQA 5FS5A 2KHAA 2R8SL 2I9LA 1XIWC 2CO6B 2VAAA 1OM3H 1BD2B 2P5WB 1R19A 1QLRB 3S3DB 5FFLA 5L4FA 4ZUSA 1J1XL 3T9WA 1AC6A 2H2SC 1BM3H 2QQKH 1U0QA 1FG9C 4M5YH 2O5ZH 4I0PB 4NP4H 1MFCL 1ZS8A 2BIPA 35C8L 3CN0A 3QI9A 1AKJA 3TVMD 4ZFZB 3BFOA 4UV4H 2JV6A 4EN3A 3B9KA 2H32A 4ZTOL 4DPCX 1HESA 1P7HL 1AO7D 2HFEA 5GIRB 1SVCP 4TPRH 4KJQC 1JHTA 1QP1A 4XPFL 3G5ZB 3NJHA 1FCGA 3CFEB 3A6BL 1CBJA 1T66C 2V7NB 3SKOA 1NBQA 1S7RB 1VLXA 1AZNA 3CQPA 1I82A 4KI5D 1E50A 1TOXA 2YXFA 2A74A 3IFLL 5CU5A 3O4OC 3MLUH 1GGIH 1PZCA 2P8LB 1UQSA 4YXLL 3QHZL 1IGYB 1L9SA 1MJ7L 1NFDE 3BMVA 3C5SB 4X9GA 2V2TB 1UOLA 5I71C 5JOFB 1MUJA 3FUJA 5DGRA 1CTMA 5A2LH 2CLZA 2Y3NA 2VKXA 3T3ME 2CO1A 4MWFA 1URZA 3ZY7A 1BAGA 4DZ8A 1KGYE 2XN2A 1B0GA 4QRTB 1ZVSB 3T08A 2MQGA 4G1EB 2CBTA 1EZVY 4HIHB 5EH1A 3O41B 1JTTA 4ONHB 5HHPB 4JG9A 4J6RH 3ETSA 5IEHB 2IALB 4GFTB 1RUPH 1O6SB 3DYOA 2H2PC 4OFKA 1KIRB 4AQ1A 3NCEB 4GI8A 3U4EA 1B0RB 1BCIA 2Q3AA 2UZYA 3MREB 3IGAA 4AH2A 1ESOA 1A7RL 1AXTH 5LBGA 1HHHB 5IFAH 5L8LB 4K3EL 2AXFA 3EADA 1Z1WA 2DTSA 4UM8B 3CN3A 1E3ZA 3BE1H 4U6HB 4BXVA 2BOBA 3O3AB 4JM2C 1D6EB 2XA8L 2OMZB 1XQ4A 3MGTA 5E2JA 5EU7E 4YXKL 1FG2A 2BSRB 2W65A 2BNUB 2ZKHL 5A2FA 1SJHA 2R1YB 2Y6SC 1VPOH 3AQDA 2C9SA 5ABDE 5BRZB 4RETB 3TEUA 3ML8A 4RAVA 3SODB 1YUKB 1DZ0A 4H1LA 4J3BA 4Y16B 3VXUD 2R2EA 4KQ3H 5L2KA 4RDBA 3CBRA 5JXAL 2F58H 1U92A 3GRGA 5F8QC 2NY2B 3GJEA 1EJOH 2Z64C 4Q9BA 5BOZG 1THAA 3I9GH 1A2YB 1ZT1A 3FL7A 4X99A 5DJCB 2DDQH 4NO0A 3OXSB 2AERT 2NYYC 3D3VA 4RZCB 5E00A 2CDFB 1NGPL 1DQJB 1IC4H 1XH2A 3Q44A 4BIKA 1MZYA 2CCLA 4QRRA 1F00I 2OJ1A 4KK9D 5ALCL 4HHAB 2FD6L 3RB5A 2WXGA 3FO2A 4GG8B 4PJFF 2DTML 2VMDA 4TUUA 2FWSA 3MRJB 3MUY1 5KVEH 3L3JB 5E4OA 3TZVB 4CC4C 1S4IA 3K71A 3KDMB 4LPXA 5DHYB 4ANWA 4FQJL 1H3GA 2XZAL 1GR7A 3TC9A 3PDGA 2LAGB 2VLLA 1IGFL 5HYJA 3CVIH 1B2WH 3FF7A 3WFHB 2APVA 4FA7B 5AVSB 4NC0B 4GXFA 1ZLWH 3CZJA 3VFSB 2QPEB 1TQBB 4DIXA 1MHPL 4U49A 2COQA 2AK4A 1SF5A 4X4KA 3OR6A 4WFFD 4H8UA 1D7FA 3X3GL 2A9NH 4DKEL 4J12A 5EA0L 1BZ9B 4IRJD 3QPKA 3CZLA 4HEMA 4ZS6D 4Y5YB 2CGZA 5KW9L 5C08A 1RUQL 1T0MB 1IFHL 2QSVA 5HHQB 3CZEA 5IVOA 3AG3B 5A3ID 5B8CA 2W07A 1DQQB 2YD8A 4GB9A 3RPIB 4XI5C 5CBEB 1EDQA 5H94B 4PRBA 1T4KB 5BO1L 4QRPB 4CL7A 5FHBH 4UAOC 1J1OH 4NCDA 2HWZH 4C59B 4MA1C 1LVEA 2BXZA 3PXHA 4DN4H 2ZSWA 2DEWX 3OPZH 3ELAT 1TTGA 2VERA 4RA3A 3QZBA 3LQZB 5FR3A 4HMEA 4TNEA 1UJTA 1IKOP 1YN7B 3GMLA 2AMUA 5C8JB 5CIPA 3WS3B 1FZJA 5CR1A 5I8OL 4I8DA 4B9GA 4E2OA 2E6JA 2VSKB 1SQ2N 1OCWH 5AKSA 4XBEH 2NXZC 5ANMA 4JHAH 4YSPA 1D5MA 5E2UH 4PHZA 4LQ1A 2BVTA 3SPHA 1CU4L 2YBRA 4KXBA 3NCJH 4NGHH 3EDDA 1JGVH 2WV3A 1FVDB 1LILA 1NMBH 2FO4B 2ICES 3BWAB 3DX3A 3TO2A 5EN2B 4AM0B 4NNYA 3S7GA 4CGUB 2GC7C 3AUWB 2WUBH 2A9AA 4MMXA 1M6OB 1HWHB 3JVGC 3OSVA 5E2WL 3UAJC 3ECQA 1IM9B 4L0ZA 2P26A 1NCJA 4D0CA 3DXAE 3AACA 4JN2A 3FSAA 3Q7JA 1XWVA 5KN5A 2C1PB 1NBCA 2AEOA 4PJFA 2EDJA 5E2VL 3DVNA 4G8AC 3VGHA 2OX5B 3TT3L 5I8CA 4IOIB 3TFKD 1IKFH 4NN7B 2PTTB 1CT8A 4GO8A 1QFPA 2HP4A 4LSRL 1UXSB 4CAGA 3F62A 4IMKA 4M7KL 4K0OA 1JWSA 5JHDD 2FZ3B 1EXUB 1OF2A 3GSXA 3IJ9A 4KUZL 1I75A 4Z7OE 4OBSA 5DRXB 1PKQB 1MSPA 4JO4H 1GIGL 3HLAA 2AJXH 1VESA 2PYEE 1EHLH 2CO3A 3CMOL 3MAWA 4LQFH 3H9HA 4YSDA 1ZHLA 4WI3A 3QH3A 1JPTL 2N0KA 2VQ1A 3MNMA 2RACA 1NH6A 3ARGD 4NDMB 1SOXA 3RLSA 1JZ7A 1GSMA 1INDH 3QA3B 4JMNA 5CCGE 4EXPX 5BS0B 1OSPL 2YD2A 3D69B 4A7VA 2VLMD 4LVOB 3ZGIA 4FFWC 2EIDA 2SODB 3V4VB 4AEFA 3QHFL 3VXME 4BFIA 1JYVA 4DH2A 1LO5A 1A4BA 1AE6L 1PJWA 1NOFA 2ATPB 2JK5A 4OLXL 1NA8A 1GCYA 5ILTL 4C55A 2HTKC 3VFOB 2VL4A 3RDTB 3DBSA 1G84A 3VRIA 1U95B 1L0XA 4OCSH 1Y0LB 3HAEA 3HE7A 1IAKA 3FT3A 5KSBB 4BSVA 1E0OB 5CKAA 2K3TA 5TPWL 2X6VA 4RRPA 1VAHA 2G3MA 1OB1B 1QSEE 1XCQB 1OAQH 4WI0B 2OMBA 3EGDB 2NY1B 3MV7D 5L6YH 4F20A 2VZVA 4A2MA 1UEMA 1YEIH 2ZZUT 3BGAA 1X5XA 1BA9A 1TTAA 1E9PB 4XMKL 3F85A 2JXMA 4A6YL 1AGFA 5AB9A 4PG9B 3TVMC 3UG5A 2OM5A 3FTYA 1TJIH 4F9PC 5HP5A 1XR9B 2XBZA 5MHSD 3RB7A 1L6ZA 4QOKE 2IV8A 1CGYA 1CFTA 1BHGA 2YAFA 4N22A 4WTZG 5HPMA 1SBBA 4LLUA 3S5LA 3MA9L 3WJJA 1JGUL 4G8EA 5IJVA 4FFYL 4PBVC 1XXFC 4XODA 3SO3C 4EIGB 1M1XA 1I1RA 5C7XH 4YHML 2E9IA 4FQ1H 4YK4B 2BNRD 1NPUA 1ZXQA 4KI5C 3REWB 3TH2T 4U1MB 3SDDA 2XWJB 3I2CH 3LEXB 4MJ6B 4GI6A 1IT9H 1JPEA 5F9WC 1I3GL 4I18A 2MCMA 2ZNWA 4JDVA 4JE0A 4WIQA 4XMPH 1S5IL 3SJVA 3B7UX 3OAYH 1C5BL 2NNAA 4UB0H 3U0WL 2ZYIA 1G7JB 2WBXA 1HYRC 2ZKWA 4NIKB 1SYVA 3WNMA 5EEYA 3S9DB 1UYWH 4WUKL 3FH5A 4XWGH 1N6VA 3IKCB 3NRQA 2ZUUA 4P57B 3MRGA 3V4UH 2IIJA 4PWKA 4QAMB 5IMOA 5F96L 3VI4E 4YVNA 1G7MB 5CEXA 5GGSY 3M8OL 5F3BA 3LKQA 3NN8A 3KR3H 5IQ7L 3R0NA 4NNPH 1D5XA 3H56A 2FQDA 3ALPA 4K8RD 5E1HB 3HS8A 1P5VB 1K8DB 1T1ZB 4M43H 5E4EB 1RZJL 3QXDA 4FS0A 4HOZA 1WV7T 4OCRL 2ZUWA 5HYFA 4YO0B 4LSPH 1I8MB 5DD1L 2FL5B 4OGQC 4JRYE 1F5WA 4Z77A 5IK3A 3FT4B 5GZNA 3UBHA 3TV3L 4A2GA 4UT9A 5DZOA 6PCYA 5I30H 2OJZL 2F7RA 4H7VA 3B2MA 4M9OA 2JKSA 4YIQA 4Z7WE 3WIFA 3RWDA 4WK2B 3U0TB 3PGFL 1UXWB 2QMJA 4DPAX 4WTZA 5LLIC 2P24A 3DJ9A 5KVMC 4L8SC 4RCAA 3Q8BA 2WQVA 4ZQKB