3TU6A

The structure of a pseudoazurin from sinorhizobium meliltoi
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
127
structure length
127
Chain Sequence
MEEYRVEMLNKAADGRVMAFEPAVIRAQPGDTVTFVAKDKGHNSALMKGGAPEGAETWKGKINEEITVTLSKPGVYMYQCAPHVGMGMIGAIVVGEPANLEAVKGIKYPGKSKAAAEKIFAEIESGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudoazurin (Blue copper protein)
publication title The X-ray crystal structure of a pseudoazurin from Sinorhizobium meliloti.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Electron transport
total genus 33
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3tu6A00
2VSMB 4MFHA 2I7SA 1RKRA 2EIJB 4E9WA 1GS6X 5F7AA 1KBVA 2IAAC 4DP9X 2PP8A 3UABA 2VM4A 3X1FA 1XB6A 3N2JA 1V55B 2N0MA 3T71A 1L9RA 2J55A 1OCOB 1L9SA 2PCFA 3OMAB 4GYBA 2DWTA 3AG1B 4G70B 3SBQA 3EHBB 1NIDA 4GP4B 3S3DB 1E67A 2B08A 1PY0A 1BXUA 5TK4A 1PZAA 3DIVA 4YVUA 3WIAA 4FAAB 5A7EA 1W6WA 3AW5A 2WO3B 2VW6A 5PCYA 3PAVA 4A2FA 1L9PA 3NT0A 5B1AB 1AZUA 5B7FA 2HZHA 1CYWA 5I6MA 2HX8A 2E86A 2XWZA 4DPAX 4DP5X 1M56B 1HAUA 2BW4A 2Q5BA 4KO6A 4A2DA 3QJQB 1CURA 1AZNA 2TSAA 2ZONA 3CVCA 4QLWA 1IC0A 4E9TA 3WKPA 2UXVA 5I5JA 4W1TA 2YAEA 3FSWA 2AANA 1PCSA 3NJGA 4A68A 3T6ZA 1ILUA 2RACA 3ABLB 1GY1A 2W8CA 4HZ1A 5B3SB 4UANA 3ERXA 1EZLA 4YSRA 4HCFA 2IWKA 1JXDA 5D4HA 2YAFA 1F56A 3MX0B 1J9SA 2GSMB 3OD3A 3BQVA 1OCZB 3G5WA 3IN2A 2XU9A 3CDZB 2BWDA 4YL4A 1JERA 2Y1AA 3H4HA 3S3BB 2X87A 3S8FB 3NSCA 1GR7A 3OMNB 1JVLA 5I28A 3PPSA 2BP8B 4KNSA 4YSPA 2BP0A 1W6LA 2JKWA 2VW7A 2XX1A 1B3IA 3V9EA 3CZUB 4YSAA 3WNIA 1V54B 2NRDA 4PCYA 4GY4A 7PAZA 4G72B 1ZDQA 2PPAA 3ASOB 3FSVA 1PMYA 4NAJA 1OV8A 2AVFA 1PLAA 2BO0A 2DYSB 2FNWA 3QJRB 2PPDA 1N68A 3DKHA 2EIMB 1AZRA 3TASA 1PAZA 4E9QA 2P80D 4Q8BA 2VW4A 6PAZA 3TU6A 3L45A 4KO7A 1VLXA 2DYRB 1ETJA 1BXVA 2H5UA 3HB3B 3NSYA 4HCIA 4HIPA 1RZPA 4DP4X 1J5CA 2IDSA 5I6LA 5B1JA 2HX7A 2P80A 1AS8A 1ASPA 2CALA 4WTQA 1ILSA 1ZIBA 1E5ZA 4HAKA 1ZDSA 2XUWA 1QNIA 1SNRA 1SDDA 2FJSA 1J5DA 4E9RA 3FU7A 3QJVB 1OE2A 3AG3B 1MZYA 1AZCA 1W8EA 4A2HA 1IUZA 3MBWB 1X9UA 5F7BA 1NIBA 1BYOA 3NJIA 2GC4C 5FC9A 1NTDA 5D4JA 4AI7A 4UF7C 1BEXA 2YAPA 4HALA 1A3ZA 1MZZA 4CSPA 5I5IA 1I53A 2PPCA 2UXFA 3NJLA 3ZX1A 4BDVB 1GS8A 2R7EA 3EH4B 2QPDB 4G7RB 3FU8A 1SFHA 4A66A 4YSQA 5IY5B 2IDUA 3DTUB 2JFCA 1AZBA 3OQRA 1SJMA 4HHGA 3EH5B 3ZIYA 3H4FA 1AR1B 1N70A 2VM3A 1OCRB 3FQ2A 1QHQA 4GXFA 1BQ5A 4TXVB 1JZEA 2GC7C 1A4BA 1JXFA 4AX3A 3FU9A 4F2FA 2UXGA 2XXFA 4KOCA 5B1KA 3ABMB 1CYXA 4YSEA 4BWWA 5TK2A 3T6VA 1E65A 1PZBA 1OE3A 4HHWA 2BP0B 1XB8A 4X4KA 5B1JC 1J9TA 1OE1A 2J56A 2IDTA 2W88A 4F2EA 5I6PA 1L9TA 2BZ7A 2CBPA 8PAZA 1AS6A 2IDQA 1ID2A 3FSZA 4RH4A 3UGEA 1NPJA 2VMJA 3OMIB 3X1GA 2H47C 3PXLA 1UATA 3IE9A 4YVNA 4E9SA 1DZ0A 4YSUA 1GY2A 3EF4A 4YSOA 3X1EA 1NDTA 1BQRA 1KYAA 2FT6A 2XV0A 1NWOA 2XLLA 9PCYA 1SHXA 3SQRA 1ET7A 1JZHA 1OOWA 1L9QA 2XV2A 1NIFA 2IWFA 3TA4D 3FQ1A 1T5KA 2H3XC 2XV3A 1AG0A 4G7SB 1ZV2A 4QKTA 2HRGA 3X1BA 4KNUA 2QPEB 3SBPA 1DYZA 4YSSA 1M9WA 3TBCA 2J5WA 1ET5A 1ZPUA 2YAOA 4ZK8A 2UX6A 1JZFA 1AS7A 2YXVA 4E9XA 1AOZA 1NICA 1NZRA 3FQYA 5I5MA 4A67A 1BQKA 2AZAA 3T9WA 2FT7A 1HAWA 3CG8A 2PP7A 1FWXA 4DP8X 4BXVA 1PLCA 2DY2A 3KW8A 3JTBA 4WKXA 3FU7B 2GHZA 2ZWNA 4AKOA 3JT2A 1CUOA 2QDWA 2X88A 2WSDA 2FQDA 3N55A 2ZXWB 3QPKA 3FPYA 2HX9A 1BYPA 3CDZA 4K9JA 1R1CA 2JXMA 3IEAA 4AKPA 1AACA 4YSCA 3S3CB 1URIA 2OV0A 3ABGA 1MG3C 3GYRA 2R7EB 3UAEA 1BAWA 1AANA 2I85A 2BP8A 1KCWA 2BW5A 4FA7B 2VSKB 2XVBA 4W9ZA 3EH3B 4A2GA 1NPNA 1ZIAA 5B7MA 3IN0A 5LDUA 3NJKA 1KDJA 7PCYA 1QLEB 1NWPA 3T6XA 4N8UA 1J9RA 2CAKA 4KO5A 2J57A 2DV6A 1JZIA 1ASOA 1JXGA 2HLEB 1L9OA 3WG7B 1M57B 3X2QB 3ZBMA 3RYMA 5I6KA 1MDAA 2AFNA 3FYIB 3NJMA 1A4AA 3QQXA 4P5SA 3ZDWA 1J9QA 1ASQA 4UAHA 1PF3A 4KOBA 1WA1X 2A3TA 3AG4B 1PNDA 3NJNA 2YAQA 2ZOOA 1GSKA 3AY2A 3FYEB 1KBWA 2GI0A 1ADWA 3QJSB 2QDVA 1AAJA 4DP6X 4CSZA 2FQFA 4YSDA 1WAEA 5I26A 1BXAA 1OCCB 2FWLB 4DPBX 5I6NA 1SHWA 3AZUA 3NJJA 2TSBA 1NIAA 4KO9A 5E9NA 2CJ3A 1JZGA 4JHVA 1NIEA 3NSDA 3U25A 2PLTA 6PCYA 1JZJA 3NP3A 1XB3A 2QT6A 1IKOP 1A4CA 1YLBB 1E30A 3PAZA 1AG6A 1NINA 2YAMA 4BWTA 2PPFA 2EINB 1PZCA 2YARA 5AZUA 2UXTA 1OF0A 1TEGA 3BVDB 4KNTA 4P5RA 3WNJA 1ET8A 1HFUA 1TEFA 4BDVA 3GXUB 4DP1X 4YSTA 4E9YA 4E9VA 3HEIB 1EHKB 1RZQA 1KDIA 1WA0X 2YQBA 1TKWA 4EF3A 2GIMA 2HRHA 2XXGA 4M3HA 5I6OA 2WO2B 1WA2X 2MRYA 4DP7X 2GB2A 4NB7A 1FA4A 3CVDA 2XX0A 2BZCA 2YXWA 4G7QB 4BXSV 1JOIA 2PCYA 1WS7A 1KCBA 5AFAA 1V10A 5AKRA 5D4IA 1MG2C 3SBRA 1TU2A 4NERA 3QJUB 4AKQA 2MTAA 3FS9A 2YAHA 3C75A 1JVOA 3PCYA 4Q89A 2BHFA 2BWIA 2CCWA 1PLBA 4L0PB 3D12B 3PAUA 2VN3A 2FQGA 3UACA 3T6WA 1KV7A 2HXAA 2IH8A 4JHUA 4HCGA 3V9CA 2Q9OA 3FSAA 2DWSA 1SDDB 1A65A 1SFDA 2B3IA 2PP9A 5EHFA 1KGYE 1A8ZA 1PNCA 3FT0A 4DP2X 2FT8A 5ANHA 2PPEA 1SF3A 1WS8A 1X9RA 3QJTB 1RCYA 1FFTB 4BK5C 3NJHA 4PAZA 3OM3B 2AZUA 1E5YA 4A2EA 3GDCA 3FPXA 2GBAA 2Y69B 1IBZA 1GS7A 3NSFA 3X1NA 2EIKB 4BWUA 2EILB 2FTAA 3NP4A 5PAZA 3WI9A 4DP0X 3TBBA 4ENZA 3IBOA 1AQ8A 3ASNB 4F7KA 3UADA 5B7EA 2IWEA 4GP8B 4AZUA 2XYBA 3KW7A 2FQEA 2OJ1A 3NYKA 3H56A 2OCCB 2IDFA 2I7OA 3CVBA 1XMEB 3ABKB 4N4YB 3WKQA 1CC3A 1IBYA 1SF5A 2UX7A 4GP5B 3UAAA 1AIZA 3S8GB 1GYCA 3PLYA 2IH9A 4G71B 2LLNA 4M4RB 4JKNA 3AG2B 1GW0A 2CUAA 3NJFA 5B1BB 4DPCX
chains in the Genus database with same CATH superfamily
4K8RH 1X44A 4MFHA 5FECA 3CLEL 4BUHA 3WN6A 3ZZQA 4B5EA 2YC1B 1RHHB 3S48A 1LP9A 3ZZ1A 1CFSA 4CDHA 3FXIC 2WQ8A 1S9WA 2XBDA 5HHOB 3FULA 4PLJC 4BK8A 4DGIH 1WT5A 3BC9A 4AENA 4CN6A 4DQOL 1RZJL 3UL4A 5C70A 1T1XA 5I0XA 3F5WB 1QLFB 2F61A 3L1EA 3Q9QA 4L5FL 2EXWD 1Q94A 1ZCRA 2ZZUT 4L1BA 5ICUA 1J1XH 1S7UA 3QXAB 4H2AA 3EYQD 3QQ9D 1P7QB 3OAUH 1TKWB 4PJHF 3NSXA 4OKDA 3WS3B 4IDLA 5J3HD 3RIFK 1MJ8L 2Q1EA 3DYOA 3L2MA 3L95B 5AVYB 5J12B 4HIHA 4RZKA 2WXMA 4P59L 5GGTH 4BFBD 5BQ7B 4A2FA 5IB4B 1I3VA 2FAUA 2XWRA 3M17A 4PGDB 3D09A 5EFIB 2ZG3A 3GSRA 3QWNA 3AWEA 3MKKA 1JGEA 1I9IH 4HV8A 3UAJC 2HX8A 3O45A 4KK9D 4LQFH 4UM8A 5D1QB 3QIUC 2FX8H 3UTPE 1OY3B 1OM9A 1ZWIB 2QZQA 2WLMA 2V2WB 3VNZA 4AE0A 1SMOA 2Z8SA 4E9TA 4Z7NE 3WKPA 4DKAA 2PF6A 3HFMH 5MENA 4ZMPA 1BEYL 3J07A 1D7BA 5GHWL 1UA7A 2DBLH 4GRWH 2ADFL 2Y36L 2BFVH 1OLZA 1ZT7B 4JHBA 3F7YB 1JNLH 4E2OA 1J48A 2K45A 1JWSA 4Y5YA 2NDGA 3ILQC 2NPLX 3GMPA 4AXWB 1X5FA 3ERXA 1DN2A 2ZJSH 3TEYA 3HC3H 3S2AA 5C9JA 3O4LB 3T65B 3VI4E 1JZ5A 1F56A 3V5DA 1SHSA 3G5WA 4X7CC 2Y1AA 5FYKL 1R3IH 3ECVA 2Y2TA 4PG2A 3O11B 2C7FA 2D4FA 3NSCA 4EKJA 1ZS8A 1ZV9A 5E1AB 3E6HB 3MI6A 5ID1A 1A1MB 3PNWA 1QQDA 1LTXA 1MVUA 3UBHA 3R0MA 3LQAH 4E42B 1B3IA 1X7QA 2A83A 3HC0A 3BP5A 3LOWA 1YEKH 4WUUD 1V54B 3NCXA 4ZXBB 4U1IA 4Z7OF 2DB8A 3ASOB 5E9DE 4NAJA 2VDNB 3VGAB 1N67A 1C5CH 2V5TA 2CCLA 5ERWA 3SKOB 1IIKA 1RUAH 1BFTA 4UU9A 3DWTA 5EEVA 5EO9A 1PAZA 3RX5A 3UZQB 3FN0L 3RPIA 1MFAH 4WCYL 3B9KB 3EW3B 1E6OH 2O5ZL 1YC8A 5DJCB 5EPMB 3IAQA 1HKLL 2YPLE 3WYRA 1OF2B 5J13C 2H5UA 1MIMH 7FABL 3FH5A 2ISDA 1IAIM 3QUHA 5GS0H 4LDOB 4XOCA 3LB6D 5INDB 2HMIC 2DIEA 1KGJA 5KBMA 1Q9WA 1KELL 2LFEA 3OX8B 1IAOA 2EACA 1I8KB 2BVQA 2P80A 4OLYH 4NC2B 1FZMB 3NPSC 4APQD 5AKVA 2A6KA 1WBXB 3C60D 2DQIH 1SYVB 3GMNA 1FFRA 3Q5TA 1J5DA 2X3CA 4FXKB 4KZ0A 4E9RA 4I85A 4NN6B 3TNNB 3ZKXB 2A1WL 5EB9A 2DTMH 2VWEE 5EC2A 3SDAA 4ES9A 4BFIB 4URKA 3GMMB 4P3WA 4AM0A 3I9IA 4IRJA 4BD4A 4WI9A 5K39B 3L13A 1CN4A 1OSZB 3EO9H 3EOAB 3PWVA 3CHRA 4NQDE 2I9TB 4OBRA 3EOBB 3KR3H 1LD9A 2B2XL 4FTVD 3SY6A 3N06B 3EH4B 4Z7NF 3VSTA 4H4NA 3TT1L 4JDTH 3RVWC 3SE4C 1B4JL 1T03L 4XPBL 2G3XA 3APNA 3H4FA 3CFJA 3QORB 3TFKC 3UP6A 4P5TD 1MFMA 1I9EA 4X2UA 3N9GH 2X1WL 4AQ1B 1O7DC 1XR8A 4PRPD 4UZUA 1MW0A 2YQ3A 4NHCL 4KGJA 4NPYB 2PXYD 1SOXA 2J3SA 3QUGA 3V7AE 1E0OB 5L4JA 3VA2C 3ZJAA 2GW5A 1FN4B 3WMSA 2WWMC 1AGFB 1Z7JA 2DOCA 3CDCA 4HLJA 3TO2A 4YSEA 3T6VA 1KSRA 3Q8BA 4AMWA 3II1A 5LLIC 5A43C 1KXTA 2X89A 3IFPB 1T2QH 1TQVA 3JWOL 4L1SA 4XPTH 5FOBA 4JHWH 5ABZA 3RWIA 2AK1H 1QVOB 2GVYA 2ZIDA 3OMIB 4J3UA 5DDHA 4C56E 5D2NB 3L3KA 4FXGA 5HGGS 4OGAD 1X4YA 1ZGLM 5DUPH 1JNHB 3FUDA 3SDAC 4JFSA 1EZVY 3LDBB 2HT2D 2PCPB 1KCUH 4YSOA 2HT4C 3JWNG 5F97E 4A7TA 2NUPB 2FT6A 1IL1A 1OW0C 4IRJC 1DQTA 3KNBA 1P5UA 2IPUG 1LEGA 1PKQB 1BFVL 3GXNA 3IKCA 4AJYV 3IKKA 4JRXE 2IWFA 3PJNA 2XTJD 3FQ1A 5GRZA 1F3JA 2D3VA 4ADJA 2W0PA 4PVNA 2HRGA 3IJSB 3FFDA 4Y4HD 4YFDB 1O9VA 1BMWA 4PV8B 1E43A 2BH0A 4F2MA 2VDQB 4O02A 5IIEB 4ZK8A 4ZMVA 3HAEA 4JFHE 1MREL 5J6GB 3ILDA 5D7IE 2IAMB 4PGCB 1NGZA 3ESOA 4P46D 1TSHA 2WYTA 1XEDA 4HSQA 4XP9H 4QOKE 1CFTB 5CGYC 2ZUVA 2YXFA 3T5WA 4Y2DD 5F9WB 4MQ7B 5F7EL 5AVZB 4ORGB 5F3BB 1MJJB 1UURA 1NDGA 3GHEH 4HEPG 1N26A 3IJHA 3MREB 5SWZA 4S0HA 4LQ1A 3SE3C 2WB7A 2ROYA 4ODXA 3CC5A 1UFUA 5SV3A 1S9XB 2AEPH 4PJ8A 4APQB 4TLUA 3BJ91 3QEQE 4X6CE 2Z35B 3VMNA 4ODWB 1HNYA 5JW4M 4ZFOA 4ZNEE 1URIA 5HVFB 3A67L 2OV0A 4OGZA 4XP5L 4AYGA 3W2DL 4OCRL 4N0UB 3WS6A 1V7NL 4FQPA 1S6NA 1T0OA 3ZMEA 4TOYH 4FXGC 1K4CA 1L6XA 3ZHNA 1F4WH 5KYWA 1ZSHA 2DQJH 5C3LD 5LDUA 2HFFB 3HLAB 1XGUB 2OCFD 4ZO7A 1EDYA 4I3SL 3EYUH 1F2QA 2LLGA 3KWTA 3KYAA 4JRLA 1P5UC 1P7KA 1S7VA 1DQVA 5EBWB 1OB0A 4U1MB 1QTSA 5DUJA 3WJMA 1IC1A 5AKSA 3WU1A 3NN8A 1CLOH 1ASOA 4JRYD 4IJ3B 4KH9A 2X6AA 1F3RB 4GW4B 1QFWL 4NQXA 4FJ6A 5C2UB 4O58L 1LDPH 1WA1X 4TN9A 1FNSH 4Z0BL 1WFTA 5EN3A 1TTAA 1JAEA 4HK0B 4P48A 4OAWA 4ZMWA 1ZGLB 4RISH 4XMUA 4FQQB 43C9A 4HPYH 1OAKL 1S7XB 3SO5A 4P9HL 1NBYB 4D8PA 1VFAB 2XCMC 2DF3A 3MRMA 4DOHB 4XNDA 1UB5A 1Q9LA 1YNKH 3LZQA 1X5GA 3P11H 3ZU8A 3BRFA 1OL0A 3EGXB 2G5BA 4XBGB 3LKQB 5FDYA 5FCSH 4EI5B 3Q1SH 4P3CL 5E03A 5C0JB 2NCMA 3L1GA 1NIAA 2WCPA 1PLGH 2R0WH 2XG5A 4OCSH 4WI4A 1I9RH 4Z23A 4XP4H 3NZ8B 4M4RA 1CGSH 1ZLWH 2GY5A 1L7TH 1V05A 3C6LA 1NCWL 4HSAC 4BINA 3VI4A 2EE3A 4KZEH 2CJTA 1HL9A 4LLUA 4Q74A 4UTAH 4PJ8C 5KVFH 1YEWA 4AQAA 3VXRE 4JPIA 1E4XL 3T0BA 3K6FA 4KTGA 5DT1L 2YARA 2YRBA 3C87A 1QI5A 2WYIA 4LCWA 4LPCA 3WNJA 1GJWA 2F19L 1HFUA 3EYFA 4TNVK 1INEH 2K70A 2B14A 1IEBA 5FHBL 5D7IF 4YBLC 1RU9L 4IGBD 1OK0A 3HEIB 1EHKB 3MRHB 5KYXB 1YPZB 3DUSA 3HMXA 1T22B 4MA1C 3IU4L 4EZJA 5ITFA 3CZFA 1EGJL 4LDLB 5SX5K 4PJFB 1MFBH 1A9EB 1WA2X 4DP7X 3OKKB 2WWKT 1TMQA 3N04A 4OCXL 4XCEB 4XI5D 1CBVH 2HKAA 1SN0A 2CKBB 3LH2H 4BXSV 5D2LA 3P54A 3B1TA 3DGGB 4WUKH 4K5LA 1H15A 4OFVA 2VXSH 4R2GC 5I73B 4Y4FD 5FK9B 3OXSB 2FH6A 4QKXB 5CSGA 2XKUA 4OM0L 3VB9A 4P46B 3HZKA 3TA3D 2BRQA 1G9ML 4RNRB 4Q89A 1KTBA 4X6CF 4XCFL 1KENH 1VAHA 3L4ZA 1WHPA 1YYLL 4U6XB 3WFCH 3GFUA 4MKTA 5L88L 5F0LB 2YWYA 5B8CA 4JKPL 35C8H 2VH5H 3MLWL 1FIGH 2VR7A 5CSZB 3QFJA 3TZVD 5GJTL 5DQ9A 4OCMC 5HYJB 3I02A 2CDGA 4I18C 1O6TA 5HYIA 4FNSA 2X4QB 5IT2L 1K4DB 1AY1L 4GO9A 4JRFA 2YUZA 4I13B 1I1RA 1MY7A 5LBGA 2P8LA 3VMOA 4NBXB 2ZUYA 2Y9RT 2YMOA 3OM3B 4NNXB 3C6LC 1AO7E 4LIQH 2GBAA 1U36A 5F6HJ 3GM0A 1WO2A 2D9CA 3NSFA 5EBLA 3SPIA 4ETQB 3DETC 1SZNA 1YMHB 3DGDA 1J12A 4EIUA 5IEKA 4DUVA 3CMOH 2PYEB 2PWDA 4X7SH 4G6JL 4ZTPH 4TTDD 3TCTA 5E4EB 3NA9L 5DRNA 2OJ1A 1ODUA 5EUOE 1DJHA 43CAB 3D39E 5DJXB 1SEQH 3QG6A 2I7OA 4AGPA 3K6SA 4J8QA 4JRYB 4XPFL 3IMTA 3GUTA 3LKSB 3TIDA 1TCRB 2UX7A 4JQVA 4S1QL 1CQKA 4UZGA 2LFGA 1AIZA 1P9MA 3M1OA 5LBVA 4F1ZA 4NN5B 3AG2B 1AFVL 3BD4A 4XN9A 4N90D 2X7LA 3Q05A 3MV8E 4JR9L 1PD1A 5FEBA 3Q01A 3LRLA 1QATA 4WO4A 2Y22A 3KLAB 3CXDL 4XPHH 4I0KA 2GUOA 4PTUA 4QT5A 3N41B 3QNYA 2Q7YB 5J6HB 1XF4B 3GBNH 5E8EB 4YE0A 2FLMA 1E9QA 3X1FA 5DLMH 3MLPA 1QRNB 2VZ3A 4R4BA 4JFEE 4CADB 1KIPB 1L9RA 5IQ7H 3QJOA 4L4VB 5JHLA 5AG8A 1USQA 1WFNA 1K5NA 1BZ9A 2C1OA 4HC1L 2PCFA 4P23D 1XIWD 1NKRA 3PAYA 4HJJL 4WTZG 2K0RA 1LGVA 5A40E 5ISZD 3ESUF 3OF6A 5D7KE 4H25A 2VWEC 3ISYA 4LPVA 2YSTA 2OYMA 1HHGB 4KY2A 2L0DA 3GIVA 3HS9A 3PP3H 2VABB 2AEQL 4R7NA 1P4IH 4FL4B 4TNWK 2BHZA 4MWFB 4FQLH 2XN9E 4HKZB 3ZZSA 5DJ2A 2GITB 4KJQD 1H5BA 5BJTB 2ODHA 3KPPA 3ZDXE 1M56B 2VQ1A 5DHMC 5DXWA 5KYNA 3L3GA 4MNQA 3CLWA 2ICCA 5I1DA 2OK0H 1UOWA 5KZCD 1CLYH 4EO5A 2WK2A 1V3MA 3AM8C 3QWQB 4DVBB 2AANA 2JI1A 3KWWB 4Y4FB 2PUQT 4GJTB 2YGPA 3T6ZA 1AGEA 1MLBA 3C8KB 1NC4D 4U1GC 4GFXA 3ABZA 2ENSA 3L3IB 3QI9D 3P1VA 4NUQA 3GK8L 4M8VA 1IM9A 4EN3A 3EJRA 1MFUA 1JERA 5T3XH 4L3ED 4XP6L 4XHQA 1SDYA 4FQXD 4OD1H 2I07B 5FKPA 3TZVB 3V4VB 3EJYD 2FGWL 3VFVA 2G60H 3BW9B 1TYRA 5IB3A 3UBXI 2EDEA 4N9GA 2APXA 1K6QH 1E4WL 3L1OH 4KNSA 4U3XA 3SCMD 5I1CH 3LNGA 4G6FB 3KVDD 5HHPB 4ZNEA 2JKWA 2X9YA 3HG4A 4YDZA 1FHNA 3US9A 2AS5M 4XO9A 4X4XA 2GJ6D 1KXVA 4YSAA 3OB8A 4I48B 2OZNA 3GGWB 2VB5A 2YGOA 3QXTA 5EUOF 5KW9L 3CFBA 5D7JD 2P45B 3EDJA 2EIZA 4KK5D 1U91A 4L9LA 4C59B 3Q2LA 4AYFA 2C9PA 2VDLB 4P4KD 4RBPH 4AEIH 4RGMC 2VYRE 4N1HB 4NUGL 3CSFA 4KV5E 2EEAA 2Y7QB 4DSYA 5KVDE 2Q8BH 3IDYC 1Z5HA 2LV4A 1M2VB 3TBYA 4KO7A 3BT2L 3QCTH 1DQKA 1NANI 2NSXA 2ORBL 2UZYB 5I71B 5C0AE 3HB3B 4XAWL 4POZD 1ROWA 1FSKC 4O4YH 3VNYA 1IQWL 1SLUA 2FBRA 1DVFD 4PJEB 2X6CA 2XN1A 4DZ8A 4LLDA 1TITA 2CALA 4O02H 1FVEB 1JK8A 4HMDA 4XMWA 2P44B 5DD6A 2CGRL 2OZ4A 2YZ1A 4E0RA 4YHLH 4OB5L 5D5MB 4F57L 5TDPB 2KZWA 5KSVB 3F12B 4LHUB 3SPCA 1N0XL 1H3PL 3F83A 5HHXH 1L0XA 5IFHH 3K1DA 4FZ8H 1XGZA 2ICEB 3PDOA 2QPFA 3F7VB 4FJYA 4TQIA 4OM1L 4FKEA 1LO3L 1BYOA 2GC4C 3JTSB 4G5ZH 5FC9A 2IQ9L 4CBPA 5IMOB 2NZ9D 4UTBH 3OB0K 2BXYA 1KG0B 2GFBB 4LCYB 1CZ8L 2FHBA 3V4PB 3C5ZD 1A5FL 1MCSA 3OKLA 1ORSA 3ZDXF 3L3OC 8CGTA 5ISZB 1Z9LA 4ONFL 4F33B 2KQNA 3PF2A 4D7BA 1IAKB 5D1XB 5AYQA 4ZFQA 1DSFL 3EOYG 4U7SA 4F8NA 2X6BA 4OGXL 1J0IA 5K5YA 1ACCA 4JPSA 2N1KA 1I7RB 4A7UA 4RRPM 3RNQA 3DX8A 1WGOA 4L9DA 5IVXE 4I7ZC 3SOBL 1ZLSL 1N2RB 4NCC2 3B9VA 2HLAB 3V55A 5ALBL 3EJTA 2W59A 2JVUA 1D5MA 3G9AB 1I7TA 3IDJB 1BD2D 1U3HA 4Z78A 4OLUH 1Z3GL 4OSUL 1QBMH 1HTYA 3ARGD 1GOFA 1PZBA 4HCRA 3ULSA 4ZUWB 3M7FB 4LKCA 4NJ9H 1JTTA 2JB6B 4NQCA 1ZLVK 4G8IA 1E8YA 4UQDA 1T0MA 2NY0D 4Y8DC 4R4ND 1OP3K 2VMJA 4PH8A 3CN1A 4FQXB 2PWFA 1ZXQA 1DZ0A 2Z65C 3KJ4C 3L3HA 1ONQA 3K72A 1NCAH 4FLQA 5I1AB 1QKZL 5EEUA 1ND0B 3VD7A 3SCMB 3UMTA 1I8MA 3KL3A 5JQ6H 4N1EA 1R24A 1NBCA 3RWGB 3KG5A 2BSRA 1XDTT 1U8JA 3P4NB 1QRKA 2R9HC 2O6FA 5AAWC 4YXKL 3QYNA 5D7JB 3RL1A 2Z7WA 4KNUA 1XO8A 1CD0A 4PIRF 4D9QD 1UCBH 2YRZA 3CHPA 4TSAL 1NCDL 4P4KB 4EJ1C 5FYLD 4JZNA 1E27A 1CF8H 1UZ8A 4MDRA 4NO0A 1G7IA 4R3SB 1YEJL 2P5EE 1R3HA 1DBAH 3LVEA 4JN2A 3TNMA 2FX7H 4WU5A 3F8UB 4S0SD 3AY4A 5FA4A 3ZTNH 4PJ5D 3O8XD 5CEZL 1N5YL 1BVKA 4Q6IB 4TNGA 3TCXA 1DLHB 3K74B 2BIHA 3HMXH 4PRIE 4ACPA 3HKFA 1NGXB 1WD9A 3MLXL 2X88A 3V6ZA 5F1OB 4F7PB 5DZVA 4JO5A 4LGPB 3PE9A 2FQDA 4MD5A 3FB6B 2AJUH 2CDEB 2R8SL 1AKJA 3WNOA 3IF1A 3IMWA 3WFDH 4HWUA 2A74C 1T7ZA 1TQBC 2ILLA 2V5SA 1KYUA 3IEAA 4DK5A 4K2UH 2UUDK 3MGTB 3T4AA 1U8HB 1P4BH 2WTRB 3TH4T 4Y8AA 4L8DA 4U3SA 1FLRL 3JVGA 3ME0B 5KBLA 1N64H 1NFDA 1R46A 2H6PA 2XRAH 4HA1A 4ZAKC 32C2A 1KPVB 4H8PA 1ZIAA 5JO5B 4X8CA 2BCKA 1C1EL 3QIWA 2ARJB 4JM4H 1WEJH 3SE9H 3ZE2E 1GYAA 2ZE0A 5IVXF 2CR3A 4BZYA 3B83A 1YVLA 4PGEA 3BKCH 3C5ZB 3CIAA 4N0YL 1N6QH 4ONHB 3ZKSD 4G3YL 1FGNL 3HS0A 3Q1EA 5DUML 4RGNE 4Y4KA 1N0LA 3A6OA 5DVLA 3WNNA 5KVGH 5DFAA 1S5HB 2V9UA 4AGOA 1I1AA 1OSPH 1F00I 1N5AA 5CLXA 1CDBA 1M57B 3IFOA 4LBEA 1RUQL 2BVUA 5DHDA 1MCKA 1WJ3A 4P5SA 1A4AA 3ZTJH 1FNEA 3QDJB 4S2SB 4Y9BA 1OAQH 3VRIB 3VFWB 4X5WB 4ISVA 5AOIA 3FT4A 3WDIA 2YAQA 4JY4A 2E59A 4MMXB 3RJOA 2GBVA 1ADWA 4GKZA 5AVXB 3MJ6A 5AZEH 5BOZG 4H44C 3D69A 4GMTL 2R2CA 5KBNC 3QJFB 4PY8J 4DKEH 3W56A 1IC4H 3IGUA 2APFA 2BNUB 5T1DL 2BY3A 3L6FA 4N3UA 1FFPA 3VDCA 2AV1B 4Z3GA 3PIQB 3VB8A 1PIFA 2FSEA 4B27A 1FL6A 3FAXA 4GI8A 1A1NA 2F8IA 3HI5H 3BI9X 2PABA 2GTQA 3L7EA 3MJ7B 4G5AA 1QBAA 3NP3A 5DJYB 4Z7WE 2OTPA 3HNTH 5F0MB 5TE6L 3STBA 2PO6A 12E8H 2JTYA 4P2OA 4OLWH 4YAQB 1QR1A 5CP3A 1KLGB 2NY5L 1EK3A 4OCWH 4AW7A 4LL9A 1RPQA 1JL8A 2ZKMX 4WW2F 3BVDB 2KPNA 2HH0H 2Z91B 2Q76B 4KAQH 3PL6B 4ZX4A 1OEZW 2AABH 4AT6B 1T6VN 3VI3A 4H8WC 5JHLH 3PWPA 5DHVH 2VDML 3S3PA 1YDPA 1UUNA 5IJKC 1BCIA 5FUZH 2YBRB 1RZQA 4KXZI 1KBGH 1NL0H 5EZLA 5E2TL 1QNZH 3ARXA 1OGAA 3CVHB 3HS0C 4XRCB 3P4OB 4PWGA 4Y4KC 4XNZB 2K6WA 4XMTA 1PG7L 5HHVL 3QWOA 1ZHLA 2IXQA 5K1NA 2BZCA 4OZHB 5F9OH 5C9KA 3I2CH 1I1AC 4PBDA 3GSQB 1NCCL 3MLSL 3SGDI 4QJ4B 4D0BA 4IBZA 4MLIA 4P2CG 1A14L 3FF7A 4HD5A 1MI5E 5IQ9A 3CIQA 1ZRUA 4J3TA 4UOZA 1U8LB 2YAHA 4IRZH 2E9IA 2CCWA 4HPOL 2R0ZL 2E75C 1QSEA 3INUL 2NX5E 2VN3A 4IKNA 2O5XH 1RPKA 2GTZA 4U1SB 1AD9A 1FORL 4DIXA 4Y5VB 1NOAA 3LKOB 4W9DC 2EDWA 3IT8D 3EH2A 1XTMA 4HGKC 4Z7VE 2ZUTA 4ZJ9A 1CT8A 4CU7A 4PGJA 1J8HE 4B9PA 3CD4A 1XGTB 2A6JB 5GRUL 2K9FB 3TBSB 3ZN6A 1AGBA 2VAAB 4YE4L 1J0ZA 3L7FA 3UPRA 1YMMB 2CDFA 2PO6C 3VE0B 3WIIL 4ATWA 5CEXA 2Z9TA 4XX5A 4BBWA 2MOVA 4HUMB 5F8QC 3EJJX 3LTVA 2DKSA 4Q14A 1YAZA 1NGQL 3ZE0E 3MOAL 3OR6B 3B7TA 2AKRA 1F4YL 4YFLF 3EDDA 5F3HB 2GABA 1S9VA 3TBBA 1DQQB 5J9PB 3EFDL 3F7QA 5SWSD 1JDDA 3RURA 2FLBT 1WIUA 2O72A 3GJFH 3EHBC 4UIKL 3C9NA 2XYBA 3CQFA 3HJ0A 2J73A 5EO1A 1G7JA 4MS8D 2LAAA 3P30L 4M7LH 4NAQA 2V3FA 2VT0A 4DKFH 1D2OA 2YJLA 3WKQA 3AAZB 2BIOA 1ES0A 4NWUH 5E5MA 1L6ZA 1FO0B 1SF5A 4PUBL 3OVUB 4FP8H 4MDJA 2DQMA 2Z31D 4EI6B 3BGAA 3KE0A 2IH9A 4G71B 1JUFA 1VFBA 2J44A 5B1BB 1XCQA 3E0GA 3V0AC 5JA8B 3CXHK 4ANKA 1C08A 2Y2WA 3NEXA 3GF8A 4G43B 4I0PB 1J0HA 4N2IA 1OAYL 5I9QB 4OZGB 3EJSA 1HC1A 2NW2A 5HGAB 3SDCC 2XPGB 5DZJA 3SJVA 3P69A 5CEYA 4BQCA 1JNJA 3TS8A 4GQPH 2DWDA 3VJ6A 1QP1A 2AXHA 2ZOWA 2BIPA 4HIXL 2FCBA 3ZHDA 3FO2B 5B39B 3AG1B 1AP2B 3QB7C 3HNVH 5GIRB 2IANE 3QCVL 4IHOB 3JZYA 3CPLB 3KJ6H 4N2BA 4U0RB 2OZ4H 3AW5A 1RZGA 3QBTB 4WZ9A 4YL9A 4C58B 4LLAA 1ZLDA 1FZOB 1N59B 3FT3B 5DJ6B 1S3RA 4V2BA 4S1RH 2HZHA 3MCLH 1MCIA 1CGXA 3ZKMD 3BSZL 5I18H 4CVWA 3KPRA 2OSYA 2FJHB 3LSOA 4V1DA 4Z7QE 4M6AA 5HY9A 2JMRA 1N4XL 2Z7ZA 1QFPA 2E6QA 1T2XA 1WUNT 3UBXB 1PQZA 1JHKH 4LF3B 5D7LD 2A9ML 2IDCA 4Z7VF 5I8EA 3MV7B 1FL3B 2XZAL 3KXFA 2W8CA 4Y9FA 3ZQWA 5IR1B 4ODVL 1Q1PA 4X0NA 4NC0B 2CHDA 1FZKB 3K0WA 3EGSA 3ES6B 5DRWA 3L4YA 1U8NA 2DM4A 4YHMH 3BQVA 3FZUD 3GMRA 2JV6A 2NT0A 2X87A 1ECYA 5DFVD 3WN5B 4KFZC 3CQQA 3MBEC 1BECA 5DEJA 3VX1A 3ZE0F 3ML9A 3FB5B 5IHZA 4W6YB 4K8RD 2JE8A 3TN0C 1GYVA 1UZ6E 3W82A 4LVEA 3VMPA 5FUOH 4XB7A 3V9EA 3VDBA 2HG0A 4HD9A 5D4QA 4XCCL 3WKMH 2HTLC 5J11B 1FBIL 4TVPL 2CIKA 3FF8A 3Q9PA 4IU2B 4P5MA 4PCYA 4WEBL 5DRZA 3FUNA 3LRSB 4FYRA 4BKTC 3BYTA 2EDLA 4UDTA 5DHYA 1N8ZA 1NSNL 2X2HA 4WGKA 4CUCA 4M8UA 2DLEA 1UD2A 2K8MA 3DHUA 2FNWA 2Q2EB 1V27A 3QUKB 4M61A 4OZFA 5HDBE 3U4EB 5F7DB 1TZIA 1JGLH 1UD8A 4I9WD 3G04A 2P8PB 5BVJB 1XF5A 4EE2A 2QKIA 3AROA 3IDGA 4P2RD 5C8JA 4UT6A 3MQIA 4LSTH 4X7TA 1XF1A 1AC6A 4HIEB 5BO0D 1C5BH 1CE6B 3PHQB 2AITA 3TO4A 2EH7L 4ZFZB 5LCVA 4NCC1 3ATBA 1IC7H 1HHIB 4OF0A 4JDVA 1ZSDB 1FLTX 5BXFA 3BEWA 5HYEA 3TV3L 4DEUA 4ZUUA 3BPCA 3F04A 2ADYA 3H0TB 5HDRA 4XCYB 5KS9B 3BIBX 2OPCA 1IGML 1JHLH 4DGYL 4BQ9A 1EMTL 4X7EC 4O51A 3V9FA 4BZ2L 1T20B 2ZXGA 4DCQA 5AW6B 4LLQA 3VTMA 5TGBA 3BISA 4PS3A 1RL1A 4ELME 1IEHA 3FU7A 4AV4A 2BSDA 4JY5L 1IM3A 2ZYHA 3FU5A 4X5LA 1NMCB 1Z5LB 4IU3B 1EXUA 4ODSL 3H42L 2LOEA 2P5WA 3PGCB 3QO0B 1LE5B 1EZUA 2E8YA 4NIKB 3VGEA 4Y16C 3T2NL 4NLHA 4CSPA 1DUZA 1NFKA 1OAZL 4JFOB 1BQHA 1SN2A 1ZANH 1GS8A 4GUPB 3NA4A 2FEDC 4P5KA 4Z7QF 1TVHB 1KTCA 3DSNB 1V7MH 1MPAL 5I24A 4YHPB 4K7FA 3SKJL 4EOWH 3OAZH 3JYBA 3RIFF 3QFDB 4X99A 5IY5B 4KRPC 3A6BL 3TVMC 5I75C 2K3TA 5CR8A 4NRZA 4M5TA 1DBBL 1TZGH 3ZIYA 5I66A 5EEYA 3RY4A 1D6EB 2VDNL 3IMBA 1CXLA 2WIIA 4GMSL 1DDHA 3SYCA 3U7AA 4J8RB 4R5VA 3ARFD 1I3RB 3CH1B 1HZLA 1MLCB 1T3FA 3FHAA 1L9NA 2FECL 2OTWA 4H8WH 4AQZA 1RUPH 2B59A 4GXFA 4RGNC 3AGVA 1KFGA 3HZMA 2ZUUA 5KOVC 2QVIA 3ZRCC 4AITA 2FEEL 5KJRL 2G9KA 3QIBA 5FLVA 1BG9A 1JE6A 4LPXA 4RIRB 4DAGL 2CO7B 2Z92A 4PR5B 3SDDC 5L8JB 3RKDC 4FQJL 5E2JA 2FZ3A 5HD8D 3CVIH 1A7RL 3WFEH 3OC5A 3MYZA 2XACC 1UZ6F 3TGXA 1JPTL 4G8GD 2ZNWA 2F5BL 5A2FA 3HRZC 5FO7B 3SIKA 2E27L 1C16A 3VCLB 3L9RA 4M6OH 4UWQB 4BFKA 1HSAA 2E6JA 3LHAA 1L9MA 2ATPB 3VXSD 4YXLH 1NCBH 5DR5L 2WPGA 1J8HA 5HDBF 1BQRA 5KWYC 1NCIA 2Z8RA 4Q0XH 2ZF8A 2H0PA 2VZOA 1OOWA 2XV2A 1NAML 1U3ZA 3VFTB 1BP3B 5AB9A 3ZDYF 3TF4A 5CZXC 3PABB 1H9DA 2JJTA 3V6FB 5AZ2L 1MCLA 2AXGA 2OMVB 5CMAA 4FABH 5AB0A 3CFKA 5KSAB 1ED3B 5AAMC 4LSUL 5F7NC 1S8DB 2X40A 1R3KA 4N2CA 5CP3H 5B39G 5HSFA 4ES8A 2WKOA 5DJ0B 3PP4H 4P2RB 5DF0A 2CPCA 1Q4NX 4A67A 3U6XS 4NFBA 1LO5B 2J72A 3IGFA 3N5AA 3QAZB 4RETB 4XNBA 3GBML 4BK4A 1XF2B 3EBGA 2VLJE 4G42A 2XIDA 4GSDH 2R69L 2K1MA 2Z1PA 4WKXA 4ELMF 2HTKD 4OLZL 1CICA 4A7GA 3G5XA 4GQQA 3CLFL 1U95A 4JG9A 4GSQA 5A3ID 1GPOH 1U4EA 1FHGA 4M48L 4NT6A 5HHMB 4MCYB 3N42F 5BS0D 1OALA 2R56H 4HIJB 5E6IA 3BN9D 5JW4Q 1R19A 3RBSA 1RH8A 3EFOA 1EV2E 2BY1A 5KVDH 5E8OB 1RZKH 4UBDD 2NSQA 3ABGA 2QFRA 4OH2A 4PS8A 2YS4A 2DS4A 1IFHL 3O3AA 5GRYA 3RVXD 2BSSB 1O7SA 4W9ZA 4L37A 1NPNA 1PYWB 4PU2A 5EIIA 1B6DA 5JQIB 3ZKND 5F7LB 3LEVH 3E1ZA 3CDFA 1NC2B 3C09B 2VJ8A 3T6XA 4PB0H 4JY6B 1SEBA 2D7PA 3CUPB 4KO5A 2MQCA 1AJ7H 3FH7A 3U9WA 2ZNXA 4GXUM 1NJ9A 3MLRL 2J2ZA 2D2CC 4OIAA 1MQKL 5HPOA 1BLNA 4AYEC 5HGDB 4JM2D 4AEHL 1G7QB 1QR4A 1ZA3B 4QRRA 1RULH 1A7NH 2DJUA 3Q13A 3N44F 4MMZB 4PJBE 1PSKL 2RHEA 2VDQL 4BCYA 5EZIL 3DO7B 2QR0B 2RIKA 3OL2A 2JTDA 4NZDA 4NM4L 3SYOA 1B0RA 2VMCA 2Y5TB 2EVGA 1R3LB 3DPBB 4F27A 4CW1B 3FQUB 2Q2LA 5C97A 5IHUH 3WDHA 1JFQH 3O3BB 1LWRA 1T5XA 4POUB 2P24A 3E2HB 3PUCA 4R0LB 1OGTB 1K2DB 2VZUA 2PLTA 4NDMB 5IVZA 3CAFA 3O6FD 3MLTA 5KVMC 1DQLL 4MD4B 5E6IC 3NCBB 4JFVA 1UEMA 1QI4A 4A39A 1MRDH 4AIEA 2YAMA 3LS4L 5CNHA 4TL5A 1OIOA 3GSVA 2BNRE 3DX9B 4P2QA 1TEGA 4YQXL 4WF7A 3D0VB 1CK0L 4BHUI 4JPVH 4X9BA 3GXUB 4YC2C 5I1IH 5AWNL 3QEHA 3ARBA 4YSTA 3RAJH 3MRFA 1GYWA 1TTCA 2D03L 3RZWA 3FFCE 5F1NB 4D9RD 5EU6D 3D18B 4PLJD 2IG2L 5HVHB 2MOGA 2ZG2A 4F8TA 1ZHKB 3KYNB 3T77B 4GRLA 4I89A 3VWJB 1WS7A 2FIRT 3KBEA 5AFAA 4HFWA 1X9LA 2FYYB 3C2SA 5CZRA 3DLQR 4M6NH 2K8QA 2VNCA 4G6KL 2ESVE 4NI6A 2MCPL 4JZJA 3I75A 3H2WA 2ZKHL 4Y9GA 3FB7A 1X4XA 3SDYL 5BOJA 4ZSOA 3O3EB 5E2UH 3E38A 5CJQH 2WXQA 3UACA 1UH3A 1GZPA 3AC0A 2OMYA 3MLYL 5EEXA 4OKVB 1A65A 3LNIA 2PP9A 4OLVH 3D4YA 4X8JA 4DP2X 4Q9QH 2PWGA 4HS3A 3UZVB 2M8XA 3RG1C 4NQSB 4DUXA 1JZ2A 4D2NA 1HL5A 2CMRH 1OPGH 2VDOH 2GTWA 1GS7A 3SE8H 1PEZA 3WBDA 1F11A 4UT7H 1HQRB 5FDWA 2MQ0A 2F2HA 1KC5H 3ROLB 3AU1A 3NP4A 1LEIB 2YR3A 3LMJL 4TRPL 2PN5A 5GS2D 4PJBF 2X1PA 3RQ3A 4GG6B 5SWQA 3FTVA 4LEOB 4AZUA 3DRQB 1AQMA 3UTSE 3IJEA 3O2WH 5HPMB 3KLLA 2E3VA 4KROD 2DQUL 3QP3A 5DQJA 4U7KA 1U41A 5E5LA 3KPLA 4PJ7E 1WWWX 4XTRC 4OQTA 4M1DH 4Y9EA 4JM2B 4NRXA 4G9DA 1DL7H 2GK0A 5MERA 2VR5A 3KCPA 4G6AC 1GYCA 4ZX3A 1C7SA 1GW0A 2MTPA 1T5WB 4XXCC 4DPCX 2BVOB 2DLGA 4MHHG 2DIJA 1TUPA 2FJGB 1UD6A 2FD6L 4JL2A 4PJAB 1LMKA 1AQKL 4JZJC 2OMWA 3ET9F 4XMVA 5ESVA 3FOMA 3V0WH 4UUJB 2PP8A 3MJ8B 4NKMA 3FO1A 2ITCA 3BFOA 4HIIB 4DEWA 3VU1A 1HHJA 4RFOL 2VL4A 1NGYA 4QO1A 3DURB 1IGIH 3T4YB 4UYPA 3WAKA 5LCVH 4F7EB 4HLEA 1IB5A 3P0GB 2DQEL 3G6JB 2GJJA 1BOGB 1A7PL 2OMXA 4JBSA 4QIRA 4TF4A 2ZUXA 3MJ9L 2EEDA 5H4ZA 1LO2L 3O6FB 2YA2A 5DC9B 3C5SA 3GZPA 4QYOB 3SGJA 4OV5A 2QGBA 4B9YA 2ZOKB 2B0SH 3GEWB 5I30H 2MFNA 1YY9C 2VQUA 4HZLA 3B2MA 5EH1A 2J8UB 1A4KB 2YSSB 1ZEAL 4XMLL 1IC5H 1XH2A 3RIKA 3QUXC 2CHNA 5MEND 2CHZA 3ARYA 2HMID 3MMEB 1FRGH 1XBDA 2B1AL 3QR1A 2RR3A 3LKNB 4NO5A 4D9LH 3NT0A 3WTYA 3REWB 3QZNA 3OKDB 3S37H 4DN3H 2XFGB 5KOMC 3S0PA 2BS8A 2WTOA 3O3DB 3X13A 2PYFA 4DP5X 4FFYL 4YEEA 1YNTA 1DO5A 1NCUA 4PRAA 1N7ML 2OW7A 4KO6A 3QJQB 2FWUA 2V5MA 2UWEE 1HINL 5EU6B 3IDIA 2CJUH 2V17L 5DEZA 4Z3JA 3IM1A 2VZVA 3ZDZB 1JBJA 3H2QA 4UT9H 1A6WL 5FWQA 4OI8A 3NCEB 4GRMB 1TTUA 1I1YB 1CFQA 4ZO9A 2HJKB 3GBDA 3QYCA 2E4TA 5FA3B 3TP4A 5AVQB 5K9OA 4G9FE 1LJMA 2VLJA 3D3VE 5TTRA 4N0FA 1G5AA 3B9DA 2N1TE 2IWKA 1LLAA 1OCZB 1UQSB 2BZDA 3VGDA 3F6LA 5E4OA 2Q6WA 3WIFA 3DARA 4LSVL 3GNML 3TFKD 2FHCA 1MFCL 3X12B 1PVHA 2CIIA 3OSKA 2BMKA 3QIUB 1KTDA 5C0IA 1GJIA 3JWDC 4A04A 3SGKA 2IADA 5IW1B 4FYQA 3TYGH 3UTTA 2XI9A 1DSYA 5FW6A 2JKIS 2CO2A 2H8PB 3C12A 5E6UB 4G72B 1ZDQA 2SEBA 5B3NA 4HJ1A 4L8SA 2CUMA 4PJ7F 2WWMD 1UXSB 4X9GA 5LNGA 2QQNL 4QRPE 4X6DE 4BSVB 5CM1A 1O9ZA 4UTCA 3QVAA 3MDJA 3RUGB 4WFEE 1KLFB 1WYJA 3O41B 4OLXL 1QHPA 2P80D 1JXJA 1RP9A 4J1UB 3PHAA 5FECB 4CSTA 3VQMA 4P2AA 1LP9B 3GD1C 1BWWA 4N3TA 1XT5A 1NH6A 2BXZA 4D7PA 3WSQH 4MDIB 1ZLUH 2NXZC 3KM1A 5JMOC 4ODHL 1QO3A 3SDAD 3ULVE 3S88H 1QSFE 4HIPA 1U33A 2VMEA 4IRJD 3BWAA 3VXPA 2JJSC 4FQCH 2E7MA 4U0QB 3WJJA 2FX9L 1E5ZA 1Q94B 2ZYSA 2VR6A 4KK6C 4ALAC 3GRGA 5I0ZA 4G6MH 4N2KA 1OAUH 1M7IA 3DJ9A 1X5AA 4AC4A 2BFGA 4N2HA 4XC1H 5JIMA 4FI6A 1XGPB 2JIXA 1OAXL 1FAIL 4P2YA 1RIVL 2NW3B 1W91A 5EOCJ 1GW6A 3M17B 2FB4H 4YH6A 4ZOCA 5MI0C 3GSRB 4R84A 3V4VL 3GTVA 4XVSL 3O45B 1WGVA 4ODTL 4UM8B 3IPBA 4BSWA 4Y1TA 4FFZL 3QO1A 4FQHA 3ZX1A 4L5FE 3KPNB 4KJWC 5J13B 1H8NA 1G6RB 4LT7A 2AEIT 2UWEF 2Y5EA 4MB1A 4X8XA 4DERA 1YNLL 4M3KB 3U0TB 4LCIL 4Z7IA 3REVB 3WTSA 4PJGB 3EXLA 5LGHL 5TE4L 1TDQA 2DLHA 4P99A 4PGBB 2WUCH 4TNWF 2ZSWA 3NPSB 1BX2B 1KMGA 2VDLL 3DC0A 2NYZA 2W07B 2X89D 4HISA 3GMPB 4M62L 3KPSB 4YUEH 4HWBH 1BSIA 3ZLQC 1NA8A 4NGHH 3V5DB 3FU9A 2KERA 3WJLA 2XKNA 5I1HL 3HPJA 3L4UA 1CYXA 2WQRA 1A6VL 4Y19A 4DGUA 1KY6A 4MTMA 3WMPA 2YC1A 4W81A 5ALCL 5FB8A 5I6XC 3GDBA 4PJXE 3ZO9A 5FO8A 5HHOA 3LIZL 4I2XB 4PWJA 4ZG1A 2A83B 4OJYA 3BP5B 3V7MA 4CNIB 3TFBA 4KMTL 4TULH 3X1GA 2O61B 3PXLA 1BF2A 1LM8V 2A77H 1QLFA 3FOLB 4X6DF 4JLRB 3WD5L 4QXTB 3QDGE 4XZ4A 2KH2B 1KB5L 4KHTL 3QXAA 3WS3A 1FH5H 1P7QA 1HOCB 1B4TA 5A7BA 4CSSA 3RPIB 2J1XA 1T5KA 2XY1A 5LXVA 4ZMQA 5BQ7A 3GB7A 5IB4A 2W81C 2YK1L 2XA8L 1IJ9A 1KXHA 4PGDA 3V4PL 1DYZA 5EFIA 3WEOA 4XVJH 5J4MA 1FI8C 1ZTXL 4JG1L 1H3UA 1MRFH 5JIHA 3ULVF 4HT1H 2HRPL 1SVBA 1UD3A 4E41E 4LARL 1ZWIA 4KQ4L 1Q9WB 5KBKA 2V2WA 1IAOB 1NICA 5J1AA 5SWZD 4Y1AB 5E6SB 3UTSA 1L3WA 3G6DL 4PJ8D 1X5IA 4KGLA 3NPZB 2QHLA 4DP8X 4BXVA 2TAAA 3F65A 3KLKA 1ZT7A 1L4IA 1S5IL 3SDAB 4FG0A 5DUBA 5LBSH 3N1FC 3VWKC 2YUXA 2ZWNA 4URTB 1L3NA 1UJ3A 2HN7A 3JT2A 1U21A 1QYGL 3N0PB 4JS7A 2R39A 1B0WA 4IRJB 2DLTA 4AOFA 1T83A 3O4LA 3T65A 5GSVB 4YHIA 3V0GA 8FABB 2WXFA 3BKYL 4BGDA 5E5RB 2H2SC 5CJOH 3PWVB 1R1CA 3NH7H 4TLTA 3EBIA 4QWWC 2AJVH 4JGMA 4Z8FL 5E1AA 1A1MA 4FOMA 4Q58C 2EVIA 1V5JA 4U3HA 3ZW3A 4A2GA 4KMLB 1J05A 4E42A 2ZP0T 4R2GD 3FTWA 3N91A 1DCEA 3BAKA 5JZ7D 4U49A 4ZXBA 4CC4C 4DHLA 3Q2VA 1PKOA 7PCYA 4CVXA 4S1DC 4PJHB 4OUUA 4YHKL 5ITBH 1G7LA 3RKPA 2EYTB 2J5LC 1S3KH 3SKOA 2YQ2A 5H8DA 1SJEB 3C08L 1F97A 3IFNL 2A9CA 1BBDL 2BRRH 2CNYA 1IKNA 3UZQA 4ZS6C 4HX1B 3ARDC 4NQEE 3B9KA 4HQQH 1P4LB 1YO4A 3KL0A 4JFZL 3EH1A 2DL2A 4LNRA 4DTGL 5MEQA 2ZOOA 5D1ZI 1EWHA 1OF2A 3OGOE 4PJXF 5E8PB 3C6LD 3PFQA 2OP4L 2Z34A 2BSBA 1O5PA 4P9ML 1NFAA 5ESQB 1Q0YL 1RZ7H 5INDA 4BV1A 1GHFL 3QUML 3OX8A 5I26A 2BDNH 1AMYA 4KY1L 5ECGA 3TONA 3L3KB 2FWLB 4FXGB 4DPBX 1RIHL 5AUMB 2DMHA 4ZX5A 1FZMA 4IDJL 4LCWD 1KIUB 4HXBH 3GSNL 2EIEA 4JAMB 3QEGH 3TJPA 1WBXA 3NJXA 4XMXA 1UJ3C 3T3ME 1SYVA 4R90L 4BK5A 3VFSB 3QJZA 3TNNA 3BLBA 1P5UB 5AG9A 2CH8A 1IZJA 1YEFH 1JS4A 1J1PH 2AW2A 3MA7B 5F7WC 4HU8A 2J1ZA 1OGSA 1MFDL 1WZLA 3GMMA 4GEIA 1OGPA 4QCIB 4HOXA 2MMXA 4WW1B 2FH8A 5K39A 3FFDB 3E6FA 1ROCA 1OSZA 3EOAA 5DCCA 3W0WB 4IS6A 2I9TA 3EOBA 4O02B 5D71H 1PZ2A 3RI5F 1O75A 5F3FA 4B9CA 5JDJA 4E9VA 5ADPL 3D9AH 4JO2H 4G1MA 4Z7OB 3VFPB 5GPRA 3C8DA 4NKIL 2YMXL 5AVRB 2GIMA 3QORA 5EZOH 2WW8A 1JZ3A 2NNAB 4JVUA 4AQ1A 3BE1H 2WXRA 4QTHB 2YXWA 5EORH 5CLWA 4QDGA 2P5PA 1NDGB 3LJ3A 3QFJD 1L7IH 1YEEL 5LXGH 1NGWA 2JNZA 5SWZB 2YBGA 5IV2B 1BVNP 2XVLA 3LYRA 4NERA 4WFHE 1HL4A 4AKQA 5IOKA 2YEVB 3AQXA 3OG4B 3HI6H 2XN0A 5IFAH 1AGFA 5JIQA 2BSTB 4TSCL 4DESA 3JSSA 3LZFH 4L8BB 3KDMA 5HJBA 1Q90A 5B4MC 1JNNH 2CO1A 4PRHE 4C4BA 5J06A 1UGKA 2DWSA 3WEXB 3MA9L 5IVNA 3S35H 4GIAA 2VRQA 2BS71 2XTLA 3KPOB 3VXQB 4YBLB 3OJMB 4R26L 1IZKA 1RLBA 3TL5A 1WQVT 1G9NL 2NY6C 2H1LM 4PG9B 2L7QA 3HG1E 5D2NA 3T0EE 4BK5C 2VXUL 3V6OE 5GGVL 3VACA 4E5XB 1JNHA 4TUKH 1JD9A 1P7KB 2PCPA 3QUYB 1DANT 4ALAH 4JGNA 2NUPA 1T1YA 1PGRB 2BVTA 4JG0L 1PKQA 4R2GB 5FW7A 4QI3A 2D31B 3B3IA 2AI0H 4ABWA 3BN3B 2NZIA 1O5DT 4GKSB 2DI9A 3IJSA 5DMIL 4F92B 2J88L 4KUZH 4Z7NB 3HN8A 4LASL 3CK0L 3DRTB 1AIFA 15C8L 2OCCB 1LILA 3MRMB 5CZVH 5IIEA 1UB5B 4OF6A 5J6GA 3DI2B 2G5BB 2FL5B 5A2IH 2IAMA 2X4UB 2AJZB 4ABQA 2L7JA 1EFQA 4I18B 2XG5B 5ANME 2WJ7A 3SYAA 4M4RB 4BFGA 4X80H 5FYLL 3U46B 4F80A 4X6BB 3C6LB 3QXUA 1CFTA 3VI4B 3ZZLA 1KCRL 4E9WA 4LLUB 4NZTL 4ORGA 1ECZA 5F3BA 3QDMA 4LGRB 1YJDL 3MOBH 4KHXL 4JPIB 3OF6D 2C4FT 4K71C 2VM4A 4EUPH 3Q44A 3ULVC 2BNQE 1S9XA 3ENEA 1Q0XL 3MRLA 2KMWA 4YBQD 4HUKB 2Z35A 4Z6AT 2X0WA 4ODWA 1A2YB 3BZFB 3EYFB 3BVVA 1XFPA 1BJ1J 4FZEL 4WWKA 5T1LB 2CO6A 4N0UA 4RVBA 1KGCD 3BSGA 5E9DB 5I8OL 3NEEA 4XB3A 4FHBD 3BUTA 4K73A 4MXQD 2C9XA 4MNQD 5LNDA 4JFFE 1WC7B 3HLAA 2Z64C 3SQOL 3NZHH 3Q7JA 3CZGA 2FO8A 5E94A 2EIBA 1SXBA 1T1ZB 1H15B 4FNLH 3BCDA 4CDGC 5EBWA 5EULV 3CFTA 5I6MA 1RAMA 1RZJC 2KZBA 1OARH 3JT0A 1HAUA 3FT1A 4M6ML 5J89A 4GW4A 4KZDL 5IK3A 3Q5OA 5HP5A 1IC0A 5AYUH 4JO4H 3I9GH 3HR6A 1VA9A 4A2MA 2R4RL 1IM9D 4EN3D 1X4ZA 4E41A 4AG4H 2J8OA 1ZGLA 3CFDA 1ZHBA 2VXVL 2X2UA 1S7XA 5DQ9B 5KVEL 5TE7L 1NBYA 3DI3B 1VFAA 4JQIL 1FO0L 4RGOH 5EZPA 1UWGH 1ANUA 4XBGA 4FQ1L 1ULVA 3AMLA 2NOYA 3LKQA 1KCSL 1PDKB 2P8LB 1ZAGA 3ARTA 3QGVA 4EI5A 4YDKH 5C0JA 5JLZA 1CFVL 1QLEH 2VLME 3CDZB 3H4HA 5EEZA 4WI2A 1F8TL 4TVSa 2DQCL 1VPOH 4EPSA 3OMNB 1P1ZB 2BP8B 2VZ1A 1FC2D 2NY4C 1ZJBA 4ZMZA 1P5VB 5ACZB 2BIMA 2D7NA 3BKML 4WWKC 2WOBA 1QG3A 1XWVA 3UCRA 4MAYC 4ZTOL 1EQWA 5J5EA 3FSVA 3DV6B 2H4EA 2JB5L 3QG6B 4UINH 5SX5H 3K6SB 5IMLB 3QG7H 5C92A 1IE5A 2BO0A 2WMPA 2XA3A 1KOAA 1N68A 3MRHA 1YPZA 5KYXA 4U1GB 1AZRA 3GKWH 4FCHA 1T22A 1YQVL 3DJSA 3LKPA 3SPJA 4PJFA 1HZHL 1A9EA 3OKKA 4AJVA 4XCEA 5CKGA 4P57B 2BOCB 5IROA 1B88A 2CKBA 3S3JA 5EF3A 3IU3B 3K0YA 4Q7DA 3DGGA 3RIAK 2V9TA 4H0GA 1CI5A 2GUOB 4PTUB 4QT5B 3WHXB 5FK9A 4ECNA 3OXSA 4YPJA 2ZWKA 1RZPA 5DHVB 2IDSA 4RNRA 4WFGD 2X5PA 1FDLH 4MJIE 3GHBL 4U6XA 3CH8A 2VLKE 2GBUA 3VG9C 2CBQA 1ILSA 3RVUC 2R9HD 5AW3B 2EXYC 3O6KL 2WZ5A 5AOZA 5CSZA 2FJSA 3BWZA 4C56B 1YY8B 2E9BA 2ZAIA 4LOUC 4W9GC 5BV7L 5HYJA 4KTDH 4K3EL 5CN3A 1WISA 4CL7A 1QWHA 1JGUL 4K7PH 1ZVYA 1D3CA 1W8EA 4Z7AA 1K4DA 3MBWB 3TWCH 3A6CL 4RGMB 4YO0B 5F7BA 2CRYA 4ODUB 2X1OA 4F9LC 4NNXA 3IDYB 4JRXB 5DJ2B 4J3OF 4HKJB 1YEGL 3IYLW 4YDIH 5IQNA 4G82A 1A3ZA 3GXMA 1MZZA 3AS3A 2XWBB 4ETQA 3VD0A 2X4OA 4K3JH 1YMHA 1RZFH 2VXTH 3JYCA 4ZO6A 5DJ8B 4KI5E 2R7EA 2DQGL 2BJMH 3BUQA 2PYEA 1LQSR 1BVNT 5BZWB 1FSKB 2OXGB 1JTOA 2IDUA 4Q56A 1HN1A 3DTUB 1U8PA 2I32A 2JFCA 1MCRA 1JN6B 5C1MB 1U3HD 1QPKA 5D7IB 1KFAH 3AU0A 4K3DL 2DYPB 2G3MA 3QARA 1UM4H 3PWLB 4MAUL 4NZUH 1MLBB 5KAQF 3B2VH 1SY6A 2XWJB 3EZJB 3TESA 2Z93A 3J8F7 1MWAH 4J4PA 3LKSA 4NQCD 3IFLL 3AXLA 2F7QA 4JN1L 4QRSB 4N87A 1A4BA 3EG9B 4QXUH 1EFXB 1JGVL 2XXFA 1U30A 2FSDA 2B1HH 4H20H 2JK5B 5K59F 5M94B 3VFVB 1I8LA 3GJFB 4PJCE 2CK0H 5IB3B 3FCUB 3QEQB 1W72L 3V5HB 3MLUL 2FJFA 1OHZA 1EZVX 2ZXAA 2Q7YA 3L3OB 4JFYA 5E8EA 2BX5A 1QRNA 3VH8B 3B2UC 3OPZH 4L4VA 4M43H 3FO0H 5C0CA 4BGLA 4AQEB 2ZX5A 1B0IA 4RWYL 4UQAA 1EHLL 5G4NA 1U91B 5A16B 3MO1A 1IILE 3A4AA 1CE1H 4QRTB 4XAKE 3NDZE 5A6LA 2WXPA 2XLLA 1E90A 4NO0D 2OYPA 3V6OA 1ET7A 3PPEA 2OMZA 3FN9A 1ZOXA 3BH8A 1PEWA 1P2CB 1CDGA 3JWOC 3ZUNC 3K2MC 3D1MC 4Z5RB 3U79A 2RMNA 4M7JL 3TBYB 3FMGH 4MWFA 3HBQA 4OGYH 2VRAA 3VTAA 2GITA 4TNEA 1BHGA 1TENA 2XWTB 4XNUH 2KT6A 5GRJH 2MQGA 1FV1A 1MAMH 2NMSA 1DN0B 4PJDE 1JZFA 5LVEA 4E9XA 3CFIC 2E9GA 3TOPA 2ZPKL 2QQKL 1NBVH 4LLDB 2EVJA 4YPGA 2UZIH 3KLHC 3OBAA 2LTQC 1AKJD 3O3UN 2TRYA 4ZD3H 3FUEA 3UJJL 3SHSA 3IMRA 1LHZA 3TEWA 4DVBA 1IQDB 4HJEA 4J4PC 3KWWA 4Y4FA 1NOFA 5ANMA 3KJ4B 3T8MA 3CZNA 1PX4A 4XPAL 3SDXE 4YFLI 2Q3XA 2Q8AH 3L3IA 4JDZA 1I4FB 5E08L 5L4MA 3P2TA 4Z0XA 1LO4H 3QIWD 1G4MA 3ECBB 3QUZC 5HI4C 3VXRB 1K8IB 1A7BA 1ORSB 2IV8A 4HH9B 1C9SA 2I07A 5D7KD 3O2VL 2CO4A 4Y4KD 4KI5F 3PG2A 2HLFD 3WLBA 4OF8A 1I1AD 1QX1A 1BA9A 2IPTL 1NEUA 5HHPA 2IGLA 3ULVH 5D70H 5DU7A 2K7PA 1G7PB 5D1ZB 5C6TL 4XPGH 4QR7A 3RNQB 4I48A 3GGWA 25C8H 2DEYX 4UV7L 5HJ3B 3T0EC 4X50A 3OLEA 1LYQA 4K8RL 3QFGA 3ZTJG 3V6OC 4N8UA 2XZQH 2DWEB 5K69A 2J57A 1Q9OA 1U3NA 3FU6A 1URLA 2AAAA 3CLEH 3ZBMA 1I7TB 5I6KA 4F8OA 4DGIL 2Y7QA 2QGEA 4XWGL 2CBTA 2VDRH 1H3XA 2ED9A 4BH8B 3CBJB 2A3TA 1DZBA 1M2VA 4PJCF 1DQDH 2V33A 2A74B 1TQBB 4DO4A 2HT3C 4WFFD 4DNLA 2ZSVB 1DEEB 1IAIH 1RZJH 4MB3A 1J5IA 3Q2WA 2PO6D 2HVBA 2QJDA 3MVSA 1T0MB 4P2OD 4L5FH 1G87A 3W37A 1LWHA 3HBPA 1C5DB 4PJEA 4ZAKB 3H9SE 1U8CA 2Y2YA 2X53A 1XH3B 3K6IA 4Z3IA 4KKBC 3DX4A 5GGTL 5E9NA 3DBXA 1ONQB 3K72B 5D5MA 2FRGP 5TDPA 1N6VA 3F12A 3LQMA 1I9IL 1VENA 4LHUA 4JKKA 5EDSA 4GLRH 4LQFL 4X5QA 3PWPD 1AO7B 2ICEA 4QF1B 2HFTA 3ATDA 3F7VA 1L5GB 1HWGB 4CVUA 4U1LB 4TL4A 3JTSA 3BCFA 3RL1B 3LPPA 1CVRA 2W9DH 5DMGD 3TT3H 1OGAD 3HFML 3N0AA 5IMOA 2CG9X 2F54E 3GSOB 2GFBA 4LCYA 1KGUA 2H1XA 5I8KL 3AT9A 4OJCA 1UZ8B 5AL8A 4PJDF 1A3RH 2OL3A 4BKSC 2F53A 4AGMA 4F33A 1J86A 4YJZL 4FHKA 2ADFH 2Y36H 1IT9L 1IAKA 1K8DB 5D1XA 5C7ZA 2YPVA 3VFNA 2ZJSL 5IKCB 3HC3L 2RQ8A 3H3PH 3QC6X 2J21A 1I7RA 3TEUA 1QSED 2WO2B 3OKYA 3EZ8A 4QRAA 1KTJA 2H2PD 1M05B 1WFJA 3ZTDC 3GLZA 1HT6A 4MBOA 5L2KE 3SDXF 2IVFC 1N2RA 4J3OC 1TU2A 4PVMA 3SGEI 4B5ZA 1JXKA 1AKJB 3LQAL 1GGBH 3IDJA 1AD0B 3B5GA 5ECJE 5H37A 3V52H 2X2IA 1YEKL 1A1OB 3PAUA 1JPGB 5I71C 3O2DA 5T5FL 1MHHA 5FGCE 5EOCH 2IV9A 4JFEB 4LU5H 4F37K 3NZSA 1JZ6A 2MPAL 5CEZE 2H6PB 2ZXDA 1SDDB 2P48B 3ETBJ 2JB6A 5EHFA 4R7VA 2VLKA 3CSPA 2BCKB 3QT2A 3RGVC 2PPEA 5F7KC 3L81A 3PHOB 5DURD 1BGXH 5DEGB 4XWOC 1RCYA 2YD4A 1KGWA 1BM7A 1CO1A 1E6OL 3WCYA 2AZUA 1G9MC 1N0LB 1MCBA 3HE7A 4HKXB 3FN0H 4TQPA 2G5UA 4Y4KB 4ZODA 4A2EA 4WCYH 1XHHA 1ND0A 2G2RB 2O5ZH 3SCMA 4YLCA 5JDSB 3HR5B 3X1NA 4PYHA 1D9KA 1HKLH 1UXWB 1RD6A 3B34A 1B2WL 3VSQA 1KULA 2XN9B 5AW2B 1R9FA 1MHEB 4FEMA 7FABH 1MAKA 3SOTA 3SKNB 5EA0L 3ALXA 3FT4B 4OLYL 3FQRB 4JY4B 2J71A 2UY6B 1MCJA 1T0NB 2OI9C 2ZOLB 1OTUC 2P1YA 4GKZB 4MRCA 1XQ4A 1KELH 4XO3A 2DQIL 3D69B 4LMQI 3KBHE 4KMQA 2CRMA 4JFUA 2WLKA 3Q6GL 4QRFA 4YGAB 3CVBA 3ABKB 2DTML 2PETA 1F42A 1T66C 4R3SA 3QULB 2DMKA 1D5RA 4FMFA 4L4TE 3DBSA 5IREA 2A1WH 3TH3T 1FP5A 1HEZB 3FCBA 1HE8A 1A1NB 2EEBA 4J3VA 4OT1H 4U6TA 4Q6IA 2HTLD 3KR3L 4XE0A 2PO6B 5I1KL 1X7TA 2QV4A 1R17A 1XGYH 2EEXA 1NGXA 2UUDH 4FNUA 1TQSA 4F7PA 1QR1B 4U6HB 4KKCD 1I31A 3FB6A 2CDEA 4JDTL 3PV6B 2IALB 4NENA 4PCSA 2C9AA 3MGTA 1U8HA 4GYBA 3N9GL 3SBQA 4OV6F 3EHBB 4AJ0A 5I8CB 4PLOB 5ENWB 5EOTB 3ME0A 1YDPB 2V37A 4CA4A 1PZAA 2HKHH 3KPRD 4PJIE 1KPVA 4FAAB 5JO5A 4LAJH 4V1DD 1QACA 4XMKH 5EZLB 1IVLA 4NHCH 3VFMB 2IJ0C 1S78C 3HE7C 4XN8A 5T5NG 3C5ZA 4N0CD 4ONHA 1D9KC 4GEJA 1DFBH 1XMWA 2BC4B 1XXFC 3CFUA 2Z7UA 1T2QL 2LHAA 4XPTL 4PBXA 3KXFD 1KJ3H 4JHWL 5I6OA 3EDKA 2WQXA 4L48A 1MDTA 4NP4L 3SDCB 2O6CA 4KI5C 3JWOH 1QSEB 3QDJA 1HX0A 5C0AB 3VGFA 4NLAA 3VRIA 3VFWA 4IRSA 4X5WA 5D6CB 5IUCA 2AAVA 5DUPL 3MGAA 4MMXA 5IOPB 4AGLA 5LKNA 4QRQB 1XEUA 4F5CA 1ZMYA 4A68A 3QJFA 5C08E 3ABLB 4NZJA 1K3ZA 4HZ1A 4I1NB 3PXJA 2LU4A 2BNUA 1CDUA 1XR9A 4YSRA 4ZOEA 1AGBB 2EICA 3PUUA 5D4HA 1BLIA 3OD3A 2VJXA 1SY6H 4FG6D 4KRPD 3W11D 3TVMD 2G5RA 3L4CA 5DJYA 4U05A 2F1EA 1GR7A 4S0TD 2B39A 2APBA 1JPEA 3CDYA 4LP8A 5I28A 1S9VB 4PP2B 4YAQA 2PR9A 1KLGA 5DS2A 1MREH 4L8CB 3KMDA 3FUMA 4QGYA 4Y5XA 3KD4A 3LEXB 2Z91A 2Q76A 1ADQH 3PL6A 4XP9L 3TO4D 1V3KA 2OR9L 1RIUL 2AQ2A 3RWHB 4NM8L 3SDDD 3WEAA 4X9FA 1EERB 3GHEL 2UYLB 3FQWB 4GSRA 3D0AA 1JUFB 3CVHA 4O2EA 5C0BE 3QISA 1XCQB 3JZ7A 2O5YH 2DL9A 4OZHA 3D48R 3TJHD 1VLXA 4WEMB 2NW2B 3TV8A 3A67H 3MBEB 1IM3D 4PP1D 3LN5B 4IRSC 4XP5H 3TN0B 4PSRA 3VJ6B 2WQAA 1V7NH 1NEZB 2YLKA 3ZE1B 2P5WD 3EYUL 4OIBA 5IMMB 4U1SA 1ZIBA 4Y5VA 5CZXD 3LKOA 2XUWA 5IQLA 1QNIA 4MNGE 2DM3A 4PJIF 4KPHL 1DBKL 1G7MA 4RMTA 2G2PA 3LQZB 4MA7H 2N7AA 2GJPA 4XP1L 5CJ8A 3IXAB 3QZBA 1LDPL 2VAAA 4M5ZL 4HK3N 1YMMA 1FNSL 1BEXA 3VXME 4S10A 4FFTA 5E1IA 2QADC 1UH2A 4WO0A 4RISL 5I5IA 4RQQB 4HPYL 3KPRB 3IDXL 5KG9B 3OR6A 1YNKL 3P11L 1NMBH 4HJ0D 3H6AA 4G7RB 4Y5XC 1OAKH 3KYOB 5F3HA 4A66A 5HY9B 3IBEA 3Q1SL 5J9PA 4IMLB 2HVJA 5G4MA 3QIBD 3I6KA 1TTBA 2VIRA 4HHAB 5JR1L 2O6EA 2P5EB 5I0DA 1I9RL 2JWYA 2MOQA 1MI5D 4X9IA 4XP4L 3MKGA 5IBTL 2K3HA 3CZEA 5BNXD 4C4KO 5CZKA 4AE1A 3LZNA 2NR6C 1TQCC 5KBPA 3KXFB 2F1BA 2VDOB 3AAZA 4HS6A 1EX0A 3CSGA 1ACYH 4UTAL 4Z1PA 1T6WA 3U6XA 2EYRA 1NCWH 3EGSB 4WHTB 3IMVA 4EI6A 1U8NB 5T1KB 3EKCA 4F2FA 3WTWA 4OFPA 4PRIB 5B1KA 1EDHA 2AGJL 3GS4A 4WY7H 3AABA 4I0PA 5DT1H 4G43A 4WI3A 4J5VA 1J8HD 1R33A 4Y16B 4U1NB 3T0WA 5IHZB 3THML 4J3OH 5HGAA 4X4KA 4AIOA 2XPGA 5E95B 2M26A 1CTOA 2IDQA 5CXPA 2APWA 1Z9SB 2CIKB 2H47C 3HUJE 4KRPB 1MFBL 3TVMB 1BAFH 3WO4C 5I75B 2WQSA 3FO2A 4X98A 1IAMA 5DHYB 3UBFA 3LH2L 1AP2A 1H9VA 5GZOC 1EGJH 2PW2B 3EIFA 4GT0A 2OR8A 4QHKI 3NTCL 5HDLA 3ZE2B 2LGNA 3CPLA 4OCXH 3FTXA 2XWDA 9PCYA 2DM2A 5J0BA 1XF5B 3IDGB 4RGNB 2E4FA 4BE6A 5C8JB 1BFOB 2AJ3A 4HH8A 3WNMA 4DKTA 3PXHA 1KENL 5GS1A 4ZOBA 4X7TB 1NCTA 3WFCL 4F8PA 1JVKA 2Z8WC 2VLRE 1G9MH 3FT3A 1ZVSB 3MNZA 4JDVB 4X4YA 1JF1B 3SDDB 4UDUB 3U83A 4HUVB 2VH5L 1CICD 3BEWB 4RA0C 5L88H 3L5XL 1OQXA 3O9WA 4ZUUB 2FJHA 4U2YA 1G0YR 4GB9A 3TCLA 1TTFA 2YXVA 3IJ8A 1AOZA 1B2YA 1FE8L 1HI6A 5E6ID 2DQTH 5H94B 3ALPA 2ALAA 4MX7B 1E50A 3HRZB 3CG8A 5IT2H 5I1EH 4XX1E 2OL3H 3VXUE 3UBXA 4NQVB 4LIQL 4LLQB 3MRCB 3FU7B 2YPVH 1BQLH 1IM3B 3MV7A 5D1QE 1FL3A 4R7XA 4JPKH 5IR1A 1FZKA 4M8QA 4Z7WB 3ES6A 3I50H 3NACL 5E70A 4AVIA 2A2QT 5I9QC 3FPYA 2ZAGA 1BYPA 1CXEA 3VFRB 3LH8A 2F8VA 3N40F 4GSUA 4WKZB 4F3FB 3WN5A 4YZFF 1X5KA 2IH1B 1SEQL 3FB5A 4LP4A 2BWQA 4WI0B 3WLWC 3DECA 2BHYA 2WP3O 3EH3B 4X99B 4JJOA 3RVTD 3FK3A 1SQ2N 2IMMA 3PQYE 4XPFH 5I66B 2CM5A 2CQVA 2HWZH 1DDHB 1GH7A 4QRRD 5C09E 1XSIA 3LRSA 1KDJA 2G9HB 4Y89A 3ZRFC 4IBWA 3D5OF 4NQQA 1WSST 4IW4C 1AFVH 2NY1C 3HZMB 3QUKA 3U4EA 3GKZA 5F7DA 5GS1C 4JR9H 4PW9A 1JXGA 3GBNL 4GQZA 5BVJA 5DLML 5E7BA 1MDAA 4GAJL 3HA0A 5CWSB 1OM3H 1MI5B 2Z92B 2NZ1A 2IF7A 4HIEA 4DT2A 4K94L 1AXIB 4Z7UE 4TUJA 1UGNA 3AMKA 3PHQA 3O9WC 4ZFZA 2G0LA 1HHIA 1ZSDA 2GT9B 1JZ7A 2NX5B 3QCUH 7CGTA 4DP6X 5DZLA 3ARVA 4FQ2L 5KS9A 4G8EB 4U4IA 4PWEA 4HJJH 3EO0B 1HSAB 1SJVA 3ZHFA 1MCWW 4S1SH 1J8HB 3ZMNA 3PJSB 2W0FB 1UT1A 6PCYA 5AENA 1TMCB 3GXDA 2X6UA 3OHXA 4OQ1A 1A4CA 3ARBD 4JO1H 3STZA 4JGUA 4KXBA 3PAZA 2C9UA 1TJMA 4MQXD 3MRIA 1Z5LA 4IU3A 3TBWB 2YHGA 5LNEA 1PZCA 1CLYL 1R6VA 3PGCA 4I4WB 3QO0A 1LE5A 1MJ7L 2XICA 3P2BA 3R1GH 2CGZA 2ZF9A 4G6AD 4LSPL 4GRLD 1R3KB 4PQXA 3P0VL 4CILA 4GUPA 1DANU 5BRZA 1TVHA 3DSNA 5FUCC 5ILTH 1GKOA 3GBEA 5KTEH 4YHPA 1HZKA 1F02I 4WTWA 1MIEL 4LSSL 2VN4A 3ZIMA 4X9HA 2ARWA 1WAAE 2GJZA 1D6EA 2MRYA 3HE6A 1G84A 4J8RA 1I3RA 3CH1A 3AREC 1MLCA 1U93B 2EUWA 3ZYIA 1MJUH 2G60L 1V10A 1KEML 5D4IA 4PWFA 5C0BA 4I5BA 4XP6H 5T1JA 5HBBA 4W9FC 5I1CL 1NM9A 3ESPA 2BOLA 2FGWH 3FS9A 3TC9A 1JVOA 3E80A 1OD7A 1E4WH 2BWIA 4RIRA 4Y7MA 4EXKA 5JXEA 2CO7A 2GYSA 4HBQA 2Y6SD 4LPYA 2DZEA 5FO2A 3N1GC 5CILL 2EP6A 4JFDE 4HF5L 4L37B 3UEQA 1JPFB 5KW9H 3BJLA 4YC2B 5GGSY 4EVNB 3K8MA 2W60B 1I7ZB 2IANB 5FO7A 4L29B 3VCLA 1EJ8A 4W4OC 4LLYA 1E2VA 3STLB 2ATPA 3CNKA 3OHXC 2WQWA 4J3SA 2HVKB 4KUCD 1AQDB 2D7QA 3GS7A 1NJ9B 4JVWA 4XMPL 4L1LA 1THAA 3BT2H 4GNKB 4O4YL 1K85A 1I8AA 3MR9B 3VFTA 4N8VB 2F5AH 1UWEL 1UWFA 1GIGH 4XAWH 4ENZA 1PZSA 1DVQA 2J25A 3TBTA 3PABA 5BW7A 3V6FA 4LPTA 2X05A 4DWHA 2YA1A 4O02L 1DJIA 4MJ2A 5KSAA 2IWEA 1HXYB 1DEDA 5IQMA 1EO7A 1ED3A 4YHLL 3FAWA 1S8DA 3D7PA 5HHXL 1TIUA 5IFHL 5AL0A 5DJ0A 4FZ8L 4YLQT 3SD5A 4OZFG 4WUUE 1DLFH 3E8UL 3HE6C 5DMYA 1EEQA 4G5ZL 2P24B 2BIQA 1EHXA 1XF2A 3QHZH 4OM1H 1GOGA 3MXWH 1LO3H 1BQSA 4NC1C 5BUAA 3I9AA 1K9TA 2IQ9H 1UT2A 1WP6A 5EDXA 3G6AB 3RE0A 4U4BA 3E3QE 2IAAC 3CVHH 5LB1A 4MCYA 3D52A 4HIJA 2MQ3A 3J7HA 1E7VA 4ZFOL 2ARJQ 1OCOB 1JWMB 1TR7A 5E8OA 2O1AA 1KB9K 1K72A 4OGXH 4UOW0 3PDGA 1XF3B 1CLZH 3QEHB 5H35A 4KX7A 3MRFB 1A8JH 1RK0B 1DFXA 2BSSA 3HUJA 4M02A 1PY0A 3NSJA 5DVKA 1WAAF 2ZKYA 3CN0A 5HDBB 4TMPA 2VW6A 4FNPA 5ALBH 5FGBA 3ZOAA 4OLUL 2ZTBA 1QW9A 1NC2A 4CMMA 1CVSC 5I76B 4HFWB 4CN1A 2DWYA 1CGVA 4PTTB 3D8MA 5AW1B 4JZJB 3BDXA 4AYDC 4KK6D 5I15H 1DHKA 2W65B 2VLJD 4A2DA 1VACB 5HGDA 4PCTA 4ZW8A 4HUUB 2XIIA 4MJJA 1HYSD 4MMZA 1S7TB 1GZPB 1U3YA 2FWSA 2IIJA 2JJWA 2QSVA 2OMYB 4FTVE 4F7TB 3DO7A 2NNRA 2WQUA 2QR0A 3QH3A 4GAAA 1NCAL 4JREC 3ZGHA 1YEDB 3C2AL 1HIML 4IMKA 5T8IA 2A9DA 3S36X 5JQ6L 1R3LA 3AQZA 4BFNA 4UANA 3DPBA 1QKZH 3QA3B 5F70A 5AOJA 4CW1A 2YA0A 1TT6A 2ICWB 3FQUA 3SZ6A 2X2JA 4PREB 3O3BA 5IJDC 4R0LA 5DYOB 3W5NA 1OGTA 3MV9E 3JTTB 1K2DA 1XSOA 3FQ4A 3QUXB 4PRPE 5C07E 4L3AA 4NS0A 1UCBL 1F6FB 4MD4A 5T3ZD 2AERT 1CF8L 4YDVB 4TSAH 2YD9A 2DJSA 1DBAL 3GLDA 1CI3M 3RL2B 3NFSH 4FN0A 4BQBA 5DVPA 2CXKA 5LUMA 4AYID 4R96B 1YEJH 1CDCA 3DX9A 3Q8CA 4HGWA 2BM3A 2NRDA 4NZRH 4RCAA 3ZTNL 3D0VA 2P43B 2EKSB 5DVOA 1TQTA 3HRPA 3HMXL 2AQNA 5F6IC 5CEZH 4PS4H 2QELA 5IM7A 4NRXB 5C09A 4G9DB 3TEXA 2GK0B 1FIEA 2RTTA 4KDVA 1ZGLP 2AJUL 5F1NA 3BVXA 4K07A 4E9QA 3OC8A 4P3DB 3DVNA 2YEZB 3IMSA 4K2UL 3KYNA 3T77A 3VWJA 1P4BL 2QQLH 1UKTA 1XZ0B 3IRCA 2BVPA 2ITCB 1JMZA 3NSYA 1N64L 2XTJE 4QEGA 2Y7NA 2XRAL 4Z7UA 1IKFL 3N44B 1FLRH 2JIXD 3ARPA 4JM4L 3SE9L 1J5HA 4G11A 2OMXB 5B1JA 1TQUA 2X4PA 3O3EA 4L2YA 1N6QL 3MU3A 3CFCH 3BGFC 1C1EH 1ZLEA 5TDOB 2AQPA 3C5SB 4IMKC 4CRPA 3MACL 4YXHL 4OV5B 1MKFA 4IIQB 4OKVA 3V0IA 1GOHA 1HNGA 2IOMA 4N0YH 4UM9D 5KVGL 3T09A 1HCZA 1E28B 1NKOA 1FGNH 5DUMH 2QTVA 1IUZA 5FPIA 4O00A 3UZVA 4C83B 5EU4B 1AMXA 1U92A 4OJEH 1S46A 2FUTA 3RX8A 1OAQL 2ED8A 2KYIA 4YHYC 1WZ1L 4NXKA 2YAPA 1X6LA 2VLLB 1KZQA 4PN6A 1FNHA 5DZ9A 5AZEL 1I53A 2J43A 3OJVC 4AYSA 2JJVA 4BDVB 2OJZL 5DK2A 2NXZB 2V5RA 1I8IB 3X3GH 4DKEL 3HLKA 5MP6H 3ROLA 1LEIA 4UQEA 2A9AA 3UZEA 3HBGA 1XL4A 4GG6A 2WZ6A 1WLHA 3EH5B 3RZCA 5T1DH 4QNPE 3L2NA 5JIPA 4MB5A 1ETA1 3ZR5A 5HPMA 1PG7W 2H2SD 4Y19D 1JZ8A