3TU6A

The structure of a pseudoazurin from sinorhizobium meliltoi
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
127
structure length
127
Chain Sequence
MEEYRVEMLNKAADGRVMAFEPAVIRAQPGDTVTFVAKDKGHNSALMKGGAPEGAETWKGKINEEITVTLSKPGVYMYQCAPHVGMGMIGAIVVGEPANLEAVKGIKYPGKSKAAAEKIFAEIESGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of a pseudoazurin from Sinorhizobium meliloti.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Electron transport
molecule keywords Pseudoazurin (Blue copper protein)
total genus 33
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3tu6A00
3ZDWA 2IWFA 3X2QB 3PLYA 4KO9A 4E9VA 4F2FA 1HAUA 4YSPA 3ZBMA 3C75A 4G70B 1BAWA 3PAVA 3FPYA 2QPDB 2EINB 3QJVB 3WNJA 2BHFA 3NJKA 2J56A 3NSYA 2JKWA 1N70A 2YAFA 3S3DB 4YSDA 5AFAA 3FSAA 1L9SA 3QJQB 3QJTB 1NWOA 2VW7A 1IKOP 1PLCA 2PPAA 3OQRA 5AZUA 4HHGA 2AFNA 2EIMB 1AZCA 2H47C 3ERXA 2E86A 1L9OA 1BYPA 4HAKA 2OV0A 1J9QA 3PCYA 1OCRB 2ZXWB 2ZONA 5B7MA 1WAEA 1MDAA 1J5CA 1VLXA 1ILSA 4UF7C 3FYEB 4P5RA 4KO7A 5I6PA 4A2FA 1AAJA 1NIBA 4KO5A 1AOZA 3FU8A 4HZ1A 4KOCA 3WNIA 3QJUB 3CG8A 4HCGA 2I85A 2FT7A 2IDSA 2YAHA 3SBPA 2VW4A 1NPJA 1CC3A 2VSKB 5E9NA 3T71A 4G7RB 3BVDB 1A65A 1TEGA 5B1BB 2GB2A 4DP0X 2YXWA 1IC0A 3UACA 1AZNA 1J9RA 1EZLA 2XV0A 4M3HA 1GR7A 3D12B 1ID2A 4W9ZA 2BP8A 1NIDA 3QJRB 3TBBA 4YSCA 2IH9A 1OCOB 3NSDA 3KW7A 4NAJA 6PAZA 3X1BA 1NDTA 4F2EA 4BWUA 1M57B 5B7FA 4MFHA 4JHVA 1OE1A 2FQGA 1FFTB 2PP9A 1NPNA 5I5MA 1KBVA 1WA1X 2Q9OA 3QQXA 4A2GA 3V9EA 2DV6A 4YVNA 1CYXA 5FC9A 3FYIB 5A7EA 8PAZA 1JZHA 4N4YB 2W8CA 1SJMA 1ET8A 4UANA 2ZWNA 3V9CA 1URIA 1RCYA 5B1JC 2IDTA 2IAAC 2DYSB 5F7BA 3T9WA 3WG7B 1JZGA 2GBAA 1M56B 3WI9A 1A4BA 1DZ0A 2CUAA 2X88A 4AKPA 1NTDA 1PLAA 2AVFA 3ZX1A 1ASPA 1ET7A 2BO0A 1BQKA 3IEAA 3ABGA 1A4CA 2BP8B 4AKOA 2VSMB 4DP6X 4E9XA 5ANHA 2P80A 3AY2A 4N8UA 2QPEB 4BK5C 4JHUA 4KNSA 1KBWA 2AANA 2FJSA 2CALA 4HALA 2I7OA 2BW4A 1AZRA 3SBRA 1RZPA 2YQBA 1J9TA 5B3SB 3S8FB 2BZ7A 4YVUA 1T5KA 2J55A 2HX9A 1SDDA 1KGYE 2MTAA 2DYRB 2FQDA 3UADA 4DP2X 4AI7A 4A2DA 2R7EB 1KV7A 3FQ1A 2P80D 3S3BB 2LLNA 1SNRA 1ZIBA 2W88A 2JFCA 9PCYA 3NSCA 5D4IA 1A3ZA 5TK4A 1YLBB 4HCIA 1ZV2A 3X1GA 2Y1AA 4PCYA 1JXFA 1GY2A 4BXVA 4L0PB 5I6KA 1ZIAA 3ASOB 4A66A 1NIEA 2PCYA 1AG0A 1KCWA 1GS7A 3IBOA 2YAOA 3ABKB 4EF3A 2VM4A 1ZDSA 3T6VA 2GC7C 2VMJA 2WO3B 3UAEA 1BXAA 2VN3A 2JXMA 3NP4A 1AS6A 1FA4A 4JKNA 1UATA 2XX0A 2FTAA 3NJHA 3T6ZA 4TXVB 2UXVA 3T6WA 3FSZA 1KDJA 2HXAA 3T6XA 3IN0A 2XX1A 2FT8A 4PAZA 2B3IA 1WA2X 3EH4B 1BXUA 3IN2A 1AZUA 3EH5B 1AACA 5EHFA 5B1JA 1E5ZA 1J5DA 1ADWA 1E30A 2H3XC 1X9RA 2RACA 1NIFA 3AG4B 2HRHA 5I6OA 1SHXA 3DKHA 1NIAA 1I53A 1L9PA 4FAAB 3TA4D 4YSTA 2PPEA 1E67A 5I6LA 2GI0A 1RZQA 1DYZA 4A67A 3EHBB 1OCCB 2XV2A 1N68A 4G7SB 3S3CB 2BW5A 3L45A 2J5WA 3WKPA 1QHQA 4DPCX 3EH3B 1JZEA 1XB6A 3ABLB 1WS7A 2N0MA 2QT6A 4GYBA 2UX7A 1E65A 4YSQA 2FQEA 2CBPA 4KNUA 1XB3A 1RKRA 2XUWA 4UAHA 3QPKA 3NJIA 2YAMA 2BWDA 2QDWA 2CJ3A 3NJNA 5I5IA 5I5JA 1F56A 2HZHA 1J9SA 4GP5B 4AKQA 3PAUA 1MG3C 4AZUA 5D4HA 3H4HA 3FPXA 4G72B 1XB8A 2HLEB 1GYCA 4YSUA 2HRGA 3OMAB 3CVBA 3EF4A 2MRYA 2XXFA 7PAZA 2CCWA 4BXSV 1PF3A 1CURA 3AG3B 1X9UA 2WSDA 5B1AB 1CYWA 1JVOA 2OCCB 4FA7B 6PCYA 3G5WA 2HX8A 2I7SA 1WS8A 2R7EA 3N55A 3NJLA 4YSSA 5I28A 3FU7B 3HEIB 2TSAA 4WKXA 4E9YA 4BDVA 1JOIA 3TBCA 1EHKB 3SBQA 1AR1B 3S8GB 4GP8B 3BQVA 1PLBA 2GC4C 4DP7X 2EILB 3NJFA 4ENZA 3WKQA 3FQ2A 2UX6A 4M4RB 3OM3B 1JZFA 2B08A 2TSBA 3PXLA 2FT6A 1M9WA 1W6WA 4E9SA 1TKWA 2IWEA 5PCYA 1R1CA 2EIKB 2FWLB 4P5SA 2AZUA 1QNIA 3FU9A 1KDIA 3NYKA 4KO6A 2HX7A 1AS8A 1GW0A 2DY2A 3KW8A 2GIMA 2H5UA 1W8EA 3NP3A 2FQFA 2UXGA 1OOWA 4BWTA 1TEFA 1E5YA 1AQ8A 1NZRA 4E9RA 4YL4A 4G71B 1MZZA 1PNDA 3H56A 1BQ5A 2FNWA 1KCBA 4A2EA 1MG2C 4YSRA 5D4JA 3ASNB 2X87A 1GSKA 3NSFA 1OV8A 4DP5X 1WA0X 1SFDA 2GSMB 2UXTA 2BWIA 5B1KA 1BQRA 2XXGA 5I6MA 2XLLA 3CDZB 3FSWA 1XMEB 3IE9A 4Q89A 2PPFA 4DP1X 3UABA 3OMNB 4DP4X 4DPAX 2IH8A 2YXVA 3AG1B 3U25A 2WO2B 2GHZA 3JT2A 3SQRA 4W1TA 1IBZA 1V54B 1PZBA 1BEXA 1ET5A 1A4AA 2BP0B 4YSEA 3NJGA 1B3IA 1ZPUA 2NRDA 3AW5A 3NJJA 2XYBA 3MBWB 3TASA 7PCYA 1V10A 1OCZB 3PAZA 3GDCA 4YSAA 4A2HA 1HAWA 4NB7A 2PP7A 3WIAA 4DP8X 1KYAA 3MX0B 2CAKA 1A8ZA 1NICA 2IDQA 3JTBA 1PZCA 1QLEB 3RYMA 1HFUA 4KNTA 1PNCA 2ZOOA 3TU6A 3X1NA 2XWZA 1GS8A 1PAZA 1SF5A 2BP0A 2YAQA 4X4KA 1JERA 1SFHA 1SF3A 5F7AA 1BYOA 5I6NA 4DPBX 1GY1A 4GXFA 3OMIB 1GS6X 1AS7A 2YARA 4WTQA 4A68A 2BZCA 2J57A 3GXUB 4KOBA 3H4FA 1AZBA 3GYRA 1SHWA 1ASOA 3N2JA 1JZIA 1OE2A 1PMYA 4HIPA 5PAZA 5AKRA 1CUOA 2AZAA 2A3TA 1V55B 4CSPA 3AG2B 1FWXA 3FU7A 4NERA 4ZK8A 2OJ1A 1SDDB 5LDUA 3CDZA 3FSVA 3NJMA 4HCFA 2YAEA 4AX3A 1AIZA 1PZAA 5B7EA 1IUZA 3HB3B 4E9QA 2Q5BA 3DIVA 1OF0A 3X1EA 1JVLA 2QDVA 1ZDQA 1AANA 1ASQA 3ABMB 2XV3A 1AG6A 3CZUB 5TK2A 1BXVA 3FQYA 4G7QB 4Q8BA 1L9QA 5I26A 2IWKA 3CVDA 1MZYA 2UXFA 4QLWA 3AZUA 4GP4B 2IDUA 4GY4A 2PP8A 1IBYA 4BWWA 2VW6A 2XU9A 2Y69B 3UGEA 4HHWA 3FS9A 1NINA 3ZIYA 4K9JA 2PCFA 3QJSB 4YSOA 3DTUB 4QKTA 1JXDA 4F7KA 2YAPA 2PPDA 4RH4A 1NWPA 3PPSA 2EIJB 3X1FA 1JXGA 5IY5B 4BDVB 1OE3A 1L9TA 1JZJA 1ILUA 2IDFA 4DP9X 3NT0A 1W6LA 4E9TA 1TU2A 3CVCA 2XVBA 4CSZA 4E9WA 1L9RA 3UAAA 2DWTA 1PCSA 2PPCA 1PY0A 2PLTA 2VM3A 3FT0A 3OD3A 2DWSA 1ETJA
chains in the Genus database with same CATH superfamily
4U6YA 3DI3B 3KJ6L 4F2FA 1XL6A 2QLYA 2Z1PA 5JOEA 1YEWA 2BOCB 4ELME 3Q8FA 2F18A 5C71A 2AQ3A 1TFPA 5EU7C 4HPYL 1P1VA 4IGBA 4HC1H 4MD0B 2K8QA 5L8KB 3WFCH 2G2RB 4J3VA 2EH7H 2J56A 5CLYA 3KCPA 2B1HH 2YC1B 2WXQA 1I8KA 3MUY1 2VCOA 1MWAL 4ODSL 5SX5K 2X1XR 3MA7B 4XCNA 1IV8A 4C4BA 4DJMA 3LZOA 2E76C 5JQ6H 4UTBL 3D39B 2VW7A 2F53D 3MV9E 5DYFA 4JM0A 5FUCC 2C9PA 4DH2A 3QI9C 3EYVB 5AVYB 3OQRA 5T1JA 1EA9C 4JFFE 2Z35A 4PJFB 3UAJA 4KXAA 1ZGLM 3ERXA 1FVEA 1VZGA 2ESVE 1ED3A 5FOBB 5F1NB 4HAKA 1BFVL 1TPXC 2QTVA 3GJFH 3VD5A 3PHOB 3WXVL 2QSTA 4L9LB 2BJML 4CC0A 1Q9OA 4PIBA 4M3JA 3STLB 1TXKA 3VA6A 3HRZA 3KS0H 3N42F 2YRBA 2P48B 2V7HA 4X8CA 1XV8A 1JYXA 3BXNA 4JPVH 5I6PA 1HIML 4H8VA 5C07E 4GSXA 2DJMA 2XJLA 3V5DA 5JIKA 4P2OA 4PJ8A 1SY6L 4AYEC 1BAFL 3WV0A 1AFVH 4O4YH 1NPJA 1UOKA 4O2FA 3GFUA 5I1CH 4PR5A 2ZUWA 4G7RB 5F9JA 2EQDA 1G7QA 4YDMA 2QJDA 1FLRL 4MAYA 2CKBL 3BGFC 3UACA 4HEMA 5IROD 1G9EA 1CFMA 1OD9A 3EAKA 3U9WA 2FJGB 3MRHB 4FGMA 5CJOH 1AQKL 5TDPB 1YMMB 2IH9A 3ZE1B 4F3FB 3JBG7 3QCTH 4AYDC 1DBAH 1WAPA 1M57B 3OL2A 4QEGA 4QHKJ 4ZXBD 3U30B 5FECB 3P4MA 1U3ZA 2PO6C 3KGSA 4LLAA 4WO4B 2LAAA 2JMRA 3HE7B 1NPNA 5CFHA 3OHXC 1KBVA 1NCCL 1FCCA 3HVDA 5FC9A 5CD5D 5IVXF 3BH4A 2N7SA 5FYLD 3WL9A 3VI4A 1ET8A 2VDPH 5F1OB 4P49A 2FBRA 2ZCLL 5B21A 3FJTA 3O2VH 4JFDE 3G08A 3O4LD 4HJ0C 4M61A 4TKWA 3TYFB 5FO2A 3MI6A 2FX9H 1KTKE 5HXMA 1KSRA 1VEOA 2CKBB 5K39B 2VXTH 3WS6A 4JFDB 3ARFD 4BFEA 1E4HA 2V9UA 1BFSA 1MH5A 2JI3A 2QQKL 4ZUVA 4JPVL 3VFVA 1QQDB 3QHZL 1MFEH 1K4DB 4QXTB 2MQCA 3C5ZC 1RUQH 2QPEB 5DHVB 5IIEB 2HCZX 1RL1A 1JPGA 3KLKA 3IMTA 5D1QA 1H6UA 4RX4D 3BIBX 3PGDA 3ROOB 2WZAA 1U0QA 1QR1A 4YBLB 1MQ8A 4M5TA 3BKJL 1P6FA 1MREL 3QXTA 1AZRA 3TFBA 3WFBH 1DBJH 5D7SH 4L8CA 1TDQA 2WLIB 4P5MB 2MTAA 4ZQKB 5ICXA 2BS8A 3NJXA 2G5BA 3LVEA 1MFCH 1JZ6A 3KYKL 1VHPA 3UTSD 4PVMA 4KZ0A 4KMTH 2VZ1A 3ARZA 2JFCA 5D2LB 3TO2A 2FR4B 4NIKB 4OFYA 4NQEA 3IS0X 1KLUA 4FFWC 2FUQA 4PCYA 1OL0A 4AVIA 5I6KA 2ZSWA 1M3JA 3MNVA 1QVOA 1WBZA 1ZWIA 4A6YH 4PTTB 3VWJD 5T5FA 1TVBB 1NIEA 2ICWB 2DAVA 3DSFL 1AG0A 3CV5A 3N41F 4HG4K 5FB8A 5DD6A 3ZL2A 5DJAB 4Z77B 2CM6A 1F5WA 2AQ2A 4ZG1A 1KCVH 1AS6A 1XGQB 4TULH 3GMMA 4K71B 2AJXL 3LN9A 4MX7A 5GRWA 4OCRL 4C56E 5HHOD 1JNNH 1G9HA 35C8H 4G9FA 4LL4A 2HXAA 1ZOXA 3T6XA 3NOIA 4EUPA 2FT8A 4UQ2B 4OI7A 2B3IA 3EH4B 3V0WH 3ZKMD 4LEXL 3UTQB 4BKLB 1AZUA 4YC2C 4F33B 2ADJA 4C56B 1E9QB 2VJ0A 4M62H 3FBQA 3AUVA 3MMEB 2JB5L 1CXHA 1JK8A 1FH2A 3UZQB 1EWHA 5AWNH 1B9ZA 4HIHA 3CK0L 3QDME 4LCWA 2LT9A 2OSYA 3AITA 5E6UB 4Q97A 4S1DC 5KUKA 4A67A 3OXSB 4GG6A 1INDH 3NG5A 5DI8A 4HUUA 4ELMB 5IKCA 1OP5H 4MQ7B 1AMXA 1T04B 5CKAA 3OJMB 4P8QA 2HKFL 4ZUWA 4Y8DC 1ZV5A 3T0BA 4QYAA 5J3HC 2VKXA 1G94A 1P4LA 4ODTH 5T3ZE 4BZ1A 2VLKA 2GEQA 2Y2TA 3F64A 3VI4E 5IMKB 1IGMH 3I84A 1JK8B 1SZNA 5CIPB 4AQ8C 2FO8A 5E4AA 3SKNB 1W91A 5T3XE 2KZKA 4ZAKA 4ZMAT 1J8HB 1W72L 5TE7L 1XF3A 2I60H 2YAMA 3DUHA 1OB1B 3MUHL 5HDRA 1N0LB 2YGNA 4HJJL 5F93C 5IMOA 4AJ0A 5INCB 4AZUA 4LCUB 4Q56A 2W07A 4WHTA 3DOHA 4IEFB 4HKZA 5HDBB 3AAZA 3FT1A 1WAAA 1XB8A 3VXSD 3QAZC 5GGQH 3HUJF 2W95A 2QKIB 5D2LF 3UC2A 4D0DA 5E1HB 3A6CH 3W3BA 4FQPA 4R7NA 1I9RH 1CICC 1LP9B 3QDJA 3DA0A 2JCCF 4BEIA 1X9UA 1FSKB 5B1AB 4Y5VA 1TZGL 2A73B 3HS0A 4XMPH 5SWSB 2YUVA 2YGVA 1QBLH 3P9MB 3NJLA 2H0JA 4WUKH 4X7DC 4YSSA 4ZX4A 4KUZH 4AW7A 3VFOB 3CZSA 1FGVL 2YMXH 1EHKB 3L5IA 4AQ1C 2AV1B 4KI1A 3IBEA 3FFCE 5ENWB 1J0KA 1I3VA 2TSBA 4CMMB 3SY6A 1A0QL 1M9WA 4JFEA 5I1DA 4AIZB 5F88A 5JHMA 5EDXA 1GZPA 2HLFD 3JV0A 4FNRA 1OZUA 1G1YA 2IWEA 2QSCL 2QVFB 2EVIA 2YD9A 1QR1B 4JFFA 2NY1D 3OTTA 4YZWA 2DQDH 1A14H 2VISB 4DOHB 2WLHA 3LKNB 2MCAA 4BSWB 4OKVA 1LGVA 2D0HA 3OX8B 4AGOA 3GRGA 4Q9QH 3ECUA 1T5WB 4PJ7B 4AQ8A 1MZZA 2CHDA 5FDYA 2R4RH 3UYPB 2OJZH 1BQ5A 3VFOA 4ELMF 1KCBA 1NANI 5JZ7C 2EDFA 1YY9C 2IXQA 1FNHA 3ASNB 4OT1L 4WFED 4G42A 5EC2A 2CD0A 3ZDYE 4PJAF 4XB8A 2XXGA 3HAEB 3V8CA 2IANE 3ARDD 1AKJB 3WXWL 2B1OA 3TNNA 2VC2H 1LO0H 4XPAL 1RZJH 3TJPA 2R0ZL 2ARJA 4L4JA 4HF5L 4HIQA 5ERWB 1H19A 1TMCB 4RQQA 3JT2A 5C0DA 1OM3L 3J7HA 1R5VB 2ATPB 2O26U 4I7ZC 2KPWA 2M83A 4PQXA 2EE9A 5AVUB 4Y9FA 3W38A 5JO5B 4XP9H 2RFXB 3MBWB 1V10A 4LRIC 5D1XC 2XN1A 3HZKA 2H1LM 2PP7A 3NRQA 1OP4A 2NDFA 4ONGH 5CFAA 1X7SA 4LOEA 1NAMB 2FX8H 1AH1A 3K1KC 3MUGB 3TWCL 2WINA 3KPPB 1WBYB 2V37A 3QYMA 3QAZB 5LBSL 2WNWA 2WLNA 4PBDA 4FA8A 3DVGA 1FGVH 3CZJA 3O6FD 1BYOA 1UVQA 2ZOLA 1TQBB 3BOVA 5E00B 2CK0H 5DI8B 4Z23A 4ANWA 1PG7X 3E0GA 1ZHLB 2VMEA 4XMKL 2DIJA 3LRSA 1JZIA 5IB2B 3RIFF 2FZ3A 2QMJA 3TBYB 5BZDB 43C9B 2GI7A 3C8KB 1T5XA 3EYFB 4NQCD 4Z95H 1FWXA 1DQDL 5IOPA 2AKRB 3WSQH 4NFCA 4YLBA 3PGCB 2X28A 1E5CA 3HN3A 2BFVH 3VA2C 4LSPL 3WELA 1BFOA 4OLYH 1KFAH 1A6WH 3CLFH 3B4NA 4GS7B 4KU1A 4IMKA 4YBHA 3BPNC 1I3GL 1UXWA 2NZ9C 1C5BL 3N50A 1A8JH 4PHXA 5DRNA 3SDCD 4QTIL 3SKMB 3VM5A 4WKZA 3JWOC 3R1GL 5CHNA 4NRZA 3T3MB 1TTCA 5FA4B 3P30L 4JHAH 3SDAC 4YHPA 5KVGE 3V4UL 4FNQA 4ZAKB 4MJ6A 5A6LA 4QOKD 3ARSA 5FB8B 2R69A 2H26A 3DLQR 4OGAD 2O61A 1UWFA 3S35L 3SY0B 4AQZA 3V0GA 2EP6A 2GTZA 3VXQB 2KDGA 4NZUH 1DQQB 1N7MH 2CIIA 5FGCE 3APFA 1NWPA 4Y5VC 3IJEB 4JHAL 5KYYB 2X7LB 1IQDA 4XODA 3LH8A 4N2OA 4YZFE 4BDVB 4YXKH 5DA4A 5E1AB 3VG0L 3II1A 5KSBE 3VYNA 4MXQC 4ODXB 2PCPB 3NT0A 4JB9L 4CN6A 1JF6A 1YUHA 1WYJA 3I75B 2ITFA 3C12A 1RUKH 1YEJL 3FHAA 3Q44A 5KG9A 4O02H 2DJSA 5GZNC 1AQHA 2O5XL 1MFUA 1NOAA 5FFLA 1PY0A 4XB3A 2ADJB 3SYOA 3FCBA 4C56A 5E6RB 4J28A 3O8XD 1J5HA 4NDMB 2ZX9A 3RY4A 1DN0A 3CDYA 4KO9A 4KK8C 4BFFA 3SZKC 2WSKA 1NGQH 1ROCA 2FE0A 2WMPB 5BV7H 2DQIL 3DPBB 2VDML 1EIBA 1CLZH 2B4CC 2J5LC 1RZ8B 5BXFB 4Q9RH 2O6DA 4QTFA 3SDXE 2BHFA 4NC1C 3X3GL 1BQLL 4PVNA 5GJTL 3L4UA 2A83A 3FU0A 3GXMA 4NO0D 4QPEA 3C5ZB 2N56A 4JRXD 1MQKH 5LN8A 4RCAA 3VAEA 4N2IA 1KJ2B 3PDDA 2VLMD 5GGVL 1IGTB 4S2SB 3GLEA 4GMTH 2FLRT 5KG9B 3DECA 3KEDA 3MRKB 4HOWA 1IGYB 4AQAA 5AZUA 2OP4L 2PYEA 4NQTA 1WSST 1YSOA 3K0WA 4XP5H 2ZKXA 4P3DA 1S9WA 2JIXA 3MACH 1KT2B 3LIUA 4R97C 2ZONA 4G1MA 3RTQC 2YUZA 2NR6A 3REWB 5C92A 3QORA 2OMWB 2IPTH 2H8PA 1ZS8B 4R4FH 1XEDA 2R2HB 1LO2L 4PRBA 4K23H 5J6GA 3QDJB 3BP7B 4O5LH 2P46B 2XIDA 1BVKB 3VFMB 2J88H 5GRUL 2QEJA 4FQ2H 3UP1A 2PO6B 4HKBB 3ECBA 3WNIA 1QPXA 2ED8A 3HI6L 1A7PL 1A6AB 5IMOB 5D1XB 1FZOB 4QHKI 4LCUA 3WLBB 4G5ZH 3S0PA 2F7IA 3HPJB 1LXMA 3G6DL 4ZOCA 1I7UA 3FO0H 2L7JA 4JMXA 4KJQC 4PEEA 1UENA 5IMMA 5LVEA 3V6FB 4JX0A 4P2QB 2VOTA 1CXLA 1Q0YH 1TSHA 2AQRA 2BSED 1UD6A 1GPOH 1AR1D 4W9ZA 3U4KA 4EI6A 3RDTB 3U2SB 1AD0B 1FFOB 4QJ4B 2EE0A 1KJVB 2OP4H 3BXNB 3KW7A 4NQVA 4UDUA 6PAZA 4RSVA 4F2EA 2V5YA 3U46B 4OQTH 3CH1B 1E43A 3LKSA 1D5RA 2QMKA 2NMSA 3UZQA 3V0HA 4N2GA 1OPGH 4Y9BA 4K94C 1WA1X 2Q9OA 5SWZD 3W81A 2CMRH 1QLFB 4LSTL 4U6XA 1IE5A 3VXRD 4UAOC 1EXUB 1XWVA 3NFPA 2CKNA 3O2WL 5DEJA 1T4KA 4JCWA 3S96A 2PTVA 4EXPX 2KH2B 1NEZA 2R29A 2IOIA 3TOPA 1OP9A 1LNUA 1Y1UA 5CGYD 1M7DB 5EIVA 3C8HA 4O4YL 3JWDC 4K5PA 3WJLA 2CUAA 5DZAA 5AWNL 4AKPA 1JHKL 4CL7A 4K8RD 4MQTB 5ITBL 1MFBH 4MXQD 1N0XH 1ET7A 1G6RL 3K8LA 5E2WH 4EE2A 5DC9B 2Q7YB 2XWEA 4MD0A 4D3CH 2Q7NA 1OTUC 3CMOL 4C4UA 3UTSA 5C6WH 2NY4B 1S7WB 2VLKE 3HC2A 4D7BA 2DL2A 2YSSB 4JFYA 5B3JE 3LXAA 1MVYA 1N6UA 1NAML 3QUMH 4HALA 3B9VA 4Y9EA 5FHAL 1OF2B 2UWEE 3K74B 2QADC 1UM5L 4M5YL 1ZT4A 3WEBA 4R97B 1QSFD 3S96B 4YWGL 5C0DB 1CICB 2HX9A 3QUYA 3ZTNH 1X5JA 3PJSA 1D6EA 2ARJQ 2X1WL 2NLJA 3FQWB 2A6KB 3QCVL 3VU1A 1OSZA 1JXKA 4HBQA 4U4BA 3BSGA 1SNRA 3VWJB 2WBJC 3N43B 4YNYA 3QXWA 1B4JL 1KB5B 3DX9A 4IBYA 3G5YB 5D4IA 5TK4A 4P48A 1A7QH 4MNQE 4FQQB 3EADA 4CC4C 3CDFA 5E23A 2MNJB 5FUOH 2MTPA 4UB0H 1IL1A 5CGTA 1O5PA 3BJ91 4FFVC 1BJ1J 2PCYA 1U36A 4AYGA 4HSCX 1NM9A 4JM2D 3FFCB 3CHXA 1B4JH 3QUYC 5A2JH 4QRBA 5CJQL 3SODB 2AP2A 4R8WH 3JSSA 4MZIA 4OR1A 1P1ZB 1U6AH 1RK0A 2PW2A 4EEEA 3DETD 3UAJD 1HH9A 4I4WA 2VDOB 2YD1A 4MLIA 5DK2B 5C0CB 2N1KA 3D0VB 1MHHA 2HLAA 2AXJA 3NJHA 4JO3H 4OLVL 4UILL 1KELL 4FQXA 1WIUA 4QRRD 3EOYG 4Z7VE 5IQLA 5EULV 5GGTL 5C1MB 1ZXKA 1I1AB 1M71A 5DUMH 4RDQF 3KPMA 1MHPL 4LESA 3MO1A 3V0WL 4GBXA 5ADOH 3LAFA 4Z7VF 2JKSA 5EN3A 3BFOA 1O7DE 1X9RA 1TJHH 4DCQB 2D03H 5I1HL 1SHXA 4HETA 4GQ9L 1L9PA 3KPRD 4OGXH 5IROA 3L3DB 4FEMA 1CDBA 1XH2A 3LZFH 4IM8A 4JKPL 1IFRA 3P73B 1DYZA 2PW1B 5F8QC 4UTAL 1U8JA 4MAYD 5IW6B 3OKEA 5AYUH 1PDKA 1PZ5B 3EYSH 3OAYK 4PJEE 4Z18A 5IW1B 2IGFH 3ZE1E 5KVFH 4X8JA 3WKPA 3BQUD 2OKMA 5C08A 3GXIA 1IC7H 3DSFH 3U6RA 4GBXB 4G11A 4YDJA 1FV1A 2N4IA 4JFHE 1ML0A 4D0CB 4EBQH 3L4CA 4DCQA 2ZCHL 2RHEA 4LCIH 2UX7A 4RMUA 3QQ3A 1AO7A 5F96H 3RVXD 3V8OA 1E9PA 2YPVA 3WN5A 1RIUH 1RULH 2AEPH 4TL4A 2DIEA 3FOMB 3VUAA 4WK0B 1RK1A 5I5JA 2P5EA 4Z3FA 4PW9A 1MG3C 3LNDA 2OZ4A 2DH2A 2ZJSH 1WC7B 5ICYB 4OUOA 3MRQB 3UTTE 4NNXB 3DHJA 4IDLA 1VF5C 4ODUB 2CIKB 4JM2F 4NZRL 1B0RB 4GW1B 4XPFH 2YA1A 4U6HA 2IBZY 1J7VR 5JDSA 1FVEB 5CZVL 2G3XA 1KB3A 1K72A 3RAJH 3VGBA 2VWEC 4WO4C 2PKDA 3PHOA 3ZDXF 1W0WB 3G5WA 2HX8A 2I7SA 1RUQL 5T1KB 2YJQA 2R7EA 4NQVB 4TV3A 4PI2A 2ENYA 4U2ZA 2F19H 3HBPA 4HS6B 2Z7WA 4FFZL 3DGDA 1SLVA 4G9FD 5FOJA 5C0NC 1YZZA 5HGBA 4DN4L 5KN5A 4DKEH 4OM0H 4PU2A 2VDLL 3LX9A 4AY0A 2WKOA 4ENZA 2IVFC 4M4RB 5CBEA 2UZPA 3N40F 2B2XL 1EV2E 1KIRA 4BYHA 5AKVA 1REIA 2A5UA 5F71A 1KOAA 1Z5LA 5I74C 1UWEH 4E68A 3BH9A 2VQ1A 1MRFH 4FL4B 3BPOC 4M6OH 2FX8L 2W9LA 4YFLI 3ME0A 4GI6A 2H0EA 2BSRA 4DZBB 4Y2DB 4PV8B 4PRBB 5T1LB 2ZWSA 3FTZA 4HA1A 2GBUA 4OZFB 3CDGB 1AQ8A 1RLBA 3FQXA 3RRQA 2D7TH 4XP9L 3RGHA 4JQIA 3LPFA 4QXVA 1DVFB 1NCHA 3RAJL 5BUPA 1J88A 5L7XH 2R29L 4QO1B 5HGBB 1RVFL 3EUUA 3BKYH 3NSJA 5LGYA 3AT9A 1YNKH 4LQFL 5FPIA 4P2QD 4RISL 1F02I 2XQBL 3IE9A 2BRRH 2JQAA 2X0WA 3LNEA 4WY7H 5I2IA 1YEFL 3OKNB 4OZHF 3Q43A 4JL2A 5GSRA 3EDFA 2K6WA 2OTWA 3AG1B 4N2LA 4HWEH 1S46A 2WSPA 2ISDA 3STZB 5FO8A 5J89A 4HJJH 1ECZA 1X4YA 2ZYHA 4QIRA 1MCCA 2EH8H 1BSIA 1BLNB 3WFHA 3E8VA 3TNMA 4YDZA 1H15A 4FHKA 4E5XB 3D0VA 2HSIA 2IANA 2EO9A 1FQ9C 1TQSA 3OJ2C 2DKUA 1HAWA 4Z3JA 2VLJA 1UFGA 1FZJB 3FQXB 4JPKL 2YK1L 3KPOB 3QR2A 3MLZL 4B50A 3DGGB 2CJSA 4PJCE 1QG3A 3AACA 3EGSA 5FYJL 4MJ2A 2JJVA 3P0VH 3KWWA 5ALCH 3B9KC 1OALA 1E90A 2ZOOA 2FWOA 5SWSE 4L05A 2VAJA 3DX8B 3MLVL 1PAZA 3SOTA 5C8JA 4X4KA 1SFHA 5E6ID 4HUXB 4PTUB 5L0QB 1ODAA 2E8YA 4LHUB 1AS7A 5SX5H 3U0PB 2HTLD 2F74A 3A67L 5EF3A 3GYRA 1SHWA 3UTZA 1V5JA 2BNUB 1ASOA 3PG2A 3QRGH 5TDNB 5FDWA 1HHGA 3DX7B 4PJCA 5BV7L 3EJTA 1HHIA 2AZAA 1MCQA 4XRCB 5EWIL 4LNRA 3GTVA 1S9WB 2DD8L 3FQ4A 1XH3A 1EAOA 5F6IB 4TUOA 1NKGA 4HCFA 4OAWB 4BZ2A 1I82A 3U1SH 1R3LB 3VSVA 1JPTL 4XI5D 3A6CL 1WCBB 4IHOA 3QUXC 4NENB 1LP9E 4WTZA 3IFLL 5L9DL 3DIVA 5C6PB 4Y2NA 4OD3L 5FYJU 4ACTA 3TZVC 1EGJA 1KFAL 2ORBH 2BMKB 1F58H 1KJMA 1J1XH 4JLRA 4RMSA 3MRGB 2CO7B 4F5CA 1SBSH 4TNFA 4F57H 1T5WA 1TZIB 4PJ7A 3HE6A 2B39A 7FABH 2DQUL 5CCHE 3HG0A 5KYNA 1ZA6B 2JVUA 3CUPA 1XBDA 5IR1B 5H35A 3AZUA 4G6MH 2LQRA 3UYRL 2KQNA 5GS2D 4B9FA 4E42B 4OCYH 1FL5B 3L2LA 3DO3A 1ZANH 3BVUA 2VQ4A 4R3SA 5EV7A 3LZQA 4ODTL 1PG7H 2Y69B 3UBXG 1IT9H 4PREB 4EO5A 4BKTC 3L3OB 2IQAA 5GS1B 2JTDA 3MV9B 1EO7A 4L5FH 3MRGA 1U3NA 3GQFA 3ML8A 5HYJE 2VDNH 1B4TA 3MJ9L 1PD6A 4G8IB 1J0YA 1JXDA 2F2HA 3FF7A 5KS9A 2G60H 1ETZA 1D5BA 3X1FA 5KJRL 4Z7WE 1ADQA 1CIDA 1L9TA 1HSAA 4U1NB 5MI0B 3TWCH 3V4PL 1ILUA 2AQNA 5I1JH 4DP9X 3HBGA 3IDXH 4CVXA 1CBVH 1TLKA 4X7EC 1RP8A 3QE5A 4OD3H 3P3YA 4OCNC 5D7LA 1F11B 1GJUA 4LLYA 4YC2B 2XG4A 3HAEG 1BMWA 3BSHA 4NUQA 2EVJA 4RAHA 4RMBA 5F1NA 1KXTA 5EORL 4MNQB 1OQOA 1QO3B 3VGAC 5B39A 4YHOL 5KS9E 3ARVA 2AJVL 5HTSA 2EH8L 1UACL 3FUJA 1NAMA 3D85B 4AV0A 1UG9A 3PWVA 1CFTA 3OXRA 3C75A 4M00A 3ZJAA 3K3QA 5INCA 4P5KA 4E41D 2HUHA 4MCYA 2ENQA 1K6QH 1MXGA 2QPDB 5FXCH 3VXTB 4IKKA 1DP0A 4KRPB 5SWZA 2EINB 3TBWA 1LL1A 3CE1A 4M48L 4I0PB 3V4VH 1OPOA 2QQQA 1TKWB 2ODIA 3WO4C 5F7HA 2IQ9L 3SE3A 3QJHB 2ADGB 3VJ6B 4NQCE 4XNYL 3G3LA 4IBQA 3N9GL 4LKXA 3SPGA 4C4KO 3BZEB 3QJTB 5D5MA 3MNWA 3HFMH 5GRJL 4LCYB 1W9XA 1S9YA 2I25N 1XR8A 3E80A 4Y16D 1JK9A 1TVBA 4J23A 2MSPA 3DUUA 2H47C 3IGLA 1HWWA 1AO7E 2GSGA 1P5VA 1ZSDB 1ODUA 2GHWB 4FQ1H 4K2UL 1MDAA 2CRZA 3N0AA 4R83A 1BPLB 4W9EC 1QHOA 3I6LD 4D9RE 1SEQH 1T6VN 5I18H 32C2A 4W9JC 4QYOB 1T7XA 3BPCB 1A6UL 3MYJB 1NCDH 5JUEL 3HNTL 1OGAE 1YEKH 4P9MH 1C16A 4NN5C 1BBDH 4RMVA 2YMXL 2WBJA 3DTXA 5E4IA 1U8IA 4GKOA 3FN3A 4G7VH 2Y22A 5BOZG 3O3AB 4HDIA 4M43L 5AZEL 1Z3GH 4OGQC 5F0MB 4DP0X 5G55A 3PWJB 5FW7A 1WZKA 3MLRL 3BZFA 3ISYA 1QA9A 2AXFA 3SE4A 2F6AA 4HCRA 3G04B 2KLTA 1PBYA 4FNUA 5CSGA 3FT2A 1OCOB 2AJSL 4NAJA 1ACYL 1TQVA 2IAND 4I13B 4JFHD 4M5SA 3QJZA 4JREB 5C09D 5E08H 3V6ZA 2P8PA 4TLKA 5EA0H 3V6BR 3NIDE 1F1AA 2VMFA 1MAMH 1FFTB 3CLEH 3GSWA 4I9XA 2NW3B 4K3GA 5IK3A 4XNMB 4PWEA 2AXGB 3X11A 3I9AA 4YUEL 4ZOAA 4PLOB 3UO1H 1KB5L 3TV3H 3T65B 1EEYB 2DM4A 3BWUF 4LQ1A 4OJDH 3JTSB 2QVIA 1KXVC 3PWLA 1WRFA 2IDTA 2EC9T 5D1QD 5D70H 4IRJD 3IETA 4EI5C 5F7BA 4HV8A 1KJVA 4JKMA 2QPSA 1KN2H 4NKOA 1NOFA 4N8CH 1KLFB 3DJ9A 1NDGB 4XBGB 3EJYC 1G84A 2UZYA 5C0GB 1IGTA 1A6UH 3MZGB 3FT2B 3RVVD 1ZKAA 3MJWA 4I48A 3G7TA 4WZ9A 1UADC 2MNUA 1J0ZA 1P4IH 1ZHBA 5AAMA 1BAGA 2WUBL 5D2NE 3MGOB 1CGTA 5EIIA 2R1WA 2EDWA 2E7LA 3GRWH 4EI5A 3O4LA 2HJKB 5TTRA 4ZZKA 4RGNC 3OKDA 4WV1A 2C7UB 3JTTA 4UNVA 4J3OG 1YN6A 1H3VA 2UYLB 2R2HA 2YQBA 1EHLL 3QDGD 2QGEA 5I1DB 5C9JA 2APSA 4DP2X 3T4AC 1GZHA 1KT2A 3RLSA 4XPHH 3VXSE 1B6DA 2V2XA 1D2PA 1NEZG 4UDTA 9PCYA 1E8WA 4L9LA 4HCIA 3U4BL 5FV1L 2Y7LA 2R4SH 4ZUTA 2CJUL 5LNDA 5ABDE 1WAAE 1OANA 2WV3A 5SWQA 1ZIAA 2EICA 3FOLB 4P46D 4A39A 3L5WB 4E41B 4YFEA 1CFVH 2WYIA 4X7TA 2BCKB 2YBRA 4Z7UF 4OTXL 2VRKA 3ABKB 3A5VA 2ICWJ 4UIMB 4OGXL 5AW6B 3F3HA 5FK9B 5EUKA 3SGKC 1YCSA 3KYOB 4ZQTA 2H1PH 3WE6A 2GTQA 4Z7NF 4MTMA 5D7SL 2XX0A 5D9SB 3D85A 3LS4H 3U2IA 4CC4A 1MHEB 2NX5B 4JJOA 3TV3L 2UXVA 2NT1A 5INDA 2VGLM 4PLKC 1NBCA 4AE1A 5I1JL 5IVNA 1EXUA 4ZT1A 1OO2A 3WIHA 1Q1JL 2AQSA 1JNHB 2VH5L 4XP6L 3TIEB 1CLVA 1JF1B 2DQHH 4I2XE 1TQCC 4LDOB 3WIIH 4JM2A 3VVWA 4UIMA 5C0FB 2FBJH 4M8QB 3GNMH 2H3XC 5JLZA 3ZE2F 4N8CL 5E2UH 3QXDA 3ARPA 1UTDA 1HL9A 3K80A 3BKYL 3TEXA 3IMUA 1N8ZA 4U7SA 1RH8A 1U58A 4UV7H 3UMNA 3CFNA 1AGCA 4I5BB 4A6YL 3WEMA 4ORZC 5INDB 3GZPA 3HCVB 1YEEH 3GJFA 2FSEA 4PRNB 3D9AL 4KK5C 2C3VB 3GEFA 5B8CA 1YY9D 3VMOA 3K6DA 1P5VB 3B1TA 4PW4A 1T2QL 5SX4I 2N0MA 5AW7B 2DYPD 3Q9PA 2A6JB 2KUTA 4Y8AA 1OAKH 3CXFA 2F7RA 1JZ4A 1DBJL 3ZUNC 3PV6A 1LK3L 2NYZA 3VI4F 4CMMA 4XN7A 2L7EA 3MUGA 4CKVX 3L3OA 3A0OA 2XZZA 2HZHA 2Z64C 5IUCA 1GH7A 2R0LL 4KHXH 2I07B 5LWYH 2BFGA 2HUEA 4IYKA 1Q1PA 5MEPB 2W0PA 2HG5B 1KACB 3BESR 2R1XB 2H3NA 2PR4L 3RPBA 3VYPA 2I32A 4RDBA 1AQDA 1ZHNB 4FJYA 2VDKH 1PY9A 2X9ZA 5ESAA 1SDYA 2CLRA 1T7WA 3QO1A 4M8UA 1JVOA 2ZWKA 5DZ9A 1YEKL 1FLRH 1X44A 4WI4A 4N0RA 2UUDK 3C6EA 4YK4B 1QRNB 4YHYC 3S88H 4O9HH 5IREA 3BAIA 5CGMA 3DRQA 4WEMB 1QPPA 5HHVL 1OP5K 1R3LA 4NQEB 1CFBA 4XPFL 3C60D 4F7CA 4XN9A 4PJDA 2EILB 2W0FB 3HC0A 2Y23A 2UWEB 2NZ9D 1IEAA 2P42B 4JDEA 3ULUD 1XVSA 4S1DD 1JZFA 3ZDYB 4ZDHB 4XGZA 3W57A 4A7TA 2ZIDA 3IE4A 4MZ2A 2VB5A 4EI5B 1U8PB 1T89A 2NNFA 1IC4L 3DBXB 3LH2H 4B3VA 2KKQA 3DYPA 4KO6A 3PL6B 4KK9C 4ODUA 4JRFA 4ZTPL 2PWEA 4N2EA 4BQCA 4CSSA 2UXGA 5CF3A 1XBRA 5DXWA 2UZYB 1IVLA 2BSCA 3L13A 4FQCL 4YHKL 4PJGE 4XTRC 4F7EB 3NIDF 3B7UX 4BV1A 3KPQA 4AJWA 4UTBH 4I77L 2F0CA 1MG2C 2EE6A 4QRSA 4U2YA 1K2DA 4HK3J 1TO4A 1XEUA 4BQ9A 3OLEA 3IDJA 2WZ0A 1D9KD 1UACH 4YDJB 3QQDB 4XPGL 1UUNA 3F2LA 2WC7A 4JRYD 2YLHA 4K7PX 4WGKA 5EU6B 5TF0A 3T4YB 2AJYH 4ZAKD 4XWGL 1UXSA 3VD4A 5IHUH 1OSPL 5BQ7B 2DZEA 2Y06H 3ZLQC 1TOXA 1YDPB 2XA8H 2P24A 4B0MM 4FTVA 3R18A 5DA0B 3SDCB 5JUEH 3M88A 4CMHB 1AMYA 2W94A 4DUXA 5EPMA 3WFEH 5T1LA 1OW0A 2AJUH 2CAKA 3NCWA 3QR1A 1GRWA 2H7WA 4NX0A 5E2VH 1QLEB 4G6KH 1FO0B 1FH5L 5LBVA 1M42A 4KK6D 3AT8A 4M7ZC 4X7TB 1RUMH 3VDBA 4YXHH 2WVVA 4U7MA 1WISA 2P28B 5TJWK 1MRCL 2HPOA 3D5OF 3X1NA 2H1PL 2WXJA 2OMYB 5T5FL 4NOFA 5FIEA 3TZVB 3DXAE 4AUUA 2ESVD 4B96A 3ALWA 1OVZA 4KOBA 1JXJA 1AZBA 4UM9A 5GGSB 4QHNB 4Q9CA 1ZLUK 1N19A 3V0VA 3U6XS 4KJPD 4HULB 4GPVA 1KMGA 1XZ0A 3QORD 3HZVA 5PAZA 4FFVD 3IFPB 1EXGA 1PQZA 3OLIA 4DEPC 2Q3XA 4POYA 1V55B 4HGMA 5I1IL 1JNNL 4M48H 4BJLA 1IM9D 1HVXA 2D9CA 4NHCH 4WGWB 4DHLA 1KTDB 4LVEA 3WMSA 4ZPTA 5C0IA 3QJXA 1Q9WB 1HNFA 5DQ9B 1UJ3A 4YDLC 5HGAA 4G9FE 4G80A 5GIRA 4KY1L 3LEVH 4WI5A 1BV8A 1G0XA 3PUUA 5DMGC 4A7VA 4GSDH 3ALPA 3ZRSA 5D96C 2XOTA 1TITA 3U7WH 3MV7B 1QWUA 5I1IH 2X3BA 1IGCL 5J12C 4IHBA 1I8IB 1JFHA 3CMOH 5TK2A 1I7ZB 1BXVA 4L1LA 2G2RA 3O2DH 3SDXB 4IMKC 1HT6A 2YOAA 4Y9GA 4X6FB 1GAFH 2EYTA 2UXFA 5I9QC 3DI2B 5LAXB 5JW5A 2Z91A 4CJ0A 4HSAC 4FG4A 5IQ7H 1FYHB 5ID1A 2YFOA 2JH2A 4XVUD 3PHSA 1DCLA 3UXFA 4OLXH 5HY9B 5IB3B 2BCKA 5IFAH 5J13C 1IO4C 3KPSD 2YBRB 5CWSB 3WBDA 4HUVA 4MMZC 1Q8MA 2G3MA 1EQWA 1D6VL 2FECI 3U83A 1A2YA 1TZIA 3S5LG 4Z7IA 1QI5A 3B5GA 3HAEA 2MOQA 3MXWH 2WAHA 3GK8H 3LDBC 3NFNB 2PMZA 3BZ4A 3PDOB 2TRHA 2CSPA 5EG6C 3HS0B 4N6RB 1KBGH 5AG9A 3UZEC 3CZFA 2IOMA 4YUEH 2PYEB 2JSFA 5D71H 1HXMA 4HKJB 5D7IA 1KXVA 2PLTA 2XKUA 4X0NA 5F9OH 2A6IA 1XSKA 2UZIL 2APBA 3CVHA 3O3EA 4HQQH 5AYQA 5MEND 2HP4A 3VO0A 3CZEA 2YOCA 3CUPB 4TNWK 4Z7OB 3QDJE 2X4NB 3CFEA 5K9JH 3CSGA 1PU0A 2FX9L 1SN2A 1E4WL 3GSNL 1BAWA 3FPYA 3I02B 5T1DL 4Y4FD 3LN4B 3HR5A 1FL3B 2MIZA 4JJ5A 4FXGB 5DJZA 3KGTA 3VVVA 5C3TA 4G9DA 4GT7A 3RIAF 4OZFG 1NCAH 4MA1C 1Z6JT 2EC8A 4IOSA 2Z4QA 3HMXH 4GKSA 4LHUG 5HYSB 5AFAA 4OZGE 3PL6A 1B4LA 3KWVA 5DZNA 4FDWA 1JHLL 2QGBA 1QFWM 2J6WA 1G5AA 1L7IL 15C8L 1YNLL 5J11B 3GUTB 1RSFA 4NENA 5SWZE 1OGTB 4OUUA 3IKCA 3TC9A 4NZTL 1WH0A 4N0CC 2LU4A 4FX5A 3VXQA 3BVNB 3NCCB 5JHLA 5MP6L 2XZAH 3NCEB 1UYWH 1PG7W 3KNBB 2GTWB 4R7LA 4WUUA 3ZZLA 1IILE 1IQDB 3TNNB 1UA3A 1DVQA 1DDTA 3DX9B 1QNZL 2B20A 1DQJB 4TQ8A 4ZMZA 4RVBA 5IG7A 3HKZA 3QUGA 5D1ZC 1G1KA 2ERJC 4R7DA 5TH2B 4Y89A 4BZ2H 1QFUH 3CVHH 5F3BA 1BD2E 3CG8A 2I85A 5IBTH 5T1MB 5DS8B 4DAGL 5DMKB 3MNDA 1QEXA 1QSFE 4OVVA 2VZUA 5CIPA 3CVIL 1U93B 5AAWA 4PRPA 3CSYA 4JFVA 1QACA 1LYQA 5B1BB 4X4XB 5ACLA 1MY5A 5EU7E 2VDOL 4XE0A 1QFWL 4AMXA 5HHXL 1GHFH 1ZLVH 2C26A 5F70A 4X9YA 4JO2H 3NZSA 4J1UB 3G6JF 3BVTA 3BPCA 4GSUA 5J4MA 4HBCL 5EFIB 1JCVA 1I1FB 4YHOH 3AVEA 3D7PA 3JWOL 5DJ0A 3TBYA 5B7FA 3HS0C 1HWGB 4WEEA 2VZ3A 2NNAB 4IGBD 4K3DL 1WFIA 3PWNB 4QHLB 5F0LB 5IOPB 5IT2L 1AR2A 1LM8V 2NXYD 4WI0B 5HHOB 3IJHB 3P9MA 3PL6D 2GFBA 3EZ8A 1I75A 3SIKA 2F1BA 5KSAB 5DD3H 4JO4H 1MPAL 2H45A 4UV7L 2DYSB 4EI5D 1C7TA 2AEQL 4MZRA 1BOGA 4KDTA 4MCNA 2Q8BH 5EUOA 3VD3A 4BFRA 5JIQA 4HD9A 1RJCA 5FW8A 2J1XA 5ISZE 5LCVL 3T0AA 5HI3C 4K8RH 3ARDA 3RURA 2V3FA 3KYAA 1BQKA 4PRAA 4JO4L 2AXWA 2XN2A 3IB4A 4PTTA 2Z1KA 2P80A 3N1MC 1EBPA 3BE1L 3IMVA 3N85L 1I7ZA 5ES4B 3T09A 4FQIL 1RERA 4PJAA 3LEYH 3GD1C 3NGBB 1SBSL 2C1OB 4NRYB 4JRWA 1LE9A 5GS3A 3WENA 5L4IA 3H55A 4KJWD 4XMLH 3TX4A 3L9YA 4X42A 3SBRA 3BP6A 1J9TA 1SEBA 1MFAL 2Z31A 4HWUA 5C7XL 3BE1H 3SCMC 4EKXA 1JV2B 5TPWH 1BQSA 1S9XA 2K6YA 4PRDB 2LLNA 2ERJB 2CM5A 1ORQB 4TL5A 3VM7A 1ZV2A 3DRTA 1JXFA 1SN0A 3BCFA 1UWYA 2JJWA 4M7LT 2JELL 5AOIA 4OZIB 2B1AL 4MD5B 2ZSVA 3SCMD 4JM4L 4EI0A 5HVFB 3SKJH 1GS7A 3HTLX 3MA7A 1K8DB 4HU2A 4E36A 2A9NL 4OLZL 5KSAD 4KXZI 4JFQA 3BO8B 3KLAB 1C5DA 4N0YH 1GZHC 4Z7VB 2PN5A 1F42A 1FFOA 2WIIA 1NCGA 1FV1B 3O4LB 5B39G 1JWSB 4ANKA 4XNQA 1FYTD 4KZDH 1FVCB 5DYOB 3QEQA 3FFDA 4NO5A 1A1NA 5JORA 4TXVB 4NPJA 3ATAA 2WZ5A 3K6SA 1MCJA 3IN0A 5EB9A 3STZA 3PNWB 2GBVA 1XXFC 4RFOH 3L3JB 2I69A 3BSZH 4P9HH 1V7MH 4ICWA 3D34A 1WE5A 3D87B 3FL7A 4HCRL 3QO0A 2V2WA 3JV4B 5E9DE 1D5ZB 3Q2WA 1WZ1H 3ARWA 5I66B 3FB7A 1Q0XL 5GPRA 2H8PB 1JGUL 1HKFA 3MRHA 3EYVA 1CDJA 4FC3E 1J5OH 4ZFZB 3L45A 4UQCA 4Y5VB 2WUCL 4F9PC 5HYSG 4IOSD 3QZBA 3MFGB 5F7NC 1S7RA 1BQHA 2VDPB 2WP3O 3D3VB 1MWAA 4B9YA 5GS0H 3R7RA 1WS7A 3WIHH 5JXAH 3AGWA 3BUTA 2ITEA 4UI2A 1P7QD 5D9SA 2K78A 3GC3A 5E9DB 1XB3A 1PW3A 3FTVA 3VXOA 2BWDA 2Q7YA 2EIZB 4NNYA 4K23L 2NTSP 2OAAA 3QCVH 5ACZA 3VH8B 1KY6A 1BVLA 2R0KH 1DVXA 1GGTA 5D4HA 1WP6A 4ZUWB 3FTGB 2J8UA 4KJYB 1IM9A 3P9WB 4N0UE 5D2NC 3QWQB 5I74B 4KRPD 3DETC 5K39A 4A04A 4M6ML 1UWEL 4LIQH 5IMKA 5HHME 4A7GF 1KCSL 4F2MA 3G6DH 4LFHD 1JS4A 2BSDA 3L3GB 2HG0A 3G08B 4MDIA 4N0UB 1CYWA 3HZYA 5FYKU 3RJOA 1I1CA 2NT0A 3QWOB 3T0WA 4GAYB 4BINA 2CR6A 3B9DA 3GZKA 3L4ZA 4OBSA 1U8HA 3R0NA 4H20H 4E9YA 1TLMA 1DVFC 1S8DB 3SBQA 2BVUA 3TBTB 4BUQA 2AJ3B 3EFFA 5A16B 2GC4C 4LF3B 2DTMH 3ESVF 4JCLA 3C8KA 1I4FA 4RGOL 3AM8A 2VC2B 3CQPA 3DXAB 3C6LC 1TPXB 4LP5A 4RLDA 3W0WA 5LO7A 2FRGP 4MXWL 1NGQL 4LP8A 4V11A 4W81A 2A1WL 1UUSA 2WB7A 5MEPA 4GIAA 1F4YH 3FU9A 4D0CA 2MQ0A 2P9RA 1EUTA 4LKCB 4F93B 3JWOH 2O6CA 3GSRB 1VIWA 2OMXA 4A6YB 3MRBA 1JDCA 1CDYA 2ZSWB 3MNVB 5I16A 1UD4A 3EDJA 8FABA 1GOHA 2FO4B 4LSUL 5JW4M 2EABA 4AENA 3GUFA 1H3GA 1FNEB 2EDOA 4JVPA 5EBWB 5I8KH 3TEYA 5D2LA 1TQWA 3TO2B 5J5EA 5J1AB 5GS0C 3KPPA 2FNWA 4YDVB 3SGEH 4PJ8D 3TXAA 2AS5M 5I0VA 3PQYA 3BLBA 4ZTEA 1WA0X 1SFDA 2AK4A 3FZUD 2C3VA 3TN0B 5B8CB 5IQ9B 1A3QA 2YPKA 5FF6B 2COQA 3BD5A 2ENPA 4R26L 1KTBA 3BPLC 4OSUL 3UABA 3GSOA 3V5KB 4X9BA 2P44B 3CNKA 5C0BD 3BPOB 2A0LC 1HZHH 1RUML 2BP0B 2K9UA 4U3SB 3ESMA 3AW5A 1SXCA 3CX2A 3O4OC 2WQVA 1NBYB 2P5EB 1TF4A 3HA0A 4K5LA 4GSDL 3KGRA 4GAGH 1LWHA 3WIAA 5ICYA 3VTTA 3RJDA 4AENB 4GG6F 5T3XL 1SMOA 3VXUE 4PH8A 2CKBA 2DQEH 5CR8A 5EOTB 2A9NH 3CIAA 2WO4A 3EYUH 3NCMA 4L5FL 3FT9A 4L9LC 3MJ7B 3VFVB 3HE6B 4Q9BA 1GS8A 5F3HA 2F15A 1QRNE 3K72B 3QCUH 4P2OD 1E0OB 5DT1L 2YARA 2QHRH 4EN3D 2Y6SC 5DK3A 1G4RA 2OMZA 1AXSA 4LE8A 2QPFA 4XMPL 1HKLL 1UKSA 2VR6A 1KULA 5GHWH 2P8LA 3F7YA 4HX1B 4BFBD 1FL6B 5JPMA 2G9KA 1XCQA 2Y07H 4Y2OA 1GAFL 2AQTA 3RPIB 1TMQA 1JPST 2V5TA 1JNJA 5DT1H 2OJ1A 3QFJB 2LTQC 2DH3A 1AP2A 3MRPA 3QZWA 4H0HB 2FX7L 4WNQB 4AQAB 2BX5A 5CGYC 4LAJH 1LE9B 1K85A 3DYOA 1LEKA 3EOAA 3UTTA 3O45A 1B0IA 4WWKB 5F7EH 1T0MB 1HQ4A 1TZHA 3E1ZA 3Q8BA 2HT3D 4IEFA 3Q2VA 4M6NH 4F8LA 4L8CB 1RIVL 4X6EA 4NUGL 2KLSA 3EDEA 4KKZA 1LP9A 5BNXD 4NXKA 2XTJB 1DVFD 4B27A 1H3UA 2IADA 5DD0L 3P9LA 1CGSH 4NDMA 1VFMA 3O11A 4EIGB 3KPOA 3CX5K 5JIPA 4GP4B 4RFNC 4YN3A 5F97E 2VDQB 1OSYA 3S35X 3CDCA 4OFIA 1HQRA 4B60A 3HLAA 1MPAH 1OB1A 4ZMWA 2YXMA 3CCHB 1S7XB 2J2ZA 3DWTA 1BIHA 3LS5L 1OGAA 4OF3A 1XIWA 3OKLB 4HVBA 3UBXI 1HE8A 3CVIH 2I5YH 2QZ5A 1ONQA 1OE3A 3I9GL 2BY3A 5K9OB 3SBWA 3N04A 5D1ZD 5DU7A 4KTDL 5T3ZD 1LQBC 3CFTA 4L4TA 1D5IH 1U8CB 4S10A 3FQUA 3CVCA 3LEVL 3T0EC 3A22A 2XQ0A 2F8XC 1Z0NA 5JW4N 1YYLL 1CTOA 3SJVE 2IAMC 4JVWA 3PP3K 2G0LA 2WQXA 3RNQB 2X4RA 3PREA 4W9DC 3W2DH 5MEOB 1HAUA 4MGXA 5EBLA 4TNGA 3FNKA 1DL7H 3MLRH 1PIFA 1R6VA 3QS2A 1XO8A 1A7RH 4FQHA 2ICCA 5CWSA 2IMMA 3M8OH 5CINL 3UGXA 2GJ6E 1IJNA 2DQTH 2WNKA 3ZDYF 2NCEA 4MA7H 1D5MA 1YY8A 3HHMA 2WBJB 4B97A 1N70A 2L7UA 2R0WL 3ZHFA 4OD1L 2VMCA 3BGMA 4YSDA 1BBDL 4WU7B 1L9SA 5HYEA 4WV1C 1YG9A 1AHMA 1J8HA 1QRKA 1WFMA 2ZKHL 4HLJA 3K4ZA 1FIEA 3M7OA 1MRFL 1GC1H 3MJ8B 5TQ2H 3QIWA 4TSAL 3Q5YA 1H3WM 4KTYA 2X6CA 2WCPA 4YQXL 2FYVA 4IRJB 4PRDA 1YC7A 2E9IA 4XNBA 4WWKC 3RTLA 3HUJB 3QNFA 1UM4H 4Y4KA 2BHYA 5CMAB 5CD3A 4G7VL 2R2EB 5IJKA 4UF7C 2K4WA 3IT8D 4N2KA 2N7BA 4KO5A 1NIBA 1H6FA 4PY8I 5ITFB 4HZ1A 2YSTA 2ZOLB 5E00A 4EDXA 1FF5A 4G9DB 4XNYH 1JGEA 4G8GA 3S5LA 2RQEA 1GGIH 2QQLH 3A4FA 1JGLH 4GUQA 3CFBB 2NY3D 5EO9A 3WE1A 4MQSB 1V3JA 1G7MA 2EEDA 3IS1X 1CVRA 3F7LA 3PABB 2WGXA 1IC0A 1FL5A 4UU9B 4KPHL 1W8OA 1J11A 2WD0A 3DUSB 2X4SA 5C0CD 1S9KC 3IWVA 1UB6A 1G7IA 4RMRA 5FYKH 1LWRA 3S5YA 5DEGA 1Y6MR 1TNMA 1OT2A 2OMBA 3M1BA 4X5XA 2XG4B 4JHVA 2CDFB 5BOPA 1EJ6A 2GIYA 2X3AA 3ZMRA 4YBQC 3V9EA 4G6JH 8PAZA 2WIMA 4AG4L 2ICEC 4UANA 1FIGH 1N5AB 4RMWA 1DZBA 2ZUYA 1CB4A 2P8LB 2B9AA 3BDYL 2X38A 3CH8A 3P02A 5K1VA 1ZLEA 4NUMA 4FXGA 3D08A 5TDPA 1HL4A 1PS3A 3L7EB 4YHZH 2WXKA 4EVNA 4J8RA 2ZOUA 2HG5A 2FYYB 4X99A 2GBAA 3QAQA 4P46B 5I15H 5FECA 4G5AA 4ES8A 1T3FB 3NA4A 3HI5L 4O51A 3RWJA 4TNVK 1F4WL 2H6UA 4KWUA 4RIRB 4DTGH 5EO0A 3ABGA 3F6JA 1RIHH 4PLNC 5I1GL 2VSMB 3TGXA 4CSTA 1FGNL 2J3SA 4NCC2 3S37H 2Z7YA 3VXNA 3LMJL 3T8XB 2E7BA 2ENSA 4KV5F 4OFQA 4WK4B 1YUHB 1CO1A 2R1YA 2DQJH 1ZSDA 4QJ3B 5E8PB 5F7LB 4PP1D 2J8OA 4BH7B 4MVBD 5B3SB 1YYCA 3WEXA 5L8JB 4GMSL 1T5KA 3UJJH 4HOXA 5MERA 2GUOA 1KLGA 2FQDA 3LRSB 3MBEC 4AK2A 3KPNA 1KYDA 4LLDA 1OWRM 3C2AL 5JHBA 1GGUA 1WCQA 2DD8H 5E0FA 1XGUB 4LBEB 1UVQB 4XNMA 3KBPA 1YLBB 1R0AH 4KI5F 4ILDA 5HBBA 2BVEA 4MMYB 2NUPA 4CAGA 3ULUH 1YEHH 4KNQA 1MJUL 1D9KA 1EZSA 4M3KB 2CUMA 2V9TA 3APDA 4K8RL 4ELDA 3SDXA 3BLPX 3U7AA 1EVUA 3RWGB 3MCKB 5EU4A 3BZFB 1A9EB 3BP4B 2YRZA 1Z9LA 3P3TA 1I3RA 4MJID 2PABA 3BKJH 1MVUA 1O7DC 3FFOA 3MV9D 1YEIH 4KGLA 1FZMB 4AK1A 4FE9A 1SHSA 2CZNA 4PCSA 2VN6A 2YPVH 1T04A 1H0DB 2LLLA 5I30L 3FQNB 1JHTA 3U4AA 5I76A 3RIAK 4HU8A 1H6EA 2J6EL 4XZ4A 1RU9H 5GRVK 3VXME 2G0KA 4U4IA 5F9WB 2DTSA 5C6TH 1NSNL 3EH5B 5EHFA 5LGKA 2ZCKH 4PVLA 1A64A 3MLYH 1BZ7A 3I3DA 3IXAA 3ROLA 1NIAA 1KPRA 3INUL 4ZAKC 5I15L 3TA4D 1YN6B 3R4DA 5GSVA 4NKIL 3O6LH 5MEQA 3EHBB 5HHXH 1Z5YD 4YL9A 4AT6B 3BPLB 1CD9B 2JKIS 3S3CB 4FTVE 4R96A 5TFSH 5ISZB 1UA6H 5DJCB 2DQCH 1T1YA 4I2XB 1AY1L 1INQB 3OR7B 4DPCX 4H2CA 5H4ZA 5ESQB 5T1KA 2YKLL 3EHBD 2VLRE 4BKLA 1RJLA 2Q2EB 1HNGA 4XAKD 4MNGE 4OCXH 1HOCB 1HE7A 5HGDB 4GYBA 1PJ9A 3FQNA 4QRPE 4G2AA 1OW0C 2FD6H 2J20A 5DK0A 1EO8L 4LARL 3HJEA 1S9VB 1HS6A 2DBLL 1VEMA 3F12A 3FT4B 4WHCA 4ZSOA 3VQ2C 4NO0B 2FEEL 1LMIA 1U8PA 1YQVH 4FD0A 5TF1H 1KNOA 4Y5YA 2AV1A 2R69L 3V4PH 3MGTA 3O8XA 4TOYL 4PJGA 1DSFH 3LVTA 1I7UB 4XMXA 1BQHB 3D3VA 3ZHKA 4JDZA 4XZUA 5GIRB 3QQ3B 2CDGB 5CEZL 3ZGIA 1BGXH 4DGWC 1DLHB 4FA7B 1BCIA 3B34A 4GRWH 5ITBH 1OTUD 1WS8A 4MXVF 1S7RB 2ZAGA 4IKIA 3ARBA 4GH7B 1T83C 4XMVA 4R2GC 4L2LA 4AM0A 2JJUA 4GRLA 1KCSH 1WFTA 4WF7A 4CVXB 2YQ3A 4PP2A 2W60A 1NGYB 1BGXL 5D7IE 5DJ6A 4ZSOB 4L8SA 3ETTA 1WZMA 2FJGA 4WJ5B 2X6BA 1A1NB 2NY6B 1SXAA 1SRDA 5JORB 2LLGA 3B3IA 1E6JH 3CFUA 5GGQL 1Q94B 2HFFB 2O93L 3HG1E 2CRIA 3RHWF 4PGCB 2ZJSL 3RL2A 4F9PA 1IAIL 5LJYH 4U0QB 4N8VA 1L6ZA 3TURA 1IZKA 43CAA 3MGOA 2H5UA 5EIIB 1A6TB 1S2EA 1UZ8A 1V7NH 4GRLD 4WFHD 2N59A 4ALAH 4N6RA 4L8SB 4HJEA 1JUFB 3G6AA 3I85A 4LOUD 3LS4L 1I7RB 1F8TH 3TZVD 1A9BB 2YD6A 3ARBD 5A2LH 4RA0C 3VGAB 3NSFA 5E99L 2EO7A 2YKLH 1BF2A 1TYJA 3SOBL 1LO5A 3I6KB 3FSWA 1XMEB 4G3YH 3AY4A 1O6TA 1K9TA 3MRNA 3ZE1F 1BZEA 1D2OA 1RZFL 1LK2A 5AYUL 4DP4X 5AB2A 3VGDA 3PP4H 3DUUB 2FBJL 2GABA 4LIQE 3MLVH 4ZFZA 1L3WA 1UB6B 2DLIA 4JKPH 5D6CA 2RA1A 4QHUB 4MD4B 4YO0A 1SYVA 2F5BH 3SQBA 5I18L 2IEPA 1B3IA 5E6IA 3WO4B 1ZPUA 3CU1A 2HTKD 4OQTA 5JOFB 1E3XA 2C7FA 3NJJA 7PCYA 5J6HA 1OCZB 3O2DL 2O5ZH 1CFSA 4J27A 4S1QH 3CFBA 4BIKA 3UERA 3QFDA 1I1AA 4FNLH 3NIGE 1JWMB 5FWRA 5I16B 2PTUA 2X12A 5CP3A 1LO3L 2A9DA 2ZKWA 5IB5B 4CJ1A 4AVHA 3GIZL 1AOHA 1L7TH 1D9KB 5B39B 3WUWA 4F27A 3GMRB 4U1IA 1J0HA 2XWZA 3RVUC 1SF5A 1VPOH 2VLME 5JHLL 4CVWA 4GXFA 3SDDA 1EZVY 2NY3C 4FF9A 2JLLA 3DX0A 2VR7A 4CU6A 3K4DA 4IBZA 2Y0SA 1HCFX 2R4SL 3GM0A 2XHNA 4Q2ZA 1NGZA 1BZ9A 4FI7A 4MRCA 2Q87A 3HR6A 3QK0A 4PBWD 3FO1A 1JGIA 3TFKC 3F85A 3C5ZD 4JFSA 5AKRA 1IGIL 4MCMA 1U2YA 4GSQA 1VADA 1AJ7L 4F7TB 4YDKH 1THAA 3MRRB 3TJEH 2NQ3A 1EFXA 4JO3L 4OLVH 4UILH 2EC9U 3CDZA 4G8GD 2QQNH 1D6EB 2YAEA 4UT7L 3L95B 1XCWA 5KTEL 4G8IA 2YBGA 3ZE0B 1PZAA 5EF2A 3AREB 3OC8A 4GXVL 4JO5A 4KZEL 5GSVB 2DMBA 4H88L 3HRZC 3IDMB 3IFLH 5L0QC 5L9DH 3AY4C 5KSVA 1IU1A 3KYNB 1W8NA 4Y4KD 5EBWA 1ZA3B 1NMBH 3QNXB 4EKJA 2CHWA 4PJ8C 4C58B 2WLZA 3FQYA 2VNCA 5AAMC 4FKKA 1MAML 2H9GA 3CLEL 1Z3RA 3NN8A 5FGSA 3UP6A 4FYQA 5ID0A 4XMKH 3VRIA 3MV7D 4PGDA 1FGNH 4K55A 4TVPD 3RJQB 1FC1A 5AVXB 3SE9L 1E8YA 1U41A 1WCBA 4K8RC 3N0PB 4JHWL 1IRAY 2XU9A 4IQHA 2BVPB 3BAJA 4Z7OE 1MFVA 4JLRB 2F7QA 4QT5B 1NC4A 3UX9B 5B22A 5HI5C 4N1EA 1WIOA 3AADB 2GPZA 4UBDD 5DTFB 4AVJA 4LMQI 4U1MB 3WNKA 1DHKA 4Z7UB 3US9A 2PPDA 4M03A 1Y6KR 4MCZB 3PPSA 3O0RH 1E2WA 1HYRC 1WHPA 4HWBA 5DD1H 1PKQB 4F8TA 3C9NB 1ZT7A 2HPTA 4PJHA 5CGBA 1F2XK 5DUJA 1XSIA 2R83A 3BFQG 4LLWB 5ETUA 2WTPA 2IPUK 3RDJA 2FEDD 3WHXB 1JPSL 1SLWA 3V6ZB 2BHZA 4URTB 2Y7QB 2Q20A 3BRDA 2EDBA 4A37A 1HHHB 4ETQB 1DR9A 3CCHA 3CLWA 3WN6A 4LCIL 2FSDA 3NPZB 4LHQB 1QUNA 1OTTC 3MOAH 3DMMC 3LXCA 1TVHB 4P4KA 3ETBF 4AGLA 5FYJE 1TQBC 4HMCA 2AK4E 4UV4H 5IUSA 1F41A 2Y1VA 3ARTA 1EFQA 2JKNA 1WGVA 2Y7QA 1KFGA 4B5EA 2JKWA 3E6HB 2OXHB 1DQLL 2UY7B 1C7SA 1HL8A 1UEMA 4N9GA 1NWOA 3LD8B 1JGVH 2ZCKL 1ZTMA 1BVOA 1E7VA 3F7YB 2QSCH 3KD4A 4LPWA 3G5ZA 5DF0A 1GZQA 4HHGA 1EHNA 4MS8D 1IC5H 1HI6B 3T77B 3ZU8A 4EZKA 2HKHH 2LU5A 3O3DB 5AUMB 4AUJA 1NFKA 5I1EL 1E5AA 1JIBA 2K3HA 3ARUA 1PTZA 3LKPA 3ULVC 5CCKH 4NS0A 5ICZB 1ZEAH 1H8NA 1XR9B 1ORQA 1WAEA 2M1KA 2DLFH 2HT2D 2QTEA 5C86A 2DQFA 5C9KA 3T3MF 1MXDA 2EDQA 4KO7A 3DJTA 3WNOA 3TH4T 3WEOA 4JZNB 5C3LD 1DANU 1YEFH 4IKJA 4HUNB 4WY7L 4XT1C 2FEEI 4YE0A 3S36H 1QLEL 2I9LA 3TT3H 1URZA 1VCAA 3SY0A 4FXKA 4XXWA 3RDTD 2ZOTA 3ZKNC 2LU7A 4KKPA 1ZVSB 1UWXK 3QDGB 5BV7C 5I19H 1E3FA 4TYUA 4PJHE 2QADB 3GSUB 4WW1A 2F68X 1CDCA 3REVB 4XMLL 5CR1A 2NR6D 3TCLA 3ZYOA 3DSNA 2MJWA 3FFCA 3HR5B 1JD9A 4IS6B 4Y4FC 3U82B 5BS0E 4BUGA 3N1GC 2B3RA 3CFQA 1KENH 1XF5B 3X1BA 1UD5A 3VW3H 5B3NA 4NI3A 1YYLH 2VZOA 2ZAIA 5HSFA 1DJSA 2B59A 3U30C 3GBEA 1JWUB 1R5IA 4QRRB 3ATFA 2DQHL 4AM0B 4KKCD 3J8F7 3T8MA 1FCGA 3EG9B 4NJAH 2ADYA 4CNIB 1XZ0B 2ORBL 3KPLA 3CN3A 4YXKL 2Z31B 4C83B 5F72S 4RWYL 4XAWH 1NCBL 2V17L 3QUKB 4JPSA 1QYGH 1UT9A 2DBJA 1A4KA 1CLYH 3VH8A 1OHZA 4QCIB 4N0YL 1JZ7A 3QP3A 3SE3C 5HVHC 4JQIL 3RX8A 4QWWC 1MCKA 5DO2D 5L4MA 5JHDE 3QZWG 1KEML 4S0TD 3JYBA 1NCUA 2B4CL 5I1LB 4OI8A 3RTQA 4CDHA 1QPKA 3MFFA 3BC9A 4HP5A 1YMHB 3CSBA 4PRHB 4WSKA 4AKOA 2NY7L 3WKYA 2KBGA 4Z3EA 5JOFA 4BD4A 5F1IA 2E9JA 4L37B 1F58L 1AGBB 5HI4D 1CICD 2B16A 3V4VB 4QWWD 4Z3HA 5F7KC 2CALA 3DHMA 2PXYB 2BW4A 1M6UA 1S7UB 1LNUB 3FTSA 3CC5A 4KROC 4UQBA 4XMUA 5DVNA 4JQXC 2D2OA 4M7LL 4Q6IC 3WHE1 1N5AA 3OLGA 1DUZA 2J55A 3HUJE 1SDDA 4BK4A 1MFDH 5A3IC 4QGTA 5IJDC 2YK1H 4FYTA 2AKRA 3BKMH 4HZAA 1I1FA 4I1PA 3BVNA 4EDWL 2YR3A 2AGJH 2W59A 2R59A 1UGNA 2NDGA 3T2OA 4D0BA 2R2CA 3FH7A 3QDMB 4YDIL 4OIAA 1DQDH 1G6RH 5E2WL 3RWHA 3NRFA 1SUJA 2GY5A 3T3PE 1J8HD 2SEBA 4LEBA 1F4XL 4JG0L 2F74B 5KVDE 4LCYA 2WKOF 3X13A 2VLLA 4XO5A 3E6HA 1X5LA 2AABL 4A1RA 1IM3D 1RUAH 2N0KA 3LZFL 4UUJB 4XAWL 4KRNA 5AW9B 1H9DA 4FG2A 2XRAH 5TE4L 5I6XB 3WFBL 2A77L 3OJDA 2DLTA 4UDUB 1G7MB 4XO8A 5LGJA 3B9KA 4YLQT 2R1YB 4RFEB 1TEYA 5EZPA 4JN2A 4YWGH 1UATA 4WI9A 4JE0A 2OQJA 4NJ9L 3OXRB 3HPLB 1AO7D 1J1PL 1W2KT 4JPQA 2R51A 3C6SB 2BXZA 4PJIE 2VLLB 2XX1A 4LPYA 2JKLA 2Y06L 4JREC 4PAZA 4Q52A 4C56D 1AZZC 3ETSA 4L23A 4YIQB 3VD7A 3D33A 4XN4A 3SDCC 3RVUD 4XH2A 3Q6GL 1PYWB 3DJZA 1THCA 4HWEL 4P57B 5GGVH 1FVDB 5I6OA 5IQ9A 1BZDA 1XDTT 5LCVH 3QHFL 2NY2D 2V9RA 1E67A 2OMVB 2X4OB 3BW9B 3CHPA 1FFPA 3MUZ1 3GHBH 5B4MD 1QWNA 2W0FA 3UIYA 4YH6A 1OCCB 4EN3A 3GI8H 3O2VL 2Z8RA 3EO9L 2CLRB 3QO1B 5D1XD 5IFHL 4JRXA 3Q8EA 2Q76B 3NEEA 5AUMA 4ZFFB 5AOZA 5F9OL 2DWEB 4RMTA 2AQPA 4NPYA 3MLXH 2YUWA 3EW3B 1BM7A 2DF3A 3G04A 1FAIL 4MX7B 3MBXH 1E65A 3FCSB 3MROA 4D9LL 3EJZD 4ZMXA 4APQC 1CT8A 2WXIA 4X6CB 4YX2H 2XG5A 2H6PA 4HS3B 4NJ9H 4O2CA 1X5ZA 3O6FB 3MXWL 4GBXD 1OAYL 1WDAA 3OG6B 1U3HD 1TTBA 2HKAA 2WN3A 1ZK5A 4XVTH 2JTYA 3K6IA 3MJ7A 3UOAB 2PTTB 1VENA 3GHEH 4G72B 2DKMA 3CFJA 2MOGA 3ILEA 4NQCA 3SKOB 3TBSA 4PM1A 5I0YA 2B7DT 2ED9A 3DO4A 3BH8A 1GYVA 2A1WH 1FYTB 4QRFA 5DZVA 2MRYA 1NDMA 2CCWA 3I3BA 5KANI 3EYOA 3IJSB 4A7QA 1YECH 3Q1EA 4LOFA 2OCCB 4RRPA 3SGEI 1TU2B 3ZL1A 3QXAA 5AW2B 3WO3B 4EOWL 1GGYA 4V1DE 4DZ8A 4FLRA 3DDFA 5E1IA 2R2EA 1BBJA 3OGCA 4J3TA 2DQIH 4XR8C 3U4EA 5I17B 2BNRB 4GP8B 1J8SA 2DQCL 5DMIL 5AW8B 3LXBA 4LMQE 3V6FA 2OYPA 3FSOA 3TO4D 2BOBA 2CIKA 5D7LE 5AW4B 4JDZB 3B83A 3KPRA 3W11C 1Z2KA 3H9HB 5KYYA 5AW1B 2ZNWA 3EGDB 2JV6A 2WXRA 2ETWA 2O5XH 3QWRA 2GJ6D 2I9TA 5ISZD 2VYRE 2A4EA 5D93B 1OTSD 15C8H 1YNLH 3VXUA 2X9XA 4XCNB 4XXCA 1AS8A 3NK3A 4BHUI 2V2TB 5C0BA 1T1WA 4N5EC 5EPMB 4QY8B 5KN5B 4K7FA 4E9RA 2WM0A 2HN7A 4IU3B 3WLWD 3QIUD 3STBA 4H5SA 3UG5A 4FULA 3H9HA 5FA3B 3Q2LA 1HNYA 4P3DB 4A2EA 2NNCA 5FK9A 2DM7A 2I9LB 1YMMD 2YA2A 4FABH 1USQA 4EUPH 5KJ7E 5LB1A 4G1MB 1U3HB 3E7JA 3QO0B 4PCKA 2C8NA 2QADD 4NFBA 4TQEL 1RJLB 1N9PA 3O41B 5MEQB 1S7VB 4L8BB 2XV6B 3UZVA 2YXVA 4KK5D 1UOWA 3MV9A 2XWDA 3MRLA 3DNKA 4AIEA 2VJXA 1TENA 1KC5L 1X5YA 1ET5A 1X6LA 2W9DH 4M1DL 5GJSH 1A4AA 4YSEA 25C8H 3C2SA 4FLHA 2XNAB 3G5VA 1Z7JA 4HGWB 2M26A 3LIZA 3RL2B 4CBZA 2P5WD 2A9CA 3QGVA 4OF6A 3BO8A 2BIIA 3KLAA 4DP8X 2G9HB 4F8PA 1LWJA 4NM4H 4IRSB 4AIZA 5HI5D 3S2CA 5I19L 4O2FB 1N64L 4FQHB 4HHAA 3BIKA 4L4TE 4HIEA 4UTCA 3ZO9A 4KITB 3V55A 3EBAA 4CKQA 2YAQA 1GHFL 5FFOA 1JERA 4DPBX 4WTQA 4PCTA 5GS2H 3F83A 4ZNEA 1CE6B 5HHPB 3HRPA 4YDNA 2BMKA 4PWHA 3GXUB 4JM4H 3WLBA 4K4KA 4GAAA 4JANA 5L2KE 2CA4A 1DJWA 1CBJA 3TFKD 4NWUH 4XVSL 1PMYA 2B14A 3L54A 3LQAC 4DAGH 5IJVB 3E9UA 5I66A 2BNQA 4XO4A 1YYML 2VQUA 1JTPA 1JHKH 3D30A 1KF9B 4YIQA 1A3LL 3ZPDA 2YFNA 4J6RL 3T6QC 4X9HA 4JY4B 1U91B 4XWOD 1FVDA 3W5NA 4YBLC 1WZAA 1FAKT 5ALCL 2FGWH 1A6WL 1WQVT 1X5HA 4GKZB 1JPFB 4O02L 2WCGA 2CLVA 1GKOA 3QFJD 2Z8WC 3X1EA 4BHUA 2QDVA 4B7LA 1MHCA 1J8KA 1IJ9A 1H3PH 1XF3B 2QVKA 4R4BB 3GMLB 4IK7A 2YGPA 2C5DC 1IQWH 3JQOB 2QVMA 3HC4L 4JBSA 1C9SA 3UYPA 1WBXA 5I26A 1BX2A 4D9LH 3BD4A 3ILDA 3UL4A 5EO9B 3F5WA 1FJ1A 2VIRB 4UV4L 2UWEA 4RESB 5DMGD 5MEOA 2PP8A 2OZNA 2XBZA 3LV3B 4F1ZA 2EVHA 2CNYA 5KBDA 1AKJD 2CO4A 4GQPH 1SVBA 4OZHB 1CQKA 4ONFL 1NGXB 3ZDZF 1Q0YL 3PAYA 3WDJA 3MV8E 2EDMA 4RWYH 4OCSL 5F9JB 1U8IB 2NY5C 5C0BE 5KVEE 4HJ0D 4Q0XL 2X10A 5I0XA 1PD0A 3HC0B 3TEZA 3GSNH 4JKWA 4AUYA 2H32A 5I8KL 1BD2D 1IM3A 1E4WH 1DN0B 4PRPE 1FO0L 3MV8B 3N6YA 4P2AA 2NYKA 4XMZA 1RI8A 3FU6A 5IW6A 3IDGB 5EOCJ 4XAKE 1JZJA 2AERT 2DQDL 1DEDA 2B0SH 1HINH 4KVPA 1ZTXH 2O6PA 2FZ3B 3IDUA 3CXHK 3QZOA 5JPMB 4E9TA 2OM5A 3AWEA 1QZ1A 4ZS7L 1YVLA 1L9RA 2Y3NA 2YD4A 4PGEA 2PPCA 4Y5XB 3VU2A 1JF1A 3MR9A 1S7WA 1WTGT 1M2VA 3H8NA 4P06A 2JJTC 2C9XA 3P3SA 4H26A 4PGDB 4YL4A 2LABA 1U93A 1LEIA 4Y4HC 2F5AH 3PLYA 2FWSA 2DWXA 3EOBB 4NO3B 4YSPA 3ZBMA 3E8UL 1E4JA 5CD5C 1TJGH 4NHUA 1UA6L 5KS9F 3CFDB 3O8XB 3GTNA 1YDPA 2YN5A 1W72A 4BFIB 2I9TB 4B0MB 5ILTH 3SEPA 3S5LB 3ALXA 1JZDC 4PJXB 3WIIL 3K46A 1CE1L 2VRAA 1BAFH 5T3ZL 2L7QA 4L8SC 5CZKA 4PRAB 3DARA 4DK6A 3UAJC 4ATWA 4R5VA 3JZ7A 5IESH 3MTRA 1IKOP 2FH6A 3M1OA 3DMMA 4OFYD 2VDKB 1PLCA 2RBLA 4FERA 3IJHA 5D2LE 5AVSB 2NNXA 3TTSA 5EU5B 3N41B 4PJ7F 1A21A 2E7LC 4MJIB 3PGDB 3LHPH 3PQYE 4OF8A 1NMCC 4FMKA 3TJEL 4KZDL 1BQUA 1U8NB 5TE7H 2Z4QB 4ZFGH 2ITCB 4P2QA 4X5QA 1HEZB 3VD1A 1ILSA 3BMVA 2NTFA 2G30A 4RAUA 3QEQD 3P9LB 4PJXE 2BLFA 5FYLH 1RURL 4AEEA 5JXED 1OAKL 1YEDA 3QORC 2CJUH 3QJUB 1JHLH 2HFGH 3SBPA 2XQYA 4PJXA 3M07A 2OK0L 4XOAA 2H6OA 3KCPB 4WWPA 5L2JB 43CAB 3NUKA 5CU9A 2XN0A 3P54A 3L3OC 4EVNB 1QBLL 3H9ZA 4FFYL 4ZW6A 2IV8A 2Z31C 4LPCA 1DSYA 1T21B 4U6VH 2G9HA 3ARFA 2Y9RT 4JJHA 5FM5M 4I18C 3GI8L 3W37A 1CXIA 2O4EA 2VL5B 1AGFA 4GAJH 4XI5C 4LVOC 4M62L 4JRYE 4R7DB 1CWVA 2BP8A 1NIDA 2EKSB 3DURB 1ZE3C 1PGRB 3PIQB 4L1TA 3VWJC 4GT0A 4YSCA 3O3DA 4ZX5A 3DV6B 3NPSC 3RIKA 4G6KL 1XSJA 5DMKA 1FL6A 4HFWB 1GW6A 3IDXL 5KVDH 4J2QA 3LZNA 1OT4A 1XR9A 3VG0H 5F0JB 2FR4A 4XP6H 4FKHA 1AXSB 4DUVA 4XOCA 4OJEH 3LMJH 1FFPB 3OB0K 4XN1A 2P45B 3TVMB 3N85H 1G1OA 4GUCA 3T5WA 1DQIA 4G6AC 5A2BA 1AGFB 1KENL 4NRXB 1IIIA 4JFZL 4HT1L 1K2DB 4LLDB 2QV4A 1RZJC 2JNZA 1CLYL 3T9WA 2EEBA 3TBVA 4MAUL 4PTUA 3QBTB 3MGTB 4KRPC 4JRYB 3RGVD 1M05B 1D5XA 5C07B 2W0KA 2XWXA 3QH3A 3AQDA 2XWJA 4TTDC 1M3IA 2RD0A 2F53B 3UTZB 3IM1A 4UQ3A 5CS7A 3WFZA 1IEBB 4YEEA 3U1QA 3HHSB 1JZ2A 5E95B 4W93A 3AY2A 5MENA 5IB1A 3RFZB 3T2PA 5HYQA 1EANA 4Z3IA 1JZ3A 1F6LL 1U30A 2WXOA 3B7TA 3L4XA 1AVAA 3APNA 4N20A 4Z7AA 2KS0A 1MJ7L 2AANA 3GBNH 5IGXL 1DVZA 1S6NA 4PMEA 3VFSB 2NSMA 3VRLF 1IGCH 1ESOA 3OG4B 4ZI8A 3FH5A 2BVOB 4APQA 3L4TA 4G8EA 3QC6X 5I75C 3BEWB 3RGVA 2FEJA 5LBSH 2XICA 1Q72H 2GKIA 2OMWA 2ATKB 4TULL 4YVUA 4N2FA 4GG6B 4F7PB 1OGPA 2AK4B 3B8YA 3MYJA 4WLCA 4QHNA 5IVOA 5I8OL 4OJFL 3RWFA 3TYFA 1XGRA 3GSVA 2X0UA 5BO1L 4BBWA 2R1XA 3VMPA 4OW6A 3TONA 3NSCA 4MDIB 4HIIB 2UY6B 4Z9KB 4P9ML 4QO1A 2L04A 1HDMB 1NC4D 4L0PB 4LCWD 4JANB 4R84A 3PS6A 2P49B 1S7UA 4DW2L 1LO4H 2J8HA 3DX3A 4YHNB 3NN8B 1KCKA 1RUPH 3VXSA 2AXFB 2N3JA 2VLRB 3WDIA 3KR3L 5CSBA 1E4KA 1ZDSA 3MRMB 3UTPE 4KXBA 5L4FA 1A66A 4NPKA 3ZT6A 1S3RA 2F08A 3MLTA 4G6FB 1CI3M 3EFDH 1I4FB 3UBFA 1FA4A 4LDLB 4G6JL 2WB1A 4WU5A 5AALA 1YRKA 1NL0L 3HHRB 4ZUTB 1DCEA 5LAXA 4KX7