1D7DA

Cytochrome domain of cellobiose dehydrogenase, hp3 fragment, ph 7.5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
186
structure length
186
Chain Sequence
ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new scaffold for binding haem in the cytochrome domain of the extracellular flavocytochrome cellobiose dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CELLOBIOSE DEHYDROGENASE
total genus 38
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 1999-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1d7dA00
4QI3A 1D7BA 1PL3A 1D7CA 1D7DA
chains in the Genus database with same CATH superfamily
4XNMA 4AMKL 3KJ4C 5ACZA 1BVNP 5DEGA 4Q9RH 1V55B 4EN2A 1P4LA 4YHIB 4OLZH 3RGBA 2R0WH 1EA9C 2Q7YB 5CCGE 5AOLA 1CTMA 3F7QA 1DLFH 3HG1E 3FB5B 3E8UL 1RU9H 1P4IL 5ICXA 3CFEA 3KLQA 4QXTA 1BMGA 4QJ4B 4PJBF 1V27A 2CM6A 5DJ2A 4FXGC 3ZOAA 4FP8H 2J6EL 2BJML 3IGFA 2F15A 3KPQB 4BHUA 1S7VB 4E41A 1LYQA 3Q05A 4MD5B 4MA8H 2FL5B 2RCSL 2Y7MA 4L3CA 2WLYA 3QG6B 1K6QH 1DQLL 1V3LA 3V4VL 3VH8A 2MQGA 2E7CA 5HJ3A 3B9AA 4JRXA 2LU3A 3V5DA 2AW2A 4YLBA 4X6BB 1E3ZA 1BGXH 4S11A 1FPTL 3GTVA 4KJYB 1BZ9A 1GGIL 3CNKA 4FRWA 3K6NA 2ZCHL 1QR4A 5FW6A 1MCCA 2PXYD 4G8FA 4M5YL 4OCXH 3JTTB 4KHXL 3MV8B 2MNUA 2ZUQC 3OKDB 3GS4A 3U4AA 2C8NA 2VDOB 1AXTL 3AC0A 1KC5H 4F7CA 3N6YA 5KJRH 1QSED 3LVEA 3FFCA 1U95A 5BS0A 5TH2B 1DN0A 3X14B 2J8UB 4X6BA 2FDBP 2OXHB 5GIRB 4AZ8A 4DVRL 5E94A 4AYFA 2ZP8A 4B3VA 4AQOA 2DQUH 4YPGB 4QTFA 1ES0B 4GKZA 4JO2H 4JG9A 3BUYA 4B9ZA 3EO9H 5EN3A 2BNRB 2VERA 3QXWA 2AABH 2QFRA 1H6FA 3OKDA 5AL8A 5E9DD 4W6WB 3FK3A 3FU7B 2CPCA 3IN0A 4NM4H 1AO7B 2IC2A 2XV2A 4JE4B 2ISDA 1T5WB 5EOCH 2N7BA 1A4JB 3H7BB 2A6DB 2JVUA 4JM4L 5GZND 3IT8D 5EU6B 4KQ0A 3LPFA 4XCYA 1JXFA 3EJZC 2BNRA 2ITDB 2ESVB 3GSXB 4C58B 4B27A 2D73A 4P5KB 3WFCL 2LGNA 4M29A 5SX5H 3EGDB 1CLYH 3D0VA 4EVNA 3UTSA 3MRFA 4Y5VA 2EDMA 1OLLA 3MRNA 4I4WB 2NT0A 4NWTH 2G5UA 3U4EB 2KT6A 3J07A 3HE6D 1BQHA 4U1HA 4UANA 4U1MB 2HZHA 4PLNC 4H0HB 1JPST 2AEPL 2X4UA 4LRNH 1AS6A 3ASNB 1UJ3B 1WT5C 3IGAA 5GGSB 3QZMA 5AOZA 1S9XB 4HULB 4XO5A 5MEQA 4M7ZB 3ZTCC 3M46A 2UZXB 4S1RL 3UZVB 1RZ7L 1MRFL 4ZUWB 4O02H 3MYZA 4X6EB 4MX7A 1E65A 3VXNB 3HI1A 3BKJL 3PGFL 4MCZB 1ET5A 3HJ0A 2FB4L 1S9VB 1YMMD 4M1DL 4KFZC 1RZKL 4FKHA 4HBCH 5JW4R 4FC3E 4HUCA 5E6IA 2NQCA 4HJEA 2HN7B 4NQCB 4Z0XA 1XCQA 1E6JL 3MJWA 3W81A 1ROCA 3KPRA 3L5IA 3EFOA 1JK9B 1XGYH 3L6FA 5C6WH 5CUSL 1LMIA 3QJTB 1ERNA 1WZKA 3MLTB 5F9DC 2A9AA 1V54B 3EW3B 4BE5A 4Z7OB 1XZ0B 3CMGA 2A6KB 2FT7A 1HHGB 1WGOA 4MCZA 5CCKH 2JXMA 3UTTB 4XPAH 3P73B 1U3YA 3TIEB 2H1XA 3U7AA 4IOSD 2W0FA 2BWDA 4IIQB 1QBMH 1BZDA 3X3GL 2HN7A 5BS0E 1FO0L 1S9WB 3Q6GL 3H54A 3MLWL 4XMPH 2OJZH 4BINA 4A1RA 1QTYT 2GTWA 3OJ2C 2GFBB 3RA7H 3VI3B 4HKJB 1CVSC 5EEXA 1EFXD 1DQQB 1JV5A 4QTHB 4KKLD 1NFAA 3WN5C 2WVSA 1PKQA 2ZF8A 5C3LD 1NMAL 1A66A 4QT5A 1FL3A 1BFSA 3VFOB 3CU7A 4YDIL 3TO4B 3KLHD 1OB0A 3FH8A 4ZX5A 1CU4L 4K15A 4XCEA 3SYQA 4KJYA 4IRZH 1F6AB 1MJUH 4F37F 3BPOC 5IQ9A 3BQUB 5C0RH 5AZ2H 3EFDH 2PWFA 2WM0A 1LNUB 1IC7L 3O3BA 4XT1C 2HPTA 1QW9A 5DZNA 2OJEA 1UACL 2M1KA 4JM2F 4GIAA 1OL0A 3LXCA 2OS7A 4CU8A 5M7QA 2KZ1B 5CD5D 4ZMNA 3BAKA 4XPHL 1QTSA 5DD5H 3WMPA 2CRIA 5EULV 5D7HA 5H4ZA 1IV8A 3DOSA 3F58H 3T8VA 1E2WA 2IXQB 1IAIH 2X88A 1EX0A 3FKUS 4OUUA 5C97A 1RJZB 4K94H 4HIIA 1O5DT 4JHWL 5J6SA 4Z7OF 1KGWA 2UUDH 1XBDA 4M5TA 2MCG1 3RVXC 5MENB 4XOAA 4GRLC 5KVGL 3QWOA 3OLIA 3CLFH 2J44A 4GI6A 3KBPA 4ZFZA 4G8GD 1U8PA 1ETA1 1KTDB 5KANI 2VZOA 5IEHB 1JERA 3V4UL 3VFSA 5HVFB 4KMQA 4ALAH 2VLLA 4M5ZL 4AL8H 5JR1L 4BFKA 3H3KA 4OZHB 3MNZB 5D7IB 5KOMC 2DLIA 2ZXWB 3BH4A 4WZ9A 3RGVB 3HVDA 2CO6B 3E2HB 4O2CA 1D6VH 4X6CA 3WLWC 5DUJA 4IKKA 1R5IB 2WCGA 2DJUA 1QHOA 5I1EL 3QDME 1VADB 2BERA 1JGEA 3QCUL 5K5YA 4N0YL 4X4XA 3WY3A 4RRPA 1Q0XH 2C4XA 3QIBC 3MNZA 5D7IA 4LLAA 1JD7A 1NCCH 2XWXA 2OK0H 4WDIB 4X6CB 1PBYA 2H3NA 4AZUA 2CIIA 3DROA 2HLAA 1A9BA 3BQUC 3OKOA 1JRHL 1OPGH 2PCFB 4MMYB 4XI5C 2W9DL 3TVMB 4C4KO 1P7HL 3IPEA 3EDDA 4GW1B 4Y5YB 2YMXL 4BV1A 3WFDL 3SDCD 4F7TA 3BAIA 4UNTA 1BF8A 4QWWD 4NZUL 2D2CC 2FEDD 3KWVA 1YMMA 1NCHA 2CLZA 5ITFB 5K9QI 1H6EA 2UXFA 2VXUL 4MJID 2IPKA 4WWOA 2H32A 2P46B 1QR1A 1KLFA 4TUKL 2QQNH 4LCWB 3BHBB 3DROB 3HNTL 5TE6H 4MJIB 1JWMA 1IQDB 1BVOA 4LL1A 3BUTA 1ZV2A 3BMWA 2WBWB 4WNSA 1OE2A 1A7BA 2P8PB 3CFQA 5E7FA 3TIEA 1RSFA 3FHAA 1C7SA 4KNQA 4N1CA 5I15H 3T1WA 3ZE0F 5GS1C 3R06A 1U33A 4NNXB 4O02A 3ABMB 3GSNA 5C0FB 1YEIL 4IGBD 4GBXC 4IQHA 1RZKC 3D39E 5I73C 4GIPD 3VGDA 2CHDA 1TSRA 1CFMA 2JIXB 1DCEA 3LJ3A 1INDH 1SUHA 5IVXB 1ICTA 4MLIA 3GPSA 2YZ1A 5L2KD 1KJVA 5EUKA 3GTTA 4NN6C 5DLLA 4IOIB 3B9VA 4LHUA 3SZKC 3LPWA 2OJZL 1CBJA 1S7SB 1P69B 3AQZA 2BXYA 1MFEL 4X7EC 2HKFH 5TJWK 3R1GL 3FF7A 4AV0A 4PJBA 4L2YA 2JIXA 2WQSA 1M53A 4FQJH 1NPNA 5D1QE 1HEJC 1J8RA 4OJYA 3X1EA 4RGNC 4W9GC 2GSGA 3HBQA 1W15A 2EADA 4RFNC 4YDMA 3T2NH 1OAKL 3B7SA 3UG3A 4DF9A 3ARFD 3F5WB 4P57B 2Q86B 1XWVA 4LXFA 2WXGA 3CFBA 1QEWB 4XVJH 4TPRH 3CHOA 3BZEB 4R0LA 5EH1A 3OVUB 1F6LL 4A6YH 3X11B 2CKBH 3UBXB 2YEVB 3HRPA 5I1JL 1H6UA 3AJ7A 4Y88A 3T8MA 2ZWLT 4HALA 3QDHA 4W70A 3O2VL 1MNNA 1XCXA 5BOPA 3QH3A 1DDHA 2NOYA 4CJ0A 5GZOD 3PV6A 3BAWA 3D34A 5F7BA 2H3XC 3I3DA 1GGCH 5BO0D 4ATTA 4JVPA 3A6BL 3T71A 4R4FL 1T2JA 3ISWA 2Z35B 1ONQA 3VX1A 5I1KH 2BY3A 3C5SA 4OGAD 5CZXC 4PP2A 2EIZA 4X98A 4L48A 4DHLA 5B3JF 3BC9A 4O2CB 3CCHA 4RIRA 3QCTL 3HFFA 4TRPL 4PJBE 5ENWB 1S3KL 5IG7A 1F86A 1EO8L 3D39B 5GJTH 3HZVA 4HJ0D 1NEPA 4G7RB 5DMKA 4JFEE 43CAB 1CLYL 1I4FA 3ML8A 4DP0X 4BHUI 3I6SA 2VDOH 4TLKA 5ADPH 3U30B 2Z91A 3CMOL 3G7TA 2X2JA 3ZDXB 1QRND 2BSSA 4S10A 4ZUUB 5GGUB 5BCAA 4PD4J 1FG9C 2YXVA 2V2XB 1UWGH 2EIZB 3CSTA 3MTRA 3N5AA 5FO7B 4IRJA 5AVUB 3N9GH 3QG7H 4GMSH 1H3VA 1CL7L 2DMBA 5GRWA 3ZJAA 2Y06H 3D39A 1A1OB 3D0LB 3QQ4B 5F7KC 4FTDA 4NKDB 1KELH 2XN9B 1T1WB 2APSA 1U8MB 2KHAA 4W93A 4D9LL 4OGAC 3NGBB 3U48A 2IDFA 1EV2E 1IUZA 1ZS2A 2BMKB 2JCCA 4DKDC 3HG0A 1N8ZB 3IXAA 4BSWA 1KB5B 2EKJA 3F6JA 4FQCL 1QR1B 1XH3B 3HAEG 1T6VN 3ZZLA 5BRQA 2RAMA 4HXAL 4LGPB 4DEUA 1RHHB 5EU6D 1NMCC 2W8CA 2ARJA 4KROD 1J5CA 4LHUG 2BX5A 4AJVA 5EBLA 1DBKL 2QBWA 1RZGB 1RZJC 4LLMA 3SGJC 3AGVA 5ACMA 3TV3L 1A64A 2OCFD 3NIGF 3ZDXF 2R0KL 4XN2A 1TQVA 3DJRA 4QGTA 4X6DA 1I3GH 4L8DA 3QK0A 4JFPA 1KCVH 1MNUL 1NCDL 4AGPA 3IDJB 1DSFL 1Y7VA 4U3CA 3FF8A 2ODHA 5E00B 3FT2B 4OLXL 4QUOA 3RY6A 2ITEA 2F74A 4RWYL 1TZHA 4X50A 2HMID 2IBZY 3VNYA 1RERA 4X4ZA 1JF5A 2NUTB 4EN3B 3GHBH 2GQHA 1ACYL 5F0JB 5IMLA 1MIEL 5DHMC 1S7TB 1TZIA 1XCWA 4UT9A 4Y89A 1B0GA 3FUFA 3HMWL 1KFAL 1ZIAA 3MUY1 4FQ1H 5D93B 5L0QC 3MOBH 3ZTEA 4M6ML 1EMTH 5HDQH 3QXDA 1D5MA 5F1IB 2XX0A 3I50H 3BP4B 4X5WA 2EVJA 3O8XA 2VR8A 5DRWA 2P5PA 3W3BA 3IBOA 1KGYE 3P30H 2Y1YA 4JQXA 3AXIA 3P77A 5B1JA 1AD9B 4N0CD 1N3NB 5KG9A 1KV7A 4QNPF 3ML9A 5T1LB 3S0PA 3DETD 4Q9QL 1TTGA 2I9TA 4JRYB 1FGVH 1C16B 1Z0NA 3VMNA 4Z78A 4MCYB 5HI4C 5BZWA 1JCVA 5E5MB 1DUYA 5A6LA 3BP4A 3ARDA 5T33L 3MA7B 4D7BA 2AXGA 4WUUE 4D9QD 1ZTXE 3FQYA 2MNWA 3DSFH 4XWOD 3SPIA 3QH3B 2JELL 2VZUA 3NP4A 5IESH 2GT9A 2Q9OA 2WJ7A 3HLKA 4Y4FA 1TJIH 4RRPG 5HI5D 1KFGA 3JUZA 1UFGA 4NN5B 1EFXB 3F12A 1OTUC 4PBDA 2NCEA 4PREA 3L9BA 1UA7A 5E5MA 2OLDA 1O0VA 3BDYL 5CJOL 4AYBA 3GRWL 4WIQA 3FB5A 5JHLL 1FYTB 4HWBA 3EDFA 4OFKA 1OGAB 2H2PC 5ABDE 1QFWL 1N2RB 1TETH 3V8OA 4JO3H 3C8DA 4FLOA 2WTPA 3MRMA 1KJMA 4YBLC 4NQUA 1C1EH 4Z77A 2O5XH 4BCZA 1TITA 5IF0A 3FRPG 5K9QG 2C7UB 3FO9B 4LBEA 4EF3A 3L95B 2VSDA 2JB6A 4GXVL 5IVZB 2EINB 2WCPA 3VGAC 5JHBA 3P0GB 4R7DA 1KTCA 3IETB 1IBGL 1FZOB 2EAEA 3H0TA 1TU2B 2R0LL 1FLTX 1QFUL 2O4EA 3L3DA 5FR3A 1SMAA 2UUDK 1KLGA 2PP7A 1BREA 3G5VB 3ES6A 3A6CL 3MBEC 4JJ5A 4Y1AD 1KB3A 2WMPA 3PQYA 2I60H 3DX7B 3ALWA 4LOUD 2AMUA 4M6OH 1U3HA 1RK0A 4AC2A 1J8KA 1UA6H 1OP5K 3BVWA 3K91A 2FBJH 1L9OA 4FXTA 2JB6B 2FR4B 5LN8A 4JG1L 2X4PB 1FH5L 2EKSB 2VR4A 3DX6A 5IMKA 4YHNB 1IC7H 1XFPA 3FFCB 5DFVC 3UEZA 1INDL 5C9KA 5KVDH 3BIAX 4UAOB 3QEQE 1PFOA 4MD4A 2J8UF 1FWXA 4HMEA 1R3HA 4JJ5B 5D7JD 3RVTC 4AQAB 4R5XA 5BXFA 2IAMD 3ARSA 5ANMB 2Q87A 1TMQA 3CAFA 2XI9A 1ZT4A 3TP4A 1MI5E 4ZS7H 5JLZB 4L1BA 1T1ZA 1JOIA 5KVFL 1HHIB 1VZGA 1X4XA 1UM5L 4L8DB 1AO7A 1OB1B 4L8CB 3U9UA 1M2VB 1A7NL 3RIAK 3APFA 3TM6A 1UA6L 3NIFE 5CLXA 2Z64C 3U7WH 4UV4L 1ZJBA 3N2JA 5HYSA 1YN6A 2QQNL 2XCMC 1UXMA 1A4AA 2JI1A 4YVNA 4ZZKA 4JQIL 2X28A 3FQXA 1EH9A 1UEMA 1YY8B 1CDCA 5TDNA 1I1YA 1A3LH 3PGCA 3MX0A 3T4AB 2AANA 4XR8C 1E42A 1D9KC 3GSWA 3KJ6H 4YE4L 4C83A 2W0PA 5HHMD 1FHNA 3NN8A 2MFNA 2QPSA 3V2AR 3JWNC 5KSBE 4PJ9A 4W9ZA 3K6OA 2Z8RA 3PJNA 3UTSE 4PJ5E 4CVWA 3DO7B 3I2CL 3QZWG 1ACZA 1E9OA 1ODAA 3O8XD 4PR5A 1J9SA 3GRWH 2X53A 3JVGA 2AK4B 3EOBB 3BVXA 3FFOA 3HUJE 2H5UA 2Q8AL 1AZRA 2Q2EB 2X1WL 2ICEC 2IH3A 5GS0L 1H3PL 4MAYD 3SYCA 3L1GA 4K23L 2VRKA 3VXRB 3MBWB 4Z7VB 3U4BL 3V6FA 5EN2A 2BS71 5DJCB 4EZKA 3W0WB 4MNHB 3WFZA 4JX0A 3KCWA 5IREA 5D4JA 2PF6A 2WZ6A 3HA0A 5IESL 5F7DB 1M56B 4IHBA 4GKNB 1F45A 1FJ1A 2YRLA 1RIHL 3NCCB 3SKNB 3IF1A 3MROA 4FZ8H 1BLNA 1TJGH 1I1FA 1W0VB 2X9YA 2CKNA 1T4WA 4AQ1A 1JVLA 1DVFC 4N90D 3MR9B 2W0FB 1JZ8A 3HMXH 5IKCB 3CVHH 4ZPVA 5A2CA 3C6LD 1EO5A 4LASH 3VW3L 3BSZH 5CD3B 4QO1B 2VIRB 3EJYC 3L5XL 2DLFL 3RPKA 2UWEF 4P5TC 2GITB 2K4AA 2H1PH 4NM4L 1F2QA 4NJ9H 4AYEC 3I9GH 1W0VA 3V0DA 5C0BD 5JA9A 1VDGA 2E56A 3MCKB 3Q3GB 4RETB 4F9PC 1IGJB 3HZMB 2EIEA 4NB7A 1KBGL 2GBTA 3SDDD 1U3HB 3ULVF 1Z2KA 3V95A 5DK0B 1EQWA 4EI6A 4JVUA 3QFDB 2Q2LA 3T9WA 1J18A 3MLPA 5EIIA 4S2SB 1EXHA 4BXVA 1UQSA 4JZJC 4KVNH 5JOEA 5K9JH 4JZOA 1F90H 2M8XA 1J0HA 2C1OB 3Q1SL 3M86A 1J1OH 1FN4B 1UB5A 4UZUA 4BZ2A 3IB4A 5C0CD 3ECWA 4ZFGL 2UYLA 4PGZA 2X40A 3WGUB 4YN3A 4TTGA 5BXFB 3FTYA 2XRAL 3QUZC 2WLHA 4PFEA 5ESAB 1YNLL 3GIZL 4TS6A 4XRCB 5I74C 4BFIB 4PVLA 1AIFA 5IT2H 1WSST 4PJCB 1QBML 4QDGA 3SSGA 4L3EB 3VH8G 4AEFA 3PL6C 1SF5A 2NY5H 2F7RA 4JZNA 1PY9A 3QI9D 4UT7L 2VDMH 1E50A 4NQDE 4BRVA 3AUWB 2WOBA 1AO7D 3L3OA 3A4DA 1KBGH 4P9MH 5FM4A 3WSQH 1UWYA 5IBUB 4EAEA 1C5CL 4B9JA 1D5BA 3G08B 3VX0A 3CWGA 5C07A 2ZOUA 2UZIH 4XRCA 2V17H 3H9HB 3QUZA 3DUUA 3AG4B 3N1GC 4K9EL 4QRBA 1CGYA 3RWFB 3GSUA 1UOVA 4JZNB 3PWPD 2KS0A 5DJXA 4HHAA 4KKRA 3VWKC 3OKMA 4B9KC 2MSPA 4EDWH 1RULL 4PWGA 5FCUL 1GXEA 3VW3H 2J6EA 4GMSL 2MCAA 2XFXB 2D3NA 3PPEA 3ARTA 3HC3H 4ISVB 5D1XC 3MNDA 1BQLH 2P5WA 3PRZA 2X6CA 4L4VD 3SOBL 1I9RL 1FQ9C 1AHKA 3DYPA 1E6OL 2AXFB 4E5XG 1TJGL 4ODWA 3A0OA 4Y5XB 2RFXA 4Y5VB 1WK0A 4MDJB 4UINH 4HHAB 3EUDA 4M7LT 3A22A 5CMAA 4NO5A 1WAAE 3L1OL 3CJJA 4XNZC 4UTBL 1WFUA 1ZK5A 2CRZA 3CN1A 5J3HC 4HK3N 1CQYA 4LFHD 4XOBA 3VFWA 3S3CB 1R3LB 5TE7H 4S1DC 3SOBH 1KN4H 3WHE1 3UGEA 2D7TH 2DWEB 3B3BA 4GMTL 5CHNB 1DL7H 2NY7H 4WK4B 5F7DA 5LGYA 2XWEA 4KXCA 1M7XA 2NSXA 3SYAA 5EO1A 4XAKE 3IK2A 3TCLB 1NUFA 2XLLA 5IY5B 1F4XL 2DIEA 1KGXA 2EYTB 1U41A 3MJ9H 4DAGL 1TVHA 4CVXB 4OI8A 3ABKB 3BLKA 2C3VA 2IV8A 2V17L 4OAWB 4KO9A 5TDOA 1BG1A 3GHPA 4MCNA 4UAHA 4DGIL 2BRRH 5DGRA 4HPOL 4XPGH 2DL2A 1BEYH 1AKJA 1HZHH 1JYNA 1XZ0A 2EO9A 2AKRB 3O4LB 3C9NA 4LDLB 1FNSL 3L48A 2IG2L 2E47A 4KI5D 1K3ZA 3SD5A 5EUKB 3RURA 1SM3H 4AMWA 1TLKA 4XN7A 3L9RA 1A3ZA 3EJJX 3ZO9A 2HKHL 7PAZA 1WYJA 1RUAL 3D08A 4ONHB 5JUEH 2X7LA 5F7LB 4CMMA 4WWNA 1RUKL 3WYRA 1BZOA 4N9OB 3TEXA 1XGZA 5AAMA 5FA3A 4QXVA 2WO4A 3BKCL 1JPSL 5FYKE 1U8CB 1DQQA 1JV5B 1YJDC 4PJ9C 1G7IB 2JJWA 1VGEL 2FECI 1QLRB 1X5ZA 2AMGA 3TFKD 2P28B 1GC1C 5BO1H 5K9JL 1FL3B 2Z8WC 3VFOA 1FN4A 1TTUA 6TAAA 5CLYA 3QXUA 2IH8A 4P5MB 3SPCA 4ZSOE 4Q7DA 3U7YL 1OTSD 2GK0B 3GZOA 4DN3H 5M94B 4U1GC 2CE6A 4YHKH 1XR8B 1WFNA 3M7FB 2JV6A 5F3FA 1ORQB 4RVBA 3PWLB 1KIUB 4I77H 2H8PB 2XOTA 4WWKC 3UC0H 5IHZA 4PJGA 2JTDA 3TZVC 2HRGA 4YFLI 3I9GL 1GZQA 3RWEA 4MASA 4FZEL 3QEQB 1YJDH 3VFNB 1TIUA 5C2BH 1JWUA 4JFZL 5DFVD 3GJFK 4XBGA 1CFVH 3ARQA 1J7VR 5JYMA 3LZQA 3VWJD 3O6ML 1H3WM 1H9VA 2WWMD 1GOGA 2EDDA 3BZ4A 3TA3B 2OX5B 1AANA 4JRXD 2OK0L 1SYVA 2QPEB 3NQIA 4V1DA 1YEFH 2DWDA 5CGYC 2VDKL 2WNGA 4BH8A 2BCKA 4DUXA 4D8PA 3IMUA 5DJXB 3RWEB 1HSAA 4XMVA 1PZ5B 5DI8B 2I5YH 3VXQB 1R0AH 2H2SC 1IZJA 2E7HA 5E95B 1NBVL 3AXLB 1R75A 1A2YB 1NDMB 3IDNA 4K7PX 2IANB 1QFWH 2IVFC 3T6XA 5KYUA 5I66B 3ILPA 4QJ5B 5I1IH 4N0YH 4O2EA 5GGQL 4AGNA 5C2UB 5KYWB 4HV8B 4LARL 1QSEA 2YPKB 2CALA 3EYVB 3QIWA 2P5WD 4L4VA 5GSRB 3UTPE 1AE6H 1CD1A 1KB5L 2I7OA 4NO0D 4JY5H 4A2EA 4PJCE 2NY5C 3EXJA 5IK3A 4BUQA 1YEDB 5CIPH 4H8PA 4LZKA 4JHVA 4PJGE 4QHNB 3IMTA 2ZYHA 1JPFA 2ZX8A 4GRWE 2WXMA 5BW7C 3O3EB 4W1TA 1R5WB 1I8UA 2B1AH 2BSRA 4XHQA 2PTVA 5HHOB 4Q0XL 3B8SA 1YRKA 1SLXA 1OKEA 3AU0A 1O7VA 4HK0A 4LVNB 4N87A 3SGEH 4TSCH 3FPYA 3J8F7 3LS4H 4GG8B 5HGDA 1WD8A 2C9UA 4G6KH 1BX2B 1F58H 2IWGA 4L2LA 1UM6L 5F7YC 1EJFA 3HC0A 3WIHH 1CUOA 4XCFH 3IGLA 5LGHL 1NFIB 1WUNT 1QSFE 3TPKA 4NQEE 1LO2H 2ZG1A 4LL4A 1XF4B 2HJLA 4U7MA 3T0XA 2VDKB 4N2DA 5I28A 1UACH 5F8RC 4ZJ9A 1NGXB 1IKFL 3OZ9L 3KWTA 3OWRA 1R3JA 4LP5A 3MA9H 3FT2A 5DJZA 1M6UA 1BAFH 5IUSA 1JWMB 2ZKHH 3CPLA 1ORSB 4N5UA 2M83A 3CZGA 4NPJA 1MIEH 3FCGA 1A14L 4OM1L 2Q0ZX 1A02N 1XGPA 2F7QA 2V8MA 4GAJL 5JOPE 1LK3H 1UUNA 3HB3D 4R7XA 4HCRH 1KJ3L 2ICCA 3HN3A 3VXTB 4WI0B 2K1MA 2R56L 4UQ2B 2IAAC 4RWYH 4ZYKA 3TEWA 1ZPLA 5E6RB 1R4XA 4TTDD 3MRPA 4OLWH 1M1XA 1IEAB 3EBIA 3GDCA 1ZHBB 1V5JA 4U4BA 1BD2A 3SKMA 4DO5A 3II3A 3F62A 5ECJE 3W0WD 3LH2L 4Z6AT 2YARA 1FFTB 4HF5H 3TFKC 2IDTA 3PYCA 5CJQL 2J6WA 1G0YR 3H9YA 2YQBA 1MWAA 4N2BA 2V7NA 3Q6GH 1DQJB 1WAAA 4PWIA 4N2AA 5EPMB 4PJAA 5DJYB 4AVKA 4LSSL 2Q5BA 4CVUA 2MCMA 3ILQC 1IEAA 1AVAA 1CFBA 1YN7B 3S37L 4NHCL 4ODXA 3WN5B 3E3QC 4EXPX 3K0YA 2O61A 3MCLH 1A6AA 4O5LH 3TIDB 1L0PA 1QWHA 3HE7A 1FYTE 2F0CA 1RZKH 4HBCL 4GQ9H 2MTPA 3RL2A 1MWAB 3CHSA 1F4XH 4XMWA 1C1EL 2DQMA 3KE0A 1EFXA 4N9GB 5E4EC 4IIQC 4Y7OC 1VSCA 5EPMA 1FVDA 4DP7X 1A9VA 5JPNA 3W9DA 1U3HC 4FDWA 5IBUG 3HPLB 1YPZE 3L4TA 1KXVA 1I8KB 5DD3L 4KQ4H 5C70A 5TFSH 3N43F 3WFBL 3BWSA 3UL4A 3TBVB 2FO1A 4IRSD 4FHKA 3BAYA 5FX3A 3M1BB 3BAEH 3MRMB 2XACC 1AAJA 2GAZA 5I5IA 2OMWB 2WW8A 4LNVA 4R7LA 2X89D 2VZ1A 3QC5X 4MXWL 3GMOA 4PVBA 5KYWA 1E5YA 1IAII 2JELH 4BZ1L 4PRAA 4RGNB 4KKZA 1C08A 1MZZA 4NQED 2JIXD 4PJGF 2VZTA 5ID1A 4Q58C 5EF0A 3S9DB 5HGHA 5IFAH 3RYMA 3EJRA 1KLGB 4MKTA 3WS3A 3D52A 1LE5B 3NZUA 4HZAA 2AJZA 3K2UH 3PHQB 3T2OA 1JPFB 1HNYA 3FW6A 4LEOB 3QEGH 1W0YT 3P9LB 5I6XC 4JFXB 1NM4A 5ETUB 4X7TA 3X12B 4ZUUA 5GGUA 1YECL 4KKAD 3NA4A 3LNDA 3CSFA 3I74A 3K72B 5HGDB 5IWLC 3I50L 4K55A 3NK3A 4HKXB 1G7HB 1CXEA 1QACA 3KPQA 5FKAB 4Y2LA 5CJXA 5FYLH 5JLZA 1OT2A 2VE6B 5D96C 1L0QA 1F97A 4L8BB 4WV1C 3IU4H 3HZKB 4QOKB 5JW3H 2QKIC 2DQTH 4XVUC 5FFLA 4L8CA 3V5KB 1CFSB 2BINA 1F1GA 43C9A 1HHJB 3QPKA 2J55A 1RZFH 3RWIA 2ADFH 5E08H 1YYLL 2B14A 4HSQA 5FYKH 4J27A 3UCQA 4Y1SA 4ENED 1FUNA 2NUPA 3B3IA 3C6SB 3UDWC 1OW0A 4C8XA 3AS0A 3LY6A 2QGDA 4PJ5B 2VXTH 4JFHD 2FJHB 2G2RA 3VXTA 2QSCL 1IT9L 5CLWA 3J7HA 3TVMC 4Z7NF 1TTRA 2WJ5A 1HCZA 5T8IA 1X5HA 4M02A 2ZOLA 2E76C 5TQ2L 1N0LB 1LEKA 5C0DB 1WEJH 5E94B 4AYFB 2HTLC 3O4LE 3RILA 1G9MC 4RMBA 4FNLL 3SJVA 4HIQA 1OCOB 3SKMB 4ABUA 4O4YL 1AZBA 1H6TA 2YEZB 5EU4B 4M3KB 1Z5LB 2BP0A 2FGWL 1B90A 1GSMA 1HTYA 3CZFB 2YQ2A 2H1PL 1HT6A 1WVZA 3OZLA 4M61B 2NQ3A 3UPRB 3SHSA 5E0QA 4F2MA 3NJGA 5EC2A 5AQ0A 5HHXL 5AKSA 4KH9A 2KPNA 4ONGL 4QRRB 3ZW3A 1Q9OA 4GSRA 1TJHL 3MRCA 2R83A 1I7TB 3WFDH 3M7OA 3QJSB 3ME0A 4QPEA 3ETBJ 5IB2B 2OMXB 4OLZL 1DCLA 5F89B 2XIIA 4AEHH 1J5DA 3LRHA 3QR0A 1T2QH 1Q38A 4ES9A 3KG5A 4O2FA 4TSBH 4A04A 1IKNC 1WITA 3PNWB 1RIHH 4AH2A 1HSBA 4IIZA 5FGSA 4N9GA 4HH9A 3ZZQA 1N59B 2CU9A 5FYJD 5KJ4A 1JGLL 4JO4H 2LTQC 5CSZA 3S2CA 1IARB 4IBWA 3QZNA 1DQDL 1VERA 4GP4B 4QTIH 4U6XB 3RL1A 4BA0A 4JZJA 2VXVH 3LRMA 6FABL 4DP9X 4ELMF 5TPWL 4Y2DC 1WAEA 2B4CC 4KY1H 3BQUD 2RR3A 1MDTA 1S9XA 5CR1A 3CZUB 5KBDA 2A77H 4U1IA 3U9PL 1M7IA 2OMWA 4PRIA 4N2KA 3BAEL 3CBJB 2B16A 4HCRA 3IJSB 5KW9L 1QSZA 1EANA 1CF8H 1FG2A 2DQEH 2XKNB 3BGMA 3FBKA 2ROXA 3I02B 4GINA 5ERWA 4AIXA 1NFDF 3L4WA 4U1KA 3V4UH 4CGUB 3EOAB 4Z3HA 2ZUWA 4K2UH 1T5KA 4UT9L 1IE4A 9PCYA 3KPPB 1HCFX 5C0AE 1FZJA 3IKKA 3NTCH 1JK9A 4WSJA 1XEUA 3GD1C 4Y2DA 1IL1B 2H0PA 3ULSB 1YY9C 4Q97A 3ULVH 1WZAA 4JPSA 3MYJB 1E4XI 4WKXA 2BOCB 5HYEA 4J5VA 4V11A 3NIGE 3P73A 1F18A 3ELAT 3DVGA 3EBAA 4Y19B 4JFTA 4KK8D 2LTQB 4XP4L 4K94C 4UCFA 3BGFC 3K2KA 2QZ5A 3JWOC 3E6HB 3ES6B 4ICWA 3VWJB 4C4BA 1MFEH 3K8LA 2NY0B 3DXAA 1H5BC 3V7AG 3NAAL 4QRAA 3INUL 3OLDA 1LO0H 1Q4NX 2PO6B 2DI9A 2NY6C 3QUYD 4FL4B 4G9DB 3CG8A 5F0LB 3QJHA 5MERA 4J3OG 4NC0B 4L8BA 1OP9A 4C4KT 4NOFA 4E9LA 5TK4A 2EDLA 2JF1A 3GQFA 3B2DC 4RGNE 3FL7A 1LK2A 5D7LA 1X5LA 2RHEA 4LNRA 5IJKA 1A8ZA 2G60H 5F8QC 1XSJA 3B5HA 2R4RL 3D4CA 3ORJA 5IQLA 1LO4L 2ITFA 5LCVA 1JAEA 1RLWA 1YUHB 3VXMB 3OBAA 5C0NC 1NMAH 1FF5A 5LHDA 1PD0A 3SY6A 4XBPB 4I18B 1MHPH 2V3EA 5MERB 4YH6A 1HZKA 1XB8A 3CZSA 2D7OA 4HWBL 1OB1A 1IJ9A 3WIFA 5F3BB 3SBWA 1WGVA 1IBFA 1WFMA 4N8CH 1S78D 1N0LA 1FYTD 3S4SG 2VO5A 4PLOB 5LJYH 5HJDA 2VC2B 2XPGB 5FV1L 2R7EA 4WJ5B 4LQFL 1OWRM 5FYJU 3VFRB 1ZGLP 2BVYA 3MV8A 1A6UL 5DHYA 2B1HL 2LAGB 4ZNEE 3IYLW 1A7QL 1Q9LB 1KIQB 2DIAA 5AAWA 2HTKD 3ECVA 2YMXH 1I1YB 1IRAY 2JKSA 3C75A 3KLLA 3PGCB 2ZWSA 1TPXB 3ZL1A 3Q8AA 5J11C 2IQ9H 4PRHD 5I1AA 3ZSTA 4N25A 4APXB 1OGAE 4A2HA 1MREH 4KDVA 4Y16A 2LFGA 5KBLA 5D5ME 3O45B 4X5XA 4HIHB 1H8NA 4DKEL 1AGEA 1E5CA 2A0LD 5JXEC 3ULUF 4JRWA 3L16A 3WY4A 2ARWA 1K8DB 3TX4A 3PNRB 1J48A 3VI4E 2XG4B 5AAPA 4NO3B 4ENZA 3CDZB 2DWEA 5IWLA 2HFEA 3NGBC 4PRPB 1DBAH 5I1AB 2HUEA 3II1A 2ENJA 4ELME 2CO4A 5SWSB 1FAKT 2LU5A 4PSRA 1GGBH 1M7DA 1NC4D 1YDPA 3GI9H 3P0VL 3BRGC 1VEOA 4LSPH 1AZUA 4OZGA 4CVXA 3DSFL 2ZX5A 1KJ2H 4M5ZH 1VHPA 5F9WC 1OCRB 1UC6A 3IDXL 4MMZA 3RWJB 2B4CL 2ZXAA 3OJDB 4NP4H 1CN4A 1HDMA 1RMFH 2DIBA 1MQ8A 3QNXB 3LKQB 2DL9A 4CA4A 3ZKMD 5IJCC 2DQIL 1I1CA 3LDBC 2I5YL 1IC4H 2PCFA 1AY1L 4MMYA 1JWSA 1UHVA 3MROB 3CDYA 1BV8A 3SKNA 4QLWA 5F7AA 2ZG3A 2WLKA 2A3TA 4N90E 1PDKB 2OSYA 3RY4A 4K5PA 4PMFA 3QDGA 1GYWA 1WA0X 3GTNA 4IOFD 2AC0A 3O6MH 5A2LH 4PJXE 5GPRA 5IB1A 4PJDF 3SBPA 2P8LB 5A16B 4YHYB 4KKPA 4MX7B 1QYGH 3WLBA 1DJGA 3V6OE 3MRIA 4ZO6A 1W80A 3WEXB 5HHMB 4X4YA 5KJ7E 4OD3H 3U79A 2J25A 1MH5A 4HWZB 4K7PL 1JHKH 2LAAA 3QUXD 3HZMA 4NNXA 4O02B 5DRZA 3SCMC 2ZX7A 4FQXA 4HG4J 1Q90A 3FO0L 3KPRB 3NPSC 4FF9A 4WI7A 1CFNA 3X1GA 1IKNA 2K78A 2WANA 3FUJA 5CEZD 5AWNH 1EWHA 5C6PB 1HHGA 1KBPA 4G7YL 2IOOA 2K45A 4P0DA 1DANU 1GJUA 5JQHC 1LP9A 4OJFL 1G6RL 1JNNL 3OAZH 5C0GA 4EDXA 1MCQA 4OI7A 1JPSH 1K85A 5E2VL 3QJUB 2CD0A 3RA7L 1LL1A 3KJ4B 4JM0A 5FO8B 1CJYA 4X9HA 3NAAH 4YHOL 4S0HA 2EE0A 2O5YH 3N0AA 2NY4D 3PDOB 5I8CB 4HKJA 4FMVA 3SODB 2UXVA 3FS9A 1G9HA 5KN5A 4YAQA 1XBRA 4QRTB 3NCWA 4P46A 4LPCA 4UF7C 1WISA 1DBJL 1FZKB 4R3SA 1HQRA 3TO4A 5KAQF 1HZHL 1JPTH 1T21A 1OQXA 1T89C 3LEYL 2E86A 2J6EH 4EI5B 1IZKA 1GY2A 4P57A 4L05A 1I9IH 2CIKA 2J72A 2WUBL 4Y19E 2F2HA 2RJMA 2LLLA 4WJ5A 5DEZA 2EIBA 2Y06L 2UWEE 5IFHH 5I66A 1XO8A 5ISZB 5DZLA 1WH0A 3AQXA 3H4HA 3LV3B 4OV6F 5D55A 3QIWB 3MHZA 2VDPB 5D72L 2ETWA 1Z3GH 1LEGA 4QNPE 5BRPA 2WBKA 4D2NA 3QEGL 2VN3A 2Y2WA 4WFHE 2KI6A 2CJUH 2GVYA 1OAQH 1TXKA 3P54A 2NW2A 3ULUE 2XU9A 4MSWA 4K8RD 5MEOA 3ZIYA 4KZDH 2X2UA 1XB3A 2CDGA 1N6QL 5AVYB 2VLKB 3L4YA 5CF3A 4PRHA 1EPFA 5GJTL 1DQML 1X5FA 2D9QB 2X87A 4NFCA 1D5IH 2ZUXA 1AJ7H 1R5WA 1XD1A 2KLRA 3P2DA 2EDYA 5I6MA 1KN2L 3BE1L 3UROR 3DI3B 3MV11 1RH8A 4W9IC 4CSPA 3UC2A 5GXBB 4B9FA 4MVBC 2FJGB 4L9DA 1BX2A 4GS7C 4HLJA 2B8OT 4NWTL 5CWSB 3B9KC 4NLHA 4UINL 2V0AA 1ZLWH 1PSKH 4DJMA 1SJVA 2DQGH 5B38B 3VA6A 1DQKA 2GUOB 4MQXC 1VRSA 3SE3C 3JV0A 2FNBA 4NIKB 3TZVA 1F3JA 4WFFE 5HY9A 5CN3A 1NC4A 1OVZA 5D72H 1JNHA 3HC3L 1HDMB 3R4DA 2NZIA 1YC7A 3FUHA 4AIOA 1FLRL 2VR3A 4GG6F 3F7VB 3SE6A 5DC0A 2WINA 3B9KD 1WIPA 2FK9A 4NPYA 3QJXA 4CBZA 5I1HH 1H3XA 3LZLA 4XC3L 3D2TA 3I3EA 2N4IA 3NA9L 2VL5B 4CADB 1XMEB 2D7PA 3KWUA 4YZFE 1PCSA 1RQ5A 4JREB 4JKKA 1NGZB 5JHDD 1JNHB 5AOIA 4ZYKB 3CVBA 4WDIA 4FLRA 2E75C 4J1UA 3DYMA 5LDUA 4LCIH 2WXNA 3FHEA 3P0YH 1SFDA 3VXPA 3WSQL 4M4PA 1DJZA 5DJDB 4AV4A 3D69B 2W0KA 1RZJH 5I30L 5CJQH 3HS0A 3LNGA 1G9NH 2BVQA 1BXVA 2HRPH 4HWZA 4JHAH 4CU7A 4FFZH 1A5FH 5C09A 1RFDH 1R3IL 2HWZL 2WVVA 4APQC 3QQNA 1GSKA 3FQUA 4PJFB 4C56D 1GGIH 3L5WA 4M93C 4ZFGH 4FG0A 1KMGA 1TZHB 4CUCA 4L4VE 4LE8A 3MUGB 5J5EA 5FV2A 4K7PY 2ZUYA 2HRHA 1F90L 1U8KA 3E7JA 3WI9A 4PW4A 3VD4A 4OW6A 4OF5A 5J6GB 4LB8A 4MDIA 3QIUA 1AQKL 2J57A 4O00A 2PTTB 3WTWA 1CLOL 1HOCB 3UTQB 4FFVC 3I6LD 4I3RH 2ZKWA 3FCTB 1PJWA 3MXWL 3L3JA 3PDOA 5I8CA 5DZPA 3QXDB 2N7AA 2Q7AA 1V3KA 2F8VA 2FD6H 1X9RA 4QRPE 1AKJD 1FV1A 3L7EB 4FX5A 4PJGB 3JWDC 1B2WH 2IALA 5E2TH 4YEEA 2QT6A 2WXQA 4XNYH 4Y1AB 4JN1H 4DQAA 5H2BA 1WWWX 1A6ZA 4W9KC 3G04A 5KG9B 3ZKXC 3DMMB 4M1GL 1KLUA 2J71A 4UMGA 4BDVA 3KLAB 1JZ3A 4QJ3B 2WLLB 4MA3B 3VFUA 4CU6A 4XHJD 3ZBMA 5FS5A 2J5LB 5DUPL 3BUBA 3K7UA 3NJMA 2IAND 5IFAL 3MRJA 2V5TA 4XP9L 5C0CA 1VFMA 5F96L 2AZUA 4L0PB 8FABA 1SVBA 4TV3A 2HCZX 2IAMB 1PG7X 3WNIA 3GJEA 1JXDA 4YQXH 3DOIA 2Z4QA 2YGVA 1I9EA 3U46B 1MG2C 4X7SH 2HFFA 2NY3C 4C59B 5E1GA 2X4OB 4FQXC 5IGXH 3QT2A 3GINA 1WZLA 3EG9B 2VKXA 3T3MB 2N0KA 2VSKB 4P2YA 4PJFF 1XT5A 5ECGA 2HKAA 1J9CT 1MWOA 3PHSA 2ADJB 3MRJB 2NZ9C 4GW5A 4C4UA 2ZWNA 4IDJL 3N0PB 1NCUA 2IIJA 3K4ZA 2IPTH 2APXA 3C5JB 2Z6FA 3GJEB 2V9RA 3BVUA 1SY6H 1E3XA 3UACA 4WWKA 1MCPH 4FMKA 1CXKA 2VISA 2Q7YA 2ZKXA 3APNA 4DKEH 3AM8A 2QHRL 2AGJL 2DWSA 1FFPB 3BFQG 3HHSA 5C0ND 3EYFA 3CCHB 4RIRB 1MCIA 4AW4A 1HL9A 1W72L 2YD2A 4FQIH 2WIIA 3Q7JA 1UXLA 1QO3B 5SWZD 4ELMA 1ZLUH 3HNSL 3Q01A 4Y5XC 3I9AA 2WXRA 2NUPB 3B3IB 1I4FB 1B3IA 3L3HA 5HI3D 1MCLA 1NBZB 2Q20A 4IBUA 1DVUA 1GA2A 3ZYJA 4I77L 4MB3A 4G80A 2V2XA 5FO7A 4JDZA 5EIQA 4P3CL 3QUML 5HVHC 5D1XB 1RURH 2IAMC 4IS6B 4JAMA 1QPPA 4RSVA 5AOKA 1SY6A 4CRPA 3UAAA 2VDQB 2CNZA 3QRLA 3GMNA 4K3JL 3CVDA 2CRMA 2VRAA 4NO0A 4PTTA 1ORSA 4AQAA 3BGAA 3QIWC 3VFPB 3SJVB 3DSNB 2XN9A 1FL5B 4HUXB 4K3EH 2F54B 5EU4A 4QHMB 4YDIH 2VABA 2BVUA 4J3BA 3TBWB 2BVPA 4E5XA 3JV6A 4PMEA 1ZE3H 5E24E 3DX9B 1KB5A 1B3JA 2V2TA 1YPZB 4YDZA 4LVNC 3OLGA 5DHXB 3L5WB 1U95B 5BS0B 1EEZB 3MV8E 5IOKA 3FOLB 2NYYC 1RUKH 2F8OA 1UOLA 2P5EA 4G70B 4MAUH 4WI6A 1KSRA 5GS3A 4NO0B 4PTTB 4GUOA 1MQKH 1AFVH 1HAUA 2ATAA 1ZHBA 2NR6C 5IROC 2CUIA 2Q8BH 3JYBA 1IKFH 1G6VK 1D5RA 3IU3A 5F9OH 2XQYK 3WMSA 5J89A 3A4AA 4MDIB 1CLZL 3AAZB 4F33B 4Z7AA 2HH0L 2L7EA 2YS4A 3DX9A 3ZQWA 2YPLD 2NXYC 3HG3A 1E4JA 4FD0A 4XPTL 4HMCA 2D3JA 1MY7A 3BH8B 2GSIA 3H2PA 4BQCA 3T0EA 4XE5B 2P5EB 1OOWA 3MRHB 2WB7A 1P1VA 1YG9A 1U21A 4LPVA 4OZFG 1EDHA 3BZFB 2VAJA 2IH1A 4AJYV 4M5SA 4FN0A 3D9AL 4JZJB 4JFQA 4GXVH 2GEEA 2EEFA 3AAZA 3EJUA 1AXSA 4HS8L 4MNGE 4NDMA 5F1KC 5HHQB 5IB5A 2DQEL 5GHWL 1ZA6A 2AEQH 4ZMOA 2NY6D 4KRNA 3HRZC 1FLRH 5KW9H 1NGYA 2J20A 3ESMA 4G6MH 3PP3H 1H5BA 4FULA 4BWUA 5KBKA 5JXAH 1AMXA 4W6XB 3SGKA 2CR6A 1UXSA 3SDXE 3FU6A 5GRUL 2R39A 1P5UC 4UNUA 5K9KB 1BVKA 4M9OA 5HI4D 3AREB 3K81A 4RMSA 3BP7B 4AUYA 5T1KD 1DUZA 1MCWW 4QI3A 5E03A 5AVVB 1PD1A 4HIXL 3HZYA 3PWNA 2ATPB 4L37B 1TCRB 3GMOB 2OR9L 3A5VA 6FABH 1CDYA 4J3OF 4B6ZA 1KT2B 4JMNA 2B3IA 4PWHA 3JZ7A 3MRKA 4BFEA 3SGJA 1DQMH 4OFPA 5BUGA 3EYOA 1MHHB 1FE8L 2ZCZA 5SX4I 1EAQA 2PP9A 4QO1A 2CJUL 3F12B 3NDZE 4YS4A 4YBQC 4AEHL 1WBYB 3RY6C 4Z76A 3UGXA 4G9DA 1OP3K 3QCVL 2W91A 1JGVH 5J12B 5EEZA 3EGXB 4PG9B 4HAFA 1B2WL 2Z9TA 3SPJA 3EYFB 2UZIL 1F13A 1T6BX 3MJ9A 5IFHL 4IIQA 1EIBA 5MI0B 4R90L 3RVWC 3N1QC 3BCFA 2ICEB 3NBNA 1VENA 3BEVA 2P24B 2PPDA 3LEYH 1HHKB 4Z77B 4BH7B 4KO6A 1D2PA 1UKTA 4NHUB 3TONA 3VACA 4W9JC 2AQ2A 1J8HE 4F57H 3APCA 2D0FA 5IMOB 1FZOA 1UXWA 2D0GA 2PXYA 3H0TB 2X4NB 4PIBA 1AGCA 3M17A 5SX4H 3V0VB 25C8H 3IAPA 5EBMA 3P2BA 3RFZC 1QW8A 2AJUL 2JK5B 4HJ1A 4HUUB 4KROC 1S5IL 3CPUA 1FPTH 2ADIA 1A6TA 2IGFL 2DQ6A 3MRRA 4WUUD 3V0FA 3L2LA 1OANA 1I3GL 1CYWA 1ID5I 1LNUA 1VZIA 3MN8A 2OSWA 4BFIA 4HIJB 3K1KC 4DIXA 1XGQA 3FU7A 4AG4H 1UXWB 2PXYB 2Q3ZA 4LCVA 4KXAA 4FXGA 2V3FA 2MIZA 2PXYC 2ZOLB 3Q2LA 2X1OA 2DQHH 3AUVA 4XNZB 4X5XB 2V7HA 4Z3IA 2JQMA 2BRRL 3BPLB 5CS7A 4QRPD 5PCYA 2Q3XA 5GZNA 1THCA 3WNNA 2A73A 2D31B 1A3RL 2ATKB 4LEXL 4NZFA 4F8OA 2IDQA 3AXHA 3GBLA 4F9LA 1WCBA 3UTSB 3C08H 2O5ZL 1MCJA 2R0WL 5DZ9A 1T1XA 3CDZA 3RTLA 4BSVB 2GSIB 4A7SA 2F53B 4G11A 5F9AC 2YPLA 5IHHA 2F9BT 3UTSD 3U4EA 2G0LA 2BIPA 4LASL 3EIFA 2XTJC 3Q5YA 4JMXA 3K2UL 4YPGA 1DL7L 2NY7L 2YMOA 4KROB 2C1PB 1HH6B 1L7IH 2Y2TA 2XV6B 5KYYA 1MCDA 3DIDA 2X4QA 4I88A 4ODWB 3GSRA 1QSFD 1OCWH 1IC4L 4NM8H 1CICB 1NUGA 2BY1A 3GMQA 4JO1L 1SMDA 3B9EA 5JPMA 1N59A 1IC5H 5CMAB 5JDJA 5ELIA 4TSAH 4WGKA 5K9OA 1CD8A 4JR9H 2F7PA 2DKSA 4WFEE 2DLHA 4OQTA 1HWWA 4LDOB 3BEWA 3V0GA 4UM8B 2GK2A 4NJAL 1JZ4A 3NJKA 4NQCA 1OGPA 5I8EB 4B5EA 1XIWA 2AV7A 3EGDA 3NCEB 2UZYA 5JQ6L 4RZCB 3KYMA 1MN4A 1C8QA 2XT1B 4RFNB 5JHDE 3FQRA 4YSSA 3SPVA 1XL4A 5JPMB 2Y3NA 4I2XA 1ZHLA 1CVRA 2QDVA 5FCUH 5E0FA 1TF4A 5T1DL 4H26A 1BQHB 4PY7B 3QEQD 5SWQA 2GI7A 5E8EB 2AVGA 1WG3A 2X0UA 3QO0B 3ULVD 5I19L 1TTFA 2C3VB 5B22A 3BP5B 3M07A 5I8EA 4NHCH 5K1VA 5HYJB 2OMNA 1EEQA 4Y16C 4M93B 3LVTA 4D3CH 1AKPA 4YHIA 3UPAA 3NJJA 1L7TL 5E6ID 3T0EC 1CFTA 1QHQA 2KZBA 3HI1B 3QA3A 4KV5E 4PY7A 2BFGA 1VESA 3QDJD 3RQ3A 2QADB 4IRSA 4L4TE 5JW5A 5C0GB 2ICWJ 3IRZA 1IAMA 4PJHE 3RZCC 3MC0A 1WAPA 4LKCB 1VA9A 4BFGA 5CD3A 1HHKA 3GIZH 1I8MA 4N1EA 4GBXD 4L3FA 5FGRA 1F1AA 4F92B 4NQEA 3CQPA 3BJ91 4NKIH 2EDEA 3QPQD 1G7IA 5DR5H 2KZKA 3QJQB 5IVXA 4OLVH 2O72A 4FQQA 5E51A 3GBDA 1X7QB 3D85D 1HQRB 4AKOA 3GS7A 2JK5A 3UTTE 1DVFB 3C2AL 3QQXA 5I8KH 1CC3A 2N1TE 5L0QB 5HHOD 4IU3B 2DDQL 3O3AB 3CZNA 3VI3A 5FPIA 3MMEA 3B37A 3MA9L 3NFPB 1ORQA 4I18A 4WUUA 3DK0A 1JHKL 1PLAA 1A14H 1X5IA 5I1GL 2IDUA 3ARGD 3HBZA 4ONFH 3INUH 4IJ3C 1BF2A 4ANVA 3NCYS 1JDCA 3DGGB 4MYWB 4Z0BL 1QYGL 1JPGB 1RSYA 4NYLB 3QAZC 4Z9KB 2I60L 3SDXF 3ZE1B 3W57A 3NCXA 1B4LA 3QIBB 2CDGB 2OW6A 3E2HC 1UVQA 5ADOL 4FYTA 2CR0A 1OT1A 3C09C 4DGUA 4K5LA 4P2RA 4BRJA 2CK0H 3MMEB 1MJJA 1N0XH 3FTSA 3PP4H 3WJMA 1OSYA 1F42A 4EIZC 2WZ5A 4ZQTA 3DGGA 2O5XL 5CJBA 3TNMB 3FB8B 1L3WA 1IM3A 4RMWA 1XCTB 1VADA 4OCLC 4WV1B 3O45A 2DPKA 3FTGA 5ALCH 1E4KA 3U1SL 5I17B 2EE2A 4JFFD 2VW6A 2XZQH 2J8HA 4G5ZH 3BXNA 3RX9A 4WI4A 5ICZB 4HEMA 3T0DA 2XWZA 5E56A 2WWMC 3D0VB 2XG4A 3QCUH 3ULVE 1GJWA 1TYRA 3B1TA 4X98B 1YQVH 3WKYA 2VJXA 1G7MA 4OKVB 5LCVH 4IRZA 4WENB 4GEJA 3F7VA 1I8IB 1U8OA 1K8IA 2JSFA 1HE7A 2AJXL 3B9DA 3AMKA 3P11L 4JG5A 1GGUA 2CM5A 5A7BA 3V7MA 2DWYA 5EWIH 4EI5C 1JTTA 5CCJA 5FM5O 1DQDH 4RWHA 5I76B 1QFHA 4OZGB 3SPHA 5CNHA 1QI3A 1EVTC 1KBBA 1OT4A 2FWUA 2EYSA 4RZCA 4DP1X 2YKKA 3BKYL 4FFYH 3FPXA 2GPZA 1JDAA 4S1QL 3GLDA 4MS6A 4MJIA 3Q9PA 3PABA 3TWCL 4JDTL 4ZQKB 1NQBA 4TL4A 3SDXB 3QFGA 5EU6E 3HS0B 3NDYE 3OXSA 3Q48A 4YX2L 1IGFL 5J7CC 5GJSL 3IWUA 3CXFA 2IQAA 2NDGA 4XP5L 4B50A 4OT1H 4YSEA 2DH2A 4HUWA 2WXIA 3KPNB 5C7XH 3RHWK 4URTB 4JFZH 3GO1L 1ADQA 3FQUB 2B5IC 2A4ZA 4B5ZA 4NAMA 1A4KA 4UV4H 4YDKH 5DXWA 4YHLL 4ZZFA 2HVJB 2H2SD 2E59A 1NFDA 2QR0A 3D8MA 3TH2T 4MHHG 3PE9A 3QDMD 4HWBH 3ZKXB 2Q76A 3FQWA 3GHBL 3UERA 3B83A 4UDTA 3ZLQC 4HDIA 1HHHB 4ZAKA 5BQDA 5ITFA 4LT7A 2RBLA 4RAVB 4E42B 4WI0A 3ALXA 4FHJA 2J5LC 4NZRL 4GP8B 3LKSB 3V6BR 5D2NB 1MNUH 2FH8A 1M7UA 1X5AA 3CLEH 4Z7WB 1RFDL 1U58A 1CXLA 1JF6A 3ABZA 3BKML 4FLSA 3T3PF 4DQOH 3PCYA 1DP0A 4KNSA 4NKIL 2VZVA 1HKLH 4IGBA 1KYUA 4Z7UA 4W4NA 5BUPA 3E8VA 3GSNB 4W4OA 3D85A 1Z7JA 2AZAA 4LLUB 2OYKA 4PJ6A 2WLLA 2YD1A 4MA3A 2DMGA 3KH4A 1Y07A 5IQ7H 5CEZH 4YO0B 4KJQD 4EN3D 2J43A 2AERT 4CN1A 4YAQB 1HXYB 2KMWA 5LAXA 3SDAA 3M6DA 5LNEA 2C3WA 4DNLA 2ITCA 3LQZB 1J1PH 4U2ZA 2F7IA 3D5OF 3IAQA 3U4KA 2R69H 4WW1B 3BVDB 3G5WA 3NSCA 4XH2A 2HFFB 5EDSA 2EO1A 2ZXCA 5DK3A 5B39G 4OZIB 5EUOF 2O6EA 3CN2A 3NIFB 1K4CB 5E4OA 3GSOB 1ONQB 4JM2A 3ZR5A 1ZHKA 1GMEA 2W9EL 1HU8A 4HIIB 3JVFC 1BBDL 3UEQA 1P7QB 4L1LA 2WV3A 4P2RD 3A23A 4L1SA 4U1JA 1J9QA 1IQWL 1MCHA 5EUOB 4IBQA 1MAJA 4KJPD 5LG1A 4F93B 3BX7C 4ACPA 4I89A 1Q0YL 4X5PA 2IV9A 2VOTA 4ZFZB 3PY9A 4PP1C 3UMTA 1CYXA 2GW5A 2CJSA 2QQQA 4OCYH 3MLVL 1RKRA 3ECBB 4JPVL 3ZXAC 1NDGA 3WIIH 5SX5K 3KGTA 4G9FE 4FCHA 4Y2OB 1GYUA 4PREB 4WKZA 2FSDA 5E6ZA 3FN3A 1BM7A 1I31A 1YEHL 4WEBL 4FFZA 3RGVA 1H3TA 2Y25A 2YKLH 1LP9F 1SN5A 3F7KA 1G7MB 4KXDA 4YFDB 1TTAA 1I9RH 1HSAB 4M43L 5DI8A 4KV5F 3FULA 4KUZH 5L2KE 3AVEA 5BMFL 3TO4D 3VXSE 3UYRH 1Z9MA 5EO0A 3ECQA 1PY0A 1OCWL 2AI0H 2VC2L 1WIOA 4TUOA 4Z5RB 1ZLDA 3D39D 1NCJA 1NCWL 3IDUA 1PU0A 2XN1A 2WN3A 1BBDH 2XBTA 1FCCA 4LVOC 4I18C 5J0BA 2EYSB 1TJHH 4FABH 2OMZB 3AT0A 3NG5A 2CLRA 2ZWZA 1MFAL 3L3DB 4KX9A 2FJUB 2XZAL 1JFQL 1AYRA 2X38A 3UXFA 2VUOA 5EO0B 4TVPH 4E0RB 2VR7A 1ZDSA 3C08L 3FO2B 4AT6A 4F7TB 2VNCA 4XX1G 4QYOB 3DLQR 5T5FA 1TQWA 2NY5L 2RTTA 1QX1A 4X6DB 4YXHL 2XQ0A 4UTCA 5EZLA 3RWHA 3S5LA 3DRTB 3R1GH 4WWPA 4DN4L 1OHZA 3QNFA 4P9ML 3SKUD 4LPXA 3FOLA 5E99L 3U9WA 43C9B 4YHOH 4NKQB 3T6QC 1A6WH 1J05B 3GGWA 3H2WA 3KYOB 2CUHA 4WW2A 2CLVB 3WAKA 2X9ZA 1KG0A 1N67A 3CX2A 4ANUA 1K5NB 1KCSH 3FN0L 2AQPA 2UX6A 2YPLE 1SQ2N 2HT3D 3HBGA 1OAJA 3LD8C 4H1LG 4OJFH 4A7GA 1OGSA 1AG0A 1T3FB 3QDMA 4HJUA 4RMQA 3IM1A 1GCYA 1YVLA 5KVMC 2O30A 4NUGH 1PIGA 1M2VA 3R7QA 1Z0MA 3QJZA 3H6JA 3BWUC 4GW4A 1M71A 2ARJB 4R26H 4YHZH 2EUWA 4AQ1C 1YN6B 1N18A 4MJ5A 2BSCA 5DMIL 3TWYA 2BP0B 3U1QA 2BW5A 4E36A 2YN5A 3P77B 3C60B 2CKBA 3CUPA 2IOIA 4ZUVB 5FYLL 3KH3A 1ZA6B 4JFPB 5B1AB 2YGNA 4LLUA 1IJNA 1CGVA 4ZDHA 4L9LC 2D7NA 4YO0A 4YDVA 1SEBA 2XZAH 4OZ4B 3SQBA 1Y0LB 5IB3B 3SCMD 4PJ9B 2MOVA 2Z1PA 1CL7H 1HXKA 4NN5C 4QHUA 3OG6B 2DYSB 1FRGL 4JDEB 1IGFH 4EN3A 4MJ5B 5BZDA 3O4LD 4N5EC 3ZT6A 2DS4A 2G3NA 4PTUA 3SCMB 4XNDA 5HYJD 1X4ZA 4ZUVA 4WW1A 5MHSD 4LU5H 2UWEB 3KPSB 1GHFH 1KLUB 2FWLB 5ESVB 1RZPA 3EOBA 3K4DA 1DQJA 3HCVB 3OJMB 4LLYA 3OL2A 2WXFA 3DIFB 2EH8H 2J2ZA 2JNZA 4XXDB 4Y4FD 4AI7A 4D9RE 3IFLH 1SBBA 4NRZB 4PP1D 2GEQA 2Y7OA 2K6ZA 4HUNB 2K8MA 3K1DA 4JANB 4JM2D 4X80L 1RJCA 3O81A 2ENQA 1ZHNB 1D7DA 4WO4C 2VM4A 3FT4A 2GCYB 5H37A 2Z4QB 4WU7B 1NM9A 2V5MA 1MDAA 3AACA 1NDGB 2ZNXA 1DHKA 2VJ0A 2YA1A 1ZVSB 4DPBX 5CXPA 5F2FA 4NRZA 4NERA 1RL1A 3LMJL 4ZO7A 2NQDA 4M3JA 5ERWB 1SEQH 2VQ4A 1IQWH 3MRBB 1E4WH 4UILL 3LZFL 5ICXB 4NN6B 3U1SH 4PGBA 1G7JA 1KTLA 2CHZA 5E4AA 3LRGA 4WTXA 4R7NA 2I07A 2UY7A 1AO7E 4MDRA 3HLAA 4N2NA 3U83A 4DK3A 4NHUA 1CE1L 3LH9A 1YEWA 4W9EC 3D30A 2FHFA 4CVZA 2VISB 2MRYA 2HT2C 1OW0C 2Z91B 2X70B 2G9HA 1GW6A 4BGLA 1SBSH 3PXLA 1JHLL 4EOWH 4ERSL 4QF1A 2VDPL 1FNHA 4RDQF 3VD9A 4UOJA 3ARBA 3Q8FA 1N2RA 4FQJL 1JF1B 2XWBA 2QVFB 3E6HA 4LKXA 5G4MA 2CPUA 1QPXA 5JTWA 3KMDA 5A2KH 1A3LL 4FNTA 5KSAD 4UOZA 4UTAH 2W88A 4TNEA 2Y9RT 2R2CA 1J0JA 1OCCB 1L9PA 2C7UA 1P2CB 3FO9A 4I1RA 4LBEB 3UC0L 1XF2A 4P4KD 2HTKC 2GBAA 3QJHB 3K74B 2X70A 4LEEA 4XNUL 4CKVX 4LSRL 1EUUA 4KPHH 4LOUC 3UAJD 1Z6JT 3VWKB 5JW4N 4JAMB 3HE7C 3S3PA 3E80A 1FFOA 2CH8A 3MBED 5H8DA 4AM0Q 3O41A 2E8YA 4FXKC 4KK5C 6PCYA 1L9RA 4HKXA 4J39A 2WMPB 3PQYB 2A6IB 2EXTA 3MQIA 1NA8A 3MLXL 3JYCA 1ZMYA 3S35X 3HFML 2NXZB 2P8MA 3LS5L 4N8VB 1YAZA 1NCBH 3RDTC 3S5LG 4ZK8A 4N2MA 2MEJB 5D7JA 4NCC1 1VFBA 4F37K 5JUEL 1ZJAA 4P2QE 3S3BB 2WSDA 1PZUB 1JI1A 2AK1H 4EI0A 4CL7A 2F1EA 3L5HA 4UTAL 4F7EA 2CG9X 4P3CH 5ANMA 3L81A 5K93A 1SM3L 5IJKC 1ZWIA 1SJHB 5AW8B 4FFWD 2AQQA 3L4XA 2F8XC 2P42B 4Z7VF 5IHUL 2VAAB 2Y07L 2Q3AA 4MCMA 4OU3A 5D7EA 3GSRB 3RGVC 2ZSVA 4G6AC 3QUYC 1KGIA 5CKGA 5AW3B 4HPOH 2E7MA 3GUFA 4G83A 2AEIT 2DTSA 5C0DA 1UM6H 3MFGB 4P3DB 4FL4C 2PN5A 5D7JC 2WP3O 3NTCL 4TULH 4OV5B 4KWUA 4NXSA 3WTUA 4FYSA 5BZDB 3LN9A 4TSCL 2YEZA 4Y4HC 2VLRA 5C09D 5AVWB 4U6YA 3SE9H 5JORA 4FA8A 3WU1A 4PUBL 2AAAA 1UD8A 3ZL4L 3QUMA 5CJXC 5HHQA 5FHBH 2PPEA 3OB0K 1GTNA 3MX0B 3WJJA 4RAHA 1JZ7A 1MELA 4MNQB 1SY6L 3V52L 2UZXA 3IDIB 3RFRA 4GO9A 1HJBC 1RZ8A 3MODL 4F2MB 1JGUH 3NSJA 4GAAA 1H5BB 2B5IB 3ULAB 3P9WB 4W9LC 4ZD3H 5DUBB 4OV5A 3M8OL 4N5ED 5IQOA 4TUJB 5FWQA 4ONOA 4XB3A 2VQTA 1ZXQA 4LRNL 3ZDWA 4JLRA 4ZOEA 4ZPVB 4JR9L 5I6NA 1QNZL 4JO4L 3WEMA 1IILE 3GJFB 5ALCL 1QVOB 4R2GB 5CZKA 5HDBB 5F7HA 2E7BA 1M9WA 2GITA 4RLDA 2VXSL 4YDNA 4ZMYA 3HG1B 4IMLA 3O2DA 3HNVH 3J2PA 2C4FT 4HJGA 2EEAA 5CSZB 1EERB 1G1YA 4DOHE 2EXYD 5LB1A 5GSVB 1IGJA 4GO6B 3V0EA 3QEUA 2FRGP 1LJMA 5DWPA 3QULB 4ONGH 4UB0L 1KXQE 4NP9A 2VUKA 5DK0A 4WLCA 2ENSA 2TSBA 3WJLA 4TVPE 4GKNA 4NQQA 1F4AA 4PJDE 2R8SH 3HG1A 3IFNH 1MCNA 1S8DA 4PGDA 3LXUX 3RPIB 3EGXA 4F8TA 3C6LA 3OR6B 3I75A 3TN0D 5HHOE 1XGRA 4EIBA 3VG9B 3EHBC 1TLMA 1GVIA 3ROOB 4PY8J 1U8JB 3ARBD 3BUDA 2F8IA 2K7PA 1U8QB 1EZSA 3GXTA 2KDGA 4IU3A 5T1LD 1B9KA 1P2CA 3DETC 3O3BB 3MSPA 1LO5B 2ZXGA 4PJCA 1AXTH 3KNBB 3ZDYE 4N0CC 2WXLA 3WMQA 4DO4A 4P48A 5IMKB 3V0VA 2DWTA 2VXTL 4Z95L 3FUDA 5FECA 1HL4A 5DZJA 1WLHA 2XY1A 1F11B 3HG4A 1QSEE 4G6FD 3C09B 4TN9A 4KGJA 5J9PB 1RP8A 3LN5B 3QWQB 5DVKA 4Z7OE 1OK8A 4L4TD 3DOSB 5DJ6B 3BT2L 3MOAL 4JHBA 2BSEA 5I18L 2SEBA 4NZ8A 5IVXF 4GSUA 4DW2L 2ORBL 2YD5A 1D5ZA 4HGWB 3O6FC 4ODUB 3TC9A 2YJLA 4BZYA 1RZJL 4AXWB 5MENA 4NLAA 1FL6A 3FHQA 5DMYA 1F8TH 5KBNC 3U9UB 1N12A 1JIBA 4ENEC 5FLVA 3QJRB 4HJJH 3RI5K 2O6PA 7CGTA 3O9WC 3D3VE 3ZHFA 4MWFB 4FP8L 1A4CA 4KKCD 5TTRA 5HDLA 4JFOA 1ZWIB 5CUSH 1ZV9A 3OPZH 4B9PA 3PXHA 4YHML 5JHDB 3ZMEA 1JZ2A 2V2WA 3ZE1F 4LSDA 4NJ9L 4Z3JA 1TR7A 3IFNL 4XMZA 4ZX3A 4S0SD 4MQXD 1R17A 3MJ9L 3T4AA 5HYIA 2WLZA 4OCMC 1DEEA 2ZUSA 3RU8H 4BSVA 4K9EC 4LEBA 2YOCA 2LLNA 2IWEA 4MKMA 2D03L 2VUYA 3KS0H 5F7WC 1WPCA 4FABL 1DVXA 3EDEA 1M3IA 1T1YB 3NQKA 1U8HB 2VDMB 1T89A 1UCBH 3EF7A 1A7PL 4PRPE 2VLRB 2FX8H 3NIDB 5DHYB 2F7OA 3VFWB 1MXGA 1L9QA 1R3LA 1IBBA 4OF0A 2O5NA 8CGTA 4YHPA 2XTJB 3PP3K 1YEHH 3GKWH 4WHYG 5DHDA 1QKZL 5DO8A 2E9JA 2JKIS 5AVRB 1L6ZA 2IH3B 3VD5A 2WNKA 3VXRE 1DN2A 1KIRA 4U1HB 1RIVH 1V7NH 3P40A 4P59L 5HPMB 1Q0YH 3QDJE 4GW1A 4UDUB 4B9CA 5B38A 2FWOB 3OXSB 1BZ7A 1CD9B 1NINA 3QJVB 2V5YA 5C92A 4AQEA 3TZVB 4PH8A 2N3JA 2RGSA 2FX8L 1SMOA 3PUCA 3CBRA 1U36A 1K2DB 1X5GA 4HCIA 2B59A 4NSKB 5TE4H 3V52H 4LCWA 4EKXA 2CQVA 4X7DC 1G0XA 4HJ0C 1HILB 1OAQL 1TVDA 4NO5B 4PJXB 4ZMXA 1YYML 3LPPA 1FSKC 3OMIB 1PZAA 3CDGA 1S3RA 2YRPA 4WY7H 2AXJA 4N28A 4G42A 1E5UI 3GSQB 4H20H 1EEYA 2BOLA 1NEZG 5HHVL 5I8OH 3EO9L 1EZVX 5LLIC 3SN6N 4AIZB 2PW2A 2R29A 2Y69B 2QTVA 4AGQA 1JI2A 1Q1JL 4CMHC 3KPOB 1OARH 1ETZB 4DVRH 2F53D 3KLKA 5E23A 2ZUUA 1DFBH 3LQMA 1ZLEA 2GJ6B 1EK3A 3IRPX 1TVHB 3TN0C 4AV5A 3CN4A 3PXJA 1UYWL 2MH4A 1KY7A 1ZKAA 5CLTA 1ZLVK 5IQ7L 3NSYA 3ILQD 2YAEA 3T04D 3X17A 3ZDYF 2YFOA 1SHSA 1MLCB 3GM0A 2FE0A 3QFDA 4XNBA 3RUGB 3MGAA 3MNVA 3HI6L 2X4RB 4PJBB 1TDQA 5C0AD 1MXDA 4XP6H 5KVFH 3WEXA 1MY5A 5HTSA 3SDAB 3EYQD 1OAXH 1KACB 4XI5D 4B0MM 3UYOD 1ZLUK 1XR9B 1XSKA 3M88A 4GUPB 1JWUB 5LNDA 3HS0C 4QKXB 2PTTA 4UV7L 4XCEB 4GUQA 1MOEA 1DBML 1O6TA 1WZ1L 4P2OD 3SPGA 1LVEA 2FO8A 2BP8B 3NT0A 3FSWA 2X42A 5I1DA 4J2XA 5TE6L 4LSQL 1K4CA 3NZSA 4WTZA 2OYMA 3RUGA 4I3SH 5CR8A 4A2MA 2BZ7A 1FH5H 2PYEA 3TF7C 2FX7H 4ZW3A 2FX9H 4PBXA 4TNGA 4JQVA 5MENE 4V1DB 4OVUA 2N1KA 4L3EA 3AABA 2X6BA 5ANHA 4LCUB 4DPCX 1LO2L 3TIDA 4Y8AA 4A67A 4V1DD 1A6ZB 1JG9A 1EGJL 4GUPA 2VR5A 3A6CH 2CO2A 4MD0A 3FOMB 5DD6B 3DWTA 3KYNB 1NDMA 1A22B 2C3HA 4FQIL 4G6JL 4JDTH 4KMLB 5C7ZA 3WLWD 4D9RD 3UBFA 2VDPH 2R0LH 2YPKA 1KXQA 4FFYL 5CGTA 3X1BA 3QBTB 1MWAH 1Z9NA 2NYKA 5DDHB 4R5VA 1PEWA 4M00A 3NPZB 4ZFFB 1BFOA 5DCCA 2O93L 3NIFF 3RDJA 5GS0C 1AY1H 3TLRA 3UTZA 3L4CA 2HVKB 4IRJC 4ADIA 3I84A 4MD0B 3V9FA 4MS8D 4AYGA 1NIAA 4U6VL 4BKLB 4Z5RA 4HIXH 2PWHA 5ISZA 1D9KA 3VYOA 1UGKA 3KVQA 4E41D 2WUCL 5HHOA 4HOMA 4BGDA 1T0MA 1Q94B 4ALAC 1M05A 4OLYH 2AITA 2WLIB 2OMZA 5AVTB 3L3KA 4R8WH 1I8IA 1U8OB 4DKFH 1WQVT 4YQXL 3CH1A 3ROLB 1BVLA 1KIRB 3CSYB 4I5BB 5K1JA 1COBA 4AYDC 4L3AA 4GG6A 1OZTG 3CZJA 4AT6B 1GOHA 1KPUB 1AQDB 2YC1A 4A7VA 3WE6B 3FMGH 4IJ3B 1T0MB 5L4IA 1DJSA 2WQVA 1M1SA 4NT6B 5DUPH 5HD8D 5KSVB 3S8FB 3VYNA 2B59B 4NSKA 3DRTA 3BYTA 2RH0A 1TKWA 4F7KA 4CGTA 1MREL 5I24A 5KWYC 4HJTA 4FNUA 5DJZB 5E2UL 3AZUA 1WS7A 2DEXX 4OLEA 4O9HL 3T6WA 3BPCA 2WIIB 3KD4A 4KKBD 5BOZG 3GXNA 3O6LL 3O9WA 1RLBA 5KTEH 5KSBB 4K94L 4W81A 3RFZA 3WNMA 1MVUA 5D8JL 3L3IB 4ZW8A 3QPQC 2FNWA 4JRYE 4XPFL 4ODSL 5FOBA 5FCSH 4FLHA 2H32B 5F9OL 1WBXA 4JHUA 2DQDH 2ZPKH 3JSSA 2XA8L 2BOBA 1UOWA 4B96A 1PAZA 2HT4C 4Z0BH 1MCOL 3HUJB 3HRZB 1MKFA 5F1NA 4ZUSA 4MAUL 5J1AB 2CO1A 4ZW7A 4KMTL 1BD2B 4LPTA 2ESVD 3HE6B 3TBSB 2A6JB 3ARED 3LIZL 3UJTL 1FFQA 4P2QB 5EU7E 1E28A 3HR5B 1MCSA 3VGGA 3F00A 5E4IA 5FA4A 5CN2A 3T5WA 1TMCB 4CN6A 5JHAA 1LEIB 2HT2D 1MLCA 3HB3B 3C2AH 3QQ3A 4WO4A 1MIML 5D2NA 4GEIA 1E27A 1NAKL 3DX2A 3RVUD 5DVPA 2DJMA 1T03H 1P7BA 1RPKA 4I48B 2XX1A 4IK6A 4ZUSB 2P48B 2OMVB 4HKBB 3WG7B 4FXLA 1M42A 2LU7A 1QLRA 2WWKT 1KULA 2WLJA 2E74C 1FVCA 1MJ8H 3FCBA 5GQBA 4ACTA 1XR9A 4P2QA 4JFHE 4E9QA 3QRFM 1NC2B 4TVSa 5C0IB 5EBWB 5T1MB 4DP4X 1SHXA 2E6PA 4FNQA 4GI9A 4FYRA 2ZQKA 4YMPA 1YY9D 4A2GA 4N26A 2YD4A 1CK0L 2ODIA 1NCAH 2M2DA 2P7TB 2WSKA 1XGYL 1HFUA 1S5HA 1HH9A 1MCBA 5BRZA 2N7SA 1LLAA 3SYOA 4FADA 1GZQB 3IE9A 5I19H 4JFQB 3ZY7A 1NPJA 5EBWA 5DD6A 5T1MA 3ULVL 2FO4B 4YR6B 4WU7A 3HAEH 4XBGB 1S7UA 1IBDA 2C9QA 3U0WH 1KYOK 3CX5K 1UADC 2CO3A 3L3JB 4H88H 3FRUB 4MA1C 2KL6A 4GMTH 3SE4A 4IBZA 5CFHA 1J8SA 2FEEL 2VDOL 4ODXB 5DO2C 2Y5QA 3FTXA 3WN5A 5ADPL 4XOCA 1DJXA 3PWJB 3NEOA 5KZCB 1TQUA 2OR8A 3DURB 4X4KA 2DQGL 3TJEH 2YD0A 3D6GA 3GRGA 4GFTB 4Q6IB 1RIVL 1V7NL 3S35L 1EO8H 4FAAB 1RPUA 1RCYA 2A9MH 2PW1A 4F24A 1GCFA 3QXVA 1AGDB 4X6FA 3MOQA 1D9KB 2X2IA 5E1AB 5LNGA 2L8AA 4CVZB 4XNQB 4WAFA 5I2IA 4JFXA 5I0YA 4YSRA 5ETUA 1E7VA 3ARGA 3ZRCC 4N2HA 1Q1PA 2WQUA 3HPLA 4DESA 4PRBB 5JW4M 4TSAL 1D5IL 3EOAA 4YK4C 3KWWB 4OCYL 4FA6A 5IK3B 4PBWD 2NSQA 3MV7A 4F8QA 1AQMA 1Y18B 2X89A 5D6DC 3EYOB 3UO8B 4KZDL 4Q9QH 4NM8L 4LSUH 1MFDH 1YNKL 3ZU8A 3ULSA 2G75A 3PQYE 3HJEA 2HB0A 1ZLVH 4HLZH 2W1NA 1Z3GL 5DS2A 1NH6A 4LLWA 4QRSA 4F8NA 4EMZA 4G2AA 2AQ3A 4Y5VC 4HS6B 4LEXH 4A63A 3GB7A 3IFOA 3KDMA 4GRLA 1RJLB 3N50A 3VU2A 3K8KA 5JIIA 3RWIB 1JL8A 1I3RB 1JPEA 2NW3B 2ZT9C 5B1BB 5HDQL 4KDTC 2O5ZH 4LSVL 1E7UA 4X6CF 5K69A 4MXVE 1A1NB 4L3CB 1GZPA 1DBJH 5DD0L 2NLJA 2L7QA 2UY6B 1BOGB 4HHWA 5HJ3B 5KAQG 2A1WH 5KYXB 3KYKH 5D7JB 5AYQA 1KUMA 2BNRE 4ES8A 4R26L 3G6AA 2NX5B 1ZTXH 4M5YH 3QB7C 3WTXA 4YWGH 1IBYA 4TYUA 4B7IA 4L29A 4ODVH 4PCTA 4Q14A 4Q6YA 2X5PA 1AACA 2RACA 1DBBL 1DQTA 3ERXA 4FFZL 2K4WA 3EYSH 4H1LA 4TNFA 4AYSA 2E9BA 1XVSA 1NCNA 2ED9A 5DYFA 1G9NL 2Z31D 4OB5L 1AZCA 4MA8L 1DSWA 4ZMWA 3EH1A 2EH7L 1E9PA 3QP3A 4OBSA 1M71B 2EACA 2DBJA 2YAPA 4HH8A 4U7KA 1LQBC 3GXFA 2H6OA 3OHXC 4J3OC 5J6HB 2R7EB 4FQCH 2VSCA 2ZJSL 1RK7A 3QGVA 4R90H 1T7VA 3GC3A 2WO3B 4PJ5A 3FFCE 4K7FB 1BJ1J 5EF1A 3MUHL 2DI8A 4AE1A 4Y8DC 5CILH 4FXKB 2B3RA 1A0QH 4JFFE 3REWB 5DD1H 3LSOB 3IDIA 2HP4A 5J57B 3P3UA 3EF4A 3MLRH 2E27L 5F1IA 2CDEB 4RAUA 5D4IA 2QADD 5IBTL 1SXAA 3SDCB 4H8VA 1C12A 3V6FB 5JNYA 3HMXL 1HYSC 5FK9B 2AFNA 4PTUB 3ZYZA 5I73B 4Q9RL 2QJDA 3L13A 1MF2H 4PWEA 1B6DA 3OC5A 1T7YA 3GJFA 1OSZB 4TNWK 3RIFF 4LOFA 3EJYD 2CMRH 2H6PA 4LLDB 4GQQA 5GS1B 1UENA 2WXHA 1PAMA 2BHYA 3LAFA 5K9OB 3QCTH 4HJGB 4K8RC 4IOSA 1R6VA 4XBEH 3ZMNA 1O9ZA 1DVFD 2CNYA 5EWIL 4OSUH 4WEBH 1AI1L 4PJEB 1AS7A 5I1KL 1BP3B 4NRYB 4Y9BA 4MXWH 1OM3H 3FT4B 1FZJB 1JZIA 2G4GA 3FSOA 2UZYB 3MLVH 4HEPA 4P8QA 1GS7A 1WFJA 4G9FA 3S35H 4F27A 4HUVB 5AOMA 3TGXA 3HC2A 1IIKA 4GRWH 2CO7A 5AB1A 2E3VA 3VXNA 2WAHA 3HC4H 3K5RA 4G5ZL 4RQQB 4RH4A 2XWRA 3ZL4H 2XVGA 3T6ZA 1N9PA 2PYEE 4LDCA 3QO0A 4N85A 5HGHB 5L2KA 1ETJA 2J8UE 4P2OB 3TBTA 2I69A 2XNAA 2GUYA 2BVOB 5HYJA 2JJVA 5AOJA 2NRDA 4HUVA 3QHTC 2GJ6E 3SKOB 4HUKB 3OAUL 4HLZG 1G5AA 1F4HA 3CVHA 2CK0L 4HS6A 5IHUH 1RPQA 4QHLB 2DW5A 4LQFH 4Z3FA 2OMYA 4LNRB 3K6DA 2GG1A 4QCIB 4TTDC 5K59E 1KEMH 4H0LC 2O5YL 4FKEA 4LPWA 1IU1A 4I8DA 4D94A 4XBPA 2A4EA 3U2IA 1YEJL 3WUWG 3FSAA 3DJSA 2B0SL 3ARYA 4W9HC 1MFBL 2K9FB 4RMRA 4E2OA 1PKQB 1TQCB 4QY8A 1TENA 1MFCL 2E9IA 3CFEB 3VJ6A 4PB9H 2DD8L 1UWXH 3FXIC 3UYPA 3ZL2A 4I1NB 2R4RH 1MHEB 1R3HB 5D1ZB 3WTYA 4JFOB 3OTTA 4OZFB 2F5AL 1D5BB 3G08A 3O3AA 3NABH 4JKLA 5BPPA 3DIVA 1ZGLA 1F02I 1W6LA 4RESB 2QTEA 4XNUH 3M17B 4TVPD 1YEJH 1BYOA 3GSUB 2BVTA 5HXMA 1FNFA 3ELQA 3LDBB 3FU9A 2YN3A 3NCYP 5L6YH 4K71B 1BD2E 4YZWA 1CMOA 1LE9A 2DQDL 1T80A 3P4NA 3I3BA 3QXAA 4F8LA 4ISVA 1KXHA 2J1WA 4G8FB 2NZ9D 5F9WB 4WFGE 3N41F 4MB4A 2NY1B 5FUCE 3PF2A 1FNLA 4DGVL 1N5AB 1WWBX 2A2QT 4UAOC 3PWPB 4UIMB 5F7EL 1UASA 4G5AA 4XMLL 4XODA 4ANKA 4ZFOA 3TEYA 4NO3A 2X2HA 4XCFL 3WXVL 2DQFA 2WBJC 4WSKA 5CEYA 2V4LA 2KLSA 5AVZB 3PFUA 3D09A 4DOHB 4P3DA 1IM3B 5H35A 4MNQD 3OJVC 3MBEA 1YO4A 4XNAA 1SRDA 2VLKA 3SDCA 3BWAA 3B2VL 4RISL 4UDUA 2FUQA 3ME0B 4A7TA 4BCXA 2FB4H 4AQEB 4D0BB 4OY9A 4ZFOB 3SBWC 3L08A 2DH3A 4XHJC 5D9SA 1O9WA 3L3GA 4WU5A 3X3FL 2DQFB 2YUVA 3QFJA 4GYBA 4JO8A 4PV9B 4GAGL 2B2XL 1X5KA 4APXA 1J9RA 3PHOA 3A67L 4KRMB 3WTTA 5JA8B 2J56A 2DYPA 5EU6A 2KYIA 2K9UA 1MPAH 3DMMC 5TPWH 5DJAB 2EYTA 1YEKH 4OZGF 2H2PD 1I1AA 5C09E 3RL1B 4FLQA 3CDGB 4FQLL 4YUEL 1GPOL 5SV3A 4V33A 4X9BA 1WWAX 1T4KB 1IFHH 5HY9B 2QV4A 4LGRB 1K8DA 5D1QC 4F1ZA 1HEZA 2RQ8A 2PR9A 2BO0A 4RRPM 2Y4SA 4GAFB 1ZA3B 4ELKA 5DUMH 3MNMA 4UTAA 3PHOB 4GFXA 3SGEI 3DTUB 2BS9A 2P45B 1GMIA 4WEUD 2BXZA 4WNJA 5J06A 3HKFA 4PJ7E 2MQ3A 1MI5B 3C87A 1NL0H 4JQVC 5EG6C 5FKPA 5H94A 2EUZA 1A7QH 1YMMB 3CFIC 1XXDC 1Y6KR 3B6SB 3F58L 2VN6A 1SLUA 2X7LB 3LTVA 4CMMB 3LKQA 1ULVA 1QQDA 2AJYL 1C5DB 5FA3B 1PS3A 4I0PC 1CIUA 3BN9D 2VR9A 3AS3A 5TQ0L 3U6RA 1JWSB 4FCAA 4Q56A 3TJHC 1YMHB 1NFKA 4KZ0A 3MRDB 4XGZA 3WJJC 4QRRD 5HDOA 1T5XA 1KGJA 1N5YH 5LWYH 2P49B 3QDGB 4MQ7A 1SXCA 3T0AA 1ID2A 1ASOA 1U8IA 4PEEA 2HAZA 3RB5A 2XBDA 5E6IC 4IU2A 2E4TA 1XGUB 2WPGA 1OAUL 1OAYH 2BH0A 2W5PA 1IBZA 3V0JA 3HI5L 3VAEA 5BV7L 1UD5A 2B9AA 3BT0A 3GXMA 1E4XL