1D7DA

Cytochrome domain of cellobiose dehydrogenase, hp3 fragment, ph 7.5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
186
structure length
186
Chain Sequence
ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new scaffold for binding haem in the cytochrome domain of the extracellular flavocytochrome cellobiose dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CELLOBIOSE DEHYDROGENASE
total genus 38
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 1999-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1d7dA00
1D7BA 1D7CA 1D7DA 1PL3A 4QI3A
chains in the Genus database with same CATH superfamily
4QD2E 4XMPL 1P7QB 3ULVE 1MCKA 4HS3B 4HUMB 2EDFA 1A3LL 5TK2A 3ZDWA 1CF1A 3GQFA 1BXVA 1HDMB 4E0RB 4FFZH 4L9LC 2BFVL 4EPSA 1OAXH 3N40F 4RFEA 1S9VA 4LPCA 1T5KA 3BQUC 4RDBA 2J44A 3FAWA 4F2MB 4U1IB 4MD4B 1CICC 5DHMC 3UJJH 5T1DH 3WN5C 2BVYA 1GYUA 1LMIA 2DI8A 3FTGB 1B3JA 5J4MA 1RUKH 2BXYA 1Z66A 4ABVA 4PJGB 2C9RA 4PG9A 5C7XH 1OP9A 5DRZA 3DPBB 1DFBL 2C4FT 1PYWA 4OM0L 4G1MA 3RNQA 4D0BB 2E9GA 3DGGB 4ZMPA 4QXTB 5I5IA 1NL0H 5ALCL 4FMFA 5TK4A 1H8LA 3C6EA 5K9KB 2XLLA 5BNXD 1CFMA 4G9DA 5FLVA 4PY8I 4MJ6B 5CEZH 3P30H 5KYXA 4NPKA 2JVUA 4PS4L 4RNRA 4TSAH 2UZPA 4MDIB 4B41A 4NENB 1WWCA 2P43B 2VDLB 3IFNH 4PCTA 4ZMVA 4ABUA 1U95A 3DXAD 3D18A 2WP3T 1U3YA 1E3FA 1A3ZA 4PCKA 4Z6AT 4RAVB 1AGBA 3SO5A 1BX2B 1G7IA 5E00B 2KZBA 3U9PL 4F8LA 2EDOA 1V3KA 4RA3A 3U1SH 3SKMB 1VFMA 4TL5A 4KJQD 2W0FA 3WS6A 4I0PC 5IZ7A 4QHKI 1IVLA 3KLQA 3HS0C 3MYZA 4WV1C 2G30A 3SDCC 3QUZB 3Q1SH 1H3WM 3TASA 2ATPA 3CFQA 4ZK8A 2ZAHA 1TKWB 2GCYA 2VW4A 5C86A 5E6ID 1AXIB 5MP6L 3Q5OA 4S10A 5L4IA 4Z7IA 4DESA 1SBSL 4TVPH 4G5ZH 2UZYB 1YNLH 2BIPA 1V10A 4HKJA 2NY2B 4FRWA 4ZFOB 3C8KA 3NJNA 5E8EB 7CGTA 4HWBL 2YQGA 3BGMB 3FB8A 2LFEA 4TMPA 4NQQA 1XAKA 3CZNA 3SN6N 4W9JC 3EZ8A 3S36H 4CN6A 1Q0EA 3AUWB 5HHNA 4PREB 3BSZL 1G9MC 1TJXA 4WLCA 4L0ZA 1RK0B 2VDRL 3ILEA 3EF7A 3V95A 1N18A 2BLFA 3SJVD 3K6SA 4GJTB 5E00A 2A77L 2H4EA 2QT6A 5JXAL 3OVUB 4HCRA 4FYTA 2B1HH 3QORD 4OFIA 3ZO9A 1MAMH 3U83A 4IKLA 1WTGT 4GRMA 2X4RA 4HIHB 1S9YA 2ICEA 4JO3L 1NC2D 4W9DC 3QIUD 3ZU8A 1O9VA 3BP4B 3H9YA 4NNXA 3NIFE 1UA6L 4U0QB 3JVFC 3FB5A 3QULB 5D2NC 2ZP9A 3BEWB 4F7TA 3AT0A 3QQ3B 1EPFA 3RL2B 3VRIB 4LHUD 3UJJL 5CCKL 1LDPL 4D2NA 4R7NB 2DMCA 3NRFA 4JFZH 5BUPA 1KGIA 2JB6A 3LSOB 5IESH 1A7QL 3KLKA 5KUKA 5DLML 1IU1A 3MA9L 5E1IA 3ZMRA 3QJVB 4N2HA 1QHQA 3FT2A 4W9HC 5HYJA 5B21A 2A74A 1JZFA 2BP0A 4APXB 4ELMA 1MH5B 3A6BH 4LF3B 2APWA 4OZFG 1MCDA 3OLIA 3NFNA 4NJAH 3TVMD 1NOLA 3NSJA 1RIUH 2WGXA 4BCZA 5CFHA 5IW6A 5B3NA 1NMBH 4QTHA 1D5ZA 4BQCA 2A6IA 1MIMH 1UXSB 4DO5A 4OCMC 4XBGB 3VWKA 1QKZL 1HHGA 1KC5L 4U3SB 3SJVA 4POZC 5DMIL 2RD0A 1SF3A 2WQUA 4MS8C 3ZDXE 5TDOA 1C12A 1XMWA 3IDGA 3L5JA 1PVHA 3GNMH 4AT6A 2E4TA 4WKZA 2GSIA 1URIA 3QCUL 4RMTA 2J8OA 7FABL 2VDNL 4JJOA 1T2XA 3ZKND 4CVUA 3WNMA 1JP5A 3GKZA 4XMLL 4KX8A 3GTTA 4MXWL 4KK5C 1EZLA 1BW8A 2O5ZH 1PKQA 3MA9H 4FLOA 2VR9A 4JVWA 3JTSA 4KAQL 4KQ3H 4M7LH 4AQ8A 4IK7A 3QJTB 2AJUL 4BZ2L 3E6HB 4FNQA 4X8JB 4H88L 4X80L 3IWUA 7PCYA 2D7QA 4JAMA 4MBRA 2QSVA 3MPCA 4JMXA 1F58H 3DUHA 2A83B 4YOKA 1HZKA 4J1UB 3QQNA 3CMOH 5LDSA 3MO1B 2MMXA 2JKXA 4CGUB 1R3HA 3QG6B 3IFPB 4F7PB 5BOPA 4X5LA 4BFOA 1ZLEA 3EDKA 1OAZH 2X1OA 4DEWA 2E3VA 1TO5A 2FDBP 3BWZA 3QWQB 5GJTL 3TFBA 5CEYA 3NTCH 2FQFA 3O6FC 3RVXC 2DWYA 4P5KB 3BAEL 2EUVA 1RMFL 1EMTH 1O75A 3GXUB 4ERSH 4QRFA 5FIEA 1OAJA 3GZPA 2C7FA 4XZUA 3WN5B 5JIQA 4PJDF 3RUGE 3RWIA 2P24A 4M4RA 4UNVA 1E8WA 2X3BA 2HVKA 3BW9A 4W68A 3ROLB 2P8MA 2Y1AA 1P4IL 2FO8A 1VZGA 3VJ6B 4PY7A 5D96C 3EOBB 2OTPA 1MCBA 5DUPH 3DA0A 5L2KA 2IQ9H 5F70A 3FTUA 4HWZA 4KO6A 4ONOA 4BHUI 3TNNB 1CLZL 4J3OH 4FFYL 4Z77A 4QOKD 5K59E 4HGMA 5KN5A 3RUGB 1LO0L 5E1AA 4NM4L 4F9PA 3K5RA 4I0KA 4KTEL 1P4UA 2J1KA 5FYLL 1BF2A 4JM4H 4BFJA 4ZPVB 1HE8A 2C3GA 4LLYA 4PIRF 1UYWH 5A2KH 2CPCA 2YXFA 5EULV 1LGVA 1MEXH 2K6ZA 3A4AA 3RWCA 1A9BA 2G9KA 3VFPB 4PJEE 9PCYA 2LR4A 1KGXA 4LPWA 4NQXB 1HESA 1QVOA 4MHHG 4Z3FA 1X44A 3QG7L 2BSTB 3R18A 3U46A 3ZZLA 4L1TA 3MAWA 4X7DC 1WGVA 4M5YH 5HGDB 3PWUB 3CN2A 3L1OL 2WNXA 4HWNA 4HBCH 2W38A 4XX5A 1MG3C 2YD1A 3VYOA 5CZRA 3OQ3B 5GHWL 4E5XB 4OZHE 1L9QA 2Q86A 4GXVL 4NFBA 1WSST 1AGFB 5LAXB 4G7YL 5IK3B 1GXEA 2YGVA 5EU7C 3HNTH 3LB6D 4H8WL 5DUML 1DVQA 4OLUL 4PWEA 2IMNA 3K6OA 4FXTA 4GH7B 3RTQD 2VDKH 1NCTA 2DWDB 3C8DA 1T5WB 4H2AA 5DQDH 3DVGA 3II2A 4D8OA 4GUOA 3ZPDA 1HHIA 4R7DB 4YQXH 1JXKA 1V7NL 5E5MA 4M3HA 4U0RB 1WYJA 3RWFA 3BUYB 5IHBA 4O58L 4I9WD 4JFEE 1CR9H 3VGHA 5FK9B 5IJCC 1N64H 3LRMA 3ZHFA 1G7PA 4DK6A 1GKOA 3NSFA 1ZCRA 1E4KC 1IV8A 2JF1A 4P2OB 4YGVB 4BXVA 3NJFA 1PZDA 5CGTA 5FGCB 7PAZA 5JDSA 4CKQA 3G6JA 4HJ1A 5ABDE 2X2UA 1U92B 5EBLB 3HI1B 2VL5A 3W57A 1LLAA 2C3VA 2VR7A 3WMPA 1FHGA 4QWWD 5B7MA 2UXFA 5AW6B 2G5BB 4RDQF 1Z5LB 4HJEA 4L5FL 4YDVB 1OTTD 4EBQL 3DTDA 3M17B 4L23A 1YMMA 4JZJB 4PR5A 4KFZC 2DYPB 5J13C 2V5TA 1J1PH 1DBML 1Q1JL 2X87A 4ZS6C 1JERA 2TSAA 4AYSA 1X5AA 2YARA 3DPBA 3SDDC 3KPOB 4XXDB 3K6SB 1CFBA 2B20A 3WV0A 3M46A 3P11L 2HLFC 2JNZA 2XI9A 4JRXD 2KERA 4ODSH 1X6LA 4WRLA 5ITBL 1I8IA 4N5ED 4N0UA 4Z9KB 4WJG3 3MJ9A 1YA5A 2Z6FA 4IRZL 3TV8A 3L48A 1C9SA 4NO3A 4KNQA 2XVLA 3F7QA 5F96L 3TURA 3RAJH 1SXCA 4EIGB 1VFBA 2CH8A 4Y1TA 5C07D 3HUJA 2E4FA 2GITB 4HH9B 4ZOCA 4YHKL 3DYPA 1SEBA 5I6MA 1KXHA 3I9GH 2FYYB 2M1KA 4FQXD 5L4MA 1J9SA 3IDNB 4YDJA 4L4VE 5IBTL 4AJYV 3S4SG 5HYSB 1BZQK 1B90A 1S2EA 1C7TA 1MHHA 4NCDA 3SPIA 3U4KA 4UCFA 2IG2H 4I3SH 2EE3A 2KLSA 3WIAA 1A3RL 3AT9A 1NLDL 3HHSB 3FKUS 5LKNA 2PW2A 4KZCA 3D52A 1BFVL 1ZWIB 2PWGA 2LU5A 5ESAB 3IMWA 4CN1A 2F15A 4N0CC 1KJ2B 1TZIB 2WLMA 3VD5A 4KXCA 5AW2B 3ZTCC 4GI6A 3MBED 1ID2A 5E8NB 4ORZC 1KACB 3HC4H 5JIKA 2NXYD 1VKXA 4ZPVA 2DWEA 4MMZC 4JPVH 3NJGA 4B9GA 1GZQA 2XA3A 3BP7A 3IXAA 3T77A 4MXVF 4NXSA 4XCCL 4Z0XA 3GJFB 3VWKC 3L3IB 3QIBA 2UYLB 3GJFK 2EDHA 2XV3A 2WBWB 2Y9RT 3BAKA 1OARL 2QHLA 4RMWA 3CWGA 4X2UA 1NL0L 4FNLH 1KCRL 3V5DB 2W80C 5CBAA 1GOGA 1NEZA 2V2WB 1FFOA 5C07A 1F0LA 4BUQA 2HMID 3O3EA 4IS6B 2VLJB 2YBRB 2WC7A 4JDEA 3MO1A 3D3VE 1QVOB 3O41A 4PJ5B 2Z0BA 1G1KA 4HYTB 5D6CA 3MCLL 1LEGB 4NNYB 4LLUA 1KCLA 4PWFA 2Z31B 3IAPA 4P05A 3MODH 3F7YB 3RZCD 1F3DH 5C3TA 3L5HA 3FFCB 5D7LD 1KIQB 5FOBA 2IAND 3ZIYA 4RMQA 2ESVD 4P3CH 3VO0A 3HC2A 4PJGE 3NA4A 4MXWH 5EH1A 1E2VA 4NGHH 3HMWL 3NBNA 4WTZG 3V4VB 5DUBA 3D51A 5K9JL 3DUSB 2J2ZA 3TJHD 2B1AL 4S1DD 2OXGA 4XH2A 3OKOA 1NDMA 1BZDA 1KY6A 1XR9B 2F54A 3CG8A 4LCUB 3GXMA 4MAYD 4MCMA 4RMBA 5JYLA 2PYEE 5IVXB 4O2FB 2YQBA 3ARSA 2IPUG 1YMME 1EGJA 3SY0A 1T1XB 2AV1A 2CDFA 5TDPB 1P7KB 3V4UH 1M6UA 3K6NA 4I9WE 5KAQG 5CP7A 4FQ1L 3UP1A 4AWJC 4QXGL 2WP3O 1YG9A 3OKMA 4AT6B 1CR9L 5IMLB 3MMEA 3GRGA 3TZVA 5I18H 2QADB 1Y18B 1WWWX 1DQLL 4ONHB 1CUOA 4N2CA 4TQHA 5F7NC 4F9PC 4XVTL 1DQQA 3M1BA 1JSYA 5JPMB 3MV01 4G6KL 4ZX3A 3R06A 1G7PB 1UUSA 1E5BA 5DRNA 4E9VA 4PRHB 2XZAH 2F58H 4K3DH 4GW5B 4WWKC 3UZEC 3AXHA 1MHCB 3VFOB 3F2LA 4DFHA 4JFFE 4OF7A 6TAAA 2C9PA 2ZOUA 4PTTB 3FMGL 2ZXDA 1F56A 1X4XA 1C5BH 4L05A 5F7YC 4WTQA 4DK5A 2K70A 4WEUD 4NERA 4QO1A 4FULA 2OZ4H 2YLHA 4I9XA 3HRZB 4ENEC 2A9MH 4FJ6A 3L9BA 1FC1A 1AZRA 2ADJB 5GSVA 2VQ1B 4LQFH 2Y6SC 3O9WD 2XY1A 3WCYA 3RY4A 1T20A 1WJ3A 4AJ0A 3FSOA 5I1GH 5DVLA 5MI0C 1IM3D 2X10A 3FB7A 2HUHA 1FNGA 3MV7A 3T2LA 1B9KA 1QFUL 2CMRH 2PCPB 1YEFL 4NZJA 5I1GL 4DP9X 4CJ0A 2XBZA 3WIFB 1JV2B 1OTUD 1PZBA 3MBXL 5MEPB 2E6PA 4BK5C 1KEGH 2P28B 4HKJB 1S9YB 2ICEB 3SYCA 2VERN 3QZPA 3UBHA 4KK6C 4AM0Q 3BVXA 2OTWB 1RPQA 2P5WB 3N04A 3I3BA 1WA0X 4OJEH 3DIFA 4TVPL 2ZCKL 1T1YA 4OZHB 3IKKA 4BE6A 3QUZA 5BQ7A 1TPXB 3DSNB 3LKOA 1BLIA 1A4BA 1CVSC 1HWGB 3TBWB 1UASA 1CFNA 2VAAA 2X6VA 3MLRL 3MJWA 2MNWA 1JYVA 1QLEH 4TL4A 2CK0H 5IQLA 5CHNA 2GFBB 3VFMA 5L7XL 5DO2D 3TBYA 3QEUA 5C0AA 4LIQE 5D2LB 4AG4L 1Z6JT 4ZMXA 3GKWL 4PBVC 4DGVH 4GXFA 3PV7A 1B4JL 3BUBA 5LN4A 4BZYA 5F6IC 4EI6A 4ZYKB 2AITA 1MI5E 3C09C 2KZKA 4Y2NA 3CX5K 4DT2A 2WWNA 2YGPA 3NP3A 2DJ4A 2AKRA 3F7RA 3PP3H 4WY7L 4FQXB 4U2ZA 3DBSA 4JG5A 3VD3A 4OGXH 3H9SE 1K6QL 2FZ3B 3L2NA 5DEGA 3LKQA 4QRPD 3A4FA 5HYQB 3EHBD 4G42A 3H42L 4F7MA 4ELKA 1LO2L 4HK0B 2R0KH 1UACL 5AUMA 1B0GA 1MVYA 3FCTA 3KXFD 2NUTA 3UC0L 1XX9C 3NZ8A 5AQ0A 4ZTEA 1J9CT 1SOQA 4H8WH 3I3DA 5GGRY 3EO9L 5I82A 5MEND 2FD6H 1JXJA 1NCBL 4XE5B 3RTQA 4WFHD 3BOVA 1X5LA 32C2A 4YX2L 3HLAA 2KDGA 2XNAA 1TJIL 4ZOEA 3UTPD 2JELH 3FU9A 3X3FH 3IDMB 2A83A 1A47A 1OGAA 2QDVA 1KZYA 4OLYL 5EWIL 3QPXH 4M48H 1K5NB 5HJBA 3S98A 2EDBA 1BMGA 4MLSA 4GG8A 4ZUSA 1JGUH 1E7UA 5DS8B 4FKKA 1X9LA 5AB1A 5C09D 4W9IC 3INUH 1AKJB 2W0KA 3QO1B 4QRQA 2YD2A 4FG4A 4G43B 4JY5H 1J5OL 3B5HA 3N44B 1E5YA 3FXIC 1FH5L 4MNQE 4JFFD 4Z7OF 2PETA 2XSKA 5T3XE 3FRPG 4PP1D 2LT9A 3M1OA 4JY5L 3I85A 5EF0A 1J5OH 3QDGA 4UQ2A 1JPFB 3MLUL 4UILH 3QZNA 4GAYA 5DR5L 3L4UA 3JWDC 1TQVA 3QC5X 4G72B 2AK1L 2ARWA 3LS5H 2VISB 4PPTA 1T1XA 3AG1B 1Q0YL 1NC4A 4Y7MA 2J57A 3WGVB 2K4AA 4WI8A 1HI6B 4F58H 2C1PB 4A2MA 1P7QA 1FGVH 4XPAL 1X5GA 2Z7ZA 3F64A 1J5HA 4TN9A 5D7IA 1D5IH 1MW2A 3DNKA 1JVLA 2R1XB 4HOMA 1AS7A 3HS8A 4YHNB 3ZDYE 4FG2A 5EU4B 4QHNA 5I1CH 3MV7E 1NCBH 2YOAA 5D7SL 2PW1A 2W60B 3NJLA 3C6LC 1F4XL 2I60H 4LNRB 2JB5L 1ZLWK 5MENE 3KYAA 5I1HL 3FU7B 5FKAA 1O6SB 2FWOA 1EXUB 4URKA 5C6WH 3L7EA 1FNEB 1IGFL 3HBGA 2UWEF 2BNRE 4DUXA 3P0VL 3O45A 3SGKC 1DBBL 5D2LF 1KCUL 3CK0L 3IJ9A 4M93B 1G6RL 1QZ1A 2ENQA 5CSZA 4R7XA 4OZIE 1I8MB 3H42H 4LLUB 4Y4FC 4DN4L 4RRPG 5E9DB 1IFHH 3O3UN 2Y36H 3V4VA 4LSTL 1E4XL 2GG1A 4BH8B 1CLOH 5B39B 2XWBA 3WKPA 1W0VA 4WU5B 2IAMA 4KVNH 5DURB 4FNRA 3TO4A 5IJKA 1UM4H 5FFLA 2JSFA 2FAUA 5JMRA 4Y19D 1W8NA 4PGCB 5DZLA 5KBMA 1SJHB 4GG6B 2OR7A 3STLA 2X1QA 1HQRB 1X7QB 1K4DB 2ZXQA 1KJVA 3TA3B 4IJ3B 3DC0A 4JE4B 3O3DA 1MPAH 4G6AD 5GRWA 1BFTA 2CR0A 3RVTD 1IGTB 3EJYD 2V6HA 4F8OA 1FLRH 3KBEA 1MFVA 2HH0H 3TT1L 3TT1H 4B9YA 3OKKB 2KUTA 4TSCH 4PRIE 1GW6A 2DQHH 1A1OA 1IT9H 4PRDB 3QUMA 3SPJA 2HVJA 2I9TB 4HIEA 2HT2C 3Q48A 3BIAX 4NPYB 5D1ZD 5IF0A 2CLVB 3D34A 2TRYA 4K94H 3OZLA 4A7SA 1FYTD 4NHUA 4HIXL 4Q8BA 4XNQB 5C8JB 1N8ZB 4G2AA 5IHLB 2XA8L 2IBZY 1CLOL 3BZEB 1JGLH 2X4UB 3RLSA 5L2KE 4X7EC 2AMUA 3DJSA 4MZRA 4ZUVB 1TMCB 2CLVA 2VYRE 2ZWKA 1U8PB 2AAVA 5LBSL 1T3FA 4L9LA 5B3SB 1RZ7H 5A2CA 1KY7A 2OMTA 2QVKA 5HD8C 1T0PB 1A6ZB 1DQDH 4ES8A 3SSGA 3KYOB 3VH8B 2AKRB 1GA2A 4JN1H 1RJYB 1CVRA 5DJ0B 5EN3A 5SWZA 1CDYA 4IOIB 4YSEA 2P9RA 3GZQA 1IZKA 1OAZL 3ZT5A 4BWUA 5DZJA 1M2VB 1S9KC 3W37A 2PUQT 2H47C 3PABB 1FE8H 3NAAL 3TJEL 5FHAH 3HE7A 4QLWA 1WAAE 3H7BA 4MYPA 1AR1B 2YUZA 2XIBA 4Y4HA 2JIXB 3S5ZA 3BKJH 3FB7B 3QB7C 3EDJA 3QJHA 2PKDA 1N5AB 3B2MA 3CC5A 4EDWH 2KH2B 3EBGA 4UINL 4UIMA 4NQDD 4CKVX 1DQMH 2XWBB 5H37H 4IBZA 4XMVA 5JXAH 3OJDA 4G6KH 5ANHA 4URTB 1IVTA 4FQHA 2DBLL 4ZUWA 1N3NA 4UB0H 3MXVH 4MRBA 3QZWB 1L5GB 2O5ZL 2IWKA 2XY2A 3V6BR 5ANMA 3PHSA 3L2MA 4QY8A 2R9HC 4PGBA 1A3LH 1J8HD 3T6XA 4M1GH 1JYXA 2Z31C 4NZ8A 1T5XA 2A4EA 3CFEA 4MQTB 2EUXA 4U05A 2YAQA 3KLDA 1XGYH 3SOBL 1W8OA 4HPYL 3CH8A 2YD9A 3SPGA 2LE9A 4NZFA 3TX4A 2Q76A 1L9OA 3BD3A 4LVNC 1L5GA 1NDTA 1LMKA 1LTXA 1VIWA 2ITCA 3PL6D 4NFDA 3QIUC 4PGEA 3ARUA 4PMEA 2VC2B 1IBZA 4M56A 4ALAC 1EJ8A 2CD0A 2JK5A 1XF2B 1KN4H 4K3JH 4N22A 1JV5A 1AJ7H 3BKYL 2WIMA 4N26A 5IOKA 1F45A 1O5DT 2XXCB 2ZUSA 3WAKA 4TNWK 3ARBA 1N12A 4GRWF 3NCBB 3UIZA 4FTVB 5MERA 1UD8A 4KROC 1KT2A 1QI4A 4R26H 4XC3L 5E2JA 1AYRA 2KL6A 3GT6A 1U8MB 2DQIH 1PS3A 3U1PA 1WAAF 4HAFA 1RFDL 4FFWD 1KCBA 1OAYL 1GIGH 1U3JA 2BHUA 2VQUA 3AJ7A 3N40P 5DUPL 2ZP8A 4KRLB 3L4VA 4LDEB 5E03A 1P4IH 2A74B 2YSSA 3MODL 3TVMC 4FTVA 5MERB 3ZVVA 5A3ID 4NCC1 4H0HB 4GSDH 4GUPB 3FH8A 2GY7B 3U6XA 2ZSVA 5FC9A 2ENJA 4P2QE 1CL7L 1RCYA 3RX8A 2AEWA 4HZLB 5JR1H 1YNKL 5KS9A 4POZD 5F3FA 3JWNE 3NK3A 1UYWL 5D55A 3MTRA 3HZKA 5GIRB 1CLYL 5D71H 1IL1A 3FT3B 4AYGA 3MRQA 1MAJA 5AZEL 4NZUH 4BELD 2YFNA 3APFA 3QDHA 4OF0A 5HHOE 3T04D 4AH2A 1KENH 4E9TA 3DVGB 1RZ7L 3SBWC 4N6QA 4NSKA 2BJML 1SMOA 3FU3A 1CDHA 5ACZA 1W15A 3QC6X 3TPUB 4PD4J 2OYPA 3DDFA 3PYCA 4G8IA 4BRVA 3HG3A 3O4LA 1HCYA 3CMOL 2EEXA 2N1KA 2APFA 1HXYA 5FAAA 4X4XA 4ABQA 4OQTL 1P4LA 1N6UA 4HGKC 1I9JH 5GZNC 2OBGA 4FZEH 2ICES 4H0LC 1WUZA 3D0AA 2K4WA 2XTJD 2YEQA 5BZDB 4Q74A 3W2DH 3QI9D 4JCMA 3SODB 4PB9H 1IC0A 2GK0A 1NLDH 2NQCA 1P2CA 4ZAKB 1N8ZA 1UCTA 3STZA 4F3FB 1OF2A 4XXWA 2B0SH 2DWEB 3FQTA 3WFEH 4YBLC 4ZSOB 3TONA 1YUKB 4EOWL 1E4WH 1NAKL 4MAYA 2I7SA 1UWFA 4OIFA 1PBYA 4EI6B 1Q8MA 3FSZA 1A25A 5J6GA 5B38A 1FJ1A 2DQMA 4DVBB 1UA3A 1E6JH 2VH5H 2YK1H 3VRLE 3ZSTA 1DLHB 2GVYA 3O3AB 4PYHA 3ZBMA 5ISZE 3UTTD 4Z7VB 5HJDA 4G7QB 2XKNA 4ZFGL 1F8TL 4HK3N 1OGTA 4Z3GA 2AS5M 1EDQA 1ZGLB 2VITA 2XZZA 3OV6A 5DK0A 4CADA 4XVUD 3TIEB 5JW5B 5FA3A 5LGJB 2EC9U 4U1MB 3AITA 2XVKA 5TFSH 1MF2H 3V8CA 1F4YH 5JW3H 2EIDA 4RNRB 3H8NA 3QJRB 2VSKB 4LHUB 1RZPA 1FBIL 5I1JL 5HHOB 3NCYS 2CHWA 2VN7A 3MREA 5BJTB 1DBMH 1LL1A 1Q1JH 2J5LB 3MZTA 4IU2A 4A7VA 4NQVB 2WIIB 5D1QB 2CKBA 2ZOWA 1JZHA 5CD5C 3OGOE 5AD0A 4BA0A 1LE5B 1YCSA 4BE5A 1E90A 1XCQA 2RIKA 2ZCHH 4JFFB 5AVYB 1AZNA 3L1FA 4MJ2A 3RVWC 5IJKC 2CA4A 5C0CE 1NEUA 5DWPA 3VQ2C 5KYUB 5DO8A 1MCFA 1SUHA 2AGJH 1XGTA 2CZNA 2VM9A 4LBEA 4E42B 1T0MB 2WNGA 2MHAA 3EIFA 1XFPA 2EDKA 1KELH 2NNCA 4Z7UE 1URLA 5H4YA 2FK9A 4N2EA 5I9QB 1W91A 2XN1A 4XCFH 4WHCA 3LB6C 3PIQB 4WAFA 1KIUA 2GJ6D 2DZEA 2J1XA 1RUPH 2AERT 1NWPA 1J12A 1G7HB 4MNGB 4AEIH 3DX7A 1TLMA 3GDBA 5DWUL 1BM3H 4HUNB 3SO3B 5IEHB 1EX0A 2Q1EA 2B16A 1NCUA 4G9FA 2ZZUT 5LCVL 5LWYH 3P9LB 1BAFL 5F6HJ 4M29A 3LXUX 4ZO8A 1KCWA 2WANA 3LEXB 3ZTNH 4LCCA 4KTDH 3G3LA 3BGFB 2HRGA 1CDCA 2HX7A 1KCSH 1S7WA 3QRGL 4H8WC 1Z9OA 1EAPA 2OR9L 1ZSDB 5EFIB 1SMAA 1YMMB 4JZJA 1TJIH 4PR5B 1AFVH 1EBAA 2WXQA 4F5CE 4I2XB 4Y7OC 2DEYX 5EIQA 3UYRL 4ISVB 3DHMA 1UWEH 5GGQL 2WLLB 1D7FA 4HMCA 1F3DJ 3ZL4H 2WMPA 1FAKT 2PO6B 1IKFH 1CD8A 3DYOA 1GKEA 4GLRH 4EKJA 4MMYB 3HI1A 1M71A 3DO7B 1UWGH 1BGXL 5FX3A 5LQBL 4Y1AE 4R3SB 4MVBD 3KYNA 2VLKD 3EYUL 4Y4HC 1GC1L 4Q9CA 3RPIA 4GP4B 1NCWH 4WFGD 3D08A 3DTXB 4G59C 2O5YL 2RB8A 4WFHE 1IM9A 3QO1A 2EDXA 4ZS6D 3SE4A 5E6RB 1IGYA 1IAII 2JLPA 3MRJB 4V2CB 4P5MB 3SDDD 3ARFB 3OD3A 5LCVA 2DLGA 2E75C 3CSYB 3PREA 3S4SB 5GRJL 3L9RA 1WAPA 3KXFE 5BUGA 4BBWA 4UOJA 1NCGA 1HE7A 3C60D 1T1YB 3F00A 4OZHA 4YPGA 1UOVA 3LKQB 3HG1B 4HEPG 3IDMA 4OBRA 4PGBB 4RAHA 3D3VA 2K7QA 3EGDA 4YSUA 2CUHA 5EZIH 3OR7A 1Q38A 3QUYB 4JPIB 4XPAH 3QDJD 1NTDA 4YSOA 1E30A 4NHCL 5E70A 1OE1A 2ZXGA 4P23B 4Z7UF 1IAMA 1WT5A 4XBPB 4O02B 5I30H 1CZ8H 5ETUA 3RVUD 3DO4A 1OP4A 1NCWL 4HHWA 5I6XB 1HOEA 3H9HB 2EADA 3LPGA 3O81A 4UM8A 1NPJA 5CZVL 3QUML 1JF6A 4AQ1A 1W0YT 1JE6A 1KG0B 3DX0A 4PJ9A 3AG2B 2OCJA 4AOFA 1A9EA 5H35A 2W95A 3PCYA 1RPKA 3WNIA 3WXWL 3U2SB 5IVZB 1SHMA 3C2AH 4MDRA 4N2KA 3WFBH 4HC1L 1T22A 3EH2A 2G2RB 1QFPA 2CKBH 4P9ML 5I1DB 4ZG1A 1D6VL 2IWFA 3MR9A 4XPFL 3W11C 2NY2C 3WLBA 2B9AA 5EORH 3HG4A 5F0LB 4J3VA 3MNDA 4DTGH 3ZYJA 2GKIA 3DVNA 5GGSA 2FX9L 2A73B 2Z1KA 3WYRA 3O8XD 5FV1L 3MBEC 3TYFA 5IP4A 2NY5H 1HHJB 4H8UA 2NXYC 4KDWA 5CJ5A 1R3LA 4TNVF 3LKSA 3MRLB 1SOKA 1YDPB 2FHBA 2EDNA 4K8RD 3KHOA 2D03H 3VMOA 3ZK0A 2Z93B 3NABL 3LEVL 4R26L 3LYRA 4TSBL 4O2CB 3BPOB 2VWEC 3HBQA 3MCKB 3NSYA 4MJ4A 2I69A 3FT4A 5I8EA 4MB5A 3UYPA 7FABH 3SYAA 2O61B 1M7UA 1RULH 3VI4B 4LMQE 1KXTB 1OIOA 1PFOA 3I9PA 4HULB 3VRLF 5F88B 5TDPA 2OA9A 1S9WB 2ZOKA 2E9BA 3ZUNC 4F7EA 5I1KL 4LLDA 1KTCA 2XPGB 1WIUA 4FNTA 4XXCC 5EZLA 1K3ZA 2C4FU 5FA4B 4FQCH 4JMNA 5EBWB 5LNDA 5D7LE 1FQ9C 3HNVL 2J5WA 2X2HA 2ZPKH 3L4WA 1QBLL 4NLAA 1A02N 1SXSA 4DWHA 4ODTH 3MGAA 2EYSB 2XVBA 3KWWA 2EDJA 2QQNH 1MCOH 2R4SL 2DYSB 4NN7C 2GIMA 2DQEL 4KI5E 4OCWL 4MA8H 1DL7H 5IQ7L 4JFED 4ZTPH 2AJ3B 3LVEA 4ZTPL 1R47A 3I6GA 43C9A 2CO6B 3AUVA 4JFDA 2F1BA 1T7WA 2X09A 4X4YA 5IEHA 3B5TA 4JDZB 4JRXA 5AD0B 4LVOC 2EEBA 2ZXBA 2N0MA 3T0BA 4YBQD 1II4E 3P73A 4PJGF 5CLTA 5ILTL 5CSZB 3FFCD 4XXWC 5LLIC 5D1QD 1N4XL 5GQBA 4S1DC 4KNSA 1CFVH 3MRNB 4WJ5B 3TFKC 1MCRA 4DHLA 1DSFL 2AEIT 2FJFB 4MAYC 4J5VA 2FT8A 4IRSA 4PW3A 3S3BB 3V5HB 3KBHE 3QIBC 4UTCA 3PLYA 2CGRL 5IQNA 1Y0LB 3EOTH 2R4RH 2BNQB 3M7FB 2FATL 3R06B 1FO0H 2B77A 1NBZA 1AHMA 1T89C 4ZMOA 4JPWL 5HGAA 4YHOH 1GGIH 4WFEE 4WDIA 3MUGB 3ZRCC 1LE5A 3IRPX 1DLHA 5LXGH 4XPTH 3KPRE 1YYMH 2XG4B 3V5KB 2JB6B 1DZ0A 4N4YB 4X6CA 5HJ3A 3NSCA 4JM2A 4YHZH 2X4QA 3JXAA 1DBJH 1NFIB 4PJCB 3ZDZB 3CN4A 4HHGA 1K2DA 2VNCA 4ADGA 1T0NB 1AFVL 4TLUA 2EDTA 3OJMB 3V8OA 3V9CA 4PJFB 2NPLX 4MXVE 2PXYA 1QQDB 2AK4E 2GJPA 2H6UA 4Y8DC 2A6KB 2DWSA 2R23B 3I75B 1CFTB 5HHVL 4ADJA 3EFFB 1G7JB 4ILDA 4LCWD 3H9SA 2WK2A 1X3DA 3MRKB 3MA7B 4FI7A 2OYLA 1R1CA 3GMRA 4Y1AD 1X5MA 1XGTB 4R4NC 1U93B 3ZGHA 1CLZH 4F57L 4X5XB 3AU1A 4RA0C 4TRPH 3JUYA 4WW2A 4XMKL 3KMDA 3TIDA 4NQCD 1MHHB 2PPAA 4FMVA 2C5DC 1M7XA 4ENED 1QTYT 1KJ3L 2AJVH 2GUOB 4EI5A 5JHDB 1D6EA 3BAJA 3RZCB 2N1TE 4I18A 2Z8WC 1OE3A 2F8OA 2DMGA 4M7KL 5EZOH 1Z3GH 1YEFH 2VUKA 4Z0XB 3FO2B 5DQ9B 4MQXD 5EN2A 4XAWH 1WFJA 1Z9PA 2NW2A 3QPKA 4ANXA 5EF1A 1WFMA 1ADWA 1I3GH 5LUMA 3BQVA 3QHFH 1HHHA 2ED7A 3L1EA 2VIRA 4HKBA 1J87A 2XBDA 1K3IA 4L4TB 5J0BA 1JWSA 4ADIA 2CJUL 2XXMB 1UZGA 4GBXD 4MYWB 4JDTH 4JLRB 1ID5I 2V3FA 5CIPH 3LRGA 2HFTA 5CGYC 2ZUTA 2NY0B 2JJSC 3DV4B 1JPTH 3FCSB 3WJLC 1G0YR 1T21A 1IGFH 1U4FA 2KLRA 2ZUXA 3EUUA 4LSSL 3N9GL 4AENB 4DVBA 1HOCA 1A6TB 1C5DB 2P5WD 1MI5B 2GTZA 3BX7C 2KQNA 5HYSA 1DLFL 1A7RH 2XRAH 4NWTL 2P5WE 1OSEA 4JGNA 2X42A 3L5WB 4A1RA 3BQUA 2ADIB 3OXSA 2LAGB 4EQ3A 4P23C 2B4CL 3HUJB 3WN5A 5B4MD 2AJYL 3ZE0E 1ITBB 1ODUA 5I0ZA 1VACA 3BAIA 5D1XC 3II1A 4Q9RH 3CFBB 3SCMD 3X17A 3ULUC 1JUFB 2DPKA 2YMOA 1AG6A 5SWSE 3IEAA 2XTJB 4J27A 3U0WL 5BZDA 1BX2A 3D06A 3SKJL 2OMUB 5EOCJ 1GTNA 5D7IE 1E65A 3K72B 3VXRE 4YDJB 5LXVA 4BFGA 2H3NA 3VE0A 5C0GA 4A2DA 3O6LL 5FK9A 1FL5B 3DSFH 5CZXD 5HYSG 2BP8A 4DP6X 4KVPA 4M7JH 1KGUA 1SNRA 3ARFD 4UOW1 5HHMD 4C83B 4NDMB 5CR1A 4YDKH 3AMLA 1ZE3C 3PHAA 3SPVB 5LBGA 1SYSA 3BFWA 3OAYH 3MRPB 4KUCF 1JHLL 1AIFB 1JGVL 3CDZB 1DVZA 5F3HA 1MVUA 1PQZA 2AV7B 5ENWA 3CFTA 1XGPA 2FH6A 2PF6A 2IH1A 4NZDA 1C5CL 2FO1A 3M7OA 2I24N 4OLVH 4UDTB 4FEIA 5DRZB 2XCMC 2YA2A 3BISA 3JT2A 4G11A 1KFAL 4WHTA 5E94B 3OR6B 2Z4QA 4XNXH 4D9RE 5KSUA 3V52L 1F97A 4PJ9C 1JZJA 1U21A 3EYVB 4K23H 4OZHF 4AL8H 3LPPA 1HNGA 3NDZE 5AAPA 4JCLA 4NZUL 3U6RB 3ARBD 2KMWA 2NTSP 2Y22A 3TTYA 4EUPG 4MAUH 1KEGL 2Y5TB 1FL5A 2P7TA 3U4EA 1CE1L 3VDAA 1HH9B 1NQBA 2Z7YA 1VEPA 4DZBA 3QYCA 1BAGA 4HS3A 4XMUA 5JOFB 1KLFA 1I7RA 4WCYL 3AS3A 4Y5YA 3UJIH 1F4AA 2Z93A 4WEMB 2FRGP 3T3PB 4GOSA 2LU4A 2APVA 4EAEA 4OFYD 4QNPF 3NP4A 1IB5A 5TD4A 5EUKA 1KPUB 1E6JL 2UX6A 1HHJA 1GGCL 3I50L 3NPZB 5F9JB 2JKNA 2MPVA 1MREH 3NYKA 5CP7B 4W81A 1BYNA 3EJCA 4BDVA 4OLZH 1EZUA 1GJWA 1BFVH 1K8DA 3MBWA 4IQHA 2HN7B 1K4CA 2HG5A 3PNWA 3W0WB 4K7PX 4UQBA 1U2CA 4ZQKA 1V27A 4DGVL 2I5YH 5KS9E 3IPEA 4LRIC 4Z3JA 3NSXA 3O11A 3POCA 4OZ4A 1A6WH 4OIAA 1EEYB 1FZMA 4X9FA 2RMNA 2J7LA 3MRIA 1J8RA 3NH7H 4L4VD 5B22A 4YFEA 4LCUA 2N01B 3QIUB 2DY2A 1YLBB 5LCVH 1N19A 3PNRB 1KJVB 2OPCA 4IBWA 1P5VA 4LCYA 3FQUA 4QT5A 4YDMA 2LLNA 2VB5A 1DQKA 1AGEA 1J5CA 5K93A 2Q86B 1UM4L 3EJUA 4Z7OE 5F1NA 4EI0A 1ACXA 2X4OB 2KC0A 1N6VA 4HDIB 5J12C 5IMMB 5MEQB 1I85C 1M7IA 1KN2L 4HIPA 4GBXB 2EXSA 3Q5TA 5BMFH 3WIHL 1L0YA 4AEFA 2CWRA 1GJIA 3LN4B 4QCIB 5KBNC 1XB6A 2ZPKL 4H8PA 3VFSA 4JHVA 2J12B 3A67H 1AHWB 4PJAF 4FQCL 1TEFA 4MJIB 2HTKD 4MA7H 3T65B 1GOFA 4N6RB 3RVTC 4FQJL 4I18B 2IALB 1N64L 4X4ME 4FQQB 4AQAB 3KPLB 5IV2B 4IRSC 4Y4FB 4YSQA 4PRIB 5LO7A 1M7DA 1BD2B 5JXEC 1FYTA 1OZTG 1YEEL 5D1ZI 3VM7A 4QHPA 4QHNB 2R2CA 4JKNA 5LGKA 1OAQH 1PZUB 2N59A 4I85A 1W72B 4Y16C 1I4FB 1NKOA 4Z18A 3AVEA 4JFOA 3K4DA 4JFPA 1RIVH 1AKJD 3VH8G 3RKDD 2IXQB 5AOKA 3GB7B 5IKCA 1NWOA 3RKPA 3O45B 5DS2A 2WJ5A 2RAMA 2I07A 3ZQWA 3RWIB 4AQEB 4HBCL 2C26A 1WGOA 2CBMA 3DMMC 4B9FA 3VGBA 1R3KB 2ARJB 4UM9D 4MCYB 4HCRH 2W07A 4LP8A 2F54B 2TAAA 4PLKC 2VDRB 4RGOL 2QQNL 4JFUA 4L48A 3RY6C 3T8VA 1E2ZA 2VXTL 5KG9B 4Y1AB 3P2DA 2JTDA 5MENB 1NAMB 2EKJA 4GAAA 2G4EA 4EI5C 2VLRD 1RHHA 1SRDA 1BQUA 3F7PC 1H3XA 4RGMC 4KK9C 4GG8B 2PWEA 4ZUSB 5FYLH 5CCJA 3QS3A 1E9OA 3IETB 5E5LA 2AQQA 3M6DA 2ED8A 4A7GF 1KWGA 2LW3A 1PDKB 1ETB1 1EANA 4GRWH 4LDLB 4UTBH 5B8CA 4D0CA 5D6CB 1A4KB 5E6UB 2R9HD 2O6PA 3NIFF 4YBLB 1PJWA 1JZGA 2YWYA 3JTSB 4ZQTA 2ITEA 5KBLA 5CO1A 1RZFH 4OQTH 2CQVA 1NFDE 1NKRA 2BP0B 3LD8B 4ABWA 5I73C 5JA8B 3WHE1 1JNJA 2HJFB 1IFHL 4R6UA 3J8F7 4HS6B 1XQ4A 3LN9A 2JJSA 1WS8A 4LVOB 4MNQB 5T3XD 1NJ9B 1ET8A 1ZV5A 2IH1B 1KSRA 2P45B 1XH3B 2BC4A 3BWAA 4I4WA 3G9VA 4QRTA 5EZJA 5F1SA 5FW7A 4JFXB 4ERSL 3TBSB 4XBGA 2WTOA 3T9WA 1J1OH 2BCKA 2B3RA 2PTVA 2ZIDA 2R0ZL 3NZHL 4Z7WA 1TJHH 2FCBA 1S9WA 2ZOKB 3EJQA 5BRZD 1RSFA 3IDXH 1VEMA 3TA3D 1ZLVH 3CVHA 3WJJC 3BI9X 3M88A 2YA1A 2OP4H 5IB1A 1G84A 1LWRA 1OSZA 4IRJA 4TUKL 3OC5A 1QR1A 2VN5A 2XN9B 2FX7L 3ERXA 4HIJB 3PL6B 2PW2B 2CUMA 4OF3A 1UZ8A 1RL1A 3MN8A 4FFWC 3Q7JA 4RSVA 3SDAC 1XBRA 2VDQL 3N50A 4A7TA 3B3BA 2W1NA 5LNGA 3U9UA 2GFBA 4WQOA 4LVHC 4OJAA 4R4FH 4GMTH 4U6TA 3JV4A 1OAUH 5DMJB 4DEPB 1SN2A 2YD4A 4YBHA 2CO7A 1PG7H 4DFIA 5T1KD 5F3BA 1F1GA 1XEUA 2WNKA 4FOMA 4HJGA 3NGBC 3W38A 4XCEA 3O2VL 4DETA 3KPMB 3QHZH 4OZIA 1CD0A 3CFKB 2V7NA 1ZS2A 4GBXA 3ZTJH 2X1PA 1LILA 4FABL 5EU6D 1M3JA 5CLZA 4FNPA 5ADPH 4JPQA 4U6XB 3K6IA 3V4LA 3OPZL 4YSTA 4DPBX 1VDGA 2AGJL 4MNHA 3VD4A 2H1PH 4UBDD 3T0EB 1WBYA 2W8CA 4GKZA 5ADOL 3FYIB 3F7VB 4LLVB 4AW4A 2OSWA 1WWBX 3NACH 4XVJH 3VX1A 2C7UA 2EEDA 3FRPA 4PRPE 3FTGA 3RILA 2ARJQ 2XTJC 4KQ3L 4M7LL 1BYOA 3WS3B 3GBNL 4RAVA 4NQXA 4CC4A 5JHAA 2V3DA 3QI9C 3REWB 2DBLH 3CVHL 4CVZB 5GS0D 4JGUA 3CDCA 2DLFL 3OKLB 3K6DA 2WXFA 2BRRH 1RPUA 1CN4A 3QSKB 1AO7B 2MCPL 1GOHA 5T3XL 1U3HC 3ARXA 2BY2A 4UUJB 3D09A 1AZCA 4K55A 1QKZH 3NJHA 4FHJA 1DQLH 4XOCA 1LO2H 1TMQA 2XN2A 4XN8A 5DJYA 1FVDA 1KFAH 2NQ3A 4LSVH 2XYBA 2KPNA 4K7PL 4B0MB 2VDML 4KXZI 1TEGA 1L0QA 5HDQL 1MCWM 2BW4A 5F9WC 2Y07H 2AK1H 3LS5L 3QHFL 4X6EA 2EINB 3LQAC 3VRJA 2D3NA 4H0GA 4NRYA 1KXVC 1TF4A 1NMAH 3TWCL 1ZT4B 1COBA 1JZ4A 3HN8A 3PGFL 1T5XB 1AR1D 3F84A 3R1GH 5MHSE 5L7XH 1LDPH 2MNJB 2ZCHL 3ZN6A 3ARBB 3LEXA 1SDAB 1TTUA 4NM4H 3GMMB 2D4FA 2OAAA 1I9IH 1JTPA 2MQCA 3C8HA 3V0VB 1T20B 3GUTA 4OCRL 3O4LE 3D12B 2JXMA 5CD5D 3RDTD 1ORSA 3HBZA 3HMXA 4M43L 4GAJH 1MI5D 4MD5A 3DX7B 4Z1PA 4AGNA 4XO4A 3F83A 4PRPD 3LKPA 2Q10A 3WO4C 5KZCB 3E38A 3WNOA 1E8ZA 3MBXH 3R7QA 3X1BA 1JPEA 1HILA 1I8KB 2NY3C 1ETA1 5EOQH 3TNMB 2VR3A 1I9RL 4MMZA 4XO9A 5I8CA 1HAUA 3IF1A 5FGBA 4HETA 2BJMH 3UBXI 4S2SA 3GRWA 4KVNL 1NFDB 2V5MA 4K3GA 3R19A 1Z0MA 3T4YA 1KCRH 3TN0A 1LNUB 3JYCA 1TTFA 5IJBC 1XWVA 4KH9A 2IH8A 4MA3B 5GJTH 4U1JB 1QW8A 5SV4A 1H8SA 2ZXCA 1S5HB 3RGVC 1UXMA 1HINL 1X7SA 2K7PA 2QV4A 4K5PA 2OMVB 5FUCE 1MWAA 4R7LA 2EYTA 1UXWA 3FCUB 3ZLQC 1J1XL 4IBQA 2IH3A 2QVTA 3GLDA 1EJ6A 3QQ4A 2O5XH 4IGBB 5C0DB 2HRLA 3CCHB 2CIKB 3EH4B 5AZ2H 5K69A 4PJ5A 12E8H 1ZJBA 4BZ2H 1A7PL 5SV3A 3QXUA 2CBTA 4EIZC 1IQWH 3DBXA 5FDWA 2X6CA 3LEYH 2HJLA 3LEYL 3Q44A 3VMNA 5F7DA 3HI6L 5K9OB 2VLKE 5D93B 3RGVB 1QUNA 1ZLUK 3SQOH 2BZ7A 3OL2A 1CB4A 1MFUA 2BSSA 3FCGA 5D7JC 5CJXA 1IM9D 1SMDA 4HUUB 1NBYA 5L9DH 4OU3A 2WW8A 3D25B 5BRZB 4NN5C 4DKFH 1HINH 1K8IA 3WKYA 5DJXA 4ANUA 2WLKA 1L9TA 4HWUA 4C57C 1IMHC 2J1YA 1PMYA 1WA2X 4FLHA 4P2AA 3UG3A 1KBGL 3IJEB 1I3RA 5FF6A 5T1KA 2AXGB 1DBAH 3CHRA 4ZMWA 2J8UA 1I9EA 1HL5A 2X88A 2C3WA 2QPSA 3LN4A 2NY4B 2PPCA 3HPJA 3QDJA 4R2GB 3PAYA 3WSQH 5F72S 5C0BA 4R96A 4L1SA 1R9FA 3VTTA 3QRLA 1ZHNB 5JPNB 2DMBA 2WXPA 4QUOA 5L0QC 1OEZW 1JRHL 2AXFB 2WCSA 5DJ8A 3V4PL 3ZX1A 3SD2A 1L0PA 2X9WA 3L13A 4LCCC 4ZXBB 2CDGA 3DDGA 2BVQA 4QRAA 1TU2A 4H1LG 4AMWA 1NOAA 1Z1WA 3W39B 1WH0A 3UZEA 4FTDA 4F9LC 4UV7L 4X50A 3LZQA 5CSGA 1UT9A 4OZFB 2YD6A 2E8ZA 4N20A 3JSSA 1DSFH 3P3SA 1RUAH 1H3UA 3EYFA 3GPSA 2VOTA 2GHWB 4ZFFB 1FZMB 1PD1A 1NBVH 5CAYB 3HR6A 4JO4H 4UU9A 1YEIL 4PHZA 4XCFL 4NRZB 3BD5A 4H20L 3PXHA 1I53A 5LHDA 1PZ5B 5E08L 1N0XL 1PG7X 1KC5H 2CIIB 3MOBH 1BP3B 1E6OH 3QUKB 1QNZL 4B97A 2IANB 3DRQA 3MJ8B 4X9HA 2AI0H 2YXVA 1ZAGA 2H6OA 1ET7A 1KPUA 2VC2L 4BKSC 1ZOXA 3RYMA 3WFHA 3C5SB 1QLRB 4J4PD 3TO2B 2R1WB 2EDMA 3GI8L 5CMAB 1HWHB 4KO5A 5ALBH 2H9GA 4R5XA 1ES0A 3EH5B 3OZ9L 1FNAA 4F8PA 4J39A 1ZY9A 2HJKA 3F5WB 4KJYB 3OB0K 2ICWJ 2DQDL 3KPPB 2X4TA 3SBPA 3VG0L 5ID0A 3U4EB 2CCLA 2YHGA 2AQ3A 1XIWA 3ULUH 1H0DB 2GBTA 1IE5A 4MJ6A 2YPVA 4LLMA 3X1GA 2QELA 5I8OL 1YJDL 1NBVL 1HEZA 5DJCB 2V2TB 3WKMH 3CPLB 1Q9WA 3EDEA 1F41A 4JDZA 3C09B 5BV7B 1JDAA 4AZ8A 4MNQA 1FG2B 4B9PA 1FZKA 1WC7B 2YD5A 5DRWB 2IDFA 1V3LA 1KIRB 1KYUA 4OLZL 4E5XA 2FECL 3QUKA 4GO8A 4XPGL 3CSPA 4YXLL 1Z0NA 1MNUH 1Z9LA 3FQXB 3KWWB 2I9LB 3G5ZA 1A8JH 1HCVA 5EIIG 5EDXA 1QFUH 3AXIA 1D6VH 1V7MH 1L4IA 4Z7UB 2AJXL 1BECA 4Q9QL 3Q2NA 4MMXB 3X14A 2VN4A 4PD4K 5IEKA 4NQDE 5FO8B 2O61A 3V9FA 2Y23A 5D1QC 2XA8H 3KCWA 2Q8BH 2K6YA 2X44D 1NUNB 4YHOL 2F7PA 1MZZA 2A9BA 3BKMH 4YVUA 5EOCH 3LKSB 3QUXD 4P46D 3HB3D 4K5OA 4DP1X 3QIBD 3FCTB 2IDSA 4DGIL 4KDTC 4EJ1C 1CZ8L 2DLHA 2DTML 4GMTL 3TBVB 2Y7NA 3QUXA 4DO6A 4EDXA 3MUZ1 1CIDA 2OKMA 3GBMH 3VXME 4O51A 1BXAA 4UT7L 5GRVK 1MZYA 4V1DB 3B9KC 1NIDA 4OIIL 5I9QC 3P2TA 2E74C 3ZO0A 5EU6B 3FO1B 3P3RA 3QQXA 1TVHB 2D9QB 1CTNA 2CJSA 4HQQL 3N1PC 2FWLB 3CH1B 3QNYA 4LU5L 3S8WA 2OYKA 2VZOA 2CU9A 4PGDA 4ZUVA 1WISA 4WGWB 1Y6MR 4AQ1B 4XX1G 4X98A 1UUNA 1CGTA 5DFVD 4KUZH 1E4XH 4AENA 1RLBA 1X4ZA 1B4LA 1A6PA 5C0AE 4GIOA 4IGBC 5HP5A 3RU8H 4V33A 2FLBT 5CLYA 4M5TA 1R24A 2QSCH 5CJQH 1CDGA 1QUNB 3CLFL 1M7DB 1QAWA 2IGFL 5B38B 1U8CA 5E2VH 3S37L 5GS3A 2O93L 3RAJL 2A4CA 4AK1A 1P5UB 4QOKE 3UPAA 1V55B 2XKSA 4FCHA 1J0IA 1GAFH 3FTVA 4H8HA 3VWJD 1VJSA 2AQPA 3GGWA 4LOUD 4MD4A 4H88H 4X80H 1FL3B 2DRUA 4OSUL 4ZT1A 4HJTA 5F6HI 3VFVA 1S9VB 4MQXC 4YFLF 4Z7QF 4YXKL 2HA1A 3VDCA 4QF1A 3AG4B 1MRDH 4KZ0A 3LXBA 1U2YA 1PNCA 1Z5YD 4ONGH 1JF5A 5HI5C 4RQQA 1LXMA 2GSIB 3OX8A 2P5PA 3OMZA 1DEDA 2J1WA 4APQD 4FFYA 6CGTA 2VH5L 3HKZA 1JXDA 3V4PH 2OS7A 2YKLL 4HU2A 1H19A 4K4KA 2BSSB 3LRKA 5LWYL 2CSPA 3ABMB 4PJEA 4AEHL 3KPNA 4BK8A 4LASH 3ULSB 5CGYD 3GSOB 1OHZA 4WI0B 5DMYA 3C08L 5FFOA 2CRYA 2PWHA 5TPWH 5KTEH 1P7KA 4WEEA 5E51A 1SPDA 3H53A 1WHPA 5DGQA 1B88A 4XE0A 3ULAB 1IAIM 4AIEA 2VLLB 4GW1A 1L9MA 4AVIA 2VLME 4WNQB 1D5XB 1IGCL 5ICXB 3B4NA 3QEQD 4AEEA 3UO1H 2R1YA 9CGTA 1L3WA 4WHDA 3VNYA 2SODB 3UMNA 5B4MC 3G9AB 1S5IH 3IMVA 1ECZA 1GSKA 2V9TA 3GEWB 2DQFB 4N9GA 3FB6A 3G6AB 3K0YA 3RA7L 3MV8A 2A9NL 4EN3B 3ULUD 3OLGA 2BOCA 4L29B 1MUJA 3HZMB 2YSSB 3RJQB 3B8YA 2EKSA 3SZ6A 3C9NB 2ZWNA 1AI1L 2CDFB 4WNJA 1U30A 2Z92B 4HGWB 5TQ2H 3T71A 3IF1B 4TS6A 5GS1A 2G2NA 2BHFA 1UJ3B 4RX4A 3MRNA 1JG9A 4BZ2A 4M3JA 1GSMA 4I5BB 2P44B 4J8RB 5TGBB 2SEBB 2YBGA 4KO7A 3S88H 5CZXC 2WYIA 5FYJL 4YHLL 3MGOB 5BZXA 3FAXA 4Q4IA 3KM2A 2OJZH 2VE6B 3WE1A 1RIHL 2IBGA 1YUHB 2O5YH 3IWVA 1U42A 2E7LA 1JPGB 3HZ3A 4MAZA 1OT1A 4H1LH 3FQRA 5AW5B 1T83A 1DO5A 3ATEA 4MDJB 1ONQB 2DKUA 2FBOJ 4R0LB 3IDYB 3UTZA 4RQQB 4JFDE 1BZOA 1SY6H 4AJVA 4XPTL 3T5WA 2LABA 4GUQA 1G7LA 5IHZA 1CICD 3L54A 1DVFB 2H6PB 4PWJA 3GIVA 3WFCL 1GHFH 1N2RB 1UWEL 1I3GL 1ERNA 1FFPB 5DGRA 4HFWA 1OB1B 5C2BL 4RFNC 4V2BA 2Q3XA 4X5QA 4BSWB 2GSGB 3D05A 4CNIA 4E9RA 1UFGA 1KJMB 3HFMH 3BDYH 1TJGH 3L3HA 5ERWB 5AZUA 1HX0A 4D7PA 4UT6A 3X12A 5LG6A 1CTOA 4Z7VA 2CR6A 2ADFL 1BOYA 4JO2H 1N5AA 1I9IL 4OGAC 1JWMA 3TH2T 2YGQA 4LK4A 1ZMYA 3KPRA 1H8NA 3PGDA 1AD0A 5AWNL 2X40A 2WYZA 4WEBL 4X98B 5J6GB 3UTTA 2G0KA 1EA9C 3SIKA 3VXMD 4Y2DC 4IBTA 1MFEH 1AAJA 3EDFA 1YY8B 5LGHH 5EU6A 3EKCA 1BREA 5CEZL 1NGZB 5IJVA 4L2LA 1XMEB 5GRVL 3LQZA 4HOZA 3PU7A 1WWAX 3CX2A 4J3OD 1KDJA 1J48A 2VT0A 3BVWA 1CMOA 3GWJA 4P2OC 1P69B 3SDCD 4PCSA 3WGUB 3L3OA 2I60L 1B0RB 1QSFB 1WITA 5HHMB 3EXJA 5E6IC 4ELMF 2Z64C 3BPNB 3II3A 2WWOA 1ZLDA 1I82A 2YRLA 3DARA 4G8GE 4NENA 4A67A 1AC0A 4LFHG 3VXUA 3D4ZA 5DUMH 5FO8A 3RQ3A 4ZFOA 5EIVA 4F91B 3MI6A 2BINA 2W91A 4B9ZA 2H2PC 2OM5A 3L4ZA 2VDLH 3FSAA 4NZTH 5EORL 2DEWX 3HHMA 1VENA 5GGTH 4RFOL 1MWOA 4P9MH 3T08A 2EH8L 1A1MB 4BKLA 1UXLA 2IADB 2QQKL 1TPXC 4HF5L 4BINA 5F71A 2AABL 3MLSH 5EPMA 4MA8L 1T1WB 1FH5H 1N0LB 4WEBH 3BO8B 1YEKH 1I1FB 4FTVE 5JXED 3LQAH 4W9FC 3MACH 4XMXA 1AGBB 5I1IL 4D3CH 5FB8A 4HA1A 2EDRA 2CM6A 2QZ5A 3RU8L 1NFDF 2QKIA 1BVLA 4P04A 1CQKA 2WZPA 3M17A 3QHZL 4YK4C 3NJMA 4F37K 5ISZD 4MB1A 1RZGA 4GSUA 3T3PF 1AR2A 3BH8B 4M48L 3AB0B 1TO4A 2IF7A 3JZ7A 5BCAA 2VKXA 2NCEA 2XDHA 1JGEB 3ETTA 4L8CA 1OO2A 5HYJE 4DKTA 4O4YL 1XXDC 2DQFA 3H3PH 2PW1B 2W60A 3CVIH 3EBIA 1JTTA 5FUZL 4JG0L 1Z5HA 3L7FB 4PJXA 1HS6A 3TBBA 1J1XH 1MCJA 4PLKD 1XGQA 1FUNA 1YYCA 4MA1C 3EFOB 1MW0A 5C97A 2DDQL 1UJ3A 2CKBL 4UIKL 3HNSL 3CVHB 4HUVB 1E5CA 4OGZA 2FUTA 2Q0ZX 3HE6D 4PQXA 2VXVL 4ZX4A 4DKEH 1WO2A 3ILDA 4ES9A 5BS0D 1ZDQA 3AACA 3FU5A 3THML 3NUKA 3EYFB 4KK9D 3P4MA 3UGXA 1KBGH 5C0JA 3HE6A 4KUZL 3ULVF 4X6CB 1XT5A 2VLJD 3QEQE 1YRKA 3S37X 2G9HA 3BAYA 3C6SB 3D0LA 1WCQA 3UP6A 3CN3A 4KK5D 4QHMA 2VDPB 1RH8A 5FS5A 3CXHJ 3E1ZA 3UGEA 3K8KA 4G6JH 3BSZH 3QYMA 1AKJA 3NCYP 1INEL 3ETBJ 3PE9A 4LCVA 4XC1H 5F1KC 3VGAC 2C8NA 2CDEA 1S7TA 4JRYD 3S2CA 1TQTA 3RWHA 3VFTB 5K1VA 2BDNL 2C9SA 4FFZL 2XWZA 5L2KB 1JZ6A 2PTTA 4EO5A 5DYOA 1JGVH 1G9MH 5CEXB 3MVSA 4KK8D 4PRNA 4JDEB 4QDGA 3ROLA 5HGBA 5C0CB 1A6VL 1D7BA 2A7BA 3O6FD 3GSWA 3RVXD 3FHQA 2XWJB 4UT9A 4PV9A 3BP5B 3GK8L 3V5DA 4N9GB 2UY7B 2IPKA 3EOAA 4UT6L 4JR9H 4X99B 3TA3C 4N9OB 5F1IB 3S96A 1EFQA 4OVVA 3ZE0B 4TUUA 1J0YA 5I17A 4PS3A 1YEJH 2RJMA 3BUIA 3AZUA 3SDAD 4ZOAA 1JNNL 3BE1H 3IFOB 1I8UA 2F5BH 1FJ1B 4LHJB 1Q0XH 1PX8A 2HZHA 3I9AA 3Q9PA 4NJAL 4OQTA 3RTLA 5A7BA 3VXMA 4F7EB 4L4VB 2BK8A 1G4RA 2F74B 3CBKB 2HTLD 1UA7A 3FSWA 1JFQL 4ZUTB 1DHKA 5B8CC 2VGLM 3VFUB 1EFXB 5CIPA 3RIKA 1CT8A 3NFSL 4W4OC 4FQLL 4X8JA 2I85A 4BHUA 5M7QA 1CDUA 4B9CA 5GRUH 1HL4A 2YAEA 4J6RH 2LVCA 1F6AB 3GI9H 3UFIA 5L4JA 4FQLH 5EUKB 3DV6A 1S5HA 5E4EC 5J12B 2MH4A 1EXHA 4B5EA 5C07E 2CHXA 2FYYA 4Q4EA 1YYLH 1KLFB 1S6NA 2BOLA 1PLCA 4OLWH 4Z7NF 4CC0A 3TBWA 5F9AC 1S78D 1P5VB 3BN3B 3HA0A 3D2UB 1VFAA 4F2FA 4X4XB 4JB9H 1M05A 4XP5L 4KXZH 2X89A 4YIQA 3U1QA 1H6UA 2GSGA 4AGLA 3BEVA 2CXKA 3GSUB 2EH7H 3KW7A 2A6IB 2BWQA 3PP4H 5F7EL 2COQA 4P5TB 4IRJC 5CN1A 4AW7A 4OD2A 5E0FA 4I48B 5ITFB 2LLLA 3O9WA 1J7VR 1N0XH 1UENA 3RWJA 3SDAA 5GS0C 4L1HA 4ELMB 5C0NC 1ORQA 3HC3L 1KJ3H 2AJVL 5KOMC 5KYNA 3BRFA 2JKRM 4E9QA 4GO9A 2E7DA 4JKWA 3QXDA 1MWAL 1YO4A 4NKOA 2EVHA 4HH8A 4X6CF 2NX5E 4XNMA 1QEWA 3KVQA 3CVCA 2WXHA 4X7SL 5ENWB 3DX6A 3AWFA 4U3SA 3S7GA 4M62L 2WUCL 1VHPA 3OBAA 4CN4A 1H5BC 3TF7C 4M61A 1KYOK 2QPUA 3FTSA 1D9KB 5A6MA 3QBTB 3WOVA 1I8LA 4IRZA 4WTWA 1AQDA 4BUGA 2XHNA 3U0PB 2X4RB 1XF1A 1AO7D 1CD1A 1IKOP 3BYTA 1G7MB 1TSRA 4LB8A 2XQYA 1U3HB 4LCCB 3DTXA 5DXWA 5BZWA 1GGCH 4JFEA 3OJ2C 4XOAA 1DBKL 2EAEA 4N2OA 5IMKA 2IDQA 4AYFB 5D2NB 1N59B 1MFCL 3HG1D 4FNLL 4KRNA 5FECB 1X5KA 4HKXA 3W5NA 2GBVA 2D0FA 5KVDH 3KPTA 3UZVB 5CN3A 1OTTC 4OCYH 1R5IA 1ZEAL 1ZEAH 3GLZA 4KV5F 4DKFL 1A2YA 1TEYA 2IFFL 4PAZA 4OW6A 2GTQA 2XX1A 3US1A 3O2DH 1SFHA 2D3VA 3RDTC 1RERA 2XFXA 1TVBB 3KJ4C 3ZE0F 3DETC 4CA4A 5AVZB 2VXUH 4KU1A 4N85A 5AW3B 1WG3A 1XGZA 1PG7L 1R5VA 3VTMA 3KW8A 3P0YH 4IOSD 2ATPB 1UWXH 4LU5H 1M2OA 1B2YA 2NY3D 3QZWA 4QRUA 4N5EC 4DCQA 3IMUA 4WW1A 4POYA 2HWZL 2YLKA 2IANA 1U8LA 3DRQB 4FJYA 4LL9A 4LL1A 3QDJE 1QA9A 3NEOA 2X5PA 3F7LA 1T1ZA 3S6CA 3LIZL 3JVGA 2DLEA 4PJ8D 3VXOA 2GTWA 2WWMC 2G5RA 2F53B 4KY1H 7TAAA 3V6ZA 1S7UB 3QUZC 5K1NA 5SWSD 4UTAL 4Y9EA 1CURA 1OY3B 2X3AA 1NIBA 1UEMA 3K1DA 2OMNA 4B96A 4NXKA 1NMBL 1E28B 3KYOA 1O6VA 5DVKA 2X28A 2XJKA 2AABH 3VI3E 2FYVA 2W9LA 3TOPA 4BYHA 2D7TH 5TE7H 5IIEA 2Q9OA 1IIKA 5BS0E 1BXXA 4LVHB 5FUOL 3SQBA 1DO6A 1X5FA 2CO4A 2EXWD 3FSVA 3MNWA 2PYFB 3GM8A 3X13B 4NN5B 1U8OA 3CFMA 4Y5VB 3KDPB 4N0CD 2V5RA 3MFGB 2K3HA 3AQDA 1ETZA 4HIJA 1TOXA 3RHWK 2MEJB 1GIGL 3BT0A 2P8MB 2DV6A 2ZYHA 3BPCA 3GTVA 3VXRA 3O3BB 2C1OA 4JL1A 4KH2A 1VGKA 5GGVH 3UTTE 2MPAH 1LE9A 2ADIA 5I1LA 4PSPA 3JZYA 1JNHB 5KVGL 1T0NA 1IGML 3FO0H 5BRZA 2V3EA 3FN3A 1JV2A 1YQVL 5IB2B 1A22B 1I1YB 3CZEA 4Z7OB 3OKEB 2XKNB 5C0BD 2R69L 1FORL 4GQ9L 4JFWA 3U7AA 5BVPL 5FKPA 5JPMC 2EVJA 1C08B 4NC0B 4YZFF 4KQ0A 4XCNA 4PG9B 2VXTH 3RFRA 1U8LB 3I6LD 5EEVA 5C71A 1C7SA 1MFEL 4ZO9A 4DQAA 1DDHA 3RZCC 5DD3H 2XWTA 5KYYB 4NT6A 2WB1A 5L2JB 1TDQA 4HU8A 5GPRA 1G1CA 3GSNH 3ARYA 4NM8H 3FK3A 5D7IF 1F90L 1JYWA 1P2CB 2W88A 1CF8H 5SWQA 1NCNA 1ZA3A 3T8MA 3UTOA 2VDQB 1KFGA 4NCC2 3NCXA 2WUBL 4JFYB 4MDJA 3MQIA 5HDBF 4I3SL 1NIAA 1QLEL 1QSED 1TJMA 3KH4A 4N2LA 4X6DA 3VA6A 3GSVB 5LG1A 4DJMA 3RIFF 5K9JH 4BGLA 5IBTH 1SLUA 5J1SC 2R56L 4AV5A 3GMMA 5EEXA 1XHHA 3OAUL 4YHNA 4L4TD 1G9NH 2FJGB 1AZVA 3IJYA 3QEHB 2ITFA 2V8LA 4QRRE 4B6ZA 4WFED 1A6UL 3UTSA 2XQBL 4TNWF 3NACL 4XVJL 3VSTA 6PAZA 3P3TA 4KI5F 3TM6A 2V2TA 4J8RA 3AY2A 3MRMB 1ZE3H 3QISA 2B1HL 4KQ4L 1MRFH 5AAWC 2PXYB 3CDYA 4J4PC 1YEGL 4P9HL 2H3XC 3ROOB 1ZSHA 4C59B 2F54E 1RV6X 3BFOA 4P49A 3WLWC 2OL3A 3B2VH 1LD9B 4TUKH 2OL3L 1W16A 2BVTA 3ZDYB 2PYEB 4BSVB 5HPMB 1CDJA 2Y7SA 1R5IB 3NCEB 2OULB 2VR4A 1G6RH 4TQPA 4YWGL 5J6HB 3MCKA 4QHKJ 2AFNA 4JM2C 3H2PA 4DOHE 4JM4L 3PFQA 4WWKD 3ZTNL 2Z7WA 3QZWG 4LKCB 5CJOH 3ZE2E 4Z78B 4IKNA 1OARH 2HVBA 3QDAA 3KVDD 5KVEH 2ITCB 5KUMA 3S0PA 4JRXE 1R34A 3ZGIA 1KB9J 2H0EA 5DK2A 5L9DL 4P5TA 3IRZA 1A4CA 2BXZA 1WHOA 4AEIL 1D3CA 1FLRL 2XWTB 3SPCA 4ENZA 4AIZA 3V6OA 4PY8J 3O9WC 5DJ6B 2XNAB 4UNUA 4G3YL 4O4YH 1EQWA 2YSTA 4ODWB 3WE6B 1TNMA 5B1KA 3LRSA 1QBMH 3D2TA 2XN0A 2AVGA 4Z8FH 2ED9A 2V7HB 3V0VA 2OSYA 3AABA 4L4JA 3T8XB 2NY1C 5C9KA 3T6QC 3UDWC 2KHAA 4OD1H 1TZ8A 2VUYA 4J3XA 4BFKA 3LKRA 4GSXA 5IQ9B 4AV4A 4LSVL 5HHQA 3BCFA 1GZQB 1NCJA 3BP7B 4XI5C 5FO2A 5TPWL 2Y3NA 3T77B 4OKVA 4P46C 4DKEL 1GMEA 2P52A 2QHRL 4KX7A 4X0KA 2MOQA 5GS2D 4HAGA 4GKNA 5ANMB 3ZE1F 4XP1H 2MCPH 3HS0A 3IJEA 1ZVSB 3QDMA 4RVBA 1L9PA 4LLVA 1H15A 3EJRA 5JZ7C 4TQEL 2A2QT 4TUJA 1NH6A 1TTRA 2AJYH 2K1MA 3U9WA 3HCVA 4N2GA 1W72L 4JJHA 5IBLC 4P5TD 1CFSB 4JKMA 3PWVB 3LKNB 4YNYA 4D0DB 3VI3B 1UVQA 1X9UA 3QWNA 4HHAB 4S11A 2Q6WB 3VXTB 3G6JF 5DFVC 1EDHA 1N10A 3J7HA 2V7HA 1JJUA 4KKNA 3CU1A 4TUJB 4BZ1H 4ZSOE 3CDFA 3LH9A 4IOIA 4G82A 8CGTA 3MR9B 1UM6L 4R0LC 3WL9B 1R6VA 2BVPA 1P53A 3H4FA 3PGCA 3EHBC 4IGBD 4BCXA 3P77B 43CAA 5IB3B 2OQJB 3X11A 3UPRA 3VWJA 5I15H 3MLUH 3Q5YA 4I0PB 4HXAH 4UILL 3LZFL 3ECBA 5GGUA 1IGTA 3GK8H 4EDXB 2H8PA 1K6QH 1Q94A 2VQTA 3OHXA 3CSBA 2BNRB 2ZSWB 5KANI 1Y6KR 1QLEB 4FX5A 2EYRB 4P4KC 5ERWA 4MJ5A 1LO0H 3DX9A 1AACA 2OTUB 4PGCA 2BSED 3Q2LA 2COVD 3INUL 4LSRH 4JPKL 4WHTB 5E94A 2Q20A 1UT1A 4O02A 2FT7A 5CEYB 1IX2A 3QQ9C 2R2HB 1WS7A 2Z1PA 4M7KH 1E5UI 2B39A 3T2NL 3FOLA 2VDMH 3BXNB 3PWNB 5E7BA 3SE8H 4OD3L 1A4KA 4Q6IA 4RZCB 1ND0A 4QYAA 3DOHA 1FYHB 4Z7VF 2JELL 4HVBA 5TF1L 4PUBH 3MGOA 4YDVA 3JWNG 5LAPA 1KTLB 1DYZA 1H0DA 1ED3B 2YMXH 4PTTA 5DK3A 4LPTA 1E4KA 4IKKA 1BXUA 3CTTA 2WTRB 4LOVA 2NNXA 2V5SA 5G5DA 4HOWA 3FTYA 3BDYL 5FR3A 5A6LA 1SJVA 1ES0B 1FO0A 1DJSA 1AD9A 2BY1A 3B7RL 3NIGB 3R4RA 3FN0H 1BSIA 1MUJB 1S7WB 5L0QB 4YE4L 5DHYB 2RCSL 2BX5A 1W0VB 3HKFA 3H9SD 1OK0A 3HW7A 4RFNB 4WU5A 2LV4A 4XP4L 3ARTA 5DMGC 4Z3IA 3RPIB 3F6JA 3GBNH 3EADA 2QZQA 2AZAA 4U1SA 3WIHH 4YLBA 5FCUL 5FYKE 1U9KA 1HEZB 4TTGA 3I50H 5FWQA 1BZ8A 3QUYC 1B4RA 5F96H 3QFJD 1JD7A 4ZODA 3BVDB 4JQIL 5KVMC 4FXKA 5FM8A 4FCAA 2K9FB 2DD8H 4ZFFA 5EO1B 4JEGB 5EC1A 1NFIA 3SDYH 4NUMA 1SF5A 4WW2F 1PSKH 3VRJB 1YY9C 1GYCA 1JHTB 2R4RL 3H0TB 1G0DA 2EE0A 4XRCA 4HLZG 4JR9L 4WFFE 5AAMC 1A5FH 4L8DB 3C6LD 5IW3A 5EU4A 1BDYA 3QDME 2FR4B 5KOVC 2P47B 3GNML 4HIIB 5J8OA 4FQPA 3B7YA 3BO8A 3BKYH 5F89A 4LHQB 4M7ZB 1AD9B 2X7LB 1R0AH 3EH3B 1JS4A 2FJFA 2PPEA 2EE6A 2Y7MA 2BDNH 2VM4A 4GSRA 4R84A 1BIHA 3MNZB 4Y4FD 3OZ9H 3SKNA 4Z7AA 1W6WA 2C34A 5IKCB 3VFWB 3GS7A 1CYGA 2ZKHH 3MXWH 3MBEB 1EBPA 4OCWH 5AKRA 1EHLH 4XP6H 3EO0B 3IXTA 1DUZB 1EO7A 2OJEA 1M7IB 1H3PL 4KI5C 3WY1A 3PP4L 3IAGC 1FA4A 2GUOA 5HDLA 3I6SA 4AJWA 5ALCH 1U8OB 3BAEH 1GZPA 3T0EA 3EJYC 4PGJA 3VGDA 2F54D 2DICA 3ULUF 2ZKXA 2ICWI 4R5VA 1MVFA 4HD5A 4PSRA 1JGDB 2NLJA 2Y25A 3TCXA 5C7XL 1OAQL 5F1OB 1AE6L 1YYLL 4G42B 5AB0A 2AEQL 4AEHH 3ZMNA 5DHVH 3S5LG 1M4KA 2KZWA 3GS0A 1E50A 2JTYA 1XO8A 2YD0A 3IBOA 4X7TB 1KBKA 2XFXB 5IT2L 2YPLD 5DJZB 4F58L 5C0DA 2P80A 3NFSH 4Y2DD 1GPOH 4K9EL 5ESVA 5CXPA 1S5IL 1Q0YH 3H3PL 2QGBA 1XAUA 1SM3H 4X0NA 1WBXB 4TVUA 3QFDB 1OE2A 4WFFD 4Y88A 3UO1L 3ZY7A 3KGTA 1DJIA 3L6FB 3ULVH 2EIJB 2QFPA 4A6YB 1LWJA 4NO0D 3UABA 3SKMA 2VDNH 2D7PA 3HB3B 1N59A 4K07A 4QIRA 5HD8D 1IBGH 1D7DA 3G6DH 5IW1B 2J8UF 1LNUA 1TSHA 4HW6A 4YXHL 4OF5A 2VAAB 3OG6B 4PMFA 1JIBA 4P2OD 4B7LA 4PJAE 1Q4NX 5FCSH 4BQBA 4HCFA 4GINA 1E8XA 1EWHA 3VW3H 3D39B 5A2FA 4JNXA 5E23A 3NVQA 3BH9A 1SHSA 2CLZA 1B4TA 3AAZB 5DDHA 1SHXA 2EEAA 2QR0B 3WUWB 3TNMA 3KJ6H 4ZAKD 3FNKA 1LP9A 1WAEA 4JPVL 3P9WB 1KG0A 4TYUA 2NNRA 2Z65C 1B0IA 4UOW0 1CK0L 3OGCA 4NO3B 3F8UB 4JUTA 5D2LA 4K7FA 3QJXA 2H2PD 3SQOL 5HYJD 3LPWA 1CXEA 4JRXB 3CJJA 1NCCH 3NABH 3X12B 1QFWI 2W94A 4NC1C 3GYRA 5LN8A 2CHNA 3KAAA 4LEXH 2HX8A 1XF2A 4YEFA 1NIFA 1JMZA 1Z3GL 1DDTA 2BS9A 3NT0A 1IBDA 1KDIA 3K5SA 5JMOC 2Z31D 5D1ZA 4FZEL 3ZYZA 4MD0A 3D85B 4K7FB 1U8JA 3ZKQD 4IIQC 5HVWA 4YSCA 3DHUA 1JI1A 4P2QD 5FYLD 1U8IA 2DTMH 2FJUB 3PJSB 3WDHA 3PL6C 2WLYA 4K5LA 4EZLA 4NWUL 3UJTH 4NSKB 4D9RD 1ASQA 2VLMD 3NN8A 1ZPLA 3B3IA 4KPHH 1U8JB 3IDXL 4ODXA 2BZDA 4JDTL 4GW4A 4NAMA 4PBDA 4PRBB 1NBCA 4YHLH 4QNPE 1OT4A 1IC7H 4X6BA 3SDXB 4EIUA 5FECA 4NIKB 2VLKA 2YXMA 2CRMA 1WZKA 1WIOA 4O2EA 2ZOLA 2QKSA 1BG1A 2RHEA 3TVMA 4U49A 3LH2H 1JGEA 1LJMA 3S35L 4C4BA 4AVJA 1J0ZA 1TCRA 2PO6A 1J11A 1JZ8A 5DC9B 4LLWB 4C55A 4YXLH 4OI8A 3NPSB 1PAZA 2BP8B 4WUKL 1IEBB 3O4LD 3AY4A 4LCWE 1U8IB 3HZMA 2AQRA 1OALA 5GJSL 2E27H 1I7TB 4QY8B 4P2RA 3EGSB 1PF3A 2ZG1A 1AGDB 1IGJB 2X12A 5I19H 2HLAB 3BP6A 4NIYE 1MJ7L 3HAEH 3B6SA 5GGTA 3I6KA 4UM8B 4QRBA 1SQ2N 2X4UA 3QNFA 1WBYB 1HZLA 2IGTA 1D5XA 1TQWA 1MRCL 4L18A 3IN2A 2NY6C 1UH2A 2AV7A 2YIHA 2C4XA 3D33A 1LQBC 2NOYA 4JKPH 2JJWA 3PV6A 4PJ5E 5GZNA 1DBJL 3FTXA 5GZOA 1MREL 4NO0A 1GYAA 2QGCA 5JOPE 5B1JC 1SLVA 3KCPA 3SE6A 5CEZE 2YN3A 5FYKH 1E7VA 3EOYG 3F58L 1OSPH 1CFQB 1DTUA 2J8UB 5GZND 4BSJA 4Q14A 3JWOL 4JUSA 5AVVB 4ZO6A 2N7SA 5G2NA 4ALAH 4AMKH 1I85A 3FBKA 3N43F 2X9YA 1TU2B 1V7NH 4WI3A 5HPOA 1MHEB 5CLWA 5AVRB 5I71C 5DLMH 1Z9SA 2N3JA 4KK8C 4XCNB 2PO6D 4TQEH 5G55A 2AXFA 3WKNA 5TE6L 4M93C 3B7UX 1BF5A 2R15A 2XPZA 4B9KC 1WZ1L 1X5ZA 1OK8A 3CAFA 3CFDA 3H9SB 1S9XA 3VXNA 4IBSA 5D7SH 1AQHA 5JORA 3VFVB 3LQZB 4HCGA 2WWKO 3MREB 1DVTA 5GGVL 3O6FB 1LEGA 2Q2EB 4NNYA 3RFZC 3VXPB 4PJHF 5J5EA 3TBTA 4ETQA 1J8KA 4JHAH 3KEDA 4GLRI 4GRWE 2DTSA 4I8DA 4FQJH 4FXKB 4JHZA 3T3ME 5EU3B 3QARA 1AQKH 5LBSA 4UAOB 2E59A 5D2LE 1IGIH 4BXSV 3A67L 3LZRA 1WFOA 4TUOB 5BS0B 3JTTB 5TTRA 1MDAA 4Z8FL 1R33A 1A14H 1OCWH 4QRSA 4XZUB 3WFDL 3WSQL 4LSRL 1K4DA 2QVMA 3CXDH 3QUHA 3G04A 3ZE2B 2H5UA 2HRPH 5IUSA 1G7JA 4Z76A 5D9SB 4WGKA 2B1AH 1HXKA 3C2SA 3JV5A 3ZDYF 1I3UA 4YLCA 4JFYA 1MHPH 1SQMA 3W0WE 2K8QA 2EIKB 5MP6H 3RY6A 1UD3A 2X70B 3RJDA 2WCPA 2B3IA 2FSEB 4DW2H 4QGTA 4W6YB 1IRAY 1S78C 5I8CB 1HYSC 2YGNA 4ZAKA 4HWEL 3RVWD 4RZCA 4OJYA 1I1AB 4I2XE 2WVVA 1FDLL 3RL1A 3ZRSA 1CPUA 1S7RB 4LARL 3MUGA 3FQXA 3OB0H 2ENYA 4GXVH 5T1MA 1NSNH 2PCYA 1HL8A 2AQ2A 4ORGB 5C0FA 2Y7QB 5E8PA 4LBEB 3QXWA 4UANA 4G8GD 1BLNB 3KWXA 4H5SA 2Z8RA 4ACPA 3OAZH 2J5LC 2W9DH 3MNVA 4D9QD 4K0OA 3QW9A 5HBBA 2HKAA 4KROB 1A7NL 5C0ND 4BKLB 2FEJA 1S7VA 3NZHH 4ONFH 5E0QA 3REVB 4GT7A 5T5NF 4ZJ9A 1MFDH 3V0WL 4K94C 3VWKB 2QV2A 5AYUL 2YC1A 3MFFA 1FN4B 4J3TA 2B2XH 4J3BA 3MLWH 3UPRB 3BJLA 4H25B 4HCIA 2ZX9A 3V0WH 3N41B 1KXQA 2X4NA 3K91A 3N44F 2OZ4A 4TF4A 4U1MA 5FKAB 1HYRC 2YUXA 3HC4L 4OY9A 4C47A 1MH5A 1RZFL 1DFBH 3HHRB 4LF3A 4OM0H 4G83A 3GC3A 3LZNA 3MRLA 2H7WA 2VZTA 2R2BA 3D5OF 4XNYL 5AVSB 3DX2A 4UQ9A 4F93B 3MJ8A 2A73A 3TS8A 1FVDB 3S36X 3K81A 5A6IA 1JUFA 4WUUD 1HXMB 1HI6A 3C60A 2GY5A 2UUDK 4KO9A 1EDYA 5KW9H 3VDBA 5L4FA 1ZANH 4LLDB 3HUJE 2BS71 5ISZB 1MCIA 5IB3A 4FQXA 4FA7B 1XZ0B 4MVBC 5BW7C 4L5FE 2VL4A 3TO4C 2DM3A 2WLZA 1NMCB 3GMNB 3L5WA 3G6JB 1MIML 1E9QA 4OKVB 3IPFA 1XH2A 4LPUA 5INDB 3UTSD 1IILE 3DETD 3PWVA 4H40A 1H5BB 5DD0L 3TBYB 1MJ7H 3EAKA 5C3IA 2H41A 2EXYC 2X0VA 2NSXA 1RK0A 4U1LA 5I76B 1KB5L 2YZ8A 3P9MA 4NI6A 4EUPB 4ANVA 2ALWA 5CM1A 3K71B 4U6XA 4L37B 1IAIL 1ZT7A 4L4TE 2CNYA 3E3QE 1EK3A 2J55A 4PG2A 4PEEA 1ECYA 2BSTA 1JWSB 1EHXA 3ECBB 4HISA 5GGUB 2HFGL 3U2SA 2APXA 1BWMA 3GD1C 4Y2OA 5IG7B 2WWMD 4M6MH 1INDL 2NY3B 3HG5A 2YPLA 2OZ4L 3VFPA 5TE4L 4JW3A 4BH7B 3HI5L 3RDTB 1UWXK 1HNFA 3QWOA 3WTVA 3N55A 3QUZD 4EUPA 3IS1X 3RVUC 4L3AA 4NO0B 3U7YH 3A0OA 4AH2B 3AU0A 3G5WA 1I7UA 3WJLA 3B2DC 2PTUA 5DA4A 1AGFA 5EU6E 2JIXD 1TCMA 2CDGB 3UG5A 2Q6WA 4G8EA 3WIHA 5GRUL 3OF6A 4H26B 2WUBH 2ZYRA 3Q6FB 4BGDA 4DF9A 2FEEI 1L6XA 3QUMH 1C16B 2Z8SA 4W9CC 4XT1C 2ZNWA 1CT8B 2X4PB 3Q1EA 4S1SH 4MRCA 1WCBA 4TLTA 3W11D 5K9OA 2NY2D 4JJ5A 2W5PA 2EVFA 2G2RA 5IROC 1ZXKA 1VPOL 2XETA 2ZCLH 4UOQA 1QI3A 4OGXL 3DOSA 1EO8L 3K1KC 2VMJA 2F5AL 1P4BH 1BQHB 3LD8C 3O8XC 3CSYA 4RWHA 3ZJAA 4WWID 1AZUA 2MQGA 2ZXEB 2HG5B 1T7YA 4HFWB 3JV4B 4ZDHB 4BFBD 1UC6A 4N90D 2HWZH 1NUDA 2X4SA 1EUUA 2FJHA 4HQQH 4JO2L 2HP4A 2BIMA 1NCCL 3UZQB 3DX6B 1FZOB 4RX4D 5E1AB 3KLAA 2PABA 4G6FB 4XXCA 4DPCX 3ISWA 5D1ZB 4BFNA 2FNWA 3SYPA 3Q43A 5DA0B 4PI0A 1HJBC 1U6AH 1ONQA 4BUHA 3DRTB 1Z3RA 2IG2L 3STBA 2XOTA 1M42A 4LSUL 3CFCH 4NFCA 3MYJB 2BSDA 2VR8A 2BSEA 4N3UA 3LKOB 4LE8A 2R0WH 4PB9L 2F8VA 1KTDB 1KV3A 4FKHA 5DRXA 3PDOB 3E7JA 5CINH 2NX5D 1LK3H 2UX7A 2WINB 1EEZB 1GHFL 1X6NA 3CZKA 2VWEE 5JHLH 4JAMB 1JAEA 2F61A 4U6VH 4ZS7L 4BFRA 4OQ1A 2Y7LA 3SO3C 1FVCB 4BFIB 2ED6A 5MEPA 1H6TA