1D7DA

Cytochrome domain of cellobiose dehydrogenase, hp3 fragment, ph 7.5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
186
structure length
186
Chain Sequence
b'ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLOBIOSE DEHYDROGENASE
publication title A new scaffold for binding haem in the cytochrome domain of the extracellular flavocytochrome cellobiose dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 38
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 1999-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1d7dA00
1D7DA 4QI3A 1D7BA 1PL3A 1D7CA
chains in the Genus database with same CATH superfamily
3TV8A 1A6ZB 1T4KA 2XQYG 3MV8A 2CXGA 2BIMA 1NM9A 1R5WA 1ZXQA 3MRIA 4HJSA 2QTEA 4A37A 3BMVA 2WP3T 4ZMAT 4A6YH 2J1WA 2X4QB 3L3OC 3ZQWA 4PI2A 2E76C 2DIJA 2XIDA 5E94B 5ACZA 4EN3B 2IAMC 2VDLL 2DMCA 3I84A 4IRJC 5C07E 4N0UE 5D71L 3ZKMC 2WQSA 4KJQD 4NNYB 1S78D 1UQSA 1T7VA 1UADC 5JHDA 4OZ4B 4JDTH 2R29L 2WANA 1SOQA 1NICA 2VN3A 2Y69B 3OKLB 4PJBF 3TNMB 4BD4A 5EBLB 3ESPA 1IQWL 3LKSB 2IGFL 4N1EA 2QV4A 1TJHL 2YRBA 1TTGA 2FO4A 4PJEA 3BP6A 3F7PC 2TAAA 4OFKA 3L95B 4K3HA 4OCYH 3H6AA 4J3WA 1ZDQA 4JL1A 1S9VA 1JZIA 3U4EA 3Q48A 2D7NA 1AOZA 3ULSA 4URKA 5CD3A 1QLFB 2HKHL 3N1MC 1FE8H 2HLEB 3BP7A 3QEGL 4P0DA 2JKTM 3CSTA 4P3WA 4IJ3B 4CADB 4PCTA 2HMIC 3EBIA 4D0BA 5E6UB 3T09A 4DO6A 3UTPD 1XD1A 5AKSA 2IADB 5EDSA 1TTAA 1ZHKA 3IPEA 4JCMA 3DRQB 2X4SA 3SGKA 2GT9B 3ASNB 4PRIB 5C08E 2F2HA 3G5VA 4G7RB 5IBUG 4YXLL 5FLVA 2VLMD 3L16A 4HKJB 2AP2A 1PZBA 1Y6KR 3ECWA 4BE5A 2XETA 5L88L 3F58H 4LDEB 1CMOA 4ONOA 5FHAL 4H1LG 1DLFL 4JREC 2EDQA 3CH1B 2PWDA 4N87A 2AEQL 1G5AA 3SCMD 2IGTA 1RZ7L 4Y1AE 2YD1A 3MI6A 3HG1E 2QVMA 3P4NA 3EYVB 3BWZA 3QIUB 1TYJA 1H6TA 2DF3A 4YVNA 5CJ5A 4LSQL 2KERA 5F7BA 1IAMA 4FFZA 4UQ2A 3VDAA 3ZYOA 3EGDB 3JV6B 3WY4A 1IQDA 1UD6A 2NT1A 2WIMA 5F1IA 1FL5A 2WXJA 4WFGE 1HNGA 4PHXA 2I9TA 5J6GA 1PZUB 3DVGA 1ETA1 5E1QA 1DDHA 4KRPC 2Z9TA 3IPFA 1FL6B 1HS6A 2VDMB 5EC1A 3OKYA 5J1TC 4IRSA 3QUYD 1RIVL 3Q8CA 5BV7C 3EJCA 2E5EA 1A2YA 4P3DA 1J1XL 3RVXD 4ABUA 4AK2A 3WEXB 4A63A 3QIBB 2DBJA 2OMUB 3O6FB 4HZLA 4WSJA 5IB2A 4JG5A 2OP4H 3M7FB 1P5UC 1WFUA 5IY5B 1A9BB 2YLKA 1ZS2A 3EOBA 4HHAA 4I48B 5EZLB 4RAUB 5BRZA 1C12A 1AY1L 4QRRB 1HH6B 2JXMA 4HPYL 1SMAA 5FO9B 1OAZL 3T6VA 3MOAL 2DKMA 1TYRA 4YHPA 2HRGA 3KR3L 1HDMA 3RUGE 5B1AB 5CWSB 3X3GL 5KYXA 1QRKA 4GEIA 3U0PA 4WUUD 2Y1YA 2YAHA 5EO9B 3RIFF 1ITCA 4HUUB 1ZDSA 5JR1H 5TDNB 1WGOA 5SWZB 1RL1A 4WJ5B 3SPVA 2ALAA 2CO6A 4XO5A 4WWPA 2BHZA 3TEYA 4JKWA 3BEVB 3V6FA 1CD1A 1R46A 3U1QA 4NKIH 2VDLH 3INOA 5IHZA 4WU5A 3LRHA 4MMZA 5D71H 4W9JC 1O0VA 1IAKA 3UC0L 3HS8A 5LBVA 4G71B 4PG2A 4FI6A 3CFJA 4JKNA 3V0JA 2H3XC 3V5HB 3KGUA 4AV4A 1UD5A 3B83A 2R29H 1T1YA 1AHWA 2BW4A 2H4EA 2XWTB 1YVLA 1JPTL 5L4IA 4DT2A 3FQ4A 4ONGH 2IGFH 3MLTB 4PJ7A 2CDFB 5FO7A 5GGRA 4EI5C 2Z65C 4YE4L 3RWFA 1IJNA 5DTFA 4O9HL 3ALXA 4EIGB 1P69B 4L1LA 1GJWA 3VH8B 3VJ6A 3IU4L 4A2LA 1TTUA 1FNEA 2CKBH 1R75A 2YPVH 1EZVY 4APQA 5TFSH 3RX8A 2HKHH 3UL4A 3SO5A 5HYIA 4Y0GA 3QEGH 4Z7OE 4J6IA 1FH5L 4NFCA 3RWHB 1OKEA 3S36L 5DYOA 1SY6H 3MMEA 3UTSA 5HI3D 1JFHA 4MVBC 5C09A 4LSSL 4DP4X 4ELDA 1AXSA 1IAII 3FO0L 3HI6H 1MVFA 5I82A 2CIIA 4L9LA 3SDCA 5IJKC 1UTDA 3HBQA 2JKRM 2IDSA 4PIBA 1P7HL 4PV8A 1RU9L 1O7SA 1HL4A 1JPGB 2ZUXA 3A3YB 4N24A 3BGFC 2ICWJ 3BWUF 4HUKB 3DUSB 3AAZA 4WQOA 5L88H 4ISVB 1BG9A 2JVUA 5F7UA 4ZRGA 1PKQA 3O11B 4W4NA 5FHAH 1DLFH 2VZTA 4KO7A 1F58L 3LRKA 4Q74A 1NGZA 5AKVA 2QLYA 4JN2A 3MN8A 1NCGA 3NIGE 3Q5OA 4HFWA 3OAYH 2FSDA 1Z6JT 3UTZB 5I74C 1NEPA 4ENED 2E6QA 2R2CA 2KLSA 3DMMB 2AXJA 4LSQH 2HVKA 3GIVB 2AC0A 1CN4A 3ECVA 1GAFL 3ATAA 3VFVB 4MJ2A 4F5CA 1TVBA 2X70A 5KSBA 2C1OA 1L9SA 1N3NA 1TO5A 4YIQB 4GUCA 4CBPA 3NCXA 5J9PA 4Y19B 2XV0A 5I73C 4Y2DC 2V7HA 1J0HA 3VFSA 3ZRCC 5FEBA 1OT2A 2OSYA 3D3VA 3S5LB 3BZ4A 3TWCL 4F9LC 2Y06L 3KS0H 1RIVH 4YHIA 3FB6B 4K8RL 2ZX9A 3J2PA 1NFDA 5CJ8A 5AW2B 3T1FA 1E6OH 3PUCA 5KWYC 2EVHA 4ZODA 4QRQA 3WKYA 2BINA 4ZMWA 2P49B 1AY1H 5BZWB 5CEYB 2X09A 3SBQA 2PO6A 5KYUB 2YWYA 4HPYH 2GFBA 3GUTA 1OAZH 3BAYA 3MOAH 2VDPL 2W5PA 3KR3H 3TJPA 3PHQA 3VYOA 4PJ8D 3X3GH 5IB3A 1QVOB 2EE9A 1CURA 2K9UA 5IM7A 4XCYA 1E4JA 1OGTB 2CUHA 3CFKB 4L4VE 5HGAB 1S3RA 4JFED 4J5VA 5AAWA 2QV2A 3N2JA 2JB6A 3TO4D 2DD8L 3L5HA 1JDDA 2I24N 4L8SC 2MKWA 4DGYL 2R23B 3GJFH 2QGEA 1UOWA 3QWRA 4MMXA 1XF5B 3VFGL 4RMSA 3TVMC 4BK4A 3GDBA 1NGXA 2EAEA 3PWLB 2BIPA 4KXBA 1OCRB 1R6VA 5FM5O 4DP0X 4KXZI 2C3WA 4L18A 2XPZA 4KQ3L 1LGVA 2IMMA 1NWPA 3HBZA 2IPUK 4AUJA 5GS1B 4JY5L 4D7PA 3D2UA 4DKDC 3O8XC 1HHHB 2G3NA 3ABKB 4GRWE 1QFHA 1WT5A 3BFQG 3QDGD 1PZ5B 5CGYC 4MA1C 5JDJA 1EQWA 5B3JE 3PXHA 4O9HH 4ZDHA 1CDJA 3L6FA 5HHOB 2GI7A 3NSDA 3QUZD 4HUWB 5KZCD 3IU4H 3RGVD 4Y2LA 2OYLA 3WJJC 2F8IA 3FU6A 4X5WB 4NQDE 1Z2KA 5FLUA 1FH5H 1Q72L 4W9GC 3RY6A 5B8CA 1S9YA 1SXZA 3S36H 2WXOA 2A6IB 2ID5A 2D8KA 5MERA 4LB8A 4GAYB 4LSSH 3FO0H 4L8BB 4PJAE 1WS8A 5FDWA 2C9PA 4J3SA 4NT6A 3B3IA 4HU2A 2NZ1A 4LAQH 3NMEA 1RU9H 5JHLL 4RISL 3U0TA 2IBZY 2QSVA 4R7DA 3N40F 5EZOH 2V2XB 2V4LA 4HJGA 1AGCA 4OVVA 2XA8L 1F58H 1WD9A 4KNUA 5HGDA 4XMTA 3QRGH 4HKXA 1Y0LB 5C86A 3BRFA 3B9KD 1JRHI 3WTWA 2N59A 5EORH 3UADA 1G7HB 2EXYD 4UANA 4QYOB 1S7TB 2VC2L 3FL7A 4KTGA 4KZ0A 5TE6L 2GK2A 2JJTC 1X5LA 1GAFH 5F7MC 3WLWD 1FFRA 4PJIF 5DO8A 4XX5A 3M86A 3UPAA 1UXWA 5I6XC 2PW1A 5I1AA 4KH2A 3F6JA 5HVFB 2K6WA 2OX5B 1RULL 1NCBL 2AJUL 4RDQF 5C0CE 3SSGA 3B56A 3MV11 1Z5LA 3P3TA 4NM8L 4PB0L 2W91A 4Z7NB 4LNRA 3V0GA 1I9EA 4UILH 1U3HB 4F7PA 4YDVA 2TSBA 2J25A 2A6DB 4XHJC 3TWCH 4IK6A 2YQ3A 5EN2A 2Z93A 2QQNH 4R0LC 3FT3A 1XGPB 3G6AB 3CDGA 1YA5A 1RUML 3Q01A 4JJOA 4P59L 3ARGB 4Y7MA 3VD3A 4H26A 5J3HD 4HSCX 4MBOA 1T4KB 4YDMA 3MV8B 1G9NL 1GOHA 4NRYA 4JHBA 2WYHA 4HCGA 1R5WB 2FIKB 2H2SC 4LSPL 5D7IE 3GPSA 4M43L 2K3HA 5DSCB 2PKDA 1D7BA 2YD2A 2YGVA 4N2NA 3VXRA 5DCCA 4EN3C 3CFTA 2Y24A 2WLLA 3F00A 3O45A 1G7QB 3MNWB 4AZUA 1U93A 3CFIC 1NEUA 5ESAB 5DJCA 4DGYH 4ZO7A 1GGTA 3QNZA 2G60L 1T22A 4GKLA 4OJCA 2KL6A 4N5EC 3VFGH 3GSWB 4JFYA 5SX4H 3ELQA 3ZLQC 1FO0H 4JPSA 1NLDH 2ZUQB 2AK4E 2BXYA 3AS1A 1U92A 3H0TB 3MCG1 1JAEA 4GRWH 4EIUA 4JY5H 1AP2B 3C2AL 1CGSL 3V5DA 5EF2A 1BQUA 3VFRA 2L04A 2Y7MA 4JFDD 3EFFA 3WNKA 2WY3B 4R2GD 2PN5A 4J3OC 2QPEB 5JIHA 1II4E 3DIDA 4PWIA 5JHLA 1S3KL 3GS4A 3MRHB 2NY2B 3ZHLA 4IJ3C 3PQYA 1RIUH 3BP7B 4PJFF 1EUUA 5BRPA 2AXGB 4UNTA 1SMDA 3IGKA 1UFGA 1Q9LB 2WXQA 1XEUA 5JZ7C 1D5RA 1QFWH 2ESVE 4JO3L 3WU1A 4JGNA 5AVXB 3RIAF 5CLWA 3TA3D 1UKSA 1ROCA 1ZHKB 1AJ7L 2J44A 3EH2A 3LXCA 2X4SB 2FEDC 5F9WB 4W4OC 5JLZA 4G80B 1MCFA 2KYIA 4FQCL 3P3UA 5K1NA 5KAQG 5C97A 3WSQH 5I1EL 3DX6A 2XWZA 4H1LA 3IXTA 1UUSA 3ZE1F 4NC0B 1P7QD 5A2CA 4QCIA 2GPZA 4RISH 3U30B 4ODUB 1LXMA 4TMPA 4D9LL 4KXDA 3ULAB 2O30A 2ITFA 4XO8A 2K0RA 4BK5A 2E75C 4F8LA 5FR3A 2R2BA 2HTKD 4XCFH 2XA8H 5HYSB 5D5MB 4WKZA 3W39B 3H9SA 4AENA 3WTXA 4LRIA 3G04B 1QKZL 4GI9A 3ZUNC 1RK0A 3VFPA 4MJID 1ORSA 3VRLE 4DPRA 1T0MA 1R1CA 5TE6H 1OANA 3KH4A 2DEYX 2PP9A 3MROB 3KDPB 5C0AE 2FAUA 1K3IA 5F1IB 3S35L 1FL5B 1E8XA 3D4GA 3RTQD 3SBRA 3REWA 4PI0A 5E5MA 3PIQA 2Y3AA 1HCYA 1RULH 3F64A 1J0KA 1O9ZA 2VLKB 1NCBH 2AJUH 5I2IA 5F7YC 5SWSB 3L4XA 4LHUB 4NM8H 4PB0H 4CUCA 3X1BA 4ZTOL 4IRSB 5HGHA 2D2OA 2OI9B 3N1QC 1XZ0B 3QIBC 2QKIC 3O6FC 1WFJA 4EIZC 4IOFD 5T1KA 2HG0A 1MCDA 4IGBA 5EIVA 3BRDA 4EO5A 4XE5B 4ALAC 4L8CA 1PZ2A 1J0JA 1KXQA 2GAZA 3BGMA 1B90A 2JTYA 4P2RA 5BRZB 1KCVL 1NMBH 4P59H 1RUMH 5JO5B 3UX9B 1WUZA 2Z7ZA 3MU3A 3FQ1A 2EIMB 2NY3C 3U25A 1BZ7A 5F0LB 3QG6B 3OX8A 4PJ5D 3HCVA 4LSPH 2OXHA 4RNRA 2OTPA 4M43H 1XSOA 1GZQB 3OJMB 3J27A 4TOYL 1S9WA 1BVKA 3M07A 3P2TA 3DVIA 3FT2B 4G1EB 3N41B 3ZTNH 4NOBA 4HXAL 1DJZA 3HIZA 12E8H 1CD1B 1MY5A 2OMVB 2IV8A 5GSRA 4YE0A 3EYQC 1GS7A 4MMZB 4JM0A 1I8AA 2E6JA 4BIKA 5GZNC 5D7LA 1HL5A 2TRYA 3FBQA 3GS7A 4OF3A 3QJUB 1V3MA 5F1KC 5IOKA 4UM9A 4G42A 4AKQA 4K55A 4HLJA 5F1NB 1E3FA 5I66B 2YC1A 3C2AH 1CGSH 4LF3A 5GGRB 1DBML 1IBGL 1KDJA 2X4RA 4W9HC 5AYQA 3ZYIA 3OKKA 3OKOA 5DRNA 3JVFC 5DWUH 5D6DA 1RVFL 3L3IA 4APQB 4S2SB 1S3KH 3VB8A 3NJFA 5J11B 4AJWA 3ML8A 1LO4L 3L2LA 2UY7B 4IIQC 5E7BA 3HNSL 4UB0H 2LU5A 3KMDA 5DD0L 3KXFE 4IEFA 4U1JA 4JO3H 3CVBA 3C5JA 2CNZA 4NQEE 1AJ7H 3LMJL 5AW0B 3JWOC 5F0JB 4FQCH 1V3JA 1RUPL 1BA9A 1X7QB 4JRFA 2UZXA 4LVHB 3UJIL 1A6VL 1KB9J 1NIFA 1RZFL 5LDUA 5C07D 5I16A 1YUHB 1A1MA 1NGZB 4FLSA 1YY8B 2AMGA 3TT3L 2BSSA 3DMMC 4L4TE 4FJ6A 2YA2A 5GISL 2HLFC 4V1DE 2A6JA 2H26A 4IRZL 5T1MA 4KZEH 1QKZH 4NO0D 1T66D 2ZCKL 2H8PB 2PWEA 4XBGB 2BERA 5DVPA 3O3BB 4KQ4H 3KHOA 4AUUA 2BVEA 3S35H 5EDXA 4OIFA 4X6CF 5EU7C 5DWPA 3GNML 1XMEB 4CMHB 3ZKXB 1GGCH 3V7MA 8PAZA 1SHWA 2MTAA 1GYWA 2GKIA 2JF1A 2PXYD 3TT1L 3D3VB 3I2CL 4ZTOH 4CU7A 4LSRL 2Z3FA 5E95B 1NLBL 1XGRA 1NFDB 1GGYA 5TD4A 4LPXA 5G2NA 2APXA 2IAAC 1QYGL 1T2QL 4XWGL 3K72A 5C08D 3FCSB 3CVHH 3KPMB 4AGNA 1KCVH 1D7CA 3EJZD 1UXSA 2ZSVB 5T1DL 2PYFA 5DURD 1J7VR 3LQAH 3WJMB 3HKZA 3Q8BA 2XBTA 2NR6C 4L3CA 5K9OB 4NHUA 1UASA 3V6ZA 4Z3JA 2F08A 5JMOC 3QUXA 4JCWA 4UIMB 4G8GE 5E6IC 3RZCD 3HG1D 1M7UA 1RPQA 3TYGH 5E4AA 2UZIH 3O6KL 2Z8RA 3UTSD 2MPVA 2Z1KA 3PAVA 3ZDWA 2DMHA 1HJBC 4HXAH 4AKPA 5E03A 3MGTB 3FONB 4OFPA 5KANI 3ULVC 4WFGD 1UT9A 1JWUB 4PJ9D 4DVRL 3MXWH 1CFTA 2Y3NA 5GS1C 1R3IL 1F6FB 2ZOWA 3PG2A 4PJCE 4MNQB 4UI2A 1G7IA 3PDOA 4XP1L 1IAIL 2OJ1A 1E50A 3O3AB 1KYOJ 3ZT6A 5IGXL 2JIXA 5CBEA 4JB9L 5GS0H 1QFPA 1PFCA 3GMMA 3VXOA 5DZVA 1KG0B 4ODWB 3UAFA 1FL3B 3PXLA 2VH5H 3MNVA 4GKSB 1WFIA 1SDAB 1UT2A 3HUJA 4KC3B 4XB7A 3VTMA 1WITA 1XGQB 1LO4H 1U8IB 2V2WB 3ARBA 5JHMA 2L3BA 3N44B 2AS5M 5EIIG 1JSYA 2FWUA 5DD0H 5FW7A 3ARFD 4FQIL 3NIFB 4PJDE 3BLBA 4N2CA 1JZ2A 4IRZA 1TDQA 1L9RA 5LJYH 2HB0A 4JW3A 3OLDA 3NACH 2BIHA 1JD7A 1YC7A 2P24B 4AWJC 1I7UA 3OAZH 1KTLA 3QWQB 4F27A 4PPTA 2ZG1A 1RHFA 1VEPA 3Q2VA 4NPJA 5CNHA 4DN3L 1A6VH 1L0QA 1NINA 1RZFH 1T4WA 2YOAA 3K2IA 1SRDA 3ZKSD 3ZTCC 1B0GA 2DYPB 3BI9X 4FDWA 4N68A 4OZIA 1W16A 4OCXL 4BSJA 2FCBA 3FTGB 4UMGA 5FV2A 4HKXB 5AFAA 4OJEH 5IEHB 3TT3H 3G6JF 4ZW5A 1YEFL 5GISH 3OAWA 1GSMA 4YC2C 4CSSA 4M8QB 3QDJA 3HN8A 3QNXB 5I30L 1X5FA 2ZCKH 1ZY9A 1T6WA 2WXKA 5E56A 3VG9C 1GOFA 5DFVC 3KPSE 2K4WA 4PGJA 4RGNB 1MRCL 5I6PA 2GY7B 4O5LL 2Q8BL 3O3EA 4AIZB 4L29A 4E41E 1CDCA 4BZ1H 4CW1B 4LCVA 2PCPB 3ARSA 3KDMA 4FQXA 3KYNB 3GNMH 4GG6E 4Z23A 5D7JB 2VM4A 2AEOA 2CSPA 5KJRH 3E6HA 1MUJA 3I2CH 1FF5A 1I9IL 1KGWA 4TQPA 2A6KB 4YHLL 1ITBB 1WHOA 4LLAA 1BM3L 3BIKB 1MEXH 2Z6FA 1CE6A 3LN4B 3VM5A 4LCYB 1T2QH 3CU1A 1DVFC 2VCOA 4XWGH 4PVBA 3ASWA 3TTSA 1ONQB 4NN6C 5H35A 2XRAL 2NRDA 2CO2A 2WZ6A 3HBPA 1SF5A 1T89C 3F6IA 4NRYB 3FU8A 2D4FA 1CC3A 3B2UD 3MUGA 5FOJA 4AYEC 4FA7B 5I23A 1IKFL 1U8JA 1LE5B 1FCCA 4FFVD 3RA7L 3VI4F 4UNVA 4C8XA 3DOSB 3SQBB 5D2NA 4ZMVA 43CAB 1A7RL 4FFWC 1KBWA 3O6KH 5JW4Q 2X6CA 1QFUL 1P53A 2H32B 3GBEA 2GY5A 4ES9A 1KT2A 3UERA 4LLMA 4DOHE 2ZCLL 1WICA 3SPGA 4M9PA 3BLKA 2ZUQC 3VD5A 2ED9A 1XXDC 1MREH 4DVRH 5IMKA 3RFZB 4L3EA 2BVOA 4N20A 3ECUA 4JKKA 1U92B 5B1JA 2E6PA 1TKWA 4G6ML 3AT8A 1CVRA 4B0MB 2FBJL 5HDBF 1IU1A 3VGGA 1AQKH 1XBRA 4XP1H 3RIKA 1IAIH 3LDBC 5DUMH 2R4RL 4U1MA 3DUUA 1FORL 4RWYL 5IGXH 1I1FA 4I9XA 3D4CA 4JB9H 4P2QA 4JRYE 4NN7B 3D12B 1K5NB 2BLFA 2NT0A 3VFNB 1E90A 1U8PA 1G84A 1GS6X 5IVXA 1L7IL 1ZANL 5AW1B 1ECZA 1Y6NR 1KGXA 3QG7L 3RLSA 2AANA 3HMWL 4PRDB 2J8UA 3MX0B 1I75A 3HZVA 1W6LA 3GKWL 5EUKB 5H94B 1ET8A 5I28A 2BRRL 3QJFB 1JRHL 4J2XA 1SYVA 3TZVC 3UTTA 3S3BB 1R3JB 4NP4L 4L37A 1MVUB 2P1YA 5MENA 1ADQL 4NQCB 1NIBA 5IMOA 4UINL 3U30C 2DTSA 3RTLA 1JOIA 3FKUS 2GG1A 2HLAA 4N2DA 4NO5A 1RMFL 4OKVA 4DN3H 3PJLA 3UBXG 3G08A 4OCXH 5E9DB 4EKXA 2OL3L 3KBFA 2YR3A 4GQZA 4P2OD 4TQIA 2BSDA 3X12A 4F37K 1YEFH 4XPGL 5GS2H 4FLQA 2OTWA 3OBAA 5AALA 4IMLA 1W72A 3CSBA 4KY2A 3U83A 1CTNA 2B5IB 2OMNA 5I30H 4QLWA 1EERB 4OF0A 2FYYB 1ZLUH 2W81C 4AQ1C 1A6PA 1XF4B 1HSAB 3V4LA 4Q9CA 2BOBA 2FUTA 4NQTA 5DJ0B 4F3FB 4O5LH 4KKBC 3C5SB 5GRJH 1AZNA 5E08H 5KANG 5LGJB 5J1AA 4Y16A 1MH5A 3IKKA 3TBTB 3IFNL 4JAMA 5IMMB 5HGHB 5KSAC 1GY2A 2OBGA 2ZZUT 5CBAB 4M6OL 4PVMA 5JXEA 2X42A 3EOTL 3MV7A 3U7WH 3M1OA 2EIJB 1J8SA 1BM3H 1TQBB 3F7QA 4X6DB 2MCPL 3NAAL 4AQ8A 2EILB 2EE0A 2GTZB 2XRAH 4HX1A 4M1CD 1HSBA 4O02B 1GJIA 3GXFA 3FCUB 4OZHE 4KXZH 2R8SL 1FGNL 2F19H 5AOZA 1FQ9C 1FUNA 2A74B 1WBYB 3JTSA 1IKFH 5I76A 2HX7A 3PQYD 5IP4A 5AVZB 4PBVC 2NQDA 3TCLA 5DR5L 4FLHA 5E6ZA 3VDCA 3EG9A 4CC1A 1E4HA 1TPXB 1E28A 3THML 3VCLA 2JCCE 1KGJA 1QFUH 2Z8VC 1ETB1 3MRLB 3ZE0B 4U7KA 4ADJA 3MFFB 3VAEA 1AR2A 5B22A 3RWJB 3AREA 4KZDL 5F96L 1LWJA 2N56A 3L5WA 1M3JA 1EMTL 3T0EA 2KS0A 5BVJA 4UM9B 4HBCL 2XIBA 3DV6B 4JL2A 3VGHA 3ABGA 4OAWB 4Q0XL 2FBJH 1MNUH 3MCKB 2WLJA 2EYTB 5IJBC 4Z18A 15C8L 4JFWA 3VSQA 2G2RA 2R4RH 3F05A 3H9SD 2VE6A 2DY2A 2BFVL 2E9WA 1FORH 3FOMB 4RWYH 5T1LA 4DKFL 1D9KD 1BZ9B 5B1CA 4HD5A 1G0XA 1SM3H 1M9WA 1NBVL 3DXAB 3QQ3A 4UDTB 3CC5A 2X1QA 4HHWA 4MJ6A 3DJRA 4RAVA 4W9FC 5F7DA 1L7IH 1ZANH 5E2WL 5LO7A 3U6XS 3B2DC 3QG7H 5DZ9A 5DZOA 3K71B 3HMWH 1NAML 3H2WA 4NFDA 3GKWH 1E6JL 2WCGA 4G43B 3WUWG 4LCUA 4R4FH 3H4FA 2V5MA 1H9VA 3PJSA 2PW2B 3NEOA 5TPWL 3V0DA 3LB6C 4NP4H 3H9YA 4OD2B 1YNKL 4JM2A 3REVA 4EJ1C 3OGOE 1BEXA 5T1KD 5IBTL 4BGLA 1ADQH 2WWMD 4KKNA 4MBRA 5C0BE 4HGMA 1JYNA 2XPGB 1FVCA 4WI7A 5KVGL 1URLA 4JDVA 1EZVX 1H9DA 2XTJD 4Z95L 5KVFE 4OLUL 1KLFA 2CGRL 3DX2A 3RDJA 2IMNA 2OL3H 1AKJA 4AX3A 4KKAD 2W9DL 3RDTC 4XBEH 5F89B 2H26B 4EUPG 1EEYB 4BGDA 4JZNA 1KJ2B 2AXFB 1V27A 4XNZB 2Z4QA 1XB8A 1GR7A 1IFRA 4XPGH 4NBYB 3KL0A 3ES6B 3FSAA 4AQZA 4MLSA 1J5DA 3EBAA 3GSVB 1TFPA 5KVMC 3SDAD 4UM8A 2PPEA 2XXFA 4LT7A 2EUWA 4YGAB 4BRJA 1HILB 2ICES 1KCSH 3LNIA 5LWYL 3IFNH 4M1GL 5IVNA 4LDLB 1E4KC 2ESVD 1AZZC 2WMPA 1EGJL 1FZKB 3P77B 4M6OH 3DBSA 3EOTH 4FA6A 4WFFE 5KYNA 3UPRB 4QKTA 2MCPH 5HYFA 3K0WA 1LL1A 2P8MB 3I74A 1KN4L 4AEIL 3HPLA 2IH1B 4HC1L 3S7GA 2B15A 5HHNA 4K0OA 3QZNA 5ID1B 4K5NA 4QHNA 1D5IL 2B0SH 3RL1A 2R8SH 1FGNH 2ARWA 2J5WA 2IDTA 5G55A 5D1QB 3PWVB 4UTBA 5H8DA 4QYAA 3L4UA 1G7PB 4E9RA 3HE6A 4NAJA 4L23A 3GS0A 4RX4D 5DR5H 2BP0A 5DD3H 3GFUA 3FOLB 3DKHA 5AKTA 2X6VA 3EXJA 3DX4A 3ET9F 4Y4HA 5F70A 3UYPA 5ICYB 1B6UA 1WAAF 2J6EL 3P0YL 4OFIA 3CFEA 3RE0A 1FA4A 5CUSL 1PG7L 3D85A 1UOLA 1ZVSA 3D07A 5EEYA 3HLAB 3AMLA 4J1UA 2UWEE 4NXKA 2GEQA 5IF0B 4X7TB 3RY5A 3MO1B 4HEPA 4HBCH 1Z3GL 2LAGB 2UYLA 3EJPA 4JQVA 5LCVA 4WTWA 1EO8L 1AQDB 3F7YB 3NSFA 4N0CD 1CICC 4G6KH 2DQEL 2H1PH 15C8H 2HYMA 2P5EE 2KZBA 4YDIL 4Z7QB 2H9GB 4HUXA 5BNXD 2FX8L 4DKFH 1WISA 1MHHA 3P30L 4RRPM 1NDMA 2WVVB 1NBVH 4Y2OA 1OB0A 1QRNB 1P4BL 3BKJL 5EIIA 4WF7A 3NYKA 3WS3A 3ARBB 1HIMH 3PV6A 5E2WH 1A1NB 5CKAA 1NAMH 4AGQA 2EEXA 3M8OL 2JK5A 2EDTA 2QT6A 2HN7A 1BIIA 2XTSA 2NXZB 1NC2D 2ZQKA 3B9VA 4BFJA 3TURA 2X6BA 5CZRA 4AYSA 2FX9L 1AGDA 4B9KC 5TPWH 2FQGA 5IIEB 3SJVA 5K9JL 2HFFB 1YNKH 2YUZA 1SZNA 1KTLB 4Q6YA 5EZIL 1GVIA 3EYFA 2WIIB 4OJFL 5IBTH 3L1FA 2J1YA 3A21A 4IDLA 4Y8AA 3V4VB 1PF3A 1TEYA 2I7OA 2WINB 3ZL2A 5KVGH 4X8CA 3T3PE 4HS3B 1B0GB 1WHPA 2FJFA 4XN7A 4Z95H 5BS0A 4OLUH 2LGNA 2X4NB 4QRPE 2CGRH 3KE0A 4O00A 2WYZA 4X6EB 3N85L 3HHSA 3NGBB 2W9DH 2OZ4A 1DVSA 3ZQXA 1EGJA 4GXFA 1DP0A 4XX1E 2KH2B 2MMXA 2GK0B 3D9AL 5ANMB 3PYCA 4PMEA 5AOLA 4ZZFA 4LHQB 4NBZB 2ZICA 4YLCA 5GS0D 4XCNB 4OZGB 5D7JC 3C6EA 2AQSA 4ZS6D 1M57B 2XN9A 2IBZX 1A4CA 1PLGL 4HJUA 2X10A 2A83A 4XVTL 4HS6A 5LWYH 1CBVL 5DMKA 2RJMA 4M1GH 3VD1A 3KXFD 1NOLA 2VN4A 3C5ZA 2OQJB 3QQ9C 3N1GC 3FO2B 3ZDZF 4UOJA 1QSFE 4MQXC 3C08H 4NQED 5TDPB 3WIIL 1CE6B 4PTUB 2X7LB 1NCWL 2CLZB 2D7MA 3BH4A 4FXKC 2J6EA 3UP1A 4E9TA 1RZJH 1CDIA 1NTDA 1N6UA 2ZKWA 1S7XB 2C8NA 1CPUA 4WK4B 4AEIH 2BPBA 4HC1H 3KYKL 3MREB 1JXFA 2GUYA 2AQNA 5E8OB 2AVGA 3W11C 3KWTA 3KL5A 4UZUA 3VXSA 5J7CC 3LAFA 1YEHL 3FUDA 3SQRA 5BUPA 1CGXA 5JW5A 3BN3B 4L4TD 5CU9A 2MWCA 4H8WL 2Q0ZX 1F45A 3DO7B 2V17L 4WUUB 2QGCA 5IB1B 3QQDA 4QEGA 3TF7C 4ODXB 1OQXA 3K1KC 4Z7VA 2QADC 2J6EH 1E27B 1S46A 3IJHB 3P0YH 1EJ8A 3FYEB 2A9AA 3RFZC 4NNPL 3BISA 3VW3H 3LQZB 2E56A 1J5IA 4L3EB 1TQSA 1J8HE 3NP4A 5HP5A 1DQLL 4Z7UB 3QXVA 2DWXA 3BQUA 1LEIB 4LEXL 2IDFA 1TKWB 4TSCL 1Z3GH 1R3HA 1EO8H 3AG2B 4I1PA 3MRMA 3VGAB 2D0HA 1C08B 2DQEH 1I1FB 1RKRA 4U3SB 4YDIH 1GGUA 4F8NA 3UG3A 5TGBB 3IN0A 1IGJB 5FA4B 3P9MB 2FO1A 3QDJD 2FX8H 1U8NA 2ZX7A 3DROB 6FABL 3WXWL 3MOBL 5E2UL 5C0JB 1X5GA 3CCHA 1P4BH 2COVD 4YL4A 3BKJH 2PPCA 2BVUA 3SDDA 4DESA 2YQBA 3ESUF 1ZWIA 4Z76B 2KQMA 2WXNA 5EWIL 1CF8L 3M8OH 1UWGL 4I3RL 4Z7WA 5T5FL 1WAEA 4G8GD 5E51A 1FPTL 1ZA6B 3NG5A 1EX0A 1E9QA 2FDBP 2VN7A 3DTDA 5GRUL 4HS8H 5KBDA 1F4YL 5BO1L 5MENB 1ZGLP 2BSEA 5IMOB 4LE8A 5EZIH 5DJ8B 3T08A 1RHHA 3JWNC 3ZY7A 2QJDA 1SFHA 1G7MA 2DWEA 2APSA 1KNOA 5CN3A 4NI6A 3D4ZA 4PJHA 5I0VA 4B7IA 2IC2A 3NIDB 2LQRA 2NLJA 1EXGA 4ODTL 3KWWB 3A4FA 5DJ2B 5EUOB 5F9DC 2AV7B 1VFAA 1VA9A 1XCQB 2B5IC 4GBXD 2AJXL 4U1LA 4F57L 1THAA 4A55A 2BSRA 4LCCA 4Z7NF 3D9AH 1IBFA 4P48A 1TZGL 1IM3A 3V8OA 4GQ9H 1HOCA 5HYQB 4MXWL 4KO9A 4BHUI 4CVZB 4BQ6A 3W38A 2COQA 4HUVA 5DVNA 1BEYL 3IM1A 4NNXB 2E59A 1D7DA 5GRVL 3T5WA 3RAJL 1HEZA 3WBDA 1PLGH 4K7PL 3ZHKA 3RNQB 1XIWC 4A7GF 5DD1L 3MYJB 4JY6A 4UOW1 2XKNA 2OCCB 4H20L 3S37X 1K6QL 2HPTA 4XXCC 2RB8A 3MV7B 4GXUN 3FSZA 3NQKA 3WIIH 2ATPA 5D72L 3KPRA 1NCWH 3LIUA 3V9FA 4A7VA 4Q6IB 4FXLA 3SE9L 2A74C 4P2QD 3ILPA 4Y7OC 1WSST 1SHXA 1B3JA 4M29A 2CM5A 1LP9B 1V5JA 1ROWA 1EZLA 1YEHH 1A7NH 1X9RA 2R9HD 4U0RB 5D1ZD 2UXTA 1Z9OA 1IRAY 1AO7A 3QA3B 2O6DA 2NDFA 1DBKH 3FUEA 4H8WH 2X44D 4PJ8B 5H4ZA 2V17H 1F3DH 3AZUA 5GS2D 4D94A 1E4WL 3UTTD 1O7VA 5CJXC 3MLYL 5AB2A 2WWNA 3KPSD 4PJEF 3NCYS 3VI3A 4JEGB 1XGUB 1QBAA 1RD6A 2PTTA 4JFEB 4NNPH 1JXKA 3TO4B 3GXUB 4AQEB 2X4TA 3LZOA 4E41D 3AXLB 5FXCH 4WGVB 5KUMA 1F2XK 1P4LA 4F7MB 1DQLH 3MUHL 2ODIA 4LEXH 1UH4A 2FX7L 2K1MA 1CFSB 4TSCH 3QEQB 4TM9A 1A9EB 4N5UA 4IDJL 1D6EB 3O41A 3RI5F 1FG9C 4N8UA 4RA0C 3GSNH 4ZUVB 5GZOC 1JV2A 2VJ8A 4WEUD 3US9A 4DN4L 2GITA 4KBPA 3IGFA 6FABH 1BYOA 3WIHH 3MOBH 3QDGB 5E2UH 1EPFA 3D25A 2E7MA 4XI5C 3T0XA 2O6CA 4HPOL 4Y1TA 4LCWE 3WUWA 4QRUA 1WLHA 3GRWH 1JYWA 1WPCA 5H37G 5KZCB 3QUZB 1CFQA 1DVQA 2NY1D 5EWIH 3GLDA 1CF8H 4Y16D 3S3DB 1GXEA 4I3RH 3BD5A 4HGWA 5T5FH 1HCVA 4IU3B 1FPTH 4X99A 4JM2B 4BFRA 5GRUH 4AL8L 1F4YH 5BO1H 3WUZA 4CGTA 4PRPA 3LZRA 3CXHJ 5HHQB 2VJXA 4NENB 3HRZB 4MA8L 4WHDA 5AW5B 1H5BB 4P5TC 3MA9L 3A24A 1KLFB 2XZAL 4NKOA 2F0CA 5GRYA 4EUPA 5F6IB 4K71C 3VVWA 4I88A 4ODTH 1MIML 5BZZA 3HZ3A 4HZ1A 3IDUA 1KYAA 2WNKA 4DQAA 1CXLA 2Z4QB 1T83C 5I8OL 4F57H 2RALA 1KTRL 1XH3A 2VDQB 4TS6A 3ARDC 5AYUL 5K93A 3QUML 1TZGH 2AFNA 3B9KB 3WNJA 3OJVC 4R6UA 5IVZB 1AS8A 4P07A 4G82A 1M7DA 4JRYD 4MXWH 3K2UL 4YDJB 4GW4B 4I5BA 4N2IA 3RGBA 5I1LA 3MUJA 1BEYH 3EH5B 1FC2D 2EKSB 2MOVA 3OAUL 3AQZA 4K7PH 4P9HC 2JMRA 2HP4A 1OZTG 4EXKA 3T0ED 1JK8B 2M83A 3ILDA 2OYPA 2C7FA 5FA3B 5IT2L 5JIIA 1K6QH 4Q97A 2LV4A 4M93C 4ZTEA 1RJZB 5CGBA 1AKPA 1AZCA 1OE2A 4PY8I 3RILA 4WI8A 3HB3D 3NFNB 4B50A 3IJSA 1CB4A 3FTVA 2PABA 1ZT4A 3P9WB 4M1DL 3VG0H 4DEPB 4HF5L 4Q9BA 3ASOB 2NW2A 3QGVA 3LPPA 5CCGE 5T1LD 4G2AA 3SE9H 1O7DC 1K8DB 2VSCA 2R0WL 2ZXQA 4N6RB 4W93A 1MQ8A 3IJYA 1GC1H 1DBBH 2HG5B 1KEML 2DEXX 1G9ML 1S7UA 2CAKA 3F62A 3NZSA 4XXWA 1NGWB 4Y4FD 3SZ6A 4JO2H 1FN4B 1ZXKA 3GMNB 4DGUA 3PP3K 4MAYA 4QHKJ 4OB5L 3ZKND 3D69A 4O4YL 1A5FH 1PDKB 1XCTA 2I60L 3OKDA 1B3IA 3LJ3A 4KO6A 5DK2B 4Y4HB 1YPZA 4YOKA 2XJKA 3G9VA 2K45A 2ADGB 1E4WH 1FNSH 1KB5L 3K3QA 2FEJA 3MXVL 1GA2A 1OGAA 2CPUA 1J9RA 3H7BA 4LCIL 4MZ2A 1R47A 4KJQC 2IWGA 1S78C 3IDMA 1TJXA 4UZSA 3FNKA 2EIBA 3EZ8A 2FX7H 3UZQB 4YXHL 1SMOA 4IMKC 4FA8A 1HXKA 4IDJH 3S4SG 5IJCC 3BH8B 2WSDA 2O1AA 1ZGLB 1YEDB 1YJDC 2EDLA 1KXTA 2OLDA 4JZJA 2K7QA 5HDRA 3K8KA 4BA8A 5JOFA 5DRZA 2OSWA 2CLVB 2R69H 3ZMNA 1PL3A 4AXWB 4R2GB 2Y07L 3Q7JA 3PV6B 4R7VA 4HPOH 1PY0A 4PS4L 2Y25A 1IARB 1UD3A 3OXRA 3VXNB 2G30A 4ELME 1AS6A 4EZJA 2OMYA 4AYBA 1LEGA 4F8OA 1AGDB 3V0IA 4OH2A 4IU2A 4OF7A 1FIGL 3WY3A 4HEMA 2WBJB 4QMEA 2BXZA 4E5XG 2J12B 4Z3TA 4EMZA 5ADOL 3TBYB 5FECA 4H25B 3CVIL 3TA3B 4RBPK 4H0GA 1BQLL 1QSEE 5DC4B 2BNRE 2B8OT 1MWAH 4H8HA 4PV1C 3CFCL 5CF3A 1N9PA 4EBQL 3MA9H 1EEUA 3BYYA 3VU2A 2O6EA 5BS0B 4JFVA 3GO1L 5DRWA 1AI1H 4HJ0D 2CRIA 1OPOA 3CQFA 2RA1A 1MIMH 3SCMC 3EH4B 3CUPA 4KJYA 3SEPA 1CFMA 2X1PA 4GG8A 3BZEA 3HAEA 4YSUA 4FQJL 1UWFA 5F44A 3OPUA 5AYUH 1PYWA 5LNDA 3QUMH 4X7CC 4C56E 2DJ4A 3BGAA 1NFDF 3QZWA 1JK9B 2Q7YB 4MJIB 3STZA 3B4NA 5I5MA 4CC4C 2ED7A 3LNEA 1CLYH 4XXDB 1H8SA 4B5ZA 4F15B 1OAUL 4FTVE 4PJBE 1BFTA 4U6XB 3ZGHA 3EJJX 5JPNA 4UTAH 3OAUH 3RTQB 3SIKA 3T77A 1SDDB 4P49A 4XCEA 1FZOA 1TQCB 3VNZA 4Y1SA 4K3EL 4XNUL 5EOQL 4BDVB 3BJ91 3AVEA 3CG8A 3QIWD 3QUYC 5B1BB 3ULVE 1K2DA 4IK7A 3FFOA 5AAMC 3RVXC 4YHZL 1JZ8A 2WD0A 3BWAA 3MJ8A 5DC2A 4M1DH 5L4JA 1I8KA 3NA4A 1KB5A 4N8VB 5C0BD 4HF5H 1EAQA 1X7TA 3H85A 2BCKA 1U8LB 4UQ9A 4E0RB 4FLRA 2R0WH 2Y36L 2XCMC 2XWBB 1E43A 3D39B 1F86A 5CILL 1HXMA 1CUOA 1KEMH 2UUDH 3PHAA 1G9MH 4J8RA 3TO2A 1Y6MR 4E42B 3HS0B 4XP4L 1KCUL 3VXMA 5ITFA 4LU5L 5F2FA 4XPHL 3KGRA 4OB5H 4O4YH 2I60H 3HLKA 3IFPB 5I0YA 4PJ5B 2GSIB 4JUSA 3ARPA 3EUDA 2V7NB 4Z7VB 3HZYB 4IKLA 1KB5H 1KWGA 4RDQG 1ZJAA 3BHBB 4ZFFA 3EF7A 3SGEI 1XTMA 1AGEA 2OSLA 5DHYB 1HHIB 1Y07A 3NFPB 3U46A 3O4LB 5M95B 1I8MA 2BSCA 4WUKH 1QR1A 4LSUL 4MFHA 4CDGC 3MRMB 4F37F 1CFNB 3F12A 4OV5A 1OSZB 4HCRA 2D3JA 4D8PB 3N44F 3QI9D 4DQOL 1E65A 3BLPX 5IESH 3NIFF 3JSSA 3FQNB 4HIHA 4OSUL 1NBCA 4RDBA 4U1HB 2Z7UA 4WFFD 4D0CA 1NL0L 1COBA 4WTXA 3DYPA 1W8NA 3JWDC 4IQHA 5IV2B 4S1QL 4JX0A 2VISB 4F9PA 5IQ9B 4FMKA 1I7ZB 2Y07H 4JO1H 1VGEH 4R97B 4PS4H 1WIOA 2VDRH 3CX2A 1JF1B 1T2JA 4MNGE 3IGAB 1XF1A 4IKJA 4Y4KC 4NQQA 1M6OA 1X5MA 2VXVH 3P11H 1E9QB 3L3GA 1INDL 3PAYA 5HI3C 3PF2A 1CU4L 1FIGH 3O81A 4PRAA 2WVTA 4HJJL 1A4JB 2HFGH 4R4BB 4XNBA 1ACCA 2JNZA 3FRUA 3MRJB 2BVYA 3CVIH 3PFQA 1KIPA 5DJDA 3TF4A 1BQLH 3QPQD 1KNOB 1B4JL 4HSQA 4UYQA 1A02N 1AZUA 3CFCH 5JPMA 2XLLA 3CC1A 3BUTA 4GRLD 4EBQH 3FHQA 4A2EA 1IL1A 2A5UA 4FG0A 5D8JL 2NLJB 4MB4A 2WUCL 4MXQD 3IETA 4WJG3 5C07B 4N0UB 5FYJL 2VDLB 2DYSB 3G5YB 2BSRB 1MHCA 1UWXH 3EOAA 3FO1A 3WS6A 4X7SL 1GYAA 1UM5L 1T7WA 2P5ED 4X4ZA 4ENEC 1IKNC 2ATKB 3TBWB 4OFYA 1OP5H 4IHOA 1CO1A 4NO0B 1GGIL 1A4BA 2HJFB 4K9JA 5HBBA 5DJ6A 1BQHG 4WAFA 1QO3B 3F3HA 3V6OC 5CFAA 1VB9A 1AMYA 2LTQC 5F7EL 1DFXA 1FZMA 3A67L 1ZS8A 4JJ5A 2FQFA 2OMWA 3WENA 3BQUD 3BVDB 2CKBB 4K3EH 4XNUH 5EOQH 4NO2B 1BOGB 1IBZA 3KPRB 2PXYB 5F7NC 5GGTL 4YHZH 3QUHA 1R5IB 4QXGL 3V10A 2R0ZL 2XVBA 2WXHA 1NCAL 3QXUA 5LAXA 1SN0A 3OD3A 2AKRA 1QLEL 1FFOA 4OLVL 1XH1A 3QJZA 4JQXA 4U0RC 4E68A 3TL5A 4QRPD 3EFDL 1WE5A 3BP5A 4NQVA 4XP4H 5DURB 1KCUH 2DEWX 4PJ8C 3MA7A 4LU5H 4XPHH 1CR9H 1ICTA 4HOWA 2IQAB 3NTCH 4NJAH 2F7IA 4Y1AB 3V5KA 2D73A 1JWMB 3CN0A 3HG1B 4BBWA 3NA9L 3W9DA 3PHSA 2ZSWA 4ORZC 2BSED 2B14A 1DUZA 5CU5A 1MFUA 3FQXA 4GAGH 1RURL 2M26A 2KDGA 2AK1L 2FWLB 1XH2A 4JCLA 2XV2A 4GW5B 4LSUH 4PJ9B 1NPNA 2QBWA 3MODH 4ZMXA 4XT1C 5LGYA 1K85A 1VADA 4LL4A 1KJ3L 4DQOH 4BFIB 3QDMA 2ZP0T 2OMTA 1AQMA 1HL8A 2DBLH 3GZOA 2B3RA 2CO4A 2GITB 1DE4B 4OSUH 3DHJA 1NL0H 2NYKA 3FN0L 3GLZA 4JFZL 2WKOF 4G70B 5KS9E 1EAPB 2QKSA 2QPSA 3OKMB 5FAAA 3QUZC 3TN0B 2WZPD 1E2ZA 3RGVC 3RWEA 4BFNA 8FABA 5HPMA 1RSYA 2ERJB 5D70L 3SZKC 3MRFB 1SJXA 3WMQA 2ZF8A 1BLNB 3QARA 5TQ2L 2OJZH 4I3GA 3BD3A 2E74C 1PQZB 5GS3A 5BW7C 3RUGB 3APMA 4UT9L 4YR6A 1UH3A 3HRZC 3KS0J 4RZKA 2P8PB 4HJJH 1UWEL 3NJHA 1H5BC 4UNIA 5FF6A 4XPFL 4ZNEE 1AG6A 5MEQA 2GQHA 1JPFA 3FZUD 1H0DA 1MJ8L 4POUB 3SPJA 4GO6B 1JZHA 3GXNA 5DMIL 5H37H 3G5WA 2GTQA 1J8HD 3K6SA 4N8CL 5SWQB 3CDZB 4L3AA 1SEBA 4LL1A 2D03L 4R83A 4GP4B 1FFPA 1OO2A 2BIQA 3GJFB 4G8EB 1G9EA 5FYJH 3WAJA 3B9KC 3GT6A 1SVBA 1YG9A 1UM5H 4BFGA 2NSQA 2EXYC 5HDLA 1AO7D 3SBWA 3JV4A 2ARJA 2B7DT 3RHWF 4WO4D 3WLWC 2AJ3B 2OJEA 1CFVL 1FLTX 3P4MB 3DSNA 4HDIA 4WI4A 2ZWLT 4X6DF 3BUYA 1A1OB 4YZFF 5F3HB 4C83B 4CSPA 2X1OA 4WTQA 2Y2YA 1CF1A 1NGYA 4FNQA 5D2LE 5EU6E 5CCKL 4UU9A 2ZAGA 4JDZA 5DT1L 1OGSA 2GIYA 5F7EH 1G94A 5KYWA 3A67H 3FH5A 4G9DB 4PY7B 1XGTA 4QRSB 5TF1H 4ZFZA 4WWNA 3HW7A 1U4EA 3T4YA 2XDHA 4DEPC 4Z7OB 2JFCA 1ZT4B 4GMTH 4ODHL 5GGTH 4BUHA 4K94L 5AW3B 1LO0L 1F13A 1XQ4A 1ZEAL 1AIZA 4XNAA 3AM8A 4YDKL 4QXGH 4Q2ZB 2R0ZH 3BWSA 2UX7A 2VQTA 4OLVH 4H5SA 4WI9A 1J10A 5J3HC 3U82B 5FK9A 3QRLA 4PH8A 1BWWA 2H0EA 2JKWA 3OL2A 3FT1A 4XMUA 2XWXA 3RFRA 2W65A 1AD9B 1R24A 2CMRL 3PL6D 5IOPA 4K2UL 3QAZC 1XCTB 5E8PB 2NX5E 2UZYA 1PIFA 2MNUA 3T9WA 4QO1A 4EEEA 4X4ME 4KROB 5TH2B 1Y18A 4MRBA 4PFEA 3NIGB 2X6MA 5GGVL 2R1XA 2CDGB 3NA9H 3LS5L 5DJXA 5C92A 3ZIYA 1UWYA 4PRPD 4JFXA 4JZOA 4TTDD 1OEZW 2IPKA 1EEZA 5K59F 4W1TA 3Q5YA 2ZXCA 2EE6A 4NKDB 4V2BA 4JJHA 3ZDXE 2AK1H 5E2VL 2V2TB 4M7JL 4X8XA 4R5TA 1YMHA 3W5MA 2C3GA 2NNFA 3ILEA 4TNVK 3SYPA 1ZHLA 1MHEB 3IAPA 3O9WB 3WO4B 1JCVA 4H8QA 3I6GA 4M56A 4UT9A 2GSGA 3D4YA 1KJ3H 5DJZB 1T80A 1FVEB 5BOPA 4BHUA 1PD0A 4O2CA 1AZRA 3MNZA 3IS0X 1BP3B 1NC4D 3AACA 4JFZH 1WA2X 3NZHL 4FNUA 2CRZA 2X40A 3W2DL 1H8LA 3CHXA 1CK0L 4XN8A 5J56B 2OULB 3DX8B 3UTQB 1TZIB 3L9RA 1MRFL 4JN1L 1ZIBA 1SLWA 1TETL 2ED6A 2EDYA 5D70H 3RX5A 3K81A 1EXUA 3I6KB 5J6HA 4IU2B 2Y2WA 5K9QI 4LVEA 5TQ2H 3LYRA 2IPTH 2WKGA 2VLRA 4UT9H 3MBWA 1OHQA 3L3HB 5FECB 1UWEH 3HG4A 5T33L 2F1EA 4I18B 4ZFOA 4XPFH 4DCQB 4PAZA 1LILA 1OW0C 4L4VB 2FHFA 4QXUH 2K8QA 4DK3A 4JPKH 5DRWB 7FABL 3MV9A 1QHQA 5FYKL 3CXDL 1M7XA 4IKIA 3MDJA 3ZQ9A 2Z0BA 5EV7A 1J8KA 4N8CH 4ZX5A 3M6DA 1KACB 4NZUL 2D03H 4RRPA 3SKOB 1F3JA 3FB8A 3N42B 4P2OB 1FO0B 5I1HH 2RMNA 2YPKB 3TTYA 1L9TA 5FO8A 2DYRB 3GMLB 3QCVL 1GS8A 4X6BB 1L5GB 1MAKA 1NBYB 2DOCA 4F15C 1CFVH 3QUGA 1GKEA 1WBXA 4WI0A 1IGYA 1UFUA 3ISYA 4QHLB 5CCKH 3ZMEA 3R06B 5DT1H 2C1PA 5D7KD 4POZD 1JGEA 4I0PA 1YRKA 4R90H 2O72A 1A3QA 4HKBB 4U7MA 1E9OA 4GY4A 5L6YH 3C09B 3PABB 5DQJA 4IOFC 4NQDB 5IB4A 2W60A 3BWAB 4ODHH 3IJ8A 2XV3A 2D7QA 3MJ8B 5GGSA 1YMMA 2E4TA 3V4PA 1CE1H 4P3CL 4X42A 3WFHA 1ZEAH 7PCYA 3GJFK 4OLEA 4PJFE 4KDWA 2XNAB 1X5ZA 1KCWA 4J27A 3QCUL 2BCKB 3TCTA 4PJAB 1AS7A 4DETA 3MUUA 3HS0C 1NDGA 2YXMA 3RRQA 1J1PL 1QZNA 4J8RB 4CKVX 3ERXA 1CGVA 3SY6A 3VXMB 3ZE2E 2DQDL 3CBKB 1DN0A 3LKQA 4MLIA 5EO0A 5IZ7A 2CMRH 3NSCA 4PJIA 4K2UH 1D5BB 2IALB 3FHAA 2BNQA 1PZAA 1KTJA 3TNNB 3BDYL 2YAQA 1JYVA 5DZAA 5I8CA 4FXGC 4MS8C 4JHVA 1BVLB 4PGZA 2MQ0A 5LXGH 3E8UL 4Z0XB 1IVLA 2ZYSA 3TFBA 1TENA 1MCOL 4LLUA 1AGEB 2OSLB 3T8MA 1AZVA 1Q90A 2A77H 4DW2H 1U95A 3HUJF 1RZIA 3L3KA 2QGBA 4MD4B 5GGUA 2F8OA 4XP9L 4M7JH 2BS71 1FDLH 2YQ2A 4U05A 2Q8AL 5C0CB 1P6WA 3AS2A 1ZCRA 4NS0A 5A7BA 4HIHB 2VERA 3VRJB 3RYMA 2ZUUA 2DICA 1AE6L 1OP9A 4HWZB 4M7LT 4YDLB 3OHMB 3MLPA 3NZHH 4AJVA 2QFPA 3K8LA 3NABH 1D9KB 1CK0H 1FYTA 3PWNA 4WW2A 1H3WM 2R56L 3GMPB 5I8EA 3CLEL 1MRFH 4MWFB 3W0WE 2VO5A 1BD2A 1TETH 2C3VB 3MBXL 1AQHA 3WEAA 1KZYA 3VNYA 4YO0B 1I3GH 2PMZA 3BVNA 3I85A 2X1WL 2VAAA 4TUJB 3OC5A 5AW7B 4BH8A 5D7IB 4ETQB 1VFBA 1XR8A 1NEZG 3M88A 3QWOA 4G9FE 5DJDB 1K4DA 4A2FA 2M8XA 5T3ZE 1V7NH 2XG5B 3VU1A 3GMOB 5F9JA 2YD0A 1E3ZA 4RGMC 4DKEL 1AC0A 2XQ0A 3V95A 7FABH 5FYKH 2IWFA 2NTFA 4J28A 1ZV2A 1SF3A 3HKFA 3GSOB 2EQDA 5ERWB 5FCUH 2EUXA 4NZUH 4HAGA 4CVXA 3FQWA 4F2MA 4Y5YA 3SQOL 3C6LA 3BP4B 4IBLT 4R84A 5EBGA 5DMYA 1DUYB 2VQ1B 1X4YA 2EC9U 3IB4A 3QEUB 4UQIM 2AK4B 4ZNCD 3OZ9L 4ZQKB 1T66C 3BZDA 1M1XB 3QNYB 5L2JA 4TQEL 4WV1A 1TMQA 4ZYKA 4U4IA 2EEDA 3HE7A 3NFSL 1K4CA 2J56A 3MJ9L 4YHNA 3W81A 2FLMA 2DQMA 4J4PA 2WLNA 2B4CH 1E67A 3SDAB 1JN6B 4P2AA 3G5XB 1I9RL 2YPLE 2PXYC 1RPUA 5B1KA 2BWDA 3SGDI 5TE7L 1L6XA 1CXHA 2F53A 3R7RA 2ESVB 3GSXB 3CZFA 3V7AE 1SBSH 4P3CH 4XMKL 5HGBB 2XQYK 4HIIA 3KPOB 3WKNA 2J55A 1NUNB 1QSED 3QCUH 4U3HA 2BNRD 3TH4T 5DK0A 2F74A 3EJZC 3OLIA 3LIZL 5JIQA 1OHZA 5LNEA 1J1PH 4BK8A 1Q9KB 3BP5B 3BUBA 3FH8A 4NYLA 5D1XE 5FHBL 3VMNA 1LK3L 4HU8A 1QUPA 4LKXA 1Z9MA 4PMFA 5IG7A 4WFHE 4Z7UF 3M45A 3BO8A 5E1HB 3RZCC 5K9QG 4P4RA 1ACYH 1JMZA 4AYFB 2EIZA 4ESKA 1O6SA 4XNQA 2VMDA 3X1FA 4QXVA 4C56D 1A7PL 2AV1A 1WJ3A 3CSYA 5CIPA 1LNUB 3E8UH 1DUZB 2YK1H 1FNLA 3FQXB 2YEZB 1H6FA 1MCOH 2A73A 3FTYA 2R0LL 4PJ9C 3VXUE 2D7TL 3DX7A 1IEBA 5IJVA 5C0AB 2N0MA 4FTVD 5IVXF 4R9HA 2HWZL 5B21A 2FATH 2NOYA 1T5WA 4WHTA 2D0GA 4AEHL 4MQTB 1N8ZA 3U9UB 4M8UA 3GSRB 3WE6B 2A4CA 5FKPA 4HOZA 1KEGL 2Q8AH 4LQ1A 3O2VL 1N59B 3MCLL 4ZUUB 5BV7L 2QDWA 3O3DA 5EHFA 2K6YA 2LABA 3EUUA 3BW9B 4X6CE 2CHNA 1NFAA 3ISRA 2D3VA 2NYYD 4S1DD 1NM4A 2IAMA 2PYEA 4AT6B 4M62H 4OFYD 4IRJA 1OTUD 3AU1B 1DN2A 1L0YA 4X4KA 1M2VA 5L2KE 3BQVA 3TIEA 4AEFA 2DJSA 2R56H 2DM4A 4NAMA 4ZW6A 1YYLL 4PBWD 3CVHB 4X0KA 3ZHFA 3MBXH 3HVNA 2RIKA 3ARFC 1A0QH 4YPJA 4I2XE 4DUXA 2BM3A 5FV1L 3NIDF 4U6YB 2ZUVA 4FQ1H 4TNEA 1HHGA 1N0XH 2GCYA 4YWGL 3TEUA 3KLHC 2F5AL 4JM4H 2P7TA 3OR7B 1NC2B 4YLBA 2YD4A 5T3ZH 1INEL 1KC5L 1H0DB 3WIFB 3K6NA 3QXAB 5A6MA 1GYCA 3VSUA 3H1ZA 3MJ9A 4QRTA 4P46D 4NC1C 5AUMB 1BBJA 4XN2A 3K6SB 4KNQA 5BZDA 1VF5C 4HYTB 1E5AA 3I6SA 1JE6A 4NDMB 5INDA 2F54A 4JFFE 3L5IA 3SQOH 3FCTB 4LLDA 2DIEA 4OFVA 3TOPA 2VXSL 4PR5A 4KVCH 3RVWD 4UQBA 3OZ9H 4X6FB 4Z77B 3CDFA 5D9SB 3ZTJG 3HNVH 4XC3H 5HJGA 2E9GA 3IDNA 4TQEH 5D96C 3DSNB 2CIKA 4UQAA 2XWDA 3POHA 5ENWA 3V4UH 3WKQA 3IDGB 5AAWC 3NFSH 3LIZA 2KKQA 3GDCA 3WGVB 2F6AA 4U1SB 3VGEA 2OYKA 4CNIA 2KPWA 1L3NA 4WDIA 1I9RH 1ZTXL 4NRZA 5DFVD 3QBTB 1LK2A 1LP9F 1TZAA 5LB1A 1ASQA 5I6KA 1ZTXE 3ZKQD 3TPUA 5ID0A 3KXFB 3GBMH 3ESOA 5JORA 5C0EB 3R1GL 4XMKH 4NQEB 2DQCL 3S0PA 5D4IA 5FB8B 3WTUA 4FL4C 1Z0MA 5FK9B 4JVUA 4MA3A 4P23B 5HVHC 1GYVA 2WZ0A 2VRAA 3S96A 4JY4B 1BF5A 4IJTA 5AB1A 3WJLC 2AJVL 4YDZA 5F7WC 3B2UC 2WJ5A 1UD2A 5FHBH 3VA6A 1LO2L 3PGCB 2UZYB 3KYAA 4FFVC 2EVGA 2QL1A 2V5TA 3FF7A 4AYDC 5E24E 4HD9A 1SOXA 3EFOB 3L2MA 4K7FA 5FYJD 3VGBA 1Y18B 2BVQA 2ZUWA 4X5XA 3UJTL 2Y7QB 4FLOA 1UM4H 5B8CC 3PE9A 4I8DA 4L4TB 1ZLDA 4M3JA 4V1DB 5DJXB 3FAXA 1F90L 1JXGA 1MI5E 1AAJA 1JV5B 1B4TA 3L7FA 5F3BB 2IPKB 4JGMA 3ESMA 5FGRA 2VRQA 4S1RL 3GSUA 1QTPA 4OUOA 3SHSA 2D7TH 5ISZA 1ZHBA 4Y9BA 2HWZH 4PV9A 1W0VB 5AVSB 5H4YA 4AEHH 1OSEA 1T20A 4TVPE 1KEGH 2GSGB 4ZJ9A 4XOEA 2AZUA 1VFOA 1A22B 2WVSA 4RFEB 1U8QB 2D31A 2CHWA 2F7QA 2R1WA 4ZPTA 2YD8A 2XYCA 4YEEA 1E3XA 4JM2F 4JPIA 3FH7A 1JI1A 4NGHL 4MRCA 3VFOA 1C7SA 5GJTH 1DEEA 2NNCA 3P4LA 4L48A 4OF6A 4M7ZB 4YGVB 3PUUA 3LEVL 3D1MC 1EXUB 3OGCA 3FT4B 3Q13A 3ALPA 4KHXH 2Z64C 5IUSA 2DJUA 1KJVA 1SLXA 4JRXA 1X6NA 1AIFA 2VLRB 4YWGH 3QO1A 4QTHA 4AMWA 5AAPA 4I18C 1WH0A 4EI5A 4B9GA 4FE9A 3OSKA 3B5TA 3AWEA 2WP3O 2ZD0A 4J39A 3M17B 4FCHA 1BFOB 1EEQA 4G8GB 1OVZA 4ZFOB 1KC5H 1CD9B 3FTXA 3PU7A 1ES0B 1MG3C 5DQ9B 3VH8G 4CAGA 1G7LA 4TRPL 3VI4E 1T1WA 3FU7B 1I7RB 3HEIB 1F5WA 1RJYB 2E86A 1C5BH 1OARL 3DIFB 4NQXB 2YHGA 4OU3A 4AG4L 4ZUSA 2P5WA 2HJLA 3FB8B 4X9YA 3X14A 3QRFM 1KN2L 4P2OC 3BRGC 3CFQA 4MDIB 1DQVA 4MJ5B 1VRSA 4YFLF 1CGYA 2ADJB 2RAMA 4LQFL 1O7DE 4PJCB 2W92A 1R3LB 5AVVB 5HHVL 5IJKA 2NYZA 4L0ZA 1AGFA 4GBXB 2HRLA 1T5XA 4QHPA 3SE4C 3BXNA 5EO1B 5KBLA 3ZVVA 3SKJL 2XXGA 2Q3XA 4U6HA 1CVSC 3FFDB 1LEKB 1HHJA 1CYWA 2PPFA 2VW4A 4Y2NA 4V11A 4Z3HA 4OT1H 3U2JA 5MEOA 5EPMB 4IBYA 1E9OB 2IANE 3MYZA 1ZTXH 2E7DA 4PRHA 3BN9D 4IW4C 2AI0L 4J3VA 4B9FA 1H3XA 1FCGA 3BKYL 2Z7YA 4PJDB 5CZXC 4OFQA 3R1GH 2DLGA 1SOKA 2XYBA 2DQCH 2Z8WC 3TJEH 3G6JA 3S8GB 1F00I 3T04D 3C60D 4PJXE 2FJGA 2JKSA 4M1CC 2ATAA 4PB9L 4JK0D 1A9VA 2ENPA 3BCDA 5LGHH 2CBTA 3MZGB 4Y2DA 4Z7AA 2VDKL 1E5CA 5KVEE 1LO2H 4AGLA 5FGBC 1XL6A 2GJ6A 2DKSA 2WCSA 5FYLL 3S5LG 4L2LA 4XRCB 4F9LA 1I4FB 4KKLD 5FYLE 5D1ZB 3H9HA 3UJTH 2VLLB 3R4DA 2G75B 4Y5XA 3AWGA 1TJGL 2VN6A 4ABQA 1JIBA 1RI8A 1U3ZA 4FHKA 1LDPL 2VLJE 4OGZA 3KJ4B 5JW4M 1XF3A 5EU6D 1LO3L 4XMLL 3IMUA 3KPSB 2FWOA 1RZIB 2VJ0A 2WCPA 3HMXA 3NDYE 2CUMA 3Q2WA 1MVYA 1MFNA 1HCFX 1WCQA 5GHWH 1U8KA 3O0RL 1T1XA 3S3SA 2DLFH 4BK5C 1KMGA 3NPZB 4GG6B 4NIKB 4MD0A 3L48A 3OAZK 4MCYA 4BZYA 4P5MB 4HULB 2FECI 1E40A 4L8SA 4ODVL 2V9QA 1D9KC 5F88B 1TOXA 4Z78B 3KPPB 3RP1A 5KJ7E 1RAMA 5E7FA 1KTBA 3ZYJA 4NGHH 4LLVA 1RJCA 2Q6WB 3H2QA 1YN7A 4KRNA 3GSQA 4N2HA 1U4FA 4L0PB 3LEVH 1U8CA 3L1OH 4QJ3B 2H6PB 3ZRFC 5FGCB 1G9NC 5TDOB 5J4MA 1OZUA 2NX5D 1O5PA 4KDTA 5IW6B 1NEZA 2W07A 3DTXA 3LKOB 5EU4A 2YBRB 4H4NA 4HSAC 1FZJB 5JOPD 2YZ1A 1VFBB 1JHLL 2QVTA 4LGRB 2VRKA 2YSSB 2XFXA 2EYRA 4QGTA 4W70A 1IGFH 2WLIA 4DZ8A 4JHAL 4XO9A 4Z3GA 5C0RH 1JZ6A 3B9DA 1WBZB 1DFBL 2GC4C 2VNCA 3E38A 5I1DA 1HHKA 2H0PA 2WWMC 4OD3L 2NCEA 1S7VA 1T5KA 1CLOL 3JQOB 4MDJA 4TRPH 3WJJA 2XTJC 4UAOC 3D0LA 4DOHB 4U1NA 1OARH 1ZLWH 3C9NA 4AG4H 4B9YA 5DRXB 5GRWA 5A2KH 3G6DH 1L4IA 4KKAC 4QOKE 5I19L 2EVIA 3HI1B 3KZ8A 1NMAL 1BFVH 3H53A 4L0YA 4HJ1A 3GI8L 4MJHA 5E4OA 4LQFH 1QNZH 4ONHB 2J57A 2BNQD 2LR4A 5AOIA 3SKMB 5L2JB 5IVOA 5EC2A 4HCIA 3HE7B 5K5YA 1A6TB 5I71C 2MQ3A 3GF8A 3HN5A 3QR1A 3LS4L 5DEGB 5ICXB 3SKJH 2Y5EA 4WNSA 3RDTD 3SDAC 3LEYL 1R5VA 3FTZA 2GHWB 4JRYB 3GI9H 5ES4B 5AZ2L 2IFGA 1Z9SB 2AW2A 3CSPA 4OR1A 4KKCD 4N0YL 4JKPH 3MRNA 4NUJB 4JFPB 1C5DB 1U8MB 4PGDA 5GGQL 5J0BA 2F53B 2QPFA 3BVTA 5MHSE 2AI0H 1T6BX 2VMEA 2CR0A 1JMXA 4BXVA 4MXVE 1A3RL 3BKYH 5EBWA 2JJTA 3VWJD 3QNFA 5C0IA 4Z7VF 1M71A 2XSKA 4Z9KB 1ZSHA 2L7EA 4NYLB 5IQ7L 1PSKL 1KCLA 1QEWB 2WUBL 4QT5A 2SODB 5FYKD 4OJYA 2VDKH 4EQ3A 4OIBA 5FYLH 2WOYA 4P4RB 1IM9A 1O6SB 4XNQB 4B0MM 3SDXA 4QY8B 2X87A 2G5BB 4JKLA 2OL3B 3VFTB 1Y1UA 4TN9A 1JF5A 2W0PA 1X4ZA 4HG4K 1A6ZA 1TJGH 4FYTA 4X8JB 3VX0A 1LDPH 2H1XA 1N5AB 3EBGA 3ZRSA 4DVBB 1LO3H 4XMLH 2VDML 2AEPL 1T5WB 3OTTA 1LWHA 3KPLB 5ALCL 2Q86B 3TS8A 2X4QA 2B08A 4P4KD 3L3OB 4N0CC 4OD1H 3O3DB 3C75A 3HTLX 3N9GH 4EN3A 1X5KA 1FNFA 1U91B 3KPNA 1BLIA 4NBXB 3EJSA 3JZYA 2XOTA 3NVQA 1H15A 3PHOB 4PP2A 4ODVH 2IAMB 2FVNA 5I9QB 4NNYA 3DV4B 2X89D 4H8PA 3QFJE 4TVSa 3QZBA 1NIAA 4UNUA 2G9HB 3QORD 4GMSL 3KW8A 1DJSA 3OKLA 4LSTL 1VENA 3TNMA 5EBLA 3LKSA 3LQAC 1BMZA 4OZHB 4PJHF 4XC1L 3FF8A 3L95A 3NSYA 4X4YB 1ZLUK 2VDOH 5ICZB 2YUWA 2WPGA 3MQIA 3QYCA 1JHLH 3S2CA 1IKOP 3RJDA 3FFCA 5KG9B 1QLFA 2EINB 5E6SB 4QRTB 4XWOD 3HJEA 5I17B 1CLOH 2JCCB 2DMGA 2O5YL 4CADA 1HK6A 4KVPA 4NUMA 2K7PA 1TMCB 1CL7I 4ZTPL 4JFTA 2IADA 1JFQL 1CLCA 3GXMA 3JUZA 3FB5A 3DRQA 5I19H 2GT9A 2QMKA 1SVZA 3N91A 4PRIA 2C9AA 1NMAH 35C8H 5CEZL 3GI8H 2IFFL 4HKJA 5BQ7B 4JG9A 3GM8A 3CZEA 2QVKA 3PWJA 2VL5A 3QJQB 5JIKA 4WI2A 4QHUB 2JH2A 4GUPB 5GS0C 3LN9A 3LS4H 1EJ6A 3CH1A 3BFOA 4N9OB 4JREB 3GZPA 3LEYH 4ZS6C 2FL5B 2P28B 1NGQH 4JO8A 4ZX4A 1NUFA 3EYVA 3QIUA 3BZFB 3W0WD 2D3LA 5HYSG 2YZ8A 3IJ7A 4U31A 2YXWA 3S8FB 3LEXB 2J4WL 2ZKXA 3X13B 4MZRA 3EGDA 3ZTJH 5GGQH 3JV6A 1CLZH 5C9JB 4K7PY 1NAMB 1U2HA 3QIWB 4G9FD 4WWKD 4YX2H 2JI2A 1YY9D 2R51A 2X41A 3C8DA 5F7HA 1YECL 3IYLW 5D4HA 5AVQB 1ZLVH 2HH0L 5T3ZD 1CXKA 1XL4A 3QYNA 2YS4A 3D06A 4YHYC 5BMFH 1FL6A 4GSQA 5C0BB 1EHLL 5JNYB 1J0YA 1FFQA 2WUBH 1AXIB 2OAAA 3CZNA 3N1FC 4LHUG 1U6AL 3S35X 2JTDA 3WEXA 4S1SL 3LH2L 3QIBA 1WFMA 2OMUA 2QKIA 3O6FA 4UTCA 4MYPA 3SYOA 3RWIB 2BHYA 2BOCB 4JBSA 3UDWC 4DPCX 1A9BA 4I48A 2GHZA 5EZLA 1DJXA 1P5UB 4QRRA 1VZHA 2Z7WA 1OP4A 2LVEA 3DSFL 3IJEB 5FO9A 1KULA 2H1LM 3HZKB 2A9NL 1SDYA 1EBAA 3K6OA 2LFEA 5CWSA 4KOBA 3I50L 1PY9A 2VDMH 5EO9A 1YDPB 3NQIA 3C8KB 2AEPH 3VDBA 1DCLA 5TDNA 5ALCH 5SWZA 4WJ5A 3MLXL 4AZ8B 3GLAA 4G7SB 1NCJA 1ZV5A 5EH1A 1JZGA 1R0AL 4FG4A 3BEVA 4OF8A 4PW3A 4Q56A 3T71A 3QVAA 3SYQA 3QI9B 4B53A 3CGTA 3RUGF 3B37A 2APWA 5AVYB 3P3YA 4M7ZC 1QHPA 3F8UB 3JV0A 4LDCA 4ZAKD 1ET7A 1AC6A 3KH3A 3V5HA 2JQMA 5GZNA 4S11A 3ZDZE 3SO3C 1WA0X 4X5QA 5D1XD 1WAAA 2XWTA 3SYAA 3GPEA 3MLTA 4FQXC 2CDFA 5B38B 1AIFB 3WNIA 3QO1B 4XC1H 2C9RA 3R7QA 1KF9B 2V5SA 4EI5B 5TE4L 1DLHB 3P3SA 3ATEA 3QFDB 1HX0A 3T6QC 3VH8A 1XCXA 1S6NA 5E1IA 2B3IA 2JLLA 4EXPX 2GBTA 3ME0B 2OPCA 2WM0A 2X4UB 1OM9A 4FGMA 4X98B 2X4OB 3D6GA 1FWXA 3VXUD 4M6AA 4FZEH 4GAFB 2HJLB 2YRLA 3BVUA 1BHGA 1E4XI 4IOSA 1T04B 2ENYA 3CZSA 4JGUA 4ZTPH 1JFQH 2UWEB 5I1GL 1RUKL 1G6RA 4GBXC 1KUMA 5CEZH 2JQZA 1CS6A 5JMRA 4U3CA 5D2NC 3KJ6L 3EO0B 3DUSA 5E23A 4ZSOA 3H7LA 2ICEB 5IROA 5LG1A 3U1SL 4ISVA 3BGFB 4Z7OF 1MJ7L 2P5EB 3O11A 2F15A 1EV2E 4K15A 1UOKA 1J05B 4HGKC 1KIUA 5FM4A 5L2KD 5MEOB 4QLRA 3UTZA 2C4FU 1YNLH 1FBIL 4PU2A 3GLEA 3DMMA 4XPTL 3GIVA 2Z31D 5E1AB 2Y22A 1ZLEA 3AG1B 3VFVA 5C2BH 3D2TA 2CG9X 2KLTA 2RHEA 1G43A 2OCFD 3L7EB 4YIQA 1CDYA 1YPZF 1DEDA 4RMRA 4NZ8A 1SN5A 6PCYA 3SD2A 1YECH 2HH0H 3JYCA 4Y19A 3NIGF 1SGKA 4TQHA 2P80D 3EYOB 2IH8A 3S5LA 5I73B 1EHLH 4D2NA 1P9MA 4QUOA 4JFDE 2H5UA 3HG0A 3T3PB 1WRFA 1PKOA 1U6AH 3QEHB 5D1ZC 2R9HC 4JFFD 1YYMH 4QRPB 1S7WB 2GJPA 2ZTBA 1J86A 2XVGA 4JFHE 3FSOA 3ZO0A 3TWYA 2EDDA 2APFA 2YUVA 3UAJD 1NZRA 5HYJE 5BZWA 3QYMA 5KYYA 5CEYA 3L9EA 5KYUA 1KCBA 2XWEA 2A9NH 1XF3B 1ZE3H 2A2QT 4FKEA 4X8GA 3QC6X 4G8IB 4YEFA 3KLQA 1QVOA 1OOAA 4QHMA 2NR6A 4Z7NE 1LQBC 1KGIA 1OGTA 2JKJA 1HQRB 1T1XB 3CFKA 5HGAA 3QJOA 3UBXB 2P5WD 5EFIB 3B1UA 1R0AH 5HJBA 1TYEB 3NCYP 3QHFH 2R23A 3R8QA 4L8SB 2XN2A 4X9GA 3GXIA 4F80A 1QSFB 1NUGA 2OR9L 3LV3B 5IR1B 4N2MA 2O5XL 3TVMB 1O9VA 3B9EA 4XN5A 2X53A 2CWRA 4PGBA 3MV8E 2BSBA 4GYBA 5GS1A 4N2OA 4C4KO 1HHHA 5DI8B 3NJLA 1JDAA 3VRIB 2NY1C 3O8XB 4M5YH 4TSAL 3VUAA 1PZ5A 3OPZH 4Y16C 3DTXB 2VR8A 5DQDH 2ZUSA 2N1KA 4HWNA 4MX7B 1FAIH 5TE4H 1JP5A 1NDTA 3HR5A 5CP3H 5HHOA 4HUWA 4PRBB 3N42F 1FSKB 3K91A 4LIQL 3TLRA 1I9JL 1ZMYA 4YQXL 3IU3B 2ALWA 3UACA 2LT9A 3JVGA 3D0LB 3DDGA 4LEEA 5JHDE 5KOMC 2WXPA 1B4LA 2VIRB 5CXPA 4GAYA 5AVTB 1NGPL 2DM3A 4L8BA 3RZWA 5KBMA 1J8HB 2BS8A 3UGUA 2C4FT 1UVQB 4PJEE 1RUKH 5FKAB 4K3DL 4EDWL 3WNPA 3Q6FB 3ZXAC 4HKZB 1GTNA 4FN0A 3KJ6H 1IEAB 4WGKA 1SJHA 2V2XA 3QH3B 3U1SH 4OCWH 1MJ7H 4U6TA 2LU4A 2I85A 4MZ3A 2XXMB 1KYFA 3D0AA 1GMIA 3IK2A 2YEQA 3GSNB 4YHKL 1Y0LA 4WO4B 5LN4A 5HHMD 4M61B 1MOEA 3AREC 3ARDD 4PLKD 2ZWNA 1G7HA 3FULA 5TJWK 2PTVA 2WO2B 4QYOA 4W9ZA 3T0EC 4EE2A 1D3CA 1S7TA 4M48L 4XPTH 1I3VA 3ZN6A 3FSVA 5CSZB 5F6HI 5FC9A 1P2CB 3EADA 4J7RA 5C0GB 3GWJA 3HB3C 4M00A 4JFUA 5HYEA 1SFDA 4LHJB 4WEBH 2OX5A 3RVVD 2EC8A 5I6XB 1HAUA 1I53A 1YC8A 1OGPA 4FEIA 4JKMA 3MC0A 1U3HA 3T2OA 3NCJL 1LWRA 2G3MA 2A6DA 4Y4FC 4YSRA 1SHMA 3NCCB 1Q0XH 1E5ZA 1X5XA 4FNLH 1XGPA 4PWJA 3ZKNC 2WBWB 5KUKA 3G6AA 3SDXB 1T7ZA 4R0LB 2E7LC 2X0WA 3ARGA 3TFKD 3GEWB 1DVFA 4A7GA 4NZDA 2DQTH 1WTLA 4I9WE 4BFFA 3ZL1A 3GKZA 2E7CA 4YHOH 3I3DA 4OGXH 4D0DB 1U8OB 3KBEA 5AG8A 1T89A 1QBMH 1RH8A 3D7PA 1I8IB 2FIKA 1JUFA 3Q9QA 1HNFA 1NAKL 1CYXA 2WQAA 3HA0A 4G1MB 4OM1L 3OKEA 5DSCA 4PD4J 3STLB 3VSVA 3L5JA 5FWRA 1X7SA 3NCBB 3BAXA 2IAND 4ZUTB 3X17A 2NCMA 3QHZL 4QAWA 4GSDL 2HT2D 1G7QA 3MNWA 3KPNB 5ESAA 4ZK8A 5I9QC 3QPKA 3MLRL 3OKNB 1H15B 1LMKA 4PP2B 2BO0A 2JKLA 5DD6B 5BRZE 3GSWA 4HMEA 1CCZA 1YYCA 2AABH 2O5XH 2EIKB 1PJ9A 5D7IF 1L7TH 2R1YB 4QF1B 4XN9A 1WDAA 3H0TA 1NC4B 4XPAL 1ZPLA 1HINL 5IB5B 1AP2A 2V37A 1CJYA 4OY9A 1INQB 3KHQA 4MSWB 4PUBH 3U6RB 5ADPL 1QASA 3D8MA 5FM8A 3K4DA 1DL7L 5FYLD 4E9WA 3HC4L 3LRMA 2AJYH 2IBGA 3FFCB 3MRHA 1VIWA 2Y5TB 1MLBB 1TR7A 3VFUA 1OTSD 2CCWA 1TTBA 2AXGA 4I0CC 3KPTA 2ZF9A 3GM0A 4YQXH 2J5LB 1XX9C 4J12A 1B6DA 2VLJD 1Q9LA 4OLYL 4DHLA 3C2SA 4AMKL 3MLVL 1QPPA 4NWUL 1P7KB 3KGTA 1D5MB 3SKNB 4HJ0C 5CJOL 1JGUL 3FB5B 1NGPH 3TZVA 4G80A 1MG2C 3TC9A 4PJ7E 3ARYA 1UB6B 4K23L 2CO3A 2HX9A 4S0SD 2DQUL 3IGLA 4K3DH 4EDWH 2JJUA 3PWJB 4JO4L 2VL5B 1HOEA 4OLXL 4X7EC 4ODUA 3F5WB 4IOIB 5SV4A 3VQ2C 3NZUA 1OAJA 4HMCA 1CDBA 2CKNA 4IYKA 2IIJA 5A2JH 1MCKA 5D5MA 5HYSA 1GTFA 3W39A 3TP4A 4YHML 2I07B 2B9BA 3L4WA 3LD8B 3QR2A 3VD7A 3G04A 3UTSE 4JNXA 1OAXL 4KMLB 5C09E 4LCWB 3ZDYB 2P42B 4M48H 1HZHL 3QIWC 3MROA 1AD0B 3ARTA 4AQ1A 3KEHA 3AFLA 2VLKA 1PKQE 1TU2B 2PCFB 5SWSA 1LO5B 4LHUA 5G4OA 1L9PA 2EKJA 3WFBH 5FUZL 4LVOB 5PCYA 1XZ0A 2PP8A 2IOOA 7TAAA 3NCJH 2FQDA 3VRLF 3US0A 1SUHA 2QKIB 4JHZA 3LVTA 1MWAB 1LHZA 3N04A 3QHTC 3MRPB 4GLRI 4FFZH 2NW3B 4QOKD 3VE0A 4X4XB 5HDQL 3PP4L 3K2KA 4OCMC 1GY1A 3ZK0A 1BDYA 2WZ5A 5JO5A 4ILDA 8CGTA 4F5CE 4LFHG 4NO3B 5KSBE 2L7JA 3LZFL 4W9LC 3MRDA 2DW5A 3QG6A 3EYUL 5IMLB 5DVKA 4YK4C 1KYUA 2NY3B 3IRZA 3VM7A 3VWKD 4OM1H 4GKOA 3D3VE 1I7TB 4Y89A 5B3NA 1GZQA 4XCCL 1YEEL 3FT2A 4G1EA 3WHXB 1DSWA 32C2A 1NFDE 3QHZH 1FNHA 4GSDH 4OQ1A 2OMVA 3QI9C 3CHOA 4NC1E 5CINL 5MHSD 2PETA 3MACL 2LU7A 3MLRH 1TEFA 2QR0A 1B88A 4IHBA 4ZXBD 1VZGA 3NK3A 3QRBA 3GHBL 1ZVNA 1RZJC 4AIEA 4DKAA 3PS6A 2BMKB 2WC7A 1TJMA 5A7EA 4XPAH 5F1NA 3HNTL 1CL7L 5L8JB 1HINH 5INCA 5I66A 1XF2B 1IQWH 3QXDB 1S5HB 3K2MC 2GABA 1TJHH 1X9LA 1KLUB 3FUNA 4LPTA 1Z9LA 5BUAA 2V3DA 3QIUD 5ADPH 2ZAIA 2XICA 5JQIB 2KI6A 4OIAA 3N6YA 4Z0BL 3HC4H 1H19A 3DX1A 5CS7A 4S2SA 3MRQB 1JVKA 2XKSA 4Y4KD 4RZCB 2ICWB 2UY7A 2ZJSL 3QPQC 3Q8FA 1E5BA 4OLYH 4IIQB 1F3RB 4GRLC 4AMKH 3F7RA 3MLVH 4U4BA 1PAMA 4NWUH 2EEFA 3B43A 4MXQC 1SHSA 3Q06A 1A6AB 5CJOH 1JGUH 1KCKA 1G6RB 2Y2TA 1MFVA 3I6LE 2H45A 4L5FL 5GJSL 4YXLH 2ICEC 4AVHA 1JVOA 1X7QA 1RJLB 2DQUH 2EDWA 4FD0A 1JPST 4F1SA 4NEHB 4OI7A 4ZSOB 4JO4H 1ZA3B 3PWPA 4OLXH 4PVLA 5GSVB 1YUHA 4QD2E 3EO9L 3ABLB 3IF1B 4KX9A 5CN2A 3PDDA 1VFUA 1YY8A 2AEQH 2Q9OA 1KIUB 1RZ7H 3QFJD 3INUL 1N5YL 4R5VA 1OAQL 2JCWA 4YHMH 1M1SA 4YPGB 4POYA 4LP5A 1OAXH 3DVNB 2H8PA 3BQUC 4XBGA 5GRXG 2H7WA 5B39B 4F7KA 4ELMB 3ZIMA 3MRGA 2VDRB 1HZHH 3QDAA 3H56A 5SWZD 3O3BA 1H3PL 2FSEB 5ILTL 43C9B 4DAGL 2X4PB 3DX0A 4QIRA 5DS8B 5IHBA 1T1ZA 1PMYA 1SXAA 3NN8B 3NP3A 3MUY1 4LSVL 1XSKA 3ULUF 5BVPL 4NPKA 2CO7B 2WQXA 2B77A 3I3BA 5KSVB 4JE0A 2EDOA 1KXVC 5FUZH 3EGSB 2BNRB 1BJMA 2PWHA 3CIQA 1J1XH 5CLXA 1ZJBA 2DWDA 1E4KA 1IE4A 1KB3A 3CTTA 5HDQH 3IMTA 1Q0EA 3FCSA 3KPMA 4ABWA 5IBLD 1AYRA 3VGFA 5KYYB 5CEZD 2ZSVA 2OK0L 3Q05A 3FTSA 4OGAD 4YMPA 1R3KB 4KTYA 3IMBA 1ZGLM 3LZFH 4AY0A 5CM1A 1QG3A 3E2HB 3WJMA 3ROLB 3ILQD 5K9OA 1MFCL 1UUNA 5J13C 4C56B 3WFDL 4QHMB 4UIMA 2H6OA 3WTTA 2X05A 1QQDB 5GGVY