1D7DA

Cytochrome domain of cellobiose dehydrogenase, hp3 fragment, ph 7.5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
186
structure length
186
Chain Sequence
ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new scaffold for binding haem in the cytochrome domain of the extracellular flavocytochrome cellobiose dehydrogenase.
pubmed doi rcsb
molecule keywords CELLOBIOSE DEHYDROGENASE
molecule tags Oxidoreductase
total genus 38
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 1999-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1d7dA00
1D7CA 1PL3A 1D7DA 4QI3A 1D7BA
chains in the Genus database with same CATH superfamily
3CAFA 1G1CA 5CJBA 2BIIA 4XPTL 3THMH 2MTPA 1Z9NA 1LK3H 4KRPB 4NHUB 1ZT7A 1XIWD 1H5BB 3GSUA 4X7FC 1N2RB 4HHAB 1JCVA 3HUJA 4FG2A 4NQQA 1QFHA 1JFHA 1J12A 2KZWA 2NY2D 1SFDA 3PDGA 4GKZA 1PDKA 1GZHA 2KL6A 3RGVA 3NBNA 3VD0A 3NZ8A 4E68A 1K3IA 2FH8A 1AQDB 4Z7UB 5CZRA 4PTTB 4BFEA 1RKRA 3IN0A 3VFTB 4RMVA 2CUMA 2L7UA 3ZHFA 1WICA 1E4XI 2Y5EA 1RJCA 3PUUA 4PJHE 3UL4A 4PJ9B 1RHFA 1QWUA 3HMXH 3FTYA 1MQ8A 2ZF9A 1QZNA 3L17A 2NDGA 3IU4L 2MKLC 2OL3A 3MOAL 2ZWKA 3QA3B 4LP5A 3S36L 4DGWC 2J73A 3FU8A 4TQPA 4OJDH 4Y4KD 3BP5A 3GF8A 5I30L 1DQQA 1OTTC 4JFPA 4WHCA 5D9SA 5AWNL 4P5KA 4ZDHA 4Z7VF 1EPFA 5K1NA 4G9FB 3S3DB 1VRSA 1TJHL 4FNSA 1NKRA 4Y2DC 1O7DC 4PGBA 3KYMB 5JO5B 1P53A 4E9WA 5J6SA 5IB3A 4OGQC 1X9QA 4ZXBA 1YEGH 1IEAA 3KWTA 3MNVB 3C6EA 4MSWA 1CLZH 4P23D 4TSBH 5E9DB 1F5WA 3OR6B 5HHNA 3CU1A 5D70L 3WFZA 4OFVA 3BUTA 2DJUA 1DO5A 2B5IB 3H7BB 1KIQA 4L9LC 5GGUA 4XCNB 4B9FA 4JRLA 4Q6IB 2WQ8A 2B59B 2B2XL 3TJEL 5I6OA 4YGVA 1X9LA 3VXSE 1BZ9B 1X5GA 4M7KL 3T5WA 3INOA 4KROC 2F8XC 5F3FA 4HVBA 3I02B 1CXHA 1VGEL 2VXQA 4BFOA 1QZ1A 1OGAB 2ZUSA 4UTBL 3DX3A 5E1AA 3JWOL 4LLDA 2DM2A 1H9VA 5BJTA 4NBXB 3ZKMC 2I85A 1OB0A 4PREA 1P4UA 5SX5K 3DMMD 5EORL 5GIRB 4ERSL 3QQ3A 1AQMA 4FNUA 5JOEA 5BRZD 2W9DL 2QVTA 4H25A 1KTJA 3JQOB 3RVVC 3W3BA 3D0LA 1ICTA 4IIQC 1MHEB 1UGKA 2R69H 2VDML 4UT9L 4WUUB 3V4LA 4EXKA 4L1HA 3VXPA 3P11H 2PW1A 4PIRF 1A6WL 5ETUB 3QW9A 2ADJB 4C83B 4YR6B 5EO9B 5DHXB 2AXWA 3VYNA 4JQXC 4GOSA 2R4RL 4KX9A 3T6WA 2HA1A 4ODHH 4X6DA 3D9AH 4Y9FA 5DZNA 3HE7A 4BWWA 5GISH 4YXKH 5C92A 1UENA 3QR0A 4FDWA 3CZFA 4XGZB 5MHSE 4FLRA 2E7BA 4KGJA 4HEPA 2YAMA 2FATH 4OZGA 4EI5D 3ISYA 3N06B 4UT7H 4X6FB 4S2SA 5D71L 2UZIH 4M93C 1LDPL 1F3JB 2QTEA 5F8QC 3K46A 4JZJA 4ONHA 4JCWA 1BXUA 3HAEH 4HUWB 4PBXA 3STZB 4PRIE 1LYQA 5CD3B 3QG6B 1XL6A 3UJTL 3P2TA 3V6OE 3TIEA 5KVDH 4XP6L 5MENE 4MXVE 5HGGS 5E6UB 1I9JH 2FWOA 2VCOA 5FYLE 2NQCA 3QUYA 2Y25A 2GTWA 2G2RB 5I1KL 4LVOC 2H26A 2VXVL 3RIKA 2FSDA 4PI2A 4FHJA 4FI6A 5TDPB 5GGSA 4R96B 2VDOB 3Q2VA 3IXAB 4WGKA 1HYSC 1OM9A 1OGTB 3O2VL 2W95A 1ZA3B 3GTVA 1IAOB 2FL5A 5FUOL 4W9CC 3D08A 2VM4A 4K8RC 4M1GL 1F56A 1I8IA 2CMRH 3D7PA 2XZAH 2FX7L 2MCMA 3UZQA 4DF9A 5HP5A 4S1SL 3QEQB 4FQQA 3KDMA 4X4ME 1E9PB 4PJGB 2DDQL 2QQNH 3HRPA 4R0LB 3RVUC 2Z31D 3F7YB 1QX1A 2YPLE 3Q9PA 4FJZA 1FH5L 3GSWB 3UC0L 2R2EA 2BOLA 1KJ2B 3BQUB 4TSCL 3BQVA 1DDHA 3T65B 5KYXB 4P5MB 5MI0B 4F8TA 4ZMQA 3DX8A 5HPOA 1R5VA 5LAPA 4LPCA 3WSQH 5I1IL 3EHBB 1FAIL 2QPFA 4AIZB 3AQZA 4GKNB 4PCYA 1S7VA 1DQDL 5F96L 1F90L 5CSBA 3KPTA 4R90H 2FBJL 4IGBA 2JI3A 3HZYB 3TO4B 3OLEA 4NERA 3ULVH 4IS6B 1YEKH 3MNZB 4ZBJA 5J56B 4AEIL 4IBYA 3NESA 2WQUA 3GSNH 3C09B 5CGMA 1J8HD 2Q86A 4KPHH 4X7TB 5EIVA 3L5JA 4JG0L 1KPRB 1Q0EA 3E80A 3T8VA 3T6VA 3ZKSD 3WMQA 4G5AA 1ZHBA 1GTNA 4OI7A 3SDDA 4FYTA 3GIZH 4A2LA 1MZZA 3KVDD 5FOBA 5A3ID 3H2PA 3L13A 4OM1L 5DS2A 3BHBA 4KAQH 5F1SA 3KJ6H 2Y7MA 4KXCA 2VN4A 4BK5A 4U4IA 5D93B 2BIPA 5DMGC 3IFNL 1DZBA 2QZQA 4OGXH 3MRNA 2UZXB 4WFEE 1MWOA 4RFEA 3VD2A 2E6PA 2A99A 3VXUA 3G3LA 1XTLA 1ZLDA 4JPKH 1TQBB 5EA0H 5C0EA 4RGOH 1HIML 4Q9CA 3C60D 5CJ5A 2BINA 5KSUA 3U4AA 2QT6A 4XWGL 4FNRA 4K3EL 4WTZG 3ZYJA 2V17L 2DYSB 3LIZA 1CXEA 2XZCL 4LSSH 3S6CA 5EB9A 3MNDA 5GGTH 1A7OH 3PREA 2CDGA 4FLQA 1Q0YL 4K7PH 4MXQD 5DFWH 5EOCJ 3VW3H 1MLCA 2BMKA 1KZQA 2H8PA 2OJZL 1O7SA 4QTIH 5CWSA 3TBTA 5A2FA 4JJHA 4F80A 1NCDH 3PXJA 3MJWA 4NQEE 1ZPUA 2XQYK 5T5NF 3EH2A 5KJ4A 3AVEA 4LU5L 5DDHA 4XO3A 2SEBA 3QPQD 4A63A 4QT5A 3L7EA 2E9GA 3LV3B 2YD6A 4BFRA 5EEZA 4X7SH 3BZFB 1HQ4B 5C07B 1BLNA 3PGFL 3WN5A 3IVKB 1JHKL 3H54A 5HVHB 2NR6D 4I48B 1J7VR 5FGRA 3DX9A 5KSAA 3VD1A 1P4LA 2HJFB 4V1DD 5IZ7A 5JQHC 2IWKA 2VWEE 3GMMA 3G5VB 4KXZH 1OF2A 3AREB 3FH5A 1TTRA 1F6AA 2VISA 4I5BA 4R7VA 1FZMA 1G4RA 2CCVA 4H40A 1GSMA 3GSQB 1SF3A 2FJSA 4M6ML 1S7XB 4UNIA 4WJKB 5D7IB 4A7UA 3MRKA 5ICYA 1R24B 3NK3A 1JGUH 1JZ7A 3BAJA 4X5QA 2OXGA 4MHHG 4HPOH 4TQIA 4PJHA 1UWXK 1W0VB 4PLJD 5E56A 3U2SA 2FYYA 2NSMA 4ELMA 3RL2B 3RBGA 3VI3F 2ARWA 1C5CL 4HW6A 4ZYKB 5DQ9B 1EBAA 4E5XG 1MCPH 4XMWA 1J0YA 1L9MA 2W81C 5LGJB 5DQJA 5I1AA 2PR4H 3MRJB 4UT6A 1B9KA 2BOCB 5HDLA 3NACL 4N2FA 2RFXA 3RKPA 5GS0C 4KJYB 3EYQC 4PJIA 2R1WA 5B4MC 5DFVC 4G6JH 1YMMD 2KYIA 3OR7A 4L2LA 4AEEA 2BO0A 2XWTA 4J3OD 3IFPA 2WUBH 3NIFE 1FRGH 4G70B 3U6RB 3FQWA 3EJYD 3T0EC 4MWFA 3EGXA 4WCYH 2AV1B 2X1OA 1HT6A 5T1DH 1K4DB 2PXYC 2VL5B 3A4AA 3ARBC 3EOBA 2C3HA 5FYKE 1AACA 4PP1D 2PTTB 3QQ4B 4ZS6D 3W56A 5DJCA 3UO1H 3VXSA 3RDTB 1KIPB 1RFDH 4Y5YB 3S98A 5I75C 2LU5A 2NOYA 1FFOB 4OCWH 3SO3B 3TN0B 4LOFA 3LQZB 2EAEA 5H37H 5GZOA 1IX2A 2PP9A 2P8LB 2PW2A 4UTAL 1KB9J 1BEYL 1E8WA 4PRNA 4M1CC 2QR0A 4KJWC 1VB9A 2ZP8A 4RRPA 5G2NA 4MJHA 5MEOB 3JWNC 2P5WD 1S9WA 4A7TA 4PYHA 2WSDA 5IB2B 2WMPA 4YDKL 2Z6FA 2R0LL 2WP3T 2Z7YA 4H88H 2DICA 4P57A 1A4CA 3V4PB 2COQA 1MH5A 2ZG1A 5F88A 5CEXA 1ZD6A 3FF7A 1E67A 2DZEA 4HIHA 1R17A 1YG9A 5DVKA 5ABAA 3JBG7 4PV9B 3CZEA 1DLHB 3VWJD 1YNKH 4GSRA 1FE8L 1J0ZA 2BVOB 4Y4FA 1E3XA 2C4XA 3Q13A 1HSBA 1CD0A 3V4VB 2L4OA 3BPLC 3PV6A 2ZOLA 4A55A 3EO1B 5F0LB 1MJ8L 4GAAA 3SE3C 5HYQA 5KTEL 5IROC 1G7LA 2NY7L 1TCRB 4QOKE 5KBMA 2M2DA 4PB0H 4X4YA 3UPRA 1NEZB 3GDCA 1I7RB 4KJPD 5AVRB 3IPBA 4F9PA 4OV5B 2XYBA 4XMXA 5D8JH 2OMVB 4H1LB 4QWWC 2MOVA 4CVWA 4FJ6A 4GP5B 2CGRH 4WKXA 4IMLB 4TULL 2YC1A 3WGVB 3LKRB 4ADJA 1MW1A 2FO4B 1U41A 3MDJA 1BQ5A 3GZOA 5ALCL 3SGEI 5BRQA 4PRIA 4HWBH 4P8QA 4R7NA 4QTFA 3IMWA 2IDSA 3V6OA 3H0TB 4TLSA 3VSVA 5MENA 3PDDA 1ID2A 2Y7QB 1T3FA 1D9KB 5TJWK 4KZDL 2GSGB 1WFTA 4KUZH 1GMIA 5DJ8A 4G82A 3RNQB 1KYFA 2DJMA 3ULSB 2Z8RA 1WWCA 3UJJH 1C08B 2QPSA 3SD5A 4QGYA 2A9DA 2YBRA 4XBGA 1EEUA 3D0AA 5BUAA 4DZ8B 4F7TA 2P24A 5ISZB 1QWHA 1NICA 1MCJA 4F1SA 5JPNA 4ECNA 4ANXA 2HJLB 1IM9A 2JKNA 1PEWA 3QXTA 3ML9A 5E6IA 5DJDB 1JAEA 2EYSA 4X4MA 3KYOB 3LRKA 3OKNA 4H26A 1E28B 1MDAA 5E6RB 1A7PH 1D6VL 1NANH 1XR8B 1ZOXA 2FH6A 2YPLA 2YZ1A 2NCMA 3ABGA 2YSSB 3KPRB 3SZ6A 3O0RH 1T6BX 2BVQB 3P3UA 4H0HB 4TUOB 4H5SB 3FFDB 4HAGA 3V4PH 3VFSB 5F7AA 4HCGA 5D2LE 2XTJD 3C6SB 5EWIL 3VVVA 2IBGA 5GS1A 1DE4A 1UACL 4V1DE 1NMCB 2E9WA 2UVEA 4MYWB 5IW1B 2O5XL 4DGVL 4KBPA 3L7FB 4K3DL 2GUYA 1Q9OA 3UBGA 3ZRFC 4KKZA 1TYJA 3QIUC 1M05B 3V4VH 4LNRA 3V0WL 4L5FH 2K7QA 1I7UB 1II4E 2BHZA 3U25A 1NDMA 2DS4A 1MJJA 4I18A 2Y22A 3E8VA 1WFNA 2R2BB 4OD1L 2QGDA 2FECL 3L3IA 2B39A 2X0VA 2IGFH 2FDBP 3TZVD 5C0CD 1OO2A 1M4KA 1DJSA 4MX7A 1ZT7B 3NIDB 4H1LH 3GSUB 4X98B 2CAKA 2CKNA 1E65A 4NZDA 1MHPH 5TE7H 3HUJB 2BNUA 1AXSA 3NH7H 1J88A 5LDUA 1PLCA 5LNEA 1H6TA 3A4EA 3F6IA 4LLQA 4GKZB 3WUWG 2JVUA 3CK0L 5FDWA 1WWBX 3KDPB 3US0A 1DFBH 1PDKB 3Q2CA 1RK0A 4XPHL 3RGVB 5ICZA 3NZ8B 1N5YL 3EYVA 4P23A 2KLRA 4NOFA 2B15A 1OPGL 2QSTA 4G11A 3QC5X 3I9PA 3DBSA 4OGAD 4S0SD 4NCC1 4L23A 2BNQD 3ESNA 4G8EA 1FGVL 1I1RA 3FTVA 4I0CC 3O45A 4YEEA 5CZVH 5IM7B 4J2QA 2Z0BA 4WUKL 1L0PA 4X80H 4N25A 1RU9L 2O5YH 2F18A 3OKLA 5KSBF 3BP5B 12E8H 1OAJA 4ZFGL 1DQQB 5TPWH 2DWDB 5K9KB 4JFPB 3P9MB 4P5RA 5D72L 5I6XB 1DN2A 4XCCH 4ZDHB 3NIGE 5FUZL 5DD1L 1WC7A 1KBVA 4PB9H 5DGQA 5F9OH 2HT4C 4OZHE 2AI0L 3GBDA 4CSPA 4NQEA 1XWVA 5IB3B 4ZXBB 5KZCB 4XPAH 2CUHA 2SODB 3NA4A 4MSWB 3QI9A 5JHMA 1TTBA 3MV11 3CCHA 5HHNB 1KIQB 1QLFA 3QORD 2DQDH 1T1ZA 5E1GA 2W92A 1O0VA 3OHXC 4OW6A 2AXFB 1T2QL 4YSEA 1WAAE 4YGVB 4QXUH 3DVNA 3MSPA 1Q72H 1PGRB 3U36B 2XPZA 1E3ZA 1K3ZA 1ZK9A 5EU5B 3AGWA 1OPOA 4AV4A 3QJQB 1AXTL 4GRLD 3VFMA 4M7LH 4M48L 2A6IA 1BZQK 4XP1L 4B9JA 3IRPX 4LLDB 1W15A 3ROOA 2I9LA 2Y06H 3BUYA 4OD3H 2JELL 4PREB 4JZOA 5T5NG 3TX4A 4LB8A 3V0VA 3ELQA 3NVQA 2XQBL 4QRTA 5BO1L 5KW9L 2WKOA 1GR7A 3E3QC 3ZO9A 2E9IA 2VW4A 5IJDC 3LNFA 3LVTA 2YGNA 4LSVL 5EG6C 3WS6C 1KIUB 4ODTL 2WW8A 5IB4A 1ETZA 3PS6A 1FNEA 1WHOA 3DGCR 3ZO0A 3QNYA 3QZWG 1NFDB 2PW1B 4UTCA 2JIXB 4YHIA 3U9UA 1D7FA 3V6ZA 3QP3A 3NTCL 1FIEA 3T3MF 4ONFH 3VXMD 1DJYA 4BQ8A 1W6LA 3NJMA 3OMNB 3QJZA 4NRXA 4GEIA 1JZJA 3X13A 1C7TA 2V2XB 4X6DB 4GXVL 5JMRA 4HKXA 4C4KO 1U30A 2WSKA 5I0YA 3HE7B 3WEAA 3GJFB 3TH3T 4PJFB 1BCIA 1NIFA 2KQNA 3CZFB 3NGBB 4MVBD 4UILL 1TPXC 4PJXE 1TSHA 4FLOA 1ADQL 3U4BH 4OZGB 2E7MA 5MERA 5AAMA 2ICCA 3M45A 4A2GA 4S2SB 5DVPA 3TS8A 4AUJA 4ONHB 3R4DA 1DVYA 2HT2D 2XWDA 5H94B 4HS8H 3FC8A 3GZKA 1F3DJ 2Z31A 3HA0A 5H35B 2YQ2A 3TIEB 3WO4B 1SUHA 2LVCA 4XH2A 5J6GA 1IU1A 4FQLH 2XTJE 4HAFA 2FWOB 1A3QA 1XGYH 1LO0L 3UADA 2QPEB 1TO5A 1X5ZA 3UH8A 5FLVA 3QUYB 3CBRA 2GTWB 4N2DA 1E8XA 2H26B 2MNJB 4JFVA 1J8RA 2VM9A 2CK0L 5GGSB 2VDRH 3JV4A 5GHWH 3B3BA 1YNTB 2HN7A 2XDHA 4JL2A 3F00A 4YSCA 4CMHB 4NKIH 1IUZA 3ZDWA 1A0QH 4KKPA 3QRBA 1I8IB 3NN8B 3X17A 2QQKH 3KDMB 3QWNA 4HBCH 1NCUA 2NUPA 3OPZH 4JQIH 4QOKA 4MYPA 1ETB1 4JMNA 1GYUA 4DTGH 4OU3A 4G7VH 1S78D 1R5WA 2XX0A 4NZUL 5C70A 2R2EB 4YSQA 4P99A 3H53A 1A9EA 2LQRA 1NAMB 1DDHB 1YN6A 4IJ3B 2PPDA 3ZYIA 3DX8B 5ILTH 3H42H 4RMQA 1U8LA 2NY3D 3QS3A 4YXHL 4ODVH 3MN8A 1S7VB 1M6UA 3Q2NA 3UAJC 4YDMA 5DF0A 5FYJD 2XXGA 5G55A 4AYMC 4IGBB 4ZZKA 2CNYA 5DVMA 4KH9A 3T1WA 2HRPH 5EZLB 3QWOA 2CALA 1I8LC 3BVVA 5FOJA 1NBYB 4ALAL 1EAOA 2AGJH 5E2TL 3HI1A 3C5ZD 3GJFH 4LF3A 7CGTA 2NXYD 5CZXD 5FO7B 5AENA 5C08E 4HUUB 5KYYB 3VDAA 3LXUX 4DT2A 3FCUB 3Q43A 1KTRL 4QYAA 3SDDB 4DUVA 3V0DA 1X7TA 3MUHL 3D34A 4MJID 3RLSA 5FFOA 4WJG3 3BHBB 2VDQH 4HUNB 2V33A 1FSKB 3U9PL 2EEAA 3OZKA 3MGOA 4FTVB 3T2NL 1S9VB 3LH2L 2A9NH 3MRNB 4FHBD 3EJTA 2YGPA 3VXUB 3R4RA 1MNUH 1HAUA 2DQUH 1AKPA 2D7TH 4JY5L 5KSUB 4DWHA 1LDSA 1NGWA 3A6CL 4LLVA 2E3VA 3ZZ1A 5HDQL 2OZNA 1BQLH 5CIPB 5TDOB 4M4RB 2NR6A 5DVLA 1JZIA 4NP9A 3QUMA 3KLQA 5D2LA 2BP0A 2UXTA 1P5UA 3PNRB 1RAMA 1KB5A 4V1DA 5TE4L 3MV7E 2CDGB 2B1AL 3EW3B 4U6VH 2ZX5A 4UMSA 1AAJA 4M7JL 1IIIA 1MLCB 1QUNA 2H8PB 4QNPE 4GG6E 3CHXA 4OIFA 3W11D 4BE6A 4UAOB 4F2MB 1P7HL 2WN2A 1JPGA 2I9TA 2FZ3A 4XP4L 5I19H 2RMNA 5T3XL 2VAJA 3FJTA 1R9FA 1INDL 35C8L 4QT5B 4YC2B 3O6ML 4F33A 1AS6A 1OZTG 4XC3H 2VMFA 1GAFH 4Z7OF 2FJUB 4EMZA 1JJUA 1NAMH 2CLZB 1BLNB 2LU3A 2Y36H 4YHMH 4ZUTA 4JM2D 1AGFB 2YXWA 1ZGLM 1WCBA 1WZMA 2AKRA 3KYKL 3DSFL 2VLKD 4KKCC 2C1PB 1P4LB 4NQXA 4QRUB 1ZLSH 3GMMB 1OF2B 3VYPA 2EDEA 2CHNA 1F6AB 4ZW6A 3ATBA 4OSUL 4PWJA 4O5LL 1FZMB 3CVIL 2QMJA 3MJ9H 4F3FB 2O72A 2GT9A 5KEZA 4AVJA 3MRKB 5D6DC 5IHUH 5ICYB 5E7BA 6CGTA 3ASWA 2OXGB 5GS2D 3E2HB 2AJXL 4PJHB 4NAJA 2WC7A 3F7PC 3U2SB 2FYYB 3APCA 2XC8A 2ITEA 4ELMB 2NY5C 5E4EC 2FQEA 5HYSG 2OMXB 4TL5A 5CGYD 5DQJB 5CBAB 5I1AB 1FG2A 3AG3B 5EUOE 4FABH 2RFXB 3D12B 2X4UA 4PJIB 3QDME 4U7MA 4RNRA 4N8UA 2WQXA 1GYVA 2UY7A 4OZHA 1HCYA 4AM0B 3JVGC 3WTWA 1CFSA 1U93A 3EDEA 1BDYA 3NA9L 3OR7B 1N64H 1X4ZA 2DLFH 4MAYD 5DA0B 5CEZH 3IFPB 5B8CC 1AYRA 3ECQA 1IGTA 3T9WA 4YSUA 4L4VE 3EGXB 1MFAL 4U1NA 1YEWA 1NWPA 2K9FB 4I9WD 4P46D 3SDXE 2RALA 3REWA 3T4AC 5CIPH 1U42A 2D0FA 3TJHC 4JFHD 4F8PA 1EO5A 1LHZA 2N7SA 2ZJSL 1HOCA 3A6OA 3UTTE 3EOBB 3JZ7A 1OW0A 1WAAA 2D31A 4D0BA 3UTSD 1YC8A 1I1AA 5DJCB 3VXSB 4OR1A 1DVZA 4OD2A 5F7FA 1GCYA 3O4LD 3PGCA 4WENB 1DBAL 2YOCA 3ARGD 1KOAA 2XN9E 2RR3A 5HHVH 4AJVA 2PW2B 2X44D 1G6RL 3D3VD 3K1DA 5DJ6B 3DDFA 3MYJA 2DQFA 3VYOA 3FRPA 2V2TA 2DH3A 4LMQI 1KBBA 1RZFL 2VDLB 1EXGA 3A21A 4HT1L 4R97B 1ZEAL 3QUXC 1S9WB 4ORGA 3BKMH 1M42A 2BIHA 4KI5E 2WMPB 3SPJA 3HZKA 5C0RH 4U3SA 4OCYL 4P57B 5IT2H 1EUUA 1LM8V 2AQNA 4YUEH 4PJEB 3D06A 1MH5B 4H2AA 5F88B 1JRHH 3NIDF 5CEXB 5F7NC 3UP1A 2XWBA 3HUJF 4LEXH 5E8NA 3CUPB 1FNSH 4BFGA 2X9WA 4KQ0A 3QZBA 2NZ9D 3PNWA 1U6AL 2DD8L 3VXNA 5GS3A 1HSBB 1JFQL 4GW4A 3PV6B 3ULUD 3TJPA 1INQA 1JWMA 2EXTA 4TLKA 2YXMA 5HYQB 1G7LB 3PP3H 3UPRB 1GGTA 4X4YB 3K80A 1QASA 3OXRB 3ESOA 3Q44A 4UM9D 3FT0A 2G0KA 3EFOA 4D0CA 4WRLA 4MJIE 4IOFD 4XNBA 4HJGA 3FO2A 3QYCA 4JO5A 4I1NB 4M8RA 1XCXA 2WQSA 4PJXA 3UZVA 5I0VA 3CX5K 5DA4A 2R56H 4P5SA 4UT6H 4ABQA 1YNLL 3ARXA 2OMNA 4M7LT 4RFNC 4WTQA 4PJ8D 3HC3H 5JIIA 4R26H 5HDRA 4LLUA 1SHMA 3MC0A 4PJ7A 5AOKA 2OMWB 3SPHA 5E2WH 1QQDB 1AGEA 3NJJA 5SX4H 5E94B 3MLXH 1G0XA 1NKGA 2IOOA 1RVFL 2UZYA 3H4HA 2K70A 3WLWC 5MENB 1W72A 4OT1L 2TSAA 4KNTA 1E42A 3ES6A 1FI8C 1C5DA 4X9IA 5DJ8B 3RU8L 2MOQA 1F45A 4XO8A 1KB9K 5GRUH 1DQLL 4CGTA 1RLBA 3ARDD 2YBRB 4XBGB 1BFSA 4YZWA 2HX8A 5EU3A 2P24B 3ULAB 4F7TB 1NCAH 4NPYA 4GQQA 3SYQA 1W0WA 2B1HH 2CKBL 2V5SA 2Q7NA 4FQJH 1IC0A 5E6IB 4FZEL 4AW4A 2PWHA 1BECA 1KZYA 2VDLH 1QFUL 3CFQA 4M43L 4PJ5D 5ERWA 3WJLA 4WK4B 4HIEA 2YEZA 3UYPA 5JXAL 1S5HB 5I74B 4CL7A 4GRWE 2ISDA 4ENEC 1MFVA 4G2AA 2BIQA 4KNUA 4MHHI 1UATA 4XOCA 1ZT1A 2QQLH 5GS1B 1DE4B 2NY2B 2Y7SA 5TFSH 4JB9H 3C87A 1JXJA 1K8IA 5FYJU 4F27A 1BOGB 2FIKA 2IC2A 1OP3H 4FA7B 5C7XL 4B9ZA 3RTQA 1Q9OB 1QW9A 4HETA 4MXWL 5E6ZA 1L9SA 3MUY1 4AC2A 5BMFL 1XBDA 2DI9A 3QAZC 3E8UL 3RIAK 1MJJB 2IJ0C 4BFKA 3CH1A 5ITFA 3OAZK 3HLAA 3L3IB 1HNYA 3HHSA 3OJMB 4Y4KB 5C08A 5JHLA 4N90D 5JHAA 4A38A 2O5NA 5A2AA 2H32H 3MZGB 5IJKC 1CQKA 1CFTA 2FAUA 1DHKA 1Z9OA 1I1CA 1AXSB 2BNUB 2F19L 2GKIA 3FTGA 2P5ED 4JFFD 4NWTH 1NMBL 4CMMA 3G5YA 4FQXA 3N3EA 4PWGA 5FDWB 4FI7A 5CLYA 4BZ2A 1I1FA 2VN5A 3BPCA 1RK0B 3POHA 3QUKB 4KVPA 3WKPA 4F7CA 2EDTA 4P23B 1RURL 4NM4H 2IWGA 1G9NC 1VEOA 1Z7JA 2FEDD 4XR8C 1DJWA 2WP3O 7FABH 3F62A 4K15A 4NFBA 1TQTA 4WO4C 1U8JA 1Z3RA 2G5BA 1EHLH 5KOMC 3ESUF 4UCFA 4LHUD 4OCSH 1KACB 4DKAA 3OKLB 1BQHA 1HHIA 3MV7A 2D7MA 2O26U 1ZLWH 1ZKAA 2ZYHA 4GRLA 5I18L 3D33A 4O4YH 1XCTA 1WC7B 4UDUA 4GG6A 2NYKA 5IQNA 4O2CA 2HRGA 2XZZA 4Y7OC 4NQEB 3U9WA 5K9JH 1FIGL 2V0AA 1ASPA 3O4OB 4PH8A 5J1AB 4OV6F 3DMMB 4R7DA 3QI9B 4JN1L 5LGKA 2WUCL 3CCHB 4KKAC 1KYOJ 5LBSA 1QLFB 1YMHA 4N6RB 1T1ZB 3LKPA 4Q0XL 4E0RB 2FYVA 2CO1A 1U8QA 5E08L 2YD9A 3HEIB 2OCFD 4PCTA 4Y1SA 3QCTH 4BV1A 1AR1D 1SRDA 3WFDL 4AITA 2E46A 3NRQA 1F8TH 1NCCL 1RV6X 3O8XD 1DBMH 3QXAB 4EI6B 3VFMB 1TEFA 3QUHA 4ODXA 4EBQL 4GJTB 2A6IB 2HTKD 4RISH 2UVFA 3PJLA 4NJ9H 4PS3A 4R2GC 3RIFF 3OC8A 4EOWL 2X4PA 2YZ8A 1AG6A 2I9LB 3WS3B 1C12B 4Z7AA 5KVEL 1WH0A 4LKCA 4YLCA 3BUYB 4JZOB 2APBA 1NZRA 3HRZB 3V0VB 1NSNH 4L8DB 4EI5B 4DVBA 1DJZA 4QRTB 1NEZG 4I3GA 1SBSH 2YAEA 3MNMA 2XA8L 3QQDB 5EUOA 1G1KA 1ETZB 1FNEB 5JDSA 3QDMA 3QNYB 1NGZA 4ZX4A 1F97A 2L3BA 5CAYB 1KT2A 1HL9A 4YHIB 1CVRA 3V6ZB 1IM3D 1NBVH 1DQMH 4J6IA 2OLDA 1SNRA 1ZS8A 1TNMA 3SCMC 2VERN 5J6HA 3RVWD 4FNLH 1QBLL 3NIFB 3OAUH 4X5PA 3LQMA 4E9VA 5DJAA 4L4VA 4HWEL 3FQTB 4HKXB 4F24A 1XSIA 1A1MA 3AXLA 3SDXA 4WWNA 3U4KA 4B5EA 2QKIA 3WIHL 1AP2B 2ZSVB 4Q9RH 3RB7A 3UTTA 2M8XA 2CZNA 1JNLH 2Y6SC 1R0AH 3DTDA 1QBAA 1AIZA 5F89B 3LQAH 1CXFA 4ZI8A 4YHKH 3TA4D 1JVLA 2BJMH 2PYFB 3ZYOA 5FS5A 1TEGA 5IMLA 4Q8BA 1WIPA 4ZMPA 3ILPB 4R4BB 2JKRM 2H1PH 1GOHA 3NEXA 2CO2A 1RJLA 2HLFC 2Z31B 25C8H 1CL7L 1UJTA 4U6HA 3S5ZA 4PU2A 2V3DA 4UOQA 1ODUA 4XH2B 5I8KL 1XEUA 2IMNA 4K8RL 3TT3L 3U7WH 3VG9B 4NB7A 3MGTA 2EIBA 2A9CA 1A5FL 2GJ6D 3K6NA 2WBWB 5I1JH 2JCCE 1TVHA 2DLHA 2NY6B 3ETBF 3GBML 1HINL 4LSUH 1AKJA 5KYWA 4OLXL 1YEIL 2I07A 4DEPB 1LILA 3QCUH 4YL9A 2HN7B 1XF2A 4AQ8C 3W37A 5EV7A 1X6LA 4N8CL 4KKBC 3GJEA 3HFML 2WWOA 5FKPB 1J8HB 3C5ZA 2EE3A 3N42F 4WY7H 5J11B 5KSVA 1F4YL 2NUPB 2R1YB 1UUNA 4QOKB 1MCSA 1PS3A 1NDGB 3DX4A 4GBXC 1JL8A 5CP3A 1R5WB 4Y7MA 1MKFA 3L9EA 1JDDA 3I6SA 3TH4T 3IS0X 5AVTB 4MJIA 4JFFE 1OQXA 3LS5L 1T1WA 1YN6B 4QCIA 5KVGH 2A38A 1JPTH 1U8LB 1MQKL 1MEXH 1DBBL 1EV2E 1OP5K 4KX8A 3RUGA 5B1CA 3U1QA 4Z3IA 1DVFD 4PQXA 1NMAL 1FZOA 2JK5B 2OR8A 3N50A 5GRYA 1ZRUA 4X8CA 1U8OA 4YDJB 3BN9D 5EO0A 5I1CL 4JREC 3QWOB 3TWCL 1U8MA 1KTCA 3BT2H 1DJXA 3T0AA 2GYSA 3LCYA 5I1LA 4LF3B 2CRIA 3PCYA 1JGEB 2NUTA 4KU1A 4CAGA 2YWZA 1P6FA 2DMBA 5E95B 1KNOA 4UBDD 3CLFH 2L7EA 5DHEA 2HKHH 1CT8A 1NOFA 1QKZL 2J1WA 2RHEA 3NAAH 4Z7QE 4URTB 3FQYA 1CK0H 2NYZA 3BLPX 4NN6B 2XG4B 3MGOB 4LOUC 3F58L 3G6JF 3MV8E 1TYEB 5JZ7D 1SJVA 1WP6A 3QJTB 3ARPA 1S9YA 1TNNA 3OG6B 1G1OA 3RWEA 2KPNA 3K6FA 1EUTA 3KH4A 5KANG 3M1BA 1B4LA 5IQ7L 2ICEC 4HJUA 1NGWB 5DK0B 4JM2A 4LLVB 4EDWL 3FTZA 4EIBA 4X8JA 3QUMB 3O6LL 2BP0B 1QI3A 1AJ7H 1KB5B 1T4KA 3QDHA 4V1DB 5F97E 3N9GH 3UBXB 2CHZA 4IJTA 1Q1PA 2YPKB 3C08H 4GUPA 1QHOA 2D8KA 1ET5A 5LO7A 1IEHA 3QHTC 5JOPE 5ESQA 2GW5A 2ARJA 1J1OH 3MRQA 3ZHNA 3VCLA 2DW5A 1JPGB 3KS0J 2FZ3B 4HG4J 2ZAGA 4L37A 3WHXA 1IBDA 4F33B 1CGSH 3L3KA 3QCVH 4B0MM 3WGUB 2FHBA 1J1PL 3N41B 1MRFL 4W9KC 4ZUTB 5HD8D 3L3OC 4YAQA 2FLBT 3SKNA 1E2WA 1FFTB 2LGNA 2AKRB 3H3BC 4GP4B 1ND0A 4I1RA 4IBQA 1ACXA 5FA4A 1DVXA 1FUNA 1FNLA 1JIBA 4XMKL 2XJLA 1YMMB 5C0IA 4A68A 1MSPA 3J07A 3MKKA 4L8BA 2WINA 3GC3A 2XN1A 5D1QD 2ZCHL 5GS0L 5IEKA 4Y5VA 3PHOB 4JFOA 4LIQH 2Q2EB 4JG1H 1OGPA 4X0NA 3C8KA 1WV7T 1A14L 4G8IA 5JW3L 1TG8A 3S37X 3UTSA 4NOBA 4YWGH 4LE8A 1H3VA 3HE6C 3R8BB 4WWKA 1J5HA 3HC0A 4KMTL 4K55A 1FG2B 3AG2B 1AIFB 1ZLVK 3L4ZA 2OTUA 4OM0H 2X4UB 4HJ0D 3B37A 3NIGB 3OG4B 4HEPG 1TU2B 4RNRB 5E51A 2LAAA 5LCVH 3ZHKA 4OZHB 5IP4A 1DDTA 2I32A 3UYOD 1CFSB 1U93B 1OHQA 2GQHA 4QXWA 4PLNC 4DAGH 2P5WB 3FU3A 3EOTH 4XPGL 4U1JA 1Q94A 3V52H 4XT1C 1K85A 2GJ6E 3EDFA 1TLKA 1GW0A 3PWPE 4TVSa 4U1NB 5AL0A 3REWB 2OYPA 1TZGH 1VEMA 3IDXL 5EFIA 3UG4A 3QUMH 3WIIH 1HOCB 4RESB 4YSPA 5AW2B 1KB5H 4D0BB 4OLVH 4UQAA 1I1AB 3L1OL 3RWJA 4Y4HA 4P5TA 4JJ5A 3VWJB 1JBJA 3TIDA 4Z8FL 3ULVC 1PG7L 4Z6AT 3K7UA 1WBYA 5ACLA 4Z5RA 2ZCLH 3HI5H 1KV7A 2EEXA 1SMDA 3ZHDA 4YBLC 1T89A 2H45A 3MRGB 2RH0A 2VUYA 4LAJH 4Y88A 1A8JH 2DQFB 1OCCB 3RX7A 4PGDA 3X3FH 1QFWL 4DGIL 4Z77A 3G04A 4ORGB 5LWYL 2J1YA 4KMLB 3HZKB 2DQIL 4JS7A 3W2DH 3BKJL 3HN3A 5C09D 1SY6L 2ZXQA 3VJ6A 2V9UA 3KLHD 3BIKA 2XACC 3BEVA 1I85C 1JERA 3GM8A 4J3OH 3C9NA 4G5ZH 5EIQA 3PNWB 1XXFC 3VXNB 1KXTA 2XZQL 4S1QH 3AZUA 4L0PB 5GGVY 4XZUA 5K93A 5IMMA 1ITCA 1JWMB 3LXCA 2GTZB 3B5GA 4QXTA 5L4JA 2L7QA 1NGPH 1XSJA 2C1OA 3O3BB 4E42A 4ZZFA 3C2AL 1AHKA 5TE6L 2J3SA 3EFOB 4HOZA 4PBWD 4HHWA 4XXCA 5JUEL 1P4IH 3FQ2A 3FUIA 1K72A 3FO2B 4NLAA 4PJXB 3UZVB 3MJ7A 3NCJH 1DUYA 5CCGE 1OP4A 2BVPB 3HG0A 3JTTB 1OP9A 5T8IA 1K8DA 4L8CA 1XH0A 4HCRA 4FI8A 3UXFA 1N70A 3JV6A 3HLKA 2KH2B 3QJSB 1IGIH 4LLUB 4PJ7B 4FZ8H 4R0LC 5F93C 3X1EA 4P0DA 4L4TD 5I2IB 2AHIA 3WEMA 4JO2H 2J6EH 4P4RA 2UZYB 3BQUC 1YPZB 4BJLA 3WJJA 1I8MA 2KLSA 5DEGA 2H2PD 4QIRA 2XTJB 3ES6B 4HXAL 1C5DB 2HPTA 3RKDC 1IL1A 4Q74A 4NO2A 3JWDH 1UOVA 2EIEA 2JCCA 1AZCA 2ZUQB 5C0JA 2VABA 2G0LA 5DRWA 4LRIC 4J1UA 4HMDA 3F5WB 3UMTA 3TO4C 2N0KA 4KTYA 5EU3B 4TRPH 1MWAL 2ICWJ 2K7PA 4NPYB 3KM1A 3TU6A 1T03H 1IE5A 3GZQA 2DBLL 3B2VL 5E4IA 1W0WB 3CDZA 3SPGA 5DMIH 4MB4A 3C09C 4BH8A 2WLHA 3WI9A 4HCFA 4GW1A 4MA8H 4BSVA 3BXNB 3OHMB 2GIMA 4EVNA 1X5HA 4M6AA 5I1GL 1PTZA 2GJZA 5F0PB 4LZKA 4AW7A 5ERWB 3TZVB 3GPEA 5C0CB 2FX8H 4H4NA 4K23H 4KVCL 4P4KD 4HIEB 2YEZB 2IPKA 3TFKC 5IB5A 2BOBA 3UTPE 3IJEA 5DWUH 1ZT1B 3QEGL 4JFFA 5BOPA 3Q2WA 3EJRA 2ZCKH 5D93C 1K8IB 5SX5H 1SQ2N 2UWEB 4LASL 1E6JH 1XZ0A 4Y1AE 5JIPA 1F4AA 2FIKB 3SGKC 4OI9A 1IQWL 2F61A 2P47B 3M7OA 1WLHA 4ZFZA 2AABH 1SYSA 4XNAA 2FEEL 1RZ8A 3H9HA 2NY4D 4NBZB 4Y16D 1CE6A 3WDJA 1KCRL 3CSGA 3DOSA 5FHAL 3R18A 3I6KA 3ZKND 3WFEL 4LLWB 1JUFB 3CH1B 4BK4A 2AJYH 4HWZB 3ARFD 1WAEA 3HLAB 3QG7H 4MGXA 3NZSA 1PPIA 5C08B 3HHSB 5JW4R 5IFJA 3W57A 1RJZA 4APQD 2DF3A 1QUPA 2BFVL 2EXYC 3VQMA 4ZFQA 1I8UA 4K07A 1CE1L 4Z0XB 1EEQA 1JPEA 4D9QE 2XVKA 3FZUD 2AJVH 1CFTB 2HFGL 3FUEA 3FTGB 4CMMB 1QLEH 1NFAA 1GKEA 1CF1A 2AJSL 2V37A 1HKFA 3BPCB 1UOLA 3DYPA 4WI0A 3NCFB 4F7CB 5LN8A 1WJ3A 2VXUH 4KUCD 5JLZA 3WEOA 2ORBL 2AW2A 2V2WB 4AIOA 4QRFA 3O41A 2PNDA 1FBIL 1RZIB 2OFQA 4HIIB 1A4JA 2YLKA 2ZQKA 5C9KA 4ZMWA 1U8JB 3UTZA 3A67L 3C8HA 3N43F 4TPRL 4AEHH 1CD1B 1NUDA 4ISVA 2A0LD 4GXUN 5AUMA 3ABZA 1OT1A 2A1WH 2E27L 3FBQA 4X50A 1BQHB 1HILA 1HHIB 2NNFA 4GMSH 5E5UB 3WE6B 4LP4A 4AG4L 5JHDD 4IOSD 4WK2B 4NIYE 2IPTL 4GRLB 4UTBA 2EDRA 4UDUB 4GG6B 4O2CB 3NDYE 1MI5D 3D39D 2VM3A 4KK8C 2CNZA 4GI8A 3T3PB 5JXED 1KPUA 3B2DC 1OAXH 3QR1A 1CDUA 1UM6L 2DQGH 4HD5A 4F1ZA 5AAPA 2M1KA 1PZ5A 4R7DB 1UH2A 4HAKA 2V3EA 1MAML 2BSTA 1QRNE 1YMHB 3K2MC 4KVNH 4RRPG 4XO4A 2HZHA 3LKPB 4JJOA 1FFRA 4UT9A 5JORA 1MCKA 1U8QB 4IOIA 1OCWH 1ASQA 5TK4A 1UCBH 1G7QA 2F1EA 4LSQL 4LK4A 4TTGA 4L1LA 1OOWA 2RBLA 1XAUA 3QPXL 1U3HD 1KJ3L 2HX9A 4LVNB 1G5AA 4NQCE 4BD4A 4B7LA 3GSXA 3S34H 2C9QA 2BRRH 4OQTL 3ECBA 2VDNB 3D4ZA 4ODXB 5IY5B 1S3KH 3VWKD 3F6JA 2PR9A 2I27N 3KWWB 3D05A 1GC1C 1T2JA 3BUBA 2WBKA 3L8QA 3UTQA 1KGYE 1AHMA 4ZSOB 2X4PB 5EOTA 3CFIC 5DD0L 2CLRA 2CR6A 4LSRL 1G7MB 4LKCB 1DLFH 3J8F7 1HS6A 2DTML 1C16B 2HT3D 2O4EA 3WUZA 4Y5YC 3EJZD 3Q5OA 3TN0C 1JHTA 1ITBB 1WUNT 3BD4A 3EJUA 4W9JC 5FB8A 3TESA 1KCSH 2WLLA 3ZGIA 1K6QL 2XJKA 5TQ0H 1OTUC 5JDSB 1FVDA 3V0IA 4BZ2H 4GSDH 3BPOB 1KT2B 4M4PA 1DUZA 2Z92A 3CSFA 4NXSA 1FH2A 2JE8A 2XWZA 2W8CA 5DS8A 3V10A 2JB6A 2QDVA 1ZS8B 3L3DB 5A43C 1CUOA 2XWJA 3ZQ9A 5J6HB 1LWHA 3JZYA 3TEUA 4JY6A 3B7SA 2GJ6A 1VERA 1ZANL 4XOBA 3KGUA 3AXLB 3SDXB 2QKIB 3TA3C 5IHLB 1OV8A 3BPNB 2Q20A 2VQ1A 5HGHB 2BXYA 5D2LF 4DW2L 1JK9B 4WGVB 3MODH 1FJ1A 4DKFH 3LPFA 3L2MA 5IMLB 2NSQA 3I2CL 5CJ8A 1KYOK 2NCEA 4DCQA 4TQ8A 3ZDXB 5L8KB 3LN4A 3TBYB 1HZHH 2W07A 3U0PB 5L0QB 4NX0A 2B77A 5MP6L 5C2BL 1EH9A 3MKGA 1RJLB 4O2EA 2WK2A 4HUXA 1J48A 4YHOH 1N6QH 1MCNA 4Q6KA 4FFZL 3BVDB 1CICD 5DYOB 5CCJA 5KYNA 3VB8A 3VXTB 4KQ3L 3MGTB 3QC6X 4Y8AA 2QFRA 5GGVL 2IH8A 2NY3B 2ZD0A 2J1XA 5EUKA 2H6UA 3DX7A 4GQZA 5HDBE 2F74A 1DJGA 3A4DA 4AYFA 1IZKA 1YA5A 4NGHH 5KYWB 2J72A 3FT4A 3RILA 1NPJA 4FRWA 1KV3A 4IRZA 2WOBA 1XF2B 5C0BD 1RULH 3I6LD 1G7IB 5I8OL 1HXKA 1J87A 3LYRA 2ICWI 2P46B 1KBGH 2FJHB 1CC3A 2HLAA 4K2UH 1LLAA 3C5ZB 5IJVA 1WZKA 1CURA 2NXYB 2OSLB 5KSVB 5DGRA 3T09A 2NSXA 3P30H 4YBQC 1MFCL 3F84A 4XNUL 1H3TA 4E9TA 3LPOA 4PBVC 1AI1L 4MJIB 4JR9L 3QUZA 3UZEA 5F7BA 1IGCH 1UWXH 2ZOKA 4HIQA 3CSTA 5D4JA 2LABA 3Q6GL 3QNZA 4E41D 4CRPA 5B7FA 3RUGB 1BAFH 1GPOL 4OZ4A 3HC4H 3PUCA 4FP8L 1MIEL 5E99L 1FZOB 1CDJA 2BH0A 3MV9D 1U8OB 3FSZA 2J8HA 4M7ZB 5DHVA 2VDKB 2BS71 2EEFA 3ZDYF 3ASNB 1DANT 3DJSA 3DPBB 4OLUL 5I1LB 4KI5C 4XVUC 5K1VA 3WBDA 2NUTB 4R5VA 4GT0A 2WGNB 1KNOB 5DJYA 1WAAF 5GSRB 1THAA 3I3EA 1ACYL 2JNZA 2WWMC 4F58L 3E6FA 3D39E 3D1MC 5ADOH 3DUUA 1PZBA 2CDEA 3KR3L 3S3JA 3HIZA 1NCBH 2BSED 1J9CT 3MJ6A 4DK3A 1LQBC 3HJEA 4ZQKA 3EGDA 2YD8A 5I15H 3D69A 4ELKA 2KT6A 3G6DH 3RWEB 3T6ZA 3B9KC 1EFXD 3M1BB 5F9AC 1E8ZA 4MCMA 4JM2B 1HX0A 4P04A 3OGCB 5JW4M 2F54D 3QVAA 1GXEA 2Z1KA 3SOBL 2VLKB 4DGUA 2AMUA 2JI1A 3RZWA 1JWSB 2K9UA 3I84A 2NY0C 5FYJH 2Q9OA 3NCCB 5LQBL 1E4XH 2D3NA 4KXBA 1MXGA 4Y1AA 1EGJH 4JE4B 3DHUA 1JPFA 1UT1A 4FQ2H 4LVEA 4IDJH 3GK8H 3ARWA 4W9LC 1LMIA 2QLYA 4FHKA 3RVXC 1IT9H 5HVGB 1Z3GL 1D2PA 3SKJL 2ARJB 1R5IA 1MFNA 5J9PA 3MRQB 1J5DA 3VCLB 3G9AB 4Q4IA 3LRLA 1DN0A 3WHXB 1P9MA 3CLEL 3BDYH 3FOMA 2OYKA 3R7QA 4YAQB 5EC2B 5I6XC 5FKAB 4AQ1A 2B4CH 1RXLA 3BP7B 4B0MB 1Z5HA 2FD6L 4M5YL 3C6LC 1LEGA 5I8EA 3MFGB 4M3KB 5CGTA 5F1KC 4OFIA 3CFNA 3P3RA 5C0IB 4MAYB 2CBQA 5IESL 4L8BB 2WINB 4ABUA 5F0JB 2YEVB 2VDKH 1CWVA 3AS1A 5IEKB 5KBDA 3NZHH 3LSOA 4Y5VB 4P46B 4JGUA 3RY6A 2H1LM 2FJFA 4LRNH 4PG2C 3GSOA 4XTRC 3NCXA 2MCPH 4U0RC 3VSUA 3ZE1E 3CVHL 2IAND 3UTSB 3LIUA 4N0YL 4DK6A 1EAQA 4DN3L 1KDIA 3E9UA 3HC0B 1CLOH 3O4LB 4W9ZA 1MPAL 4S1RH 4M62H 2A6DA 3O81A 1H6UA 1NC4D 3ARGB 3FU6A 2E7HA 3P9LB 3P2BA 3W9EA 1RUAH 4QRQB 3UEQA 4UTAA 3D3VB 4CNIA 3C2SA 4U3HA 1HSAA 1KENL 4MA3A 1TFHA 1WF5A 5H2BA 1JV5A 1QVOB 1L7IH 3ZTJH 4U1JB 1Q94B 2HLEB 2YHGA 4KY1H 5C09A 3SQOL 1QRNA 3LNGA 1UKTA 1OAYL 1QATA 2HH0L 5MEQA 1RK1A 4OCXH 3P77A 4OB5H 3EH1A 1I3GL 3VXOB 3GUTA 1YECH 4Y4HB 3G5XA 4P5TB 5GGQL 1T20A 1YEHH 2Q8AL 3OXSA 1WBYB 1DBKL 4Z5RB 3WKML 2EVJA 5GS2H 1QSFD 1ZXQA 2R2CA 5DLMH 1H9DA 4PN6A 1E40A 3DIVA 5AAWC 4UM9B 4HF5L 4PGDB 4O58H 4YHPA 4Z77B 2K45A 3MUGA 3RZCC 4G8FA 3G04B 3HKZA 1UD3A 4HJIA 1XDTT 3SKOA 3APMA 1R3KB 4PFEA 3W38A 1UKQA 1G43A 3FQNA 5DQDH 4IEFA 4MQXD 1H3UA 1QBML 1HEHC 4PJ8B 1FA4A 3ABKB 1KCVL 3VJ6B 4HSQA 3Q3GA 3BIKB 3BEVB 1BJMA 1A6UL 3HS0B 4Z7VE 3C9NB 2B1OA 5K33A 2C9UA 2ED7A 3WXVH 2JB5H 3IGFA 2GBTA 3PQYD 4MNHA 4XZUB 3TBVA 5KJ7E 1CBVL 2C1OB 4QHNA 4E42B 1WT5A 1WZ1L 3ARDB 3ECWA 1YYLL 2G4GA 3VUAA 4K5LA 1JD7A 3SE9H 5KANI 2OZ4L 3ZMRA 3BUDA 1GY2A 1CB4A 1ZTXH 3MJ7B 1LP9E 5BW7A 1GS6X 3VRJA 1R19A 2VJ8A 2AJUH 5DUPL 4OJFH 1U3JA 5HI3C 1K8DB 2F7OA 2Z0UA 5FM4A 4TLTA 2W80C 3CZGA 4JQVA 2YMTA 3JV6B 4QNPF 4Z7NF 4LPUA 1LO3H 4PJ5B 5FCSH 4KHTH 2ENYA 4YFLF 3B5TA 4P4RB 1AY1H 3OAYK 3S48A 3W0WD 3ARUA 3KAAA 5DEGB 4P3CL 4OZFG 1IL1B 5CU5A 5LHDA 4AGMA 2JCCB 4FXGB 1COBA 4FL4B 5C0JB 1ZHKA 5DRWB 5CKAA 1IBHA 4J1UB 3WLBA 5HI4C 3MXWH 3DSNB 3JSSA 5DD3L 2RCSL 2QHRL 3AM8C 3T0VA 5AVSB 4NPKA 2WJ7A 4MTMA 3CDZB 5LKNA 1KXVC 3HB3C 4BH8B 5T3XE 3L4XA 3SQBA 1H8OA 4GW1B 5DUML 1KEGL 4BSVB 1UH3A 4MA1B 2WAQA 1B4JL 5JIMA 2GJZB 4Y2NA 3KZ8A 3EJJX 1JGVH 4AMKH 3NFSL 1UD8A 3DK2A 1N12A 2CIIA 1AANA 1NCHA 2BOBB 4TSAL 3IJEB 3PDOA 4UB0L 4JFFB 2P5EB 1V3JA 1CFQA 3RRQA 3SGJA 2W1NA 3K2UL 4PLKD 2DWEA 1B0IA 2EE0A 4JDTH 1XZ0B 5EUOF 2EE6A 3WIAA 3MR9A 2WIMA 4PW4A 3DUSA 3FCGA 4JRWA 1SYSB 2JKSA 4DP8X 1P7QD 3H9HB 4R4FL 3NJGA 5JQ6H 4KKQA 1CE6B 1DQVA 3DOSB 3L45A 2IANE 3R1GL 4NCDA 4XN1A 4JPWH 2BLFA 2GAZA 4X7CC 3SDXF 5IFJB 1G9NL 4KDVA 1BZ7A 2ZWNA 2R7EB 4XCYA 4RFOL 2I24N 4Z0BH 1GL4B 3F01A 3FT2A 3NCYP 3OL2A 1L5GA 2ESVD 1XF5A 4U1IA 2FB4H 3GMRA 1J0IA 3D39A 4Z7QB 1O7VA 2VGLM 5CR8A 1OAQH 5DR5H 1EJOL 1RZKH 2CA4A 3REVA 5BVPL 5FV2A 4Q4EA 4KDTC 3FN0H 3I9GL 1OSPH 4WI0B 2ZT9C 4AWJC 3GRWH 3FCBA 4YC2C 3DX2A 4XVTH 1P1VA 1PX3A 4ZFOL 5ACZA 4ICWA 4OF8A 4XAKD 5FO9A 4Q97A 4WHTB 3ZE0E 5MEPA 4IRJD 3B83A 4KRLB 1A4JB 4UQ2A 2E9BA 1UWEH 4BIKA 1UOKA 4DKEH 4KI5F 3UTZB 2NMSA 2OK0L 3NSJA 3NZUA 3KLSA 5CJOL 4YSAA 4ISVB 4LQFL 5EC1A 2IDUA 1AR1B 2NNAB 3SDCA 4PW9A 2AQ3A 2VXSL 3EBAA 1U3HA 2DQCH 2G60L 3QZLA 4RWYH 2YGOA 3HTLX 4XOEA 1DVTA 2DIBA 4U1KB 1URIA 4KRPD 1N0LA 1RZ7H 2GI7A 15C8L 2IDQA 4F93B 3JUZA 1HKLL 5AYUL 4M5ZL 2E56A 4MJ6A 1X5KA 3EZJB 1I3RA 4FFYA 3OB8A 4MMXA 3S88H 3T08A 2EKSB 3C5SA 4KROD 3K8LA 5DZAA 2R9HC 4XPTH 4NC1E 5CM1A 8FABA 5TDNA 3RVTC 5GRJH 2P5PA 4GS7B 3EYSL 2BSTB 2ZXDA 1J8KA 4AI7A 1YEEL 3FRPG 5DSCA 1YUHA 1GZQA 3O9WA 5JORB 2VDMB 1AQKL 1X5AA 1E27A 3SB3A 1CGXA 4L3ED 1BVLA 5LNGA 3DYOA 4PTUB 5FF6B 1ZSHA 1RUKH 1RL1A 4ANVA 1A22B 1TKWA 1IM3B 1WUZA 2D9CA 1X5FA 5IB1A 2F5AH 1L4IA 1YO4A 3GSXB 1PD6A 1QAWA 3RVVD 4C4UA 4ZG1A 2J8UF 3BLBA 2RAMA 3X3GH 4GAYA 4N3TA 3UTQB 3VFGL 3OMAB 2V7HA 5SWQA 4W9FC 3NFNB 2GABA 2CLRB 1KELL 5L7XH 1ADQA 2HKFL 4HU8A 2VITA 4N0FB 1ZHLA 3WFCH 3UP6A 2XY2A 4WFFD 4KO7A 2R15A 1JHTB 4N22A 2ZWYA 4HIXH 4KFZC 1IBZA 4LDOB 3CVCA 5FB8B 3Q06A 1ZGLP 2WLLB 4TYUA 1X5JA 4HXBL 5D2NE 5C0FB 3JWOC 3BC9A 1E30A 4AY0A 1O5DT 1E2VA 1FVDB 3PIQA 5JIHA 3LKNB 4HWUA 2GSIA 4DETA 1DUZB 3OKYA 4R97C 3MRBB 3V8CA 4TTDC 1IBYA 3EFFA 1WPCA 2JB6B 5D70H 4JKPH 2XWJB 1KN2H 2JJTA 5KBLA 5J3HD 1QTPA 2AF2A 2GBVA 4I0KA 4JY6B 4QMEA 1OGAD 4ZS7L 2GJ6B 3CVDA 4PBDA 4P06A 2B2XH 4YE4H 3X12A 2VMEA 1A7QH 4GRWF 2MKWA 4XPFH 2DWTA 2E86A 2IALA 3FO0H 3KMDA 3THML 2ZONA 1LK3L 5HHXH 1ONQA 3UG3A 1FJ1B 3RFZA 1VSCA 1QTSA 4JFDD 3NEOA 4K0OA 5IQMA 4ZTOH 4MS8C 2KS0A 3EJPA 3FSVA 3IE4A 4DCQB 1WQVT 3K4ZA 3OBAA 2X05A 1GGIL 4LLYB 2YO3A 5DZ9A 2HVKB 5KN5A 4O2EB 2ADFH 5EORH 4B50A 3NSFA 2MRYA 3EBHA 5SV4A 1XQ4A 2LW3A 1XF3B 1YVLA 3FONA 3F65A 3LH8A 4P2QD 4CBZA 3VI4B 3SGEH 3G9VA 5B3SB 3VI3E 1TETH 3ZR5A 2VDMH 3RVUD 3DX7B 4EKXA 2F74B 4AYFB 5C9JB 2CHXA 2HX7A 2NY1C 1A6WH 1LO5A 4JM0A 2O5ZH 4I0PC 5HHME 1NGYA 2VJXA 4Z7VA 3U46A 2R4RH 1WS8A 5FHBL 1QBBA 2EABA 2Y23A 1MHCA 4NEHB 1RQ5A 1X5XA 4BUHA 1TTAA 1T7XA 4DNLA 4W6XB 2ZXBA 4F2EA 5I8CA 5IJVB 3GEWB 3GXTA 4PJBB 1EDHA 5AW7B 3I74A 5CUSL 3DO7A 1YEGL 4POZC 3FH8A 2R59A 1CLZL 4TSBL 4P2OD 1M1SA 5DJ2A 1UJ3B 4QF1B 2PPEA 4UOZA 5DZJA 2PP7A 2IAMA 5IHBA 1RUQH 4KXAA 2AXHA 5DT1H 3QNZB 1IILE 4ZOAA 1Q9LB 4I2XE 4MNQE 4OZ4B 2WXGA 2BSEA 5HHPA 1BJ1H 3TURA 1X9UA 2A4ZA 5E03A 4YS4A 1V10A 2Q7AA 4PHZA 2XCMC 3ALXA 3F12A 2AEPH 1O7DE 1XIWC 4M1DH 4ZPVA 3IM1A 4HFWA 4M6NH 3NP3A 4YZFE 3FUDA 4AZ8A 5DMGD 1S7QA 4WI5A 3HS8A 5GZNA 2BX5A 3O3EA 3QEQD 5FAAA 4C59B 4Y19D 1UB6A 2IOIA 4TQHA 3FTSA 3FB8B 4UIKH 2ENSA 4Z18A 5EOCH 4XBPA 4WGWB 5FCUH 2B20A 5ID1A 1P7KB 2XFXA 4JFEE 2VZ3A 3GLEA 4XHJD 4JPSA 3E6FB 2WXKA 3D5OF 1FGNH 4MZ3A 3DUUB 1BQHG 1N59B 4IRSC 2R69L 3EHBD 2DDQH 4N28A 4L29A 4GY4A 1IAII 1QG3A 3QFDA 3K0WA 3P11L 5KJRH 4X42A 3VXQB 1KG0A 3UC0H 3AABA 3D69B 3N6YA 4LCCC 4P59H 1E7UA 4Y4KC 5G5DA 4MJJA 4ELKB 2GY5A 3BVXA 4J3SA 4LEEA 4ODHL 3D9AL 1RHHA 1ZLUK 2N1TE 1A6AA 1KN4H 4BCYA 4WV1B 3EZ8A 1KGCD 5GISL 4YXKL 1DQDH 2J71A 3EYFA 1WBXA 1YQVL 3QPKA 4I13B 4GYBA 3VQ2C 1AE6H 3KGTA 3FBKA 5F9JB 4IK7A 2FATL 1FORH 4JN2A 5FWRA 5BZWB 4IRZH 4UT7L 2CRZA 4FFVD 1OE2A 3L4WA 1MFDH 2EACA 2UZIL 4XB7A 5D1QB 3HOGA 4I85A 4XXWC 1SOKA 5DMKA 4JRYD 2X4QA 1R4XA 3K81A 1UZ8A 1XT5A 1MCBA 1R5IB 2C9XA 2CR0A 3CFTA 3OF6D 3IJ8A 5KVEE 4RIRA 5K1JA 1AC6A 4RAVA 2EECA 2IANA 1DN0B 1OZUA 5KVDL 3HNTH 3SIKA 1NIEA 3B34A 4G1MA 4GPVA 3KPMA 1I9JL 3FOMB 3GXFA 3LQAC 4MCZA 3GZPA 1NC4A 1FPTL 1H8LA 2EC9T 1JZGA 3FOLA 1WZLA 1J18A 4QHMB 3DETD 4AQ1B 3PF2A 1BP3B 3PAZA 4Q9BA 1LEGB 5I8EB 3EH3B 2VNCA 4L1SA 2ZWZA 5I23A 2VN7A 3O4OC 3PFQA 2X2YA 3G5ZA 4C58B 3DMMC 4RMSA 4L2YA 5GS0D 1XCWA 4OCLC 3LSOB 2XZAL 3Q01A 5B4MD 5DFVD 2FJFB 2XLLA 3GSOB 4N9GA 2ZAIA 3AUVA 2QQNL 4OLWH 4CSZA 1JNHA 1VFBA 3VM5A 3SYPA 1Q0YH 3S8FB 1M7DB 3L5XH 4NI6A 3T0ED 4JFDE 2JCCF 4A2FA 4BKSC 1DVSA 2A6DB 4BFNA 3FT1A 3FPXA 3B56A 1DEDA 5C07D 3W9EB 1U95A 3CV5A 1G6RA 4FQHA 5C0AD 3GT6A 2YGQA 2VLJE 4CNIB 1HSAB 2AANA 3B2PA 4R90L 4NS0A 2PWEA 4I7ZC 4MA3B 1LWJA 5FUCC 4ZK8A 3OV6A 4UQ3B 5HTSA 3CE1A 3ULVL 1MHHA 1SN0A 2H6PA 3FTUA 1JV5B 3HRZC 2Q2LA 4EI5C 1YEKL 2HRHA 5DJXA 3P3TA 2ZP9A 3CMGA 3S9DB 1R3HA 4X5LA 2P48B 5C09B 3GSNL 3TNNA 2VLMD 2NT1A 1A47A 4M1CD 3JT2A 1B90A 1QRNB 4KPHL 1AHWA 5MEQB 3NG5A 1DSWA 1RK1B 4Z3TA 3GD1C 5AVUB 1P84J 5LGYA 3GIZL 4M9PA 3DC0A 3G5XB 1A3RH 3HPLB 4DUXA 4YNYA 1T20B 3NEEA 4KK9D 3OXSB 3R7RA 2E4FA 1QO3A 2BK8A 1KB3A 1FCGA 3FUJA 3GXDA 4MDJB 4O02A 2GUOA 3KJ6L 2VXTH 4LEOA 1J5OH 1XCQA 3L4CA 4OBSA 2BC4A 5F9WB 1JXFA 3QFJE 5T1JA 1T0NA 1OE1A 2Y7LA 3B7YA 1N6UA 2R83A 3CPUA 4UZGA 5IBUB 5EA0L 4QHLB 4JPKL 5CZKA 4RGOL 3L1EA 3NCBB 3DVGA 4XMLH 1BWMA 4MD4A 1YLBB 4PGZA 1E43A 1G7HA 4JBSA 1A4BA 3SKOB 2WZ5A 3DXAD 4OFYA 3FQNB 3OAZH 5CLWA 4KZ0A 4LSSL 4CC4A 3L9RB 4LNVA 1A7OL 5CJXA 1KF9B 3I3DA 3AUWB 3BO8A 5L8LB 5D2NA 2X10A 1OD7A 4L4TB 3RPKA 3WD5H 3VW3L 4LCYA 3IE9A 4M02A 4QTIL 4GQRA 4OLYL 4ZAKD 2ILLA 3NJVA 1NCDL 4C56E 1FL3A 2J55A 3VG9C 1EAPA 3AY4C 3TBVB 3U0TA 3MJ8A 1L9QA 1DTUA 4QHNB 3CFKA 1TJMA 4MD0B 3LN5A 5HYFA 3VX0A 4DEPC 2Z7WA 2V5RA 4X7SL 3ROLA 4PCKA 3VRJB 1N4XL 1QW8A 4FKKA 2CKBA 3ARTA 1X5YA 3RIFK 2Y3AA 1EXUB 5J11C 3GMQA 1U8NB 5DZLA 4RGNC 1UA6H 3KLKA 3QIWA 4P4KB 3G08A 3TTYA 3O3UN 3QIBC 2A3TA 1HE8A 1JGUL 3F7KA 5FX3A 3TPUA 2WANA 4HPOL 3GLAA 2O1AA 5G4OA 1A65A 3QE5A 3VI3A 1MFUA 1L9OA 5HDBB 2FGWL 4GRMA 2VDPB 4NO5A 2XTSA 4TNWF 1MCPL 4I9XA 5D7KE 2X9XA 4Y9GA 5B1BB 2Y1YA 1OD9A 4JRYE 3C60C 2PR4L 1P7QA 1A6TA 1O6SA 2J56A 2NY4B 2YRBA 1HXYA 1LXMA 4HUKB 2NY7H 4AGPA 2CPCA 4G6JL 4KKLD 3SQBB 2X28A 4DOHE 4NNYA 1IV8A 4O51B 3SKMA 1XFPA 3T71A 2VERA 5CN3A 4GFTB 2WUBL 4MXQC 4NZTH 4I1PA 4WFGD 5B3NA 1NC2D 1EIBA 3GINA 2IG2L 3KCWA 4WCYL 2ROYA 2CIIB 1D9KD 5T1DL 3PDOB 4ACTA 1CFQB 2ROXA 5ALCH 4OF3A 2DWEB 1D7DA 3QPQC 1H0DB 4I2XA 4MNQA 2X12A 3UO1L 3BLKA 1RFDL 3MR9B 3UG5A 2PO6C 4OCWL 5C2UB 2WCPA 5ISZD 3T0DA 4Y2DA 4M8VA 1RIUH 5DO8A 1BFTA 2AK4D 1HN1A 3IMRA 2O6FA 2X2UA 4TNEA 3KBHE 4KK5D 2GAZB 5F1IA 2AAAA 1BZ7B 4FXTA 5E4AA 4U1HA 5E0QA 4L9LA 4DPCX 3CXHJ 2YXFA 4H88L 2X88A 1J1XH 4JFEA 1L5GB 1XF5B 4HALA 1EO8L 3GMRB 3WFBH 3CZKA 3DI3B 1MI5B 3D39B 2UUDK 4X9YA 3WL9B 4DVRH 1WE5A 4PLJC 2EYTA 4U6XB 3QDJE 1H15A 2NRDA 4PRPE 1YNKL 2BSDA 4QRRE 3AWFA 4P2RE 2QELA 3P40A 4ZTPH 5ACZB 2AS5M 4QHUA 4GP8B 5FO9B 5MEPB 4G71B 2IMMA 2IPUK 1QNZH 2WYTA 3OKOA 5EWIH 5EZIH 1UM4H 4UQ2B 3I9AA 4PB0L 5TF1H 3CFDA 5EPMA 3JWNE 4FMFA 1L7TH 4L3EA 1OTSC 4LSDA 2LFEA 3C8DA 4HK3J 5EC1B 3STLA 3BGFB 3SDCB 1L9RA 1RD6A 1B0WA 2A74C 2VDPH 2P26A 4FQIH 5D8JL 1F11A 4ZD3H 4A6YL 1U3HB 1Z0MA 3CLWA 3IDMA 4L3CA 3LZRA 3EJYC 4IU2A 2VLRD 3V0WH 3VWKB 4IIQA 2CGRL 4XN7A 1NEPA 2YQBA 1TJGH 3IFOA 4WSGA 4MJ6B 2EDWA 2D3LA 4QAMB 4XMTA 2WNWA 3HZVA 4R3SB 2UXGA 1I3RB 3IDUA 2Y5TB 3C5SB 2IFFH 4HWBL 3B3IA 5TF0A 3RGVD 4JQXA 4ZS6C 8FABB 5TDNB 3B43A 3DOIA 3GXMA 3VXRD 4G8AC 1GC1L 3RHWF 4KUZL 3H56A 2ZYRA 3L1FA 1DR9A 4YBHA 1VFOA 1YUHB 1GZQB 1U4EA 3O9WB 3L4TA 5I1DA 1E27B 3UJJL 3CK0H 1BVLB 2F8IA 4MJ5B 4XPHH 1FZJA 3NABH 5DRZA 5IB1B 3VMOA 3SDYH 1TZHA 3VGAB 1JXGA 3BAXA 2APWA 2R39A 5FA3A 2JJWA 1OP5H 4BH7A 4JCLA 5LN4A 5AB0A 1FGVH 4GAYB 2KERA 3BI9X 3IJHA 1EQWA 2V7HB 5SWQB 2ALWA 3KL3A 4NUGH 1YEJH 3P0VL 4YE0A 3WIHA 1FVCB 2AP2A 4OZIE 1A7PL 3ZE1B 1L9PA 4W9DC 4DQAA 1NUGA 3H55A 3O0RL 3VWJC 5D72H 1J05A 2VZSA 5BNXD 1FO0H 4JFDA 5FUZH 4NT6A 4KWUA 4AM0Q 3GLDA 2A77H 1VZIA 4X99A 1KCUH 3MA9H 1F3DH 4OIIH 4DP4X 4KJPC 3PIQB 2GSIB 2F6AA 1FC1A 2WXRA 5I17A 3V8OA 4BSWA 5D1QC 1D5BA 5D55A 4L5FL 4TVPD 4FNTA 2FNWA 4MB1A 3RWHA 3ESMA 2ADYA 2EEDA 4E5XB 2X0UA 5HYSA 4NWUH 3X12B 1KYAA 4CJ0A 4Z7OE 1DSFH 2IGFL 2NXZC 4ONOA 2IALB 1BBDH 2UXFA 4OGYH 9CGTA 2CHDA 2XWCA 1BG1A 3SBWC 1ONQB 5EU4A 3K6IA 4G1EA 2OR9L 1AXTH 5I5RA 2Y5QA 5BV7B 1R47A 4HEME 5EBLA 3NH7L 1XEDA 4XPBL 4WVRA 3RNKA 3NJNA 2R23A 2WV3A 2YMOA 4QRPE 3QFJA 4FFYH 2W38A 3KPNB 1EXHA 1J0JA 2F0CA 2H2SD 4WFGE 3AS3A 1ZE3H 2WO2B 4OUOA 1CN4A 4FG6D 5GJSH 3IF1A 5E8OA 3IRCA 4FYRA 5CZVL 4ODTH 4P05A 4QY8B 2GJRA 4E41B 2HPOA 3JVFC 4EIGB 1N67A 3IJYA 3GEFA 3H8NA 1KWGA 1HC1A 4TV3A 5HHOE 4N6QA 1BYPA 1VGKA 3RWIA 4DN4H 4MB3A 1HQRA 3FU7A 3NTCH 3MV9B 5TPWL 2ZKHL 5D1XC 5LXVA 2A73A 4Z7VB 3U46B 2A7BA 3PHAA 2H6OA 1JI1A 2F1AA 4XCCL 5TH2A 4YHYB 4Z7WE 5IF0A 4GXVH 1G5GA 2AK4E 5IUCA 4PB9L 4TUUA 5FGSA 1QHPA 1AGDB 4C56A 4I88A 1S2EA 3GDBA 2WWNA 1ETJA 1JZFA 2VUKA 1GGCH 4PJCE 1MJ7H 3DO7B 4PPTA 4XPAL 2FBOJ 3ZKXB 3NJFA 2XKUA 3LAFA 4BFFA 3KEHA 4Q56A 3FU9A 3VFUA 3UOAB 2E76C 5C3LD 4X2UA 3MLYH 3NYKA 2VMJA 5DJ2B 4AVIA 1X3DA 1WEJH 1G0YR 1JVKA 2DQJH 2DQDL 4WJ5A 1U2HA 3SY0A 4KOBA 4X5XA 2OV0A 1BVKA 1UASA 4QXUL 4YPGA 3K2KA 1Q72L 3N1QC 3HVDA 4LCUA 4CVZA 3F7QA 5E5LA 4BFIA 2ITDA 1ZLVH 3TZVC 1VPOH 2QMKA 1EFXB 5CO1A 4M7LL 4ZPVB 4HFWB 2EDLA 3P73A 4AZ8B 1XGPB 2J20A 1SZNA 4D9RD 2OA9A 4F9LC 1S7QB 1H3XA 3KL5A 1E4JA 2LR4A 3LEXA 4P48A 5AALA 2D7NA 5D1ZC 1UQSA 2AXGA 1QR1A 1BD2E 4MFHA 4OD3L 4ATWA 4DUWA 3QYMA 3PHSA 3BAWA 3D87B 1NLBH 5EBMA 3TONA 5ID1B 2XFXB 3A3YB 4X0KA 4OGAC 5BV7H 5I6MA 1PZ2A 1F41A 3AU1A 4TXVB 4JRYA 1DL7H 3QEHA 3D4CA 1WZAA 1U8HA 3DROA 4L29B 2PCXA 3QFDB 3QZNA 4OVVA 4ZUVB 1KG0B 5G5DB 3N2JA 2DI7A 3B7UX 1ZLEA 3MYZA 4FULA 3CIQA 1RHHB 1A6AB 1F6LL 2V9RA 2WCGA 1WBZA 4YXHH 1LTXA 2IH1A 1BPLB 4L18A 2D7QA 2APFA 3E3QE 1EHAA 3N91A 4JN2B 4ELDA 4O2FB 1WD9A 3LEVH 4WU7B 3CFBB 3SDDD 3U7YH 4JRFA 3MCKB 3HFFA 3ZUCA 3L81A 5DMKB 2X4QB 3BE1L 3QORC 1HOEA 3S35X 1UZ8B 2LVEA 4U6YA 3SOTA 3V9FA 4FKHA 4BELD 1F1AA 5I26A 4RIRB 3EADA 2KMWA 2IANB 3OJDB 1FHGA 3APDA 1AGBA 1FYTE 4G1MB 1BZEA 4W4OC 3VXUD 3T0EA 3BAEH 4JKNA 1DYZA 5CEZD 4JG9A 4FQLL 4G72B 4MCZB 3DJZA 2VT0A 1NC4B 3WKYA 4NYLB 2NNXA 1BMGA 3FOLB 2PXYA 1H19A 1ZT4A 5E8EA 3ARBA 3IKKA 3VTAA 3LH2H 4DESA 2VDRL 1UUSA 5E2VH 2MQ3A 5GHWL 4ZX5A 3TCLA 4YH6A 3RJDA 5ABDE 3EJQA 3G5ZB 3QDJA 1QPXA 4PRPA 1A0QL 2X89D 4Y1TA 5I5JA 4QRRA 4P2RA 3EO0A 3RJOA 2QQKL 3BWUF 4AENA 4N9GB 1WIOA 4WAFA 3OPZL 4JQIL 1YHPA 2N59A 2WQRA 1ZPLA 1EFQA 5TE4H 5FGCE 3L95B 4DTGL 2B1AH 3PL6C 4G7VL 5M7QA 3SE6A 1NAKH 2ICWA 2EDNA 1S9KC 4W4NA 5C86A 4LVNC 5HDBF 2A6KA 3ECUA 3WKQA 1U91A 3VNZA 5ILTL 3H42L 1U95B 4X9HA 2WGXA 6FABH 4ODVL 4D8OA 1QSFB 4RAHA 4FQHB 2F5BH 5KSAD 5B1JC 3MOBL 4MVBC 35C8H 4HIJA 5T5FH 3O6MH 1NBQA 1MHHB 2H6PB 2W0KA 4HJEA 2HRPL 4ES8A 5DJXB 5AOZA 2C9SA 3FAWA 4IMKC 5IW6A 2RGSA 1D5XB 3MBEC 3SE3A 1R3HB 5IROA 2XXCB 2IH9A 5F0MB 2EIDA 4JPVL 4NUPA 3KYKH 1SY6A 5BZZA 4EXPX 2AGJL 4JO1H 1GY1A 1BYNA 2GJJA 1U8CA 3GGWB 1TQCC 2HT2C 2X2HA 5E2UL 4PRHD 3DBXB 4PJAF 3BPOC 1SXZA 1Y6NR 4KTDH 2BFGA 2OMUA 2FJGA 4OSUH 4YNYB 2EUVA 1QO3B 4ZMXA 5DXWA 2OJEA 1YY8A 1F6FB 2GUOB 4NQSB 4LEOB 2VDQL 4O02B 1XCQB 4UYQA 1CXLA 1VCAA 1NJ9A 2A9NL 4KXDA 1XD1A 3FUHA 1WAPA 4GSUA 1FVEA 2EZ0D 3DIDA 1MNUL 1YZZA 3GMLA 4K5MA 4N0UA 3DVGB 4OZIA 2DQUL 2D7TL 3D4YA 2WXOA 4YDLC 1G7HB 4PSRA 1CDBA 2OXHB 3MREA 4LCIH 4MZRA 1AO7E 5D5ME 4WNQB 3S3SA 1BQLL 1ZMYA 5ADPH 1M7UA 4HMCA 3TEXA 1O5PA 1TF4A 1A4KA 1BFOA 4PSPA 5AOJA 2CO3A 4N87A 1K5WA 1Q1JH 4HJTA 2D3VA 3IWVA 3LKOA 3FUFA 5AVZB 1LO2H 3BO8B 4U6VL 5D2NB 4HZLA 2APTA 4ZQTA 1I3UA 1S78C 4WDIA 3VXSD 4LCYB 2GITA 4Q52A 1NFIA 3ZY7A 1FL3B 2EDXA 1SM3L 3DO3A 2K8QA 1A8ZA 2HVJA 4JE0A 2AERT 4LGRB 5GZOD 4MNGE 5AOLA 3U0TB 2NY3C 2ZJSH 2X2IA 1YUKB 3UDWC 3CFKB 5I19L 2FRGP 2DAVA 2YD5A 3VACA 1QLRB 3V7MA 4OAWA 2Z4QB 4XC3L 2N4IA 4N9OB 5SWZE 1MWAA 3MRDB 1U3NA 3ROLB 2Y36L 1NAML 4YFLI 4YHML 4HUVA 2VKWA 3FQXA 3KLLA 1NPNA 2CQVA 1JGDB 2EVGA 4JFQA 1JSYA 3UGEA 1G9MH 4HEMA 4NO3A 4Z7IA 2ZAHA 5INDA 4AYDC 1A2YA 2BIMA 1ZLSL 1UD5A 1MCOH 3QIWB 2BS8A 1P84K 1SHSA 2CA3A 3QIUA 5A16A 1NIDA 5E7FA 3G08B 3MJ9L 4Y4FD 1NINA 32C2A 5I1HH 2XFGB 5AOMA 4N8PA 2CRYA 5IHUL 4ZOBA 3TPUB 4Y2LA 1PY4A 2W0LA 4LCWE 2B4CC 4HGMA 3DTXA 1PSKH 4G3YH 5EF0A 3VI3B 2VC2B 2IDCA 1AH1A 2NTFA 1QD0A 3H9YA 2OTPA 5DCCA 3IDGA 4WEMB 5AL8A 4NKDA 5HHOA 4QYOA 3L3HA 2DD8H 2VSCA 5MHSD 1CFNA 4WIQA 4JVWA 1J0HA 2BP8A 3JTBA 4E9SA 1P7QB 1F2QA 1NPUA 1O6SB 4O02H 1TVBA 4FABL 4Z7WA 4HFUH 1EEZA 2Q5BA 2J6WA 2AK4A 1NBZA 2AVFA 3F04A 1K5NA 5HDWA 3OJVC 3TP4A 4NNYB 3SKMB 4ABVA 1N64L 2CM6A 2DLFL 5DEZA 2P44B 4PRID 2Y2WA 3N85H 1H3WM 4AGNA 3ZE1F 2P8PA 4BA0A 4GUQA 1HNFA 5CHNA 1OARH 3FNKA 5IVXF 3W11C 4TUKH 2Z9TA 3GM0A 2JCWA 3QQXA 5FYLD 1WHPA 4TF4A 1HCZA 4JRXE 2WZ0A 1IGJA 4I2XB 4MNQB 3T4YB 4EF3A 1JHLH 2ED8A 1U9KA 1ODAA 4BRJA 3VFPA 3VQLA 2EIJB 4IRJB 1IGYA 3Q8CA 2P8MA 5HHVL 5B39A 5J12B 4CW1B 1IM9D 5EF1A 5F7UA 5EU7C 3SKUD 1U8KB 3CIAA 1MOEA 3ZL1A 1BIHA 1BD2A 3TBBA 2ENPA 3BKML 4OTXH 2HTLD 4U1HB 2NZIA 3AU0A 4L9LB 2YPLD 5C0RL 4Z95H 2HG0A 2A9BA 2PYEE 2VLRA 2ZG3A 4ETQB 5IT2L 1X7QA 3OHXA 4JFEB 4ZUUA 4WO4D 3TVMC 1JRHL 2VJ0A 3H85A 3KG5A 2C9RA 1D5ZA 4LEXL 3UBHA 1U92A 1FNSL 1BJ8A 2QHLA 4M6OH 2WZPD 3KW8A 4KROB 1H15B 2AZAA 4QEGA 5EZOH 5IREA 1NOAA 1JWUA 2H3KA 5FLUA 2R27A 3J7HA 3VXRA 3MTRA 1AOHA 4QHUB 3X11A 4AV5A 5ABZA 4NLHA 5CMAA 2E5EA 1UZ6E 3LRMA 4OFQA 3CFDB 1V3LA 5EPMB 4L3EB 4PRHE 3ILEA 2VC2H 1X5IA 3STLB 1UXMA 1IGML 1F2XK 4GLRI 3KCPA 4MAYC 2BCKA 3PWLA 4L8SC 3IDMB 5EH1A 4TNVF 2A6JA 3DX1A 3MLTA 4L3CB 2MJWA 1SN2A 3Q7JA 4OQTA 4YXLH 4JHBA 5BVJA 5KVFH 3WS6A 2GTQA 2R56L 2W0PA 2B16A 3BW9B 4PRDB 3V0GA 1H3GA 4IIQB 4P46C 3BH9A 3KH3A 3IFOB 1XH1A 1AZUA 1Y7VA 3HC3L 2CE6A 5HGAB 3DV6A 4R26L 4HLZH 1SYVA 3WY1A 3LY6A 1OWRM 4BKLA 3FSOA 3B3IB 4MMZC 3QJUB 5CSGA 1UA7A 1HCVA 1R3LA 3L3JB 4WFED 1FYTA 1T83C 1BGXH 2XVBA 3T1FB 3K1KC 3ARGC 5IBUG 1ETA1 4BQ6A 3P4NB 1NMBH 5I1DB 2DEXX 2FSEB 2YAFA 1LP9F 1QSEE 1GYWA 4YVNA 1O9VA 1EHKB 4NZRH 3CN1A 5IG7B 3ZIMA 4CU7A 1TZHB 3BOVA 2MH4A 4WZ9A 5HPMA 3QRGH 3MRIA 5FA3B 2B1HL 3M1OA 4LBEA 4B60A 1OANA 3CXHK 4BH7B 3G6JE 3CXDH 3S8WA 3EH4B 3MRCA 3IJHB 4AXWA 3MRMB 3SSGA 4JCMA 5BRPA 5IMOA 5CD5D 2YARA 4NQED 3VA6A 2BNRE 2YPVH 2VDLL 4LDCA 4J3XA 3SCMD 1PQZB 2NZ9C 3QI9D 1J05B 4KK6D 1DQKA 3BZEB 4JFDB 3DRTA 4NT6B 1F4WL 1KBPA 3LD8B 2QQLL 4LEBA 4NQTA 5D96C 1SXCA 4ZUSA 3ULUC 5TFSL 4WWID 4HX1B 3K2IA 2IOMA 4X99B 5KAQF 2W59A 2YUWA 3UCRA 4APXA 2VR9A 5AKRA 3WTYA 2JKXA 1J0KA 5CN2A 3LZQA 4IOFC 2EADA 5D7HA 5DFAA 5I17B 4FTDA 4FXKC 4LKXA 2VR3A 4LSTH 1IAKA 2YFNA 3P1VA 1D5BB 4BSWB 4GIOA 4P2QB 3RWHB 5HYSB 3TV8A 3TYFA 4C8XA 4IIZA 2P7TA 3QS2A 4PJ8C 1M2OA 5KYUA 2ZE0A 5BZXA 1XGZA 1ZXKA 2N1KA 4ZW8A 5IIEA 3HS0C 1IFRA 1NCCH 2W65A 5EU4B 4JHWL 4G1EB 2ATPB 3WNMA 3DIFA 2YJQA 3CZJA 3KNBA 5EBLB 4NUJA 2HFFA 3KVPA 4QD2E 3UAJA 3RNKB 5E1QA 4E9XA 2R23B 3RAJH 2VIRA 5KVEH 2C34A 2ZOTA 3O6KH 1M7XA 2WYZA 4NM4L 3ARDC 1CTOA 2R1XA 4P2OB 1U8PA 3U4EA 2YRZA 1I8LA 3ZT7A 2GK0A 3ZBMA 7FABL 2ZXEB 1BQRA 3IF1B 4QRBA 5E8OB 3N1GC 4F37F 3FU5A 1BQSA 5F7EH 1AO7A 5D5MA 5L88H 1EHLL 1LK2A 4N8VA 5KSBB 3EUDA 3IJYB 4GBXD 4OCSL 3NSXA 4PR5A 1RZKC 1ZVSA 3HS9A 3VFOB 5B38A 1VGKB 4WEEA 1E5UI 1HQRB 2K6YA 3FB7B 2EYRA 5FYKD 3DURA 2A73B 5TH2B 2H47C 3WY4A 4O4YL 5IF0B 2QSVA 4K5PA 2EDHA 4HWEH 4C56B 2Q0ZX 2WXJA 4NQVB 5K9JL 4Y19B 8PAZA 4MNGA 1X7SA 4PGEA 3ZE0F 4FXGC 3QHFH 3T2LA 1IKFH 3U6XS 4JY4B 1IBGH 4LAQH 4WJ5B 3SY0B 4NI3A 2GI0A 2QFPA 1T6WA 3KPPA 3V5KA 1BVKB 3CWGA 4YPGB 3HC2A 3QCTL 5TGBA 2NY6D 2BDNH 1FNGB 5GRZA 2ZIDA 3OQRA 4X9GA 2X0WA 4LCUB 1B0GA 4CVZB 4BFIB 1F8TL 5I8KH 2ITDB 3KLDA 3CZLA 3AQYA 5I66A 4QXVA 2D73A 3LEYH 4JAMB 3P73B 2XNAA 3L6FA 4RISL 5L4IA 1G9HA 4YN3A 1LE5B 4KO6A 2XYCA 2Q7YA 3HR5B 3LEXB 3PP4L 4LCWA 4OLXH 1QR1B 1YEIH 5JTWA 1EDQA 4QOKD 4J8RA 1A7NL 1NSNL 2F2HA 1PNDA 2WXLA 2PWFA 5EBMB 4LOEA 4TUJB 1S6NA 4X0KB 2FEDC 1V3KA 3HFMH 4FD0A 4QXGH 4JRYB 4BK8A 3QEHB 3ZL4L 2YQ3A 3BVUA 3AB0C 3KS0H 1U8HB 2WLMA 3DROB 3O3AA 2AVGA 3T3MB 1SEBB 3IGUA 4R84A 4DOHB 3IETA