1D7DA

Cytochrome domain of cellobiose dehydrogenase, hp3 fragment, ph 7.5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
186
structure length
186
Chain Sequence
ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLOBIOSE DEHYDROGENASE
publication title A new scaffold for binding haem in the cytochrome domain of the extracellular flavocytochrome cellobiose dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 38
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 1999-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1d7dA00
1PL3A 1D7CA 1D7BA 1D7DA 4QI3A
chains in the Genus database with same CATH superfamily
5F1IB 3MN8A 4M7LH 4B9CA 3QJRB 3MREB 1Q9OA 5H37G 2D03L 3UTPE 2OV0A 2XN0A 1IBHA 2IH3B 5GS2H 5K33A 5HDQL 1KV7A 3KPSD 2CXKA 3LQZA 3KW7A 4D8OA 3IGUA 4U1JB 5T1DH 1ZVYA 4LSVH 4HH8A 4X5RA 1T2JA 3RVTD 4K5OA 1XGRB 3ELQA 2D7PA 3GC3A 3UPRB 4WWKA 2WIMA 4AWJC 3LN5B 1XR8B 4YDMA 2CIKA 1MNUL 4NP9A 2EKSA 1R5WA 5T5NG 4FZ8H 3CPUA 1FFQA 1MXGA 3QZWG 4ZMLA 1IEHA 3HZKB 3MNVA 3FUNA 3POHA 3PQYE 5CMAB 5D7HA 1NBVL 1M53A 5LDUA 4JFXB 3APDA 1TZGL 4Z3TA 3VGFA 1X7SA 5BVPH 5HY9A 1HEZA 5BO1L 3DHJA 4U1KA 2ZWLT 1UWGH 4YOKA 5EU7E 4KJYA 3MSPA 1A9BB 2UVFA 3SDDC 5KN5A 4M5SA 4KRMB 4PGCB 3IS0X 3K2KA 5H4ZA 3H6JA 4EUPG 1PZ3A 4D7BA 5IOPB 3PDDA 1ID5I 3MLZL 2B2XH 4L9LB 1N3NA 4YZWA 2AMUA 3L3GB 1FAIL 1ESOA 5GZOA 2ITEA 4NHUB 1JAEA 1K9TA 5AYTA 5EUKA 2DM2A 5C0BE 4G42A 2FT8A 2WP3O 3MRJB 4N68A 1CUOA 3ZSSA 3SIKA 4XNDA 4EAEA 4DP2X 1KNOA 4I3RL 4JCLA 3M8OL 4YFEA 2QR0B 4ZMQA 5FFOA 1W0WB 4JCWA 4XNAA 3MV9D 1N9PA 1FUNA 4JFDD 4N2MA 4R4BA 1WBXA 2DN7A 4ACTA 1NCJA 2RBLA 2VR4A 5F7AA 2Y2WA 2BK8A 2ADGB 3FFCE 5EU6D 3R06A 4FF9A 2VN3A 1KPVA 3EJZD 4A6YH 2WGNB 3P4NB 1N26A 1AKJA 4Y8DC 3RX5A 1OHQA 4HDIB 3SN6N 2WZAA 4JN2A 1IC7H 1R24B 3QJZA 4XMVA 4FA7B 5F93C 4XX5A 3ROLA 4BZ2A 1FH5L 4QRRE 2E46A 3QDJE 3D12B 3L6FB 4YHKL 3VFGH 1UKQA 1KB5B 1R5VA 2W81C 1ZLSH 2XWRA 1FPTL 4P23B 1P7QD 4KDTA 1U95A 5DK2B 3RWEB 5E9DA 1P4BH 1TVHB 4HBQA 3SBPA 5MEPA 3QQDA 1CLOL 1QPXA 4ZMAT 1JGDB 2OR8A 3BZ4B 2VH5L 4AV5A 1XR9A 2VCOA 4EIBA 5EU3A 1Q94B 1OOAA 2FO1A 5FA3B 5I1DA 2WXMA 2CPUA 1VERA 4PBXA 3VWKB 4PRIA 4QKXB 4G5ZL 5GGVL 1DZ0A 6FABH 2AJVL 3GMOB 1FLTX 1UXMA 4L8BA 3FL7A 4M3HA 1BYOA 4NNXA 5ALBL 4AQ1B 5I73B 1V54B 2X05A 5J6GA 2SEBB 4HS3A 2D2CC 2R39A 2Q7NA 2OTUB 5CGTA 5JIHA 3U6RB 1V27A 2HA1A 4JUTA 3ZE1E 3ZGHA 3H7LA 1UWXK 2QVKA 2XN9E 4HZLA 3W11C 5JOFA 1I3VA 3DUSA 4LCUA 1IAIL 2ZXEB 3MA7A 3N6YA 5FYKU 1BVZA 3N42F 5IB1B 2NR6C 1QSEE 4WRLA 1XGQA 3WNMA 3FT9A 1T6WA 3DMMB 3NCJH 2WCSA 3VXRD 4BZ1A 1L3NA 4M1DL 3IMRA 3IK2A 3VFTB 1Q9LB 1R17A 4ORGA 4FNTA 3FB7A 3RKPA 1ODUA 3H9YA 3VI3E 5C0CE 4H13C 5IM7A 3FTYA 1QFUH 1AFVH 3VB8A 4PRPA 1M05B 1KJMB 1VPOH 1I1AA 2QZ5A 5T3XD 4BKLB 2OK0H 4C47A 2GBUA 2E76C 3WU1A 4KJQC 2DQIL 2HX8A 3CZFA 1FZJA 3D07A 3DIFB 3HC4H 5IREA 2H26A 5JIQA 5JHMA 2R2CA 1SN0A 3WAJA 2PR4L 5T5FA 5CGBA 3VFRA 5IR1A 2VXQA 5IMLB 4HS8L 4DPBX 3D2UD 3JV6A 1KFAH 4XOCA 3EDJA 5LBSL 2CO4A 2LGNA 3U0TB 1SOQA 4EOWH 3KYKL 2R69L 3GJFK 3ZR6A 4CU6A 3F85A 1N5YL 4HLJA 3QS3A 3DV4B 1VACA 4U3XA 2EICA 2APFA 1AQMA 4QRQB 3CHRA 3I02A 3L3JB 3FU7B 4F57L 2IVFC 3WNNA 2EC8A 4G1EB 3RVXD 4M3JA 4PJAB 2NXYD 3Q43A 5AKRA 1LHZA 3LRMA 3FUDA 5AZEH 2V7NA 1E4HA 3IFNH 3ZDXB 3K2UL 1G6VK 4X9YA 3U1PA 4Y4FA 1PEZA 1YYLH 3DGGA 3M17B 1QFWM 4FHBD 4Y5VC 4M6NL 2R29L 1E28A 2WQWA 4LVOB 1DUYA 3OZLA 3DI3B 3I6GA 4OIIH 4P3WA 5D72L 4YDLB 2CBMA 3WIHH 3WEMA 1RL1A 3BGFB 3MUY1 4NQEB 3ABGA 3L13A 3HI5L 3IWVA 3D52A 1KB9K 1WEJH 1HYSC 3HHRB 1YY8A 3MV8A 1QLEH 4IKJA 1TZHA 1XL6A 2VLKA 4QTHA 2JCCB 1X7TA 4EI6A 4NEHB 3OKNA 1TCMA 2IAAC 3VX1A 3EGSB 4EPSA 2QQLH 4NSKA 1FNHA 4P4KB 4F20A 2IBGA 1WWAX 2OYLA 1CU4H 1HHHA 3GSNB 2XG5A 3RL1A 5GHWL 3AS2A 4WWKC 4WI3A 3ZE2E 5JHDD 5EDXA 1SEQH 3P02A 3WY4A 2GT9A 3EUDA 3WTWA 2BZDA 2WBJC 1EEQA 3EYQD 3NFSL 3MV01 2X1QA 1U3HA 1X5XA 3FUIA 3OMAB 4XCYA 4YDZA 1T1ZA 3EO0A 2DJUA 3QR0A 1A14H 3BPOC 6PCYA 4WO4A 4XCEB 2VDMB 4OI9A 5CP3A 2FATH 2DYPD 2EDOA 4PJFB 4QRUA 2EZ0D 4XPAH 5FOBB 2Z35A 3HVDA 2PNDA 3TFBA 3Q9QA 4F37K 5A7EA 1T66D 3GI8H 4XP5H 3D3VE 5DJXA 4P46A 3FO9B 25C8L 3LZLA 5L6YL 2Y36H 4QTFA 1SY6A 2H4EA 4NB7A 1XGZA 1ROCA 3R0NA 1MFCH 5LGHH 1CZ8L 3WTXA 2AXJA 3EYOA 3V4VH 2IJ0C 2J6EH 2Q8BH 3KLSA 4OJAA 4Y5XB 1LE5A 4ZFGH 1L0PA 3RX9A 5LGJA 1E0OB 2ZXQA 3HS0B 4QT5A 3JWDH 5F88B 1OP3H 5IV2A 1ICTA 1U8MA 3AMLA 4PG2A 5IGXH 3OR7B 3FO2B 5KBPA 1WPCA 1RU9L 2ZXWB 2Y6SC 5KSAD 5F7DB 4XNXL 3MACH 5TK2A 2YD8A 2GAZB 2C1PB 4NN5B 3CX5K 1LQSR 2F54D 1U8NB 3MJ9L 4HFUH 2FECL 3OL2A 1UGKA 4KK9C 4ZUUB 5I24A 4P2RB 5DZAA 5KSVB 3VG0L 2D31A 2NY3B 2WVSA 2LE9A 3MMEB 4LSRH 2A6JA 2YGQA 3VXPB 1RURL 1DEEA 1RPQA 2J4WH 3SKOB 3R8QA 2XRAH 4BFKA 4G9FB 4BQ8A 2DQCH 1FL3A 3NRPA 3TEUA 2Y24A 3RZCA 2V2TA 3LZOA 3T0WA 3AVEA 4L2YA 4R97C 2EH8L 4PWEA 5I18H 3JWOC 5LBGA 3MLPA 3UMTA 2K6WA 3A4AA 3QIWD 3MRFA 4OUOA 4Y4KA 2J2ZB 2HFEB 4YHMH 4KDTC 1DQQB 4B53A 1MW2A 1BX2B 4P9HH 3PABA 3Q6GL 3H3PH 1HSAB 2JTYA 2AJXL 2ICWI 1K3IA 2GABA 5D7LB 5E1AB 1HZKA 3NAAL 4J8RB 4QCIA 2E6PA 4NQCA 2CA3A 3DARA 3DJ9A 5BRZA 2I25N 1KBBA 1XO8A 3BZFA 1OB1B 4L29B 4U05A 4GBXD 2A9ML 2Z93A 4FQXC 2O5ZL 1K8IA 3VU2A 4ZMZA 5CGMA 1PTZA 1SN2A 5EIIB 4U3CA 4G8EB 3CDZA 5H4YA 2A77H 4JJHA 3V0WH 4DO4A 5JPNB 4L37B 4F7CB 1ZS2A 3X11B 3WTYA 1RZKL 1ASOA 3S4SA 1ET8A 3VGHA 3GJFA 2EXSA 5AZ2H 4PJ5B 3V5HA 3IMSA 5GS2D 1FHGA 5CSBA 2HTKD 4MD4A 4MMXA 1ACYL 4N2IA 4PUBL 4BFIA 1HCZA 4HIQA 4LVNC 1QWHA 4LPTA 2NZ9D 3FQRB 4AGMA 5SX4I 4JQVA 1SJXA 2IOMA 4Y1AB 5FLUA 2MOGA 3DRQA 4UQIM 4IU2A 5I17A 4QNPF 4NQQA 5D5ME 3VXSB 2XG4B 1OSYA 4KV5E 1DBKL 2FL5A 4NGHH 5ABAA 3RVWD 1KLUB 3C5JB 1XIWD 4MQ7B 4ERSH 3ZPDA 1XF3A 3FB5A 3QR1A 4OTXH 2PXYA 3PJSB 5DJCA 5EC1B 3OR6A 2YPVA 1JPGB 1TEFA 2XVKA 1GGIH 2BP8B 3MX0A 5E8OB 5EEWA 2J8UA 3FJTA 5IG7A 4JDTL 5AVYB 4JPKH 4GP5B 3V9FA 2EVJA 1ADWA 1I1AC 4HCFA 2XZAH 4RGNE 1XFPA 4IRJD 3CFDB 4TLUA 2CALA 3BAWA 5CILH 3L5XH 3SGDH 3F3HA 3CFCH 4WV1B 3WEXB 2N7BA 5EBWA 1Q72H 2BSEA 4R8WH 3CN1A 4F58L 5FHAL 4AQOA 1L9RA 2H3KA 4HMEA 5DHXB 5DVNA 1HQRB 5IQNA 4JN1H 1JTOA 3GK8H 3I3BA 4OW6A 3L45A 3HIZA 4RQQB 1VIWA 2FZ3A 3BPLB 3UYPB 3R0MA 1OTSC 4UQAA 5AVVB 3U7WH 1OCOB 3FMGH 5GGRB 3OWRA 4TS6A 1OAYL 2W59A 4JG9A 4JFZH 4CSTA 4APQA 2NDFA 1EUTA 1UZ6E 4I77L 1INQA 4LNVA 5LG6A 1FIGH 2NYZA 3MRHA 1PX8A 3F01A 4QRPB 3VXQB 1IGML 2HRGA 2C9PA 4OKVA 2Z92B 4JFED 2WCPA 3T77A 4CSSA 1OE3A 5F7YC 1YPZE 1GYVA 1CFNA 3BQUB 3CSPA 4PVBA 4BELD 4ELKB 1HIML 3BRGC 1G7IB 3B7YA 5EZOL 1CI5A 4JRYD 4XCFH 4QHNB 3U4BH 1GKOA 5FKPB 4YXLL 4Y4FC 5AW7B 3LNEA 5HHOB 3L4ZA 2JKXA 4GUPA 4QYOA 2MEJB 4NOFA 1PX4A 4EXKA 5K9JL 1E30A 3QUYD 5J06A 4WAFA 3CMOH 2HMIC 5AB9A 1A8JH 5AKTA 1QEWA 5ISZD 3FZUC 3SDCB 1NFDA 4FXGA 3OZ9H 1WDAA 4KKLD 5E6IB 1YMHB 5EEUA 2I5YL 5B39G 3TJEL 3ZHNA 2XA3A 1A7OL 1JRHL 1DBBH 3WOVA 5CJXA 3E3QC 4HAGA 1H3TA 1OGAB 3EDKA 1RHHA 2C34A 1B4TA 1QFWH 4WNJA 4PWFA 1CBJA 4P2QE 1OY3B 1UWEL 2WVVB 3ASNB 2JB5H 3FTSA 3Q5OA 5JW4Q 4ZD3L 4HFWA 2KDGA 1FE8H 1Z0NA 1WAEA 4RFEA 3S3CB 1FNGA 2OX5B 2X70A 3MJ8B 4KBPA 5E23A 1FFNA 4JBSA 3BFWA 1RUQL 4FJ6A 3S3PA 5D2LF 2AC0A 3GSUB 3IYLW 4HU8A 1U3HC 3H53A 4JKNA 2VLLB 3DVGA 1RZJH 2CO3A 3I74A 1VENA 3CHQA 4JZNA 4X5QA 5ECJE 5ERWB 1A22B 3WKNA 4WO4C 4GLRH 1OPGL 3D51A 3O3DB 3PP3H 1CYXA 5CJOL 4LBEB 1SDDA 3B4NA 5IBTH 4EZMA 5GS0L 1S9XA 4KY1L 5I1GL 2IGTA 4OJEH 1WWCA 3ME0B 5D7KE 5I1JH 3GMQA 2IG2H 4P46C 3TESA 4AT6B 4AH2B 3DSFL 2JTDA 4J3UA 2CBOA 1NMCC 2E8ZA 3L1FA 3U46A 2G3ZA 1C8QA 4EO5A 4D2NA 5FO7B 3IAGC 4JKPH 3GUTA 1DVFD 5HDBE 5BJTA 2MQGA 1SUHA 3T08A 2UY7A 4QHMA 1AJ7L 5DO8A 2A3TA 2RGSA 3ILDA 4ZMOA 1H3UA 1PKOA 5ANMA 2VLRE 4NQXA 1DL7H 1JWSB 4HIPA 4PG2C 1LWHA 1TCRB 1BSIA 4ZTOH 3ZZSA 1H9DA 1FL5A 4E41D 1YN6B 2F19H 4MZIA 4X80L 1INEH 1XF4A 3HOGA 1WT5A 2VC2B 4H8UA 4X7SL 4ALAH 1TLKA 3GEWB 4YHLH 1E9OB 3K2IA 1HOCA 3WJJA 1WE5A 4TSBL 2P5EB 1RH8A 3SDXB 3JXAA 2I7SA 1BP3B 2HT4C 1RZIB 2LFEA 1BFOA 1Z5YD 4GAYA 3VGGA 1PZCA 1I1CA 4Y2LA 4X6BA 4O02B 2BO0A 2NOYA 3FB6A 3OG6B 4HK3N 4U1IB 1MUJB 3RZCC 1HHJA 5DMYA 4NJ9H 3P0YL 2VMFA 3DNKA 1J5OH 3GXUB 4Y4KC 3NZUA 3OJ2C 1U21A 5F8RC 4LAQL 4JY5L 5JHAA 1HK6A 4ZXBD 4WFGE 1TR7A 2WQAA 1SMDA 4HKBA 1V8HA 1K4DA 1OAUL 5KG9B 4MJJA 2ZPKH 1E9QA 1E6OL 1ZTXL 3UBXB 4F3FB 4KDVA 1SLUA 1TTFA 2Q8AH 5I8CB 3WFDL 3U30B 2FBRA 1AMXA 4QRRD 2J5WA 3QDJD 4UCFA 2PCXA 2Q1EA 1QO3B 5DQJA 3EBAA 3H0TA 3IF1A 4KTDH 4KZEH 1IQDB 1ZS8B 1U30A 1DQDL 2X87A 1UJ3A 4FP8L 4NZTH 3ETTA 4WDIB 5I6XB 1BBJB 5IQOA 3QYMA 4AY0A 4PGDA 1FFPA 4JO2H 4UQCA 3CMGA 4AQAA 4YDVA 5F9JA 3KLAA 4XPHH 2BNQA 4ZUTA 3KYMB 4DZBA 2MPAH 3ULUE 4MMXC 5ESQB 4HIEB 3RWFB 1E4KA 3DPDA 2OMTA 3T1FA 3BO8B 1CDBA 1QG3A 5LBVA 1OSZB 2DIBA 4HD9A 2IPKB 4AW7A 1TVBB 2WUCL 2XQBL 4TV3A 3NTCH 1RQ5A 2P52A 2MNWA 3MJGX 2IV8A 1F4YH 1RZGA 2D7QA 2PXYC 1BD2D 5AOIA 4BIKA 4DP6X 1ZGLB 1EJ8A 5I8EB 4GAGL 4PRHA 3IDNA 3GSRB 4WEBL 1MJ8H 2VN5A 5EBGA 1J87A 3W9DA 4MCNA 4X8GA 3VFOB 2OR7A 2FX7H 2K6YA 3KJ6H 1QSED 2WXJA 1CK0L 4GO6B 5J9PB 1J86A 1N12A 1J5IA 1Y0LA 5K9OA 4GQ9L 3AQZA 3BIAX 3GHPA 3IE9A 4OT1L 2BZCA 5D1QA 2QGBA 1JFHA 3ECQA 3B2UD 4C58B 3KWTA 2NY5L 4M1GH 1UFGA 3TC9A 3TV3L 3VYPA 2J6WA 1AHWC 4E68A 1PG7X 3GGWB 3QNFA 2R9HD 3MA9L 1UYWH 1HXMB 2ZUUA 5LLIC 4E9LA 2Y07L 5FGSA 4U1HB 3IXAB 1WH0A 4PV9A 3H3KA 1Q90A 2VC2L 4IBSA 3QUMH 5JXED 4KRPD 5E94B 4JKKA 5AQ0A 3UO1L 1D2OA 4FNRA 4YSAA 3ECUA 4R7XA 1D7CA 3EO9L 3KPSB 2R8SH 1JPFA 1CLYL 1IEBA 5IVXE 4LPUA 4CC1A 2X38A 4DKDC 3FN0H 2CHWA 4UT6A 1FO0H 2OYPA 4CRPA 3EH4B 2YSSB 3L7EA 2O72A 3MOBH 2IWGA 5FK9B 4S2SA 4Z7WB 1CC3A 5E95B 1T5WA 1I9RL 3UAFA 4HIHB 3GWJA 5JLZB 2ENPA 4FQPA 5AVRB 3PGDB 5AOKA 2KBGA 2WXFA 3DX9A 4ZSOB 3VGAB 1N8OE 2NY2B 3GS4A 4Y2OA 3WFCH 1OLZA 4HJ1A 1ZE3C 3OAYK 3HCVB 2BJML 1M3IA 1P6WA 3RGVA 3AGWA 4TOYL 4JHWL 3DV6B 4RRPG 1W72L 5J12C 2DIAA 2ZT9C 3TU6A 1DN0B 4JFUA 2G5BA 1BOGB 4EIGB 4AX3A 3CC5B 4R2GB 2NXZC 4GSQA 4KZDL 4WK0B 3IDGA 1IE5A 5TH2B 1WBYB 2ERJB 3MLWL 3RP1A 3BT2L 3OKYA 3AWGA 1QKZH 3CSGA 3WYRA 5FGCE 2HTLC 1H0DB 3HAEB 4L1BA 4XNYH 5CJXC 1TZIA 1XD1A 4WTQA 3FQNB 3NH7L 4AGQA 1EVUA 2VR5A 1O9VA 2WB1A 3PP4L 3C2AH 1D5XA 4Q0XH 2FRGP 1N18A 4UQ2A 3VGBA 1LK3H 4YC2C 4S1DD 1A6TA 3D33A 1CGSL 4JQIH 5DJAB 3AB0C 2YEZB 1OSPL 1DLHA 4YDIH 5AZUA 4TNWF 4A38A 4W9ZA 1GGTA 2Y0SA 3BAEH 3MLTB 2CO7A 2CO6B 1T1WA 4PJIF 4WI2A 4ODHL 4AG4L 2ZG3A 4NO3B 5KBKA 1BZQK 1OLLA 2YD0A 5ECGA 5MEND 4PLOB 1PY4A 5I19L 4HGMA 2GJZB 1KLFB 1PS3A 5DUMH 2WTPA 3AREC 5L0QB 3PIQB 1EGJL 2KLRA 4PW4A 1PGRB 1BMZA 5TQ2H 5B3SB 5J5EA 4WJKB 1VFUA 2D4FA 2VM3A 2IPUK 4MB3A 4P5TD 1ZV9A 2XX1A 4Z6AT 3C5ZB 2NY6D 4FZEH 3ZZLA 3DUUB 3QT2A 3CIAA 3FQUB 1L7TH 3LPGA 1QBML 3EOBA 5FYJL 3QXTA 3P9LA 1IEAA 2X4UB 3E6FB 3F7RA 5I75B 2AXFA 5J6HA 2M1KA 3QG7H 3I6LD 5F1NB 5J3HD 3QORA 4P4RB 2P26A 1A25A 3D3VD 3KPRE 1WCQA 4B3EA 3H8NA 2DWYA 4U1LA 2ZKHL 4Z7VF 1PJ9A 2DYRB 4M7LT 5I71C 3K8LA 3CVHL 2VSMB 2Z8SA 3A0OA 3BT0A 2B9AA 2X6UA 3H55A 4P5KA 1WT5C 1QW8A 1RIVH 1F58L 3U1SL 4DPAX 2NYYD 3WJJC 3WN5B 2VE6A 1DN2A 3QZPA 4EQ3A 3BLPX 1LO5B 4QWWD 3O11B 1IGCH 4OZFA 1FNSL 1QMUA 3STLB 3QNYB 3T09A 3NEEA 4DJMA 1IVTA 3CLFH 4XVJL 5JXAH 2GJ6D 4LEOB 5DJ0B 3IU4L 1AGFB 2GC7C 4I3SL 4JE4B 4MDRA 1BWWA 1IIIA 2Y1ZA 4MNQB 3V7AE 2EIZA 4RAHA 3UIZA 3APFA 2OA9A 1BF2A 3FQYA 4G8GE 5JW4M 1F90L 4U1SB 5K9QI 3W39A 4Q4EA 1CTMA 3QS2A 1P5VA 4OIFA 2HVKB 1QR4A 2YRBA 3FN3A 3T2PA 5LN4A 3RILA 1DTUA 3NJJA 3VH8G 3MRIA 3KLLA 1SM3L 4QKTA 3RUGA 3VTTA 3LEYL 4P5RA 4KFZC 1LLAA 4HJGA 4R7NA 3MJWA 3GF8A 1I3GL 3VSTA 4CVXA 1FZOB 2QQKH 4OZGF 2OMVA 3S8FB 3BSZH 4DGIH 1G7LB 2MWCA 3EYUL 5IHZB 3RE0A 2MCG1 2JQAA 1ZA6B 3L3DB 4ZO8A 5GRXG 2J72A 2WV3A 4X6EA 3KPOA 1CE6B 4JHAH 2NYKA 1T6BX 3PS6A 3QPXH 1CLCA 1CDGA 4YSSA 3FBKA 4ZUVA 2ATAA 2FCBA 1ZANL 1YNKH 2IDSA 1GZHA 2HLAA 1S7WB 1B0RB 2F5BL 5F7EL 4CADB 2R23A 3EYFB 1E4KC 1JV5A 3BFOA 4NN7C 2DQTH 4JX0A 1KY7A 3P3TA 4BJLA 2PYEB 3K6OA 3SPVB 3CHXA 3VXMA 3N41F 5A2AA 5D1ZC 1YCSA 2QFPA 2YUWA 3QJQB 2UWEE 1DVXA 3FFDB 4DH2A 2VLMD 4J7RA 4NNYA 5CR8A 2XWEA 4WNQA 4CBPA 2DH2A 3QPQD 3HMXH 2ED6A 3EBHA 3C08L 2Z7ZA 4WJG3 3HHSB 3EGDA 3BH8A 1NAKH 3FU8A 3GS0A 3LRGA 2B7DT 5C0DB 1MVFA 3HE7A 2DW5A 3SZKC 1MVUB 5EEXA 1UACH 2WBKA 2DKUA 2EUWA 2X4PB 4JLRA 1MCIA 3NCEB 4ONHB 1LEIA 3UJJH 2EC9T 1TTAA 3X3GL 5DD1H 4NPYB 4L4VE 4G9DB 2FSEB 1V05A 3D69B 3PWUA 4FL4B 3FUFA 3I3DA 2WXLA 5FV1L 3LKQB 5JUEL 3OJMB 4L0YA 2APWA 4NUQA 5EZIH 5D1QC 1X4XA 3MGTB 3MREA 1IV8A 3L48A 4LHUB 3ZTJH 3MTRA 3ZQWA 5I66B 1IBZA 5FYLE 1Q0YL 4GQZA 3IFOB 3TF7C 2Z4QB 4I4WA 3SKUD 1HSBB 4KKPA 4Z5RB 4MNGE 4PRAB 5HVWA 2ATKA 1XGRA 4JANB 1NGWA 1OAQH 5CEZE 3TCLB 2YO3A 1GHFH 3QG6B 4NP4H 2BP0A 3KXFE 4GSRA 4V1DE 2CIIA 4PTTA 4XZUA 3DX3A 1UZGA 4XVSH 4WWOA 1TQCB 4Y16B 4BUGA 4UZUA 5CMAA 4ODWB 1X6LA 4XO3A 4AC2A 5JHDB 3OLGA 3MNWA 5EA0H 1CG9B 2DI7A 4FQCH 2QJDA 1IJNA 3L5IA 2JKNA 3RFRA 3IMBA 1YVLA 2DYPB 3CH1B 4G7YH 2NZ1A 4YXHH 3HNSH 1CYGA 3TL5A 1MJUH 1ZHLA 5IOPA 4G83A 3RGVC 3H42L 3SGDI 3DX7B 2WTOA 4PVMA 4M7ZB 3TYGH 1RUKH 1P5UA 4ANKA 5C09E 1XZ0B 1MCBA 3B3IB 1GPOL 1VESA 2CR0A 2LAGB 3O3UN 1GC1H 2OL3L 5C2BH 1RPUA 4J3TA 5I6OA 4NHUA 3MLUH 4LCCA 2NCEA 1NCWH 2X4NB 2P7TA 4MAUL 3O6FD 4FXLA 4G6JH 1AR1C 2AEIT 4NC2B 1K4CB 5T3XL 3GNMH 4QRBA 4XAKE 3C6SA 4L8DB 3HR5B 3WFBH 3W5NA 2OSLA 2HCZX 4LEXL 5AAPA 1W0WA 2DPKA 3Q7JA 5LBSA 5DZ9A 2WN2A 4F7MA 4YHYC 1MHPH 3HB3D 4MMZA 2R69A 1IBDA 1PG7H 4HIXH 1JHLH 1USZA 3KVPA 2WP3T 4HHAA 5F7FA 1YEEH 3CN4A 3WIIH 1A4JB 1CMOA 3K3QA 3DX6B 3S96A 4KQ3H 4LLQB 3MJ7A 3TIDB 1LEKB 3LNHA 1CD8A 5EWIH 5GJTH 4ZOAA 1Q9KB 4HSCX 4MD5B 2AEQL 3QUZD 4IQHA 4XVUC 4N24A 5DLML 4HX1B 2XPGA 4H20L 4OCRL 5HVFB 2BIOA 3OX8A 4ZAKD 1YEIL 3AROA 3T0VA 5A40E 1FYTA 5SWSB 4P23A 1E8XA 2GJJA 4IOSD 4B41A 4EZJA 2OCJA 4R4ND 2R29A 2KPNA 3QUKA 1QNIA 2GEQA 1NBCA 4Z7OB 1FZMA 3L1OL 3VFMA 3ZDZE 1HH9B 3QIWB 3VI3F 4K9EC 3U9PL 2DBJA 3REVA 4QGTA 4YWGL 5KJRH 3TA3B 3E1F1 3JV4B 2IQ9H 3UAJD 3US0A 4L5FL 1N4XH 4XN7A 1H8OA 3RY6A 2EDQA 4YUEH 3QORC 2VXSH 1QRND 1MJJB 4PRIE 3WMQA 1M9SA 1MRFL 5D7KD 2OMUB 3QI9D 4BKTC 3MLVH 1QFWI 5B3JE 3X1FA 4GBXB 2DLTA 1S9WB 3FQXA 3K46A 4GRMB 4K7FB 3U9UA 4IMLB 2SEBA 2OJEB 1R3LB 3GO1L 3DJZA 2BSSA 3C87A 2VDKB 2CGRH 4NM4H 1QSFE 3DUHA 2GI7A 1UZ8A 1BJ1H 2DQGL 2VLRD 4X8JA 3X12B 5FYLH 4RBPK 2EO1A 3T8XA 2WXOA 4GAJL 1TDQA 5CLZA 3B8SA 2ICEC 4GLRI 3DC0A 4I2XA 5ANHA 4JGJA 1G43A 5IFHL 1KYOJ 1ZA3B 2IDTA 2HKHL 2FVNA 4P2YA 2L7JA 4FS0A 5CEZH 2JIXA 2R2HB 1F1GA 1A2YB 3QIBC 4LSPL 2J88L 3LD8C 5KYWB 3WS6A 3M46A 2R4RH 1AQ8A 1Z3GL 4HWUA 4H8VA 3IT8D 3TVMD 5D96B 4PRPE 2D4DA 2XFGB 1ASQA 3DKHA 3ULAB 5I8OL 1PF3A 3ATBA 5G4NA 2EDJA 5SX5H 1IL1B 2HG5B 3KYOA 4H1LB 2O6FA 3PAVA 1BXUA 1I9JH 3CXHK 4JDEB 1KB9J 4OCYL 3RTQD 4UOW0 3MLRL 3SKNB 2CO1A 3D0LA 4XP4H 2H3XC 2NUPB 1YAZA 1JDAA 2A74B 5F7NC 3BVNA 1TOXA 4OF6A 5EUOB 4AL8L 1UJTA 3SCMA 3MJ9A 3U0TA 3QK0A 3ALPA 5C7XL 2LTQB 2YUVA 5FECA 4JFHE 2Y7QA 5LO7A 4ATTA 2ZXCA 3NZHL 3RAJL 1UKTA 5HDLA 3GEFA 3HRZA 5A2JH 4MJHA 5L9DH 4QRQA 1YEGL 2HZHA 2AEWA 3QC6X 1JG9A 3CZLA 5EO1B 1FSKC 3ZTNL 3F05A 4XODA 5CEYA 3H2QA 3ZE2F 1G9ML 3RURA 5I0WA 4YIQB 5IMKB 1BZ7A 3HZYA 3TBVB 2AF2A 2EIBA 4S11A 2EDLA 4OAWB 3H9SE 5CD3A 4JFEB 4GY4A 4Y1TA 1YEDA 2AJUH 3HE7C 1T3FB 1TETL 4JPVH 4UIKL 2VRQA 1NC2A 5T33H 1RJLA 3VG9B 4LOFA 3APCA 1KCRL 3QQ9C 4HK3J 4RLDA 1PZUB 2XSKA 3UTSA 1CQYA 2VXVH 3TBCA 2BNUA 4BDVA 3GBDA 4Q6IA 4ZT1A 4A04A 1VCBC 2Y22A 4ICXA 4LIQL 4XRCA 1EBAA 5FUOL 4NZUL 5A2IH 4OFIA 5IK3B 2HFGL 2Z1PA 3WJMB 1JGLL 3CX5J 3VFPA 4MJIE 4DIXA 5A3IC 2F15A 4F91B 5DD5L 2FGZA 4PJXF 5LCVH 1LD9A 4M7LL 3TX4A 2XNAB 3K72B 3WBDA 4JAMB 1H5BA 1E9PB 1S7XB 1Z2KA 2XQYK 4M61B 4B9IA 2EXWC 5D7IA 2P80A 4L1HA 1LK2A 1T0PB 4TPRH 4BFEA 2IMMA 5FOBA 1MREH 4NZJA 3NK4A 5AYUH 5EF0A 5T1DL 3NIGB 4U7SA 1N19A 2MQ0A 4Z7NE 2FJGA 7FABH 4FNSA 2QV2A 3FO9A 4HVBA 4AC4A 2VIRA 5BRQA 5KAQG 1DJYA 1ULVA 2CCLA 3ETBJ 1ZLDA 4L9LC 4FZ8L 2MOQA 1P5UC 3IMWA 3ZX1A 5ENWB 1UTDA 3CPLA 5KVEL 4KK5C 1MRCH 3SJVB 2B39A 4LCCC 2OW7A 3QBTB 5BVPL 2FAUA 3VGDA 5LXGL 1UWGL 1TYRA 4P2OD 5TE4H 3ULSA 3BIBX 3CBJB 4JS7A 4L1DA 5TFSH 5KOVC 3S36H 4PLJC 1NDMB 5IJVB 4MMZC 4DGUA 4XO8A 4JZJA 3T0EA 3V4PH 4WI0B 1U8NA 1JTTA 2QPEB 3ZXAC 1FJ1B 4P2RA 4AITA 4PRDB 1S7RA 3TO4D 2K45A 1A7QH 2V5YA 4E41B 2J8HA 1XH1A 3RJQB 1BAFH 3KPLA 4EDXB 4Y4HB 3O2DL 3TJPA 3U0WL 2GEEA 1OAZH 4G9FA 4F7EA 3HUJE 4U1NA 1JI2A 1YDPB 1HL5A 4KROC 3WSQH 2O61B 4JFFA 2FD6H 2VN4A 2BY2A 1T4KB 4N0UA 5C0GB 2J2ZA 4P23C 1VFAB 1TFPA 2Z34A 5D5MF 4A6YL 1EHLH 1I31A 4KV5F 2XWDA 1TJIL 5C07E 3MKGA 5E1AA 5EMYA 4J4PA 4Y0GA 3VDCA 1IC7L 3RKDC 2EXTA 2PWGA 4BH7B 3D7PA 3UEQA 4L29A 1F3JA 3GBEA 3U36A 5BRZE 2G9KA 3ZLQC 3RY6C 1OCZB 4XVTH 2DLFH 3VFGL 4FGMA 1ZLSL 2RIKA 1JERA 1P4BL 2UZYB 4KKAD 4L37A 1KB3A 2BVQB 5IHWA 4QR7A 3MUZ1 2C7UB 2R4SL 4J3OC 3BW9A 2K8MA 4AQ1C 4FADA 1QLFB 2Y1VA 4CN6A 1YMME 4PJ5A 2BSBA 4D9QD 4AGLA 3M1CA 4HKXA 3NCFB 2P5WE 3V2AR 5FR3A 3N85H 2WQ8A 2DMCA 3UTQA 4XMWA 2QQQA 4L4TE 4XN4A 2ZSWB 4N2NA 6FABL 2NZIA 2X3AA 2K4WA 3QPKA 5EN2B 1EO8L 3LIZH 3O6LH 2PTVA 4ZOBA 1YNTF 3PJSA 3T3MB 1V10A 3MV11 2H32A 2XIIA 2EDRA 1WYJA 2OQJA 4JL1A 3DX8A 5EFIB 3TGXA 3WS6C 3LQMA 4XOAA 4E9QA 4ZZKA 2J8UE 4HXAH 2O6EA 1AXIB 4HJTA 2AVFA 1WFIA 3M88A 3RPKA 3TBSA 4WV1A 4KKCC 2AJZB 4JY4B 3NABH 3EO1A 1MFEH 5BV7H 4GQPH 2B4CH 4U6HA 4G8GD 3EG9A 2PCFB 1JNNH 3RWGB 2H0EA 3QW9A 4MWFA 3PWLA 1TQVA 1CJYA 3GRGA 1ZLWK 2QPSA 1QFUL 4FTVA 3T6QC 5HHNA 5GRUH 3MXVH 2N1TE 1VPOL 1TQBB 2ARJQ 4CMHC 5EOTA 3LEVH 4Y5YB 1NGPH 2WCGA 3V4VB 3WNJA 2Y5QA 3OPZH 2OK0L 5L4JA 2MNJB 4HCRH 1YQ2A 3WFEH 1UB6A 3L5HA 5C7ZA 4CVUA 4LVHC 4HYTB 1NWOA 4OJFH 5D9SA 3WELA 1IVLA 3HC4L 5ESAB 5DFAA 3FT2B 3HRZC 3RWIB 1KDIA 1QYGH 1GR7A 4QRPA 4X0NA 1SPDA 3H2WA 3WNKA 4ZMPA 4GNKB 4R84A 2BP5M 1SJVA 3N40P 2CRZA 1KFAL 5IHUH 3BQUA 1KCSH 4ODXB 4EOWL 1IRAY 3SYQA 2APSA 5L2KA 3MRLB 3BAJA 3E6HA 3ARGD 2WWNA 2NTSP 3L4CA 4M43H 2OS7A 4QHNA 4ANXA 3U79A 4YSEA 1CXLA 3BQVA 1JP5A 4Y7OC 1UCTA 1QFPA 3D4YA 4GG6E 4L0PB 1BG1A 3HE6D 3V0GA 1P53A 1BQHB 4YDLC 4OZ4B 3P0GB 1MCEA 4ANUA 2GTWB 1H3VA 4NOBA 3QISA 4DVBB 2CGYA 2V3EA 1J05B 4HUUA 2EDHA 1NFDE 5HDBF 3IFNL 4X6CE 2CD0A 1KYFA 3DIDA 3GXNA 4E9TA 2BIHA 3KPQB 3TZVA 1YYLL 4PI2A 3QULB 2AK4D 1NEZG 4WW2F 1KJ2B 4OIIL 4UM9D 4P4KC 1WCBA 2RMNA 4RX4D 1BQSA 3N0AA 3WIHL 3HFMH 3O81A 2WYZA 5HYSA 2OX5A 4RAVB 3AQYA 1DEDA 2VR8A 2JI1A 4LRIA 4JK0D 4JFVA 1WEJL 2ZICA 3PJNA 4KK6D 1USQA 2VLLA 1H5BC 1QOKA 1QLEL 3OZKA 3LKNA 4PB9H 3BDYH 5SWZD 3UPAA 3BAXA 1EQWA 3T4AA 3EH2A 3LHAA 4PJ8D 5FYLD 3T6XA 4NQDA 2X2UA 2ZTBA 1I8MA 2QQLL 1VHPA 2W07B 2XWTB 4HUXB 2Q86B 1Q1JH 2H8PA 4Z23A 3HLAA 3L1EA 5DO2C 1CU4L 5FW6A 5MENB 1E5YA 1MOEA 1MFBH 4JPIB 2I9TB 5CEZD 1BVOA 1SEQL 4FQQB 1GZPB 1N8ZB 3GSXA 1HH6B 1U92A 4XC3H 5IQ7H 1HWWA 3ARDD 1XGTA 1A14L 1AOHA 1A3RH 4HKJB 4LRNH 1QR1A 1QNZH 2FATL 4P5TB 3QEGH 4K94H 4NYLB 4ZFFA 1G0YR 1B9KA 2NY6B 4XPAL 5DA0B 3IE4A 4IOFC 5HI4D 3TBBA 3AFLA 3M6DA 4B3VA 4YSDA 4D8PB 5ANME 4XP5L 3FUMA 4FFYA 4C4KO 2WOBA 2Y36L 4WW1B 1LO2H 1NM9A 1YEJH 4AENB 4DP9X 3QEQD 1IGIH 1XMEB 1BQLL 4WTZA 2QTVA 5LGHL 1IBGH 3H54A 4JZJC 3KW8A 4NN5C 3T0EC 5JQ6H 5I1LB 1E9OA 3V4VL 3WXWH 4RIRB 2P5EA 1XB6A 2J6EL 2Q8BL 2YUZA 4PH8A 4GSDH 3V5DA 1U8LB 3B9DA 1RZIA 1URIA 2ILLA 2NY3C 3Q2NA 3W81A 4ZFGL 5DYOB 5J1AB 4M8QB 2CR6A 4LLDB 5CF3A 3JWDL 5KS9B 4IBWA 4B6ZA 3A6OA 5IGXL 1Y1DA 2PETA 2UXGA 3D6GA 4JKLA 3ULUF 3F58H 1UHVA 5HJDA 1MUJA 3WJLA 3HFFA 1AY1H 2W1NA 1HTYA 3UERA 4NCDA 1S5IH 1P4LA 4JO3H 5DRXB 1GOGA 5CIPA 1C8PA 2GJ6B 3NCCB 4PJCB 3MYZA 4HFUL 3HZVA 2A83B 2O30A 1YJDH 3C8KB 4FNUA 1OTTC 5DS8B 4K5MA 2R1XA 3MV7D 3K6SA 1W72A 2FQFA 2D7MA 2J4WL 3AW5A 1G9EA 3OXSB 4IRZH 2XRAL 3VO0A 2FO4A 1NGZB 4PJGF 4C54A 3QJVB 5HI5C 1F3RB 2DQCL 5BZDB 3NRQA 5D7SH 1MLBB 3IKKA 5K9KB 2FO8A 5ID1B 1UM6H 3TH2T 5HD8C 2HRLA 3VX0A 4F5CE 5I18L 5I9QC 1MI5E 2JF1A 3O4LE 4IIQB 4NDMB 4PWHA 5BVJA 3VAEA 1V3JA 4QOKD 2PP7A 4YHML 4M7JH 1FC1A 4R6UA 4P9HL 3DJTA 1CIUA 2X4RB 3C5SA 3H3PL 2OTWB 3OQ3B 4O2CA 1LJMA 1MEXH 4TUOB 5KAQF 1BQKA 1U8CA 3P9WB 4A2HA 3HKZA 2NUTB 4G8FA 2KZKA 5C2BL 4NM8H 1KC5H 3QVAA 4ABVA 4UNTA 5ESQA 3K5RA 2UZPA 4HIEA 3QDGB 3HZMA 3BO8A 1AZUA 1DVSA 2OZNA 2X9YA 4RMRA 4PJHB 1X5YA 3FQWB 4GKOA 4OVUA 1NBYA 1CIDA 1YUHA 2V37A 3FTGA 4H25B 3V0WL 2A77L 4JO4H 4LNRA 1X7QB 2GUYA 5JPMA 3DX2A 4FG6C 1EGJA 5ITFB 3ABLB 3C60A 5AALA 5AZ2L 2GUOB 3HG0A 4YGVB 5JW3H 2FWOB 1ZT1B 2FX8H 4ZW7A 4D9LH 1BVNT 4Q2ZB 3VSVA 4EE2A 1DQKA 4FI6A 1JWUB 1QSFD 2F18A 4PJEE 2EDWA 5FC9A 2F2HA 3ZHFA 3CQFA 5I74C 2WKLA 3T6ZA 3GXFA 2GIMA 2C4FT 1IGYB 2PCPB 4WY7H 1D9KA 5H37A 4ZUSB 1GJIA 4WV1C 4NGHL 5CJBA 32C2B 4ERSL 12E8H 4OTXL 1CFQA 1WITA 2H6OA 4DERA 1GJWA 4OBRA 1GGIL 3BH9A 4KXBA 5D1QE 3Q1SH 3UMNA 3TN0A 5CFHA 3CVHA 4JPKL 1KGWA 4TUUA 4HIIA 1VADB 1UT1A 2QVTA 2TAAA 4AVHA 2XZAL 5CILL 3BPLC 1HXMA 4FAAB 3L5XL 4UIMA 4KNUA 2EADA 3CFCL 5E94A 1HL8A 1KZQA 4X6FB 1ZGLP 4BFGA 2VDNH 3CU7A 4R8WL 5IW3A 1BEYL 1HZHL 3WGVB 4DZ8A 4JZOA 1CDJA 1ES0B 3HC0B 4XPGH 3OC8A 4JN1L 5DD3H 2PW2B 4X2UA 5JOPD 4IYKA 4GG8B 1JHTB 2HAZA 3AQDA 4WFFE 3GK8L 2WYTA 3VDAA 1JOIA 2KZBA 3BQUC 4PJBF 2CKBB 4HIHA 5FPIA 1J11A 5DQ9A 5L2JA 5JLZA 3EHBD 3C5XA 3FMGL 3PGDA 4GW1B 5KYNA 4KHXH 4ZSOA 1O7DC 3VI4E 4JFZL 2ITDB 2VDPB 2PKDA 3H4HA 4OV5A 4OM0H 4KQ4H 4LLMA 4ADJA 3Q06A 5HYJE 3NBNA 1FIGL 2WLIB 3MRGA 4IBQA 5BS0D 3WFHB 3NSFA 4MCYB 3IJYB 3PWVA 2HXAA 4QHLA 4OR1A 1JNLH 5EC2B 1IE4A 2H7WA 2N01B 2DWEA 1RK0B 2W9EH 4O2EA 1QI5A 3QYCA 5JOEA 1NCAL 1KEGH 2WYIA 2N7AA 1OP9A 4XCFL 2H6UA 3BCFA 3HAEA 4FQHB 3U4BL 3DA0A 3TZVC 4N26A 5FO8B 2QADB 3ZKXB 3F62A 3BE1H 3FQNA 3NIDE 3O6FB 4GKZA 4Z1PA 2E7MA 2PPFA 4FQIH 5FX3A 4GKNB 3CMOL 1K5NA 3MRQB 4P57A 1A3ZA 4MXQD 5I6NA 1WS8A 1UVQB 3J27A 5KSBB 2FB4H 2ODIA 1DJHA 3MV9A 4JFOA 5KVFE 3IETB 4JFDA 4AV0A 2FYVA 3HB3B 4LRIC 5GGTH 2CDGB 3MGAA 4LFHG 3BI9X 2UX7A 1I4FB 3TONA 5E8NB 1E5UI 4NO3A 5EU6A 5GGSY 5CNHA 1DBBL 5DK0A 4G6KH 3ZDYB 1C08A 3QO0B 1QBBA 2CLZB 2GJZA 3QEUA 4YDKH 2HUHA 1QFWL 4O4YH 1QLRB 1W0VA 4WZ9A 4MJID 2JB5L 1CDHA 3L3KB 1CT8B 4B95C 1FE8L 4QXVA 4R90H 2ZX7A 4JB9H 4PMFA 1U93A 3SBQA 5FYKD 4KHTH 3DRTB 4XWOD 3FQUA 1DANT 2HRPH 1RZJL 3GKZA 3NSJA 4B9PA 2H6PA 1P7QA 5DC0A 3Q3GB 5IIEB 3DETD 3HJEA 4B60A 4DKEH 3A5VA 4GXFA 3D18A 3MRPB 5IBTL 3V0EA 2EE9A 1S8DB 4ZMNA 5DURB 2NY5C 3FW6A 5GZND 2MOVA 3DECA 4P4RA 3VD7A 3CDYA 43C9A 4AIXA 4BSWB 3QP3A 4BQ6A 5I1JL 2IG2L 4JG0H 3QFDA 4XOBA 2VO5A 1YZZA 3FU5A 3FDWA 1BF5A 1WIOA 5C08B 3W3BA 4BK5A 4JKPL 3H9ZA 2G2RA 2OPCA 4UTBL 4MYWB 4S1SH 5F7BA 1NEPA 3HPLA 1QRNB 4U2ZA 3QI9B 3WN5A 1XCWA 1DJZA 3HNVL 2ZP9A 4YPGB 1FDLH 3G7TA 1OALA 1JHKH 2DQJL 4KWUA 1DL7L 1KIRB 1ITCA 4Z76A 1C16B 4LEOA 4FI7A 3T0AA 4ZTOL 3N1FC 4HXBH 5CKGA 3WJLC 1CVRA 2ZAHA 1NBZA 3IVKB 2YXVA 2F19L 1E8YA 4WW2B 4W9KC 1INEL 3G6JE 1A6UH 1OAJA 4APXA 4YS4A 5BW7A 3MZTA 4YHLL 5ETUB 3DTDA 4L3ED 2ITFA 5FCSH 3VRLF 3D85B 3VXRA 2HVKA 2YEVB 1CLVA 2UWEF 3VU1A 2W0KA 1F86A 5D2LA 1FO0B 2WANA 1IFGA 1J1PL 5DRWA 2P1YA 3DOSA 2BOLA 2OL3A 1ADQL 5GJSH 2H3NB 4UV4H 2NQ3A 2X4TB 4PP2A 5EU4A 3V7MA 4NJ9L 1E5CA 2VDRH 1FZOA 5JW5B 4U3SB 5ELIA 1Z3RA 1G7LA 4DP4X 3NACL 5K39B 1J5OL 1XB3A 5IHZA 3U6XS 5EZLB 3VXNA 1NJ9A 2NNAA 2FHBA 4RZKA 1N68A 2D3VA 1CE6A 1CF8H 1M7IB 3MNZA 5C07D 2Z65C 3TIEB 3QNXA 3SE4A 2ICWA 1NAMB 5LG1A 3RTQB 2ZPKL 5PAZA 3FB8A 4OD3L 4ADIA 2EUZA 2VZ1A 4GKSB 1LP9E 1THAA 4N6RB 4C83A 5EZJA 3L1GA 2J21A 3V0HA 5KBDA 1N0LA 2ESVE 2QSVA 2LFGA 3D05A 3D2UA 1XGPB 4W9IC 4MQXD 2JKSA 3S6CA 3GSOA 4KTDL 3NN8B 4OM1L 3LKOA 1T04B 3BP6B 1QQDA 2A38A 3PWPA 3QDMD 1SQMA 4CU8A 1JSYA 3A6BH 3RY4A 3OJDA 4BK8A 3L3HB 4KKQA 4CGTA 1BLNA 2XXCB 3QQ3A 3C60C 4JO2L 4KXAA 1S3KH 5I5IA 2IGLA 1J12A 1YMMD 4XPHL 5KVFH 3CD4A 3IM1A 2MPAL 3GMMA 5F72S 2P5WD 3D39A 4PCYA 2YKLH 5A16B 5AKSA 3SDAB 3C8HA 5C0DA 5G55A 4L4TD 3CFBB 3BD3A 3PGCB 2KMWA 1BREA 3RNQA 4WSJA 3RNKB 4WWPA 5HDOA 1CF1A 3DHPA 3IN2A 3NTCL 4OIBA 2MSPA 4LLVB 2FSEA 3LKQA 2P4AB 4M02A 4PGZA 4AM0A 1A6AA 2BDNH 2XXMB 1Y18A 4LZKA 5LB1A 5KBLA 2JH2A 5INDA 4OLXH 1A4KB 3TN0C 5I66A 4G2AA 1OAXH 1MJ8L 4X6DF 1N5AB 3P4MB 2D2OA 2YD1A 4FLQA 4LDLB 1N6UA 4K3EH 1JIBA 4HF5H 4L3CA 4XOEA 3RYMA 5F0PB 4NRZB 4PJGB 1JK8B 2FX7L 3KJ6L 3UP1A 4ZX4A 1GY2A 2AGJH 2C3HA 4GAAA 3MC0A 2AANA 1AIFB 1R46A 2P8MB 1UWFA 3WUWB 1BM3H 2BSTB 4MDIB 3QG6A 2YPKA 3FHAA 2WZ6A 4HG4K 4NQTA 3B2PA 4FTDA 4CVZB 1TEGA 1AGBA 4M1GL 3IRPX 4TMPA 3RVTC 4Z7QB 2ZCKH 2DZEA 3HBGA 2WW8A 5LXVA 4GSXA 1N59B 4ONGH 1KCUH 3BC9A 2Z31A 5IOKA 2R0LH 3QUML 4Y2DD 1U58A 1H3PH 3HHMA 4XE0A 1ZHNA 4QYAA 4MJ6A 3DTXB 1G9HA 4PLKD 1YRKA 2R8SL 3U7YL 3WO4B 2H1PH 4ZFOL 5HGDB 2JELH 2Z8WC 3FN0L 3GMNA 2Y1YA 2RFXA 3BP5B 1A9VA 1FO0L 2IANA 4W1TA 5B38G 1MFVA 1XZ0A 1AC0A 4N0YH 3B3IA 4M6MH 2DLHA 5KJ7E 1CE1H 3Q6FB 2YOAA 3WE6B 1BFSA 7CGTA 2OCFD 3LQAH 4L8SA 4DN4H 2E7LA 3ESOA 3FTVA 3ZDZF 4KU1A 5I6PA 1MCRA 4N3UA 1EZVX 1XF5A 4O51B 3WFCL 4EUPB 1HI6A 2UXFA 1VF5C 1HHKB 4KKRA 4W70A 1FBIH 2JI3A 1NCNA 4YL9A 4TTDD 4P2OB 4J2QA 4YZFE 2B20A 5GS1B 4M5YH 1Q9WB 1LO0H 1UB5A 2ZCZA 1BYNA 1A4JA 5KSAA 1O75A 4L8CB 4HLEA 3GXTA 4MFHA 1QKZL 5GISH 2F54A 3OKEA 4KVCL 4QRTB 3TASA 3ZTEA 3MCYA 3OMIB 2X6MA 1RD6A 1W8NA 2Q7AA 3TO4B 4AEIH 4F7TB 4PCKA 5L0QC 5F8QC 2L4OA 4G3YH 4Q0XL 1S9VB 5AW8B 3WV0A 1LK3L 3ZU8A 4B50A 2NW3A 5TDNA 3W0WB 2NPLX 4JQIL 3KWWB 4Q9QH 2VDOB 4YDIL 3BX7C 2Y23A 2D0GA 4RSYA 2PTTB 3LNDA 3MBWB 1I82A 1HH9A 2VW7A 3QIWA 4DOHB 2KLTA 1T2XA 4ZS6D 1DBAH 3ULUL 2X40A 5I75C 1O6SB 5IBUG 5DUML 5I5MA 5KSUA 4KPHH 5TQ2L 4WTXA 1M2VB 1G4RA 4GW5B 5DMGD 4G1MA 4BCZA 1RJCA 5DMJB 5AVSB 1T7WA 3RGBA 4GBXA 4E9WA 4O2FA 4FZEL 4LASH 4BK5C 5BUAA 1U91A 1OGSA 2F53D 2MPVA 3RL2B 2ZX5A 1RZ7H 4OLEA 4NS0A 1E90A 2XFXB 1AXSA 3WN5C 3OGCB 4XN5A 2J5LC 4BH8A 2ZOTA 3ATFA 4QRSA 4FERA 1HS6A 3QG7L 3X12A 3NFPB 4UWQB 3MRMB 3FT3B 3X17A 1HE7A 1PZ2A 2A7BA 3AC0A 2MCMA 3SDYL 2ZXDA 1S5HA 5DI8A 1ZSHA 3X3FH 1MCWM 1RIVL 4NUGH 5BW7C 3PFUA 3KPMB 3FRPG 3ZHLA 1GGBH 3E9TA 5DHMC 3T4YB 4DUXA 2Z91A 5IB5A 2IWKA 4FFWD 5KYWA 1A7RH 1PKQA 1XIWA 1J1XH 1FVDB 2BHFA 5GRZA 4AJWA 4GKLA 4PJIA 4C57C 3CLFL 1FQ9C 1L6XA 4FYRA 5JXAL 1HAWA 3SD2A 3O9WD 1U8OA 4JREB 2KZWA 2H9GA 3HPJA 4OFYA 1TUPA 1RUAH 4BK4A 3WG7B 3ARBA 1IL1A 4FFZH 5FS5A 2R2BB 1R5IA 4ADGA 5CCGE 1EAPB 3QWRD 4HUWB 4JDEA 3A4DA 2NX5A 4IRJA 4P59H 2DQDH 3SKNA 1RP9A 2BIIA 2AI0H 4LO9A 1UATA 5DJYB 1KJVA 5DJ8B 1D5RA 4HJJH 4RMQA 2A73A 1NDGA 4WWID 4HOWA 3SE4C 4LPYA 4JRXA 2A9DA 2R59A 2VXUH 1D6EA 4HOZA 1PMYA 2WXNA 3CK0H 2UZIL 2YRZA 5HYEA 1IFHH 1MDAA 2QQKL 4BCXA 3IRCA 2R2EB 3BSZL 4TLKA 4DGIL 3PNWA 3O2DA 3QO1A 2QDWA 2K9UA 4OD1H 3ET9F 4Z7VA 4JHAL 1JVOA 3IRZA 2ZOOA 3QPXL 1GMIA 3L3IB 4UV7H 1E6JH 4KNTA 3WMPA 1FCGA 3D06A 3CFKB 1MLCB 3JTBA 1YNKL 4YHNB 3K6FA 2UXTA 4PJAE 4A6YA 5FKAB 4HUMB 2WBXA 4OGXH 1ZHBA 1DDTA 1IGTB 1KTLB 2DQTL 3RVXC 2ITCA 1OARH 1BF8A 3ZDXE 2NXYC 3T2NH 3A3YB 1C12B 2HJLA 4AIZB 2V3DA 2HJKB 4LMQI 4OSUH 3UZQA 5B39A 1DE4B 4HULB 4Z7NF 1IGJA 3CFIC 1QACA 1WAPA 4JRYA 4B9ZA 3COOA 3V0IA 1XD0A 4MA3B 4CL7A 2IIJA 3GMPA 4HJ0D 1KB5H 4F2EA 1S9YB 4U4BA 5I30H 3QIUB 4LOVA 2ZWSA 4NQEE 3HMXL 4GRLD 3QUYA 3QXVA 3HE6B 4PYGA 1V7NH 2EYRB 4ICWA 1KGIA 2KQNA 1KXQA 3WTTA 1E67A 1NAKL 2E86A 4PGBA 5ISZA 1A7NL 4WK4B 3SHSA 3Q1EA 1DJSA 1UACL 2JCCE 2AABH 3OV6A 4XGZA 4KO5A 1L0YA 2JJSA 4M93C 4MSWA 1KXTA 3P3YA 3UJJL 2WQSA 2WQVA 3QXDB 3GRBA 5DD1L 3ZKND 1JYWA 3NJLA 4KJWD 1PD6A 1SEBB 4OZGA 3OHXB 4OD2B 3KBEA 4IDJH 2AK4B 1RUPH 1TO4A 5EZIL 2K3HA 1FNAA 4UM9B 2DKMA 4LT7A 2Y5TA 1IGFH 4JAMA 4WSGA 3TEZA 1TQCC 5IB4B 3FULA 4LAJH 3TPKA 4MX7B 1T7YA 1WBZB 3RTLA 1CGYA 3EYQC 3P4LA 4PJFE 1M7UA 1A8ZA 1PPIA 1ZJBA 5TDOB 5AW2B 4DSYA 5SWZB 3T0DA 2YD3A 4G7VH 1IAKB 2CJSA 5D71H 1WWWX 3HUJF 5IW1A 3KM1A 1OAQL 2VAAB 4NP4L 1GHFL 2EZ0C 4ZPVB 4AQ8A 3OKKA 2R51A 3CN3A 1I75A 1A6WL 4WU7A 2A4CA 2H2SD 4OGAD 2ZONA 2ZYRA 5E7FA 5TGBB 4XVSL 1NIAA 4BGDA 5F6IB 4LL1A 2RACA 4AZ8A 1K5WA 5DZLA 4UTAH 1BFVH 4PGEB 2BOCA 1DVFA 3ARDB 4IHOB 5EA0L 4AMXA 1OOWA 4FQCL 2ZCLH 4OCNC 3NEOA 1AGEB 5F70A 1FVEB 4OKDA 1Y07A 4G7YL 4YXHL 1MY5A 4WKZB 3HNSL 1MJUL 2V2WA 4AL8C 5IJVA 3IPFA 1NDMA 5B8CA 3TYGL 1RUKL 5T8IA 1QBLL 5CINL 2F8VA 4WU5B 4GQRA 3EF7A 1T0NA 4WI0A 2X44D 2VO8A 3IJEA 1GZQB 1GC1L 4X5XA 5TQ0H 2OMXB 1IIKA 1L3WA 3MLUL 3QEQB 5A6MA 5KSAC 1R0AH 1NCWL 2IH1B 4P2RE 4G6JL 5DRNB 5C0AD 2XKNB 1BHGA 3CG8A 3GNML 1M6OA 1XCTB 4IU3B 2XBTA 3WFBL 3G5VA 1G9MC 3BIKA 1RVFH 4G9FE 5T1KD 2E75C 3EGXA 1MHPL 3CQQA 1BV8A 1GTNA 4HIXL 1JHLL 3QYNA 2HVJA 5ICZA 4YDJA 4H7VA 3GXMA 1YEEL 4BM7A 3WIIL 1YC8A 3RPIA 3QJHA 3FTXA 4KQ3L 3MRNA 3UZVB 3QIWC 5EWIL 4LP5A 1NANH 5D7LE 1E50A 3HG5A 5GJTL 1CCZA 1S7UB 3T2LA 2YN3A 1YNLH 4ZXBA 3HC3H 3IGAB 2R7EB 4HS6B 1KSRA 3MAWA 2PPEA 1A1MB 2J8UF 3P69A 2DF3A 4DTGH 4ELMB 1EAQA 2XKSA 2XDHA 3WIFB 2DQHH 4PJ9D 3FSWA 4P3DA 1XBDA 5DTFB 3VFUA 5ICYB 4GBXC 4QRRA 1MXDA 2C7UA 3QDJA 3WI9A 4M29A 5D2NB 3IXTA 1QLFA 3KDMA 1NICA 3EJQA 3S5LB 3T1WA 4QOKB 1R3HA 3WIHA 1KT2A 1EBPA 3BP4B 3B9KD 5KJRL 2JI2A 3IDMB 4PY7A 4PJ5E 1MZZA 2IQ9L 2OMZA 4QF1B 4ZMTA 1AP2A 1N4XL 1WSST 4IRSD 5EULV 2ZSWA 2ZSVA 3BZEA 5DJZB 4YUEL 2WXPA 3FCSA 2VXSL 1U8KB 1X5FA 1EUUA 1QP1A 2HTKC 4FQ1H 4Y1AE 3BVDB 2IWFA 3MLVL 3MBEB 4TTGA 4I9WE 1P6AB 4PBVC 2NZ9C 4QIRA 2IADB 3VXSE 4LGPB 2VWEC 1PCSA 2BHZA 3J8F7 1ORSB 3GSNH 1E8ZA 2E9JA 2MCPH 4JM2D 3QXAA 1M1XB 2CGRL 4NKOB 2R0ZL 4NM4L 4D0BB 2VNCA 4H8HA 4P07A 1PAZA 3LKRA 3RVWC 1XIWC 2W94A 4R0LB 1NGXB 1LO3H 4UUJB 5FYLL 5D96C 5KW9L 1BD2A 3NQKA 2DQUL 1N0XH 5IHHA 2VDMH 3KE0A 1U36A 4XH2A 2WSPA 3AGVA 1ECZA 3DURB 4X7EC 2XN9A 2DQFA 1CFSB 5CEZL 4XO4A 5DFTA 4IRJC 3C6LB 5EF1A 5KVGH 4GG6F 1QSEA 4Z3IA 3UBGA 3V95A 2HP4A 3FO0H 5JW4R 2R4RL 4GOSA 3TBYB 4IGBB 3VVWA 3VI3A 3FTWA 3V4VA 4OZFG 3RWHB 5C0CA 5LQBH 1D3CA 4RNRA 5FFLA 4X6CF 4ZODA 4FLOA 3UTZB 1G5AA 1I9JL 3BXNA 4IHBA 3PNRB 3NIFF 4XP4L 5JXEA 5J56B 1OWWA 2ZF8A 1IM9B 2CDFB 1VJSA 4QRPE 3MUGB 3ARWA 1ETA1 2R0KH 1NUDA 4XPBH 4PJDB 4LCWD 4BQCA 4E42A 5CD5D 2AS5M 1UH3A 4U0RB 2KQMA 5E4AA 3JYBA 5L2KE 3IDJB 5GRJH 5HPMA 2G75B 4PR5B 1MCSA 4HUKB 3MOAH 1O7DE 4H5SA 1SVCP 1E5AA 5HHOE 4HV8B 1OW0A 5L9DL 3RDJA 3VG9C 5I82A 3QCTL 3K71B 2Z3FA 2HRHA 1BQHA 2DH3A 2GTWA 3RU8H 3WY1A 5BS0B 3ECBB 3QUYC 1TF4A 3D4GA 4CNIA 4WI8A 1T21A 4NERA 1KEML 1JL8A 2AXHA 3LNIA 5F7KC 1MCJA 5E2WH 2AJUL 2FEJA 1N10A 2VJ8A 4MLSA 3QULA 4KKLC 1OGAE 1ZHKA 2K78A 4R96B 3E7JA 2GSGB 3UZEA 4GEIA 3G9AB 2XWCA 3ML8A 1YA5A 3EBIA 5GGUB 4RAVA 2X10A 2VXVL 4AUUA 2E7BA 5AWNH 2LABA 3FU0A 3HA0A 3QRBA 2WJ7A 1TQUA 4KTYA 5D1XD 1N6QH 2BIMA 4I85A 2IXQB 1IFRA 2ADIB 4HD5A 3DBSA 1ZGLM 1DQJB 5J4MA 5CSZB 3O0RH 2ETWA 3D34A 2BS9A 3X14A 2GK0B 2Y69B 4NQDE 4ZMVA 3LMJH 2Z0BA 4LE8A 1BYPA 3VXUD 3ZMNA 4XP1H 4JPIA 2UV3A 5JNYB 1KPRA 5KTEH 4AQ8C 3DO7A 5LCVL 5IB3B 4FQQA 2IAMD 4LF3A 5DC2A 4IEFA 1HH6A 4HETA 5IUSA 5HJ3B 4JFYA 2MKLC 3QB7C 1MNNA 3NJIA 4MAYD 4L1TA 1RV6X 2G30A 4TPRL 4BQBA 3O2VH 4NYLA 5IMMA 2OCCB 1MREL 3OB0K 2DRUA 1DSFH 1DVFC 5C6WH 3P9MB 5DT1H 3B83A 3F84A 1H15B 3O6KH 1VFBB 4Z0XA 2GBTA 2K7PA 2W65A 2HPTA 1U8IB 1BIHA 2N56A 2NQCA 3P77A 4NENB 3QZOA 4AENA 4PRBB 1AD0A 1WZLA 1F1DA 2X53A 1YECH 5B8CC 3LB6D 4TVPE 1JUFB 2E7CA 3D3VA 4G6MH 1CXEA 4H8PA 5T1JA 1MRCL 3GMLB 1I3UA 3I6KA 3N44B 4NNPH 1KLGB 2F74B 5BV7B 1GTFA 4TUJB 1E8WA 4I5BB 2P5EE 1ETB1 3SDXE 1ASPA 4AEFA 4XB3A 4C4KT 4D94A 3QWQB 1ANUA 3ETSA 5B21A 1U4EA 2DD8H 3MRDB 5TE4L 1XBRA 1VGKB 2ZNXA 3CFNA 1F3DH 5TFSL 4XXWA 2Y6TE 2NTFA 3S36L 3VH8A 5IEHA 2RALA 2B0SL 3V4PL 4WGWB 2Q0ZX 1A3LH 1AQDA 3N43F 3OBAA 4AV4A 2DWTA 4UMGA 1JK9B 1WFOA 3A23A 3G5YB 1CFTB 1F97A 3VQLA 4PJXA 2AJ3B 1VZHA 2IV9A 1BAFL 1NIDA 4LCYA 5A7BA 1OT1A 5I8KH 3OXSA 4P49A 2JK5B 3N55A 5D4HA 1P7KB 5ACZB 2VZUA 1OAZL 2PYFB 4L3EB 4NX0A 4ZXBC 4QXGH 3Q8BA 1S4IA 4PJEF 1GCFA 5C9JB 3IS1X 2AJYH 4FXKB 2FD6L 4KKBD 4W9HC 5EF2A 4AW4A 3B37A 4MKMA 1BXAA 2WOYA 4JDVB 1EHLL 1BZEA 2VABA 2X4RA 4E0RB 2QV4A 1AHKA 2RR3A 4HGWA 1BWMA 4N25A 1DFXA 3A6CH 2MRYA 4J1UB 4N90E 5LGYA 4MJ4A 1MKFA 2CBTA 4RFNB 4EN3A 3DX0A 1UA6H 3ARSA 1UXSA 3ZRSA 3TBWB 3QA3B 1JF1A 3SPCA 2ZKMX 4XVTL 2DLFL 4X5LA 3VWKD 3VDBA 4KH2A 5BOZG 5AD0B 1M9WA 2JXMB 2DLIA 5E5MA 4E9RA 1JMXA 4DEPC 1CWVA 1FFOA 3G5XB 3EFOB 5DFVD 2WB7A 3ZT6A 3REWA 2RJMA 3APNA 2BFVH 2ISDA 4YGVA 3O41B 1IC0A 2FWOA 1DJGA 3FAWA 2WIIB 3Q5TA 5HGBB 5DEFA 3SEPA 1KZYA 1UA7A 1P1ZB 3QDMB 2BRQA 3N85L 1JWUA 2X1WL 1BXVA 3AAZA 3BD4A 3IMTA 4DKAA 4GJTB 5EORH 2F0CA 4ES8A 2ICCA 5IEKA 1BPVA 3AXLB 3B2VH 3LIZL 4QJ3B 3VI4F 3EJSA 4X8CA 1SOKA 2N0KA 2YQ3A 3B56A 3DMMD 3CFTA 4ZPTB 3HS9A 4YLQT 4ESKA 3NCXA 2R15A 3WUZA 3WNPA 3GLEA 3TH4T 4KO6A 2CA4A 3G6AB 4RESB 1OPOA 1CD0A 2NY7H 2ID5A 4UTBA 4QY8B 4HXAL 1RZFL 2Y1AA 2XVGA 4I48A 3B2UC 3ZT5A 3QWNA 2Q6WA 1QA9B 2F1BA 5ESVB 5TE7H 2XYBA 3LH8A 4X6FA 2WXQA 3NABL 1JZ8A 1EHXA 3DWTA 2XY2A 3JWDC 2CM6A 5BV7L 5JORA 2R9HC 4AKOA 3NIDF 1G7PB 3UG4A 1ES0A 3KPSE 2MHAB 4LLUB 5JXEC 2G0KA 2P5PA 4KRPC 3TEWA 2OP4H 4RSVA 4YR6A 3MXVL 1F6AB 5DXWA 1WLHA 2AV1B 1KN2H 2BVOA 4A1RA 5DD6A 1NGPL 3KNBB 3I50H 1C9SA 3OPZL 1I7ZB 2RCSL 3GIVB 1JYVA 4HCRL 3WFEL 1P4UA 1UD8A 5A6LA 4OJFL 1RSYA 1P4IL 3MCLH 1X5LA 3V8CA 4ZSOE 3JYCA 3JVGA 2X4QB 1J0JA 1ADQA 3VRIB 1QYGL 3WFHA 1XH3A 2AQ1A 5EC2A 3DK2A 2CAKA 3BVVA 3F7YA 2HT3D 3UJIH 4A66A 4F33A 3CU1A 4WF7A 1SYVA 3FC8A 5C3IA 5IHUL 3ILPB 1EO7A 1KCSL 1KIQB 5AG9A 1YNTA 3S37X 4P9HC 1ZXKA 2GITB 3ASOB 3G5ZA 4M43L 4UQBA 1UWXH 2YZ1A 6TAAA 2WZPA 4YJZL 5FO8A 1FNEA 3CFEA 3IJSA 1TENA 3FRUB 5E8PA 1SXSA 1Y6KR 4GKNA 3UZEC 4HK0B 2B15A 2E59A 3SQBB 3EYVA 4LPWA 4BQ9A 2APXA 1Q1PA 4PV8B 5DJDB 3P1VA 2E47A 3IETA 3KDPB 2Q3AA 1I4FA 1S78D 2ZF9A 3G08A 3FCBA 4JM2F 3VJ6B 4S1DC 3QC5X 4QO1B 5EU6E 1JXKA 5JO5A 2N1KA 4PGJA 1U4FA 2FGWH 3WEOA 3B9EA 4ZX5A 3TO2B 1BLIA 4QHUA 5DQDL 3N06B 1CT8A 4I0KA 3HFML 5CLTA 1JN6B 3QUZA 3IPEA 4GFXA 5IVZA 2Y2YA 2NNCA 4JGNA 3QEHB 3QUHA 3DRTA 1E4WH 4ZAKA 1JZ4A 3G6JF 1XEDA 1IMHC 2JKRM 4PB9L 5DHEA 3BDYL 1JPTH 4IOSA 3Q3GA 3SE3A 4P5TC 4XNMB 2XOTA 4JQXA 5CBEB 3QJFA 2UY6B 3KLQA 5FA4A 3TT3H 4X4YA 1OVZA 5EO9A 4FABH 4ZG1A 1LE9B 5GGSA 1Q1JL 3U4EA 2D8KA 1MCWW 3RB7A 2RAMA 1AAJA 3GJFH 2BM3A 1OK0A 4DETA 4MAZA 3I9PA 4YFDB 1F13A 1PLBA 1OGPA 5E51A 3UAJA 4C56D 1AO7B 2ZCHH 3RWJB 5ICXB 4P5MA 5I1AA 1FG2A 4XC3L 2E74C 5J3HC 3U4AA 1OD7A 4XXCA 1L9SA 1QRNA 3L9RB 1A3RL 4TKWA 5MEQA 4FQ2H 4G6FB 4I8DA 2VITA 5DMIL 4K94L 4KFMA 1YEHH 1B88A 4HISA 2F53B 1XXDC 2ODHA 3RDTD 4K15A 1MVYA 2NYYC 5I6LA 1SJHB 1QPKA 1UM4H 2Y7NA 5FYJU 3ZUCA 5FF6A 3UTOA 1LP9F 4TLTA 2DTSA 4F9PC 4XXWC 1YEJL 2FDBP 2J1KA 1MAKA 1U8QA 2IPTH 2Q2LA 1IGIL 3AG2B 2I9LA 3QDAA 2VLRA 2XX0A 4QWWC 2AQQA 1KCBA 4K7PH 4MNQE 4NPJA 4R5VA 1IBGL 3NZ8A 3PHQB 3QUMA 4WW2A 5JQ6L 2WXHA 3WXWL 1I1YA 1ND0A 4DWHA 5L4IA 1BVLB 4GSDL 2H1XA 1JV2A 4ZFOA 1I7TB 1VSCA 3IJ7A 1F4HA 1FO0A 4GW4B 3VXTB 2WWKO 3F2LA 3CZSA 3OKLB 4FYQA 4YPJA 1JZ7A 2NLJA 3VWJA 2AV7B 3F58L 5CBAB 1PZSA 4TNEA 1AY1L 4IOIB 4CJ0A 5GZOD 2DY2A 3J07A 4RZCB 1S5IL 1MHEA 2COVD 2FBJL 3S88H 3TVMA 4CMMA 4IIQC 4JO3L 1AYOA 4Z3GA 1QVOB 5FUZH 3UJTH 2BP3A 1ZWIA 4OB5H 5T3XE 1YJDL 4NHCH 3BP7A 2A1WH 3U7AA 4PIBA 3RTQA 2X28A 1XGYH 4IRZL 2BVTA 1AD9B 5EEVA 3V55A 5LGKA 1G9NH 2ATPA 3CSYA 5D7SL 1QX1A 1UM6L 3ZHDA 1F1AA 5DSCA 4L2LA 3U6XA 3ZSTA 1I7RB 1JXDA 2LT9A 3KWXA 1WJ3A 4HG4J 1NL0H 4LXFA 1JXJA 4M7JL 4NKMA 1ODAA 5IJKA 2F7OA 2PYEE 2RA1A 2XT1B 3CSTA 1XV8A 4U33A 2D9QB 1RZ8A 4GI9A 1MEXL 4IBTA 3S5YA 5LVEA 4MA7H 1RMFH 4N1EA 2B16A 1AC6A 1TLMA 2GTZB 1DUZB 4AYID 1EAOA 1KJ3H 4NM8L 1KC5L 4JQIA 4EZKA 3O8XA 5AFAA 3BDBA 5CLWA 2H47C 3R19A 4KMQA 1IM3B 1NANI 1RZJC 4OGYH 3KCPB 3ESNA 1NLDH 3QPQC 4Y1AD 2OSWA 1ML0A 4JO4L 4LKCB 3OKOB 2V9UA 1R3IH 1Z9SB 2LU5A 2BSRB 2YEQA 1YYCA 4LLVA 5EIIG 4V33A 3VXSD 1D5ZB 3HBPA 5E8DH 3HG2A 4L5FE 5EO0A 3U4KA 1KN4H 5JW3L 2GQHA 3GM0A 3ARFA 3CFQA 1ZV5A 2FX8L 5CGYD 3PXJA 3Q05A 5E2JA 1BIIB 2XV3A 1GGYA 2R1WB 3LOWA 2E56A 4RMTA 4EIUA 4E36A 3QQXA 4A7SA 1XL4A 3DYOA 4AYFA 2E9BA 4NRZA 4PJGA 4WY7L 3BLBA 3FYEB 2HG0A 2HPOA 1DVQA 4LDOB 1TU2B 4QXWA 12E8L 2BSTA 2YMTA 1KIUA 4MDIA 3CUPB 3GKWH 3GPEA 4I18A 3LKPB 2DTMH 1G6RB 3Q1SL 3IJ8A 2A6IB 4KJPD 4YZFF 4HALA 2NY1D 4URKA 1BVNP 3K81A 1R3JB 3DBXB 4ALAC 3CIQA 4FMKA 1G84A 2FYYA 2BNRB 5JHDE 3HG1B 2PWHA 4QXUH 1LL1A 1PDKA 3NSCA 4PREB 2WKOF 2VDNL 3DPBB 4RMVA 4LESA 3U0PB 3JVGC 1GGUA 4QEGA 3P30H 2BCKB 3TTYA 3OKMA 4D0CA 2JQMA 4YHOH 4KKZA 5DD3L 1SYSB 2CRMA 4ANVA 3S5ZA 4LL4A 2B59B 1UM5H 3LN9A 1HHGA 3LRSA 1TKWA 4WK2B 3DI2B 3RJDA 3O3BA 1MAJA 1JZ5A 1AQKL 5IQ9A 4KHXL 2QDVA 4V2CB 3T8MA 3HBZA 1XEUA 1MAMH 1FC2D 1T1YA 5IMOB 4FC3E 4KQ4L 4G70B 3AU1B 1J8RA 3ALXA 4R7LA 2VQ4A 3P4OB 2VJ0A 2YAPA 3L2LA 3LN4B 3WS3B 1I3RB 2EE2A 3DOIA 5GS1A 1Q9WA 1T20A 2W9EL 1ZEAH 3Q13A 4U6VH 3HB3C 1T0MA 3DSNA 1B4JH 3DROB 1GGCH 2I7OA 4HSAC 1WHPA 4ZRGA 1AXTH 1FZKB 1M6UA 2VM9A 4ZW6A 3SDCD 3BVWA 3UG3A 4N8PA 5E6ID 2VL4A 3NSXA 4ISVA 4ONFH 3B34A 2P8LB 4J27A 2VKWA 3MRBB 3BE1L 2A4ZA 2YAFA 3KM2A 4FQIL 4PJ7F 4Q58C 1AZRA 2XTSA 4GS7B 4OF0A 5C0AB 3V6ZB 4PU2A 3JUZA 1N6VA 4GP4B 4ZMXA 1YPZB 2XC8A 2FB4L 3QUZC 5T1KB 2JKLA 2TSBA 2KKQA 1CICB 4XN8A 1EEUA 2XICA 4YX2H 4JVUA 4ZAKC 1FA4A 4U1MB 2E9IA 3TPUB 5C6TH 4Z7OE 3VFVA 5E00A 5MHSD 3PYCA 4G6KL 2CLVA 3SE3C 4CC0A 4J6RH 4JQXC 4RWYH 4R4NC 1BZ9B 4YDKL 1O6SA 3R4DA 4O4YL 4PJBA 3ZMRA 1BG9A 1NSNH 3HMXA 1TXKA 3BWZA 5MEOB 2W60A 2GTQA 2DWDB 5DU7A 4LCIH 3ZGIA 3FXIC 4R90L 1UWYA 2BWQA 3PL6D 4JB9L 4M5ZH 3UAJC 4ZQKB 4CKQA 5MERA 3PAUA 2WNXA 2ZOWA 3OMZA 1FVCA 3EOAB 4KHTL 4I3GA 4LIQE 3L3OB 4N20A 2HRPL 1EZSA 4MMYA 3IB4A 4PJ9B 2OJZH 3QI9C 2YD5A 4LLWA 2FJFA 2B1HH 4K3DH 3LS4L 1A21A 5FDWA 4DKEL 1ZPUA 1CQKA 2HUEA 3MRMA 3MXWL 3CBRA 5CM1A 2VSKB 3SGKA 1VFMA 3B9KB 4JG0L 5HXMA 1TSRA 5E08H 3OXRB 5DZPA 1S7QA 4WW2C 1R34A 1AGCA 3EFFA 2G9HB 3F7VA 1U41A 4S1SL 4B9YA 3O45B 2VWEE 1KY6A 4C4BA 3U48A 1EJ6A 3C8DA 3D48R 3LSOA 7PCYA 1FDLL 4H8QA 8FABB 2O5XH 3EJPA 1JHKL 3FTUA 3MPCA 2X1OA 4N2LA 5LNEA 2MTPA 3ESPA 4PJAF 3VWJC 4F2MB 3PV6A 4HXBL 4Z7UB 3GM8A 2FQDA 3CFJA 4KXZI 2CCWA 4WWNA 3B7UX 4YSOA 1EEYB 3ZDXF 1O7VA 3TVMC 5HHXH 1A6UL 3IJHA 4XCNB 3BUQA 4W68A 4NKIH 1MPAH 4JY6A 3JVFC 4Z78B 3GS7A 4L1LA 3HI6H 3IDIB 3RTQC 2YS4A 2H0FA 4G8GA 2FWUA 3U2SB 5DC9B 5GJSL 4JRWA 1VRSA 1F8TH 4UV4L 1U2CA 4HPYL 2XZQH 2NT1A 4X4XA 5DUBB 5EEZA 2VDRL 2GK2A 1SGKA 3ML9A 1OD9A 2VQ1B 4D0DB 1PYWB 2HT4D 1HXKA 1PZBA 2JCCF 1AZNA 3IMVA 4LSTH 1URLA 4Y19D 3BISA 4MD0B 2XQ0A 1JYXA 4JFPB 1EFXB 2C1OA 5HHQA 1CF8L 1SNRA 1U33A 4NO2B 5DVLA 1TJGH 43CAB 5AOLA 2ZZUT 3W9EA 4X5WB 3Q8AA 5DZJA 1ED3B 1UASA 4X98B 5E2VH 3UBXG 5HVHC 3GZPA 1IGTA 1KTLA 5E6UB 3KR3H 3A47A 3AQXA 4JFEE 3GSQA 2DQ6A 4PJFF 1DE4A 4NQCD 4ANWA 3KCWA 1WC7B 4F8QA 2ZXBA 3ARGA 3OM3B 5HJBA 5EPMB 4MA1C 3A6BL 1G1KA 1O6TA 5C0EB 3QXWA 1HZLA 4JRYE 1S3KL 1G0DA 1NPJA 1F56A 1PJWA 4BEIA 3ESVF 4JCMA 5KVFL 5SWQB 1KWKA 1JNHB 2VL5A 3FUHA 3T65A 2FR4A 4MQTB 2IDCA 3CN2A 3KZ8A 2YKLL 3EBGA 3QAQA 1MY7A 2UWEA 1WIPA 3BKJH 3FOLB 2V7HA 4EVNB 6PAZA 1KXQE 3AADB 5D7JB 1BAWA 3LV3B 5ISZE 3DYMA 1A3QA 2YC1A 3PWNB 3QQNA 1MHCA 5I1EH 1SEBA 4M4RB 4OD2A 3S3DB 1OP5K 3QCUH 5JDSA 3VRJB 2AK4A 5F9OH 4ODTH 4I18C 2E7DA 3QJOA 1MJ7H 4Y5VA 1KENH 2BOBA 4OLXL 4RX4A 4YNYB 1IBYA 4Q9RH 4NFBA 2BVPA 1SXNA 5CN3A 1RSFA 2QGDA 4K3EL 4K9EL 1NC4B 4HF5L 4NQVB 1P1VA 5D1XB 4S1QH 3VCLA 4CW1B 2VDKH 4RWHA 5IB2A 4HEMA 1E3ZA 5AYQA 4XBPB 3NIGE 5SWZA 3NZSA 4Y9CA 4TNVK 3IPBA 4PJ8A 1BM3L 4GQQA 4LLYB 3WO4C 3BUYB 3MLSH 1AACA 5GSRB 4EF3A 4ECNA 5EB9A 1NINA 4NUJA 5CUSH 2O6DA 4MNGA 5MP6H 4OLVH 5TGBA 2WTRB 2ZCKL 3VXUB 2D03H 1HDMB 1QUPA 2GFBA 1I1FB 3JSSA 2HVBA 3H7BA 3PDGA 4OCXH 2IAMB 2Q5BA 1ORQB 2ZG1A 4XWGL 1ECYA 3KXFA 4ONGL 1KCUL 4V1DA 1Q4NX 3SJVE 4ES9A 4N0FB 4R3SB 4JDZA 3ROOB 5GIRA 1U0QA 2R0LL 1H3PL 2WBJA 2Z7UA 4MBRA 4X7FC 3RA7L 4MAYB 1R4XA 2WMPA 3TBTA 2P24B 2J1XA 5EOCH 1B0GB 2H1PL 2NY2D 4FRWA 2JELL 3C9NA 1JPSH 2X4OB 2F7IA 4P2OC 1Z5LA 4H1LH 4M6ML 3RIKA 5GS1C 1HXYB 3US9A 4APQD 3IMUA 5KEZA 4R2GD 3LQAL 1HILB 4DN4L 4J3SA 4YDNA 1XQ4A 1ZVSB 2XKNA 5C09A 4E41E 3WLWD 2APTA 5KZCD 4WHTA 4X6DA 1MCCA 4MQSB 3TO4C 1FBIL 4AE0A 3L08A 2X3BA 4MA8H 4L0ZA 4YVUA 2VGLM 4KO9A 1FV1B 4GXVH 5C70A 1U8HB 2UYLB 4M5YL 4DP7X 4WHCA 1LO0L 2LU4A 4DCQA 1S46A 1J9RA 4B5ZA 4UANA 1ZTMA 3UZVA 5GISL 3HN5A 4ZO7A 1UH4A 5I2IA 3SDDB 2ZUQB 4XZ4A 5B1JA 3UTTD 5DRZB 2J71A 1EJOH 5GSVB 5DC4B 2R7EA 2WN3A 2OYMA 3HAEG 5H2BB 3MV7A 2P46B 1SJEA 3RHWF 5E5RB 3FCTA 3P2TA 5TPWH 3U1QA 3A67H 3LIUA 3UBXI 4BHUI 4Q9QL 3WHE1 2M26A 3VYOA 3N40F 2Q7YA 3S5LA 2A0LD 2Q3ZA 3C5ZD 5FGCB 1TJXA 1BEXA 3I2CL 2FT7A 1SBSH 1DBAL 4KKAC 4OZHB 2X12A 1FH5H 4KPHL 4N86A 5DJ6A 1KBPA 3IDYC 4KRLB 3HI1A 3SGKC 1MHHA 2GCYA 3WDIA 2YSTA 3IDXH 3BHBB 1P2CA 2FJHA 3OAYH 2XJKA 4LASL 2LVCA 1RZ7L 1H9VA 1OF2B 5KYXA 5D6CB 4FQXA 1J88A 2H2PC 5DJ2A 3T3ME 1F00I 5LCVA 3KGRA 1LMKA 3MR9A 3TEXA 3VE0A 4XI5D 2YGPA 2Z8VC 2IGFH 4UUJA 1GOHA 1OE1A 1F4XH 2CJTA 4ZYKB 1KTKE 1HVXA 2WINA 1BD2E 4F93B 2WYHA 4JMXA 1QSFA 4ATWA 5E03A 4LPVA 3IFLH 4BXSV 1A1NB 1TVDA 4MNQD 3FUKA 4PJ7B 5IBLD 1JGEB 2XWJA 3L9YA 3LKSA 1CXFA 5HGAA 3VQ1C 2MKWA 1GGBL 3VGEA 2OMWA 3U9WA 1A7RL 2R27A 2G4EA 1R19A 3TBYA 5LAXB 2VLJD 1J1XL 4OZIB 3PUUA 2GBVA 1LXMA 5G5DA 4RDQG 4WENB 1GC1C 5I1HH 3C2SA 3LPWA 4NQSB 4FNLH 4OU3A 1XSJA 1BDYA 1J0KA 1JD7A 1RUAL 4FFZL 3MRRB 1A1OA 4ZDHB 5DWUL 2D7TH 3QCVH 4W9FC 4H88L 2EVFA 4P59L 2DQDL 4JJ5B 1MCPL 2AI0L 4XNUH 5JHLL 3WKPA 2OMYB 4HJJL 3TNNB 4ZX3A 5BQDA 4BFNA 4HUVB 4JFWA 5JYLA 3V4PA 2VXUL 1XCQA 3F7QA 4PJDA 2W9DL 3CK0L 3SQOH 3OF6A 3GB7A 5KYYA 2ZAGA 3LRLA 1IFHL 3SE9H 4LPXA 3LDBB 3BAKA 2DM4A 1NIBA 1DDHA 4G71B 1X4YA 2PW1B 3O3AB 4OD1L 5E8EB 2ALAA 5EZPA 1XGUB 5HYIA 3ARGC 2PYED 3INOA 5C8JA 3F83A 4QXTB 4F2FA 4UDUA 2PR4H 1QTPA 3T5WA 4LQ1A 5TDPB 3B