3TLRA

Crystal structure of the tetrameric beta-2 microglobulin dimc20 mutant
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKCNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title A recurrent D-strand association interface is observed in beta-2 microglobulin oligomers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tlrA00
5FO8B 3SDCD 1NGPL 3RZCC 3HI1A 2YKLL 2FJHA 1NAMA 1DN2A 3RZCA 3GRWA 3KPRE 3VI4F 4JFDB 2QSCL 3BKJH 4HH9A 5I66A 5DMKA 3GSQB 1G7MB 4HHAB 4UV4H 3KPMB 3PL6C 4FQ1H 3QH3B 4NQSA 1E6JL 4HBCH 4HJGB 1ZA6A 3PL6A 1KN2L 4JANB 5I6XC 3OJVC 4NQED 5GGRY 1RHHA 2NW3B 5JR1L 1T20A 4OT1H 2J6EH 4DZBB 5T33H 4WJ5A 1HINL 5FOJA 4GKZB 3BKML 4FXGB 3I2CH 5HDBE 5KW9L 3QUYB 3H3BC 4U6XA 2N4IA 4PRPA 1QLEH 4Z5RB 3EO0A 5IEKA 1EO8H 1K4DB 4UAOB 3ULSA 2GJ6B 3IFPB 5D2LF 2PETA 4J3VA 1P1ZA 1U93B 3KLAA 2XA8H 3QPQD 4PB0H 4HZLB 1OAKL 4LLAA 1U8LA 4TQEL 3UTSD 5DJ0B 2M8XA 4UT7L 1MFNA 2WNGA 1Y18A 3FHAA 4U1IA 3T2NL 4JPKH 5GISL 1L0QA 5I8OH 3QAZC 5GGQL 5FUCE 2NY3C 5IK3A 4XCEB 5IMMA 2P5WE 2AJYH 4IOFD 1S9VB 4UB0H 2ORBL 4R4BB 2OZ4L 4G3YH 2EXWD 3HE7C 4BQBA 4M48L 4LHJB 3IFLL 1UT9A 1N2RB 2UWEA 3HE7A 4GBXC 1QVOA 3UC0L 4OLWL 1CQYA 4DUVA 3PV7A 2ADFH 1RPQA 1KJ3H 2FZ3B 5IVXB 3C09B 4GBXA 3O81A 3QEHA 5EZLA 5HYJE 4BQCA 1KIRB 4MNHA 3GIVA 3ZDZF 2RFXA 3EOTL 4E9LA 2GQHA 4K94H 4BSVA 1SJEA 1CIUA 1FE8L 4U1KB 3QUMA 5FGCB 1EHXA 1NEZA 4M8VA 1WIUA 1VENA 2GW5A 1FH5H 1CVSC 3ZTNL 5BVPL 3EFFB 3TA3C 5LWYH 3TLRA 4JAMB 2OYPA 3W82A 2E6JA 5IMKB 4NZTH 5HYQA 5KSVA 3TA3A 3GMOB 3BO8B 1RZGB 2AP2A 4KJQD 2VDOL 1UWGL 1BD2D 1NC4D 1Q0XH 4DGIH 1YZZA 5ETUB 4HWUA 4Y4HC 4ZPVA 4EEEA 4WI2A 1N59A 5C9JA 5GHWH 4PJ8C 4D0BB 1RV6X 2ATKB 5CLTA 2GJZB 4PJ8A 4UQ3A 1X9QA 3UCRA 3V9FA 3DVGA 1QFWL 3KWWA 4HT1H 3VRLF 5C0NC 1RZIA 2JK5A 2BXYA 1KCVL 1I7ZB 4NKOA 1YEGL 3NVQA 2IGFL 4B41A 3OKDB 4QF1B 3UPAA 3ABZA 2EDWA 1CDIA 3MLRL 4E41A 3KLSA 3I6GB 1YN6B 4YO0B 4CDHA 1S7QA 1MRFH 5AWNL 4LF3B 1OTUD 3ZSTA 1BLNB 5FUZL 2X40A 4CVXB 2ENYA 3FFCA 5IV2B 4E5XB 3KPSD 3X3GH 1B2WL 3SBWC 3ARWA 4ZS6D 3EGSB 4G6AD 5A2JH 5ESQB 3SBWA 5C08D 1IAIL 1S5HA 4KUCD 2DLIA 4M6OH 4Z78A 1J1PH 2ZPKL 3VE0B 3BGAA 5HI5D 5GRJL 1ITBB 1N7ML 4RX4D 5E56A 4KV5F 5FXCH 1A1OB 3WN5A 1UG9A 3H9YA 2DICA 5D8JL 1NBVH 1OF2A 1S7RA 3MRQA 4APQB 4XWGL 3V5HB 1JYNA 3S36H 4IJ3B 3WEXA 4NO3B 2CXGA 4RMQA 1LDSA 4LVNC 2YSSB 4LVHC 2Q3ZA 4OTXH 1FORL 3P9WB 1ZS8A 1QFWM 1WUNT 1YEHH 2VLRE 1ZLVH 4OCLC 3VXUA 4HWZA 3WCYA 4Z77A 4LLVA 3X12A 1W0VB 5IBLD 1JWUA 1SY6A 1NCNA 3QEQA 5J4MA 4A2LA 5JMOC 2XPGB 2NY6B 1OM3H 2HTKD 3C6SA 2AJZA 4PJ7E 2VJXA 4IS6B 5SV4A 3MA9H 4JGMA 3B2VH 3W5NA 3CUPB 5HHVL 5AD0B 3BFOA 1FFRA 5JIIA 3SGEH 2KUTA 3RVWC 3CLEH 5EFIA 1E27A 1CGYA 5EU7E 3FONB 1DUZB 3C5SA 4JDVA 3ARXA 2M1KA 3QHTC 4P4KC 4KFZC 2NXZD 5F7WC 2VH5H 4PJGE 2FEDD 3N85H 1CLYL 3BD3A 1PX4A 4P4KA 4KMQA 4JJ5A 3SJVD 1WAAE 4LLWB 3P73B 5KG9A 4NZRL 4Y19B 3I3EA 4DVRH 1D6VH 1DLHA 3GNMH 43C9B 1HIMH 1Q1JH 3BAEH 1SBSL 5F9OL 4OZGF 1HE7A 1PG7W 3L3OA 3UJTL 1SM3H 4GMTH 4U1JA 1TZHA 4UDUA 3D69B 1HEZA 4L4TA 1FL5B 4RAUB 2DMKA 3MRJB 3VXRB 3BH8A 2KZWA 5EOCH 3MSPA 2PTVA 4JO4L 4PYHA 4NC0B 3VW3L 3HS0A 4Y2OA 3ZHDA 5FGRA 3X13B 3KHQA 1IKFL 1R3IH 3PE9A 2GT9A 1TIUA 3O4LE 5FDWA 5KSAD 2V5YA 3CZJA 4WFGD 1T5WA 5B39A 4XCNA 1I9IH 3MV8E 1FLTX 3AS3A 3VFOA 2CO6B 1CGSL 4UTAH 2YHGA 5TDPB 5KZCD 1E4JA 3MV7D 4Y4KC 1JPGA 4PJHB 2AEPH 3SGEI 2IALA 1UM4L 1SEBB 1KLFA 5C0GA 2UZIL 5FYLH 2DWEA 4Y4KA 1G9MH 4FA8A 3VRIB 4IOIB 4GLRI 3BP5A 4JB9L 4DKEL 3G5YB 2P5EE 4OV5B 4UIMA 3NZHH 3BPCA 2EYRB 4BZYA 4JZNB 5B38A 2PYFA 3HI5L 2R2CA 3QISA 5IB2A 1FVEA 1KTLB 3L3KB 3P4MB 1NMAH 3MLZL 4YX2H 3I6LD 5CBEB 5K9JH 2JB6B 5ANME 5F7NC 4XBGB 2XY2A 2MWCA 3B2UD 3RWDB 3KNBB 4NFDA 4KZDH 4NUJA 2A0LD 5J13C 5F1NB 3X3FH 4RFNC 5TE7H 4BH7B 5C2BH 5E6ID 2CKNA 1KT2B 1U8PA 5T1LD 3ROOB 2R1XA 4NQDE 1DQQB 2APXA 3PGDB 3O2DA 1G6VK 3CIQA 4RISH 1PG7X 4JDTH 4JG1L 5K9QI 2N7AA 1D9KB 1FGNH 4LLDA 3R4DA 3V0WL 2B7DT 1VA9A 4X0KB 5ID1A 1T2JA 3NABL 3D39D 3U4BL 3H0TB 4CN4A 5DUML 3U7WL 1KCLA 3D18A 1OP3H 1W72H 1E28B 1XGQA 2WAHA 4FQCH 4PBXA 4J3SA 2F5AL 3NIGF 4QTIH 4HGKC 2Y36H 1VFOA 4XNXH 1CE1H 1S8DA 4KRPD 4MA3A 4TOYL 5GRZA 5HYFA 3IFNH 1MCLA 4MA1B 3V4UH 3DO7B 2BVOB 2HWZH 3WXWH 3MOBL 1FVDB 1UACL 1YMME 1I7TA 2HN7B 1S7XA 1LNUB 1WJ3A 4CMHC 4IRSB 2IADB 5D70L 4PRHA 3U0TA 4HWBL 5DGQA 4GXUM 4I9WE 3HAEH 32C2B 1FZKA 1S5IH 4TULL 3FCTA 4TVPE 1EEYA 2FIKB 3ARFD 2BRRH 3BVNA 4M62H 1JK8B 4PS4L 1OP5K 2NX5D 4JFQB 3I85A 2KKQA 3FN0H 3VFVA 2NXYD 1NMBH 2ARJB 3UROR 4X6CB 4EI5C 4MD5B 3FO9B 3B9KD 3OAUL 1LGVA 3KPOB 4M5ZH 2EC9U 1MCEA 2NQCA 2WIIA 1A7QH 4H20L 1O7VA 4P2YA 2EE3A 3QA3B 4N9GA 4PRNB 3D2UD 1A7NL 1QRNE 1RZFH 3V4PH 3ZT6A 2VXUL 3QEUA 5I71C 1OWRM 3DRQA 5D7LE 5EOTA 2D3VA 1I1RA 5JXED 1AGEB 1DDHA 1G7HB 3ZE0F 1CFVH 5SX4H 5LXGH 1NGQL 2CJUH 2MPAH 2ZUXA 3TPUB 2GK2A 5BMFL 1IILE 3F6IA 3RWEA 4BK5A 3QQ9C 1BWMA 5KJRH 1CK0H 4DAGH 1PKOA 3RU8H 4N0FA 4OFKA 1AD0A 5IBTH 3QHFH 1TTGA 3SY0B 5ESVA 5C6TH 4GKSB 4JFHD 3I02A 2VXTH 1D5MA 5FKAB 5HD8C 4LCWB 2JKXA 3VFMB 1V3KA 4OUUA 3F7YA 1DUYA 5SWZB 2HFGH 1OOAA 3ARBB 1X5GA 5I8CA 1F2QA 3GSOB 4PJAE 4F33A 4LLYA 4N0CC 3ZYJA 2JIXD 1DBKH 3AMKA 3F5WA 4Y1AA 2FR4A 4P57B 2EEDA 2LVEA 1OAUL 3U30B 2XRAL 5B39G 2YPLE 5J8OA 5DRNB 1F97A 2EKSB 4EZMA 2JJTC 2YPVL 3V52H 3F65A 3MLWH 4LASL 1T22A 4HIHB 1HH6B 3B43A 3S9DB 1JGLH 1Q0YL 4MX7A 5BV7C 3QFJB 5F7FA 5B4MC 1R24A 2QQKH 4PLNC 3SDAB 4M6NL 1ZLUH 1JRHH 1U95B 2Q87A 1NJ9A 1MJ8L 5H94A 5TDOA 5F7DB 5MEND 3DVNB 3G5VB 1MPAL 1U8JB 1RJYB 4FS0A 4M6AA 1BQLH 5SX4I 4JGUA 2CLVA 2Q8BH 3GGWB 3T65A 4YHNA 5EU6E 5DJDB 3C5JB 1ED3A 3KPLB 1WFUA 4JM2F 5KS9A 1PAMA 3VGAB 3L5WB 5JHDD 3DXAB 5F7LB 3Q6GH 4Z0XB 4U1GB 3U9PH 2P8LB 5BRZA 1GGCL 4HKZA 4KRMB 4QGTA 4G8GB 3TFKC 1DBJL 1I1AC 2BNQB 1JUFA 1VADA 4XRCB 1NCUA 3IVKA 5L2KA 5J6HA 4FFWC 3N1PC 1I1AA 3C8DA 4OZFA 3ULUE 1F3DJ 1MHPL 2Y72A 3D6GA 2P8MB 4NZDA 3EUUA 3T8XB 2NY3B 2VL5B 2E8ZA 3PGCB 4EKXA 4JHAL 3VXPA 1Z0NA 2DS4A 1JFQH 3MRDB 5ITFA 3BT2H 1K8IA 2DM3A 3NTCL 1K5NB 4NSKA 4KVNH 5EU3A 2ITDB 1JNJA 5HDLA 4OCYL 3PDOA 1TTFA 5HDQH 4RMSA 3MOAH 5TDNA 4C83B 4R4FH 1EEQA 1XH3A 1J0HA 4NCC1 2FATH 4YUEH 4X6DF 2F74A 1X5FA 2VDQH 3IDXL 3QO1B 2VDML 2IH1B 3O11A 2VUOA 5DD1L 4RA0C 3IDMA 5HTSA 3EJYC 3D48R 3GM0A 4PGEA 3OKKA 4OV6F 1JRHI 1OSZB 3ZTJG 5JHLH 3KJ4C 1OGTA 2EDKA 5DI8A 5FHBH 4NO2A 2P1YA 4EXPX 1G1YA 4MS8C 5I9QB 1Q9KA 4ELMA 2KDGA 2IQ9H 4Y4HB 1MRDH 4BFEA 5DR5L 5GS2H 5I1EH 1X44A 1NCTA 4U6VL 4JLRB 2CKBB 1R5WB 1C5BL 4L3EA 2QBWA 4XVUD 3ZDZE 4OLUL 4FXLA 1VGKB 3L5IA 3RUGF 1GHFH 4NNPL 3BGFC 2PUQT 3QIBD 1KTDB 1BM3L 3TJEH 5DVOA 3QUXB 2R8SL 1U8KB 3G5ZA 4BYHA 3ILPB 4CW1A 5EG6C 1P53A 3PABA 3MTRA 4NO0B 5A2IH 4QRUB 4X6FB 5J9PA 4PRAA 2ATPA 1S3KH 1KV3A 1LP9B 3DOSA 3FT4B 3KYOA 4PUBL 1MFCH 4M7ZC 2IPUK 4Z0BH 1U36A 4ZPTB 2R2HA 2UWEE 5AZEL 4ZOBA 4HIIA 4GFTB 3G04A 1UJ3B 4PTUB 4M8QA 4U3CA 1LQSR 4YDJB 1BBDL 4XBPA 5ADOH 3LKSB 1ZT1A 1ND0B 1KPRB 3VRLE 3W39B 1YNLL 4KTEH 3LZFL 3LMJH 5CSZA 4K3DH 5A2LH 5A43C 2RCSH 4KI5D 1KIQB 4RZCB 2O5ZH 5EWIL 4C56D 2K3TA 4OF5A 2K7PA 3CH1A 4NFBA 3P9MA 2YBRA 3U46A 35C8H 1KLGA 3FT3B 4KXZH 2GSGA 1FYTB 3EJZC 4LVHB 3QDMB 4JRYD 3E6HB 4FP8L 2V9TA 4OD2A 1JNHB 3WE6B 4WGWB 1C7SA 4DOHE 3RWFA 2W0PA 1AGCA 1TETL 1EBAA 2X4QA 2OTWB 5IM7B 5MP6L 3W0WA 2ADJA 1QFUH 3C9NB 2GI7A 2QHRH 4X6EA 1ZT4B 4P5TC 4Z7UF 5EORH 5DWUH 1OPGH 4HS6B 1FO0A 1NL0H 3E8UH 5GGSY 1CFTA 1UM6L 2R0ZL 4P5TA 3FMGL 4XCFL 5K9KA 4YIQA 5F7EL 4IDJH 3TO4D 5I2IB 3UTTA 2E7HA 2NY5H 1MI5B 5I8KL 3WHE0 1R5IA 4HJJH 4RMTA 1GZPB 1GGUA 5T1KB 3WNMA 4MDIB 4UINH 4JY6B 2X4OA 3P77A 1LO4L 5LGHH 3HNTH 3UTQA 2FJFA 5IBUB 4I4WB 2CIIA 3P30H 5DVMA 4OZFG 1KEGL 2O93L 4S2SB 2R29L 5D1QB 3STZA 3DGGA 2DLGA 5AYQA 1CICD 4TVPL 2CQVA 3GSNA 5K9QG 2CUHA 2DQFB 4JFZH 5ESAA 4KXZI 1GAFH 1KPUB 2CDFB 2QJDA 2R0WH 3I9GH 1KJVB 1PZ5A 3RAJH 4WO4D 2J2ZA 2W0KA 4OKVA 5FA3A 3VXQA 1F4XL 1AY1L 1CD0A 3Q6FA 4IHOA 3RDTD 1IGCL 5JO5B 3CC5A 4PPTA 3NPZB 3MLUL 4JZOA 4QO1A 1FFPA 1FVCB 5IOPA 4YNYB 3VXUE 3B9VA 3TNMB 3H9SE 3T2OA 3QEQE 3DYPA 3IFOB 2ZUSA 2QQLH 3MX0A 4EOWL 3MJ6A 2Z93A 3D3VB 5DT1L 2ICCA 3U1SL 3GEWB 2HG5A 4OFYD 4QLRA 3P4OB 4OZGE 1LK2B 4MD4A 1F58H 2F53D 2HFEA 1ADQH 5DRWB 5JOFB 5KSBF 2XICA 1BVLA 4F37K 4NQXA 4JDZB 3DURA 4YFLI 1A4KA 1E6OL 3BP4A 3V0VB 2NY4D 4JO2L 4LLUA 3CCHA 4R90L 1HHGA 5DHVH 5EO9B 1CXEA 1NGZA 4WHYG 3FOLA 3MNWA 3VFWA 4UNTA 1A3RL 2X4RB 5C09E 3QIUC 5BZDA 3U36A 5IMOB 5L88H 1QTYT 1VPOL 4PD4J 4YHZL 5I1HL 4KROC 4EDWL 1FL6A 3TYGH 3QIUA 3SGKC 4AM0A 5HI3C 3W2DH 3MRLB 4L4VB 5J11B 4X98B 3SGKA 1IAOB 3F8UB 5E08L 3RWIA 3QI9B 1DBAL 1NANH 1UH4A 3B5HA 3WV0A 1F5WA 1LWRA 4LDLB 5BJTB 4OD3L 2WUBL 3VD4A 1JPFA 1Z9MA 2ZCLH 3QG7L 5F72S 4CBPA 1QLRB 3I6KB 4K7PL 4HS8H 3QBTB 2FX8L 1UXWB 3GM8A 2WP3O 1BQHG 1R0AL 4JM4L 2VDPL 1YMHB 2R1WB 1P7QA 3I50H 2XZCL 4X7EC 3A6CL 4RAVA 3ESVF 5MEOB 1IC5L 2G9HA 4NKMA 1YJDL 2P24B 1A7OL 2AJVH 3ROLA 1AGFA 5D7SH 3ZHKA 1S7WA 3PQYA 3HAEG 4FQXB 4NQCD 4ORZC 1G7QA 4JFED 5C6PB 2DQTL 5C0RH 2HJKA 5D7JB 3AS1A 3PDDA 4U2YA 3VXMA 3PV6A 2YS4A 5FYJD 4N90E 3H9HB 1IFHL 3G6JF 4F8QA 4NYLA 3MRMB 2JF1A 1MELA 3BDYH 3QDGD 4KKLD 1DJSA 2OSLB 4RDQF 4HWEL 4QRSA 4H1LB 2G60L 2OR9L 3EOBA 4CJ1A 3GRWL 2YPKB 4X9IA 3MBED 4MNQE 3SO3B 4EI5B 5C0AB 3FT2B 4JPIA 2ADIB 2OJZL 4LQFH 4EUPH 2QLVB 5IFJB 5HVHC 5CIPH 1NANI 3TEUA 4QRPB 3IXTA 4H26B 5DEGB 4GW4A 4NDMB 1JGEB 3LEYL 4WW2B 2Z4QA 1G6RH 3H7LA 3LIZH 3QRGL 1GXEA 4ODWA 5HVWA 4M61A 1INDH 4QXWA 3LSOA 1YEKL 4NRXA 4L9LC 4YBHA 4D9QE 1UCTA 1UEYA 4MJIB 2NY1C 4YFDB 4L9LA 4FMKA 2JCCB 2Z91A 3IKCA 4LGPB 4XPAH 4CUCA 5CD5D 3EYOA 2LVCA 2HT2D 2Q6WA 1OP5H 1GC1C 4P2QD 4RFOL 4WWKD 5HHMD 3T0ED 4GKNB 4PP2A 3GJFK 3RHWK 4LVOB 2R4RH 4YDVA 3U79A 3IDJA 1RAMA 3U6RB 4TNWK 2VRAA 3P3YA 3WUWB 3MLVL 3L7EA 3ZE0E 3CVHA 4J3XA 3V4VH 1J8HA 1I3UA 5J1TC 1WEJH 2FWOA 4KK5D 3STLA 2A9NH 5DJ2B 3RY4A 2YD2A 3DUUB 5D1ZC 5DK2A 4PV8B 1I8KA 8FABA 2BVEA 1Q9OA 2FYYB 3VG0L 3VGFA 1AGDA 1CDBA 5D1ZA 3AS2A 4ZNEA 4ZXBB 2VDRL 3C60D 1NBZA 1XEDA 5D6CB 2X4UB 4HEME 4UNVA 2OTUB 5HHQA 4YQXH 1YYML 4YE4L 2VLLB 1KJ2H 1P2CA 3QWOB 5CZVH 4AL8H 2FSEA 2FX9H 2YD4A 5F88B 3O3EB 4G6ML 4YWGL 4JFDD 1FNAA 1QRKA 4P59H 1X6NA 2H26B 4FFZH 2J7LA 2A73A 4PJEF 4NQVA 1E4XL 3QUML 3JBG7 1AR2A 3VD3A 4JO1H 4KK8D 1ZVYA 5T1DH 2VAAB 3MCLH 1OT1A 3TZVB 1OD9A 4JHZA 1IZKA 5DYOB 3CSBA 1DSFL 2NNAA 3UJJL 1BZ7A 1Z5LA 3T0WA 5D1XC 4KY1L 1LHZA 3HUJB 2R9HD 2RQ8A 3KLDA 3QUYD 4D0CB 5D1XA 1OGAA 5EC2A 1MWAA 1F90L 1QHPA 1RUMH 4DN4L 1FNGA 4MJ6B 4LP5A 2GJ6D 4YFLF 1QYGL 4Y1AE 1IGJB 4OCSL 2Q7YA 5D7IA 5F1IA 1UZ8A 3ZDXE 4MQXC 4R0LB 1J1XL 4LCYA 5CJOL 1IC1A 4F3FA 4KJYA 1N6QL 4XMKH 4WDIA 5L9DH 4GRWH 1DANU 3MFFB 3NGBC 5KVEL 1FZOA 4LNRB 2JJSC 4NNXA 4ZO9A 4M7JH 4XNMA 4AZ8A 1BREA 4LL9A 3L6FA 2JJSA 3BMWA 4G6KH 4FRWA 1T7YA 1MAML 6FABL 1TJGH 2AEIT 5C0JA 5E9DA 2AJUH 1X4YA 2P7TB 3OKOB 1LILA 2AV7B 4K7FA 3ARTA 4PFEA 4Z76B 5KAQG 3BPOC 2P43B 3VFTA 3ELAT 3CZFB 1SVCP 1JHKH 4AEFA 3ES6B 5E8DL 5E8NB 1WBYB 4X6DE 2BRQA 1AXTL 1T7XA 3KDMA 4K9EH 4NJAH 5HGAA 1NCCH 3K4ZA 3QQ3B 4MCZB 1S7SB 2VXSL 4UNUA 3TBTB 1NCAL 3FQTA 2GCYA 2JB5L 3O3BB 1YEJH 3MR9B 3R06B 3CFIC 2DM4A 1BPVA 4OM1H 2EYTA 4TUJB 4YEFA 1X4XA 1T89C 4GAJH 4OZHF 1SY6L 1CLZL 2HMIC 4MCYB 5A1AA 4ZUWB 1T89A 4L8CA 3JV4B 2AJSL 2BSTA 1RURH 1JPSL 3SDCC 5HHOE 4I77L 3UO1H 4OLXH 4PLJD 1EHLH 3T3PF 3SDCA 1CFSA 4K8RH 1B0GB 4K7PY 3S4SA 3TBYA 1CDJA 2J88L 1OLZA 3BYTA 4UTBL 3RUGE 1H8NA 1T7WA 1KCRH 5GRVK 5CZXD 4FQLL 3X14A 4NT6B 1F11A 4XB8A 5E2UL 1JN6B 1R3JA 5B8CC 4LRNH 1H3UA 5EIIB 3PWVA 3ZL4L 1YNKH 5DRXA 2VLRB 4AT6A 5DTFB 5B8CA 5KN5B 4PRBA 1K6QH 5CJBA 4HQQH 4NQEA 3DROB 2AXGB 3VFUB 1QBLL 4OGAD 5F7HA 4ELME 5TQ0H 5EO0A 4BZ1L 1WFTA 3U2SB 4X4YB 4UOW1 1NSNH 2HAZA 3L3IB 2VR9A 3MRKB 4HAGA 5C71A 4HFWB 1SHMA 2OLDA 5ITBL 3MGOA 4IRJC 4N8PA 3OKNB 4JY5H 4O02L 1UWEH 3QPQC 4M93C 4WNQB 5IW6A 3RVTC 4KKAD 4APQD 2FGZA 5DRZA 3EZJB 1C5CL 5MEPB 4J8RA 1FJ1A 1H8SA 4ZD3L 2XTJE 2UUDK 2H6PA 2WINB 3UTSA 5EBMB 2Q76B 1D5IL 5J1SC 4GG8B 3H9ZA 1IQWL 1ZA3B 5BW7C 1F13A 2C7UB 4F7PA 3MNVB 4F57H 1MNUL 4IOFC 5FYKE 5BW7A 2EXWC 3HR5A 4QRTA 2NY6D 1HSBB 4MMXC 2ICWI 4YXKH 3ZHLA 4XNZC 3I75A 2XKNA 3CX5K 4UT6L 3FB8A 1C5DA 5E2VH 5D2NA 1A6ZA 4Z7UE 1HKFA 5FAAA 1EEZB 1N3NA 3L7FB 3THML 4QXGL 1YC7A 1DQDH 4RMVA 4G8FA 1A9BB 4GQ9H 1A6AA 2BSSA 1WGOA 1YEEH 4ZUUB 5ICXB 1W0YT 3WSQL 4HGWA 1NLDH 3VD5A 5DK0A 4U4BA 3CLFH 3V6BR 1QQDB 4OUOA 3O4LB 5E6YA 5IUSA 1BFOA 2HVKB 3L5HA 3QCTH 4ZFOA 1R3KB 4LLMA 3R1GL 1AFVL 2LFGA 1A14L 1OB1A 3GBML 5HGDB 3D9AH 2Q8AH 4KJQC 4WCYL 5ICZA 4RFEA 4XWOD 1W0WA 4KKNA 4Y19D 4F58H 4TYUA 3TCLA 4EJ1C 3W0WE 1BD2A 1NC4A 3EYSH 4BKLB 3O2DL 4YHPB 1YDPA 4KTYA 4OM0L 1P4IL 4IIQC 3LQAC 2P5EB 5C07E 2E9IA 3VXRD 4HUUB 1WLHA 2YD9A 5IVZA 1KLUA 2BVTA 5T3ZL 4GAFB 5HY9A 4UIKL 3SKUD 4G7YH 5HJ3A 4MAYB 2VXVL 4JFYB 4P9HH 1I7RB 5DDHA 1FAIH 2XNAA 4GXVL 4K71B 4FQHA 3O2WL 1CZ8H 4QRQB 5TE6H 1EO7A 1TQBB 2VZTA 4G5ZL 1WIOA 3PWPE 3ECBA 4ZS6C 4L8BA 5AAMA 4K07A 3WDHA 2V2TA 3WD5L 3KPSA 1FDLH 1IVLA 2D7OA 3SDXA 1D6EB 4I2XA 1PG7L 1DE4B 3S34H 2PCPB 5I17B 4GG6A 5C08A 5HI5C 1PEZA 4LEXH 5KSBE 3SGJA 1HYRC 1I1YA 3HHRB 4I0PB 3WFEL 3CFJB 4P3DB 4RX4A 4GSDH 2HVJA 1XR8A 4O2FA 3MUGB 1UB6B 4XI5D 3WFCL 4Q9RL 1PDKA 4HX1A 1WFOA 4LFHG 5F93C 4F15B 2EDYA 3FO2A 4PJDA 5DJ8A 1JF1B 4QXTA 1KIPB 3MLSL 3PP3K 1HKLL 3DO3A 5SV3A 3V6OC 4ZUSA 5K59F 1N64L 1NCWH 4XNYH 5JOPE 4XMLL 4U3HA 1T4KB 4W81A 3V6OA 1RJLB 3QNYB 1YQVL 1XZ0A 4RGNE 5IBLC 2ZG1A 3RWJA 5IEHA 2H32B 4M43H 2HTKC 5EBLA 3KLHD 4HIEB 5CEYB 4W6XB 3MRBB 1RMFL 3QXWA 2MSPA 1D9KD 2HA1A 3QQ4A 5HDOA 5FV2A 2BNRE 2W65B 1GGIL 1B4RA 4B5EA 5EZIL 4MD0A 5C3LD 5I19L 4M1DH 3LS4H 2I5YL 4UT9L 5EUOE 3K46A 3QWRD 3DSNA 5F96L 5H37G 5E4EC 1WBZA 2R69H 3OMZA 5I0DA 2NXZC 2PTTB 4WIQA 4EBQL 1FNFA 2I9TB 4NBXB 1P84J 4LSVH 2FEDC 2IFGA 4GRWF 1HWHB 3S96B 3BH9A 4NRZB 5E8EA 1DZBA 1M05A 3WFHA 5DJCB 1X5XA 3SJVA 4PGCA 2IPTH 2ZWLT 4OGYH 5D7LB 3F12A 3NCJH 4J3UA 5CJQL 1XR9B 2YXFA 1QUNA 4IRSD 3DUSA 5CINH 4Y5YB 3UDWC 2DD8H 1WBXA 3SHSA 5JXAL 4TRPH 1J0KA 2SEBA 4Z7VE 5LBSH 1YEFL 1A6UL 1M7DB 3UDWA 4K94C 1XAUA 1J0IA 3O45A 3K2MC 1O7SA 3RX8A 3VG9C 1GCFA 2PW2B 1PLGH 3NPSC 4YPGB 1U8QA 3QJFA 3TO2A 1BFSA 3TIDA 3G6JE 3VCLB 1ZHKB 5EA0H 3WDIA 3HPLA 1EMTH 3NFPB 2WMPA 3OKEB 4I0CC 4JPWL 5BV7L 4WI5A 4NN5B 5KSAC 1RQ5A 3JWDC 3PWUA 1MUJA 4ONHB 1NGPH 3RI5K 2YKLH 3U48A 1MCOL 3C2AL 5KSAA 4PJAB 1MJUL 1DQMH 2BY3A 1P9MC 4QT5A 2AK1H 3QULA 1HN1A 3RVVD 3O6ML 4J12A 5C0BE 1P9MA 5I1IL 3GUTB 5CGYD 4MJ5B 3MV7A 3HG1B 3TNNB 3OKLB 5C0CE 2H8PA 4MQSB 5H2BA 4Y5XA 1E6JH 4MXVF 3VXME 2Y07L 2ZCHL 3DJ9A 2Z8SA 4PJHF 3ZSSA 3NA4A 1KN2H 1N26A 4ODVH 5GGRA 1K85A 2YUWA 4EIZC 2AKRB 5KVFL 3FB7B 5JR1H 3OAZK 1CFBA 3GKWL 3GI9H 1OL0A 1IGIL 1ZGLP 3B2UC 1UM5H 5SWQB 1HINH 4U1NB 3BKMH 5IQ9B 4HUKB 4AEHL 4H25B 5KW9H 4EDXB 5FHAH 2W0LA 4LCWD 2RB8A 4LKXA 5SWZD 2XWTB 1T2XA 1CYGA 5E6IC 3ARBD 2NW2A 3E6FB 3ZDYF 4XPGH 4ZNCD 4JFFB 3CX2A 4UUJB 1FZJA 2BK8A 2ICEA 1U92A 1OAKH 5IHUL 4XP9L 4Y89A 5T1LA 5JQ6L 1H3XA 2EDRA 4TQEH 2CRYA 4MAUL 2X4SA 2FO1A 4UT7H 4XXDA 2WM0A 2QKIB 1EFQA 4MDJA 1LEIA 3GJFH 4TUKL 5H8DA 3FRUA 4ORGB 5E00A 4KWUA 3WIIL 5IT2L 2VZ1A 5GGQH 1G9NC 4F7EB 4FG6D 5D72L 1IGFL 3D39A 4UILL 2DQUL 4HFUL 4JFOB 1P4BL 2A6IA 4KUZL 5HHXH 2ORBH 3QFJD 4Z95L 2OZ4H 5BO1L 1NGWA 4Z7NE 5CD3A 1SBBA 3SDAD 1A1NB 3LB6C 4GRLB 4M48H 3IFLH 4JM2C 1YPZA 3KYNA 1CXHA 4KRPC 1P5VA 5D2LB 2GY5A 3ARDB 5IB3A 4OD1L 1SQ2N 4PGZA 4Y2DA 1T04A 1NKRA 1U8NA 2ZP0T 4R26L 4PJEE 3TWCL 3EOTH 3GI8L 2J8UF 2ENSA 4RAHA 3DXAD 1FE8H 3BXNA 3DRTA 5E5MA 1N8ZA 4G8GD 5GIRA 2BNQD 3ZTNH 5BVPH 1S7UA 3ARFC 1CU4L 1L7IL 5KANI 4TSAL 2X41A 2HP4A 1KBGH 3VXOA 1VGEL 3UEZA 3ARFA 8CGTA 3NGBB 2ZUTA 3IU3B 2VWEE 3WFBL 1U8OB 2NXYC 5MEQA 1RUKL 2VDLL 2A74A 2NX5A 2CRMA 2AV1A 3MJ9A 1CXKA 1EA9C 5MHSD 2NY3D 4JFXB 2VIRB 3B9KC 1BEYH 4QHNB 2VITA 3QDJE 4HKXA 5I1JL 3ZKQD 3B9KA 2I9LA 4CADA 1KB5A 1OLLA 2CGRL 2OP4H 3J8F7 4DKFH 1QFWH 3KVQA 1ZKAA 3BZ4B 3CSYA 3D2UA 5IIEB 2CO7B 1FBIL 1W8NA 1Z9OA 1YEGH 3E3QE 3GSRA 5JXEA 3V79C 3MLRH 3L3DB 3WXVH 3E2HC 5BQ7A 4KDVA 1HXMA 3W9EB 1HI6A 5AWNH 1UKSA 4YHOL 5FUZH 1HHIA 1J1OL 5A2KH 1YEIL 1ACYL 4ZS7L 4F80A 5HYSG 1XF3A 4I48B 1MJJB 3G9AB 5LQBH 1MFDL 5ICYA 1U91B 4WEUD 5D71L 1ACZA 3PIQB 2VISA 2ZPKH 4Y4HD 3H7BB 1N7MH 3IYLW 1UH2A 1QP1A 1PEWA 3HC3H 4G6FB 1G9MC 1FO0L 1KG0A 4XPHL 3DYOA 1UXSA 5D8JH 4D3CL 2VLJB 3DBXB 4XWGH 4LEOB 2JIXA 3HMXA 5DGRA 4A6YB 4AH2A 1JHLL 3GMLB 3LRHA 5C92A 3QUXD 5D93B 1KYOJ 4XAWL 3WFDL 1CE6A 5AAWA 1FORH 2VLME 3UBXA 4FQJL 4UU9A 4BH8B 3TBSB 2GITA 4NO0D 1ZHBA 3TYFA 1JGDA 3K2UL 4OZHE 2XZAH 3ULVD 4PGDA 3VXTA 5AUMB 2YD3A 1Q9WA 4MQ7B 2Y23A 5LCVL 1QFWI 2C1PB 3T04D 5IB5A 4HK3N 4G7VL 2OL3A 4PJCF 2IPUG 4AY0A 5I76B 1FCGA 3OF6D 1CTOA 3K7UA 5MENA 3L9RB 5B3JE 3GSNL 2ZSVB 3BRDA 4AIOA 2EE9A 4IRJB 1HOCA 2FHFA 3GSWA 2AEWA 4H0HB 2ICES 1LEGB 3CDGB 3MUHL 3EDEA 2J8HA 5JHDA 2YEZB 4KRNA 4QRRE 1PYWB 3QO0B 1NFDA 3GDBA 3CMOL 4QHKJ 1GRWA 1FYTD 1WITA 4NOBA 3QDMD 3KPNA 3SPVB 2O61A 3EOAB 5TGBB 4PRIE 4HG4K 2C1OA 4N0UE 1A2YA 3BQUB 5F7YC 3W11D 4XP4H 1G7LB 1SBSH 1HHKA 5I8EB 4OCRH 5F9OH 3T4YA 3UJTH 1IBGL 4HWNA 5DUBB 2X1OA 2WQRA 4MGXA 4NKDA 1FZMB 3T08A 3VW3H 4Y7MA 1CXLA 2UYLB 4PJBF 5LAXA 2DI7A 5FO9A 1IKFH 1T1XB 1BVKA 4JE4B 2IG2L 1DR9A 1OSPL 3EYUL 4WI9A 3H9SB 5BXFA 1MI5D 4NWUL 1RFDL 4PGBB 1QLFA 1ERNA 3O6LL 4G9DB 5T1KD 2UUDH 4Q6YA 1BBJB 2HKFL 2WK2A 4OZGB 1UM4H 3BWAB 4BK4A 2UZIH 2Y5TA 1FG2B 5EBWB 4NC1E 2BMKA 1LMKA 5D1QD 5D5MF 5GJTH 4XVUC 1I8LC 3CFEB 2R2BB 1MCWW 3IJHA 4IIQB 4R3SB 1I8LA 3ZO0A 4U6HA 2L7UA 3MLZH 3QIBC 4YK4B 5ACZA 2PN5A 2LU4A 3QIBA 2EH7L 4OF8A 3BIKA 3U7AA 2E7MA 4LCCC 3IJSB 2LU7A 1VDGA 3CFBA 1VEMA 4CMMA 5L0QB 3WS6A 2UY7A 4LCCA 5C09B 3P2TA 1VACA 4RIRB 3HMWL 3D3VD 3FQWA 4ODTL 4XVTL 3EO9L 4MVBD 5D2NE 2R23A 4GW1A 4QGYA 2HRPL 4JG1H 5DSCA 5JZ7D 3V0WH 3ZT5A 5DFVC 2VQ1B 3NABH 5DUMH 1TJHH 3U7WH 4KI5C 5H35A 1WCBB 2CDEA 4YHYC 3JV5A 1UQSB 3RX7A 4C56A 4P5MB 2C26A 3GBNH 5CEXB 1OAZL 4YAQA 4XP5H 4NNYA 1PKQB 4M5YL 3RHWF 1TPXB 4TOYH 1BX2B 1TVBB 5FV1L 4YZFE 3EHBD 4TNWF 4JRYA 4N0RA 2EEBA 5DXWA 5LKNA 2PO6B 3UBXG 1MCWM 5JA8B 3V6FA 1UACH 3UAJD 4ONOA 3JTSA 4PTTB 3FJTA 2O5XL 3HZVB 4L4VD 4NQTA 3ZMRA 5D70H 2QL1A 3LRSA 1WV7T 3RTQB 4TULH 4GS7C 3MRFA 3QI9D 1NDMA 4PS4H 5E99L 3DX6B 3BP6B 2XN9B 3QFDA 4X80H 4U49A 5T3XE 3IF1B 2D31A 3MLYL 4NUGL 3TO4C 4OZIF 3GMNA 4C55A 3BEVB 5GRWA 3LN4B 3OAUH 3W9DB 1U8HA 3KYMA 5I75C 5K59E 3MYJB 3TO4A 4H20H 5KSUA 3KPSE 4MNQB 3WS3B 3S3SA 1GC1L 1KFAL 3S5LA 3UYRL 1A7NH 4FQQB 4GG6E 1CGXA 5C08E 5J7CC 2VXUH 3JV6A 1NDGB 2E9WA 1AQDB 3NA9L 5C8JA 1G0DA 4PG9B 2EH8L 5F9JB 3PP3H 1S7TA 3TH3T 3CVHL 4V1DE 2J4WL 1NGYB 5F7MC 1RIHL 3EYVA 4FQXD 3HZYB 5IKCB 4L8DA 2X9XA 1NGQH 1KPVA 4OI8A 4I18B 4X7TB 3LV3B 5BMFH 2CMRL 5D7JD 1CICA 1S7VB 1AP2A 4QYOB 3X11B 4U1HB 4WO4C 1MFAH 1OQXA 4X7SL 2OR7A 4PJ9C 5C0IB 4GRWE 3BDXA 3RDTC 4WO4A 1B0RA 5I18H 4C54A 4OF6A 5EU4A 5TPWL 3RDTA 2BCKB 4EI5D 5C0AD 3BN9D 5D7KD 5INCA 1YN7B 2FGWH 1OAUH 2CUMA 2XRAH 4PJ5E 4PJFF 2BC4B 4PJIF 4QRPD 3Q5OA 4U1SB 3PHQB 4OFYA 5E8OB 3SE8L 5DJXB 3BZEB 1IM3B 2F53A 2JJVA 4ZFFA 4X5LA 1K2DB 2JJWA 3KG5A 5DEFA 1MLBA 1ZLWK 5DC0A 4P23B 4LASH 5FA4A 3MRCA 3RBSA 3PHOA 1XIWB 2X1WL 1RK1B 3DX9B 1CL7L 5JPMB 4NKQB 4KJWD 3WLBB 1Q0YH 2NY4C 4N8VA 3WLWD 2ZNWA 5TJWK 4IMLA 1CGVA 3FQUB 4MJID 4ZTOL 3SE9L 5IGXH 3WIFA 1JZ5A 1MWAL 1S9XA 4CGTA 1QZ1A 4WHTA 2B8OT 1MJ8H 3LDBC 3NFNB 1MPAH 3MUJA 4BSJA 1R3LB 1S9YB 4LBEB 2Z0BA 4U0RC 3G5XA 5GRYA 3QR2A 5ILTL 3QZWA 2F8OA 3BRGC 4N0CD 4TUOA 3MLPA 4N9OB 1VESA 4XC1L 1GGTA 1CIDA 4MXVE 4NIKB 1GGCH 4X4XB 4JQVC 5E8PB 1DBJH 1MH5A 5ERWA 4YDKH 1DFBH 4E42A 2QR0A 4NM4H 2VABA 3KPPB 1D5ZB 1MY5A 4ZXBD 1NQBA 1HQRB 1DQJA 3DVIA 4LVEA 1I3GH 1NCDL 1A6WL 5ALBL 4N0YH 5EIQA 3JUYA 1I7UB 3VGHA 1Z3GL 4WFGE 3BW9A 3NTCH 3RIFK 4OCYH 3G08A 3OAZH 3FO1A 4NOFA 3MJ8B 3NCEB 3SOBL 2Y9RT 4JM2B 1NBYA 1C16B 1QSVA 1XGRB 4D94A 3BZFA 1PW3A 2QTEA 3B8SA 2IPKA 2DTML 3MRHA 2DL9A 4WU5A 3DV4B 1EERB 2VDMH 3AFLA 3T1FB 4NQCA 5DD1H 3QIWB 1P4LB 1AGBA 4JFEA 1AD9A 3TZVD 4XHJD 1L7TH 1BJ1H 1FNLA 1IAKA 2J3SA 3I6LE 3BUYA 5FUOL 4CDGC 2DQGL 3NN8A 4GAGL 1WZMA 1I9EA 4UOJA 1KXVC 4WEBL 2ADGA 3PGFL 1XF2A 4KKLC 2GFBB 4BQ8A 3PNWA 5J6GB 1UVQA 3VFSB 3MJ7A 3QDGA 4K3HA 2A83B 3QXDA 5DR5H 4ALAH 4U6VH 3HCVA 3MBEC 2HLAB 1C5BH 1ONQB 3MO1B 4GUPB 1SEQH 3MBEA 4OLUH 3J7HA 4NO5B 4X6DB 2R0KL 1EFXB 4NNPH 4IRZL 2FDBP 2HH0H 1BM3H 4QTHA 1AHWB 2D4DA 2W9DL 2R8SH 2X2YA 4G6JL 2BSRB 3RL2A 5FKPB 3VFRA 4N1EA 4AMKL 1AQKL 1YEDA 3AB0C 4UOW0 3KPQA 3OX8A 3WO4C 3PG2A 2X4TB 1MLCB 4G42B 2DWDA 4XVJH 4PUBH 2ERJB 4QY8A 2CLZA 1YPZE 1JJUA 5EUKA 3HB3D 3KXFE 5EU5B 3VH8G 5CD5C 5HHOB 4Y16B 5HGHA 5DMGD 1KJMA 3EYFA 5AG8A 2V7HA 3REVA 3T0EC 4I3SH 2E8YA 4PV9B 1ITCA 1B9ZA 4QHMA 1RIUH 3DX8B 4P2QA 4WWKA 3T0EA 1YNLH 1KELL 3LZFH 3RUGB 1VB9A 1XF4A 1H15B 1MEXH 1WCQA 3NFSH 1UENA 2I60L 4HUNB 1RZKC 5IW1A 5EWIH 4KK5C 2X7LA 1G7IB 4YGVB 4RRPG 1IQDB 1T0MB 3IB4A 4AYFA 4X9BA 3CJJA 1NLBL 2NX5E 2VR4A 4HWBA 1I9JL 4FP8H 3FB5A 3D25A 5B3NA 3C60C 5C7XH 2ZOKA 5F89A 5DHVA 1TETH 2DQIL 2DDQL 5JDSB 1IM9B 3C60A 4NJ9L 4YHIA 3VDBA 2X70A 5IG7B 1TCRA 5E7FA 1OP9A 2V2XB 5FO8A 4WW1B 5TH2B 3WIHH 2COQA 5CCKL 4R2GB 4HUWB 2EE6A 1UM6H 2R0ZH 5AYUH 4JFDA 1OAQL 3FMGH 4ZFZB 2XTJB 1FFNB 1A47A 3H8NA 4GKOA 5DUPL 3D87B 4KK8C 3GSQA 1G7MA 4HHAA 1ETZB 5F7EH 4ZFOL 1RK0B 3KPMA 2LU3A 5ID0B 3QH3A 1YC8A 3QZWG 2VLKE 2VERN 4HJGA 4PBVC 2VLRD 4JANA 3VXSB 1C1EL 4FABL 5I8KH 2NW3A 1LDPL 3TV3L 4FTVB 1W72B 3F62A 4CVWA 4DZBA 1KB9K 1JBJA 2GTWB 3HI6L 2ZG2A 3WNKA 2FBOJ 4GKZA 2YC1B 1T21B 4FXGA 4M7LT 3TIEB 3QUYA 2X5PA 4UAOC 4Z7UB 2C4FU 4Z5RA 2R29H 1FV1A 1KC5L 1K4DA 5J56B 3LQAL 2GJ6A 1BQHB 4JVUA 3IFPA 4TVPH 4U05A 1UZ6F 1U93A 3LEVL 4TSCL 4HZLA 1JNNL 4OZ4B 5DMJB 5DJ0A 1IAMA 3HAEB 1F4XH 1TXKA 1AY1H 5JW3L 4MXWH 4LKCB 3QUKB 1PSKL 1U2HA 2W9EL 1HQ4B 5FF6B 1MJ7H 5TF0A 4CU7A 4EOWH 2V17L 3BZDA 1TNNA 4XCEA 1HWGB 1PJ9A 4JCMA 1NCBL 3RPIB 5JW4N 5EOCJ 4YBLB 5C07B 1AC6A 1GSMA 5MENE 4G9FB 5DS8B 2ESVE 3LKNB 2CSPA 1N2RA 2FHCA 3C09C 4OF7A 3GMRB 1MCSA 2FZ3A 5IVXA 1YY9D 2DBJA 5JTWA 1E6OH 4LRIC 4FQ1L 1KIRA 5JHDE 4PJBE 2FRGP 4P9ML 4MNGE 1JMZA 4L29B 2AJXL 4K23L 4LRIA 3O4LD 4U1KA 4R90H 3S35X 4R8WH 4LLQB 1VHPA 1JHTB 4RWYH 1Q38A 3EFFA 4YBQD 4JAMA 3PWPB 4H5SB 3RKPA 5GGTA 5IMKA 3AS0A 1N4XL 1A3RH 1JTPA 2X6MA 3GMOA 3BO8A 1RZGA 1VPOH 4YHZH 5I1HH 4XP1L 4EDWH 5ETUA 2G5RA 2UV3A 5KSBB 1I8MB 1F00I 2X4NB 4PLJC 1U8MB 3FFDB 2P5ED 2XA8L 4D0BA 5D5ME 4NGHH 5E08H 4WWID 2ATKA 1Y6NR 2GJZA 1DBAH 4Q74A 4ZO6A 4D9LL 3UTPE 3CXHK 2VNCA 5CZXC 1I7ZA 1I3RB 2Q7NA 4LSSH 3B5GA 2WUBH 3OKDA 4MAYD 2HT4D 4QF1A 2HFFB 4OCNC 5ISZB 3QG7H 3RI5F 2OK0L 3I6GA 1YN6A 4YO0A 2FX8H 5FM5O 1RJZB 5DA0B 4TN9A 4YGAB 4LF3A 4UB0L 1BLNA 4RGNB 4CVXA 1T2QL 5IV2A 2VDPH 4Q6IB 4E5XA 4K3JH 4OGAC 4KQ3L 1PX3A 2PW1B 3EGSA 1IC5H 4ELKB 1YJDH 2GAZB 1A7OH 3NCCB 5ESQA 1EHAA 2BY2A 5F6IB 2BNRB 4I0PD 3VE0A 5HI3D 2DQTH 4PJ7F 1A1OA 4KKAC 3RVXD 4JR9L 2A38A 4IJ3C 5EUOB 4OGZA 4GS7B 4APQA 3V5HA 3P40A 5F9WB 3ULUH 5LWYL 1RZJC 5FOBB 4NO3A 3F58H 2WWKT 3VXNB 4OFPA 2YSSA 1QA9B 4HWEH 1YNTB 1NAMH 2OR9H 3JWDL 3D0VB 1YECL 4ZODA 4WTZG 4XZUB 3AXLB 5HGBB 2DLFL 4PJGF 3VGBA 5GHWL 2APBA 5C86A 2AXJA 2IFFL 2ZOLB 1M4KA 1K3ZA 2OJZH 2NY6C 1IT9H 1WAAF 2Q86B 1W0VA 4OGXH 3OGCB 2X4PB 3OL2A 1BQUA 4Z7VB 3U0PB 2XPGA 2UVFA 2CR6A 3QXAB 3QUZB 4HT1L 3ARQA 4O5LH 4IS6A 1JVKA 3LEYH 2B5IB 1WWWX 3MA7B 3L3GB 2NY0B 3CUPA 4KK6C 5AD0A 4J7RA 1OARL 5IB1B 3G6JB 3SKJL 1NAKL 4DZ8B 5E2TL 1MAKA 3FONA 3B8YA 1DUZA 4PJXF 4OZIE 1Q9LB 1JWMB 2CR3A 3SGDH 5BS0B 4UBDD 3X3GL 1CLOH 1T66D 2BVPB 3QHZH 4RFOH 4PJ9B 4XWOC 3GMMB 3DMMB 5C0BB 4LLWA 3P73A 5D7LD 5JW5B 4NFCA 1OAXL 2J5LB 4Y19A 5C0CB 5IROC 2BVUA 43C9A 2HLFD 3UTZB 3L5XL 3N1GC 1N0LA 3H2WA 4DUWA 5IROA 5CS7A 3Q5TA 4WTXA 1A7RH 1NBVL 1J7VR 2W60B 1BF2A 1FIGL 2B2XL 1A7PL 3D69A 3N9GL 1FL5A 4OLZL 4RAUA 3MRJA 4S0TD 3VXRA 4K9EC 2DJUA 2DQJL 1P7HL 4Q7DA 1G9NL 4OTXL 1QEWB 2VDRH 4F7TB 2EC9T 1RI8A 4B50A 1EVUA 3X13A 3IDIB 3CVIH 3FRPG 4XXCC 1T0PB 5GGUB 1OWWA 1YYLH 2EXYD 1IKNC 4XXCA 4LCIL 4MXQD 3MV11 4G6MH 1OM3L 4YWGH 1DTUA 1IKNA 1I3VA 4NCC2 3C2SA 4EQ2A 3MA9L 2F5BL 5FIEA 5TDPA 3B2VL 4PJFE 1YUHA 3HG1D 1SEBA 2W9LA 3K8KA 4LP4A 3VRIA 3GO1H 4IOIA 1CN4A 2FIRT 3FQRB 1IARB 3SGDI 3G5YA 4OV5A 5DJZB 3REWB 4IOSD 3IXAB 4ODHH 2EYRA 1FNHA 4X7FC 4XI5C 4JZNA 3UJJH 3P4LA 3UZVB 4WI3A 1KTLA 2FECL 3L3KA 3MJ9L 3P4MA 2GIYA 3N85L 5CBEA 2VB5A 2JB6A 4XBGA 4LSDA 3RWDA 2EKJA 5L6YH 3KNBA 1ZLWH 1F90H 1AJ7L 1QR1B 4DN4H 1KB5L 5F1NA 1D6VL 1QYGH 2DBLL 1ORSB 1KENL 4JFFD 4PJEB 4OCSH 4BH7A 4Z6AT 1KT2A 2WBJB 3KLHC 3QEGL 1FFOB 3RL1B 3ROOA 2ZJSL 2W38A 2B4CC 1N6QH 1DQQA 5SWSE 2QSVA 5IVOA 3PGDA 1D9KC 4JFPB 1ZGLB 4AEEA 2FCBA 3BP7B 3DYMA 5KVEH 1D9KA 1F3JB 3LHPL 3GMPA 4HMEA 3ULUD 3MBXL 4X0KA 3VA6A 3GJEB 3CFDB 3H0TA 3BKYL 1LO2L 3K81A 4Z7WF 1RULL 3QXTA 4OFVA 4HUVB 1T1ZB 3K4DA 3QWRA 2P46B 3DI3B 1E28A 1F4WL 4HKBB 4Z8FL 3QDJB 4GRLD 1I9IL 1PFCA 4U1LB 1SVZA 2A1WH 3ARDD 2X1QA 4MA1C 2DQDL 1A3LL 1R6VA 3O0RH 3ORJA 5E8DH 15C8L 2ZNXA 4WI7A 1G9ML 3QPXH 1A6VL 4PB9L 3DO7A 2BVOA 3HMXL 3QQNA 4IRSC 1FVDA 1T5XB 1LNUA 4R97B 3EKCA 4HXBH 1AXTH 3BGMB 1BIIB 4IRSA 2YMXH 2IADA 2VXSH 4YX2L 2JB5H 32C2A 1JCKA 5K9JL 4JCLA 3MRRB 3AMLA 2FIKA 3RY5A 1JK8A 4ZUVB 1I4FB 1SY6H 4JFQA 1CLZH 4H8WH 4C4KT 3G6DL 25C8L 4X4MA 4RNRB 5I1DB 3ZE1E 2F9BT 3C6LB 4G43B 4M7KL 5TE7L 2ARJA 1DVFB 5DFWH 2OL3L 4I77H 4X6CA 4MD5A 3FO9A 4JQXA 4RA3A 2D7TL 3KPOA 4YHML 5DFTA 5EZOH 2PTUA 4HV8B 3L3JB 3RVVC 5BOPA 3QA3A 4PRNA 4JDTL 5CGYC 2J88H 4UTBH 3OTTA 3IRPX 1FGNL 2ED8A 4PJAF 3F7VB 4OAWB 3BRFA 4FQLH 2APFA 3MOQA 1AGEA 3CPLB 3IKKA 5GS0H 2VZ3A 1ZANL 5E2UH 4KHXH 2NLJB 1G7HA 3LKOB 3E0GA 3TPUA 2BY1A 3MGTB 3ZL4H 4OZHB 2VN7A 1A4JB 4GRMB 1Y6KR 3IDNB 4KHTH 3SKNB 3OSKA 2XZQH 1QBLH 2BVQB 2Z35B 3SY0A 4XNXL 1CE1L 4BZ1H 1CCZA 3U0WL 5M94B 4GKSA 4U6YB 5FKAA 3V4UL 3ARBC 4LCWA 4CVUA 2R4SL 5I1AB 3VFMA 5ITBH 5DC9B 5SWZA 4QHLB 4G6FD 4O02H 3ARBA 4HKJB 3GSOA 3HNVH 2VLJD 3U30C 1QR4A 2VXQL 1C5CH 1RD6A 1V7NL 4P57A 3DV6B 1UB5B 4QRRB 5FCUL 4LNVA 4Q0XH 5DRNA 1D5IH 1H0DB 3CAFA 2EKSA 4HW6A 3MCG1 4FN0A 1UYWL 2XWBB 1A5FL 3GSUB 3HE6B 3FN0L 4PRIB 4FG6C 2DJ4A 7FABH 1NMBL 1MNUH 4HIHA 1HH6A 2ARJQ 2P8PB 2DF3A 4N0UB 4XAKE 1M71B 2NY2B 1F02I 2IANB 3SDAC 4LPTA 1A7QL 1U41A 4OCMC 3ULUF 3QFJA 5I30H 4I1NB 4U2ZA 3S88H 3SDAA 1E4WH 1U95A 5F7DA 3DVNA 3G5VA 1U8JA 1RJYA 4QXGH 3L1OH 5BZWB 12E8L 2F15A 1KXTB 3MCKB 1YA5A 3GGWA 4IRJD 3VGAC 5DJDA 3WSQH 4AQOA 5DVNA 3C5JA 3KPLA 4U1GC 3RVTD 1NKOA 4KMTL 3L5WA 4DK3A 5ALCL 4R7DB 3DXAA 4OQ1A 3ARRA 5KJRL 1AXSB 1CK0L 4Z0XA 2P8LA 4DAGL 3KYKL 3R1GH 3RU8L 1AFVH 2CK2A 1A14H 3QHFL 4G8GA 5IB4B 2BNQA 3GBMH 2F58H 2VYRE 4JGJA 4XRCA 3TJHC 4WCYH 5ADPL 5C3TA 1LEKB 3VI3E 3FO0H 2O26U 1U6AL 4IBLT 5KOVC 3BQUD 4XPBL 2CK0L 3JVGC 3O2DH 2HFGL 3S97C 2P8MA 3EDFA 3T8XA 4YDLB 1J0ZA 2VL5A 1DLFH 1Y0LB 3PGCA 4OM0H 4WY7H 5CMAB 3R0NA 5F8QC 3JVGA 3MRDA 4JKWA 4HH8A 1K5NA 2ITDA 2PYEE 4JFDE 1AE6H 4FZ8L 5GSRB 1UZ6E 1EPFA 4IDLA 5M95B 3AAZB 4EUPB 5T3ZH 4C83A 2I27N 5DJAB 4N5ED 1LK3H 5CIPB 4QOKE 4WUUB 1B3JA 2EO9A 3DETD 1CD9B 3PWJB 3ZZ1A 4U6TA 3V52L 5CEZD 2VXVH 4QCIB 5I74B 1G6RB 4HEPG 3QO1A 1FNEB 2M26A 3H9SD 2IH1A 1E0OB 3O2WH 3SDYL 3Q0HA 4G5ZH 1T6WA 3QCUL 1OSZA 3WD5H 4Q2ZB 5I9QC 2WIMA 3ZTJH 3H3KA 3P0VH 1BQLL 3QP3A 4D0DB 4FXKB 1MF2H 2UWEF 3VFGH 1LO5B 4Y4HA 2R39A 4JLRA 2CKBA 1R5WA 4MJ2A 1XF1A 5GPRA 2AXFB 3MV9E 3DHJA 2X10A 1FLRL 5GS0D 3Q6GL 3SCMB 3U9PL 3WFCH 2QV2A 4Q9RH 1N0XH 1VGKA 4Y8DC 3QUXC 5JIKA 1IL1B 3NAAL 2F8VA 1KTDA 3TVMB 1UEMA 4DTGL 4LSPL 3ZKMD 3QUXA 4GAYB 4TTDD 1DEDA 4ZAKB 1HKLH 3GB7B 3O9WB 1U8KA 2J8OA 3AU1B 3ILPA 5J1AB 5C09D 4O9HL 4XMLH 4NO0A 4QRUA 4X6FA 3ULVC 1H3PH 3TF7C 4NPYB 2DQCL 4NHCH 1I85C 1LP9A 3FT4A 1T0NB 2X44D 3LAFA 2K1MA 1UJ3C 4MHHI 4ZPTA 1RMFH 3MRGB 1YQ2A 1MHEB 4JO3H 5HDQL 1KJ2B 1UJ3A 3OAYK 3QT2A 4PTUA 3G6AB 3OR6B 4R4FL 4YDJA 5HY9B 2H3NB 1GGIH 1SMOA 3LKSA 1ND0A 3KS0H 5E5UB 3W39A 1BF8A 3HTLX 3OF6A 5EZIH 5I19H 2VDQL 5J12B 1KN4L 5IVNA 1KIQA 4RZCA 5CP3A 4ZSOB 2E3VA 1CBVL 3ECBB 1IC4L 3CH8A 2HFTA 5CILH 4RGOL 5HHPB 5IF0B 3FT3A 3BPLB 1FYTA 5FHBL 4ERSL 4CJ0A 3QDMA 3JTTB 4M9OA 3E6HA 1BZ9B 5E94B 2PO6D 5AZ2H 1JNHA 1JV5B 2J12B 2YRZA 3WE6A 3O3UN 3W11C 1X6LA 4V1DB 2QQNL 5CJQH 5D9SB 2OTWA 5JUEL 5IM7A 2ZUQB 4X6BB 4WUKL 1A6UH 3ARVA 3RTQD 2IMMA 3C9NA 5CKGA 1ZT4A 4OQTA 1B6UA 4HS6A 2CRIA 2XYCA 3O6KL 2XN9D 3BHBB 1ZMYA 2EIZB 5EOQH 5KVDH 1FRGL 1VSCA 4GRWB 5I15L 1UGNA 1CG9B 4JPWH 4K2UL 5BV7H 1IAIM 4ONFH 3RIFF 1L9NA 1RY7B 3QB7C 5I2IA 3U9UB 4XC3H 1GYAA 4MNQD 5DO2D 2IH3B 4Z0BL 1MCOH 5FK9A 3B9DA 1MI5A 1INEL 1RJCA 3O6MH 4JRXE 4PJ5B 1GZPA 5T1KA 4MDIA 5DJ6B 4JY6A 1S9WB 4I4WA 4DJMA 1O0VA 1RZ8B 4KTEL 3T0XA 3LMJL 5D1QC 4P46B 2ZCHH 4HCRA 4S2SA 1NMCB 3V5KB 2E7BA 5D1QA 4OZFH 3PWLB 2DMBA 5K33A 3LKQB 1P69B 3GKWH 2DTSA 3LN9A 1KCUH 1U8IB 4KZEL 2C5DC 1KOAA 4PJXE 4C57C 1IGIH 4LIQL 2DQFA 3D0LB 4M02A 1KPUA 2CDFA 4ZQKB 1L9MA 4AEHH 5HHNB 4OIAA 3BESR 1CQKA 5K93A 2EDDA 3EYQD 5JO5A 2I07B 1FVCA 2YUVA 4YNYA 4KMLB 1II4E 3TNMA 3C8KB 1RZ7L 3BWUC 5GS1B 3IFOA 5HYSB 4XP9H 1ZTXH 1NEZG 3D3VA 4MVBC 3U7YL 4GW5B 3CDFA 3IU4H 4MAUH 5IFAL 3JWOC 3P4OA 1LK2A 1QSFE 3E8UL 1RVFL 5JZ7C 5DRWA 4CVZB 5JOFA 3V6ZB 4P23D 3WIIH 4BSWB 4Z7OE 1XIWD 1IEHA 3TESA 2ICWB 2OQJB 5F3BB 4JKPL 4JDZA 4X9HA 1IGFH 4FNLL 4UILH 4IDJL 1A21A 2DQUH 4HFUH 1FAKT 1P4BH 1NUFA 5GRUL 5FYJL 3V0VA 1TQCB 4NN7B 3DLQR 4D8PB 5BO1H 4DQOL 2H9GB 3JV0A 1AKJB 5EO9A 4P2RE 2GUOB 3MXWH 4OD1H 2DKSA 3K0WA 3CU1A 2EE2A 3EHBC 3P30L 4R26H 2AVGA 2X4RA 3UAJC 3WKML 3CFCL 4Y5XB 2Y4SA 5IMOA 2CH8A 3GMQA 4WHYH 1U2CA 1N5AB 3BISA 5KVMC 5J11C 1QSEE 5CUSL 3MRLA 1PD6A 2BX5A 4KQ4L 4LCUB 4L4VA 3RNKB 4X98A 1A6TB 1EV2E 2B1HH 1IAOA 3Q3GB 3QI9C 1QO3B 4TSAH 3IS0X 1VGEH 1JGVH 2R2EB 4NWTL 1JZ3A 3QI9A 1GPOH 3RAJL 1ZT7B 3WFBH 4JZJB 1MVUB 1RUKH 2C3GA 4K55A 5FYKH 5BJTA 4PG2C 3LCYA 4F7MB 4FFYL 1QLRA 2ICEB 3I6KA 2GYSA 4XB7A 3S37H 3L3HB 3HFMH 4PG2A 1UXWA 3LKPB 2BZDA 3LB6D 5DQJB 4JN2B 3QRFM 4JM2D 3UZQA 5DLML 2J8UB 3M07A 1REIA 4ZO8A 1YMHA 2R1WA 3N06B 1F58L 4Y0GA 4LMQE 5E00B 5MEOA 4FQXC 2P24A 3N1QC 3UXFA 1Q94B 1RZKL 4O51B 4FQXA 1BGXL 4J2XA 4LAQL 5D7JC 3QIWD 5C70A 1KSRA 3BEWB 3M17B 2DKUA 4X99B 2EDOA 5CSGA 5D7JA 1YEIH 4HLZH 1ACYH 5C0FB 2G5BB 4ZS7H 4Z7WE 3KXFB 1FFQA 4EVNB 4HULB 3H9HA 4G8EB 4LOUD 5D71H 4Y2DB 1R5VB 5FFLA 3VRJB 3MRMA 4KGJA 2OSLA 5L88L 2BSED 1BFVH 3SO3C 4H1LA 5DZLA 3HC4H 4JQIL 3BN9C 4AG4H 1FO0H 4XPHH 2YPKA 3W2DL 3ZKND 3ILQC 4EI5A 1GIGL 5C0AA 4D3CH 3FT2A 1DANT 1PVHA 2ADIA 1EFXD 4CNIB 1U3ZA 5DZNA 5IFJA 1JHLH 3LVEA 1U3HC 4WW2C 2IMNA 1U0QA 1IEAB 4QRPA 4RSVA 4H26A 5DEGA 2ED9A 1FN4B 2H2PD 4NDMA 1JGEA 4WW2A 2D7QA 3BD5A 2D7NA 1N6VA 1HILB 1A64A 4KJWC 4S11A 2BY0A 3WLWC 4MA8H 4BFBD 1G7PB 4OCXL 5E2WL 4HZAA 5C0EB 3L5JA 4MJIA 5HHOD 4Y16D 2JCCA 3GIZH 4G7VH 4YR6B 2ICWJ 1LO3L 4LVOC 2YD7A 1RUPH 2AJVL 4GKNA 3MLXH 3GSRB 3GSNH 3MRIB 3HPJB 3BDBA 4M00A 4CRPA 5FYLD 3VD9A 3U6RA 1TVHB 3WUWA 3UX9B 4NRYB 4AEIL 3CNKA 2F19L 1OVZA 2VLKB 3EOYG 1F4HA 1JTOA 1J5OL 2DJSA 3V0AC 5DJ2A 3DUUA 4WTWA 4PV8A 4Y5VB 4ZXBC 1ZHNB 1HNFA 2FYYA 3MC0A 2JJTA 3S3PA 4X6CE 4ZXBA 1IM9D 2V9QA 4PJCB 4OLVL 5D6CA 2X4UA 2YD1A 1IBGH 3RWHB 2OTUA 5B38G 1T03H 2VLLA 3QWOA 4W68A 1ORQB 4G8IB 1G0XA 3OXSB 3VWJB 4R2GD 5DURB 5F88A 1ZSDB 4PY7B 1O5DT 2XTJD 2H26A 3FN3A 2D2OA 1DL7H 3OJDB 4IMKC 3SKMB 3ZDXF 2C3VB 4LGSB 1Z0MA 3MREB 2Z31B 2IG2H 1OSPH 5FUCC 3EYUH 1ODAA 3VXTB 3TZVC 3NCFB 4XHJC 4NWUH 5FM5M 5GGTL 3VFPB 1RFDH 3VXSD 2VAAA 2JTDA 3TZVA 3ZKSD 5DYOA 2C3WA 4FTVD 3O6LH 3BIBX 2CIKB 2HKFH 4YLQT 1EZVX 4DW2H 2A6DB 2FB4H 3HUJA 3H3PH 5SWZE 2ESVB 1DCLA 4D0CA 1IEBB 3DIFB 1XF5B 4MHHG 4MJ6A 2VDKL 3FAWA 1I1FB 5A3ID 1JF5A 4EXKA 3KYAA 4R0LC 4F9PC 2OXHA 1IGJA 2OTPA 4PJBB 4KKCD 3V4VL 1CDCA 1KF9B 4MNGB 2A77L 4R0LA 4F9PA 1WZKA 5KS9F 2A9NL 3S35L 3GHEH 4XMPL 2NR6C 3MFFA 4LNRA 3VFNB 1J88A 4ODXB 1A2YB 2MFNA 2WLYA 4AIXA 1WZ1H 3T0BA 2G2RB 3VMOA 3HB3C 4XP6H 3NOIA 4ODTH 4XVTH 3KPTA 3EO9H 2P7TA 3OKOA 4P3CL 5DMGC 5IESL 2AV7A 4PRPE 2MMXA 5D5MB 5C07D 4EI6B 4Z76A 2HRPH 4G9FD 2H1PL 3B6SB 3QCVH 4NBYB 2FBJH 1CS6A 3CZFA 2HKHH 1D7FA 5IFHL 3ES6A 1XCQB 1HXYB 2AABL 1D5XB 2EECA 5E8NA 3DXAE 2D0FA 4XNQB 1WBYA 2GTZB 2GK0B 1FC2D 2BNQE 1RZJL 5T1MB 5CWSB 5E2JA 1OAZH 3QQ3A 4MCZA 1S7SA 4M5YH 3TBTA 3PWPD 1K9TA 2UZYB 1T1WB 3O3BA 3R06A 3MR9A 3IT8D 2XFXB 4V2CB 2BMKB 4TUJA 5JW4R 1ZOXA 3HLAB 3EJJX 4MCYA 4ZUWA 2EDFA 2O5XH 3JV4A 4LPCA 1OCWH 1HHJB 4ELMF 3EO1B 3RWGB 3KAAA 1B0GA 3PWNB 2BOBB 2DN7A 5L9DL 4MA7H 5DFVD 1FCCA 4M7JL 2QEJA 1DEEB 3MLYH 3MUZ1 3GJFB 5ISZD 5A16B 1HHHB 4NT6A 1DBBH 5JOPD 1JN6A 4Q97A 4U33A 2AJUL 5E1AB 5EIIA 2ZUWA 3WUWG 4RGND 2VLRA 1GC1H 1KFAH 3UYRH 3P4NB 5DTFA 5KN5A 1M6OB 3HZMB 3DROA 3TT3H 2WP3T 2AXGA 1U58B 5TF1H 3VFUA 1G84A 1MCJA 2Y06L 4DFHA 3CVHH 2J4WH 1JHKL 1SYVB 2BNRD 3U2SA 4YHLL 4X4YA 3L95B 3L3IA 3QG6B 5F97E 5EH1A 3MRKA 2DAVA 4HFWA 3VWKC 2CMRH 4M1GH 3OKNA 5EU7C 4MJ4A 4EQ3A 5JORB 1E4KC 5EPMB 1CXFA 2LAAA 4WNQA 1Y6MR 2OJEB 1F4AA 2IAMB 3CDYA 5IR1B 4K9EL 1E4KA 1V3JA 4OZIB 1JTTA 1QOKA 5MEPA 4DEPB 3OAYH 3FHQA 1KTKE 4X7SH 3M8OL 1ZHLB 4E41E 2WINA 3GSVB 5EBMA 2Q76A 4OM1L 5F44A 4X8JB 2BNUB 3Q2CA 5TPWH 4HC1A 3FFCE 1LP9E 4GG8A 1ZA3A 4ETQB 2C7UA 3MNVA 5KVGL 4YDIH 1EAPB 2Y6SD 1OAYL 2ED7A 4ZFGL 5EZJB 1I8IB 1TENA 1HSBA 4L5FL 3QUZD 1CD1B 5EDXA 2V5TA 1ZWIB 1HH9B 2NY0D 4AIZB 1YY9C 1KCRL 1EEZA 1JE6A 3L7FA 1NBQA 4TSBL 1CL7H 3W5MA 1NUGA 1A9BA 5J3HD 5ICXA 4ZUUA 4LRNL 4ZTOH 2NPLX 1KCSL 1WSST 1MWAH 1QQDA 5BS0D 3O4LA 4YHKL 1FGVL 2HVKA 3U4EB 1FYTE 4YBQC 1R3KA 1BOGB 5DHYB 3R0MA 5MERB 2AK4B 4PJ9D 3DMMD 5HGDA 5TQ0L 5C0BD 4MB5A 4LSTL 4PJFB 2XT1B 4PJIB 5ILTH 5C0CD 4J3TA 3VH8B 4BKLA 4YHPA 4J3WA 1VFBB 4JY5L 4G80B 1CF8L 1UWEL 2B4CL 4XC1H 5GS2D 3DTXB 2BHUA 4XBEH 4S10A 2P5EA 3GSXB 1GOFA 4WFFE 4HUUA 1AO7B 3RZWA 5I1LB 4HIXL 2WANA 3OJ2C 1Z9SA 2DI9A 2GSIB 2HT4C 4MAYC 4ZOAA 5ALBH 4K71C 4MAYA 4JFYA 3GHBL 1I7RA 1TQBC 1CFNB 4XCCL 1J05B 4QRQA 5CLWA 3H6JA 2Y25A 4FFVD 4NKIL 1DQTA 4YXKL 3A67H 1HDMB 5SWSB 2DIAA 3CK0L 1D6EA 1BECA 1DE4A 1NGXB 2Z8VC 1CL7I 2PCPA 4HUXB 5I17A 4I0PC 1GJIA 2J1KA 1UWXK 1TTUA 2OI9B 3WIHA 4L4TE 3TP4A 4I0PA 1P6FA 1XGUB 3CFJA 3RVXC 4P3DA 1F4YL 3CLFL 4KU1A 1JYVA 5FUOH 1QG3A 4ZUTB 2DQGH 4F15C 1EEUA 1UB6A 3MUGA 3QCTL 2OXGA 3OKMB 4GAGH 3ARPA 4POZD 4WEBH 3PGFH 5ENWB 3D9AL 2Q8AL 1JF1A 5EUOF 1KIPA 3EDKA 2FJGB 5CGMA 1G1CA 2DYPB 3TH2T 3FZUC 1CGUA 2XKUA 2XWJA 2VSDA 2VE6B 3EYSL 1J86A 3KR3L 2XOTA 2XV6B 1T4KA 1I9RL 2WBJD 1RJLA 3QNYA 4GJTB 2H32A 4HK0B 4HIEA 5CEYA 5C1MB 2ZUVA 3MRBA 2HJLB 2W9DH 2YWYA 4L8SB 4G6JH 1MCDA 5EN2B 4HIJB 2W65A 4HLZG 4ZYKB 4Z7VF 2A6JB 2EYSB 2RR3A 4NP4H 4LPXA 5L2JB 1HZHH 4G7YL 4Y8AA 1QHOA 3BE1L 1FAIL 4BM7A 3HRPA 3OXRB 1IGTB 2CPCA 1RUQL 2Y7QB 4UBDC 3QDJD 2PTTA 4P5KB 4ODSL 2YD6A 2I9TA 1T66C 5H37H 1LD9B 5JW4Q 1B4JL 3S96A 1FDLL 4NRZA 1WVZA 1CI5A 5CBAB 1K8DB 3S34L 1KELH 3V95A 4J6RL 1GGBL 2P42B 2I60H 2HLFC 1H5BB 4Y5YC 2OM5A 2DOCA 1C12B 1X7QB 2NCMA 1XR9A 4Y5YA 5J0BA 1M7DA 1NLBH 1P7KB 4Y4FB 3C8HA 1U3HB 1W2KT 1UC6A 4BA8A 2PW2A 3VU2A 4DN3H 3FB6B 5T3ZE 1I9JH 5KAQF 3O41B 4YPGA 1QBML 2QADB 1CR9H 1R3HB 2DQIH 4MQTB 3VCLA 4NN5C 1ZHKA 3C6LD 3WJJC 3NFPA 1DVFD 2G75B 3OKEA 2YA0A 4NJ9H 3VD7A 4P4RB 2EXYC 1DP0A 4ODUB 4ONHA 4MXQC 5C9KA 3OHXB 4TPRL 1YY8B 4M43L 3TC9A 2DQEL 3O6FB 4PJAA 4X5WB 4RGMB 4OSUL 3CXDH 3BPNB 1WQVT 3KPRB 3HC0B 1OAQH 1XGPB 3GUTA 4FZEH 4HF5H 4MJ5A 4J3OC 5DUPH 3HG1A 4PRHE 3TNNA 3OKLA 3GBLA 3SQOH 2YR3A 3AREB 4M1DL 1T1YB 2BFVH 1NC2B 2V6HA 4DVBB 3LKRB 1IGYB 4OLEA 4ZMAT 2YUXA 3HRZB 3KGRA 4PIRF 3C87A 1H3GA 2R69L 4FABH 5I16B 4PR5B 2AKRA 1LDPH 3FB7A 5CGTA 2I24N 3PJSB 3MNZB 2LTQB 3OWEA 3WL9B 5FM4A 5EC1B 2XXCB 1OTTD 4XNUL 5SWQA 1PY4A 2CUIA 2DLTA 4U1NA 4X5XB 5IQ9A 3TN0B 4H25A 3P9LB 3MMEB 4EDXA 2IPTL 3Q5YA 1IC7H 1MAJA 5C0AE 4Z7NF 5JNYB 1KC5H 2XWTA 3CFKB 3LQAH 3E6FA 4YJZL 5TE4L 3UPRB 4JFFA 1PQZA 4UUJA 3TBWB 3LEVH 4JREB 1MCPL 4TSCH 2BHZA 3D85B 1JNNH 4QRPE 1JPTH 4QRRD 5JOEA 4M6ML 5JW3H 2QKIA 5T3XH 2EDJA 3ULUC 3Q48A 1XGTB 1PSKH 3HE6D 4ORGA 2W9EH 3NACH 4PRID 4S1QL 5EA0L 1ZEAH 1EMTL 4MJIE 4C59B 3FQXB 3STBA 1N5YL 4F7EA 5E6ZA 2WBKA 2NY2D 5KBNC 2IAND 2F54A 2P5WB 4JFOA 4LFHD 4GRLC 1U3YA 1A1MB 1NCBH 1DQML 2VDNL 5GGSB 1A1NA 3ARDC 2ARWA 4GRLA 2AK1L 3ZYOA 5ELIA 2PYEB 5LGJB 5D2LA 4U7KA 2CKBL 3ARDA 5FM8A 4JPVL 2CDGB 5F70A 4QOKB 5HYJB 4P9MH 4PP1D 5DA4A 2AJXH 4K23H 1CFQB 1QKZL 4ODVL 1TZIB 5CAYB 4MLSA 1EBPA 3GI9L 1VFAB 3UMTA 1RU9H 1FP5A 3FQNB 1CDGA 1DQLL 1UM5L 1MFEL 2B0SL 4E0RB 1N4XH 2MNUA 4PBWD 2KQMA 5FHAL 3IU3A 1U8OA 3ULVL 4UMGA 4XP1H 1FV1B 1ZVSB 1I1CA 2XI9A 4JFXA 2VIRA 4XPGL 4ONGL 2W59A 3LRGA 4QHNA 4UQ2B 1WTGT 3RP1A 1K3IA 3VJ6B 1JWSB 1FSKB 2D9CA 3MV9B 2X89D 1HSAB 1MRCL 4U31A 1IJ9A 3CX5J 4XGZB 3UTOA 4P2OB 1BAFL 4D9LH 5D7IF 4WV1B 5KS9E 3BZ4A 5IIEA 4WUUD 5FB8B 2B1AH 5IMLB 2WUCL 4JHWL 2MHAB 4WEMB 5BRZE 5D96B 1LO0H 2OK0H 2Z92B 3L3DA 5L2KE 3W9EA 4OB5H 4HUMB 5HHXL 3RKDD 2BERA 1T2QH 3T4AB 4LHUB 3R8QA 2VN4A 1A9EB 4KQ3H 3HUJE 4I48A 1MJJA 4JRWA 2XG5A 3B83A 1U91A 3LEXB 3B3IB 3BSZH 3PIQA 2DQHH 4HS3B 3H42H 2R1YB 3H7BA 5IQ7H 1OW0C 4Y88A 4OQTL 4RCAA 3ZKXB 4K3GA 3SCMD 4JR9H 1OW0A 4MB3A 4YXLL 2VLJA 1SMAA 3DBXA 4HJ0C 5D93C 4LEOA 4O4YH 4C4KO 5B3JF 3QNZB 3TVMD 4A6YA 1KBGL 3GMLA 4ZAKD 4LPYA 3QDHA 3O9WD 3RGVB 5C0DB 3JWDH 4BH8A 2BDNL 3TBSA 1YECH 2DLFH 4ZTPH 3SKOB 1BEYL 2IFFH 4CU6A 2FL5B 1UKQA 3ALXA 3TPKA 5AUMA 2V2WB 4MQ7A 2OP4L 2C1PA 3A6OA 1GL4B 4DKFL 1F8TL 4Q9QL 3JZ7A 4PJ7B 4HCRL 1FL3B 1WC7B 2EDHA 1IGML 3OJMB 4YC2B 4L3EE 5I76A 2H41A 1F6AB 5DC4B 1ES0B 1EVTC 1SJHB 1SYSB 2V7NB 3L9RA 4ISVB 1OARH 2ZSVA 5T3XD 3VWKB 3WXVL 3SKJH 1NAKH 4IRJA 5E2TH 1Q72L 4MWFB 5HPMB 1LEGA 3CDGA 2NY7L 3AUVA 1BOYA 1EGJA 3IAGC 1BMGA 2YEZA 1JNLL 5CP7B 1LE5B 5LQBL 1PYWA 3QO0A 4PJGB 2EIEA 2IWGA 1A8JH 1EIBA 5DK3A 5INDB 3GFUA 2EDXA 5DJYB 3SPVA 4JRXB 4D9RD 1N6UA 3EOAA 5TGBA 2X9YA 3BQUC 1OAXH 4V1DD 3WN5C 5FYKU 2DMCA 1L4IA 3BQUA 3L5XH 3HC3L 1G7LA 3OR7B 2W92A 5I8EA 5D6DC 3JWOL 1ZLSH 3WHXB 3WNPA 4NCDA 4LSQL 1X5JA 1JYWA 1FIGH 3IGAB 4Z18A 5DUBA 2B2XH 5D6DA 5IJVB 1A7PH 3N9GH 2FLBT 4NHUB 4OLZH 3FTGB 2M2DA 5DEZA 1KNOB 4B53A 2ITCB 4N5EC 5GGVL 4PRDB 2DQJH 1FZMA 4GQPH 4PJXB 1G9NH 3DETC 4LSRL 4DGVH 4HDIB 4KK6D 3RNQB 1AI1L 2JLLA 2UYLA 3MLTB 4L3CB 3EFDL 1T1XA 3V5DA 4U7MA 1V3MA 4H8WC 2EZ0D 2XZAL 4QHUB 1T3FB 3H9SA 2HT3D 4LCIH 3VGDA 4PGBA 3MV8B 5KTEH 4ZOCA 5FO7B 3TBVB 4XPFH 4PJ5D 4CAGA 3BJ91 4G9DA 2F5BH 1BBJA 4OZGA 3ARGB 3LN5B 3BWAA 1QSFB 1TZGH 3O4OB 1V7ML 1EH9A 2NTFB 3QXVA 1FG2A 3M1BB 3P0YL 4P46D 3JSSA 4XCYB 5EBWA 4BFIB 2Q1EA 5FECB 3A0OA 4JY4B 4AENB 4GLRH 3CFEA 1X5ZA 4KVCL 4LPVA 2R2BA 1EUTA 5GS0C 4YK4C 4IIQA 4R3SA 1X4ZA 2OCFD 1OQOA 3MJ9H 5DQ9B 5ANMB 3ZKMC 3LD8B 5TFSL 4TTDC 4F7CB 1G7JB 1EXUB 3UTTE 4P2RB 4R6UA 1AJ7H 5L0QC 3MRPB 2IQAB 5GRVL 1KB5H 2YOCA 3IJSA 2DBLH 3DSFH 1KENH 2GHWB 1J18A 3TT1H 1SJVA 1UKTA 5C09A 4XP4L 3LS5L 1C08B 4OCRL 3RIAK 2PXYB 3QEGH 3I84A 4RIRA 4S1SH 2B20A 3MODL 1QSEB 2ZJSH 4NQDB 2D0HA 4YZFF 5MI0B 3MRNB 4RBPK 5DHXB 4WFHE 1MCCA 4K8RD 5JMRA 3ARUA 3LHPH 2VL4A 3LQMA 2FO4B 4LGRB 1HK6A 1UFUA 3OGOE 3MBXH 2VQ1A 4L1DA 3O3DB 3BKYH 1LO2H 1RULH 2O5YL 1LE9B 3O8XB 1WCBA 4OJFH 1L0YA 1F4WH 4Z8FH 2EDLA 4OIIH 1UQSA 1DN0B 1J12A 3G9VA 2YK1L 4P5MA 1AKJD 1MHHB 1TPXC 5CEXA 3HR6A 5DD5L 3T1WA 2ZSWB 1PKQA 3S4SG 2DQDH 1YUHB 4KAQL 1A3LH 5TQ2L 1H3VA 3RBGA 5F3HB 1INQB 1BX2A 1ZE3C 2PO6C 2J6EA 1TVBA 2XKSA 4JN1L 15C8H 3RA7L 2A6KB 1TJIL 1A6VH 4PB9H 1FPTL 3HMXH 2PO6A 3SDXF 1YMMB 2RHEA 4J1UB 5HYEA 2KPNA 5GJTL 4PTTA 4DUXA 5EO1B 4GG6F 3C5ZB 1IE5A 2W0FB 3NIDE 3HZVA 3RTQC 2FECI 1BJ1J 4KUCF 5CJXC 3RTQA 4XVSL 4F2MB 2IJ0C 4Z7WB 3UZEA 5CJXA 1F6LL 3DX6A 3BP6A 1D5BB 3SDDB 2XN9A 2XQBH 3G6DH 25C8H 4S1RL 3QJHB 1UWXH 5JLZB 3PP4L 3IF1A 2MCPL 4M7KH 3MXVL 4PJDF 4LSUL 5IW3A 2OL3H 3BEVA 3LN4A 5DO2C 3W9DA 2D7TH 4YHMH 1CXIA 3MYJA 5DD6B 4MNQA 3WS3A 2H2SD 1VKXB 1NFIB 4R96B 1AIFB 3P11H 1MHCB 1F6FB 1UA6H 1QRNB 4FQQA 4R7NB 3M45A 5GSVB 2I25N 4L3AA 3RQ3A 3GMPB 1NDGA 2BHYA 1AQDA 3BD4A 1CT8B 5F9JA 4PG9A 5IHZB 4OF0A 4MSWB 1NGYA 4I18C 4DCQB 1ZANH 3HZYA 4KJPD 5IKCA 2CD0A 1QNZL 1TJHL 5JIHA 5I73B 3OB0K 2A2QT 1T80A 3BKCH 3FOMB 3LV3A 4I18A 1XCTB 4X7TA 2BVYA 43CAB 1K4CB 1S7VA 2HJFB 3GBNL 4QYOA 3X11A 3KXFD 4TVSa 4U1HA 4XP5L 3LH2L 4O2CB 2PR4H 4Y2DD 3MROB 2AJ3B 3U0WH 2IC2A 2E7CA 5C0IA 5GQBA 3EYQC 1S78D 1WF5A 2R4SH 4KH2A 3B9AA 2BCKA 4JJHA 3UBXI 1TDQA 3IJYB 3S6CA 4EN3B 3DX7B 4O2EB 4ZDHB 2VXQH 5B22A 1V7NH 1YN7A 4WFEE 2QSCH 4XH2B 4RQQB 1GZQB 3HNSL 3PQYE 2BC4A 2YPLB 5FCUH 5LG1A 4U1SA 5E8OA 3PHQA 5DJXA 3BZEA 2X1XR 5L8LB 4P23C 3N50A 1IM3A 1UYWH 1QPPA 1A5FH 1XIWC 4X80L 2FX7L 1K2DA 3S3JA 2YN5A 3QNXB 4P23A 3T2PA 3IETB 3NZ8B 4Z9KB 5BVJB 1XIWA 1RK1A 3DX9A 5JPMA 1J8KA 4I5BB 3WLBA 3RWCB 3S36X 2C3XA 3TGXA 3FQUA 1AH1A 1G9EA 1FNSL 4X7CC 4ZO7A 3B5TA 3QWQB 4U1MB 3O3AB 3T77B 2CLRB 2P4AB 3NFNA 1R3LA 1S9YA 2LE9A 4LBEA 12E8H 4XPTL 4PREB 4X7DC 5FGBC 3MFGB 1QBAA 3LQZB 5EU6B 5E6IA 5FGBA 2D7PA 2V5SA 2XQYG 4KMTH 4UDTB 5ALCH 2VLKD 4KK9D 2D4FA 1EK3A 2BOCB 2ZZUT 3KYKH 3MV01 3O2VL 4CKVX 3HZKB 4X4XA 5E8PA 3NH7L 3WNLA 4WU7B 4RMWA 1M7IB 4S1DD 1MFAL 3T2NH 5ADPH 5GISH 5DD3L 3KPPA 1D5ZA 1U6AH 5I18L 1HQRA 5JPNB 4XPBH 1L0XA 2CK0H 4M9PA 5GGVY 4RMUA 1Z9LA 1T7ZA