3TLRA

Crystal structure of the tetrameric beta-2 microglobulin dimc20 mutant
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKCNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Beta-2-microglobulin
publication title A recurrent D-strand association interface is observed in beta-2 microglobulin oligomers.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tlrA00
3NAAL 1LNUB 1I1FA 3FAXA 4PFEA 4WI9A 5T3ZE 4KI1A 4LCCC 1JNNL 5DUML 1BBDL 2PO6D 2R4RL 5F72S 2EDEA 1XR8A 2IFFH 4MA7H 1IL1A 4E9LA 2CR6A 3HI5L 5FYJD 4OTXL 3TV3L 3UPRA 1X3DA 5AG8A 4K3JH 5I73B 3QDMA 4OIIL 1IC7L 1CFNB 4NJ9H 2XKNB 2CIKB 2E7HA 3PXHA 4LBEB 1IAMA 4R97C 1PZUB 4L8CB 3VRLE 4PJ8C 5H94A 2ARWA 4X7TA 1FSKB 1GGIL 3MNVA 3PF2A 3OZ9L 5MERB 2XRAH 1JGLL 2F5BL 4LP5A 2B1HL 2VDLH 3TA3B 5M7QA 3CH1A 4U1KA 2XWBB 1U41A 5C3LD 3PUCA 3MOAL 3ZE1E 2KZ1B 3BISA 2WWMD 5HHOA 4CGTA 1PW3A 1KXVC 4HDIA 5FUZL 1IAII 1FFPA 3NTCL 1U8JB 2YZ1A 3SDXB 5BVPH 1S7UA 4MXVF 5CILL 4FNLL 3EO1A 4EDWL 5TDPA 1D5IH 1QLEL 1K5NB 3B43A 3BPNC 2OMNA 3PWJA 2ZUWA 5C08E 1S7RA 2E8ZA 4L8DB 3WL9A 3ULSB 3UTQB 1J8HD 4XC3L 3L3HB 1T2QH 5E7BA 4OZGB 2F54D 2I9TB 4F37F 2X40A 4X6CA 4LLVA 1NQBA 3EFFA 1REIA 4TUJB 1UVQA 3KYKH 2EC9U 4BH8A 5C86A 2OTWA 5GGVH 4PRPE 3UC0H 3WFCH 4LPWA 4UV7H 3QAZB 4OD2B 1T21A 3RU8H 4KVNH 5E9DE 2XN9D 2R1YB 1SJVA 4PJDA 3QZWB 3L95A 3IF1B 3PJSB 4QRTB 2BVEA 5I1IH 2XACC 5FYJL 2AJ3B 4OD1H 3ILQC 3G6JB 5F8RC 1UA6L 1U8OB 1JNHA 4X5XA 2BZDA 3MC0A 4MNGE 4NO0A 4R4NC 5I6XC 3MZTA 4XP1L 3OGCA 2P8LB 5CUSH 2Z8RA 4ODBD 5KSAB 3MZGB 1FYTA 1CLYH 3GKZA 3OKDB 3RX7A 3W39B 2DQFA 2ICWA 1FAIH 3QUYD 4GG8A 1Z0MA 2AQ1A 4PP1D 3MV8A 4LQFH 1IAOA 1CZ8H 1DR9A 4JFFD 1J12A 1P53A 5BQ7A 6CGTA 5AYUH 1C12A 5EOTB 4F7PB 3B9DA 1KJVA 5IFJB 3SJVB 4WFHE 2BNRE 3PV6A 4IMLB 1LEIB 1J1XH 2VDKH 3C08L 3LKNB 3MROB 1Z5LA 2BVOA 4PG2A 3NN8B 4BSJA 2W60B 5DJ6A 5ICZB 4NUJA 4GKOA 1YEFL 5C0CD 4HPYH 1C7TA 1OGAA 2DAVA 1RZ7H 5GGQH 3EO9L 3RJQB 1VHPA 1NGPH 4PJHF 1RZFL 1A1NB 2IADA 5FF6A 1R0AL 4PRIE 4OQTA 2CGRL 5FECA 3O9WC 5DXWA 1XF5A 5EOCJ 3RX8A 3ZYIA 4UT6H 2IFGA 5E08H 1MELA 2V2TA 1KFAL 4K3GA 4WHYH 4UTBH 1UQSA 1DTUA 3UTPE 1ITCA 1NCTA 4DCQA 5D1QD 5IBLC 3IJYA 1F13A 1MY5A 4MX7B 3F65A 3U46A 4X6DE 3NMEA 1MI5E 4N0UE 3V6OE 1DLFL 2DTML 3DUSA 5E1HB 5F89A 2LTQB 4O2FA 4MJ5B 3SCMA 4FQIH 3D3VA 4X6EA 1KT2A 5AZ2H 3U4EA 3WKMH 1QSFB 2ICCA 1IQWH 1ONQA 5GS0D 3CFDB 2D7QA 1ZT1A 2DI8A 4KPHH 2JELH 3KYAA 2B20A 3IB4A 3FFDB 5IFAH 4XXDB 1KTLB 4MXWL 4G7VL 2WQ8A 1EUTA 2EDBA 3GBNH 3QP3A 4G6FD 4KK6C 4S1SH 1T1ZA 5EOQH 4LU5L 3QDME 1WFOA 4U1HA 1V7ML 3G6DL 5IEKA 4GBXA 3EYSL 1MFAL 5DZLA 5E94A 4JN2A 3S3PA 1U3HB 1MF2L 2WSKA 3RVWC 3G5XB 5L9DL 1E4WH 4OCSH 3CSGA 2Y36L 3B9AA 4LSTL 2BXZA 3BSZL 1Y6NR 2F58H 3OR6B 4BSWB 1VERA 4JRXA 3T2QA 3FCTA 5I9QC 4CJ0A 2W0PA 2FIKB 2PW1B 4LLYA 3O6LL 1BIIB 1CS6A 1FZOA 2BY3A 5C7XH 3WDJA 3CFBA 5EO1A 5BZDA 1YEEH 4JM4L 3RVUC 1QFWI 2QQLH 2JCCE 4O2CA 1NGYA 4R26L 1I1AD 4UQ2B 2X1QA 4EI6B 1PZ5B 2Y06H 2KL6A 5AAMA 1RQ5A 1IGIL 3FRUA 2NZ9D 3BKJL 5FO7A 3V4VL 3G9AB 5KVMC 3O2VH 4HG4J 4K94L 3OJDA 4K71B 1R3LA 5I75C 3BDYH 5ICXB 5SX4I 1VFAB 4NZRL 5C0EA 3Q3GB 4NT6A 4HLZH 1JF5A 4XZUA 4YWGL 1ZLVH 1YMMA 2Q3AA 3HC4H 4I9WE 4W4OA 4X83A 2PTTB 3B9VA 3LIZH 3NACH 3GO1H 1WWCA 4U6VL 4TULL 1G6RH 5CMAA 5E2VL 2H2SD 2VR5A 3DIFA 4X6CE 5T33L 1IFHH 1PX3A 5E1AB 1QO3A 1JGVH 4Y5YA 4BZ1H 4OLZL 1TPXC 3GHEL 4UDTB 1OAXL 5FYJE 4KAQH 3BFOA 1HKLL 2EYSA 3BP7A 3GM8A 4MNQB 5BRZB 3WO3B 5CEXA 4KKCD 3DRQB 4OI8A 1AHWA 3C5SB 4CVZB 1DCLA 1P7QA 1JFQL 1Q72L 2VAAA 5IMKB 5ETUA 5GRUH 4B41A 4DZBA 4I13B 4PJBA 2V2XA 5LJYH 3P4OA 2HG5A 1KNOA 3PGCA 3SOBL 1AFVH 2IAMC 4FQ1L 2A6JA 4X6BA 2FEEI 1A47A 4HXAH 4QXUL 4P3DA 5ANMA 4HQQH 3MBEB 1CFSA 1KLUB 2RHEA 5FAAA 3LN5A 1FCGA 3MLWL 2ICEB 5HHMB 4KJYA 1GAFL 5JW5A 4MXQC 1FIGH 4ODWA 1KSRA 4U33A 3G5VA 5CWSB 3GMNB 4K3DH 4M3KB 3KVQA 2Z35A 4LVNC 3PWLA 2ZPKL 4PJXB 1FFRA 3QUZC 1YEHL 2IEPA 4LSQH 4OLYL 3BGAA 2YBRB 1YEIL 2LVEA 5FFLA 1QSED 1J8HE 3TBYB 1NJ9B 1JV5A 3RDTD 2ADIA 4U6TA 5A16A 3CXHK 2V2WA 5DRNA 2CKBB 1V3JA 1PKQA 5I15H 4POUB 1IZKA 1OTTD 2DICA 3O2DA 2WINA 5D1XA 4J4PC 32C2B 3JTTA 4M48H 3HPLA 3JV5A 1CL7H 3EFDH 4X7CC 3KPPA 4QRUA 4MXVE 5GGUB 4PREB 3WDIA 1XGYL 4KMTL 1WCBA 5LWYH 1CDHA 3SY0B 3I3EA 2ZSVA 3M17B 4NSKA 5E8NB 1JPTH 1QNZH 2R1WA 4HT1H 3REWA 1VGEH 5GISL 2YXFA 4Y16D 4U3CA 2FECI 1JF1B 5BCAA 4P57A 2CLRA 1F4HA 3QIBB 1C16B 3JWDC 4Y4HD 3DX7B 2QADC 3PE9A 2ZG1A 5I1HH 5C0RL 3MLRL 3MRDB 5AYQA 4Y1AA 4LHUA 4ZS7L 3V4PH 4Z7QF 4P46C 1NGXA 4ZFOA 3HC3H 4JFFE 3QQ9C 4ZG1A 1KB5A 2J5LC 1LO0H 5CZKA 3FZUC 3LKRA 3O6FA 3UTZB 1J11A 2BRRH 3MREB 5IVZB 3UX9B 1EAPB 1CE6A 1U93A 3VGAC 1R5IA 7FABL 2WV3A 3BIBX 2B2XL 5HD8D 2AJVL 2HWZL 3UP1A 2XXMB 3LOWA 1NCWH 5F96H 5C0CE 4EXPX 2XT1B 3GEWB 4ZFOL 3S37L 2CMRH 5LGHH 4JRXE 4DUWA 2R2HB 1MJUL 1RIUL 4HJGB 2WBJA 3QG6A 2EH7L 2KQMA 2Q8BL 2RFXB 2H9GA 2ZUQB 1ZOXA 4PJGF 5F1SA 1LDPH 3IETB 5K9QG 4OGXL 1T1XB 4XNUL 2VO5A 4G8EA 3P2TA 3CSYB 1IC4H 5DHXB 1IGFL 3L3IB 4HUVA 2IF7A 5HYIA 1NSNH 2Y5TB 1D5XA 3VA6A 4M02A 3TH2T 2ED9A 2GSGA 2PTVA 3RX5A 5EC1B 5A3IC 4PJHE 1YMME 3X3FH 2QQNL 4NC1E 3EJJX 3GBML 1DLHA 5HVHB 3RI5K 3DETC 3G08B 3MFFB 4LKXB 5IT2H 4MA8H 1YYLH 3TJHD 3VDAA 4A6YA 4LHUG 5HVWA 5E99L 4EQ2A 4CU7A 3MNZB 4Z77A 1MIMH 1XAUA 2NY6B 5L8KB 4JQIL 4OKVA 2Q86B 2CK0L 4NNYA 4ZYKA 4U7MA 3MLZL 1T83A 4K2UL 1G7QA 3DO7B 5FM5O 4G42B 3VXQA 2IMMA 4QOKD 4R4BA 1BZ9B 3ZO0A 3CLEH 5GSVB 4XHJC 2JJSA 5C0FB 3VFUB 5J11C 5D6CB 1JWMA 1DN2A 2WM0A 1OL0A 2X9YA 1MRCH 1P5UA 4MA1B 2YPVH 2DQTH 1CICC 3VXSD 4JDTL 4BKLA 1K2DB 4PJ9D 2AEQL 2E7MA 4Z76A 4NO2B 3ZKND 4FZEL 3LEXA 4AIZA 5F1KC 2FX7H 3QEQD 4CKVX 3QIWD 3MODL 2VZVA 4JG0H 3HB3C 3U0TA 3V7MA 1SEBB 1ZS8B 1FC1A 4YX2H 1HXYB 1QSZA 4UNUA 4YNYA 5GGSB 3PABB 2O5XL 3G5ZB 2XG5A 1NMAL 1PSKL 2XTJB 4PV8B 5EOCL 1UFUA 4GRLA 2Z4QB 1JYNA 4P5TC 3HR6A 1OSPL 1B4RA 1HIMH 4WI6A 1JZ3A 1U42A 5DK0B 3ZKMD 3FO2A 4XP9H 5ESVB 5ID0A 5JDSA 5GHWH 2DQGH 4HWZA 5KSVB 1R5VA 1FZMA 3TT3H 1TQBB 1L6XA 5F21B 2YD7A 3HUJB 1SYSA 4Y4KC 1MPAL 1K8DA 5EPMB 3FONA 1XGTB 5HDOA 1ZEAH 2DMCA 2EDJA 5D7IF 1S5HA 2UZXB 1T1YA 2FATH 1CLZH 1KN2H 4Q6YA 5JPMA 3DGCR 3B9EA 4Y4FC 4U1SA 3STZA 5FYKU 1ZA3B 3NBNA 2BJMH 1I8LC 1MAJA 1AD9A 4XT1C 5KJRL 1MFEH 4GJTB 2AK4B 3B8SA 3LRSB 1M05B 4FQ2L 4GAGL 4G6JH 1M1SA 3HNTL 4CMHB 4JFOB 2R4SH 1Q0YL 3NABL 3TO4D 1I8MA 3FHAA 5C6PB 1WITA 4C83A 5CEYA 1OM3L 4XWOC 2J8UF 5FCUH 5EBLB 1TJIL 1AO7B 1A3LL 4PYHA 4YEFA 1CDCA 1KPVB 1HZHH 2ZUTA 4YHNB 5I8KH 2BVUA 3DVNA 1FL6B 1N0XH 3HG1A 5GQBA 1MNUL 3GKWH 4QRPD 4RMWA 3ARBB 2VDNH 4DW2L 4W70A 3QIUB 5CSBA 4I0PD 5JDJA 3X13A 3UEZA 4H0IA 5J9PB 3ALXA 4OFYA 4KQ4H 4WO4A 1E6OH 4MWFB 2A6DB 1DQML 3MJ9L 5EUOA 1IGMH 2OP4L 1EO8L 3K4AA 2YRLA 3V8CA 4LSSL 1EBPA 2CK2A 5E8DL 3WD5L 1W72A 3Q6FB 2N7BA 5DK2B 2Z91B 4AT6B 1GZPB 4ODHH 1MCPH 3GSVA 3HE6C 4WENB 1CL7I 1AIFA 3OB8A 1A3RL 3QO0A 1G7IA 2A77L 4NQEA 4G9FD 3MRNA 1MEXH 1FAKT 2ZCHL 4JR9H 1DQDH 3GSWA 4DN3H 5TDNA 1N5YL 1DEDA 3LS5L 5BV7L 3VRJA 3RPIB 5EBWA 1R24B 5KVFH 3MV7D 3DYOA 4HS8H 3QQ3B 3T4AA 5KAQF 3O6KH 5DUBB 3VXTB 3ULVL 1NAMA 2BMKA 2DM4A 1F42A 4K7PX 1TETH 1JGEB 4N0CD 1UWEL 4C57C 4M4RA 2IBZX 2OTPA 3DUUB 4U3XA 3GSRB 3JWDH 4ZFFA 1WBYA 2VLJB 1EPFA 5GGRB 4JPIB 5D70L 2UZIH 1WFTA 1J1OH 4NKIH 1C5DA 2ZUSA 4QF1B 4QKXB 4M62H 3RGVA 3HI1A 2XIDA 5IOPB 4XMPL 3ARDD 2XICA 3FAWA 1KCUL 3ALPA 4XBGB 1PGRB 3RBSA 4HUUB 4JREB 4HPOL 1I3UA 2X1XR 3Q1SL 1W8NA 4YAQB 4MMXC 1JYWA 1L7IH 3HAEH 2X1WL 5DS8A 5BZWA 3TZVB 4U1LB 4H1LH 3TCLB 1CGSL 3VI4F 3QJHB 3C8HA 4XCYA 5E6YA 2J8UA 2UY7A 3NFSH 3EAKA 4NHCH 5MP6L 2GQHA 4G8GA 5KS9A 4Z7QE 4LFHG 5FDWB 1V5JA 3SGKA 3D0LA 2QKIA 5GRZA 2B1AH 4LVOC 4ZFZB 4XVUD 5IMLB 1D9KA 2JJTA 3FO9A 2D3VA 3KDMB 1D6VH 2AQ3A 1AGCA 4EOWL 4WHTB 2W0FA 4JZJA 3KPRD 1BM3H 4QRRD 5GGTH 1QLRB 3GZKA 1CLOH 3WIFB 4AH2B 3W0WD 1HHGA 3MBXH 2DTSA 5KG9A 5ESAB 3X17A 1OAKH 1BQHB 1SMAA 1NGWA 1MY7A 5ELIA 2XZZA 3MYJA 2H8PA 3GJFB 1F02I 4JLRB 3TVMD 3V4UL 4PB0L 3STLB 5L7XH 4J8RA 1MCCA 4MMZC 2ZKHH 4DQOH 2G2RA 3E6HA 2OTUA 1UB6B 3ARGA 4PJGE 5SX5H 1L7TH 5DC0A 5DJAB 4FXGB 4AEHH 4G6KL 2KQNA 3OG4B 2J4WL 1C1EL 3C5ZA 1J8KA 3ZTJH 4L8SB 1NCAH 5F7NC 3ULUC 2HT2D 4E41D 2DLHA 4Y5XB 5BS0D 4IMKA 3O8XA 3LD8C 5TE7H 3WHXA 1XCQB 1JI2A 4PJEB 2R2EA 5D7LA 3PWPD 2MKLC 2D03L 1FGVH 5TH2B 3QB7C 2HH0L 4WW2B 2YPLB 3V7AG 1X7QB 4N90E 5CJQL 3EW3B 3SE3A 5JMRA 2D7MA 4GUPA 2Y7QB 4TSAL 3BESR 4J3TA 4PG2C 3PDDA 2FL5A 3QEQE 4QXGH 3M8OL 5FHAL 1NC2D 3F7RA 5D1ZA 5CJOL 3KLSA 1VKXB 4DKDC 3MRBA 4GT7A 4WDIB 2AI0L 3TBSB 1Z9SA 3HG1E 1U91A 2I9LA 1GGCL 1XGQB 4N8VB 5EBMB 1BWWA 2NX5A 4X7SL 1GPOH 1FLRL 1MH5B 4RNRB 4MVBD 5I6XB 1TVHA 3BP5B 4MAYB 3ZL4L 2DYPD 3KPQA 3B6SB 1J10A 4GRWF 1J0ZA 3EJZD 4YO0A 4EIGB 3FQXB 3RZCD 2WLYA 4GW5A 1F3DJ 3QT2A 3L5XL 2X4QA 3QDJB 1YPZF 4DVRL 2ZSWA 1DVFA 4FZ8L 5EZLB 4NCC1 4C56A 3PWUA 4RA3A 3D39B 3OPZL 2RCSH 2CO7B 3PDGA 4YHMH 2DQHH 3ISWA 4QTHA 5FYLD 1TXKA 2FO4A 4GH7B 3UJJL 3QCTH 4MGXA 4F3FB 3V79C 4PGCB 5GRVL 2V5SA 3L6FA 4YIQB 3R8BB 1KBGH 1RJZA 3ECBA 3TPUB 1YEKL 5GS1A 2HAZA 3D9AL 2Z31A 5KAQG 2Q87A 5I1EH 2Z93A 1I9IH 4PP1C 1RD6A 3CSBA 4ONHB 5DFVC 5EZJA 3RWJB 3KPNB 3V5HB 5HYQB 4POZD 1A1MB 4FFZL 5I19L 3H42H 4D9LH 3BUYB 1R3IH 4ODTL 1T2JA 5JW4N 4J23A 3WNKA 5KSBF 3H9SB 4ODUB 3MA9L 4Y8DC 5CZVH 1N6QL 3P4NB 4WUKH 4GBXC 4WY7H 1BQLH 3KNBB 4PLJD 3ARQA 3LSOB 3O9WB 4MD0B 4Q9QH 4DOHB 2B39A 2H6PA 5DD0L 4IHOB 4WTWA 3IDXH 1DN0A 3OB0K 4YHYB 4FQJL 3RVXC 2JB5H 1LP9B 4EBQH 5D7IE 1M71B 1XF4A 3V6FB 4D2NA 3FFCA 3WNPA 5EU6D 4FQXB 4BH7A 4KRMB 2LVCA 2ATKB 3BJ91 3EHBC 4K94C 4F58H 1JL8A 2RBLA 4OCRL 1ZGLM 1YMHA 4ERSH 4QRPE 3BXNA 1VPOL 5DGQA 1BLNB 1TTUA 3T1FA 2ITDA 4JFDD 4EN3D 3D2UA 4LMQE 3OKYA 1ORSB 2ADGA 1RZKL 3ARFC 1A7BA 2BSED 4BJLA 3VXUE 4ZO6A 4JO4L 3V7AE 2J8UE 1S9WB 1JNNH 1U95A 1EXUB 1BBDH 2R4RH 5TFSL 5HPMB 3VU2A 3FTGA 3TV3H 4W4OC 3O3BA 4UILL 4OZIB 4PD4J 4FP8L 2P4AB 1IC7H 2VZ1A 4Y5YC 3AS1A 5JA9A 3GSOA 1T6VN 2ZUUA 3GM0A 5L0QC 4M7LT 2I07B 4WW1B 1CGWA 5I9QB 1GGIH 5F93C 3MV7E 3UZQA 1EK3A 4CDHA 1JGLH 2F5BH 2XA8L 2XV6B 2B1HH 4TPRL 4U1MA 2CSPA 5FA4A 5C07A 5BO1H 1MCDA 1EEZA 2ZNWA 3UJIL 3MJ7B 4UU9A 1R3HA 4JFYB 2GUOB 5I1CL 4L3AA 1S7SA 3GSQA 3MOAH 3LV3A 3LPFA 2R0WH 3FN0L 5FUZH 4N8CL 2EIZA 2ZUXA 1QBLL 2DBLL 1U8IB 4HKXB 3MLPA 4NIKB 5I76B 4PRHB 3LDBC 1E4KA 4NYLB 1G6VK 3HC0A 1ROWA 4FNLH 5CILH 1PY9A 2AW2A 3RUGF 4EDWH 4HULB 1N3NA 5E00B 5INCB 1SYVA 1QVOB 1QLEH 3IJSB 4X4YA 1ZHNA 4N5UA 3O11A 2P8MA 3C9NA 5IMOB 1ACYH 1Q94B 5KSBA 1LEKA 2GY7B 4HBCL 2X9XA 3NCEB 4X8JB 1N5AA 4V2CB 3I6LE 3MGTA 2NY2C 4F80A 3SBWA 2F53D 3MLTB 4MSWA 4Z7UA 1ZAGA 2YA0A 5B38A 4XC3H 3VJ6A 2PR4L 4PGBA 1YN6A 4NOFA 2NZ9C 2JB6B 5KSUB 3O3EB 1G9ML 4ENEC 4AK1A 1RUPL 4LPXA 3F58L 1JRHH 3BIKB 3BP4B 1A9BA 1NFDB 3EO0A 4LSVL 5EIIB 2MHAB 2VL5A 4HKBA 2ITCA 5D1XC 4XNQA 3OJ2C 1RK0A 3P4MB 3DX6A 4LEOB 4QRRE 4O9HL 4HUNB 3PP3H 5HHVH 5E2UL 3VI4E 1M7DA 3S96A 3FB7B 4KQ3H 3FT3A 1FRGL 5FYJH 3U36B 5IKCA 4PP2A 1UA6H 3FQTB 5T1KB 1INDL 4GAJH 4HKZB 3WSQL 4AG4L 4OFIA 2E8YA 4XP1H 5HGBB 3VWKA 1ORQB 1G7HB 1F11B 2NMSA 2R1XA 2BOBA 1TFHA 3IS1X 1LK2A 4C56E 3AS0A 4O4YL 1BJ8A 1NBYA 5JHDD 1MREH 4OAWB 5BMFH 4L3EA 4Q97A 2FO1A 3HZMA 2A9NL 3QUZB 1FYTD 1JGDA 3X12B 4Q7DA 2BDNL 4KVCL 3UMTA 2R9HD 3MSPA 2VXTL 4U49A 4JPWL 4E41E 4IRJD 3L3GA 1ZKAA 5BS0E 3OV6A 1FYHB 4Q9RH 1YECH 1WGOA 3ULUH 5CJXC 3BKYL 3HLAB 1IM3B 1YN7A 3PWPE 3QQ4B 5B38G 1NCDL 2AJYL 4N9OB 1HHKB 4GXVH 3EDKA 4DKEL 2HMIC 3O6FC 3VFSB 4M6AA 4L4TA 3LKOB 3EO9H 1NUFA 4C4KO 1RZFH 4RWYL 1R0AH 4KZDL 2CGRH 2G75A 2VXVL 3JVGA 1GXEA 4PLKC 1S7TB 2NW2B 3OXRB 2F8XC 1YNTA 2X2YA 1JN6B 1KFAH 1LO5B 3MOQA 4PJ5B 5D7JD 3FN3A 1NCCL 2WBJC 5ITFA 3ZT7A 4U1JB 3E8UL 3UTTA 4CRPA 2BVQB 3VWJD 2CRMA 2W1NA 3H0TA 4L4VD 4OQTH 1Q38A 5DHYA 3OJVC 2DTMH 5B21A 2IPUK 4F7TA 4ZSOE 3KPSB 1ZXQA 4M1DL 3QDAA 4QWWC 3VFMA 2MTPA 5E4EC 2Q76B 4WWKB 4YHOL 1OHQA 5T1LB 3SCMD 3OG6B 1J9CT 1F2QA 2J5LB 1H3WM 3ESVF 5F1NB 3I84A 4MXWH 4Z7VF 3U0PA 4G7VH 3C8KA 5C0BA 1ZSDB 1WAAA 5GRXG 1OT2A 1FPTL 1V7MH 2NXZB 3G6DH 4QHLB 4F33A 3W9DA 3EYSH 1G0XA 1MFAH 1GIGL 3SDXF 3T3MF 4HCRA 3ZYJA 3O2WL 4GRWE 5L9DH 1YY9C 4YDVA 3W81A 1W0VA 4LNRA 4UZGA 1UH4A 5IW3A 5CD5D 3U7WL 1VFUA 5DFTA 1YPZE 4LSTH 3F7YB 3BSZH 5DJDA 4RA0C 3RL1B 1NUNB 5D7KD 4WEBH 5E8OB 1RJCA 4GQPH 3TWCL 4L1HA 3O6LH 4NZUL 3QNXB 1RJLB 4XVJL 5GS3A 4OBSA 2NY7L 5CINL 3QO1B 4HCRL 5MI0C 1XIWD 5IIEA 2QSQA 4R26H 1AY1L 5EU6E 5T1DH 2BOCB 3HZKA 2HVKA 4AQOA 3VFTA 4UNVA 1QR1B 1BZ7B 3QUXA 2K1MA 1IGIH 3BKJH 4N0YL 3V4VH 3G04B 3BPOC 2OQJA 1ZT4A 4K94H 1QRNA 5KSBE 4WEUD 4JFDE 3IDGA 4X6FB 2AXFB 5H35A 3AC0A 4G5ZH 5IB4A 4YWGH 3BP6A 1LNUA 4UINH 4CBPA 3NH7H 4TULH 4EDXB 1A2YA 3B2UD 5E2VH 1Q9LB 4MQ7B 9CGTA 2GTZB 5T33H 4KUZL 4MCYB 4OLZH 3GHEH 1JTPA 1OAXH 3N9GL 2OK0L 3LZFH 2IWGA 1HKLH 4XNZC 4XAKD 5IHUH 2E7CA 3KPLB 4XAWH 1H3TA 4DAGL 5JR1H 1CFNA 1EAJA 2XKNA 1DL7L 1Q72H 2YUWA 1LO4H 4LBEA 5J11B 1Q9WB 3QDHA 4L8CA 5C08B 4LLDB 5IB3A 4LF3B 1BFVH 4J7RA 3SN6N 2EDDA 4OZFB 5MERA 3VFVA 3K8MA 2GT9B 5FUCE 3ZHLA 3SOBH 4FQ1H 1OCWL 3TA3A 2XWBA 3BO8B 3NPZB 2X1PA 1OARL 4QXUH 3HCVB 4L9LC 1RU9H 2HLFD 3ARSA 3MO1B 3MLWH 4KFZC 1GAFH 4PRPB 4QNPE 4L3EE 3KJ6L 4P5TB 1U8JA 2FRGP 4XNXL 4YLQT 3SDXA 4XRCB 4ZO9A 3T4YB 3ZKNC 4NKQB 2BC4B 1R5WB 1FV1B 2BRQA 5KOMC 5E9DB 3C60D 2ZPKH 1U6AL 4RQQB 1YEHH 3ULSA 4OLYH 3IDJB 1YEIH 2J1KA 1WIPA 3BYTA 3MXVH 3UTQA 1FN4B 2F53E 3L3HA 2YR3A 4Y4KB 3R06B 4YBQC 1B9ZA 4OZGA 3Q5OA 2A74B 2I9TA 1AGBA 4AJ0A 5LAXB 3ZHKA 4L4TE 4Y2OA 4A2MA 3CVIL 1OQOA 2CUMA 4TUJA 1LGVA 4RMQA 5IGXL 5F70A 3DSFL 2OR9H 5JZ7C 5B8CB 3SDCD 3RUGE 3QFJD 5SWZD 5BV7C 4OD2A 4NC2B 1XGYH 4KJQD 4LAJH 4YGVB 3WNMA 2R1YA 2BNRB 4WIQA 3D69B 4OV5A 3O2DH 2OJZL 2AKRB 3QZWA 3ULVC 3PHOB 2YA2A 3IF1A 2VXUL 3PJSA 2BX5A 4XMKL 3MA7B 4MZ2A 4QRTA 3T77B 1CCZA 3LRHA 4I77H 1A6UL 1ZMYA 2VDOL 2AJ3A 2W65B 3G6JA 1IZJA 1U8OA 3QNYB 1JZ4A 2GK0B 4X5WB 1KEML 2P8LA 5KSAA 4OGZA 5I1DB 3CXDL 3OKDA 1SEQH 4PRIB 3PNWB 1MCBA 1U2CA 3S36X 5JHDE 5KVDL 4ZS7H 2NY1C 5SWSD 2FD6L 1U36A 5A40E 5B39B 2EIBA 5C0BE 3BQUD 1N4XL 4JRWA 4NBYB 2KBGA 3EDFA 3B8YA 5EFIB 5EOTA 5IFJA 3SJVA 1JMXA 1MCJA 3Q2CA 1LEIA 4LDEB 3LKNA 4RAHA 3DVIA 4X6DB 1KPRB 5BVJB 7FABH 3RGVC 3NN8A 1MI5B 2W60A 5ICZA 1IJ9A 4QT5B 5ALBH 2K7PA 1A6WL 2AJVH 5DC9B 3TYGL 3RTQB 4X4ME 3S37H 2GY5A 3A67L 4ALAH 4TUKL 1AQKL 1T7XA 1RIUH 3IXAB 4UIKL 2IH3B 2VXSL 5HY9B 4MCZB 5EZOL 5ITBH 5GJTL 3VH8B 4OGXH 4XNUH 2VRAA 3FQUB 4NRXB 3QDGD 4MD5B 2X4PA 2BFVL 4V1DD 3SGKC 3CFJB 1IGFH 5KW9L 4IIQA 3QZWG 4MX7A 3OR7A 3WE6B 2JJTC 3UAJD 2W9DL 4HH8A 5ICYB 1ZVHA 1P69B 2ZOKA 3H9YA 4L4VE 4MLIA 1AR1C 4MJ5A 1OB1B 5IEHB 1ERNA 4JZJC 5I2IB 1WUNT 4KKLC 2PETA 2QQNH 5KVEL 1QSFA 4KKBD 4UOW0 5AEAA 1WSST 4A2LA 1EFXA 3CFDA 4IRSB 3GBMH 2Z9TA 1OOAA 3QRGL 1WZLA 2MCPH 1RURL 2EDQA 3FFDA 1S78D 4LDLB 3ROLB 4D8PB 4XXDA 4LCIL 5E99H 2JCCB 4D0BB 3SO5A 4J6RL 4KI5D 1A4JB 4XCEA 1FFPB 5H2BB 4M1GL 3ARGC 3OSKA 5CBEB 3VFRB 5LGJB 2MJWA 5MENB 2CK0H 5EO9B 3E3QE 4GXUM 1U3HA 3C5ZC 3MLZH 4K2UH 3G5XA 3TF7C 1BPVA 5I16A 3KLHD 2Y07L 1C08B 3OWEA 5DMJB 4NC0B 3EGSB 3NIDF 4IMKC 3O8XC 2R8SH 3OR6A 4BSWA 3WN5B 5BXFB 5D7KE 3O41B 3SGJC 4Q9BA 2FIKA 2PW1A 4JDTH 4JAMB 1A7OL 2AEQH 3CJJA 4FZEH 4Z7VE 2PO6B 1ZLSL 3WO4C 4NOBA 1W0YT 3P0GB 4ZOBA 4FQLH 3UO1L 3MODH 5DDHB 4G9DA 4UQ2A 5AD0A 4HWUA 4JKWA 5K9OB 1BFOB 2QLVB 3BGFC 4EI6A 1PZ5A 3SDXE 1UXWB 1YEGL 3T3ME 2CUIA 2O5XH 2UUDH 2PF6A 2X4TA 1NMAH 1PSKH 2O26U 4YHPB 5EOCH 3TBVB 5I74C 4ZUUA 5D1ZC 1OSPH 4R3SB 5TQ0H 2Q3ZA 1VFAA 3TEUA 3AGVA 3Q3GA 2L7JA 3CZFB 3EJYD 2PTTA 5DVLA 1NAKL 4P4KD 5JOFB 3HI6L 3VFPB 4ZXBD 2QQKL 3LPWA 4HMCA 4YBHA 5E1AA 1MPAH 4ORGB 4UDTA 1S7QA 5J89A 1DBJL 4E42B 5BRZA 2BY0A 3DRQA 1OTSC 1DVFC 4XAKE 4JZNA 3C5SA 3MRHB 1IAOB 4CVZA 5IMKA 2W91A 4JHBA 1VESA 1HYRC 1G7MB 1KB9J 2EECA 1PLGL 2Q6WB 5IB2B 4WI8A 5GZNC 1H15B 1X4XA 4PGZA 1YDPB 1J8HB 2MPAL 4G6AC 4GAGH 5D93B 3HNTH 4LVEA 2F54B 1Q0YH 3TT1L 1EGJA 4OLXL 3MBEA 4P2OD 5H8DA 4H20L 1KLUA 3NCJL 4NDMB 3VXOB 1RUAL 2AJSH 2WMPA 2NY3C 1TJIH 2ICEA 1A3LH 3QQNA 2A6KB 3WFDL 2ZJSL 5EWIL 4HUWB 2ED7A 3VDCA 1CQYA 3OGOE 4JPKH 5CWSA 3GMNA 1OW0A 5C2BL 1JUFB 1DEEB 1F90H 4TSCL 4PJXA 4HUKB 1NMBL 4PR5B 4AM0B 4BZ2L 2XN9B 1EGJL 1RZKC 2IJ0C 4RFOL 4DW2H 5L6YH 5KTEL 1JF6A 2YBRA 1KJMB 4HUXB 1KJ2L 5CAYB 4ZQKB 3RWHB 4JPVH 3TBYA 1HN1A 1NJ9A 3SPVB 3OKNB 1DQMH 4O2FB 2OP4H 2CKBA 1EO8H 3P30L 4RFEB 3ZKSD 4M1CC 4X6EB 1KT2B 5E8DH 32C2A 3WD5H 1YA5A 2H32H 3Q48A 4WO4D 1KEGL 4N0FB 5AWNL 2EDWA 5TF1H 5GGUA 3QUYB 4PREA 4WU5B 2CLZB 1A3RH 4CNIB 5A2FA 3QFJE 5SWZE 3PQYD 3VGHA 5ADPL 3MRJB 4JFFB 3OHXB 4OSUL 4R9HA 3SY0A 3M17A 5E8NA 1SY6A 4U1GB 4I8DA 4BQ9A 1FLTX 2OZ4A 1LE5B 1N5YH 3TO2B 3LS5H 5BV7H 2DKSA 3R4DA 4CL7A 1SBSL 1W72H 2KH2B 3O6ML 4JO3L 4R4FH 5CLTA 4BQ6A 4F9PA 4P5KB 1JF1A 3MOBL 3QIBA 3ULVH 4QHKI 2AXGB 1C16A 5C0CB 5K9QI 3DX7A 2L0DA 3Q6GL 1UYWH 1EUUA 2OZ4L 3MRDA 1JGUH 3P0YL 4ZUVB 4PLJC 4FG6C 2Z8VC 4NBZB 4ODVL 3B2VH 3WJLA 5E5MA 2VZUA 5SWSE 5D70H 3U4BL 5I30L 4ONFL 4BFIB 2XZAL 2E6PA 1FHGA 1T22B 3ZKXB 4XMPH 1FNAA 3ARFB 3UTZA 1KCUH 5D1QB 3MREA 5IVZA 1EAPA 3WUWB 5L2KD 1KF9B 3Q1SH 4XI5D 1G9MC 1E4XL 5EA0L 5IFHL 3R0NA 1CGSH 4PJHB 1YMMB 1L0QA 4KKAD 2EZ0C 4OI7A 1EVTC 4XTRC 2DDQL 3VG9B 5FO9B 5MP6H 2R2HA 4HJGA 4UBDD 4XGZB 3BHBA 3SBWC 3DPBA 2RFXA 1S7XB 4OFDA 3IETA 1T1XA 3BZFA 1AGEA 2E6QA 2OL3L 3MLVL 4J12A 4X0KB 1ZT7B 2GJZA 3CSYA 3QDGE 2DB8A 3IS0X 4S2SB 4V1DE 3L3IA 5A2JH 4BK4A 3LMJL 5ESQB 1MCFA 3U0WL 3ZDYF 2VTFA 4JFXB 3N1PC 4FFVD 2Y5TA 5HPOA 3SDAD 5D4QA 4IJ3C 2R39A 1KJ3L 5E6ZA 4V2BA 5EC1A 3IDUA 1KNOB 4BFGA 1CG9B 3V4UH 4PB0H 2NY4C 2EH8L 1QBBA 5A43C 1R3KB 3G08A 3MFFA 1WTLA 3RWEB 5J3HC 3C09C 1FO0L 4G6KH 2X4OB 3P9MA 2DQUL 2J4WH 1C1EH 2FB4L 3MNZA 4I2XB 1H3PL 2NXYC 1RHHA 1I1AB 3VWKC 2X89D 2D4DA 1X5YA 1CWVA 2Q86A 3G5VB 3LEYH 4P2RD 4AEFA 3I2CL 3WHE1 1BVLB 1I1CA 3DO7A 1OWRM 3SGDI 1X5GA 4G42A 2VQUA 2OCFD 2ICES 1T04B 1BZ9A 3TCXA 1E0OB 4K7PL 1XZ0B 5GSVA 2D03H 2CDEB 5C0FA 3VFUA 2M26A 5D6CA 5LXGH 5FV2A 1KENL 1XF2B 4YDIL 2P46B 4C54A 1K2DA 2CKNA 2W9EH 4JVPA 2M2DA 4NO2A 4OFVA 2VLKA 4X7DC 4C4KT 3EYUL 3M8OH 3BT2L 4JM2F 2ERJB 2IQ9L 5FHAH 3V0VB 3SO3B 5CJOH 3S88H 1SEBA 1ZS8A 2AI0H 1HXYA 2Y6SD 4ODXB 5GGSA 3PABA 5EU5B 3G5ZA 1GGCH 2BVYA 4PV8A 4X7SH 1FLRH 2Z4QA 3NIDE 4R90L 4Y88A 3VGFA 5HVFB 4G7YL 3REWB 3ZL4H 5DK0A 1BJMA 1HI6B 5ESVA 3QUML 4KK5C 5KSVA 3GMQA 4D3CL 4DVRH 4NUGL 4FZ8H 2UY6A 5DGRA 4JM2D 3HUJA 3AB0C 4JGJA 3MCLL 1Z9OA 5EPMA 1XGTA 3RWCB 3SE9L 3RRQA 2C26A 4I3SL 1X5KA 2GJ6D 3TN0D 1YEKH 3R8QA 1ZA3A 1JYVA 3D9AH 1KIQB 4LQ1A 3F5WB 1IKNA 3LKRB 3TC9A 1Q9OB 4DGYL 3NZHL 1TNNA 3KHOA 4FFZH 5I19H 4HK3N 4ODTH 2AK4A 2NTFB 3S35H 3GGWB 2OX5A 3LRSA 3MA9H 1M05A 5DHVB 1QSEB 1N6QH 5D8JL 5DUPL 1HHIB 4JFOA 3RDTB 2ID5A 3U1SL 5DD0H 4P23C 2VZSA 4X7EC 1VA9A 1IQDB 2X44D 4I48B 5EBLA 3IDYC 1AO7A 2WQRA 4HZLA 4YHNA 3K8LA 3WBDA 3V0WL 1MCQA 1FL6A 4TVPL 1GHFL 2YSSB 3ARBA 3SQOL 2I25N 4YUEH 1VPOH 3CU1A 1AGFB 1TJHL 3NPSC 3N85H 1A22B 3SE4C 3QIUA 5EU7C 2ZUYA 4RISL 4P59L 4YK4C 1T03L 5E4EB 5J9PA 2IBZY 2FEDD 4Y16B 3QUXC 4MWFA 1RZKH 2A6DA 4P49A 2HN7B 3VWJC 3TESA 4JO2L 4JO4H 1H3XA 4Y4HB 4LIQE 1U8LB 1V3LA 3Q6FA 4PY7B 4Y19A 5DK2A 2Z91A 1N7ML 1GZPA 3LS4L 5TFSH 1H8SA 3UDWC 3EZ8A 2IQAB 2FHBA 3I6GB 2E7BA 3A6BL 4UILH 4NRZA 2XWJB 4FP8H 4JKKA 1IEBB 2FR4B 2VZOA 4U2YA 3MRCB 3MV01 4NN5B 5I73C 1BGXL 3RPIA 4XWGH 1R24A 3WEXB 2ZCLL 3MPCA 1MAML 4E5XB 4R4BB 3QQ3A 4CVWA 3ETBF 5DUBA 3VXTA 5JXED 5CSGA 2E9JA 5M95B 1JGEA 3UJIH 4KROD 5DA4A 1FSKC 5CD5C 5C6WH 5IVXF 3WFBL 3NCMA 1MFDH 3DUUA 3PWNB 1Z9LA 4AIZB 3FN0H 4KDWA 1MHCB 1D3CA 1PEWA 5GGRA 1QBLH 2DBLH 4JPIA 3UBXG 4YHKH 3BPOB 3I50H 4QF1A 1WEJL 2AK1L 1OSZB 1LHZA 1NANH 5GJSH 4IOIB 4XBGA 4HBCH 4HUUA 2J8OA 5L2KE 4YAQA 3T08A 3JBG7 3TZVA 4U1LA 3TCLA 2PR4H 3QJHA 4NO3B 3LKPB 4NNXB 5HGGS 2LU4A 5F1IB 1G9MH 3WXWL 4XNZB 3K1KC 3ZMRA 3MRFB 1RUPH 5CGMA 1JPFB 4PJGB 5FDWA 4ZFZA 1E6JL 4WUUD 1DFBL 1UM6H 5IMLA 2VLKE 3WNNA 4LMQI 4LSVH 3KDMA 2AGJH 4YJZL 2A0LC 1F97A 2VQ1B 3RHWF 3H3BC 3QCVL 4XXCA 4ESKA 5D9SB 4WHTA 5F6IC 4WFFD 1DUYB 1QLRA 3WIFA 4AH2A 4GS7B 2UV3A 4O9HH 1WTGT 4JHZA 5ESAA 5FYJU 3H6JA 3LB6D 2IC2A 2BHUA 3QAZC 2MQ3A 4F7CB 1BQHA 5FUOH 2F5AL 1FRGH 4ZDHB 3DMMA 4HIXL 4L9LB 5CLWA 1HEZB 3L1OL 1INDH 3GJFA 4JLRA 3WSQH 4I18B 4AG4H 3STLA 3C8DA 1OAUL 4LHJB 1UB6A 2AJUL 1BF8A 4PJ9B 2VSCA 5DRXB 5DJAA 4FXGA 1JWUB 4KRPD 4O4YH 4JY5L 3RY5A 3QEQB 3QIWB 4P9HC 4L8SA 2CH8A 3QCUL 1LP9F 2A9NH 5KSAC 5D2NE 2BDNH 3K4ZA 2IMNA 3DVNB 2VXTH 4XH2B 4JPWH 4Y5XA 3HG1B 4S1DD 2K9UA 2MQ0A 5F9OL 2F15A 4HS6B 2H32B 1NMCB 3BOVA 4RX4A 1XCQA 2EYRB 4PJEA 1JZ6A 3BKYH 4O5LL 1DE4B 3U6RB 1I8IB 1NCDH 1ZE3C 3CXHJ 5TH2A 2AJYH 3QXUA 4TVPE 4WW2A 2YPLA 5DLML 5CEZD 3HE7C 1X7QA 3SKUD 4DKEH 1KGCD 4I3GA 2Y7QA 1P84K 5BV7B 2YRPA 2FH6A 4KZDH 2EDFA 2VXVH 3LY6A 3VXMD 4LAQH 4JFZH 3RZWA 1VKXA 4JHAL 2APWA 4WDIA 3K7UA 4J2XA 3TBSA 3S9DB 4PJ7F 5F1OB 1YJDL 4D0DB 1XGQA 2MNUA 5IQ9B 4N8VA 5EBMA 1NCCH 4DTGL 1O0VA 1MH5A 4RNRA 5TDNB 3DVGB 2JTDA 3BP5A 3A6CH 4MAYA 1BQHG 4UT9L 2AJXL 3B6SA 4HZAA 3D5OF 3FQXA 2J88L 3T4AB 4DFHA 1S8DB 4LPTA 4M1DH 4TYUA 3QDJA 4IIQC 2NY1B 3MRLB 5EZLA 1BBJB 2F74B 3T0ED 4Y19E 2DN7A 3D39A 4ELMF 5D7IB 2R0LL 1HXMB 1EDQA 4IRZH 4NWUL 5JW3L 4F3FA 4PGCA 4KUCF 4YIQA 2LQRA 3VMOA 3S8WA 3UTOA 1DSFH 3TPUA 1FPTH 1FL5B 2GJ6E 4QRPB 3QWQB 4XCCH 4KWUA 4C55A 1GIGH 3RWJA 2OXHA 3V5HA 3KPNA 2VLRD 5HYQA 1KC5H 3BN3B 1A1MA 3O2WH 3BUYA 4I0PB 2PXYD 3H9SA 4ODUA 3U7WH 1J87A 2EC9T 3P4NA 1G9NC 4PTUB 3QXVA 5DS8B 3KNBA 4QCIA 1F8TH 4ZNEA 3MV9D 3O9WA 3LSOA 4MD0A 3VXUB 4HXBH 3GNMH 1U3HC 3NFPB 4IHOA 2FZ3B 3BJLA 2YD3A 3TWCH 1X5AA 1LP9A 4POYA 4NZUH 5JUEL 1M71A 3V6FA 4KUCD 4XVJH 5MEQB 2NY7H 4HCRH 4FQXA 2ATKA 1AY1H 1KOAA 4OT1L 2RAMA 4JCMA 1IE5A 5CEZL 4NZJA 3FQNB 4Z9KB 5F97E 4N8VG 2YUVA 3FJTA 2AEWA 1JK8B 1QQDB 3QWRA 2VL4A 5HI3D 4OCLC 1ORSA 3RL2A 3QPQD 2R56L 5IJVB 5IQ7H 3MV7B 3DUHA 4K71C 4L5FH 1S9WA 1HWGB 3B83A 4OLEA 4NN6C 5J6GB 1EXUA 4DN4H 3T2NL 2C1PB 5HPMA 4KUZH 5JQ6L 1F3DH 2V7NB 3N9GH 2APFA 5E24E 2VDQL 3C5ZB 3C6LC 1A14L 5J1SC 4OZIA 1EHNA 4DAGH 1RJYB 3D85A 1DL7H 3KXFE 1SVCP 3MRQB 3ARDB 3SDDD 2YWYA 2I07A 5B4MC 4L3CB 4WW1A 3CDFA 5HHPB 3JTSB 4G3YL 4YH6A 1TZHB 1OCWH 5IVOA 1KV3A 3MJ7A 4JFYA 3U9PL 3VXPB 3NVQA 3O4LD 4NWTL 2GUOA 5D6DA 1OARH 3MCG1 1CXKA 3BGFB 4HV8B 2AEPL 4Z8FH 1GC1C 4HKXA 1U8IA 1JTTA 5I76A 4PRHA 3KJ6H 1BMGA 4XNXH 4NYLA 2HKFL 3W2DH 1IEHA 3ARZA 4LRNH 3V6BR 5E00A 3MBEC 1CF8L 5INCA 1QVOA 3IJSA 3PP4H 5IMOA 1Q94A 2P8PB 3HFML 3VD7A 1NANI 1U6AH 4X8JA 4QRRB 2EDYA 2WAHA 3REVB 1MFBL 4H88H 4JHWL 3MLTA 3N1GC 1GH7A 1T89A 2JB6A 5KSUA 1I7ZA 3O3EA 5IVXE 1UCBL 3QULB 3X11B 2WP3O 5C70A 3AS2A 1QBML 2NYYD 5I8OL 4WFED 3E0GA 3BIKA 3BP4A 5IGXH 4Z7WB 4KK9D 3DSFH 3UJTH 4P4KC 1NFDA 5EIIA 1T5WB 2MHAA 4QEGA 4UAOB 4EQ3A 1UEMA 3TNNB 1MCLA 3AVEA 1MLCB 4E41B 3PHSA 5DT1L 3P4MA 4XPTL 5BS0B 4HIJB 5J57B 3GMPB 4LEOA 5E0QA 2HT4C 4UOJA 2EXWD 2OJZH 3ESUF 5B22A 2VXUH 4K8RD 5FYKH 4XMKH 3LAFA 4D0CB 3FB7A 4O58H 2BERA 3NGBB 2VDOH 3PWPB 3U36A 4TTGA 2Y72A 4RGMB 4ONOA 3FQTA 5T1KA 2BSRB 4HKZA 4JZOB 1A02N 2EC8A 4OD3H 5HGBA 1ORQA 1G7HA 1KEMH 3HKFA 2CD0A 3BEWB 1F11A 4N9GB 1IRAY 3CXDH 1LE9B 4MS8C 5DJXB 2IBGA 4YQXH 1NFIB 5TDOB 4NKOB 4PGJA 4OAWA 3QIBC 1VGKB 5KVDH 1X5IA 3QUZA 5DEFB 1TVBB 1F2XK 1NC2B 2FD6H 5ERWB 4HAFA 4KV5F 3TNMB 3X12A 4P2OC 1N4XH 4P9HH 2RB8A 8CGTA 4G8FB 1QUNA 1YMHB 2XWTB 3MGOB 4ONGH 1TTGA 3WJLC 4HJ0D 5JORB 1I1YA 2EO9A 5JNYB 3HLAA 3I85A 1IM3A 1OP5H 1PFCA 3SE8L 1RI8A 3QQ4A 4RAVB 1ETZB 3T3PF 1HHKA 2DYPB 4U1IB 1A6WH 4LOUC 1K3IA 3RZCB 4ZSOB 5CEZE 3TYGH 3VFSA 4ZNEE 2CR3A 3LKOA 1GOHA 3A67H 1AQKH 1HYSD 1JIBA 1LP9E 2Z8SA 2HJKB 3S5LB 2VXSH 1S7TA 2J8HA 3VXME 5J13B 2NW2A 5IHZB 3OXRA 8FABB 4RFNB 1JN6A 1LO5A 3BN9C 4PJ5A 2RIKA 1I9JH 2BFVH 4U1JA 1F58L 2B4CC 3QFDB 2BVQA 4NGHL 5KW9H 1GYAA 1E27B 4GRWB 5I1GH 2W9DH 3NZ8B 2ADJB 2V5YA 4CN1A 1U92B 1ES0B 4MJ2A 3RY4A 1YPZB 3W9EB 3T0DA 5C0NC 3KPSA 15C8L 2MWCA 4PJFB 4DGVH 5KVEH 2H1PL 1A6VL 2Q76A 2VWEC 4WWKA 2VDML 5T1LA 1I7RB 3T0EE 2NR6D 1T20B 1RURH 4JFED 4KK8D 3CDYA 1JNLL 3CFCH 2X1OA 4K8RL 5F1NA 4LCIH 4PJ7E 5EU6B 1ZSDA 4RMVA 4TSBL 3MLSL 5HVHC 4M1GH 5L2JB 4QHLA 3UZEA 1ZV5A 1WBXB 3CAFA 1KG0B 2ZZUT 4AL8L 4JFDB 4EN3B 3L7FB 3OF6A 1VACA 2Y07H 3TGXA 4YE4L 3F7YA 5C09D 3RI5F 5JOPD 3RL1A 2CRIA 3MV9E 1YN6B 4OJFL 3S36L 1P6AB 3VXRD 4ELME 5E8OA 4O51B 12E8H 1OAQL 4P9ML 1A7OH 1BFSA 1G9NH 3B4NA 5GS2H 1ZLSH 1RJLA 5DJCB 3GSUB 3FL7A 3QO1A 5GIRB 2BOCA 4MA1C 3CVHB 3EO0B 2MQCA 4GKSB 3WLWD 1BZ7A 1QR1A 1MWAL 4FN0A 3S34L 5T3ZL 4JKPL 3CPLB 1LO2L 3RVVD 1YEDB 4LPCA 4ZTPH 5IP4A 2NY4B 4X6FA 2AXFA 1QYGH 2YMXL 3ARRA 3AREA 5CJ5A 1M7DB 3S96B 4JO1L 1ZLWK 4F7MB 4FFYL 4U3HA 2XTJC 3C09B 1OPGL 1KLGB 4PP2B 3BRFA 4GOSA 3HI6H 1WC7B 3AAZB 4EDXA 2QQKH 2H2PC 3SDAC 4JFPB 4HFWB 1Q9LA 3VWKB 3OXSB 4MQ7A 5ACMA 4P4RB 2N56A 4MCYA 4LRIC 4Y0GA 3MLUL 4K23L 5A1AA 1QKZL 3TM6A 3DX9B 3HMXA 3RWGB 5TPWL 4L3EB 3GRWA 3LEVL 5IV2B 3KPLA 1DBAL 1FVDB 3PIQB 4BUHA 3KYOB 3ZE2F 2CLVB 2YRZA 1JWSB 4MNQD 1Q9WA 3L3GB 5C08A 2QHRL 4LLDA 4LF3A 1PLGH 4QY8B 4TQEL 4OZFA 3FQWB 2IGFH 2GT9A 2F53B 5EU3B 1N26A 5E2TL 3HMXL 4F2MB 3GRWL 3P0VL 4BSVA 4H5SB 2OMBA 3BO8A 2YD6A 4RGOL 2LU7A 3TT1H 2OJEB 3O4LE 4OLXH 1CBVH 4S1QL 3HCVA 4H20H 5CD3B 2IBBA 3NCJH 1RUAH 3WFDH 5EWIH 4PRPA 4CMHC 3RUGB 4P5TA 1MHEB 4LVHB 4XRCA 3T4YA 3EIFA 2BC4A 1R5WA 1NKRA 1YNTB 5C0AD 1FV1A 5HHMD 1GC1H 4TSCH 5HVGB 1NMBH 4BZ2H 5ITFB 4LSUH 4RQQA 4Q0XL 1EGJH 4RFOH 1C5CL 3IDJA 3BZDA 2ZP0T 1FN4A 5C9JB 1KJ2H 1T7WA 2CQVA 3ARBC 3R06A 4Y4KA 4PJCF 3RBGA 1LD9B 3BMWA 2A74A 1DBKL 3P30H 5LAXA 3QIUC 3GUTA 3K46A 4ZOAA 1PJ9A 4N5EC 1KEGH 5AWNH 1FBIL 5T3XD 1VADB 5B8CA 5JHDB 2ARJQ 1I8LA 3DROB 4R0LB 1CK0H 2FX9H 3FT4B 2AAVA 4JM2C 4EI5D 4YGVA 4OSUH 4K9EH 2NY5L 4ZOEA 5DVNA 3T0BA 4PJ5E 4IRJB 3WIIH 4QXTB 3BYYA 3DV6B 2BNRA 3D69A 2AKRA 5HBBA 3T77A 1KTKE 1SBSH 3MA7A 1CE1H 4Z18A 4OZFG 4P23B 2HTLC 1RVFH 4JE4B 2W65A 3O6MH 4JO3H 1BVZA 3MOBH 3QNYA 5GZOC 2DIBA 3L3KB 2WUBL 4X5WA 4JDZA 4ZUTB 2BNQD 1G7JB 5I1DA 3BW9B 1SY6H 1KCLA 4PRIA 2OZ4H 3PNWA 2MMXA 3L5IA 1QFWH 4HFUL 4ODVH 4LLQB 5HI5D 1OP3K 3NPSB 5B39A 3FMGL 4OF8A 1E4JA 3U4BH 5I30H 4ONFH 1ZGLB 4MQTB 5EFIA 3GFUA 1Y6KR 4R7DB 1HINL 3GMOB 4YFDB 4CAGA 3VWJB 4X6DA 1KPRA 3LKSB 1ZT4B 2R69L 5BVJA 4HWNA 1MI5A 3V6OA 4L4VB 5DVKA 3BDBA 3V0AC 4QT5A 1AE6H 5TF0A 1E4XH 4FQCL 1BQSA 5EA0H 4EVNB 4OGAD 5H35B 5IFHH 4S0SD 3RTQA 3EKCA 4BA8A 1RUKL 4JREC 4R96B 1BIHA 3V5KB 4KJWD 4ZAKD 4XVTL 3IXAA 1A2YB 2HJLB 2DD8L 2FEDC 2YKLL 4J3VA 3TZVC 2IH3A 2DF3A 4KV5E 4MQXC 4WI5A 4MCZA 5HY9A 2P24B 4NJAL 1FNGB 3VH8A 2CDFB 3EYQD 4NRXA 3FQUA 2OL3H 3CLFL 4MD5A 4FQHB 5TE4H 1UKTA 3VE0B 4X98B 3CFJA 1BEYL 1CVSC 4Z7OF 3LMJH 3WE6A 3T2OA 3T3PE 3U0WH 5ICYA 5IB3B 2DLTA 2B4CH 5T3XL 2VIRB 1KJ3H 4XXCC 1OB1A 3CU7A 5IEHA 3VFVB 2JLLA 2R0ZL 4KMQA 5I2IA 2BNUB 1RZIB 4YHZL 3ARUA 5DD1H 1JJUA 2EH8H 4IRSA 5A2LH 3UTSD 4R8WL 3QI9D 4FHBD 4Z7VB 3ROLA 1M7IB 4D8PA 3DMMC 4H26B 1NKOA 1FO0H 4JFEE 3U30B 2V9RA 2P5EA 2DQUH 2JCCA 4FTVD 2FB4H 4D0BA 4WI3A 5B39G 1H3PH 1A4JA 2IG2L 3QJFB 5H2BA 5FO8B 4OIAA 1RIHL 2Y1VA 5CBEA 3VFRA 5LGJA 1EHXA 1WISA 5MENA 5EO9A 3I2CH 2VERN 2F8VA 3OKMA 4L8SC 4GW4B 3RHWK 2VH5L 1VCAA 1C08A 4K7PH 4CUCA 3EGSA 4OF6A 4Y5XC 3QXTA 1KENH 1ULVA 2EXYD 3WN5A 2ZOLA 5BXFA 3O41A 2DLGA 1ZVSB 4JAMA 1AGBB 2PO6A 1RMFH 2PYED 1HILB 1WWBX 4KJPC 1YJDC 4WW2C 5F6IB 5DDHA 3VH8G 3EYUH 3V9FA 3BT2H 2IQ9H 1TZGL 4ZOCA 5K9OA 1BFOA 2IFFL 1UXWA 4PRDB 1U8NB 4M7JL 1EX0A 4MJ4A 1KN4H 1J86A 5MHSD 4LCYB 5HYFA 4ETQB 4O2EB 4YHPA 3TBVA 1RULH 2CIIB 3IU4L 4JEGB 3VGEA 3CMOL 5DK3A 3B9KD 3BH8B 4OV5B 4R3SA 3MUY1 4R90H 4G7YH 1FG9C 2OI9B 3CZFA 4NQCD 3MYZA 5FCSH 4PRBB 2FJHB 1PG7W 5JOFA 2EYTB 4D3CH 3VFPA 4DGIL 3CX2A 4IDJH 4MAYC 2XRAL 4Q58C 4PPTA 5ECJE 4ORGA 3RVTD 4E42A 5BW7A 4MJ6B 4M5YH 3SE9H 2EICA 1RUQL 1NLDH 5HDLA 1H0DB 3MRHA 3H9HB 4I3SH 1A9EB 2JJVA 1RZJH 4MDJB 1G7MA 2AS5M 3A0OA 4D9RD 3C60B 3PL6D 5E03A 3HE7B 3L7EB 2Q6WA 5BVPL 4U1NB 5IB2A 4DGYH 3NZHH 3VRIB 2Y5EA 1H15A 3HNVL 1YDPA 1J8HA 5D8JH 5DUPH 3MRGB 1AGDB 1YQ2A 1IAKB 5E6ID 4FFWD 2F54A 2A73B 4LP4A 3AFLA 2AK4D 4CN6A 3VGDA 4JFHD 4NDMA 4RZCB 3VXOA 1I9EA 3OKLB 2V6HA 3JSSA 2A6KA 4HUWA 4Y2DD 2FBOJ 2I24N 4B7LA 5HXMA 3HZVB 3RAJL 2YWZA 3ZE2E 4U6HB 3QFJB 4TVPH 2A6IB 5SWZB 4YHYC 1JUFA 4NKMB 2OR8A 5C0AE 1DEEA 3SQOH 5IROA 3U7AA 4MHHI 4PR5A 3CCHA 1B0GB 4AM0A 2X4PB 2XN9A 5C9KA 1YNKL 4GG6B 3TIDB 1AI1L 4FQXC 5CGYD 1A6TB 2E27L 4IIQB 1AXTL 1KPUB 3OR7B 4JQVA 3RU8L 1KJMA 4RISH 4DZ8B 4KVNL 4P59H 4HUXA 1T03H 3UCRA 4ZQKA 3RWHA 5FIEA 2ZOKB 1II4E 2FCBA 3SPVA 3OKNA 1UJ3B 1EV2E 5BOZG 1K4CB 4HSQA 4JVUA 2YS4A 4RFEA 4JO2H 2GTWB 5I1IL 1AJ7L 1CD1B 1EFXB 1N7MH 1I4FB 4N0FA 2WBKA 2NY0D 5K59F 4RMSA 1TITA 3QUYA 5DEZA 2RR3A 3Q5YA 4WU5A 5T3XE 1JVKA 2CLZA 2N4IA 3CDCA 4CNIA 5SWSB 3A6BH 2XYCA 1D5MB 1CLYL 3MRJA 1IC5L 2P5WD 3OHXA 4JFFA 4XCEB 3BQUB 1X5JA 1UH2A 1LE5A 2ESVD 3TO2A 1VEOA 4JY6B 1H3GA 2VN4A 1JMZA 1BGXH 4PJCE 2GIYA 2ZCLH 3BE1H 3RNKB 1MAMH 5I16B 3KS0J 2X10A 4P5KA 4MZ3A 4TRPH 2AXGA 5C0CA 3H2WA 1JZ7A 1J1XL 2WIMA 4PLNC 2BNQE 3JV6B 3IGAB 4AEEA 3ZHDA 5HI4C 3WFBH 1XF1A 3FT2B 4HPYL 1CU4L 3D6GA 2DI7A 4ZUVA 1MCHA 1WZMA 3QHZL 1RZ7L 5GGQL 2P5EE 4JY4B 4OZ4B 4G9DB 5AD0B 5D6DC 4BFIA 2A1WH 2AK1H 3AY4A 3QDGB 2VLJD 3K4DA 2XKUA 1T22A 3ARFA 4V1DB 5C71A 5MENE 3X14B 5D1QA 2BCKB 2X4TB 3WUWA 4UT6L 5E08L 1A8JH 4X99B 5DMGD 4ZUUB 1HCVA 2CXKA 4NN6B 2O5ZL 4X8XA 2IALA 2C4FU 1MQKL 5F7HA 3IXTB 1E4XI 4XNYH 4PJHA 1FIEA 4FMFA 3O81A 4X80L 5FKAB 5FDYA 5FO9A 3C6LB 2ADFL 2DBJA 3DXAD 4XGZA 2LABA 4EZMA 4FQQB 1FH5L 1S7XA 1T89C 4ORZC 2WP3T 3DARA 1DFBH 3HR5B 4KTDL 1S7QB 4UT7H 4OV6F 4X0KA 4HIEB 1QSVA 1ZT7A 5DR5H 3D0VA 4JGUA 1MFNA 3IU3B 1FE8L 4JZNB 4WFGD 4S2SA 2DLEA 5HYJD 2I5YL 1HSBB 4RGND 1NFKA 5LG1A 5ESQA 4PJ8D 4Z5RB 5GS0L 4S1SL 3CH8A 4JFXA 5CSZB 4Z0XB 2EDNA 2FLBT 1OGTB 2VE6A 2EDOA 4HIXH 5DRWB 3GSNB 5HYSB 3L1OH 1CG9A 4CMMB 3WFEH 3ZT6A 3SKMB 4LPVA 1R3KA 1OAUH 3UTSE 2AJUH 4OLUL 3RWEA 1B0WA 3HRZB 5DMKB 1C5BL 4JY5H 2X4OA 2K3TA 4LEXH 3JV4B 4RDQF 1MUJB 4I2XA 1KJ2B 2FBJL 4FTVE 2DIJA 1I1AA 4ZUWA 5FHBH 3QRFM 4WRLA 4Z7OE 3D25B 3GJFH 1G7LB 1BVLA 5F9OH 1WWWX 1PD6A 3WUWG 1T04A 4YBLB 1Z3GH 4O5LH 1XZ0A 1LMKA 5F9WC 2CDEA 3RKDC 3VA2C 2YK1L 1UM5L 3T2PA 2B7DT 1LO3L 1OP5K 1XF2A 5DLMH 1A7QL 5J0BA 4P4KB 1MCOL 2AERT 2F54E 4ZXBB 3S3JA 4UIMB 5J4MA 2YPLD 4PJIF 1KCVH 2DM2A 3LIZL 3NACL 3P77B 1DANU 3V0VA 1LK3L 1E28B 4JHAH 3E2HC 2IAND 2Q7NA 2YD4A 1IFHL 1P6FA 4ODXA 1YJDH 5EU5A 2F8OA 3QHFH 4DTGH 5MHSE 4KK9C 4N1EA 2XN9E 1QA9B 1YQVL 3LN9A 4FA8A 1ED3B 3ILQD 1I85A 2AJXH 1J1PL 4MD4B 1HI6A 1INEL 1JPSH 1SJEA 2J88H 4NQCE 3HRPA 2EEBA 4R4ND 1QG3A 3MRKB 1EJOL 2N1KA 1QFHA 4OCWL 4K3EH 1D6EB 2PKDA 4P2OB 4M43H 2R0LH 1JP5A 3RWCA 1UACL 4NWUH 3UYRH 4CW1B 35C8L 5JW3H 4HXAL 3P73B 4NM8H 4HQQL 5E5MB 5CJXA 4WWKC 4UV4L 4KRLB 1CDUA 1EJ6A 4I3RL 1KIQA 1BAFL 5T5FH 2DQCL 3F5WA 4D9RE 1FIGL 1W0WB 2NTSP 4U6XA 4PIRF 5JA8B 3BEVB 1Q9OA 1AKJD 4K3HA 4G43B 2NTFA 5GSRA 3GGWA 3KLAB 3LHPL 1MLBB 2OL3B 1QSEA 2NXZC 5DHVA 2LFGA 3P9LB 1HHIA 3RDTA 5C0JB 5EZIL 1YNLL 1IQDA 4JJ5B 4I48A 3T1WA 3O9WD 3BHBB 3MX0A 4W6XB 4HEPG 1BECA 3T0WA 3PGFL 4AMKL 4OT1H 4ELKB 3V6ZB 4KTEH 4M48L 3BZFB 2YSSA 5JIKA 1AGEB 3TBTB 3PQYB 1X5LA 3EFDL 4QTIH 1LWRA 5D71H 1XGRB 2GJZB 3L3JB 5IBLD 3DO3A 3O3AB 2GSIB 1AGFA 1KIRA 4ODSL 4G8IB 5F7EH 3MUGB 2IPKB 4OCMC 3ELAT 1FO0B 2DMBA 3ZYOA 4XMLH 1V7NH 1HK6A 4Y16A 1JPTL 2V7HA 4U31A 2HN7A 3MGAA 2IPTL 2XPGB 2HTKC 3QISA 3UBXI 4Y4HA 3ZTNL 4FABL 1U8LA 4PY7A 5DD5H 3WS3B 3T2NH 3AREC 1WFUA 5JQ6H 2IQAA 3F12B 3GK8L 4UUJB 3I6GA 4P48A 2YD2A 2HKHH 1PEZA 1U3YA 3P9MB 4KK6D 1NDMB 4ZO7A 3K81A 2VDQH 1A14H 1J88A 2W92A 3D87B 4OGYL 2XWJA 2C3GA 1IM9D 1RHHB 4OUUB 1TJGL 1IEBA 4Z7NF 2P5WE 5J06A 1J5OH 1ADQA 3I02B 2FR4A 1MCWW 4PUBL 1U9KA 3RVWD 3MRCA 2D0FA 3I3DA 3WEXA 2EEDA 3PV7A 5I1JL 4E5XA 5L2KB 2YEZB 5H37G 1UG9A 4XVSL 3FQRB 4G3YH 5ILTH 1B0RB 5IB5A 4O02L 3H7LA 3OAZK 2XOTA 1IGYB 4RDQG 3U9PH 4AYFA 4LGRB 5K59E 1U8QB 3FRPG 1WWAX 1ADQL 3ZSTA 3MUZ1 1D5ZB 2AEPH 3PWNA 2G5RA 5CCKL 2V5MA 1MHCA 2OSLB 2VLKB 3F7VB 1T3FB 1Y18B 4I2XE 3QUMB 3G9VA 2HKFH 2HFEB 3K3QA 3KPOB 1OSZA 4J3WA 4IOIA 4M9PA 2FDBP 4PLOB 3ARVA 2A38A 3WLWC 3SDAB 5HDBF 3BWAB 3EYVB 4NO3A 4JRYD 3OKEB 3LKPA 4NNXA 1I3GL 1BD2D 5F1IA 3GMQB 3MJ8B 1UCBH 4XB8A 4AEIL 3MRFA 5GRJL 3C2AL 1JPFA 3DXAE 4PJGA 1QBMH 1HQRB 4YHIB 1ZWIB 4FOMA 2NY5C 1MCEA 2VITB 4GXUN 3VMNA 4WCYH 4PTTB 2VQ1A 1YYLL 1ZHLB 5D2NB 5D9SA 1CTNA 5DT1H 3LQZB 4YR6A 3MRPB 4XPTH 1DUYA 1MFCH 5HYJE 4RGNE 3CC5B 5B8CC 1L0XA 2VISB 3BZEB 2WZPD 3GI9L 4F7CA 5FGRA 1FQ9C 1VSCA 2UWEF 4ZDHA 2IAMD 2XQBH 4L9LA 2D0GA 2GITA 4NQDD 1HEZA 5EU4B 4YDKL 4I18A 1B6UA 3S4SB 3EDEA 3CGTA 3VXSA 1INQB 2V17L 4PJ9A 5DRXA 5J1TC 3RY6A 1JWUA 1BX2B 3QEQA 4WV1B 3BAEL 3QIWA 1I9RL 1ZANL 4MXQD 2XQYK 4TTDD 2EDLA 4HZLB 2IPUG 4OM0L 1MCSA 3MJ9A 3UBXB 4XH2A 4HX1B 4GAFB 2BY2A 2XFXB 3CNKA 4L1DA 1JHLH 4HS6A 4HH9B 2H32A 3QUZD 2EYRA 4D94A 1I7TB 4JGMA 1DE4A 3U6RA 3SE8H 1I8IA 5JQHC 2C7UB 5JLZB 1QSEE 5IW6B 1QHOA 4ACPA 1NEZA 1HIML 4J4PD 1OQXA 2H26B 4XP9L 4JM2B 3V6OC 4Y19B 2DQGL 4H8WL 2D7PA 1CFBA 3RTQC 3SKOB 5J56B 3D48R 3VI3F 3KPMB 2EE9A 3GJEB 2IANE 4NRZB 1T66C 4D0DA 5IQ9A 2GJ6B 4NZDA 4U05A 3TN0B 1F58H 1IMHC 1CR9H 1KYOK 4NGHH 3DVGA 3MLXL 2DL2A 3MRIB 2J2ZA 4C59B 1R3JB 1KN2L 1PG7X 2ZG3A 3CK0H 2HLAB 1BQUA 2ZCKH 3FO1B 3OAYH 4PV9B 1S8DA 1TCRB 4N0RA 3TBWB 3U83A 15C8H 3MRLA 1BBJA 2H1PH 1A6VH 2QADD 2DM7A 3UROR 2F74A 3WJJA 3TO4A 2ENYA 2VDMH 2A83B 4MJID 1Z0NA 2KZWA 5D7IA 1HH6B 4EXKA 1HXMA 4MLSA 4JQXA 4P46D 2X4NB 4YXLL 1CGXA 3N1MC 4IRSC 3MLSH 3QQ9D 1F00I 1QBAA 3EYFB 1FL5A 4ZS6C 5FCUL 3W82A 4M7LL 4I4WB 4QRPA 3FZUD 2JJWA 5HSFA 2BHZA 4XC1L 3BPLB 4AL8H 4I0PA 1NPUA 3RPKA 3S6CA 1CXEA 3L5HA 3MQIA 4M7KH 4PTUA 4KC3B 4YE4H 1C8PA 3VFGL 1MJ8L 4D9QD 3VXUA 5SWQA 1NEZG 2Q7YB 4J3OC 4KHXL 4OJFH 5JOEA 5DC4B 3NFPA 1I7UB 2FZ3A 1X44A 4P9MH 2DLFL 3TIEB 3O0RL 4F8TA 5MEQA 1IGML 3WN5C 1JPST 1GOFA 1RIVL 4KJWC 2JIXD 4ZAKC 1GRWA 4J1UA 3FQNA 4Z7WF 1FVEB 3DI3B 2PO6C 5D96B 1MWAH 2BHYA 3HNSH 1JK8A 1QQDA 2EKSB 3KXFB 5T3ZH 1S7VB 1LO2H 3BIAX 1G7PB 5FGSA 1JE6A 1MEXL 4LLMB 2DM3A 5IJVA 3MV7A 5J12B 4FFYH 5DEGB 3DMMB 1OPGH 1KLFA 1MVUB 3VMPA 3IFOB 5J6GA 4LSPL 2GCYB 4KROB 1T0NB 2C1PA 2EO1A 1A7NL 2N7AA 3MLUH 4K23H 4OLWL 2V7NA 1S7WB 5ABDE 2VR9A 1QKZH 1NBZB 5IHLB 1JPGB 1OY3B 1RUMH 1QPXA 1DBAH 1MRFL 3VCLB 1RJYA 5D5MF 4S10A 2WWMC 3JUYA 3OJMB 4CN4A 3JWNC 3MLYH 2QHRH 3ARDA 3MRQA 4EJ1C 5BW7C 4L3CA 4JG1L 3HPJB 4TQEH 1B4JH 3SGJA 1RK1B 25C8H 4QOKE 2ICWJ 3JTSA 4XHJD 5HHPA 4E0RB 1HHHA 1TZHA 1O7VA 1WZKA 3HMXH 4LNVA 1P9MA 3GRWH 5IVXB 3P0VH 4APQD 5DURD 2XKSA 1CICD 3VXPA 2D31B 4RGOH 3CMGA 4S1QH 4HV8A 3VXSE 4OCXL 1Z2KA 1YC7A 1CQKA 3GMLB 1CLCA 4WUUB 5D93C 3HB3D 1F4YH 4NHCL 4P2QD 1NCBL 4OZFH 1UWGL 2QSCL 2COQA 2ENSA 1I8KB 5KN5B 4IEFB 2VC2L 1H3VA 3K2UH 3NCFB 4ZPTB 2P8PA 4PRPD 2R2BB 4P5TD 3L3OB 4QRRA 4KY1H 5AZEL 3REVA 2BVTA 3W0WA 4MNHB 4S11A 1C5CH 5IBTL 3FHQA 4OZHB 1OTUD 5E9DD 5IROC 4JRYE 5E56A 5K9JL 3C6SB 2VDPH 3MBXL 3IVKB 3ARYA 1DBKH 3QULA 3K80A 2R29L 3X11A 3CUPB 3PGDB 4JQVC 1F4AA 4Y4KD 4NPYA 5JTWA 3EOBB 5C1MB 3GSXB 4PJFF 5JIIA 1FBIH 4Z7WA 3V52L 4LCWD 1T5WA 2V5RA 3S35X 3WIHL 3TNNA 5I1KL 4Y4FD 1FFOB 1MLCA 4E41A 4EEEA 2NY5H 5BS0A 3U9UB 4HIJA 4Q74A 1HOCB 3GMPA 4WNQB 3TFKD 3QUYC 4XPBH 1K6QL 5DTFB 5HDBE 2CPCA 1F6FB 4XNMB 4OF0A 4D0CA 2G9HB 5KVGL 4HHAB 1U2HA 3PWPA 4WFHD 4U1GC 4KDVA 2BSRA 2DS4A 3PDOB 4JZOA 4GMTL 4QCIB 1GGTA 1MHHB 3BEWA 4HC1L 4N9GA 4NFBA 4P0DA 1LE9A 4XWOD 4I1NB 5DJXA 1NFIA 3D18B 4XP5L 1SBBA 3OAUL 4NKOA 4XPFL 5TDOA 1V05A 1VGKA 1EEQA 2ZUVA 4HFUH 4NKDB 3VXMB 2E9WA 5DEFA 1TVBA 2MSPA 1NC2A 4XCFL 1U8HB 5ERWA 3TNMA 1QOKA 4PRID 3I3BA 1TCMA 4KDTC 2V5TA 4G8FA 1MJJB 3U2SA 5J1AB 3RA7H 2FIRT 3F7QA 2XWTA 3MGOA 3KYNB 2G5BA 1NC4D 4Y2DC 5JORA 2UWEE 5ISZD 5JNYA 2YC1B 1IT9L 2R69H 1KCKA 2YD5A 3UTPD 4RAVA 3RL2B 1ETZA 5FOBB 3AY4C 2WIIB 2DYPA 4FQCH 4U1IA 2D9QB 1HSAA 3RZCA 3L9RB 4ZSOA 5C0IB 3ZKXC 5CGYC 3NAAH 5D1QC 5I17B 1RUKH 3LN4B 4YGAB 2RQ8A 5EUKB 1ZLVK 1U58B 1J0JA 3BDXA 5HTSA 3UPCA 5DUMH 3MV11 2DD8H 2X41A 3T0EB 2HJKA 3HE6D 3S5LA 3TYFB 5C2UB 2CDGB 5EORL 5IHZA 4PJ7B 3HI5H 2J6EA 4OTXH 8FABA 4NC1C 4G80B 2HRPL 4CU6A 3VG9C 5GS0C 3CLFH 4G9FE 4OIIH 3QFDA 4X5LA 2D4FA 1BEYH 2VXQL 3EDJA 4NN7C 3QCTL 3D85B 5ENWB 1E27A 1AP2B 2VLRB 5IW1B 3NZ8A 3QDMD 2ADJA 4RSVA 1OAYL 1A1OB 1U92A 2ILLA 3X3GL 3ES6B 1ES0A 3W9EA 1YPZA 2PXYB 4C58B 3OZ9H 2J6EL 2R0ZH 5FYLL 3MV9B 4PJFA 5EDXA 1Q9KB 4D9LL 1S9KC 4ELMB 1R3IL 2WUCL 4JN1L 4R8WH 1I7RA 1T20A 4WUKL 2WANA 3VI3E 2PCPB 2B5IC 2YN5A 5EU6A 1SM3L 4AY0A 4RMUA 1UZ8B 4RRPA 2FSEB 3NTCH 4M8QB 2IG2H 3U82B 3V5DB 4M3JA 4EBQL 5HHOD 5L2JA 3DX8B 3FOMB 5CHNB 5I1AB 1WBXA 1KG0A 5SV3A 4JFDA 4EN3A 3L7FA 5C8JA 1I1AC 2VH5H 3LCYA 2DQIL 5IBUG 3SGEH 3EOAA 3IFLL 4WVRA 3DVFA 1I7ZB 4O51A 1B3JA 1J0IA 4HIIB 1NCUA 4PJDF 5DJCA 1KTDB 3GSUA 3S5LG 4I9WD 1Y6MR 3MRRB 5GIRA 4LLUB 1H3UA 1TZGH 2YXMA 3CVHA 4AIOA 4ETYA 4GKSA 2AJZB 4PBXA 2H2SC 3ALWA 4M7JH 4P5MB 3ZZ1A 1WIUA 4ISVB 3ULUF 3CPLA 4HK3J 4DFIA 1XFPA 5CIPH 3IU4H 2ERJC 1YEDA 3KPRE 3SO3C 3CMOH 3RIAK 3SDDB 3F6IA 4DJMA 1EEUA 3W0WE 4KKCC 2APBA 3VFOB 1UXSB 3QEHB 2E6JA 3W5NA 2WWKO 2CO6B 4QHKJ 2IH1B 4F7MA 4Q6IC 4RGNC 1FVCA 1KLGA 3CVHL 1UENA 1WC7A 2KPNA 3AAZA 4DUXA 1WIOA 4DGIH 4JFPA 4HFWA 3O4LB 2Z0BA 3OXSA 1ND0A 2GYSA 4P4RA 1I85C 5BO1L 2D7OA 3O3DB 2QEJA 4I0KA 2W9LA 1OD9A 4NO0D 4Z7WE 3GIVB 1MCNA 1PAMA 3DX9A 3RWGA 1RUQH 4RRPG 5IV2A 3ULUD 1PYWB 4NQVB 1FVDA 3JXAA 3PIQA 1FNEB 1FG2B 2R0WL 5DA0B 3KYOA 3ARXA 3KLDA 5F9WB 2CLVA 1JWSA 5EG6C 2EIEA 4P3WA 1A21A 3MV8D 4Y5VB 4QY8A 3BKCL 2HT3D 1I1YB 3FQWA 3C08H 5DD6B 4X4XB 3HNVH 3GI8L 2F53A 5EU3A 1RV6X 1ACYL 1H5BB 4F2MA 1P84J 1YEFH 4H5SA 2W38A 4JB9L 3MXWL 2OJEA 1T0MB 5DO2D 3E2HB 5CD3A 5F6HJ 1EO7A 1VEMA 3T0AA 5MEOB 4IS6B 3RDTC 3RUGA 1OGAD 4P2QE 5D5ME 1MHEA 3RAJH 1AC0A 1D7FA 1OTTC 4TNVK 4OF5A 1L6ZA 1JRHL 1MIEL 1P7KB 1T1WB 5JO5B 1AXIB 1CIDA 1YNKH 1AI1H 3WS6A 2E27H 4LGPB 1AXTH 1S9XA 1W8OA 3MNWA 5C9JA 1VB9A 3BGMB 3CFIC 3P11L 1DQJB 1DLFH 1LD9A 5EIVA 5HHVL 5F7WC 5HJ3B 1AJ7H 4KQ3L 2Q8AL 1OT1A 1S9YB 4GAJL 4Y16C 1VADA 2FJGB 4HS3B 5JHDA 1EO5A 1XMWA 2DQDL 3D3VD 3DROA 4LCWE 4R0LA 4U2ZA 3FB6B 4BYHA 5HGDB 4Y4HC 3FT4A 5FYLE 5F7UA 1CFVL 3TH3T 1OLZA 1CD8A 1IC5H 4LLAA 4IRJA 1GVIA 4LU5H 1MREL 4QXTA 5BMFL 3DV6A 2R23B 4OFPA 2ORBL 5DFVD 4U7SA 1NGQL 1MF2H 4P23A 4OLVL 2P7TB 2Y36H 4F57L 1VACB 5FK9B 4ZD3L 4Q9RL 4GBXD 1YECL 3DGGB 5L8JB 3L3KA 3BD3A 3SDYL 3ULUL 4ZUTA 1MWAB 3JUZA 4X4MA 4XBPB 4NN5C 4PJFE 1G7JA 3H7BB 3GHBL 3RVXD 3BW9A 1EEYB 3GMRB 3BPCB 1CU4H 4GXVL 5HD8C 3IYLW 4MB5A 4JM4H 4LLQA 3BWUC 3EHBD 3QHZH 4R2GD 4JRXD 3SE4A 2VLMD 3VW3L 3VGBA 1ZGLA 3JWOL 5D7JA 1HH9B 4R7DA 3GMOA 3FN9A 1KELL 2PW2B 3VWJA 5F8QC 2DQJL 5ISZE 3LKSA 2QHLA 1L0YA 3AU1B 3V8OA 4L4VA 3IDMB 3B5HA 2O5ZH 1B88A 3ARFD 4EVNA 4NZRH 5BOPA 1MQKH 3AREB 3UDWA 3F8UB 3PHQB 3QEGL 2UYLB 4H0GA 3OTTA 5C92A 4X80H 4R96A 3V5KA 4OQTL 1Q1JL 2ADFH 4U6VH 2HJLA 4PJBF 1FH5H 1A0QL 1YMMD 5JMOC 2P24A 5I0DA 4JFEB 1FNGA 2CDFA 4KTDH 4KZEL 4EUPA 3S98A 4FQHA 5GPRA 1FE8H 5K93A 3FO0L 3VE0A 4X98A 2LAAA 1JFQH 2I5YH 3TJHC 3ROOB 5GS0H 3QYCA 1P2CB 1P7QD 1KCRL 2VIRA 4OI9A 5K33A 5C09B 1RZGB 2BNUA 1RZIA 4GS7C 2PYFB 3K74B 3QUKB 3VXRB 3CX5K 1HCFX 4BSVB 2I60L 4UQ3B 3K2MC 4OLUH 3AXLB 4Z7VA 1M7IA 4PJAF 1C5BH 4H26A 3OB0H 4IOFD 4RBPH 4WEBL 2YPKB 4KTYA 1P5VA 4I18C 1XIWA 3HZYB 1FNLA 2FBJH 4RCAA 3QJFA 5D7SL 5FO8A 4QRQB 4PJ9C 5IR1A 3G6AB 2P49B 5HHOE 3RY6C 1WK0A 4X9HA 3RIFF 4KKNA 3QIWC 1QFPA 5T1DL 4YFLF 4DVBB 2ATPB 6FABL 4GW4A 1NEUA 2NY2D 4IM8A 1EHLL 4GG6F 2YK1H 1IGCL 1UM5H 2DQEL 3MUJA 4JVWA 1LO3H 3SGEI 2VUOA 1NMCC 4WI4A 4H8WC 5DJZB 1A7QH 4ENED 5DFWH 1L9MA 1MCOH 1ZVSA 4G5ZL 1X9QA 4AENA 3GUTB 4UINL 1HILA 3ZKMC 5F7YC 4QGYA 4YPJA 1CXFA 3NH7L 1LK3H 4EUPG 5D1XD 2CXGA 3VG0L 2YD9A 3ARTA 4M7ZB 4PRDA 1U8NA 4KMTH 1N6UA 1P4BL 3CFEB 4LCYA 4YHLL 4ETQA 4O2EA 1U8MB 3LZFL 5DQDL 2CIIA 2VZ3A 5IHUL 1UKSA 4MA3B 1YQVH 4PY8J 3BH8A 1BP3B 4XAWL 1UB5B 1G1CA 5JR1L 1EIBA 1N2RB 4W68A 5GISH 1J1PH 3EZJB 1RAMA 4DKFL 1INEH 1LO4L 4PRBA 2FJHA 1BFVL 2EYTA 4PJDE 2VDRL 3KR3L 2W07A 1EJOH 3OAYK 4JDZB 3PXJA 1ZHBB 5I18L 4B50A 4OCWH 1QEWB 5C0RH 1HQ4B 3MLRH 3DTXB 4MJ6A 1UACH 35C8H 5T5NF 2LU3A 1H0DA 3H9HA 4S0TD 3ULUE 1RU9L 3WJJC 1FYTE 1P4LB 3TO4C 1FZJB 4UV4H 5C0AB 1A9EA 4MDJA 4I3RH 4Y1AD 3QWOB 4P99A 3QA3B 1BAFH 4LHUD 5F7MC 3C60A 2DQCH 1WJ3A 3LKQB 3HE7A 3L7EA 4JQXC 4TTDC 3NCYS 3MV8E 4U1NA 1I3VA 4FQPA 3VRIA 2DMKA 3LHPH 4OF3A 2B2XH 2HMID 3O6FD 3MRGA 1AGDA 1IAKA 2HWZH 4PJAA 1J7VR 3UYOD 2A73A 3MXVL 5EZIH 1TTFA 4I0PC 1YNLH 4RZCA 3WMSA 4HK0B 3OKLA 1MJUH 2ARJB 3UPAA 3DYPA 4PLKD 2EH7H 2Q8BH 3PGFH 5E8PB 3HZVA 4YC2B 2WW8A 5IF0B 3SDCA 4AMKH 5FB8B 1OGAE 4U6HA 4FS0A 3QFJA 4TOYL 2A6IA 5SWZA 4NKMA 5H37H 5DHVH 2WBJD 4HF5L 4EI5B 2X4SB 2OR9L 1B0GA 5AUMB 1KUMA 4KI5F 4ODSH 3TIDA 5KOVC 4GG6A 1A6TA 4R7NB 3ZT5A 1KPUA 4DZ8A 4PJCB 1AQDB 1A6AA 1UJ3A 5DSCB 1K4CA 3DI2B 5FV1L 4QWWD 4PG9B 3O2DL 2IPTH 3K1DA 1G84A 1CD0A 1IGJB 2GTWA 4I77L 3L3DB 3ZTNH 2BNQB 1FORL 3DHMA 4QHUA 4FABH 4M00A 1CD1A 1I4FA 1CT8B 2K7QA 3MR9B 3GK8H 3D3VE 1CXHA 5SX5K 2AV7B 5SWSA 2P5EB 5IK3B 1D5MA 4LHQB 3BD4A 4N0CC 2NLJB 4OGYH 1SEQL 4F15B 3BQUA 1TJGH 3W11D 3FB5B 4XCNA 5I66B 4JQIH 4JY6A 1JTOA 3SGDH