3TLRA

Crystal structure of the tetrameric beta-2 microglobulin dimc20 mutant
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKCNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title A recurrent D-strand association interface is observed in beta-2 microglobulin oligomers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tlrA00
4GAYB 1CT8B 3IDXL 3MLXH 4IRJA 3BDBA 5AYQA 3C5ZB 3ZHDA 3LZFL 3B9KA 1B0RA 3DV4B 4XTRC 3LH2H 2DICA 4M1DH 4MDJB 3KYAA 4OQTA 2ZSVB 3RX8A 3PQYB 2IH3A 5E5MA 1CLOL 1MNUH 3PGCA 4F58L 3WUWB 5DJYA 3QZWG 1HCFX 1T83A 3ME0A 4APQB 3HC0A 5L0QC 2AS5M 2BY2A 2OL3H 3VDAA 3U9UB 3GKWL 5GIRA 4N8CL 4GUPA 4XNUH 2LTQB 2AKRA 1AGEA 2NY2C 3DUUA 4YBQD 3ARDC 1S7WA 3IDNA 1MHEA 2F9BT 4NQEE 4ZOCA 2H3NB 3NOIA 4OCLC 3KPMA 3SO5A 2A9MH 2EXWD 3TNNB 5E2UL 4P59H 2DMBA 2OSLA 1OOAA 3GI8H 4ODVH 3B9KB 1B0RB 1Z6JT 4M8QA 4YBLC 2OK0L 1SHMA 3GO1H 2DQFA 4R8WL 2GITB 5CCKL 5T3ZD 4QO1A 5E5MB 2IH3B 4PB9L 2FH6A 3EDFA 2VL5A 3LKNA 2LABA 1AGCA 3NMEA 1EXUA 1QEWB 4X7TB 1VA9A 5FHAL 5DJYB 4LCIL 4LEXL 3HC0B 5EA0L 1YPZE 5IHLB 1KJ3L 3BWAA 3QULA 1HXYB 1A22B 1C5DA 5EDXA 1OGAD 4LSDA 3SE3C 1ADQL 4GUPB 4PUBH 4AT6B 5TE6L 1QSEB 5HTSA 3V4PL 2AKRB 2BRRL 2VXSH 1S7WB 2HA1A 3IDNB 1GHFL 4D9QD 2A6DB 4K7PX 1U8IB 3KPMB 4P9HC 4M9PA 2PTVA 2B1HL 5FCUL 1BVKB 1ZAGA 4PG2A 3TM6A 4Q9RH 4WFED 2OSLB 5C2UB 4HBQA 2APBA 5MP6H 1L9NA 4M8QB 5CZXC 2BHZA 3ULVF 7FABH 1G7MB 1YNLL 1R3LB 2DQFB 5IB1B 4YDIL 5JR1H 1UYWL 5A2FA 3MA9L 2BJML 2VL5B 1OT1A 4UV7L 1S5IL 1AGCB 5E24E 5E6ID 4KQ4H 3WIFB 4MJIA 4L8CA 3QULB 1WFUA 5LXGL 4G5ZH 1NLBH 3DROA 4LHUG 3O6KH 1MPAH 1SMOA 3P11L 3WFHB 1ZLUK 2VXTH 4XC1L 3G5ZA 1GIGL 2WMPA 4OQTL 5HHXH 5IESL 5BJTA 2NY5L 3VXSD 1J8HD 5BCAA 1JPSL 3KPSB 1HKFA 3ALXA 2HT3D 3VG0L 3H3BC 2BVQB 2F8VA 4JGJA 1GZQA 4X83A 1FG2B 4JPIB 1S7QA 5JOFA 1CXIA 2Y6SC 3P9LB 1HQ4A 5JW4M 3GB7A 2GI7A 1C16A 1UQSA 1RFDL 3G6JA 4JZOA 5BVPL 3WLWC 1IEAA 3DROB 3VFPA 4DFIA 2H26A 3DECA 1MCPL 5DFWH 5HI5C 3BPOC 4JY5H 1K8IB 3RUGE 3N9GL 3QNYB 3QCVH 3ZE0E 2FECI 5DJXA 4DEPB 2VDMH 5ALBL 1AE6H 3W11C 5DEZA 4Y19E 3DXAD 1PYWA 1JYNA 1FDLL 3GEWB 3VDCA 4QHKJ 4HMDA 1CE1H 1J1XL 4KV5F 1F58L 2NY1D 4GRLA 2HWZH 4GW4A 3RVXD 3V7AE 4E41A 1ES0B 3VD7A 4LAJH 3BKYH 5JOFB 1TZHA 5L2JA 5BOPA 3MACH 4JHWL 3GB7B 4PP1C 3TH4T 3PIQA 1A1NB 4JZOB 2Y7QA 1ONQB 4LGSB 5EO9B 3FQNA 4I3RH 5ICYA 1BOGA 4YXHH 1KCUL 3L3HA 2H26B 2W0PA 3G5XA 3VXPA 5IQ7L 1VPOL 1NCDH 3NAAH 4B5EA 3MBXH 4X7SH 4S11A 3QEUB 5IVOA 1RURL 1UH2A 4N0RA 4WHDA 2XWTA 3O6FB 4LPWA 4YNYA 4ERSH 1J0YA 2VISA 1PYWB 4K3EL 4YHKL 4BQ6A 2JB5H 1MIEL 4CU6A 2C7UA 1MOEA 3NZHL 5JIHA 1JPTH 2V2TA 3ARBD 4KZDL 2VLRA 4GRLB 1BD2A 2W91A 4FQIH 5GSRB 1LNUB 3KXFE 3QG6A 2IFFL 4HUUA 1F6AA 5EBGA 1G0YR 3QIWA 4L9LC 5E1AA 1H0DB 5C0AE 3FQNB 3LQAH 3GNMH 1BOGB 2YUWA 1LK3H 3L3HB 4DCQA 3R4DA 5ICYB 3VXPB 4KUCF 4WUKH 1D5MA 3KWWA 3D69A 1MHHA 2E7LC 1EGJA 3DTXA 1I85C 3GJFA 5FYKE 4NQED 4YNYB 5CS7A 1GYAA 2VISB 4JRYE 4WWID 3SDYH 1G6RB 2OI9B 3MRCB 4WW1A 4KAQH 2BXYA 5KVFH 3A67H 4Y16B 5B4MD 3DETD 1OSZB 1EHLH 1BD2B 4P5KB 2HH0H 5DQDL 1T2QL 2H9GB 5C0RH 3RZCD 2WQ8A 1OARH 3AS3A 4O02H 4HUUB 5I74B 5E1AB 5M95B 2HJLB 3SJVA 4DCQB 5EWIL 1IZKA 2BNRB 3RX5A 4M7KH 2X4OB 2Z8WC 4UNTA 1EEUA 5D2LE 3JTSA 1D5MB 3C60A 3KWWB 3D69B 3KPRE 4ONFH 4H1LA 2CRZA 1QFUH 4F9LC 4MZ3A 2EYRA 3ESVF 1QLFA 3HFML 3GJFB 5E0QA 4HIXH 3MRQA 2X10A 1JFQL 4GMTH 3K2MC 4U6YA 2P5EE 4JRXA 3BUYA 1A6UH 3O0RL 2E27L 1TZGH 5B8CC 2AJZA 3DNKA 4PY8J 5GGSY 1A7NH 5KVDL 1MRCL 2XY1A 1U6AH 2ADIB 3QXDB 3R8BB 5I1EL 3QQNA 4L3EA 1N4XL 3ARYA 2EXYC 3SJVB 5FUZL 1OM3L 4E5XB 4Y0GA 5DD5H 4UV4H 4BZ2L 1KPUA 3QRFM 2V9RA 5CWSA 1O7VA 3C60B 5KOVC 3ARZA 3KLHD 3U0TB 4S2SA 3RDTD 2EYRB 4KDTC 1QLFB 1N64L 3QEQE 4I48A 3MRQB 3S3SA 1BGXL 3W9DA 2QLVB 4GKNA 5LVEA 4P3DB 2ZPKH 4LASL 4TRPL 2DQEL 5DFVD 1WZ1L 4HK0A 3C08L 5ADOL 4F80A 3C6SB 1ZVSA 4QRPE 4Y5YA 3S35H 3P40A 2MTPA 2BOBA 3MCG1 4OQ1A 2R2CA 1Z5LA 4L3EB 1DBKH 1EGJL 2I9TB 5B3NA 3P9MA 5ESAA 2H2PD 1KPUB 5CWSB 2CGRH 1MLCA 1AFVH 5DF0A 3RAJL 3CMOH 5E6ZA 5HDQH 4U7SA 4CVXA 5ENWA 4S2SB 1S9WA 3B4NA 2IBBA 1T1WA 4MXWH 3EYUL 4I48B 3W9DB 1OGTA 5C0CE 5HHQA 2RR3A 5EBLA 1IC4L 1J0JA 2P5WA 3MNZB 3P0GB 5CUSH 3ZKMC 4LFHG 4XCNA 1JHKH 1KB9J 5DJ2A 1ZVSB 3FQXA 4Y19D 1XGPA 2P49B 3QNXA 4UDUA 1J8KA 4QGYA 1BX2A 2EC9U 2BOBB 4X7FC 4BJLA 4XNQB 1Z5LB 15C8H 4OUOA 4HKJA 1R6VA 4J23A 2GKIA 4KTYA 1C5CL 2VAJA 3VXME 2CRYA 4RGOH 3TBSA 1GGBL 1MLCB 2Y36H 3MYJA 4FP8H 1UG9A 1CFTB 4CVXB 5ENWB 3GMMB 2IWGA 4J3OC 1T1WB 3L3OA 1BPVA 1B0GB 5JW4N 4OCRL 1RAMA 1N0LA 3OXRA 3V0WL 1OGTB 5HHQB 4F3FA 3RVVC 1T7WA 5EBLB 1YNTA 4LCWB 5T1KB 2AAVA 2X42A 5DJ2B 1ZGLB 1HYRC 1IBGL 2FEDC 5J06A 3PXHA 1XGPB 2A9NH 4L1HA 3QNXB 4J4PC 3FZUD 4G7VH 3L3KB 2GSIA 4MQSB 2X7LA 3KLDA 4ZS7L 4HKJB 4R2GC 5LGKA 5KANG 1HK6A 5FHBL 3GBMH 3AB0C 3HAEG 3KXFD 3TBSB 2L7JA 2LQRA 3MYJB 5CEYA 1P4BL 3VXUE 3DVFA 3BGAA 5C0AD 1CQYA 4WU5A 4NN5B 4PTUB 3RNKB 4HMEA 2XN9E 2GEEA 5E95B 3OXRB 4JQVA 1A6WH 3QJHA 4LNVA 5FEBA 1PKQE 1YNTB 4JCMA 1NBVH 3QQ9C 4KU1A 1ORQB 3IFOA 4ZUWA 4XRCA 5BQ7B 1D5BA 4L3AA 5FGBC 4JRYD 5T5FL 1KCRL 4YZFF 3L5IA 1Q9LA 4XP5L 3SDDD 3U82B 1E4XI 3REVA 4U1KA 2VSCA 4XCFH 1RU9H 2W65B 4NWTL 1A1MB 4K7PL 4GXUM 3SKNA 1IEHA 5DD3L 5CEYB 2EZ0D 5ALCL 1RY7B 1A6ZA 2VTFA 3FMGL 3O8XC 4P4RA 3OR7A 3C09B 3HE6B 2F53A 3P4MA 2F54A 1OAXL 1M7IA 1NDMA 2DYPA 2W60A 4ODSL 3QJHB 3KPRD 4LVOB 3F7YA 3CFBA 2E5EA 1UXWA 4F15B 4U49A 4XRCB 1REIA 3MR9B 1D5BB 1QYGH 1IM3A 3F58L 5EZLA 4LSVL 3B9EA 3O6ML 3T2NL 1FL3B 5D72H 5HHOA 2HVJA 4KUZH 1BM3L 2VC2H 2P5ED 1BVLB 1MFDL 5IG7A 1X5XA 3HRPA 2DI8A 3SKNB 1IZJA 3OKMB 4P57A 1RZGA 5HPMA 1FZKA 2QR0A 4BSJA 1V7NL 2HP4A 43C9B 5I73B 1WFNA 4P4RB 4WWKA 2VDKL 5KS9B 3RQ3A 1HQRA 1LEIA 4D9RD 1DN0A 3CXHJ 4JB9H 1DJSA 1RZKH 3HNSH 2AJXL 2F53B 2YXFA 2F54B 4YBHA 3OKEA 2VJXA 1MAMH 4XI5C 1M7IB 2DYPB 2W60B 4RSVA 2R4RH 4TSCH 4U3HA 4UIKL 5FYJH 4PJFF 4ZXBC 1MLBB 1FNFA 3MV8B 2V2XB 5TFSH 3CFBB 5B22A 5CAYB 4E42A 4PRPE 3QEQD 4XMLH 2R29L 5EZLB 2DQJH 1LE5A 1ZHLA 4YDVA 4RFEA 2PXYC 4RGNE 5C8JA 4PRBA 5IG7B 3BOVA 3AAZA 5CLTA 2WBJD 4WW2F 2NXZD 5IK3B 1U3HA 4P57B 1RZGB 4QRPD 3V4VL 3BISA 2Q86B 1FZKB 1X3DA 2QR0B 2QSCL 4HC1A 1DUZA 1OTTD 3U9PL 2JJSC 4RGMB 4EDWL 2X89D 1HQRB 1DN0B 1JZ6A 1I8IA 1HSBB 2IPTL 4NZJA 3ZE2F 4KRPB 3D0VA 1YA5A 2AQ3A 1P5UA 1MAKA 3UJIL 3D39B 5A2LH 4B53A 1OP5H 3GSQA 3VI3F 1JK8A 3FO1A 4JFYA 4E42B 5CFHA 1F4YH 1C5BH 1QHOA 2DQDL 3BAEH 1FORH 3T0EA 5GGUA 5C0CD 3H8NA 1IT9L 2IALA 2LVCA 4YUEL 1LE5B 3KJ6H 4DQOH 5C0FA 1ZHLB 3HZKA 5C8JB 1O7SA 1RMFH 4PRBB 2Z91B 5CKAA 3AAZB 3JXAA 2VZSA 4G43A 5JUEH 1X5KA 1NCWH 1DBJH 4HWEL 3VFUA 4ODTH 4KK5D 2J88H 1LO4L 2BVEA 2XRAL 1N5YL 4OSUL 4MNGE 2H8PA 3O2WL 4FFZL 1CICA 1RZJH 2EDDA 1I1YA 1BWWA 5CSBA 1XMWA 1QSFB 4BQCA 3VXMD 2V17H 5GGQH 5DZLA 4LHUA 4HWNA 3GSQB 1N59A 1JK8B 3FO1B 4JFYB 1AXTH 3MXVL 4RRPG 3DYMA 1JNHB 2HLAA 5GGUB 1QTYT 2IALB 5C0FB 4HMCA 3HZKB 2YA0A 4JZJB 3MZGB 5FA3A 4JQXA 2D7TH 3CFJA 4ZAKC 3VFMA 2FNBA 1CS6A 3X3FL 3VFUB 3VGHA 3DRQB 1T4KB 5GGTA 3OPZH 3WNKA 2YN3A 2H8PB 5B38G 4OZIE 3WJLC 3FOMB 2XXCB 1CICB 4MA8L 1KTDA 4OGYL 4R0LC 4P49A 4JQIL 4M7LH 3LIZL 3VXUD 2WUBL 2X1WL 3SY0A 3X17A 5D7LE 3DWTA 4LHUB 5K9QI 2HTLD 3MOQA 2RCSH 5I15H 1HIML 2YUZA 1AXIB 3LEVH 5DT1H 1F4AA 3CZJA 5EZJB 3K2UH 4TVPE 2XN9D 2FBJH 4HGKC 3UTQB 3MCLL 4HC1L 5T1LA 1ZT7A 3IDYC 1B4JL 4MD5A 4NRZA 4DZ8A 4I3SH 3CFJB 2P42B 2DAVA 3VFMB 2PYEE 1ITBB 1E6OH 3AY4C 3U79A 1HOCA 1MQKH 4KVCL 2DLFH 3QWRA 2AK4E 1WV7T 5D1XA 2O5XH 3QDGA 5GS0H 4HJ0C 2Q87A 4XWOC 1B6UA 2ZUQB 1YPZF 5EULV 1R5IA 3LEYL 3VFWA 3OJVC 4NP4L 3SY0B 4NQDB 1NGPH 2RQ8A 4K23H 3ET9F 3L3IA 3TBYA 4PGCA 1D6EA 4FQCL 1TJGH 3LRHA 4XP4H 2J6EA 3QO1B 3CK0L 4HS3A 4MSWB 4QWWC 1ZT7B 1IC5L 3MRPB 1J1OH 3GMQB 4RISL 3C5ZC 3H3PL 4MD5B 4DUWA 1N0XH 3H0TA 4FZ8H 4Q97A 2B8OT 1BZ7A 2AJVH 1BFSA 3TYGH 1R0AL 1FLRH 5ID1B 2PCPA 5D1XB 5DWUH 1FNHA 4APQC 4FFVD 2MQ3A 4GXVH 1CL7H 2AQ2A 5ACMA 3VFWB 2HVKA 2O5YH 1YY8A 2LTQC 4CVZA 4MAYD 1ZT4A 4OKVA 1ETZB 1U8OB 3TBYB 4OGAD 1D6EB 1NAMH 3RTQD 3TV3H 4LPVA 1J5OL 2XACC 2VQ1A 1IVLA 5FM8A 4HS3B 1EJOL 4L4TE 2OZ4H 3PG2A 5GGTL 5TGBB 3QXAB 5I8CA 3H0TB 1JZ7A 4PRPD 3B9KC 1BZ7B 4HIIA 1Q9OA 3DI2B 1AJ7H 5BS0A 1VFAB 1Q72L 2NY5C 4RGND 1JGEB 4YHYB 3TBWA 2CUIA 2PCPB 2VDLH 3CDGA 1E4XH 5TDNA 1LHZA 4DVRH 4CDGC 1T83C 4LARL 2XZQH 4X4YA 1HHHA 1NMAL 4PJEA 2Z93A 1K3ZA 3ZKQD 1YC8A 4ZFZA 5T33H 4UZGA 2ZCHL 1ZT4B 4OKVB 1JZ2A 3UPRA 4Q0XL 1QSZA 5LG1A 1V8HA 4HZLA 3ZDZE 1KLGA 4P2QA 2DS4A 2VQ1B 4HXAL 5BZDB 1RJYB 3RUGF 3GK8H 3MRFA 5I8CB 1F3DJ 3B2VL 4HXBL 2QADB 4RMRA 3C8KA 4JPWH 4HIIB 3DUHA 4OBRA 4WHCA 3UTSA 2M1KA 1QNZH 5BS0B 1I7UA 1T5XB 1NFDF 1GSMA 3V6OE 3HUJA 4NNYA 5J11B 3CDGB 3OR6A 3JWOL 5DFTA 3HG1E 5J3HC 4PJCF 4MD4B 4X4YB 1NBZA 1LO0L 2J6EL 3MGTA 1A6PA 4KK6D 4M43H 4NPYB 2WM0A 3IU4L 4KTDH 3M17B 4NNPL 5H8DA 5FO9B 2YPVH 2R2HA 3B9AA 4GQPH 4RWHA 2WWKO 1TTUA 3UTOA 4P2QB 5FUCC 1M71A 3NACL 4NBXB 4YPGA 3F65A 5C0NC 4PJAA 2FX8H 4GRWE 4YR6A 3GGWB 3SN6N 1P84J 2X4TA 3UTSB 1CFNA 4KZEL 1OP9A 2IMMA 1QBLH 3HUJB 4NNYB 3HI5H 3AVEA 3KG5A 3OR6B 4U1GB 5SWZE 3TEUA 1QLRB 4PV8A 3J7HA 1NBZB 5JDSB 3DHJA 2AP2A 6FABL 4KVNL 2UUDH 5JLZA 4XNYH 4QKXB 5DQ9A 5LJYH 1H3PL 2L4OA 3LQAC 3U36A 4M7JH 5SWSA 2CXKA 2R2HB 4U1NB 4NRXA 3M45A 5CZVH 1M71B 4NCC1 4G6ML 2ARJQ 2X1PA 2BDNH 5D7LD 5FGCE 2BFVH 3FL7A 4PJAB 4YR6B 5KVGH 2QKIA 4DEPC 4ZTPH 4N0UE 4FABL 1KTLA 1SY6H 2DJ4A 2X4TB 4TVPD 4PJ9D 5DVKA 1CFNB 2VZ1A 4ZFOA 3K7UA 4YHML 1KEGH 5D7IE 3RBSA 3JVGC 2PYED 4M62L 4PV8B 2CLVA 5IHBA 4WEBL 5CD3A 4WI8A 1BIHA 4FOMA 1EH9A 1H8OA 4V1DE 2BOCB 4BFIA 3FB8B 1CF8H 5DQ9B 1NUGA 2CO6B 2AK4D 4NZRL 3ROOB 3U36B 2ZUWA 5SWSB 5ADPL 4HUWB 2X4NB 2FD6L 3P4OA 5GS2D 3LN4A 4MJ4A 3DYPA 4NRXB 1UM6H 1SJXA 1HKLL 3EDJA 4DJMA 4XBPB 5DD1H 5I17A 5EU4A 1I9EA 3ZYIA 3TN0A 4FMKA 4JFXA 3QIUA 3O6FC 5CBAA 1A1OA 1JNLL 1KTLB 1A02N 1KPVA 3UZQA 1AD0B 1EERB 2HJFA 2YBRA 4ZFOB 5D1QA 1XGUA 2BX5A 4V2CB 2J12B 1VGKA 3WNNA 2HT4D 4PY7A 2UVFA 4GRLC 3VFTB 4LMQI 5I16A 5IMKA 4Z7UA 5CD3B 3PL6D 4JR9L 1JGVL 2OXGA 4BFIB 5D4QA 5IB4B 4CW1A 1UB6A 3QYCA 5LBSL 1YEIL 5DHXB 4B7LA 3P4OB 2JLLA 5IFJB 2FLRT 5GRUL 3D3VE 1ND0A 4GAGH 2Q8BL 3UC0L 5I17B 5DRXB 1ORSB 3CH1B 1LO3L 3CLEH 4ELKB 1D6VL 1VACA 4AMKL 4F2MA 2OJZH 2QQLL 1S7SA 1SEBB 4JFXB 4ODXB 1QLEL 1J1PH 5E4IA 5CBAB 1YN6A 3I02A 5B3JE 1KPVB 2HJFB 2OI9C 2YBRB 4TUJB 4PGJA 3G6DL 3LRSA 5D1QB 1WITA 5KZCD 1XGUB 3U7AA 1U9KA 4L4TD 4Y16C 4Y4FA 3HMWL 1RK0A 1TNNA 4N0FB 5EUOE 3O6LH 3NH7L 1YEDA 4R4BA 5I16B 3OV6A 5IMKB 1CGVA 4ZSOA 5D8JH 1BJ8A 4KGJA 5EU7C 1FGVH 5I74C 3SE9H 1EFQA 2JK5A 3WFDH 5I6XB 3VFSA 5E00A 4ZUTA 4U6HA 1DBBL 1PX3A 4ZFOL 3Q3GB 1A3RH 4TSBL 2FR4A 1IGML 1N2RA 3V7MA 1KB5A 3BEVA 3I02B 1G9MH 1MHCA 2AXGA 2NY4B 3LRSB 2APFA 4LVHB 3DUSA 2IJ0C 2YC1A 4Y4FB 1RK0B 1CXKA 3OQ3B 2KUTA 2DBJA 1CDIA 1YEDB 5JIKA 1MJ7L 1V3KA 2I5YL 4ZSOB 1RHFA 1W0WA 5L8JB 2NLJB 1V3JA 3V95A 8FABA 1R3IL 3VW3L 3TT3L 5L88L 4IDJL 3DSFH 4LDLB 3DJ9A 3UJTL 3NA4A 3VFSB 3HG1D 4KKNA 2IFGA 5E00B 5I76A 1JF1A 2B4CH 4S1DC 4WFGE 4ZUTB 5I1HL 4XAWL 2XWJA 4U6HB 3UROR 2WV3A 3V52H 1CFBA 2A6JB 1ZXQA 3C60C 3HTLX 1A9BA 1FZJA 2RHEA 3LAFA 2EECA 2GJZB 4Z7WF 1ZVHA 5DZNA 1S5HA 3QQ4A 5D5MF 1N2RB 5DJZA 3S3PA 2NTSP 2ID5A 1MHCB 2AXGB 5EU3A 1U8PB 2YC1B 4DGYL 4Y1AB 3KS0H 2D7QA 4XPGL 3TP4A 1WT5A 3WSQH 3TPUA 3SHSA 8FABB 1A3QA 3GKWH 5KW9L 1KYOK 4OLVH 3CDYA 2NY0D 3AROA 3K4ZA 3NCMA 4X6CE 1PLGL 3E8UH 1ZT1B 1S7UA 3HAEH 3HC4L 5SWZD 3ISWA 4LKXA 1YQVL 3MFGB 1JF1B 3O3BA 3BESR 2H2SD 2XWJB 2KQNA 1DEDA 1A9BB 2C4XA 3CX5J 3OF6A 4PJ8A 1ZLSL 4P2RE 1PG7H 3CPLB 3VE0A 4Z9KB 1S5HB 3D87B 3QQ4B 3B83A 3JWDL 5DJZB 4DKEH 4WI9A 2OK0H 4Z76B 5DK3A 1Q9KB 5EU3B 4R8WH 1QR1B 1K8DA 1JGUL 5DEGB 5C71A 4F7MB 4UU9A 1XIWA 3TVMA 4LCIH 5EA0H 5INCB 2UZXB 3QPXL 3LD8B 1CZ8H 3TPUB 1ROWA 3QEGL 3ZKSD 2KBGA 4N1CA 3INUH 4RX4D 1MFNA 5I71B 4S1RL 5TE6H 2IPUK 3W39A 2AGJH 2G5BA 3O3BB 1GHFH 1KB5L 4NKMA 4QTIL 5JPMB 1NDGB 5BRZE 4V1DD 4WY7H 2DIJA 4X6DF 1A6AA 4PJ8B 5FCUH 4YJZL 2V7HA 4JVWA 3VE0B 3BIBX 4GBXB 3TA3A 3RL2B 4WFFE 1DEEA 5IW3A 3ULUL 1XF3A 3NA9L 3V8OA 3QIBB 2Y72A 4P5TD 4EUPA 4YDIH 3C5SB 5D1ZD 4AJ0A 3ARVA 4GH7B 2NY6B 2OTUA 5TE4L 3VH8A 3PWVA 3BGMB 1C08B 2NZ9D 4UU9B 3TVMB 1H5BB 3IGAA 2E9BA 4P2CG 2NR6C 2GJ6A 1AP2B 3IAPA 1MWAA 2G5BB 4QRUA 2UZIL 3FTGA 4K9EH 2JJUA 5FIEA 3FQUB 1YEEL 5IESH 1A6AB 2E7CA 1L7IH 2V7HB 5GRJL 2VH5L 2XV6B 1B2WL 4RCAA 4NN5C 1YDPA 4ONGL 3MLWH 1XF3B 2NQCA 2Z4QA 2ITDA 2EDBA 4F57H 3D3VD 2F58L 2XWBA 1NSNH 3BZFA 4EUPB 1T5WA 1S78C 2AABH 2CSPA 1IAOA 5E8EA 1IKFL 4PLKD 4G6JH 4S1SH 3BX7C 2OTUB 3VH8B 2BHUA 4BQ9A 1QFOA 4I0PA 4PV9A 5IIEA 3IGAB 4OAWA 5C9JA 1RFDH 3D6GA 4Z7VE 1TCMA 1CCZA 4JHAL 4XVUD 4LGRB 4H20H 5F7FA 1G9NL 3WXVH 3U7YL 2J5LB 1MCPH 4OZHF 5T5NG 5KN5B 5DI8B 3KPNB 4OCYL 3MUY1 2WIIA 4DKFL 3C09C 3HE6C 5C0EA 4OCXH 1YDPB 5F9OH 3BWUC 4IEFB 5ALBH 4LSTH 3RIAK 2Z4QB 2ITDB 3P3YA 4LIQL 4MS8D 2EDFA 4JQVC 2ENYA 1FDLH 2XPGA 2XWBB 4LVOC 3BZFB 2SEBA 3M8OL 1IAOB 4PR5A 1AO7A 4F15C 1J1XH 4U1HA 1MCRA 2PO6D 3JUZA 4LP4A 3PWPE 4I0PB 4NUGH 2IADA 4PV9B 5IIEB 4TULL 3MV01 2ZNXA 5C9JB 2DQCH 5EC2A 3OHXA 1IAKA 1KULA 1KCUH 2VXQH 5IQ7H 5C3TA 3MO1A 3ZHKA 4FA8A 5I73C 1HZHL 4AG4H 3F7QA 1RURH 5FYJE 2WIIB 3SKMA 4WFGD 4QLRA 1WTGT 3FFCA 5JHDE 3L3JB 5C2BL 3K3QA 2XPGB 4OD3H 3SGJA 4ESKA 2SEBB 4PR5B 3FB5A 5HVWA 4QHUA 5AZEH 4ZNEE 5DGQA 1PVHA 1MWAL 3AUVA 3MRLA 2IADB 4DGIH 1FNSL 4I3GA 3VXNA 2C26A 5EC2B 1RIUH 1NL0L 2AQ1A 3BIAX 2D0GA 1YEJL 1HINH 3OHXB 2F19L 1IAKB 2WWMD 1E6JH 2OR8A 4PBVC 4FTVA 1TLKA 4PYHA 3MO1B 5E2VL 1G7PB 4KMQA 1WBYA 4RGMC 4QT5A 3S96A 5CP3A 1FV1A 2H6PA 1WJ3A 5DD0H 2F8OA 3SKMB 2C1OA 4KRPC 3FFCB 4G42A 4KKCC 2DLTA 1NEZG 2A1WH 3TIDA 4P2RD 4PRHE 3FB5B 1H3XA 2CMRL 3W9EA 4MDIA 3ARTA 1DN2A 5DQDH 2R9HC 5DC9B 1X6LA 3CFDA 1QFWH 5CILH 2YUVA 3QI9A 3WHXA 1ZGLM 4FTVB 5IROA 1NUFA 1UWEH 3WKML 2P7TA 3EOYG 4PJGE 1WBYB 4QT5B 3WDIA 1FV1B 2H6PB 3WFCH 3RA7L 2C1OB 1FZMA 5F7UA 3FONB 3MRMA 4HV8B 2AV1A 4G42B 5BO1H 3H42H 4BK5A 1XZ0A 1JFQH 2YA2A 4X4XA 4NZDA 5BRZD 4TPRH 1KNOA 3TIDB 4KHXH 3VFOB 5E8DL 3W9EB 4WFFD 4RIRB 4LNRA 4DWHA 2D4DA 3ULVL 3T0EC 2NY2D 5KVDH 4IRSD 1KIPB 1MRCH 2Q7YA 3CFDB 5SX5H 4HK3J 2EKJA 2BP3A 4JZJC 2HFGH 3O4LE 4G7YL 5I1EH 4MJ2A 1ZLWK 3WHXB 5FUZH 1OM3H 4OGXL 3WUZA 4KMTL 3GHBH 5I1JH 4WJ5B 3U4AA 1BQLH 3AREA 3IFLH 3QFJA 3OAYK 3SEPA 1CICC 1UH3A 1N64H 1TCRA 4RNRB 4OD1H 2AV1B 4MMZC 1BGXH 1U41A 4X4XB 1KNOB 2DMKA 5CGTA 3BIKA 2YD9A 5FYLH 3PWJA 2DQEH 2X4UB 1LEKB 3QUXA 1NLDL 4I4WB 2R15A 3GBNH 4MNHA 2L7UA 5TH2A 2DQGL 2FIKA 3P30L 2Q7YB 3WNOA 2R0KL 2AJUH 4CU8A 1OB1A 5CBEB 4JQXC 4I0KA 2OCFD 4NJ9L 3ELAT 1HNGA 1A4KA 2VIRB 3KR3H 1DTUA 2ILLA 3AREB 2A6KA 5CJXA 2NY7L 3EYUH 2ZUQC 1U2CA 4ZOEA 1SEQL 1WF5A 2QV2A 4JKKA 5FCSH 1JRHI 4N0YH 3BIKB 1IC4H 2P8MA 4AEEA 3PWJB 1TVBA 3ROLB 1ACYL 4MNHB 4R4ND 3WCYA 5TH2B 4WNQB 4JFZH 3TBTA 1J05A 3L3DB 3GSNA 4J3WA 3ARUA 3IFPA 4MZ2A 5CGMA 3OKOA 1UACH 3EO0A 1FH5L 1OD9A 1E28B 3OAZK 1OB1B 3ZT7A 5C0IB 5DO2C 4AZ8A 5T1MA 2HLFD 4TQEH 3PWPD 1S9XA 3OAUH 2WINA 1C5CH 1X6NA 3S97C 5DD6B 4TTGA 4HG4K 4JGUA 3EIFA 4ZPVA 1MIMH 1OW0C 2A6KB 5D1XC 3RPIA 4XXDA 2LU7A 1I1AA 3V7AG 2XA3A 5EC1A 4BELD 3SDXE 1N7ML 1SJHB 3V0WH 4L4VE 3SDAD 4ZS6C 3JWOC 2P8MB 5FA4B 5FYJD 1TVBB 3DX8A 3UTPE 3WLWD 5J89A 5JHDD 1DDHA 1U58B 3GSNB 3MTRA 3IFPB 4ALAL 3PABB 4LK4A 2PNDA 5HI5D 3S6CA 3KDMA 3OKYA 3L5XL 32C2A 2BNUA 4PJ5E 4CDHA 1AGDA 1MI5B 3WS6C 3V9FA 1EBAA 5FHBH 2WINB 2PR4L 5C0BD 3W11D 1AC6A 1JTOA 4MD0B 4LQFL 2WQRA 3OKNA 4YHYC 2JE8A 1YYLL 4J6RH 4NC1C 1RUMH 3WJJA 2R0LH 4XXDB 1A7PH 1I1AB 3EO1A 4M9OA 3ESUF 3EYSH 4ZO7A 1DQQA 2EE2A 3QCTL 4WUUB 5F7HA 3W0WE 2YKLL 3VCLA 3FQRA 1FIGL 1PSKH 4Z95H 4PP1D 4OM0L 3DX8B 5I0ZA 3KHQA 5SX4I 1MF2H 3QHTC 3D5OF 5JQHC 4PRHD 3KDMB 2D7MA 3FCTA 4HULB 5AZ2L 1AGDB 3CJJA 5F1SA 3IDJA 4EOWL 2QADC 4NWTH 1W2KT 4K7PH 3ZKXB 2V5TA 1MVUA 3S36X 1BMGA 3SGDH 2BNQE 4LF3A 5J11C 4OTXL 3OKNB 3VXQA 5DD3H 1MY5A 1Q38A 5JW4Q 4KROB 4Q6IA 1JP5A 2VXUL 3GSNL 1DQQB 4Z0BH 5CEZL 5I1GL 1DQDL 1R3HB 5ITBH 4JPVL 5FGRA 1EAJA 2EDJA 5GS1A 3VCLB 4EN3B 1BFVL 4Q2ZA 2IQ9H 1QA9A 2YWZA 3LPWA 4GMSH 4OLWH 3UYRH 2LU4A 3QUMA 4KKBC 4PYGA 1WEJL 3RZWA 5M7QA 4KRNA 3T2NH 4OLZL 2MKLC 2X4QA 4JN1H 1BM3H 3FCTB 5I1CH 5DMKA 4OCSH 5DJ0A 3IDJB 4AL8L 3MREA 3ZO0A 3LCYA 3KYNA 4KTEH 1MVUB 4XMKH 4IOIB 3RY6A 2J8OA 2MQ0A 3O4LD 2O93L 4U1GC 1CDJA 2QSTA 1YEGH 4O4YL 4P46A 3R8QA 2AJXH 3MRDA 1RJZA 5KVMC 4Q6IB 3WO3B 5I8OL 5IVXF 2EKSA 5DMJB 1KFAL 4D9LL 1XGYL 1QA9B 1AHWA 3P0VH 3QUMB 4J7RA 4OIIH 1IRAY 4G6AC 1WWWX 3FKUS 3TCLB 5DMKB 4IRZH 1LE9B 5DJ0B 4MNQA 2DRUA 4BUHA 3CLFL 4C56E 3V4VH 1QRNE 5DMGC 4P23D 4NZTH 5EUOF 4RWYL 5CD5D 3MLUL 1GVIA 3N1QC 3V0AC 4PLJC 2EE9A 5GS0D 1EFXA 3MRDB 3O3UN 3NVQA 2MNUA 1GC1C 3OG6B 2EKSB 4MAUH 5MEOB 1F3RB 1AHWB 4GRMA 2IF7A 1HILA 3FN0H 4CNIB 1AXSB 1IT9H 2F5BL 4YUEH 3RHWF 3KGRA 3TO4A 3HI6H 3TF7C 5ETUA 4ZTOL 5DK0A 2Y07L 3GRWA 4KJPC 4M6MH 1DE4A 1VDGA 2I60H 3DGGA 2VZOA 2LVEA 2XRAH 1ZHNA 1G1CA 3EYQC 2GT9A 3O2WH 1DLFL 2NY3D 5I1KH 4XAKE 3QUML 5I66A 4JO3H 3D85D 5BMFL 5L2KA 2YK1L 1KPRB 3C2SA 3EHBD 3L7FA 5BVJA 1Z9SA 4N5UA 4BA8A 2B4CC 4GRMB 4K8RH 5E6IA 3SKOA 1IGJA 1FNEA 4H88L 4MQXD 3PP3K 4L4VD 5MEND 5IJKC 1D9KD 2YD2A 1MRFL 1A3LH 1MJUL 2C1PA 3UTPD 2V2WB 2QQKL 3IS0X 4PJ7E 1VEOA 5DK0B 4TUKH 5D1QC 4TYUA 5IR1A 4PJFA 1DE4B 3DGGB 3VXSA 3QXWA 2MPAH 4PJ5D 1J8HA 2GT9B 5KVEL 3ZT6A 1ZKAA 2V6HA 2W0FB 2W59A 4R26H 2CKBL 4XPFL 5FYJU 1C12A 4U7KA 3U4BL 2WUBH 3L7FB 1JRHL 3O2DH 4IS6A 5I6XC 1FRGL 3BMWA 4MMXC 5CZKA 4OZFG 3WIIH 1HI6B 1MUJB 4WW2A 5E6IB 1IGJB 5LGHL 3MPCA 1CDGA 3IJSB 1MVFA 4V2BA 4WENB 3VI4E 2O61A 3W0WD 1JGLL 3SBWA 3F5WA 4PJIB 1F90H 1UKSA 3MLTA 5GSVA 4BH7A 4XPAL 1NMBH 2NX5A 3DARA 5FDWA 1INEL 3QRGL 2NY4C 2K1MA 1WCQA 5KSBE 3LV3B 5F7MC 4LVHC 4PJFB 3VXSB 4Y4FC 4X5WB 3TPKA 1J8HB 3WNLA 1WIUA 3JWDC 5DMIH 3UDWA 3MLRL 3HNVH 3PJSA 2ZKHL 2BY0A 4UB0L 2BNQD 4KKAD 4NFCA 4ZFGH 4J4PD 4IS6B 4FQXD 3GMLA 4IMKC 1GJIA 4X4ZA 4WW2B 5HDBF 4LLVA 2HRPH 4CJ1A 5C7XL 2DTML 1FYHB 3GRWL 4Q58C 2LAAA 3CK0H 1IC5H 3BH9A 3F5WB 4K55A 4H8WL 3MLTB 3L5WB 4BH7B 3RVWD 1JE6A 3O9WD 4XVJH 3IU3B 3QDMA 4I13B 5FDWB 5LQBL 3QDAA 4EDXB 3DSNA 1LILA 5KAQG 1CLYL 1YEFH 1R0AH 1GAFH 2VO5A 2R0ZL 5GHWH 3K46A 3M07A 3PJSB 4MQ7A 1DR9A 3DXAB 4GKZA 4PREA 4LDOB 1NCCH 2X5PA 5D7JD 3Q0HA 5F3HA 1OP3K 2XZCL 3UO1H 2O26U 4FXGA 4Y4KA 4LLVB 5IVNA 1PAMA 4NZUL 2ICWI 1HHIA 3BH9B 3D1MC 2EDWA 4OFYA 5E70A 1KXTB 3SGEI 1QD0A 2CUHA 2NYYC 3B8YA 5SX4H 1BJ1H 1N6UA 5K59E 4OCWH 4RMQA 5I2IA 5E1HB 3BKCL 1A7BA 1DLHB 2HMIC 4G6KL 1IGCH 1WT5C 4NJAL 4MQ7B 4C56D 1KJVA 2B39A 1HN1A 3LD8C 4GKZB 1QRND 1VGEL 5JIPA 3S88L 4PREB 2B1AL 4OB5H 5I71C 2OMBA 1KIQA 3ARBB 4JG0H 1KELL 3ILQC 1UENA 3OMZA 5GRWA 4LGPB 2DM3A 1A9EA 2G75A 3FOLA 1D3CA 3DRTA 1W72A 5ANME 1C7SA 4FXGB 4Y4KB 3ZTNL 2C9AA 1S9YA 3L1OL 4PJ8C 3S37H 1HHIB 4IJ3B 4ZO6A 3D25B 1OD7A 1IAIH 5HYSA 2VMFA 4LSSH 2AEPH 5JHLH 1G9NC 2V9TA 4HXBH 2CR3A 3RWJA 4EBQH 1YPZA 1GOHA 2VDQL 3QIBC 3P0YL 4GLRH 3T3PE 3DGCR 3IB4A 4OLXL 5DJ8B 1YNKH 2IPKA 2NY6C 5EU6E 5GRXG 4C4KT 4NQEB 3TVMC 3W5MA 1H5BC 1LO0H 4DOHE 1KJVB 4FFWC 4NKDA 4LRNL 3H9YA 5ITFB 2EE6A 2XY2A 5KSAD 1IM9D 2VLJA 1KIQB 3FHQA 4H0HB 5FO7A 1T0MA 4XAKD 4GG6E 4FXKA 3NZ8A 3FOLB 3RZCB 4Q6YA 1WZMA 2BHYA 5DUBB 1S9YB 4UNVA 3MRIA 2Z31A 4G9FA 5HYSB 5I30L 3NFSL 4NO0D 4YGVB 2CLZA 5GXBB 5IHUL 3ARDA 1YPZB 1P6AB 1EJ6A 3AM8A 3HE7A 1D7FA 4WDIA 1V3MA 1RIHL 3RDTA 1P4LA 2EH8H 3WNMA 5E2TH 1G0DA 4NHUA 3OX8A 3QXTA 4YGAB 4NKDB 4K3JH 4XPBL 4UIMA 2XQYK 1B88A 4YWGL 4M5ZH 3DO7B 2X05A 5FO7B 4FN0A 3O45A 1T7XA 1F2XK 2J5LC 1FCGA 3NZ8B 2NXYD 2PYFA 5HI4C 3P77B 4IHOB 2Z31B 2F15A 4ZUUA 1IL1B 4G9FB 3VRLE 2ICES 1A5FL 4QTHA 3BKJL 3NTCL 2CLZB 4RDQG 3F62A 4GKSA 3S36L 3Q48A 4YO0A 3BRDA 3SO3B 4HPYL 4OZGF 1IILE 3HE7B 3Q5OA 1CLCA 1DBAL 1RUAH 1JV5B 5FUCE 1X5AA 3RDTB 3RHWK 4HT1L 4LFHD 1P4LB 2XICA 3I6GA 4JDTH 2UWEF 1UM5H 4XVSL 1RSFA 1DQJA 4I0PC 4WEBH 5F6HI 3OX8B 1W72L 4N68A 3RUGA 4NZRH 4XCEA 4R7NB 5F9AC 5KS9F 1SJEA 4GW1A 3LDBB 4HCRA 2PYFB 1FZOA 4OUUB 4OI9A 3MYZA 4P2YA 1NFDA 3N1FC 1GXEA 5CJQL 2NW3A 4MJIE 4QTHB 4PJCA 2FSEA 3RU8L 4YXLH 4GKSB 2AEIT 4JRWA 4XZUB 1C7TA 4XB8A 3ARFD 2N1KA 3TC9A 3DURB 1H3UA 4JFOA 3I6GB 1S3KH 2A77L 1DQJB 3HNTL 4UUJB 3QPQC 1YC7A 2OP4L 4JDZA 4PRAA 4NQXB 4YX2L 3RUGB 3G5VA 3LEXA 4HFUH 5IW1B 2Y25A 1NAKL 5LBSH 1JMXA 4P4KD 1SJEB 1OTUC 2AK1H 2D03L 5C0JA 5D9SA 2PW1A 2R69L 2Z35A 1UCBL 1YJDC 2Q8BH 1IGFL 2M8XA 2NW3B 3CVHA 1MFAL 3GM0A 4MXQC 3G6JE 3GSVA 4PJHE 1TJHH 1MREL 43CAA 5HVHB 1UFUA 4HJJL 2GFBA 3FO0L 3GJFK 1FVCA 4HJ0D 4JKPH 4C58B 3G6DH 1AR1C 4XWOD 3SGJC 2ICWB 1UM4L 4A6YA 1ZE3C 3MGOA 5C1MB 3LKSA 3BDYL 1OAYH 4BQ8A 4Y5XB 2HN7B 4PRAB 2XNAA 3LEXB 3VD9A 1X5YA 2DWDA 3ILPA 5LCVL 4WHYG 5F3BA 1SVZA 1V7ML 4JRYA 4E41E 5D9SB 3GJEA 4F7EA 2PW1B 4J8RA 2Z35B 4Q9QL 3SDDA 4UAOB 4JM2D 5DJDA 2ATKB 1GGIL 3STLB 4LLUA 3GSVB 5I1IL 1IGMH 1OT2A 2X2YA 4ODUB 43CAB 4C83A 3GMNA 1TVDA 5JQ6L 1I9IL 4MA1B 2ZUYA 3JUYA 5I18H 3RNQB 2ZOKB 4U1SB 5F9WC 5D7KE 5C0AB 3MRJB 3MGOB 2YZ1A 4IMLA 3LKSB 1MJ7H 1QSVA 4X5LA 1S9VB 3C6LD 4GSDL 4HCRL 3HMXA 3ZDXE 3DVNA 3A6CH 4DW2L 1R3IH 4LCYA 4IDJH 3FB7B 2VXVL 5EU6D 2DWDB 3ILPB 3QI9C 4IRJD 5HYIA 1GPOH 4P99A 2VLRE 3H3KA 4HBCL 3NFNA 4HH9A 3CFEA 4JRYB 1MHPL 5C0GA 3GJEB 1KF9B 1EUTA 3B9KD 3SDDB 1VESA 5DJDB 1KB9K 3I3EA 4NHCL 2RIKA 2P5EA 4KDVA 4JFDE 1IFHH 4XCYA 4LLUB 5ECJE 1DL7L 4X6EA 1T89A 2YPLA 1ACZA 2DQUL 4NUJA 1KENH 2VZ3A 4JN2B 4QY8A 3HN3A 4XXCA 2WLZA 3MLVH 1OCWL 3VXRA 5C9KA 1OY3B 4IMLB 3R0MA 3HLAA 1KUMA 4TTDC 1I85A 3L3GA 4P2OD 5DURD 5IFHH 3JWNC 2HAZA 4OF6A 5D2LB 3O4OB 2H1PL 3KPRB 4LCYB 1T03L 3NIGE 2DKSA 1WZLA 5D71H 3CVHL 1I8KA 1A6VH 3IXAA 1F4WH 4BYHA 2ZJSH 2B2XH 3PP4L 4JVUA 4KQ3H 3CFEB 4WI5A 5C0GB 1KSRA 1MFCL 2D7PA 2D0HA 1QBMH 1I8MA 4OLYL 2P5EB 3AREC 4A6YL 3KYKH 3SCMD 3LS4L 5JO5A 4GS7B 3VDBA 1U8QA 5LAXB 1FAIH 4X6EB 2GTZA 3QWOA 4NDMB 4I0CC 3OJDA 3BYTA 4D3CH 1UA6L 4QY8B 1EHXA 4K2UL 5L8LB 3VXRB 5EH1A 2OMNA 3HLAB 4F9LA 3VG9B 3QHFH 5CP7A 3HB3C 4OM1H 1BF2A 1CFSB 4LPTA 1X7QA 4X99A 3SE4A 5IBLC 4ORZC 1DQLL 4S1RH 5FYKH 4JRXE 4L8BA 3SQOL 1OLLA 2VE6B 2FWOA 4N8PA 1Q8MA 1K4DB 1I8MB 4POYA 4HJGB 4AEIL 5JO5B 2N4IA 1A7QL 4A2MA 3ULUH 2WBJB 3DVGB 2NXZB 3QWOB 5F88B 1H8SA 3HMXL 3OJDB 2D31B 4BKLB 5E4EB 1TZIA 1U8LA 4MJID 4P5MA 3NN8A 5C07D 5TE4H 2OM5A 3CUPA 3DOSA 5CP7B 2JIXA 3RL1A 4Y8AA 4JGMA 3OKKA 1NCTA 5MHSE 1VADA 4Z7WA 3KYMA 5AEAA 3DBXA 5D5MA 1WISA 1U8KB 3CMGA 5DJ6A 2N7BA 5C0CB 4OFKA 4XNMA 2CPCA 2WSKA 4QXUL 1OAUL 3UP1A 1CG9A 4TNVF 4PTTA 1I1AC 4ONGH 3C5JB 5EBMA 3TZVD 1TVHB 3MLPA 5H35B 5BW7C 3T04D 5F96H 1TZIB 1U8LB 3RWCB 2WW8A 4P5MB 3NN8B 3QG7L 4LLAA 3DX9A 3CUPB 2ARWA 3VXMB 2J4WL 3RL1B 2L0DA 5AUMA 3MLYH 2MCPL 3NABH 1VADB 3WKNA 2FB4H 4Z7WB 3KYMB 5JTWA 5BV7B 1CQKA 5D5MB 2P5WE 2YUXA 3U7YH 1HEZA 2DI9A 1N6VA 3FN3A 3ZKXC 2XN9A 5DJ6B 3REWB 4GJTB 4NWUH 4XNMB 1YEHH 1PKQA 4PJDF 3LB6D 5EBWB 3T4AA 3ECBA 3X14A 1CG9B 3BD4A 4KROC 1MH5A 3VFGL 1BQHA 5EBMB 4XVTL 4E41D 4LIQH 4UT6H 3VFNB 2ZSWA 3HHRB 3MV9E 3FAXA 4EI5A 1EEYB 1F4XH 1U91A 4GQ9L 3BSZL 4EN3C 4OZFB 4YHNB 4XNXL 3GIZL 1KEML 3S5LA 4KWUA 3P4NA 4UILL 1KC5H 1F8TL 2BCKA 4X6DA 4MVBD 3VXUB 4Q9BA 5D7KD 2H32A 2P48B 4FQ2L 4WIQA 1CVRA 1KBGH 4POZD 2XN9B 1I1RA 1P5VA 1YN7A 3I50H 1T04B 3LVEA 5EORL 4LSQH 1PKQB 4OGZA 3T4AB 3ECBB 3OKDB 1KCSH 1YECH 1IGIL 3K8MA 3F12A 3MLSL 2VLRD 1MH5B 1P69B 3PHQB 1BQHB 5ESVB 4Q6IC 5KJRL 5ACLA 1PDKA 1OHQA 1RULH 5TPWL 1FJ1A 3RI5K 4Z7QF 4EI5B 3WBDA 5GZNC 3SPVA 1U91B 2VDNH 4YFDB 4JFDD 5D6DA 3QIWD 5IBUG 4JPKL 5JW5B 3QUZD 5CHNB 1YMHB 4X6DB 1MFBL 4U0RB 5JZ7D 5BV7H 2H32B 4J3SA 1JPST 2XZZA 4HGWA 4PJ7F 4XX1G 5C6TH 3RIFF 1YN7B 2MSPA 3RY6C 4YDKH 5E2VH 3FAWA 4XCCL 5I1LB 5KSVA 2UYLB 5B39A 1KN4L 5EOQH 1DANU 1PZ5B 1CFVL 5J6GA 2FHBA 2Q6WA 3F12B 4PRPA 5JA9A 2ZCKH 5DHYB 4XWGL 3H9SD 1QPPA 1FJ1B 3T4YA 5EUKB 1OTSC 3SPVB 4OFVA 4OZFH 1NGYB 1AHWC 3O8XA 4L4JA 1BHGA 2A0LD 2ZUSA 4OZHA 5EOCJ 2F53E 1UH4A 2F54E 2E7MA 2R1WB 1FBIH 2FDBP 3I2CL 4MAYB 5IMLA 3C60D 4M93B 3JV6B 4YBQC 1Q94B 25C8L 3BN9D 3MJ9A 3FRPG 4KGLA 5GJSL 2R2BA 3T0VA 5E94B 2AEQL 2EXWC 2CJUH 2GK0A 2YD1A 5KSVB 1CD0A 1L7TH 4GOSA 5DUPL 4DAGH 5HHOE 5J6GB 1JF5A 4JRXD 2EH7L 1FVDA 4PRPB 4J2XA 3D9AH 3BJ91 1Y6MR 4NSKA 1FYTA 4S1QL 1BJMA 2VERN 3T4YB 4UBDD 2XZAH 1F6LL 5EZIH 1H8NA 3ALWA 5J9PA 3KPQA 1XCQA 4CAGA 2FHCA 2CDGA 3ULVH 2WZPD 4OZHB 5CINH 5CJ5A 3F8UB 3R06A 5EOCL 3ULSA 4ZXBA 1WK0A 1NGQH 2C3GA 1GCFA 1XH3A 4ZD3H 1MCOL 2G60H 4KY1L 4OGXH 2R2BB 4HQQL 1LD9A 3BW9A 1YY9D 2GK0B 2NW2A 4W6XB 5MHSD 1MCJA 3EJZD 1A2YA 5IGXH 5L9DH 1RZ7L 1QHPA 1J86A 5CJBA 1LO2L 2IMNA 2GY5A 2FRGP 1VEMA 3BHBA 5J9PB 5FK9A 3KPQB 3L6FA 3STZB 2R4SL 3IKKA 4LCCA 4HKXA 4XBEL 5E6IC 3MRHA 3B5TA 4QXGH 2CDGB 5SV3A 3K1KC 3P30H 3LQMA 1B0WA 3OB0K 3R06B 2R0KH 5CP3H 2UY6A 3DMMA 4K94L 5TDOA 1OAZH 4M1GH 5K59F 1NUNB 2QQNH 4EQ2A 2P8PB 1A64A 4LLMB 3T0EE 4CRPA 3MRRA 4NM4L 5FF6B 3UBXI 1JPGA 2P5WD 1MRDL 5TE7H 4S10A 4AIZA 2BVOB 1AD9B 1IAMA 1T0NA 1Q0YL 3CFKB 3BHBB 5FK9B 3L5JA 4LPXA 2XIDA 4AYFA 5I19L 3MJ9L 1RV6X 2E3VA 4LCCB 4WW2C 4F9PA 1Q1JH 4O2FA 1KACB 1FPTL 5IMOA 1MCDA 3LPGA 3MV9D 2HG5A 4OJFH 1J0HA 2AK4A 1JGDA 1IGTB 4OZIB 3FFDB 3CX2A 3DMMB 2FEEL 5TDOB 4BK4A 1KGCE 4YHPB 2VDPL 4R90H 3RWEA 1K5NA 5D7LB 4EZMA 3NCCB 2ED9A 1CGWA 2JB6A 4L1DA 1D5XA 2Y4SA 4UOJA 1T0NB 1KXQE 2FJGA 1MCWW 1G7IA 5LKNA 1J0KA 2PYEB 4GG6F 2YHGA 4F37F 5IMOB 4LLWA 4HLJA 1RJLB 1WGOA 2WUCL 2OL3A 2X4RA 4CGTA 2AK4B 1JGDB 2W9DL 3L5XH 3NCYP 1PD6A 5A3IC 3CC5A 2YSSA 3ZT5A 5HHPA 3BEWA 2PR4H 2R56L 4LLYA 3VD4A 4HAFA 4LQFH 2Y06L 4NC0B 1BLNB 1I3GL 2GAZA 3B3IA 1N3NB 2E9WA 5BXFB 4X9GA 4OI8A 1ZVYA 4H25B 1D5XB 4KK9D 2XI9A 5GISL 5IW6B 2LU3A 3LMJL 3ARBC 2FJGB 4JM4L 4MWFA 3S35X 1OWWA 2DD8L 5FDYA 2FGWL 1FIGH 2YMXL 4C57C 5CJOL 1NANI 3MJGX 5DS8A 3WIHL 2EDXA 4HDIB 1T20B 5IEHA 2BC4B 3QDGE 4Y4KC 5T3XL 3HPJA 4ISVB 2OL3B 2X4RB 4DGVH 2R2EA 1EHAA 4DTGL 1BAFL 3CC5B 1UT9A 4ZUSA 2YSSB 35C8L 3BQUD 5HHPB 2DM2A 2F53D 2F54D 4M6OL 2KH2B 2EDKA 5E08H 4E0RB 4HZAA 3B9DA 2GAZB 2DYPD 3B3IB 3IAQA 4GAYA 1CT8A 4IDLA 3MOBL 3C5ZA 3KLSA 4N8VG 3UZEA 2D7OA 4TVPH 5DTFA 4LHJB 4O9HH 5KZCB 1FGNH 1T3FB 1ZANL 4L4TB 4JPVH 1WAAE 5DVLA 3EZJB 3PQYA 5HHOD 2MKWA 5B4MC 3DETC 3DIFA 5DS8B 1QFHA 1RIVL 3B43A 5IEHB 4RAHA 3RZCC 1SM3L 4H5SA 2BY1A 2QEJA 4K8RD 3BT2L 3TT1L 3CCHB 4GAJL 3VU2A 2R2EB 4LKCB 3HG1A 2KL6A 3MLXL 4F33A 4WWKD 5HGAA 4LSUL 5I1DA 1RZFH 3V0VA 1FE8H 2XG4A 3LH2L 2H3NA 4M1DL 5DUMH 3I6KB 2GTWA 3TNNA 1H15A 1MNUL 4O4YH 4F8TA 1VERA 3BGFB 5DTFB 3CDCA 2AV7A 3S34H 3BD5A 3N85L 2GITA 2J1KA 4XNUL 3DIFB 4NN6B 3UBXA 2DBLH 1QEWA 1JL8A 2W9LA 4X7TA 1NGZA 4H5SB 4X7EC 5LWYL 2Z31C 1U3HD 4G8GE 1HXYA 3JSSA 4AT6A 4PJEE 3HG1B 1QSEA 2Z9TA 4F33B 4P59L 4PJHF 5HGAB 3B8SA 4MXVF 5I1DB 3V0VB 3CLFH 3SO3C 5L6YH 4ODVL 2A6DA 4FNLH 2RFXB 3AM8C 3HE7C 1U8IA 4FQQB 3GO1L 4P2QE 2AXHA 1U95B 2GTWB 4FZEL 4J1UA 1BVKA 4RWYH 4Z18A 1H15B 1FO0B 3MLUH 3RDTC 4JG1H 5DDHA 2DLEA 2ICEA 3V4UH 1TFHA 2AV7B 1G7MA 3T0ED 2COQA 1R3LA 3Q1SL 5IB1A 4WHYH 4JEGB 1K2DA 2ZG1A 3HUJE 5HHVH 3O3AB 3W2DH 3UBXB 4WVRA 3LDBC 2VXSL 3DX7A 1NGZB 3PWUA 2YD5A 4G9DA 5FOJA 3WIFA 2F5BH 4LLQA 4XGZA 4KJWC 3RRQA 2NY0B 3T8XB 3KPLA 5KG9B 3RX7A 5SWZB 1TJIL 1AH1A 4GW5B 1I9JH 2H2PC 2X1QA 4V1DA 3WFHA 7FABL 1F42A 4J1UB 5JR1L 3GM8A 3FT4A 5DDHB 4PJAE 2ICEB 1CU4L 2JJTA 3TH2T 1KGCD 1WBXA 3MXWH 3KPSA 4P5TA 4KQ4L 1HYSD 2GSGB 5D96B 5D1ZA 2BVQA 3WDJA 5DSCA 1K85A 1WFTA 1K2DB 1FG2A 3KJ4B 4N0UB 1NLBL 4JPIA 4YHZL 3O6KL 3DX7B 4NKIL 1MPAL 3PWUB 3OXSB 4G9DB 1JJUA 4XGZB 4LLQB 3P9LA 2X41A 3OB8A 2VWEC 3KPLB 5HHXL 4D0DA 2HT2D 5HVHC 3DO3A 5SWSE 1XR8A 3ZZ1A 4V1DB 3CNKA 3TBVA 5IVXA 4JHZA 3QXVA 1K8IA 1FO0H 3FT4B 5KVEH 1QRKA 3QNYA 4HEPG 4Y5XC 4NQUA 1WBXB 3D3VA 4HFWA 2CKBH 4P5TB 4XPFH 5IFAH 5JW4R 3ZL4H 5D1ZB 4M6NL 5DSCB 4GRWH 4JY4A 5T1LD 4GKOA 2DDQH 4OCMC 5EB9A 2GQHA 3LN9A 3DYOA 3JVGA 4CADA 1ES0A 3FZUC 3E6HA 3F6IA 1NCBL 4OT1H 5EUOA 4JY5L 4D0DB 1A1NA 1HSAA 1ONQA 3UPCA 5EO9A 2DIAA 3QWRD 1WUNT 1H9VA 3QCVL 5D1XD 3QDGD 3QRGH 4JO4H 2VDML 4RMTA 1AE6L 1XR8B 3FQTB 4MA1C 1FFQA 4QCIB 4P48A 3TBVB 5IVXB 4MA7H 3QEUA 5AWNH 2PW2A 4ZS6D 5KOMC 3LSOA 4M7ZB 1CE1L 3MLRH 2HWZL 1J12A 2EDHA 3CX5K 3O6FA 2BMKA 4U3CA 3D3VB 4HFWB 1FFOB 3BKYL 3DV6A 4RFOL 3UEZA 1P1ZB 3MACL 2HKFL 4JY4B 3TIEA 1DSFH 3BZ4A 2PO6A 3MQIA 3WN5A 2PKDA 4KI1A 5IMMA 4I3RL 4YXHL 4CADB 4XMPH 1NCDL 5GSRA 1LNUA 2BY3A 3E6HB 3LKOA 3NAAL 4Z7UE 3SDDC 3MBXL 1QKZH 3RWIB 5EUOB 3MV11 1FN4B 4H8WH 4KKLC 5HYJE 1HSAB 2FL5B 3GHEL 5MERA 1H0DA 3BP6B 4CMHB 2V5RA 4Z8FH 4ERSL 3CU7A 1AQKH 2AJYH 2EZ0C 2JB5L 2PW2B 1JPTL 3LSOB 3QISA 3MUJA 3C9NA 3PWNB 1TETL 5AG9A 4FQIL 2BMKB 3O4OC 3DV6B 1UWGH 1G6RA 1D5IH 1OLZA 3MRCA 4PGZA 2EDRA 5CSGA 3U2SA 3TIEB 1NPUA 4KRMB 4Y16A 3BZ4B 2PO6B 4UT7H 3WN5B 1ZWIA 3IS1X 1BFOB 5IMMB 3LQAL 3GNML 1LK3L 1XGQB 1OSZA 3BDXA 3VGDA 4Z7NF 4P5KA 4LBEB 2H9GA 3LKOB 4ZSOE 4NZUH 1DQMH 4WUKL 4J12A 4GS7C 3SOBH 5MERB 4CJ0A 3VWKD 1T89C 2HJLA 1NANH 2VDOH 4AK1A 4ZYKB 2EDQA 3FT3B 2V5SA 3LKPA 2BNRA 3HS0A 4XXCC 2X4OA 4G8GD 3SDYL 5EU5B 4NGHH 3BKCH 2B0SL 5JXEA 5KVFL 1WCBB 2CK0H 3U7WH 3VG9C 3C9NB 4P3CL 1EHLL 4NJAH 2HH0L 3N1GC 1NFIA 1JZ8A 4P2QD 2R8SH 3U2SB 5K9JL 1I7ZB 1YYMH 3WO4B 1MJ8H 1ZWIB 3EFDL 4OFIA 3BP7B 3ZTNH 3ULUE 1XGRB 2DJSA 4M7KL 2ADIA 3QXDA 1Z9MA 4ONFL 4XC3H 3NCJH 3TJHD 1QFUL 2WBJC 3H6JA 1A14H 2NXZC 4BFGA 4E5XA 4G8EB 3CSBA 4HIXL 4OIAA 4O2EA 3LKPB 2EDNA 3EOTH 5E4EC 1L9MA 1C1EH 1HHJA 1OTTC 3HS0B 4MX7A 2BSRB 1T1YA 2XT1B 3TJEL 4X6CB 2Q8AH 3U0TA 3VD3A 1U92B 1A6UL 1TZGL 4W70A 4YC2B 3RKDD 1A7NL 2Z8VC 3SE4C 4G80B 4KJQD 1W8NA 1NFIB 3QNZB 3T3ME 1U6AL 4P3DA 2BERA 4CUCA 4RFNB 1FVEB 1DBMH 1RZ8A 5E2WH 2RGSA 4IRSA 3C6SA 3UTTE 4UV4L 2FZ3A 1VFOA 3HC3L 4UTBH 3BVNA 3NFSH 5DR5L 5ISZE 1X5GA 2B20A 4C55A 1A0QH 4IOFD 4MHHI 2I9TA 1M1SA 4O2EB 4PLJD 4MX7B 1HHJB 4KK5C 1G6RL 1T1YB 2ZPKL 4J3XA 3WHE1 4I9WE 4Z7OE 4ZG1A 1JVKA 3GKZA 4LU5L 3WMSA 1CN4A 5TQ0H 1B90A 5BV7C 3MNZA 4LPYA 3WXWL 1RUPH 1RZ8B 1DBKL 3QEHA 4IRSB 3R1GH 1CE6B 3HI1B 1TDQA 2FZ3B 4HLZG 4LIQE 1ZV5A 4HPOH 2YS4A 3CVIL 2CGRL 1AFVL 3BVNB 4WTWA 3CMOL 3QFDA 4XNQA 5HDQL 2BVPA 5FM4A 5F72S 2QTEA 2VAAA 4MXWL 4LMQE 1GH7A 5IJVB 1DBAH 5HJ3A 1NUDA 2I26N 4D0CA 3EDKA 1CFTA 4G6FD 3GMMA 3MOAH 1JHKL 1OAQH 1YEKH 1B0GA 3LKQA 3GSXA 2HTLC 4NCDA 1LK2B 4LCWA 5T1KA 15C8L 1PX4A 3TH3T 3TN0D 2X4SA 3QEHB 4WGVB 1ZGLA 4ACPA 2IGFH 5E8NB 3QIUD 5FFLA 3JBG7 3ZTJG 1KT2B 2EIEA 4RGOL 3L3KA 2Y36L 4GG8B 4FP8L 3QFDB 1G7LB 2GJ6E 3D2UD 2BVPB 3O11A 4XB7A 2VAAB 1JNNH 3MUZ1 4EI5C 5AD0A 1T7YA 5HJ3B 4D0CB 5HYJD 4N5ED 1EO5A 4NC2B 1J10A 3HZMA 5I8KH 4PTUA 3RNKA 3LKQB 4JY6B 3GSXB 2A9NL 1MEXH 4U0RC 4G7VL 3S3JA 4QRRE 1NAKH 1JHTA 1ORQA 5D2NA 2X4SB 5BQ7A 5K33A 4AIXA 3GBML 5F89B 4RMVA 5A1AA 1ED3B 1UCBH 3VRJB 4AM0A 1IGFH 3IJYB 5A16A 3MMEA 3VXOA 1RHHA 3TO2A 4Y4FD 3O11B 2B7DT 2W65A 3PWPB 3T0BA 4QHLB 1MREH 3AC0A 3ZDYF 5DVNA 1A1MA 4YXKH 5C0BA 4M6AA 2IANE 1CL7I 5AD0B 3PUCA 4FQPA 5D6DC 4LSPH 2O5ZL 1M6OB 1NBVL 3HZMB 4DUVA 3BDYH 1WC7A 4FFVC 3HE6A 1JN6B 5EO1B 2FECL 4YEEA 1NC2A 2HKHL 4BSVB 3SDAB 3GZKA 3WEXA 2VLKE 4MAYC 3JTTB 4M93C 2MHAB 1JHTB 4OGAC 5D2NB 1AO7E 3NIFF 4M8VA 4XCFL 1RU9L 3CXDL 5JHDB 5FYKD 4KMLB 1XCTA 1V7MH 3NPZB 3MR9A 4OZGA 1KLUA 4KPHH 3BP5A 2IAMD 4Q9QH 4AM0B 1WWBX 5J12B 3QUKA 1FL3A 4F7TB 4P9HH 5J57B 5A16B 3MMEB 5J1SC 3CFCL 1BVLA 4JJHA 3VXOB 1RHHB 2UWEA 3TO2B 4K94C 5I1IH 3VRIB 1CBVH 1Z2KA 3ULUD 3PGFH 5C0BB 3I3DA 3OKMA 3ULVE 3UTZA 1H3VA 3ARGA 1BQSA 4ODHH 3EOBB 4L29A 43C9A 3LHPH 5EO0B 4F7CA 5KS9A 4F8QA 1WC7B 2ORBH 3IDGB 3OGCA 4HAGA 3WUWG 1NC2B 3WEXB 5D72L 1J0IA 1MLBA 4KUZL 2VC2L 3MV8A 2V2XA 3NIDF 1XF4A 1XR9A 1XCTB 4HBCH 4OZGB 5KTEH 1KLUB 3BP5B 4L3CB 5J13B 4PRHB 3QUKB 3H7BA 3FB6A 4YH6A 4KRLB 5F44A 2UWEB 1DL7H 1E4WH 1CGSL 1QVOB 3U46A 1RZKL 3HNSL 2HMID 3UTTD 4Y5VB 1P2CB 4FTVE 1EZVY 5IK3A 3UTZB 5JW3H 1MAML 3ARGB 2Q86A 5IBTH 4L29B 1OCWH 3O4LA 2R4RL 1UWXK 4HD9A 5ISZD 4PJIF 4F7CB 5TFSL 2YRPA 3QZWA 3X13B 1HSBA 3OGCB 1CK0H 1I4FA 1WZKA 4XMLL 2EIDA 4KK6C 2Z0BA 4PJGB 3V79C 2DQJL 1T03H 1IC1A 3UJJL 3QUYD 2HFTA 3D39A 3OF6D 4I9WD 3VWJA 2YPKB 1XF4B 1LDPH 1XR9B 3PP4H 5JXAH 1X5ZA 2Q20A 2F74A 4UTAH 1SJVA 2VL4A 3H7BB 3FB6B 3X12A 2C3HA 2EYSB 4LSRH 3IRPX 3IVKA 2Z91A 2NY6D 3U46B 1KN2H 1FSKB 5E9DE 3SKJH 5T5NF 1XIWD 4K2UH 3O4LB 1A7RH 4LCCC 4KV5E 3QZWB 3RGVD 3MBED 1F4YL 1C5BL 1I4FB 3QAZB 3BAEL 3PV6A 1FORL 1QSFA 4Y8DC 4DQOL 2FJHB 4NO3B 1A4JA 3VWJB 1BBDH 3DMMC 4NO5B 3SQOH 2C4FT 3TA3D 4M4RA 5GZOD 2F74B 1JNHA 1LVEA 1NCWL 1DBJL 4ODTL 3X12B 4JZJA 5C09A 3IVKB 2XTLA 2X9YA 2GUOB 1BBJA 2V17L 4P23B 1SYSB 1WAAF 3DRQA 3PWLA 1CLZH 5GGQL 1T4KA 2GJ6D 3UPAA 5C92A 5CJ8A 4HF5H 4F9PC 1I7TA 3QFJE 3FOMA 4PRIE 1Z3GH 1AXTL 3D85A 4FQJH 3PV6B 2VABB 5HI4D 4LLDA 1TPXB 4LCUB 3EOAB 3QJFB 4QHNA 1A4JB 3QWQB 2D7TL 1U3YA 2BVTA 1J9CT 4JKLA 1NAMA 2E9JA 5EZJA 3WFBH 5MENA 3T65A 1T1XA 1INDH 5F7KC 4CVWA 3UTQA 5ID0A 1I3RA 4NQVB 4QRRD 4CN1A 4NQSA 5C09B 3OPZL 3UAJD 2DWEB 4U05A 1NGXA 3E3QC 1FFNB 1BBJB 5IT2H 4I0PD 2XQBL 4M7LL 2HT4C 3PWLB 4PJ5A 1EA9C 3KAAA 2NY3B 3RY4A 1ZA3A 1I7TB 4NRYA 3BI9X 5IHZA 2RCSL 1GGCH 2ZWLT 5DT1L 3D85B 4L8DA 2IAND 4LEOA 2FBJL 2ICCA 4LLDB 3WLBA 4JLRB 4QHNB 1CIUA 2ZCLH 2XA8L 1PG7X 4NQDA 4ORGA 5H37G 1JBJA 1Z0NA 5F7EH 1NAMB 3RVTC 1E6OL 5MENB 2XTJC 5D93B 1T1XB 4TN9A 3T65B 3W0WA 1D9KB 5JMOC 1JWMB 2VLKD 5DYOA 1MQKL 3QO1A 5CEZE 5ID0B 1I3RB 4MSWA 4JVPA 3MRPA 4FQ1H 3GMQA 2DLFL 4NQSB 3T77A 4OFDA 2FJFA 1AO7D 3EYFB 3RP1A 1G7HB 2O5XL 12E8H 1NGXB 5FKAB 4KI5E 5IOPA 4DN3H 4GQ9H 4PJ5B 4UT9H 5ID1A 1OW0A 1KEMH 1LWRA 1NGPL 3MSPA 4K23L 1ZA3B 4NRYB 5IHZB 1A21A 4YQXH 1O5DT 4QF1A 2MWCA 5CSZB 1OTUD 1F8TH 4L8DB 3ULVD 4LEOB 4XP4L 2BNQA 3T1WA 3WLBB 4FQXA 5FYKU 4FFYH 1J1OL 3ARPA 4ORGB 1ETZA 1N0XL 1U8OA 1SBSH 4RBPH 2FATL 3JV4B 1MCCA 1ZLVH 3W0WB 5DYOB 1RUQH 5EPMA 2AJVL 5INDB 3O81A 3TYGL 1FLRL 4L5FH 2W1NA 5TGBA 3QXAA 3T77B 2FJFB 3WS6A 1VB9A 3BGFC 4JO2H 5DWUL 1KTRL 2I25N 2VDRH 5IOPB 4GXVL 4BZ1H 1CL7L 1VFAA 2O5YL 1JGEA 4HS8H 3U0WH 3K4DA 4JFEE 4NN6C 3QA3B 1HHGA 4XPTH 4BSWB 5DQJA 4QF1B 3TV3L 1NJ9A 4FTVD 3LKRB 2BNQB 4CL7A 2CDFB 4I77H 1WQVT 3GFUA 4XHJC 1H3TA 3GMPB 5D7JA 1ZLWH 4FQXB 5F21B 4Q9CA 5MI0B 4U7MA 2DN7A 2E8ZA 3FO9A 3EYVB 5IQ9A 4X8JB 2R1YA 2FGZA 1KCVL 5EPMB 1AJ7L 3VA2C 5ABDE 5BZDA 1KN4H 3OAYH 1RJYA 4IIQA 3O9WB 1CD9B 2DKUA 2VDLL 3KLAB 1E4XL 3GI9H 3MODL 1G9EA 4DVRL 2XZQL 1SY6A 1T5XA 1WICA 5KANI 2AW2A 2QHRH 3Q6FB 1IQWH 4ZDHA 1HHGB 2P43B 4C56A 4MD4A 3QR2A 5DQJB 3QI9D 1QP1A 5E9DD 3RWFB 1NJ9B 1OSPL 5ELIA 4PJDA 2NY0C 5D7JB 3I2CH 4NPYA 3GK8L 5TQ2L 2YD4A 25C8H 2AJ3A 2H2SC 3M17A 5FO9A 3FO9B 5IQ9B 1P7QD 3ORJA 4JPWL 2R1YB 5DHVB 4AH2A 5DK2A 1QNZL 2JTDA 5CIPB 5F93C 3QHZH 4IIQB 1Z0MA 4Z78A 2EH7H 4H1LG 3ZE0F 3GGWA 1JWSB 2A74A 4LOUC 4S1QH 3U1SL 4JCLA 5D96C 3BZEA 3DVIA 4O00A 5DVOA 2UZYB 4M43L 3VMPA 3KJ4C 3I84A 1HH9B 4ZDHB 4C56B 1JIBA 1QLRA 4FG6D 3VD5A 2YPVL 2E6JA 4WU7A 1QRNB 2VSDA 5JDSA 5KSAA 4PJDB 3OAZH 1CD8A 1BECA 1U8JA 3AFLA 2AJ3B 2FX8L 3MRBA 1JYXA 3QFJD 4PRID 4U1NA 3IJHA 4ONHA 4XPHH 2J3SA 4AH2B 5DK2B 1MCLA 5GGRA 4HWBH 5HHME 1QBLL 2FX9H 3HI5L 4Z78B 1ZTXH 1DFBL 2JJTC 3OJ2C 3QUXD 5HSFA 2A74B 1JZ5A 4MNQE 4P5TC 3A6OA 4RMUA 1HHKA 2R23A 3HB3D 3BZEB 5D1ZC 4FQLH 2Q7NA 4XNYL 2N7AA 5HHNA 2NZ9C 5I9QB 4PJ7A 3T08A 4WU7B 3EFFB 1EMTL 3BE1H 5KSAB 4N9GA 2DTSA 4YZFE 5CZVL 2BOCA 3FB8A 3UYOD 3WFZA 1S7VA 1KJ2B 2DQTH 3ROOA 1U8JB 2BFVL 3SE8H 3MRBB 5KVGL 4HUWA 2X4NA 3X3GH 4ZTPL 1AI1H 3QH3A 3IJHB 4ONHB 1SY6L 5DHVH 4PS4H 1NQBA 4K3DH 5GGRB 2BXZA 1FL5A 5CIPH 1KEGL 4XBPA 1SYVA 4M7ZC 4JFQA 4OF3A 1GOGA 5I8EB 4TOYH 2VKXA 3TESA 1AD0A 1EVTC 1HHKB 2R23B 2MMXA 1Q0YH 5CEZD 3C2AH 4PLKC 1IARB 1H3GA 2BK8A 4PD4J 5HHNB 4X6BB 4PJ7B 3VFTA 1T7VA 2JELH 1CVSC 4BH8B 5HVFB 3H7LA 5J8OA 3FJTA 4KI5D 4ZODA 1UM6L 4N9GB 4O58L 3WNPA 5IB4A 5L2KE 1S7VB 5DD1L 1K6QH 1NGWB 3IKCA 5DRWB 3I9GH 1F6FB 2NXYB 4OD2A 4CMHC 3QH3B 4M4PA 5IFJA 3D0LA 2PTUA 1EPFA 2VDPH 3PNWB 5D2LF 3RVUD 1FL5B 2PN5A 3THML 4NNXA 5C3LD 1SYVB 5DRXA 1ORSA 3CH1A 5IJKA 4ELKA 4JFQB 1ZOXA 5IV2A 4J3VA 3A6BH 1SEBA 4MS8C 4ODXA 4JJ5A 3KPTA 4TUJA 3VFVB 2AXFA 4PJFE 2PO6C 4N0FA 2YRZA 3VXSE 3WN5C 1KXVC 1I7RB 5EIQA 4YAQB 2FO4B 4YHLH 2HFFB 2WUCH 1HH6A 2W9DH 2VR5A 3CLEL 1KJ2H 3IKCB 4JFED 1NCAH 4P4KA 2OJZL 3HAEA 4OD2B 5F8RC 1CXLA 4UQ2A 1P4IH 4OV5B 3D0LB 4D0BB 4U1LA 4ZUVA 2EIZB 1I3GH 2HTKD 4NNXB 3Q3GA 1I9RH 1LMKA 3O6LL 5IV2B 2CKNA 2HYMA 1DZBA 2LE9A 4ETQB 1DP0A 4U6VH 3ZE2E 2NX5E 2VUOA 3ARFB 4JJ5B 5D8JL 3HKFA 5IB2B 5GISH 3TWCL 5TF1H 2XKSA 2IEPA 2AXFB 1GC1L 5MEQB 1FGVL 3WO4C 3WD5H 3WFDL 5DJAA 1R24A 2K7PA 3SDCD 3WIHH 4OKDA 3VI3E 4MJ6B 4HLZH 1B3JA 3MLZL 2NLJA 1X5HA 1AGBA 3BKMH 4RMWA 1S7TB 1HH6B 3P73B 2WWMC 4DTGH 4U3XA 1BAFH 5D70H 4P4KB 3KPOA 1F4HA 3HAEB 4IMKA 3V6FA 3U6RA 35C8H 2K3TA 4UQ2B 3NFPA 4Y2DD 2A6JA 3QDJA 4U1LB 4HUKB 4ZUVB 3UXFA 1CR9L 5JXEC 3VGAB 4QEGA 1QFPA 4BQBA 2GJZA 3KS0J 3MOBH 1XF2B 4D94A 4OF0A 2OX5A 4YPJA 5ANMA 2RJMA 4YC2C 3QDME 3I85A 5AYUH 1GGUA 1QFWI 4I18A 1U8PA 4RFNC 1MCIA 3DSFL 1M4KA 4HW6A 1R24B 5DJAB 4ETYA 1F97A 4Y1AA 3EDEA 3ZTJH 2ATPA 2B4CL 1SM3H 2EDEA 2VLME 4XP1H 5F8QC 2ZUTA 3TT1H 3V52L 1AGBB 3WS3B 4Y2OA 2ZNWA 4Z77B 1I8LA 4I1NB 3WE6A 4CVUA 4UI2A 3KPOB 1UVQB 1ZT1A 3A0OA 3K1DA 4LSUH 3V6FB 5HPOA 3U6RB 4P46D 1BFTA 3NFPB 2B5IB 4U31A 4JM2B 3QDJB 3B2UD 2J8UE 1CD1A 2V5MA 5JDJA 1OPGH 1OTSD 3CPLA 2JCCE 3IDXH 4WV1B 5KSUB 1Y18A 4GG6A 1GOFA 3LZFH 5ANMB 1X9QA 4XX1E 3JV0A 4UMGA 3DPBA 1AIFB 4Z76A 1Q9KA 3WSQL 1QR1A 4I18B 3N85H 5HHMD 1EX0A 4OLVL 1J18A 5DEGA 1CLOH 4F58H 5HYQA 3E8UL 4F7MA 3C6LB 2UY7A 4IRSC 4P2OA 2ATPB 4MNQD 3PP3H 5HI3D 4OLUL 4O2CA 5LWYH 5FKPA 5INCA 1EEZB 4Y4HD 3BP4B 1FQ9C 2X09A 5EU6B 4N8CH 1PG7L 3WE6B 4IRJB 4DKAA 4DOHB 1YMMA 4DKEL 4ELME 3PGDA 2ZG2A 1EFXD 1V5JA 5JPMA 3PDOA 1NDGA 1HE7A 1NBQA 1CD1B 3SCMA 4FZEH 2YWYA 5FB8A 4GBXA 1Y18B 3RL2A 3PGCB 5E2UH 4GG6B 1WFOA 4L8SA 4YDLB 2X6MA 3QIBA 4PY8I 1CZ8L 3Q1SH 5CCKH 5GIRB 2GK2A 3INUL 3C5SA 4PB9H 5HYQB 2AGJL 3GUTA 3TO4D 1AGEB 3DUUB 4P2OB 5FHAH 2AI0L 1Y0LA 3BGMA 5DURB 1C08A 1MHEB 3VGEA 4O2CB 4LEXH 3ARRA 1H5BA 4HUXA 4OV6F 5FKPB 1KJ3H 4WY7L 4XP6L 1ADQH 2VITA 2VLJE 3IDUA 3V4PH 1AP2A 1TJIH 4EIGB 2BRRH 4KK8C 1YMMB 3LQZA 3PGDB 1I1FA 4X8XA 3PDOB 2B1HH 3FQUA 5TJWK 3SCMB 5L2KD 5FB8B 4G9FE 1MCFA 1K3IA 3LKNB 1CU4H 1EXUB 2WLYA 4L8SB 4HIHA 5KAQF 1AKJA 1YNLH 3BWAB 1C5DB 5C07A 1UYWH 3MA9H 2BJMH 4R4NC 2EDOA 4UV7H 1EUUA 3GUTB 1S5IH 4YHZH 4RRPA 1Y0LB 4NKIH 2X40A 4K9EL 4HUXB 3I3BA 5LXGH 2VITB 1L7IL 1U42A 1W8OA 3FRUA 2HLFC 4PJXE 1FC2D 3LQZB 3MLWL 1I1FB 3P11H 1P9MA 4XC1H 1ZA6A 1GIGH 4F57L 5KN5A 2P44B 4OQTH 5DI8A 3KPNA 1NSNL 3HRZA 5M94B 3ZKND 5B38A 2EE3A 2AABL 2NY5H 4G6JL 4S1SL 3TZVA 1RZKC 1JPSH 3EKCA 3SDAC 4Y7MA 4HIHB 1WIPA 5JA8B 4MJIB 3VG0H 1AKJB 4L8CB 5C07B 4M6NH 4WI3A 1OP3H 5D2NC 4PJHA 4H20L 3WXVL 5J1AA 2NX5D 3MV7E 5J12C 2ZZUT 5JPNA 3IT8D 3G5ZB 1NCBH 5BJTB 3FRUB 5BVPH 4W4OC 4OCXL 5F9OL 1TQCB 5HD8D 4LSTL 4NCC2 4B41A 3OGOE 1ZA6B 2VB5A 1G0XA 3HRZB 1NFDE 5B38B 3N9GH 1GZQB 2VWEE 2Z92A 4UQ3A 3TZVB 3CDFA 1S7QB 4PJCE 3L3JA 4NUGL 4RFOH 2HKFH 1HQ4B 1C16B 1UQSB 2DQCL 2GHWB 3G6JB 4PJHB 1F58H 1IEAB 3VFPB 2VXQL 5J1AB 3QDMD 5A3ID 4JANA 4G8IA 1FL6A 5J13C 3SGDI 5JPNB 4M03A 3VA6A 4JHWH 4P9ML 1QBAA 5EG6C 4AG4L 3GHEH 3T2PA 4WTXA 5DJXB 1VPOH 2VLMD 4Y5VC 3ARGC 1G7PA 4E9LA 5F7NC 2AJSL 4OD3L 1WVZA 2GIYA 3ZSTA 2Z92B 4UQ3B 5AZEL 1RZJC 4GW4B 4E41B 1TETH 3T0WA 4DGIL 1TZHB 5L2JB 4Y4KD 4K3EH 4YHKH 3QDHA 1EBPA 4JFDA 3CZFA 1MIEH 4QRTA 1RIUL 3NZHH 4WO4A 4KZDH 3PIQB 2OBGA 2Y7QB 1HINL 4OFYD 3QUZA 1E6JL 5F9JA 2XKNA 3G5XB 4JANB 4G8IB 1FL6B 1JTPA 2AEWA 4W81A 2QQQA 2IFFH 1L0YA 4QNPE 1KV3A 1R5VA 5F1NA 3GDBA 5DD0L 2VYRE 2XWTB 2X9WA 1FSKC 2YR3A 3RBGA 2VNCA 3O3EA 4N0CD 2A1WL 4QOKA 1X5IA 2B0SH 2C7UB 4DK6A 5DGRA 2V2TB 1RUKL 2VLRB 4OZIF 4P3CH 4RDQF 3H9SA 4PJBE 3QAZC 2FYYA 3FONA 4HV8A 2I07A 3QG6B 4PIRF 1B4RA 1QFWL 4JFDB 3CZFB 5H37H 1C8PA 4QRTB 1F6AB 5CILL 3VFOA 1PKOA 4WO4B 3VWJC 5K9JH 3QIWB 3QUZB 4RIRA 3EFDH 3RWHA 5F9JB 2XKNB 3WDHA 1UWEL 4UOW1 1T2QH 1KIPA 1MY7A 1EZVX 1IKNA 1MHHB 3QQ3A 3WFCL 1R5VB 5F1NB 1JYVA 2J7LA 3DTXB 5I1AA 5EWIH 5BO1L 3H42L 4KI5F 4OI7A 3O3EB 4P23C 4XTRD 4TPRL 4QOKB 5CD5C 4WW1B 2DOCA 3TJEH 4WJ5A 4KHXL 2VLJD 3K0WA 4FHBD 3BUTA 1INQA 5GS0C 2R1XA 3MA7A 5J56B 3HFMH 3H9SB 4RNRA 2FYYB 2YPLE 1TPXC 2I07B 2Q1EA 2Z31D 4G9FD 2OJEA 2HFGL 3VXRE 5GGVY 2X4UA 1LEKA 4I4WA 1NMCB 1Y6NR 2E27H 3O0RH 4D9RE 3P9WB 3RWHB 1FNGA 3ARDD 3GHBL 3HC3H 3HE7D 3JTSB 5I1JL 5IWLA 1YJDL 1BQLL 5DR5H 3QQ3B 3IFLL 4H1LB 5CBEA 1N4XH 3CGTA 3EO9L 1A7OL 5I1AB 4OD1L 5K9QG 2X1OA 4BZ2H 2VIRA 2X9XA 1G6RH 3BYYA 1CDYA 4U6YB 4LAQL 2NY3C 4JRXB 5FYLL 1INQB 2R1XB 3BUYB 3MA7B 5C08E 3GBNL 2AJZB 1BWMA 4KC3B 4J3UA 1U3JA 3EHBC 1XF5A 1ITCA 4LU5H 2VRAA 2AJUL 2OJEB 3I75A 4LASH 4TRPH 4KJWD 3WXWH 1WZ1H 2BVUA 3ROLA 3C08H 5ADOH 4MQXC 1FNGB 4WNQA 3C8DA 4M5YL 1JCKA 1J0ZA 5D93C 3L3DA 1D9KC 5FGSA 3KR3L 3CVIH 3T0DA 4O5LL 1E28A 5C0IA 1EGJH 1UEYA 3GJFH 3TFKC 2AVGA 1FP5A 3MV7D 4NBZB 5CGYC 4HWUA 5DD6A 3EJYC 4GKNB 5CZXD 3BPLB 5B21A 2EC9T 3RAJH 5ICXA 4N0YL 4HK0B 2ZUXA 4JFZL 3C8HA 1SJHA 4Y5YB 1XF5B 4PGEA 2BSSA 1UACL 3S37X 4JKWA 3I75B 5FA4A 4B7IA 4KXZI 3SGKA 4TQEL 4M1CC 3P9MB 3ZDZF 3OAUL 3MV9A 1U58A 5ESAB 2QHLA 3PABA 2ESVA 1MCKA 4PRDA 4G8FA 4H1LH 1MIML 4Z7WE 1MI5A 1S9WB