3TLRA

Crystal structure of the tetrameric beta-2 microglobulin dimc20 mutant
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKCNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A recurrent D-strand association interface is observed in beta-2 microglobulin oligomers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Beta-2-microglobulin
total genus 14
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tlrA00
2CJUH 4QRQA 2EZ0C 4ZSOE 5CJQL 3RKPA 1JN6B 3PV7A 3UTPE 2Q3AA 1JV5B 2F9BT 4H8WC 5T1MB 1BFVL 3W81A 3LIZH 4PJXB 2VLKA 5DXWA 4EKXA 2F53B 5EZIL 2D7MA 2DIAA 3WFDL 5FYLD 3DX8B 4JM2B 5E08L 1MUJA 1WCBA 1T7WA 1YEDB 2FH6A 2BVPA 3ZDZF 5AZEH 2FBJL 1ADQA 4GKZA 3TBWB 2ICWA 5C0ND 5F3BB 2OXGA 1KTLA 2R2BB 3MROA 5HHVH 3Q0HA 4FQLL 4BJLA 5IBTH 1S7WB 3F58H 3H9YA 1DE4A 2FB4L 3CXDH 2GJ6D 3MUGB 4GQ9H 1HINH 1F3JB 1PYWA 4G9FD 3ZKXB 1WF5A 4Y4KD 5F1IB 3WIIH 2D7OA 1OTSC 1NBYB 3O8XA 4HS8L 3U7AA 4XNZC 3P11H 3T0ED 2BZDA 1C5CH 3IDJB 5CSZB 2XZQH 1AD0A 4HWBA 4H20L 5CEZD 4L3ED 3NVQA 4N8CH 1SVCP 2FJFB 1KBGL 3WCYA 1DBJL 5DHYB 1QLEL 4OD2B 4YDJB 3EIFA 1UJ3C 4X8JB 1T4KA 4QCIB 4U1GB 1Q9OA 1A6UL 2FEDD 3PQYA 3ZSTA 2ICEA 3U7WH 1JI2A 1MJ7H 2IFFH 2V17H 2VZVA 4QLRA 3ARWA 4F7PB 1DE4B 2YPVL 3HMWH 1CFVL 4RDQG 3MUGA 4Y4FC 3C6LB 4IMKA 5HHXH 3QXWA 5J11B 1HN1A 4Y5XA 1NLBL 5MI0C 1ULVA 1U3ZA 4I9WE 2A6DA 3VH8A 1KCSH 4JAMB 3IYLW 4JY5L 2AAVA 2VQUA 5CSZA 4HIXH 2D31B 4G9DB 1O7SA 2Y36H 3GIZH 5LGHL 4TULL 3LQZA 4WW2C 1G9MC 2HRPL 2VRAA 3ECBB 3MZTA 3I02B 1MRFL 3AFLA 1CZ8H 4HIHB 1UM5H 5GHWH 4GG8A 1FIEA 3MRIB 1XAUA 4LEXH 3RZCA 3MGTB 4K3DL 5D1XA 4HIEA 4ZPTA 5KSAD 3V79C 2AJZB 5DUMH 2FO1A 5HHOE 3VXOA 3QBTB 2WUCH 4NN6B 4OF3A 1JHLL 4RSVA 4NQTA 2HKFL 3O4OB 4U2YA 1IQDA 4Y88A 4IM8A 3HG1D 5IUSA 3I6GB 3FQXA 1G7HB 4DKFL 5D96B 4M7JH 3H3KA 3PGCA 4DOHB 2QHRL 4JG1H 4QWWC 1FH5H 5AG9A 4CNIA 4ONFH 4JAMA 3PUCA 2P8LA 3VXSD 3RGVD 1J05B 1RHHA 5IOPA 2WWKO 4P57A 2QADB 4LARL 2VXUL 4OAWA 3IJSA 1UB6A 1KPVB 1QHOA 1XR8B 4P46B 3W5NA 5GZNC 1CXEA 3BIAX 1SEQH 1MFCH 2XQYK 3V4VH 3QXAB 1T6WA 4JFDE 5I15H 3F7VA 4X80H 3ZHLA 1XF2A 5DVLA 3WNNA 2IAMC 4JFPA 4GAYA 1I8LA 4DGYL 3ARDD 4D94A 5AG8A 2XG4A 3QIBD 5EDXA 1UC6A 4OCYL 4XRCA 1EMTL 4LSSH 1KG0A 1IEAB 5EBWA 4DUVA 3U0PA 1G7HA 2VZTA 3PGCB 1DANT 4WTXA 3F7YB 4RFEB 4PJIF 1AHWC 1J12A 1RZFH 2H26A 3Q6FB 43C9A 1HHGA 1IAII 4CW1A 3VFOA 3O8XD 1G6RB 2JLLA 4KJQD 5CD3A 2Y06L 4ODBD 4ENEC 1DDHA 4KDVA 3UCRA 4PP2B 5GGSA 2VQTA 4U6VH 1QFPA 5J1AA 5BZWB 4D9QE 2NMSA 3MACH 1MHCB 1KPVA 4NZTH 4LHUA 1TVHB 2Y25A 3E3QE 2ORBL 4NBXB 3NABL 5DZLA 3WL9B 4QXGL 1MJ7L 3IXAA 1CFTB 2IC2A 2Q3ZA 2BNQD 3HE7B 5A16B 1AC0A 4M62L 4HPOH 4M61B 4U6YA 1AR2A 1IM3A 4M6ML 2NY3C 1J9CT 3C8KA 2YD1A 3WLWC 4OV5A 3JV6B 4L29B 4NWUH 3V6ZB 5CMAA 4OTXL 1IE5A 2OTWA 1UACL 1FL6A 1QEWA 4ODVL 1IKNC 1KT2B 4EOWL 2WIIA 1KEML 2V7HA 4YO0B 4PJDF 4CW1B 3OJ2C 3V5HB 4W6XB 2JKXA 5FGSA 2IANB 3RTQB 1RZGA 1L6XA 3UAJC 4JHAL 4WY7L 1AY1H 4UV4L 3NAAL 3MRRA 5FYJL 5C08A 5HPOA 1DBKH 2E7LC 3CPLA 4MX7B 4M5YH 1KOAA 5CHNA 4CDHA 2BOCB 1JTTA 3ULVH 3KYOA 4ZODA 3LZFL 4GLRH 2FX8H 3IXAB 1KXTB 5L9DH 5JW5B 1T1ZB 3FT2A 3K74B 4LPWA 3C8DA 1WC7A 3DIFA 1IC7L 3QIUC 4PJGF 1K4CB 1BEYH 1U8NA 3MUZ1 3SJVD 4LP4A 3BH9B 4IOIA 3UTPD 4MXVE 2VAAA 4D8PB 3RWFA 4MAUH 4JDTH 4XVSH 3QT2A 3VRLE 4X6BA 1CXKA 3E0GA 4PRPD 3KWWA 4P2OB 4QRTB 2C3HA 5T5FL 4LMQE 4JEGB 5HI3C 1A2YB 5SWZB 4OZIB 3VFVB 3PDOB 5DRWA 1YMMD 3NBNA 4LRIC 2X9XA 5B4MC 1MVUB 3GSQA 3BSZL 1IC5L 3O3AB 4NO0A 3QWQB 1IGYB 4DVRL 5E4IA 4QHLB 4XHJD 3TCLB 1U91B 5LGJB 3KXFA 1PKQA 3CH8A 5KOVC 1EO8H 5D4QA 4WTWA 1KCUL 3OKKB 4F7MB 4GSDH 5GGUA 5JA8B 3CJJA 5I1IH 3C08L 3QPQD 4HS3B 3UTSA 3TZVB 5SX4I 3L3HB 4CADB 1B0GA 2XICA 1E4WH 4HZAA 5DMIH 5GGVL 2HN7B 4JFFA 3EYOB 5EZLB 4P59L 1RY7B 3MXVH 1KTDB 2NXZB 1ZK9A 5D1QA 3GM0A 4HT1H 4X6FA 3PL6C 3QHZH 4O5LL 3SO3C 1CDBA 3RA7H 3HI6L 4LHJB 1ED3B 5GGQH 4Y4HA 4OCWH 1D5ZB 3EYFA 3ZT5A 1FL5B 4MNQB 1KV3A 5FEBA 5JW3H 4X6DB 3QIWC 4HJGB 5DA0B 1CVRA 3IF1A 2MFNA 3O6FA 1A7NL 5K59E 5F89A 3E8UH 1RZKC 5FO8A 3U4AA 1FFPA 4FTVA 4AIZB 1Q9KB 1UM4L 2X09A 3W9DB 2VYRE 1X5YA 3QH3A 1NAMB 3QIBA 3SN6N 2VDNL 4NP4L 1RMFL 2DJ4A 4ETQA 5HGGS 3W9EB 1FV1A 2FLBT 5H37G 1D6EB 1TTFA 2ZUQB 5MENB 3VU2A 4X6FB 3VXRA 4PJAE 3SGEH 1W72A 3C6SA 3ZL4H 4AIXA 1JNNH 5AYUL 5C8JA 4GRLC 1HKLL 1L6ZA 4HJ0D 5KSAA 5ESAB 1EO5A 3EOAB 1KCRL 5DI8B 2GTZB 1BZ9B 3WXWL 5TDOB 1GAFL 4NRYB 2HVJB 3GI9H 5DJXA 3UDWC 2I07A 4H8WL 5BCAA 3B2UC 3GM8A 4GXVL 2F19H 1ZLVH 1FO0B 5C0IB 2HLAA 2JJTC 1YEFL 1WZMA 3V6OE 1EVTC 1UG9A 3WN5A 1FLTX 2W0LA 4OD1L 4ZFOA 5D72L 1P7KB 2K7QA 3QRGH 4JY6B 3AAZB 2I9LB 1X4XA 2QQKL 1BWMA 1T7ZA 3EYUL 1HKLH 2Q76B 4GLRI 1Z9SA 3UJTL 5KOMC 3CAFA 4KDTC 5T3XL 5IB4B 1LO0H 3IETA 4FFYH 1CLCA 3WDJA 1DQQB 3PWVA 3I6KB 1I4FA 4LGSB 3NCCB 3RGVC 5D6DA 2LAGB 3FQTA 4RAVA 2E7LA 1A5FL 2X4NB 4TOYL 5C8JB 1OW0A 3MRDA 4WO4B 3V6OC 1YEKL 4X83A 3OWEA 1PZUB 2ESVB 5C0BB 1NFKA 2R4SH 4IS6A 4U1JB 2VDQL 5CBEB 3MLRH 5HYJE 1U95B 4K8RC 4NQEB 4X0KB 5C0AB 2YXFA 3TO4C 3RUGE 3HNTH 1F45A 5HHMB 3EJZC 2NTFB 5ELIA 5FDYA 2GCYB 4HUXB 4WI7A 5C2BH 4J4PC 2FDBP 4M5ZL 3UO1L 4JZJB 1XGYH 2OLDA 3O6ML 4CUCA 5FUZL 1VKXB 5L8JB 4HUMB 3BIBX 2X1PA 5DJDB 1A7PL 1PDKA 5JHLL 3AU1B 2DQHL 3CH1A 5E6IA 1U3HB 3ARBB 3DUHA 3PWVB 2NY7H 4KTDH 3HLAB 1YN6A 4JFQA 5D1ZB 3FO9A 2VABB 2R0WL 2VL5A 5IB1A 4JFEE 2VUYA 2DN7A 5INDA 1HYSC 2IGFL 2M26A 4O2EB 1A0QH 4UIMB 2XTJE 1SYSA 5IHUH 3FTGA 2ZCHH 1QSVA 2MKLC 2DM2A 4N0RA 1M05B 4L8BA 3ZT7A 5CFHA 2QBWA 3MLVH 5EU4B 1WFNA 1NFDF 4YUEH 1T5XB 2AJYL 2C1PA 4HHAB 3H42L 3MYZA 4QRQB 5KS9F 2GIYA 4NKIH 3BSZH 4NPYA 3TPUB 1OTTD 2WINB 3DV4B 5IB3A 2IAMD 5IHZA 4LNRA 1LEKA 4JO1H 5E56A 4HLZH 4XPHH 5IQ9A 1H3VA 2BVPB 3VFTA 3RIFK 1IBGH 3FJTA 3VRLF 3QA3A 3GSWB 4R0LB 1Z9OA 4AENB 1WWCA 2NX5D 1NUDA 1TPXC 2OR9H 3O6FC 1U3HD 3ARBD 1DBAH 4F7TA 5GGSY 3SDCD 3RU8H 2A1WL 4L4VB 5BZDB 5CZKA 5EU4A 5H35A 3MV8A 3AS3A 1D3CA 5A40E 2YK1L 3S3JA 1HH9B 3OXSA 5ANMA 5J11C 1YYLH 1CICA 2XT1B 3EGSA 4U1IB 1JF1A 4JHAH 5I1AB 4ONHA 1KENH 1TETH 3ARFC 4Z77B 4L4TE 5DJAA 1C5BH 3BXNB 3RDTA 2NNAA 3BFOA 3IDMA 1DANU 4LF3B 4OIAA 4A2LA 4AG4L 1U93A 1FNLA 1UACH 3UPAA 3ZE1F 3QA3B 3LKRB 1DFBH 4XH2A 2EDHA 4HQQH 1OB1B 4O2CA 3VDAA 5MEPA 2MJWA 2Y07L 4PJ8D 1MCQA 4M62H 1Z6JT 1ZV5A 1HHKA 5H35B 3T77B 4QTHA 3TIDB 4C56B 1WIUA 2F54E 3MC0A 4BSWB 4HC1L 4EUPG 3EGSB 5C0BD 2I60H 2DQFB 3GSVA 4P5KA 1CE1H 1UYWL 2D7TL 4NM8H 1CD1A 5EOCJ 4AK1A 4XCNB 2UYLB 4XBGB 5I6XC 3CLEL 2DDQH 2ED8A 2EDQA 3CSGA 1E4XH 1TJGH 2DQGL 1CGYA 5L7XL 3ARRA 4JLRB 4Y4HD 2BCKA 3SE3A 2V2TB 1RI8A 1KLUA 3QB7C 1CD8A 1EXUA 3BW9A 4NUGH 3B9AA 2QSTA 1AI1L 4NUJA 1DVFA 1A22B 1JWMA 1IGJA 5DJ0B 2A74A 3OF6D 5EWIL 2DQCH 2GAZB 2G5BB 2XQBH 1LEGA 3RBSA 2GYSA 5IB2B 4YHYB 1XGTA 2EC9T 1KCVH 3BPCA 5E2TH 2P8LB 1ZHKA 4Y4KC 5IW6B 2XIDA 4GO6B 1IGTA 2VXUH 3JWDL 3LDBB 4NFDA 3LMJH 2DLTA 4R7NA 3P4OB 2D7NA 3ARGB 2QKIB 4OZ4A 3RZCC 4K94C 1D9KC 2WW8A 3W2DL 2VITB 3FB8A 3VFSA 3QP3A 1T5WB 2J8UB 2O5YH 3QFJD 3BAEH 3RWGB 3F7VB 2HJKA 3L1OL 3MRNB 1NGXB 4GBXD 2VDKL 4LVNC 4ZS6D 1VENA 1P7QA 2RCSH 2MPAL 1KXVC 4WGWB 2PTUA 2YD7A 3IDYC 1VGKA 4HWEL 3BGMA 4K3EL 3RGHA 1HHGB 5EU7E 2AABH 1B6UA 2JB6A 3O3EA 4KAQL 5MP6H 2HKHH 2ICWI 1BBJB 3VW3H 2NYYC 3DBXB 1HQ4A 3LPGA 4MHHG 1I8MB 5L8KB 4FXGB 1T3FB 3GSUB 5JXAH 3FHAA 4AJ0A 4MSWA 5IVZB 4RISL 5F21B 1EGJH 1BD2B 5HDBF 4OFDA 5DLMH 4HCRA 3EO1A 5C1MB 1E6JH 3BQUA 3QDHA 3GZKA 4ALAL 4PREA 1MREH 4M61A 2C3VB 2LAAA 2FH8A 3AM8A 3NA9L 1PQZB 4ODWB 2ITDA 5L2JA 2AK4D 3TPKA 2OSLA 1BQSA 4MAYA 3B5TA 4PJ8C 3I9GH 1WGOA 2OTWB 3HC3L 4UT7L 3TP4A 1MHPL 2BRRL 1BBDH 2BSRB 1QLEH 4J3OC 4NQED 7CGTA 2WIIB 2H32H 4OQTA 4WEBH 5F7EH 5IIEB 4ACPA 4WW2A 3QIWB 4FP8H 3DV6B 2YPLA 3MLSL 4K9EL 4APQA 2YBRB 4P2CG 2PKDA 4NQXA 4B50A 3MTRA 4H20H 5DQ9A 2NY2C 1JGUL 3VXUA 4GAGH 1S5IH 3H42H 4JFYB 3EYSH 4MSWB 5IVZA 3GMOA 4XVUD 5EORH 2VERN 3CSPA 4WUUD 1P69B 4NSKB 3B9KD 4XVJL 3RHWK 5CSBA 1VSCA 1J1XL 4YNYB 1MJUH 4K71B 4DN3H 3M07A 5I19L 12E8H 3O6FD 1B4JL 2YPLE 4Z7OF 4I48B 4PJIA 4FQCL 5AZEL 1CGVA 3BP7B 1IGFL 3TBSB 4XB7A 5FK9B 5IVXE 4X9BA 3H8NA 5CIPA 4JZOB 5KSBE 3LN5B 4APQB 1IAOB 5DQJB 2CKBB 3D2UD 3O6MH 3B2UD 2EXYC 5DD5H 2AERT 4FG6C 4J12A 3N1MC 3TH2T 3REWB 5MEND 3CIQA 1VFUA 1QKZL 4OD3L 1FP5A 5IVXB 3TCLA 5LGJA 3VXPB 4JR9H 2AV7A 3MA9H 1AE6H 3OZ9H 4YPGB 1GGBH 2IMMA 4G7YH 2FEEI 4NNPH 4PV9B 3OGOE 1JZ3A 4JQXA 1YYML 1C5DB 4R9HA 3FONB 3MXWH 4YHLL 4YHZH 1P5VA 2Y5TA 4X98A 1DP0A 3OKOB 1ACYH 3U4EA 1ZVSB 4JJ5A 4G6MH 4OFYD 1L7IH 1MFBH 3BP5B 1EA9C 1HYSD 3HE6A 1ZVYA 3BZ4B 1C16B 3LD8B 4AQOA 2L4OA 4XMLL 1CBVH 2ITCB 4YXKH 1FVCB 4ELMA 3HG1E 4M02A 2B1HL 1YYMH 4QRUA 1NLDH 1ITBB 1FNHA 2PW1B 3NFSH 1AE6L 3EFDL 1MJ8L 5CCKH 1BFTA 2CMRH 3ZTJG 4UTAL 3QDJE 4LBEA 3VXME 2DYPA 4E42A 5GXBB 2H2PD 2C3WA 1RPQA 5K9KA 4XNYL 2SEBB 3U4BH 4OLZH 5ETUB 3PHQA 5FO8B 3MODH 2B0SL 4JB9H 2IAMB 3O41A 5EBMB 2NY4D 5E8NB 5DHXB 3HPJB 3MRQB 4LLUB 5IF0B 1A14H 2J4WL 4LIQE 2XTLA 5TE6L 1CR9H 1ZVSA 1FO0H 1RK0B 1UT9A 5E8OB 4LGRB 2J88H 3VRIB 2HG5B 3ALPA 1RUML 5I9QB 3OBAA 4DN3L 1ONQA 3RVVC 5JPMB 4XXDB 2ZG1A 3DECA 4L3CA 3CCHA 4Y19A 1J1OH 1FVDB 2EE6A 4NFCA 2X2YA 3WE6A 4P4RA 5C9JB 3IVKB 2I5YL 2QQQA 1MLBA 3UPCA 5C09D 1KIUA 3O6KL 2CK0H 2J6EH 1S5IL 1P84J 2LV4A 5I8EA 3MBXL 3OJDB 5FYJU 4WU7A 4X6CB 1A9BA 1T0MA 3X13B 2HVKA 1CDHA 3TBYA 3MV8E 1X5LA 3UJJH 5C0JA 2R8SH 3G08A 3CLFH 3NCFB 4EDWL 3QUXD 2DMCA 3R8BB 3KPNB 2EDWA 5BV7L 2DQTL 5CBAB 1U8IB 3HI6H 5EO1B 4EN3C 1P1ZA 4M3KB 2YD9A 5DMKB 4MXQD 3DGGB 4IHOB 2O5XL 3D85A 5F1NB 3MRGA 3RVTC 1YN7A 4PR5B 1NCBL 3OAUH 1U42A 4TNWF 1JPSH 5A2JH 5BS0A 4F7EA 1YY9C 4L3CB 2NR6C 2IADB 5GGVH 4DFIA 3WFCH 2HTKC 3B5GA 4HUVA 4IS6B 3U0WL 1UZ8B 5F88A 3WNKA 4X6DE 4U1JA 2AJUH 1B3JA 5IFAH 4F33A 1T1XA 1QVOA 1JIBA 4ZAKA 3K8LA 3T4AB 1ZS8A 1F3RB 3KPSE 1KCUH 2AI0H 3L3JB 4FTVD 5DURB 5AAMA 1W0VB 3QSKB 3GSOB 5JXAL 2D0GA 2FWOB 4J3XA 1KLGA 4HUXA 5GGRA 5DMGC 3VD7A 1IAIH 3BO8A 3PHOA 4P3CH 5FYKL 3WUWG 1LMKA 3LKNB 2ZSVA 4LCUB 5MP6L 3WFHA 4WV1C 4DN4H 2P42B 4OJFL 1FE8H 2FHFA 5T3ZD 1OARH 5IBUG 3T0WA 5DT1L 1H3GA 3SDAA 3RUGB 3IFNH 3SKMB 4XXCC 5D70H 1PD6A 3BIKA 2FD6H 2P1YA 3I2CH 3IS1X 4AT6A 2BY1A 5C07A 4K23H 3BZFA 4M7KL 3CFEA 4UZGA 3QAZC 1UZ8A 3RVUC 4V2CB 1OSZB 4KMTH 2NY5L 1AR1D 1IC7H 2VLJD 1QA9B 2E9IA 3ZLQC 5C3LD 4HUUA 3CD4A 3HG1A 1ZS8B 1WWWX 4X4ME 4E5XB 4CL7A 2ZNXA 3L7EB 3LZFH 5GS1B 3I50L 5LAXB 1BJMA 4FQXD 1D5MB 5JHDA 1MCRA 1BZQK 3LKNA 2YPKA 4F57L 5HHOB 3C60B 3MA7A 3ILQC 4OZFH 5D1ZC 4AIOA 4Q58C 3MRJB 1EHAA 3LV3A 5FKAB 3ZTJH 1S7XB 4OGYH 4FFWD 4QTIL 3INUH 1WLHA 4BK5A 5EU6B 3AB0B 5KVEH 5I0ZA 3VXQB 5D1ZD 3ULUL 5D1XC 3GJFA 4S1RL 3Q48A 2YWZA 5FA4B 3L5HA 5FV2A 5T5NF 4QGYA 1T04B 1C08B 1FNGB 1C12B 4ZO9A 5E6ZA 1Q72L 2DQGH 3OR7A 1TJGL 2VAJA 2V7NB 4PPTA 3FFDA 1Y6NR 2H3NA 1DQTA 1A4JA 3E6FB 4GW5A 4YDIL 2NZIA 3DRTB 1L0YA 3IAGC 5ANMB 2MCPH 2NZ9C 1K4DA 4HC1H 4U1IA 1JF1B 1LP9B 2GK0B 5GS0C 1U8KA 3VMPA 2BVOB 5FKAA 4LRIA 3CU7A 2BJML 4XPBH 2HT4C 5EIQA 3UBXB 3VMNA 4I0PD 2ZUVA 3BT2L 3VXQA 3BKML 4X5WA 1YC7A 4NDMB 5TH2B 3ZKQD 3U30B 5IV2B 5E5MB 3LKRA 5ILTH 2BVQA 4KTEL 2EDRA 4I0PC 4NCDA 1S78C 4HX1A 1WAAE 4YDJA 1A6AA 4DGYH 2R0KH 3VGDA 2CSPA 3FZUD 4P3DA 1N0XL 3RVXD 4G42B 1AXSA 1EEZA 3E6FA 4GW5B 2JCCA 5E0QA 2V9TA 3WKML 3GMPB 3IFOB 3T1FB 3K4DA 5C3TA 2VOTA 3TJHD 5ADOL 3DROB 5GSRB 2ED9A 3PL6A 3D0LA 3PWNA 2RB8A 4OGAD 2PO6D 3UTQB 5AUMA 5D7SH 3SKJL 3G9VA 3NGBC 1RZJC 3ECBA 9CGTA 5TH2A 1KSRA 5IV2A 2OJZL 4UDUB 1VESA 3VXNA 3MREB 4KKCD 3PWUA 4M1CD 1PZ5B 4PJDE 2ZZUT 3DVNB 2VR4A 1CGXA 4NUJB 4S10A 4XPBL 3EFFA 4PJ9A 5BRZD 3L3KB 1I1CA 3FO2A 4X4XA 4GUPB 4HLJA 2HJLA 3AREA 3G5XB 1RZJL 1IGCH 4JDZB 4KZDH 5E8DH 5EN2B 1OSPH 1PG7W 2EDEA 4JY5H 1NGYB 4UI2A 2R2EB 4AEEA 1A7RL 2BP3A 1TCMA 3R4DA 3VCLB 2JCCF 4MQSB 3T09A 4LSTH 3SE8L 3SBWC 2F8XC 3QI9C 5K33A 3S37X 1XR8A 4LIQL 1VADA 1GRWA 2HJKB 1G1CA 1CLZL 1YEHH 2ZOKB 5I76A 1G7LB 4ORGB 1J0IA 3NIFF 4PRDA 1BFOA 3B9DA 5KVEL 4PTTA 4G8IA 3CXHK 5KW9H 3EFFB 4PJ9B 5H2BA 4Z7OE 5F9AC 1G0YR 4ZUSA 1DBJH 4PUBH 4PG2A 2R39A 4OLXL 3RUGF 3CVHH 4X6DF 1P6AB 4LHQB 3CLFL 4EDWH 1RZ7H 4JDZA 4QOKD 5HI4D 4L8SB 3OKLA 4XP4L 2XRAL 3WS6A 4I1NB 1LK2A 1ES0A 2NX5A 1NGYA 3VMOA 2GJ6E 1OD9A 2FJHA 1VEOA 3VGAB 1VGEH 4PP2A 1CF8H 3D9AL 1QACA 5EH1A 1F6AB 2WP3T 3MRMB 4LHUB 3CXDL 4TOYH 3JSSA 5CZXD 2FD6L 4LLYB 4R8WH 2WBJB 3IRZA 4LSVL 5M7QA 1F3DH 4G8IB 4WHYH 2GSIA 4JKPL 5DJ6A 4IMLB 3D69A 4KV5F 1ZLVK 4FFYL 3QFJA 4JM4H 5J89A 1KJ2L 2CIIA 4GAJL 3RTQC 3EYUH 5FUOH 1IGML 4LASH 5EC2B 5C0CB 1FL6B 1QEWB 1IAIL 5FYKH 3OKDB 5DFTA 1JGDB 2F54B 4ISVB 4QT5A 1NGPH 4FFWC 5B3JF 1QQDB 5CJQH 3MNZB 3U4BL 1YEFH 4XZUB 1JYXA 3PWPE 5H94A 3ULSA 1LNUA 1YNKH 3VFUB 3QNYA 4DGIL 4ZXBD 1MJ8H 3OKMA 3TT1H 3NPZB 3O4LD 4I9WD 1N5AB 4L4TD 4UT6L 3FOMB 5F6HI 3PP3K 4V1DE 2IMNA 3BD5A 4PJ9C 4XTRD 4ZDHA 3HPLB 1ZVHA 3NCBB 4Y16C 1F58H 4MNQD 3BPNC 4BSVB 1FZMB 5C0NC 4G6ML 3QDJB 1HNGA 5BV7H 4U4BA 4NQSA 1MELA 4CU6A 3QEGL 5I8CB 4JFDA 4N5UA 4Y16A 2W65B 4JFOA 3B6SB 1IAKB 4PLJC 1JPGA 1GGCL 3KWWB 4P2OA 3VG0H 1X6NA 2AP2A 4KRLB 3TA3C 4JN2B 3WJJA 2NXYC 4IRZH 4KRNA 2MOVA 3DUSB 2AQ3A 3KYKL 3U36B 2I5YH 3LS4L 3ES6A 4N0UB 1OGAA 4PRAB 2G60H 4PJ7A 1OCWL 5DMGD 1VACA 1FJ1B 3N06B 3LQAH 4YPGA 5FYJE 1LE9B 2AEIT 1TZHB 5IKCB 3QDMA 4KVNH 4XPAH 4XPGL 1F97A 1HI6B 2Y5TB 4QHMA 5EO9B 4ZDHB 1MY5A 5IHBA 5F3HA 5F72S 3U4EB 4JJ5B 2XY2A 4L8CB 1OHQA 1NMAH 5FKPB 4WDIA 5AZ2H 4CJ1A 4OZIE 1ORSA 3WEXB 4R4BB 3BZ4A 1GGUA 2ITCA 3B9KB 1NMBH 5FHAL 2AEQH 2QQNL 5SWSD 3M1BA 5MEOB 2OR8A 1MCEA 1ZHNA 4WENB 1L9MA 2V2WA 5CJXC 4XMPL 1GZQB 5EORL 3QUXC 4UTBL 5DRNB 5EG6C 1B9ZA 1FJ1A 2XKNB 4NYLA 5CUSH 2EDOA 3TT1L 1LE9A 1AGFB 1YNKL 4KK9C 4PJHA 1AO7A 1CIUA 1IC5H 1SBBA 3RJQB 4XP6L 2ATKA 4JFHE 4KVCH 3DX9A 2JB5L 3QUYD 2V5RA 4NKDB 5D5MF 1FG9C 4FTVB 5DURD 4PJBB 4PJGA 4RGND 5CJ5A 1DLHB 3I3DA 3LH2H 43CAA 4K3JL 3L3IA 5C0RL 4XAWH 1I1YA 4KKCC 2IQAB 1VCAA 5JMRA 1CFSB 3KPSB 3DSNA 1LDPL 1IFHH 1UM6H 1FV1B 2EIDA 4RIRA 1NCTA 4JRXD 5MENA 5TQ0L 2WIMA 1RU9H 4L3AA 1WBXA 2OQJB 4I18B 4NHCH 5C0AE 1QKZH 2AQ1A 2E6JA 5ID0B 2C4FT 2F53D 1EGJL 4JRXE 3QUYC 1AO7D 4AEHL 3RVUD 5D7LE 1UB5B 5DQDH 2EE3A 3I3EA 1BQUA 3RL1B 5CJ8A 2HVKB 5DJXB 3TBYB 5A1AA 3VXSE 4U6HA 3G08B 1NFIB 3CX5J 2O61B 1U8IA 2XNAA 2XRAH 3FO1B 1H8NA 3GFUA 2ZKHH 5F1NA 5IBUB 3S37L 1AD9B 2W1NA 2VLRB 4DUXA 5E5UB 4NWUL 4R8WL 1KB5B 5EOTA 4X9HA 4PB0L 1NC4A 4N90D 2W9EL 3AB0C 1BJ1J 4N0YL 2P24A 3OKEB 3TN0D 2OQJA 4L3EB 1IC4H 1R5IA 3WBDA 1XGPA 4ODXA 3PXHA 3MRDB 1QVOB 2CIKA 4FFZH 5GS0D 3KPMA 1DN2A 2XI9A 5J3HC 5C0DB 3VGGA 1T2JA 1S7SA 5EU5A 1KULA 4JE4B 1RZ7L 1MCIA 4K2UH 3MJ9A 5DRZA 3V4UH 1IAIM 5BOZG 4LFHG 2YRZA 4WEBL 5F7EL 3TT3L 4J8RB 1V7NL 2XNAB 4H1LA 1RZFL 2H1PL 4P0DA 3C5SB 5BO1L 1HZHH 5DEFA 3UTSD 2J8UE 2Z4QB 2WBKA 4QOKA 1K5NA 3VRJB 5C2UB 3DXAD 4GG6A 2G75A 4ZXBB 2J8OA 1VKXA 5LJYH 4BZ2H 3NZHH 1HCFX 2Q20A 3C2SA 1JPFB 3TA3A 1KYOK 3Q3GB 2MCG1 2LU4A 3QG6A 1MAJA 3CFEB 4ZO8A 2ARWA 5DLML 3PGDA 3GSRA 4E9LA 2XACC 5INDB 4EN3A 1JWUB 4HUUB 1WAAF 4XVTH 3HG1B 3C5JB 2PXYA 3T3PE 4MMZC 4QRSB 1E4XL 5DZOA 5LG1A 1OSPL 2QLVB 4HPYL 1E6OH 2IG2L 2HFEB 5DVOA 3T65A 2FECL 2YPKB 1WZ1L 2NX5E 3GNML 2R2HA 4NC1E 1E28A 4R6UA 1KJVA 1S3KH 2ZG2A 4MJ5A 3TVMD 4M7JL 2B4CL 4MNGA 3KXFE 3WLBB 2EH7L 3H7BB 1OTTC 4I3RL 2RBLA 1AGCA 3LEXA 3L1OH 3HS0B 4QXTA 4W68A 2YMXH 2AJSL 4LRNL 1J1PH 4JQIH 4P2RB 2R0KL 4V1DD 5HGBB 2HJFA 1TQBC 3S88H 3SJVE 4LVEA 4B5EA 5DUML 5DHYA 3ET9F 1DVFD 2H2PC 5DJZA 4LEXL 1N8ZB 4EN3B 3CC5B 1OQXA 1JRHL 1KTRL 4AZ8A 5D2NB 4JQIL 5EUKA 4JFXA 2YWYA 2H3NB 4Z76A 5FOJA 4QRRA 2Y1VA 3BKMH 1GC1C 1AHWA 2EH8L 5I1DB 4OZGF 4LCWE 4YGVB 4OZGB 3CSYA 2BVOA 4OKDA 4I77L 5E2UH 5HY9A 3RU8L 1CICB 1H8OA 3GKWL 3HCVA 5HHXL 2MCPL 3UBXA 5J0BA 4JJHA 5LCVL 1DBAL 5CSGA 3NCYP 4Y2DA 1VFAB 4EEEA 2ZCKL 3RVTD 3MRIA 3LKQB 4JREB 5AD0B 3MRFB 4YHPB 4ZPTB 4HX1B 2Z93A 1OF2A 1KNOA 2NLJB 4G80A 3K81A 4Z7WB 4OLYH 4PJ8A 3DETC 5KANG 3E2HB 4JFXB 2CLVB 4QNPF 5B38A 3U79A 4N8VG 5A2IH 2HTLC 1IQDB 4U7SA 1Z5LA 5C0AD 4OCXH 3P30L 4OBRA 3FHQA 1TIUA 1C5CL 3P9LA 4JGJA 5HJ3A 1F13A 1HZHL 1Q1JL 1MLCA 4P2RE 3VI3E 1M1SA 5CIPH 1H15B 5E4EB 4DQOL 2NY2B 1MCOL 5A2KH 4K2UL 1SJHB 4I5BA 1JGLL 1RJYB 1DFBL 4DZBB 2PW2A 4MCZB 1AKJD 1UQSA 3CDFA 2DD8L 3FT3B 1A0QL 4LCYA 3BH8B 4MAYD 1EFQA 3BMWA 1NBZA 4LVHC 3EZJB 5F93C 5JQHC 4O2FB 5DR5L 2EYRB 4PJ8B 5DMJB 2FECI 3WIHH 4XMKH 1HXYA 1OT2A 1VEPA 2HJLB 1EEYB 1YYLL 1KTKE 4M7LL 4F15B 5DJ0A 3U0PB 2QL1A 4JVUA 1OP9A 2X4SB 3EYQD 3O9WD 4TPRH 4Q97A 4QF1B 3DYPA 1GOGA 4A2MA 4F80A 5I1EH 1X7QA 5DMYA 4C54A 2E9WA 1UJ3A 1YEIL 3T0EA 4ZUVA 4WO4D 2R4SL 1N6UA 4HEPG 1MHCA 4LCYB 4MNGE 1FNEA 1A6TA 3GMMA 5C0EA 1BVKB 1TXKA 4PJFE 5DT1H 5HI4C 1ERNA 2X4QA 1FNSH 3OKNB 3KG5A 4ZUSB 3O4LB 5JW4R 1FYHB 3PWLA 4OJFH 5T3XH 2Z8RA 4KXZH 2KZWA 4DN4L 1BVLA 2FBOJ 4OUUA 1CL7I 2ENSA 1NCBH 2DBLH 2VLJE 4RMQA 4TUOB 5IGXL 3IJHB 5JR1H 5DFWH 4PS4L 4K3JH 3D3VB 3PL6D 1C7SA 4JY4A 2AK4E 2QHLA 4NJ9L 5JOEA 2X42A 4ELKB 3TO4D 4ZAKD 2YR3A 2V7HB 5D6CA 3O3EB 1INQA 2J8HA 4P4KD 3U9PL 1I7UB 2LU7A 1JZ5A 1AP2A 5AYQA 1HQ4B 5IHUL 4YHKH 1SJEA 3PQYE 5I17B 4PBXA 5CJOH 5K9OB 1JI1A 3ZL4L 2V9QA 4KI5F 4FZ8H 5F9WB 4WI5A 5EULV 4KK6D 3P0VH 5DC9B 2WUBL 2X1OA 3SQBA 1F8TL 5DK2B 1FG2B 5C6WH 4MNHA 3DIFB 2VZ1A 1K4CA 2N56A 1KN2L 3B2VH 2BXZA 2Y7QB 1BVLB 4PJGE 1S5HA 2EC8A 2EYSB 4NP4H 1I1FB 1IMHC 3SCMA 5GJSH 3D3VA 4N9GB 3ZE0F 1VPOL 3C5ZB 4JFEA 3S35X 4PB9L 3HR5B 3NN8B 4WW2F 2CK0L 2J6EL 3CFIC 3DI3B 4KRPD 1JZ8A 3MLRL 4ORZC 1LNUB 2A9ML 3L3DB 5HYSA 3U48A 5DQDL 1S8DA 4NO0D 1W0YT 4OCWL 3L95A 4WU5A 1JZ4A 3JVGA 2F54D 1YEKH 2IWGA 4MCYA 1HKFA 3IDYB 2ZUSA 1A5FH 1LK3L 4OGAC 4Y89A 1G7PB 5KSVB 2FSEB 5EIIB 3BKJL 4OBSA 2LU3A 3G5YA 2Y5EA 2W60B 2F58H 3PJSA 4OGXH 1JZ6A 2R69H 3TWCH 1A9EA 3DVFA 4BSVA 5TE6H 1I8KB 4U0RB 4KWUA 4XPFL 4L4TB 3SE3C 1I1FA 1MPAL 1X6LA 3D0VA 4QY8B 4JGUA 1NL0H 2YRLA 4GQPH 4JB9L 4P9MH 4YC2C 5ICZA 3MODL 2WSKA 2LTQB 4H26A 4QHNB 5CIPB 2EO1A 4XWOC 3EO9H 4P49A 5F9JB 5J56B 3IGAB 3ES6B 1G7JB 1DQJB 1FZJA 4I0CC 1KCRH 4LHUG 1ZT1A 1SBSL 2NY1D 2XZCH 2CD0A 4KMQA 4WTZA 1AQDB 4HH9A 5T1LA 1XIWD 3EO9L 4HK0A 3ARED 3PGFL 3BISA 4X6DA 1J8KA 1ZOXA 3V0VA 1WT5A 2GJZA 3SOBH 5CLWA 2QQNH 3QQNA 4PV9A 4P3WA 4ODUB 4GBXC 4P9ML 3QQ9D 3MV8D 5FCUL 2R23B 3HE6C 4DTGL 2HTKD 1IGMH 1G9NL 4GG6E 4L4TA 2DQEL 3HUJE 1U36A 1KJ2H 3W9EA 1NBVL 3LRHA 4PGZA 3S35H 2AGJL 3PP4H 2EDXA 2GFBA 2E6PA 4U33A 3OZ9L 4XWGL 3ZDYE 4L9LA 2FX8L 3DPBA 1JCKA 2FX7H 2L7JA 2VISA 2WLYA 2E6QA 4M5YL 5KSAB 1XCTB 4HV8B 3MX0A 2VWEE 4P48A 2I9TB 3A6CH 3ARDC 4WTZG 4D0DA 5IMKA 1UKTA 3TN0B 3QHZL 3HB3D 5HVHB 1XR9B 1NCWH 3WNPA 4LKXB 4O9HL 5E7BA 5EC1B 5ETUA 5DD0H 1JGUH 4ODUA 2PYFB 1GGCH 1WTLA 4BQ6A 3QZWG 2ZWLT 4KROD 5T1DH 5K59F 5HI5D 1L0QA 2I9LA 3L3IB 3HAEB 1I1YB 4MA7H 4AH2A 2C1OB 1E4WL 3CVHL 4LFHD 5C09A 3ESVF 4GMTL 1RK0A 4MZ2A 4YHOH 3ZKSD 1F8TH 4WGVB 3RWDB 4UT7H 1TFHA 3I9GL 4LSUL 2X4TB 4JM2F 3HMXL 4OKVA 4HMDA 1ODAA 2ORBH 3U46A 3CCHB 4Y19B 4R96B 4YFLI 4FQIL 3MACL 3QZWA 3V9FA 5B39B 4ZNEE 1K8DA 2VR9A 5E6YA 5JNYA 1I85A 4K9EH 1XR9A 4TTGA 3QCTH 4RISH 3QJFA 2UWEB 3S5LG 5E99H 2IBBA 2AJXH 4LKCB 4OZHB 5J13C 3EJJX 2PCPB 1CLOH 4XP1H 2O61A 2PYFA 1NGZB 1BOGA 1TPXB 1IGCL 1AQKH 4MAUL 2BFVH 3QAZB 3K3QA 2BMKB 1ZANL 1S78D 1TTUA 3LY6A 4NQDA 3RDTC 3IDNB 3V8OA 1EEQA 1Y18A 5IT2H 5GQBA 1KPUB 2NY0C 5BVJA 5I15L 3KR3H 3FQRA 2GW5A 1NUGA 4K8RD 2CIKB 3KGRA 1CXFA 3QZWB 1LWRA 4MJIB 4XP9H 1QOKA 4MQ7B 2OJZH 3S3SA 2O5YL 3BQUD 2E7MA 5DS8B 1RULL 2AK4B 2UUDK 3D3VE 4I2XA 4KKLC 5I73C 1F90L 2CGRH 4NQDE 3L3JA 2JTDA 3M17A 3GSOA 2CO7B 2XXCB 5KSBF 4J8RA 2EEBA 3MRCA 4XP4H 4AYFA 4EOWH 4KKBD 4OF7A 4X7FC 1DUZA 4YDVA 2IH3B 3LQMA 1MHEA 1UEYA 3PIQB 1DBBH 1GGYA 4ZXBA 4PG2C 5B39G 2X41A 3U7YH 1KB5H 3V6FA 1SM3L 3QG6B 2VSDA 4LDLB 5BVJB 1JV5A 1YEHL 2RFXA 2LFGA 4PJXA 3VFTB 3CUPA 4OCRH 4PYGA 4F9PC 4KKBC 2GQHA 4IRSA 5BS0E 5F8RC 1G9EA 3GJEA 4U6VL 3ULVC 4V2BA 5DK0B 4CVZB 5IB5A 1EAJA 1DEDA 3TM6A 3IDGA 4YXLL 2GITA 5HSFA 3BT2H 5HYEA 3DMMA 3T65B 2YA2A 2GT9B 1FFOA 2VH5L 4NZJA 3QDAA 2BJMH 1H5BB 5SWQB 4YXLH 15C8L 5DJ2A 2UUDH 1T20B 1FZKB 2CUMA 4RRPG 4TTDC 5HHOA 4PJXE 1ZLWH 2HT3C 1CFVH 5DHVA 3CSBA 4F8QA 5DWUL 3TGXA 2NCMA 5CD5D 4Z77A 4JZNB 3TJEL 1A6UH 4XC3H 1SM3H 3KPQB 4C56E 3MGOA 5IMLA 1RJZA 4OZFB 2UVFA 2VXQL 3OG6B 2BNRB 2Y07H 3GJFB 4R90L 2ZUYA 3DSFL 1Q38A 3D39A 4YAQB 5I2IA 4ZQKB 5I8OL 4E0RA 1XGRB 4M03A 5EUKB 4CVZA 3CVIH 4Z76B 1J10A 2APXA 3GSNB 3ILPB 3HC0A 5D9SA 4N8CL 3BEVA 1MEXL 5I71C 1G6VK 1W8NA 3QEUB 5CD5C 1MFNA 5T3ZH 2N4IA 1W0WA 3BGFB 4I77H 5E2UL 2MHAA 1KELH 3QCUH 3V8CA 2QHRH 3T77A 4TTDD 1T0NB 1KENL 4PG9B 4XT1C 4G8EB 4K8RH 2ARJB 3C6LA 4JVWA 3UC0H 4N1EA 2NYYD 5TFSH 4Q2ZA 4FMFA 4H1LH 5I1KL 2P43B 3JWDC 4XCNA 4XBGA 3A0OA 4U1MB 1VFAA 3N50A 4TUJB 1H3WM 4M9OA 4RQQA 1NGWA 3HA0A 2FBJH 3GHEL 4YIQA 1U8QA 2J7LA 4TSCH 4RAUB 4G8GB 5EU7C 5HHPA 3MV01 3SKNA 2YSSA 5E08H 4E0RB 5TQ2H 2YMXL 2HRPH 1ZMYA 4NKQB 1DL7L 4CN6A 3QIUB 3PABB 1CXIA 4Y2DD 3BW9B 5DTFB 2R2CA 3JZ7A 3FRPA 3LRGA 2V5SA 2PO6A 2DOCA 4GMSH 2X70B 3HB3C 1KCSL 2ADGA 2A74B 1LO3H 1AXSB 2IANE 5CILH 1WZ1H 4M1CC 3TYFB 1LO4H 3CNKA 2PTVA 4X4MA 4FQXC 3PL6B 1RJYA 1GC1H 4M7ZB 3U7WL 4HDIB 2YZ8A 1U8OB 4MD0A 4NT6A 3KHOA 5IOPB 3RVVD 2VITA 4EI5C 4XCFL 3VFSB 3DHMA 2G9HA 4JO1L 4MA3B 3GMQB 2OI9C 2P8MB 3TJHC 2YD2A 3QWRD 3MJ7B 3UTTD 1HK6A 3OV6A 5HGHB 4D0BB 1N7ML 3MV7A 2VUOA 1FAKT 3TZVC 3NZHL 2BERA 2VXTH 2HLFC 1PZ5A 2R9HC 2XZQL 2BSTB 2IPKA 3F62A 4O9HH 5C08E 1NCWL 3QQ3A 2VDOL 2ICCA 4MD4A 8FABB 5KS9A 1JJUA 2DL9A 3QO0A 2J12B 2R8SL 5JORB 2C7UB 4FN0A 2A73A 3MBXH 2AGJH 4P99A 1YMMB 1OPGH 2X4RB 1YMHA 3QWOA 2VDQH 2F5BL 3D18A 3LEYL 5D1QD 1CK0L 2DKMA 2A2QT 2APBA 1BVKA 3KVQA 3VCLA 2P8MA 4OZHF 1D5IL 3GSXA 4PB0H 5EZIH 5GIRB 2BK8A 3K8KA 3H9SA 3LIZL 2RR3A 5KS9E 5L2JB 4KI5D 1SY6A 3MRBB 1TVBB 2CO6B 1CFTA 1XGYL 2CR6A 4EI5D 1RUMH 3UO1H 3WS3B 1NCDL 1P4BL 4PRHB 1KIRA 4LCCA 2IEPA 4M3JA 5FM5M 2A0LD 2X4UA 3EKCA 3OPZH 4KH2A 8FABA 3VFMA 5D6CB 3O9WB 4JHWL 5IWLA 4E41D 4YR6B 4WHTA 4PJ5A 3MJ9H 1WZLA 4PGJA 2ZUWA 4QRPE 1ES0B 1SJEB 3MZGB 3VWJC 3CGTA 3SDCA 1UA6H 2IANA 3RTQA 1NL0L 2CMRL 5TQ0H 3WFCL 4D3CL 3S4SA 4MX7A 4PRPA 1MAML 3QDGA 4MDJA 1C8PA 3MBEC 4IDLA 4WJ5A 1LDPH 4KTYA 1JPSL 3NACH 2CDGA 4U1HA 1G0DA 2EDLA 3EOBB 4D3CH 2CLZA 4XAWL 3ZYIA 4KUCF 1VHPA 1A4KA 1OAUH 3VFRA 2XXMB 1MCKA 5KTEL 3FB6A 1PEZA 2FLRT 4KMLB 1OTUC 1YECH 2JB5H 3RNQA 3Q2CA 1NC4D 3EOTL 3OKDA 4EQ2A 2F8OA 2OL3H 4XCEB 4XP6H 1BIHA 4ODHH 1BQHG 4HKJB 5IEHA 3SDXA 3WS6C 5MHSD 2JJTA 4X7EC 2JF1A 2G5RA 3D2UA 4JANB 1KCKA 2FR4A 4GS7C 4G7YL 4NO2B 3K0WA 1WWBX 2APFA 5EIIA 4PRNA 4CBPA 3VXPA 4D9LH 5KG9A 1PBYA 4F37K 4OCMC 3PNWB 4P9HH 2QSVA 5F1SA 4Z7UB 2R15A 3PJSB 3BP4A 1A9EB 1XZ0A 3QWRA 3QUZA 2WUBH 1RMFH 4HGMA 5DSCB 2CLZB 2FGWL 1U8HB 5B8CB 4FXKB 2J88L 3OX8A 4IJ3C 3LEYH 5F97E 2R4RL 3L3HA 3STZB 4OI8A 2BOBB 3F8UB 4MLIA 1T1WA 4PRBB 3VA2C 3DMMD 4NQSB 1FVCA 1MH5B 3WFBH 2R1WA 1GVIA 4QRUB 2ID5A 4NN5B 4ENED 3EYQC 3P77B 4IOSD 3MYJB 5DO2C 3MCLL 5CGMA 4U1KA 1PKOA 1F11A 4H0IA 4YHMH 5T1LB 1FN4B 4JVPA 3EJZD 3SDYL 4NZRL 4PRAA 4HK0B 5ACMA 3ULUC 5T3XD 3KS0J 1HWGB 4IRZL 3PV6B 2A9NL 3PHQB 1S9YA 2PYEA 4R26H 4Q6IA 2VXTL 3MXVL 5J13B 3MLSH 5GZOD 3MLWH 4PJ7E 2HFTA 2F15A 4Z78A 3MNWA 2XYCA 4OCLC 1FCGA 4TNVF 2FIRT 5E6ID 3WSQH 4KKNA 1QR1B 3ZKNC 1BIIA 1MHPH 2BRRH 4BH8A 3ARPA 2D4FA 3SGKA 4X8XA 4HCRH 1D9KD 1MH5A 5IESH 2ADFH 3EW3B 4TVPD 4RGNE 4X5XA 4UT6H 1I7ZB 3KLHD 3REVB 3NIFE 1D6EA 4ZG1A 5JPNA 1P5UA 1U41A 3FB7A 1ADQH 2X7LB 4DGIH 2PR4L 1MLBB 3QQ4A 3L7FA 5DEGA 3VWJD 4FQQB 4WI4A 3OB8A 1IARB 3CZFB 1PGRB 2XKNA 4NYLB 5I8EB 1S9YB 4Z7WF 3OAZK 2GJJA 1Q94B 4JPVL 3IAPA 4WW1B 2XKUA 3D39D 1U2CA 3WIHL 5F7DB 1K85A 3HFMH 4U1GC 3WN5B 3QULA 5EO1A 1IGFH 5LXGH 4NO3B 2DLHA 1QR1A 4FQCH 3MNVB 3CFBA 5JZ7C 3RGVB 2DD8H 2H8PA 2IQAA 5L9DL 1N26A 1XF4A 3N85L 1CFSA 5EOCL 5IVOA 4LSVH 2QR0A 1WBYB 5I1KH 4IIQB 1U8PB 4U1NB 5IB4A 5JOFA 3D1MC 4Q9CA 4XVJH 3T0VA 4RIRB 5FGCE 4R96A 3FB7B 1K8IA 3FB5B 4OF8A 1I3GL 5SX4H 2X7LA 2VXVH 4RBPH 4HUVB 1MIEH 1MAKA 1KPRA 4F2MB 1G9NC 5JNYB 3QQ4B 4HZLA 3RAJH 4GW1B 3NIGF 1KELL 3QCUL 4E41E 5D7JD 4Z7UE 2AQ2A 3QHTC 1OGTA 3OTTA 4NBZB 2PCPA 2CKNA 1CCZA 3RJDA 4Y4FD 1FLRL 5GGRB 5CBEA 1REIA 3LMJL 4UUJA 4KPHL 3JWDH 4PJFF 4LLQB 5E2TL 2JIXD 3WFHB 3DVGA 3I84A 1L4IA 3RIAK 3JBG7 4R90H 3IDNA 4P46D 2XQBL 1GIGH 2DQCL 2VZUA 5DYOA 3AMLA 4XC3L 2H8PB 3RWHB 2VLRA 5ACZA 4QXGH 2R1XA 1CLZH 2CLRA 3NA9H 2E27H 1QLFB 4M43L 4WIQA 1K8IB 3ZE0E 2Q6WA 3HLAA 3DX8A 1YN6B 4JFQB 4L3EA 2BDNH 5D2LA 1A7RH 4J1UB 1R3IL 3GMRA 5IMMB 3NCJL 3FRUB 2VH5H 2ZJSL 4E5XA 3R06A 5IP4A 5FYLE 3H0TA 3UTOA 5D7KD 4OLUL 2OZ4L 1NMCB 3EDKA 4LARH 2Q8BH 1FPTL 1K6QH 2Q7NA 5BW7C 4HIJA 2YS4A 4P2QE 3RY6A 5IK3A 5F1IA 5CP3H 4OCYH 1A7BA 4ELME 2VIRB 3NFPA 2D0HA 3TC9A 2MPAH 1S7XA 4X6CF 3ABZA 2I27N 3GB7A 4YXHH 5GS0L 4WI3A 3W11C 1RQ5A 5FM5O 3TA3B 1EPFA 3NCEB 2ZG3A 2WWMC 1CQYA 3WJLA 5DEZA 5D2LB 4RCAA 4P4KB 5IQ9B 4OGZA 4K3DH 1GHFH 3GUTB 1C12A 5SV3A 3GNMH 4KUCD 3SO5A 1LEIA 3OL2A 4FZEL 4BELD 1H5BA 3QDMD 4OFVA 1BF2A 1IAMA 4XWOD 3OMZA 1K4DB 4TSAH 4RFNC 3ETBF 3MV8B 4JO2L 5DUPL 1FDLH 1ZE3C 3L3OB 2BDNL 4X6CE 2VDMH 1KGCD 3X14B 4G9DA 2D31A 2E27L 2FGZA 3ZE1E 4JFZL 4JPKH 4QXTB 2BNRA 4ZTPL 3CFKA 3P73B 1HSAA 1MI5B 4U05A 5E5MA 4KQ3H 1BLNB 1R0AL 1IBGL 1ORQB 3MGTA 4I8DA 5DJZB 5C92A 3CC5A 2FEEL 2AJXL 4KPHH 4YJZL 1T2QL 4KUZH 1CE1L 3SDAC 1OTUD 3JV0A 4NKIL 4OFKA 4XNQA 3SCMD 2VLLA 1QSFA 1F4YH 4C58B 5JIIA 2KBGA 4FFZL 3QPQC 3FQWA 3RAJL 3HMWL 2D9QB 4HS8H 4Y5XC 1AO7E 3STBA 3FL7A 1MWAL 3FT4B 1KACB 5LQBH 3MRKA 2DM7A 1I3GH 4K3GA 3NH7L 1I8IB 1NUFA 3GSVB 4P5KB 4JHBA 4U0QB 4K3HA 4NZDA 4BK4A 4IRSD 3F58L 4HQQL 1CDIA 2UYLA 2ERJB 2XN9D 1P53A 3SKNB 3KHQA 4L8DB 5HYSG 3OHXA 4JRWA 2OTPA 5IHLB 1GGTA 5J1TC 2Z93B 1QYGH 4WNQB 1NDGA 5DVNA 2NY7L 4KTDL 2CK2A 4F9LA 1OWRM 1FVEA 2YEZA 1BFVH 1ZHLA 1X5IA 5GZOC 4I13B 4HKXB 3PDGA 2X4OA 3C87A 4CU7A 1T7XA 4CKVX 4N8VB 1CT8A 2YK1H 5HYJD 3IJYB 4Q74A 2CKBH 1NQBA 5IM7B 3WHE1 3MMEA 1U2HA 3FT4A 1WBZA 4JG0L 5I8KH 3BPCB 3VFOB 1WITA 5IW6A 3OQ3B 5JXEC 1PSKH 2UZIH 3N1FC 1KCLA 2AXGB 3VA6A 4L9DA 4FQHA 5E4EC 2VKXA 2GKIA 3BUTA 1G9NH 4KI5C 5D2NC 2DLIA 2JCCE 3MJ7A 4G6FD 2AV1A 3MLXH 5E95B 4DTGH 1JHKL 3I2CL 1A7QL 1JHTA 1S7TB 3G5VA 3VG9B 5SWSA 4MLSA 2A6IA 2CJUL 1CXHA 5ALBL 5C0CD 1MQ8A 3BDXA 4R26L 4OV5B 1SYVB 3QIWD 1SBSH 3CXHJ 3UEZA 1VFMA 5J6GB 3D25B 2QQKH 2PYED 4IRJC 1M71A 5JORA 4L8SA 4POUB 3L3GB 4KJYB 3MMEB 2C7UA 4EVNB 1FRGL 2IALB 4YO0A 5D7KE 4DVBA 2DKUA 3V5HA 4M8VA 3LN4A 1A7OL 4BA8A 2WM0A 2UWEF 4GBXA 2F19L 5BJTA 1LE5A 3DBXA 3QUZC 2VE6B 1RIUL 3V0WL 4YZFF 1II4E 4HKBA 3OJMB 2E9BA 4XPFH 4U2ZA 5CHNB 5DC0A 1OM3L 1A6ZB 1M7DA 2ADIB 1TQCC 1NAKH 4LLVB 1T1ZA 1TTGA 4CRPA 1ITCA 5HPMB 5E94A 4WFHE 4HAGA 1YJDL 1PQZA 4ODWA 5HHNB 3IDIA 4UBDC 2HWZH 2VC2L 4WFEE 5FUZH 4ZXBC 4XHQA 3IDUA 2VAAB 4D8PA 4BUHA 4I0PB 4LSPH 3QIBC 4WHTB 4JY4B 1M71B 4B7IA 1FBIL 3IU3B 3E8UL 1XIWA 3LN4B 4UAOB 3DV6A 3BVNA 2YBRA 3GSQB 3ZYJA 4LCWD 3EOTH 2B20A 5FA3A 1SJXA 2RJMA 3QEGH 2R0LH 1N6QL 3O11A 1WFTA 2XN9B 1FC2D 4G3YH 4LDOB 2XWBB 3ZKMC 4Z7NF 3RZWA 4Q7DA 4WJ5B 4LL9A 4GRMB 1OAUL 2EDBA 1PG7X 4QWWD 2CXGA 1FFRA 3BQUC 3EDEA 1IM9D 3BDYH 3C09C 5ERWA 3FB6B 3MUJA 3GRWA 4P59H 4QXUH 2MWCA 4FQPA 3BEWA 3BP6A 1F4XH 4JFFB 3V0WH 3HI5L 5I8CA 3SCMB 3IFPB 4XCEA 3NZ8B 2VWEC 5HDQL 4JN2A 5ADPL 5L2KD 1I7RB 4KJPC 1WICA 4Y1AB 3QXDB 1I1AA 3A6OA 3KLDA 2X40A 4PJ7F 3L3DA 3RWEA 4YDLB 4PRNB 5D96C 5KG9B 5IGXH 5FUOL 3ZKXC 1D5ZA 3DUUA 3PF2A 1TZHA 2B1HH 4J3TA 5ESVB 3S3PA 2O26U 2P5WD 5FGCB 2AV7B 2MQ0A 1U0QA 5ALBH 5DSCA 4HWZB 2IF7A 5GS1C 1A6PA 1FFPB 1A3QA 4HUNB 4C55A 4L8CA 1KIQA 2ZPKL 2QEJA 2HLFD 1T6VN 1D5IH 1DSFH 1CICD 5F44A 1MRCL 2CDEB 3IFPA 2NTSP 1ZTXL 4Z8FL 1V3JA 5I1EL 3CDCA 3N9GH 1Z3GL 1A64A 3P77A 4M6AA 2EDKA 3CFDA 1GZQA 1AFVL 5I16A 3O8XC 3TFKD 3BRDA 1CG9A 5HHMD 3KLHC 1NBQA 5ESAA 2FL5B 5KVDH 4WI2A 1ZT1B 4ZFFA 5DD5L 1DBKL 4GH7B 3RA7L 2PYEB 2DWDA 5C07D 1A6WH 3SKOB 5IFJA 1ND0A 2VDOH 4LCIL 5C0IA 1JTPA 3EOYG 3T0EC 4Z78B 1PG7H 4DWHA 4NRXA 1MFEH 3ROLB 4ZFOB 4YBQD 1DQLH 1X5XA 3GMLB 1YQ2A 4AEIH 2EIZA 4XCCH 1AGEA 4QRRD 1DUYA 5C70A 4TVPH 4PGBB 2VB5A 3GBLA 4M6MH 5GRYA 1QBLL 3QNZA 4N0CC 4DAGL 4I18A 1GC1L 3MRLB 5DO2D 1ONQB 4XNZB 4BQ9A 4KZDL 5KN5B 1J8HA 3ULVE 4WO4A 5MEQB 1HDMB 1ETZA 5D7IB 1XCTA 1QSFE 1M7IB 4KQ4L 1NSNL 4LK4A 2X1XR 5CILL 1M6OB 1D9KA 1VFOA 1KFAL 3FZUC 3RVXC 3HUJF 4MJID 2Y06H 3Q5OA 3OGCB 5BW7A 5T5FH 4PY8J 3OJDA 3MRHB 1I9EA 4NM4L 2ATPA 4R4NC 1DEEA 5DVMA 1E4JA 4KV5E 3PQYD 5JO5A 2EDDA 3H3BC 1R0AH 3HAEA 5TQ2L 3S36X 2P7TA 1CE6B 3DJ9A 4C59B 1LP9E 1A21A 3U2SB 3QEQB 3TVMB 1LO2L 2QV2A 5DMKA 4IHOA 3B83A 1AGDA 3O2DH 4N1HB 4J3VA 4HWBH 5F9WC 2VABA 4OKVB 1KPRB 2DIBA 4F2MA 2VKWA 3RI5K 5I9QC 2DKSA 3OAYK 4XNMA 5L2KA 3ARYA 3QISA 5JLZA 4UIMA 2IADA 3TZVD 4HLZG 5D7IA 2DQDH 3QUML 5B39A 3VFPB 2WK2A 2I24N 3T4YA 3BD4A 4WY7H 1UWEL 2WV3A 5HYIA 3GBNL 3RL2A 3QR2A 2YKLL 1AJ7H 2KQMA 1DN0A 4U6XA 2AABL 5B3JE 1KTLB 4JQXC 3VXRE 3S5LB 3BDBA 3BO8B 3PHOB 1C1EL 5EZJA 3MOQA 3T0EE 4QOKB 2P7TB 3VFNA 3RPIB 3LB6C 1QRNB 5E00A 1LQSR 3S7GA 2NXYB 3EAKA 5IBLC 1Y18B 1CD9B 3SDAB 4KROC 2R1YB 5IB3B 2OK0L 3NABH 4EDXA 4KC3B 3S8WA 1QHPA 1JWUA 4F3FA 3FRUA 3F6LA 2PXYB 3VG9C 4E41A 1CZ8L 4JM2A 1OTSD 1YEJH 4Z5RB 4AQ1B 5C9KA 2AK4A 4TULH 4X7SH 3C8HA 4GKZB 1G9MH 5ANME 5F3BA 3WHXB 5FYKE 4G8GE 3DO3A 3UXFA 1T03L 4X99A 1S7WA 1SY6L 1MSPA 4G6AC 4NQCB 1T2XA 1FGNL 3VJ6A 2IH3A 4DCQA 5J57B 2KL6A 4RFNB 4LEOA 4OCRL 1CL7L 1AGCB 2WAHA 3PXJA 3CK0L 3DETD 4YX2H 3N0PB 3HE6D 1QFOA 1NCCH 4OSUL 1OAXH 4APQC 2DAVA 4QTIH 4RA3A 4V1DA 1KB5L 1YY8B 5IFHL 5A3ID 3BZEA 4L3EE 5L6YL 4WI6A 2C5DC 4F3FB 4IRSB 1YUHA 4CDGC 4F57H 1MCNA 1LGVA 2DDQL 5GISH 1FYTD 1TITA 4IDJH 4QRRB 4XPTH 2D7TH 3EO0A 5EU6D 4HIEB 2B7DT 5DD1L 5ENWB 1FFOB 4FABL 5F6IB 3QDJD 1HHKB 5D5ME 4QTHB 3TIDA 4C56A 5L2KE 1QUNA 1IC4L 4NQCA 4Y1AE 5GRZA 4FQJH 3V5KA 1HHHA 5ESQB 3AS1A 4Y5XB 4K23L 3RNKB 4LEOB 4M48L 5D8JH 4EJ1C 3FRPG 2HKFH 5FO9A 2A6DB 3IFNL 2JK5B 3KPQA 1BLNA 5DDHB 4X7TB 1J05A 1HQRB 3LQZB 4JLRA 4Y5VA 3A6BH 3MRFA 2WP3O 3DWTA 4P57B 4YHPA 5LXGL 3SEPA 1N2RA 2FO4A 5CINL 1YUHB 3V7MA 4HIIB 3HI1A 4H0GA 1SVZA 1R5WB 2XA3A 2AJZA 4F8TA 2DM3A 1EXUB 3L9RA 1EO7A 3QEUA 4XP1L 1QP1A 2ESVD 5DGQA 1OAZH 4QHKI 4OM1H 4MXWH 5ICYB 4OM1L 1MCBA 1EEZB 5IFAL 1MFAH 3GSNH 1LEGB 2LQRA 3U1SH 4OZHE 4YHNA 1JZ7A 3QUXA 3HZVB 4GT7A 3W39A 4JHZA 3GGWA 2W38A 3ARVA 1ADQL 3IFLL 1HILA 3ESUF 3IFOA 3T1FA 2IAND 3RTQD 1FQ9C 3ARSA 2EXWC 4R7NB 4CNIB 5IESL 3TBVA 3P4OA 4U1MA 3WFEH 3F7YA 4RFEA 4ESKA 2JK5A 2VLJA 4RQQB 4NCC1 1A1NB 4JKMA 5J7CC 1T89A 2GY7B 1MNUH 4QRPA 5AUMB 1MJJA 4XPHL 4YIQB 4MZ3A 3NMEA 4NKOA 4M4PA 3L5XL 1N2RB 2FO4B 3LKSA 3V6OA 2W9LA 1EGJA 5T1DL 3G5ZB 3QXAA 3MRNA 1BQLH 2Z31B 2YOCA 2ADJA 2YUVA 2FZ3A 1MCWM 1EEYA 4YHIB 5TDPB 5AWNL 1QLRA 3O6KH 5I1LA 5A16A 3CFJA 2A38A 5IM7A 4LSDA 4XRCB 3B3IA 3VGFA 1WBZB 4Z7VF 3C8KB 3MCLH 5C08D 3RDTD 5F7KC 1J1OL 3D3VD 3NPSB 4PRID 2ICWJ 3AXLA 5EN2A 3T0EB 3TBVB 1EHLL 4JRYD 1P84K 1IEBA 1G6RA 1XF3B 1TCRB 5CD3B 4OM0H 4R2GB 4S1DD 4RMRA 3G5VB 3R8QA 1RZGB 3EO1B 4K7FA 1JNLL 2DQHH 4WEUD 4JCLA 3MJ6A 4LLMB 4ONOA 2X10A 4FXLA 1I9JL 1SYVA 4UINH 4DK3A 3OB0H 4RDQF 4M5ZH 4EZMA 2G60L 3UJIH 2B1AH 4X7SL 1R5VB 4N0UE 4OLWL 2EEAA 3V6ZA 4CVXA 5CCKL 5CMAB 3C60C 3BH9A 3NFSL 5IIEA 5TGBB 3BX7C 4XBPA 1INQB 1ZSDA 3RWFB 5J6HB 3OKLB 4NQXB 1WISA 3KPOB 3P9MB 4G9FE 4OZFG 2WWMD 3ARFA 1UKSA 3K7UA 4MS8C 4HKBB 4YK4C 4JFYA 4PYHA 1OAYL 3GMOB 4ZD3L 2QTEA 4KK8C 1L7IL 2V5YA 3FFCD 2X05A 5FYJD 1GPOH 4LLVA 2UZXB 4LAQL 3PWJA 3MXWL 2XV6B 1F2QA 2F58L 3MRBA 3ZSSA 2I25N 7FABH 5DJ6B 4JR9L 3WNOA 3U82B 3BKYH 4WWKC 4ZO7A 2P5EA 3QI9A 3MFFB 4HS3A 4PJCA 3NN8A 3QDME 5JIHA 3VFMB 1S7UA 1FYTE 2YPLD 4JZOA 2F5AH 3LN5A 3GI9L 1IAOA 4PRPE 2CKBA 1NPUA 2LVCA 3F7PC 3GK8H 3ARFB 3BD3A 1IVLA 4XZUA 2XWBA 1OAKL 4PLKD 3G6DH 3KNBA 3MLZL 5I1JL 4NC0B 3AREC 5CEYB 1NCDH 1BD2E 1F4HA 2X1WL 3S4SB 2NY6C 4X5LA 4Y4HB 2BXYA 1C5DA 4OT1L 4K55A 4PJCE 3FONA 2ZSWA 3MR9A 5EO0A 1R3LB 4HS6B 1JGVL 3HAEH 4QY8A 3UTSB 4R0LC 2IPTL 1B0GB 3BP5A 2O93L 2LVEA 3P4MA 1V5JA 5EZOL 1S7UB 3V7AG 4F9PA 1NSNH 4LU5H 3V0AC 4YHKL 4PJDB 2LE9A 4JFDB 3B6SA 4LNVA 4CMHB 3V52L 3HMXA 4FQ2H 4YQXH 4POZD 1CFQA 1RURL 5F96H 3EDJA 3O3DA 4PUBL 2RAMA 4O5LH 3VXRB 4FG6D 4GFTB 4N0UA 4GAFB 3UYRL 3RX8A 4MVBD 1MY7A 5KW9L 3O45B 4CU8A 3OAYH 1EZVX 2P47B 4M6OH 5EA0H 3QDMB 2OJEA 1X5FA 1KIQB 2ZSWB 4HJGA 2HVJA 1P7HL 3IF1B 2I07B 4U6TA 3MRQA 3MLYL 2BC4B 1U8HA 5B8CA 25C8H 4P2QB 2OXHA 2CDEA 3IXTB 5E8OA 3C08H 3T0DA 1A1OA 5CGTA 5M95B 4J6RH 2BOBA 1EJOL 3P4MB 3H9SE 2GFBB 4XCYB 2CDFA 4KY1L 2JJSC 5F70A 1RURH 3ZDYF 1ZHBA 1YEIH 1U58A 1D5BB 4C83A 4WI9A 3HTLX 4ZFGL 4HK3J 2KKQA 3MYJA 4KDTA 4PV8B 3BESR 3FCTA 4TPRL 1Z3GH 2V2XA 3G6JB 3N9GL 3P3YA 4RGMC 4N0FA 4UT9L 3E6HB 2JIXA 1LO3L 5I74B 4LKXA 1YZZA 4G9FA 4NIKB 2GTZA 2D3VA 1UWGH 2W92A 2ESVA 3ROLA 35C8H 1NC2B 4UAOC 5CEXA 1MOEA 5C0JB 5IW1B 3X3FL 3SHSA 2GSGB 4IOFC 2C1OA 4DKAA 3T8XA 5I1HH 3BAEL 4P2QA 4HF5L 3LN9A 4PJBA 3J7HA 5INCA 1PX4A 1UH2A 1D5XB 3SKJH 4JKKA 1NCAL 3IKKA 4ONGL 1YN7B 1R24A 5AEAA 3N1GC 3MRLA 2YUZA 4RX4A 1RV6X 3TIEA 1U58B 1DQQA 1H3UA 1TQCB 1YC8A 3GO1H 2VLKB 4DQOH 3TNMA 4UV4H 4PV8A 3WV0A 1XGQA 3FCTB 3FQTB 5BMFL 1MUJB 1WCBB 4B41A 3WKNA 2ERJC 5JA9A 1F42A 2E7CA 3TBWA 3P30H 2YZ1A 2RHEA 5D7IF 1KEMH 2PTTB 2O5ZL 5CEZL 4PY8I 1NC2A 3X12B 1E4KA 5CEXB 1NCNA 4K7PY 3BDYL 2BMKA 3AUVA 1CE6A 1YPZB 1ZA6A 1GPOL 1M05A 3DSFH 4L8BB 3VH8G 3K80A 4NO3A 1TJIH 1GSMA 1NFDE 3O9WC 1EDQA 1TJHL 2Q7YA 2AK1L 1DVFC 2DLFH 1AD9A 3WIFB 1T5XA 1OAYH 4EN3D 4L4VE 5CKGA 3TIEB 5T1MA 4QO1A 1INEL 3FB5A 4YEEA 3V95A 3TNMB 2FX9H 1E27B 4Y5YA 4RMWA 4NWTH 5D1ZA 4KRPC 5DRXA 1YEDA 5GS2D 3RL2B 3DXAA 2Z92A 5FYLL 3FO0H 4OD2A 3UJIL 2C26A 3KPMB 3MROB 3MJ8A 5TE4H 2Q8AH 1JF6A 3M17B 4NHUA 3GMNB 4YWGH 4EI5A 2M2DA 2K3TA 4WHCA 1CD0A 5DRZB 4UUJB 1JWSB 4FQXA 4OCSH 1X5KA 1EMTH 4LSSL 2AJVL 5D2LF 2EDTA 1X5HA 3C60A 4OZIF 1NAKL 1BAFH 4KK6C 3MRJA 4G5ZH 3OXRB 2WZPD 3ROOA 4IMKC 3U9UA 3MLPA 2A83B 2Z4QA 3VRJA 4GG6B 3RWJB 2I26N 4UNVA 4X80L 4AM0B 4ZNCD 4NPYB 3TPUA 4R3SA 2VJXA 5EOQL 4ONHB 1J11A 3ULUF 2XFXA 2WINA 4LHUD 2R0ZL 4P4KC 3GSRB 3PGDB 4NGHH 5IB5B 2CPCA 3ARUA 4GG8B 5CEZE 4QHKJ 4PJFA 1YA5A 3DXAB 2A1WH 1Q0YL 3OR7B 2GT9A 1R3JA 3H0TB 1NFDB 5IMOA 4X99B 4NQVB 5FAAA 5FYKU 5KVGL 4DKFH 1JWSA 3EZ8A 1AGBB 4XP9L 3HNSL 5E2WL 1V05A 2R2HB 4H88L 3L5XH 5HYQA 3R1GH 3WLBA 2Z8VC 4NC1C 1MF2H 2DLEA 3QEHA 5I1AA 3O0RL 4X5WB 3LEXB 1RHHB 3WFEL 2NY6D 4BZ2L 2PUQT 1RAMA 5KJRH 5JZ7D 4YAQA 3I02A 4P2RA 1ZANH 4S0SD 2HJFB 2BFVL 1ZKAA 1HHJB 5I8KL 1QRND 4F37F 3ILPA 2NPLX 2DM4A 3QPXH 4APQD 3DHJA 3DX6B 5FDWA 1MFAL 3ARFD 3GSNL 4HIXL 4KRPB 4OQTH 1N6VA 5E99L 3WMSA 3ARGC 3QCTL 1IGIL 1OB1A 4O2CB 3K2MC 4XC1L 2EXYD 4GAYB 2ZCHL 1ZGLP 2Y6SD 3H7LA 4PG9A 4ZS7H 3D87B 4OZGA 1DVFB 1GGIL 4PLOB 2F74A 4HEME 5FGBA 1UCBL 4OI9A 3SDCC 3DROA 5F9OH 1A3LL 2GAZA 5GSRA 1J5OH 4JDVB 2G5BA 5DFVC 4BSWA 4TUJA 1QFWM 4N0YH 3BN9D 3EDDA 4PJEF 1ZHKB 4KKAC 1YEGH 1U8QB 4KHTH 3NIDE 4R97C 5D8JL 3IJSB 2J5LB 3C2AH 4MQTB 5ICXB 1JP5A 5GJTL 3ARQA 5FF6A 1HHJA 4FQJL 3ARZA 2EEDA 2VLRE 2VSCA 4LVNB 1J5OL 2A77H 5DD0L 5DTFA 4KDWA 4Z7WA 2PO6B 3P11L 4JFPB 1DZBA 2VO5A 3HE7A 3IB4A 1DQML 1F4AA 3L3KA 5DD3H 3HC4H 3H9SD 3WIIL 4NRZB 4XNQB 2P5EE 4IDJL 4XC1H 1HCVA 4ZYKB 3P0GB 4HUKB 1NGXA 1JWMB 3MSPA 1B0RA 1KIPB 4DFHA 5ALCL 5IJVB 3G6AB 3NIGE 4S1SH 3CVHA 4DKEL 4FQLH 1Z0MA 4I3SH 1H15A 1NKOA 2VLJB 3WYRA 4MDIB 3LDBC 1MFDH 3BJLA 5JQ6L 2EO9A 1MJJB 3IU4H 1LO0L 3O2WL 4Z7WE 4NKOB 4ZTPH 4RBPK 5GPRA 4YHYC 2W0FA 1TVHA 3KPLB 3WFZA 1FGNH 2ZOKA 1FSKC 1FDLL 4N90E 3DTXB 2QADD 4XI5C 4Z7UF 2BSTA 4JN1L 2FZ3B 4RGMB 4TQEL 2BHUA 4XNYH 3MRPB 2YEZB 3QQ3B 4H8WH 1BX2B 5IG7A 5F7FA 5HHQB 2XZCL 2HRLA 4IOIB 32C2B 5C0GA 4UTBH 1Q0YH 1BPVA 4MA1C 4LCWB 4YLQT 3O2VL 5EBGA 5I6XB 1CBVL 2BNQA 4D9RD 2FJGB 1BBJA 1RIHL 5L0QC 2FJHB 4WFFE 3VXTB 5HGDA 3U0TA 4P2QD 1OVZA 3HKFA 1RK1B 5HGAA 1MVUA 4NFBA 4WCYH 4QOKE 4ZUVB 1FFNA 4WUUE 5C08B 1MPAH 1VB9A 5I73B 2VXSL 1FFQA 3MQIA 2VDNH 3BN3B 2W07A 4WFFD 2HT3D 2DQJH 1CDUA 3KYOB 3L5IA 4LCCC 4X9FA 3JXAA 1U8MA 4LLYA 1JHTB 4LLMA 3DTXA 4YPJA 3LSOB 5JW5A 1FYTB 1PKQB 3FT2B 3F7RA 2YA0A 1JFQL 3WS3A 4NSKA 1M7XA 2X4QB 3OKKA 1VERA 1BX2A 3H2WA 2YKLH 1LK3H 4OI7A 4OD3H 1Q9WA 1HYRC 2AJ3B 5SX5K 5TF0A 4KZEL 3TZVA 3A67L 1EJ6A 3O9WA 4OIBA 4IJ3B 4LOUD 3QEQD 5EPMA 2HN7A 1JGDA 2F54A 2A9MH 2NY1B 4PJIB 3WUWB 2X5PA 3BRGC 1QZ1A 4WWKA 4HT1L 3GEWB 2FX9L 4GBXB 1W72H 1RZKH 3VXTA 5GGVY 3WDIA 5F7YC 3O3AA 4YE4H 1JYWA 1A1MB 2EC9U 1AIFA 2Z9TA 1MJUL 5GS2H 1YNLH 1KGCE 2VR5A 1U8MB 1CGTA 1JNHA 4GS7B 2E9JA 3HZMA 5F6HJ 4GSDL 2BY3A 4KK5D 1QBAA 3VDCA 3HPLA 1FGVH 1RZIB 4ZTOL 3ZO0A 3O6FB 1QO3B 2XWJA 5HPMA 3WXVH 4YNYA 2H45A 3EYSL 4JZJC 4TUKH 4BFIA 4GRWH 4KQ4H 3EYOA 5EZLA 5IWLC 1EUTA 2AEPH 4OLVL 4HH8A 4N9GA 1JYNA 3HAEG 5F7LB 1P4LA 4WEMB 4WWKB 5FK9A 1QSZA 1XIWB 4ERSH 2X89D 2VXVL 3ZTNL 1UWXH 4NO2A 1M4KA 2Y9RT 4XBEL 4H25A 4ELMB 1S8DB 1A1MA 4PS4H 3O11B 3WLWD 1AIFB 3FQUB 4W4NA 4ETYA 4MCYB 4GAJH 1G6RH 3ARDB 5IEKA 4WHDA 3BP4B 4PJIE 1BEYL 4I2XE 3MR9B 5EO0B 1DQLL 3QNXA 4LBEB 4NN5C 1HI6A 2XQYG 1E6JL 1PG7L 4HG4J 1QO3A 2XWJB 4AIZA 3BHBB 3X3FH 2UY6A 4DGVH 1P7KA 3STZA 1I8KA 3T2OA 2JJVA 1I3UA 3SGJC 3NAAH 5FYJH 1AY1L 3SGJA 3B9KA 1CF8L 2R1WB 5B8CC 4LQFL 1RZ8A 1F4WL 4UT9H 3VW3L 5ISZB 1AFVH 3TBTB 3HE6B 3M1BB 3VRIA 4HG4K 3H6JA 5ITBL 2HMIC 4HWEH 1WAAA 1I4FB 5F9JA 2OTUA 1N4XL 1YQVL 1FN4A 1F4WH 2ADFL 3PV6A 3X17A 4JPIA 4BZ1H 4HCRL 4O4YL 3V5DA 4J7RA 1IEHA 1OOAA 3SBWA 1AGFA 1P6FA 3M8OH 4AMKL 3DUUB 3WE6B 2Q86B 4PGCB 2OJEB 2EYTA 3F65A 5K9KB 4HPOL 3BOVA 5HI5C 3GBML 3LD8C 3SE4C 5C07E 3PHSA 3PWPA 3AY4A 3DOSA 5E8EA 3V2AR 5DGRA 1G7QA 2NTFA 2GCYA 2G2RA 3W2DH 1ZT7B 4LIQH 3GJFH 3NPSC 1QPXA 4LLUA 5IF0A 2MQ3A 4LSTL 3LHPH 1MWAB 5GRUL 3C60D 4RRPA 3IETB 4NZRH 5DJDA 1NANI 5C0CE 3TBTA 4W6WB 2HA1A 1SHMA 2PO6C 4NNYA 5FO7A 5HVFB 4PR5A 4RAVB 4YQXL 1S9XB 3V52H 5ID0A 3FO9B 1UFUA 2OI9B 1RZJH 3E6HA 3UZQA 1FVDA 4X6EA 1UCTA 1AI1H 1TNMA 4HV8A 4OQ1A 4O2EA 2P46B 4OCXL 1PY4A 4UILL 1NJ9A 4N5ED 1Q94A 2Q86A 3UTZA 4DOHE 4R97B 4Z7QF 1U95A 3FTGB 4NQEA 4X0KA 5C0AA 1OP3K 2GSGA 1I3RB 3DO7A 3FO1A 1MFCL 3V4VL 3X13A 5INCB 3RPKA 2GJ6B 2ZCKH 3JV4A 1XMWA 3OG4B 2NY5C 1XF4B 2C1PB 5E24E 4IIQA 1L7TL 3CH1B 3JWOC 3QNZB 3QO1A 3MOBL 4HWUA 1XGQB 1EFXD 4RWYH 5CP7B 4F7EB 3SGKC 3SKMA 1LO5B 3U6RA 2FATL 4F58L 1BGXL 4Q9RH 1Y6KR 1CYGA 2JELL 3MO1B 4Q6YA 4CVWA 2OL3L 4LVHB 4UQ3A 3WKMH 1HWHB 3GSWA 2D03H 2PTTA 2IQ9H 3B4NA 1KJ2B 1F2XK 2FEDC 3BKYL 4G6AD 1N0XH 4LLWA 2ICWB 1YPZA 2WUCL 3S97C 1GL4B 2H2SC 4AG4H 4XTRC 3MOAL 4X7DC 4XP5L 3CU1A 2K7PA 3SDXE 5CGYC 5LAXA 5GHWL 1K5NB 3RWHA 1HH9A 3S96B 2BVTA 2IFGA 1TETL 4OIIH 2DTML 3MA7B 5C6PB 1ZT4B 3T3PF 4LDEB 4YDKH 3LRSB 3LEVL 1QLFA 4XXCA 4GW4A 3UTSE 3QO1B 1KJMA 4G6KH 2B4CH 5DJAB 3FQRB 4OB5H 4G8FA 2VTFA 1S3KL 1LO5A 1INDH 3MO1A 1AXTL 2ZUXA 5E9DD 3BZFB 5ACLA 2FJFA 4MJIA 1I9RL 4KRMB 1U93B 4XNXH 4YFDB 3VFPA 4NHUB 3W82A 3KYNB 4JHWH 1E6OL 2IG2H 4HPYH 4EI5B 2YPVH 4GRLD 1QA9A 4YDIH 3T2NL 5C6TL 1C08A 4OCNC 3STLA 4LPXA 2IFFL 2V17L 3QEQE 5BVPL 3F6IA 2YD5A 4FQXB 1MCFA 1YEEH 4XVTL 5T1KB 2CRYA 3ZHKA 3OXRA 4PJXF 4Y4KA 1CICC 1U92A 1O0VA 3L5WA 1D5MA 3P9WB 4RX4D 3RWJA 4G8GD 1ZGLA 3S96A 4AM0A 3MCKA 3T0XA 3LV3B 4S1RH 3T1WA 2DQFA 4X9IA 5D6DC 1LP9A 2H9GA 4GW4B 2X1QA 2DI7A 1KJMB 2Z0BA 3VH8B 4HW6A 2NNAB 3IDMB 1PSKL 4WFHD 4L9LC 2WQRA 4OGYL 4JO3H 4GJTB 3DURB 3KS0H 3QXVA 1R3KA 1UVQA 3ARGD 5CS7A 4LVOC 3TT3H 5FA4A 4B53A 5BS0D 1T7VA 4E41B 1LEIB 5JHDE 3DX7A 3KYNA 4HIHA 4PD4K 3I50H 5MEPB 3IDGB 1HXMA 3TF7C 2NW3B 3RWIA 4GKSA 3VXOB 1A6AB 1CDYA 4YGVA 3UDWA 2BSED 1PAMA 2F8VA 5FOBB 2A77L 4K94H 2R0WH 1WVZA 3DRTA 5DF0A 1H0DB 5GRVL 5I74C 4TRPH 1ZGLB 5HYJB 3ISWA 5LKNA 1OWWA 3C2AL 4M1DH 3I6GA 1IGTB 1LDSA 4FA8A 5DK3A 3D0LB 2HH0L 4V1DB 3VI3F 3E2HC 5LQBL 4PLKC 1A3LH 3TCXA 3T2QA 6FABH 3FB8B 1T5WA 1KNOB 2E7HA 3BKCL 1SJVA 2J8UA 3D39B 3RY5A 1QFUL 5I2IB 4TSBL 5GRJL 3T3MF 5I1CL 4OAWB 4UV7H 4MB4A 4U3HA 2WANA 4P5MA 4TNVK 3SE9H 4OB5L 4NZUL 1CGWA 1XT5A 4P3DB 1W0WB 4YBQC 1FHGA 5HJ3B 4MB3A 4BH7B 4G6KL 4O02L 5FOBA 2GI7A 4NJAL 5FCSH 1T0NA 4A6YA 2E3VA 2RQ8A 5IB2A 1NEZG 2Y23A 5ID1A 1ZEAL 4OIIL 1MCJA 1NEUA 4J4PA 1EK3A 1UENA 4KQ3L 4NN7C 5FGRA 3RY4A 1U8LB 5FO9B 4MGXA 4HFUH 4W4OA 4OZ4B 3MOAH 4DZBA 1DQDL 1T3FA 3P4NB 2AKRB 5GGTH 1Y6MR 2O5XH 3R1GL 4G7VH 1T1YA 1B2WL 1ZLSL 1NBZB 3QRGL 1KXQE 1Z2KA 4JO2H 3T3ME 2VLKD 4ZMAT 3B8YA 1BFSA 3UC0L 3K1KC 1RVFH 3UJJL 1R5WA 5KVGH 2JELH 1GAFH 3D48R 4P5MB 1BGXH 4Q9RL 2ITDB 3HN3A 4LPYA 3IRPX 2X4OB 4MAYB 1B0RB 4FZEH 4UDTB 1KIPA 4P46C 5EBLB 2FNBA 2DTSA 4Y4HC 5EUOE 2X4SA 2DBJA 5MI0B 4X4XB 4YHNB 4QF1A 5ID1B 3VXSB 3AREB 3G5XA 4NGHL 1MIML 4HMCA 4X4ZA 2XA8H 4O58H 3KYAA 1I75A 1OQOA 1CTOA 1CLYH 4JRXA 5EOQH 3EJYD 2BHYA 1I8MA 3O6LL 4HDIA 3AROA 5DQ9B 1OP5H 1U8OA 4NT6B 1A1NA 2M1KA 2OP4L 4GKNA 4OSUH 4K9EC 4HAFA 2R2EA 3K2UL 1QG3A 1FNEB 4FTVE 2AXJA 5T3ZE 1CR9L 1S7TA 2B2XH 5C0EB 2EDYA 5GRVK 1MRDH 5FGBC 2J4WH 3OKYA 4JQVA 2VDRH 4QRRE 3MRRB 2AJVH 5HGHA 3C5ZD 3MV7B 5JW3L 5IG7B 3HRZA 3F5WA 4XPAL 4KVNL 2KZ1B 4ORGA 4JRYA 1ROWA 2B0SH 1U3YA 2UZYB 4ZUWB 3ZDXE 3LQAL 4DUWA 3ALWA 1JUFA 1OCWH 32C2A 3CMOL 1OGAE 5H2BB 4Z7VB 5TE4L 4I48A 1RUAL 3LS4H 3L3GA 1DCLA 3G04B 4EVNA 4PJEA 5GRUH 1N5YL 1WZKA 3RY6C 3TLRA 4WW2B 1CGSL 3FN0H 4WHYG 1NLDL 1S7QA 5L0QB 4MJIE 2C4FU 4M43H 1IL1A 5HGDB 3U0TB 3QUKA 5FYKD 1EFXA 4WUKL