1OSZB

Mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and an (l4v) mutant of the vesicular stomatitis virus nucleoprotein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I H-2KB HEAVY CHAIN
publication title Differential thymic selection outcomes stimulated by focal structural alteration in peptide/major histocompatibility complex ligands.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (mhc i/peptide)
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1998-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oszB00
3JWOC 4ZMAT 1B0GB 2F9BT 4P2RD 1BGXH 3RGHA 1LEIB 2XY2A 3V6ZA 3N1PC 3SOBL 4XCFL 3G6AB 5DD1H 3ARBB 1LP9B 1GZPB 1L7IL 3UYOD 2VDNL 4OZIB 2WV3A 1ZXQA 3L3OA 2P45B 4I3SL 4KROB 5E94A 1QSEB 3SDYL 3MSPA 3NCJH 3STZA 3AC0A 4YAQA 4QRUB 3MA9H 2YC1B 3TN0A 1N3NA 1OT1A 4HUMB 2Y9RT 3VDBA 4G6JL 4XBGB 4Q97A 5MERA 4ZXBC 3MLYH 2JJUA 2BSSB 4S1SH 4V1DB 1D6EA 4MCZA 2P43B 5JQ6L 4L4VD 4K2UL 5FCUH 2Y7QA 1TTUA 4HJJL 4XP9H 4Q74A 2GTWA 4YK4B 3TYFB 1RIUL 1WUNT 3QHZL 4RMQA 2YMXH 2VXQH 4JEGB 2F19L 4NYLB 5C6TH 5JXEC 1KTDB 4E42B 5FECB 4X98B 5I1LA 3CX5J 3OXSA 5DMIL 4ZNEE 1IRAY 4Z76A 3PHOA 1X4XA 3T8XA 4ZFOB 4TVPE 5FUOL 3QT2A 4OZFA 5T1DH 2BNQE 4P9ML 2C3HA 3BPNC 4N0UB 1HH9A 2JLLA 1ZT7A 4DZ8A 3UDWA 2FBJH 3DYMA 1ZK9A 3AAZB 5J8OA 25C8H 1YEKL 1OP3K 1G9NH 3P3YA 4M7JL 5F7DB 3JWOH 2Q7YB 1X5KA 2ARWA 4MA8L 1BQLH 3SDDC 1CD8A 4FP8H 1CIDA 1MY5A 4WHYG 5C0FA 1BD2A 4U1MB 5E7BA 3T0DA 2VLJD 4LCIL 2VE6B 3LIZL 1U58B 1KEGL 4P49A 1N0XL 3K3QA 4Q9QL 1A7OL 4WCYH 2VXVH 3S36H 5EU4B 4PREA 5I18H 3U7AA 1KC5L 3SO3C 3HI6H 3HE7B 1KB5A 3TNNA 3O3BB 4NQDA 3ZSTA 3F12B 3KPTA 5D2LA 3IJSB 2VXUH 2YEZB 3BUYB 1JE6A 5T1MB 4Y4FB 4I2XB 3QFDA 3C6LB 2NY7L 3QIWB 1W0YT 5DK2B 1QA9A 1QLEL 3TIEB 3GSOA 3GMLB 4Y2DD 1ROWA 5HHQB 4Z7WA 1P4IH 1OGTA 3A6CH 2FJGA 2P4AB 1XH3B 4YUEH 1RZ7H 4JDVA 3DURB 5D2LF 3CFBA 1WSST 2VJXA 3DYPA 4Y19A 4EOWH 5IEKB 2Q8BH 3P4MB 1CLZL 2QQLH 4PJEF 1N64H 5CUSL 3GIZL 5C08B 4HC1L 4JFEE 3OKYA 3VMNA 3ZTNH 4GRWH 5IVXE 2FECL 1CFNA 4WJ5B 3N50A 2R9HD 3F6LA 1HHGA 2NYYC 1MCHA 3Q0HA 5TF1L 5CZVL 1Z9SA 2B1HL 3SKNA 1BPVA 1FBIH 3V4UL 1XAUA 1IL1A 1R5VA 1QBML 3W39A 4ONOA 4UTAL 2DQJH 4PB0L 5SWSD 5IV2A 5F88B 3RUGE 5HHOB 4OLUL 4QOKE 4Y5XA 5D96B 4UNVA 4HIEB 4X4ME 2DB8A 2X4OA 1JF1A 1LO5A 3G6DH 3TFKC 1XGUA 3CUPA 5DI8B 3TJEL 3L3IB 2RFXB 3OX8B 5F7FA 4B7LA 1CFSA 5DZNA 3UTZB 4WI2A 4Y16C 3QDGE 4PJHA 3SQBA 4LQ1A 2DLFL 1QQDB 3OAYK 5MHSD 3OKMB 3ROLA 1NQBA 1IQWH 5FO9B 2P5EE 4OV5A 3UPCA 4PG2A 5DJAA 4Y4KA 3HUJF 4FA8A 5E2UH 1JVKA 2L0DA 5C07B 3CC5A 4OD2B 3HI1B 5EZOH 4JM4L 2L4OA 3BXNB 5IMMA 2GAZB 3I6KB 5DEFB 3D9AH 3H9HB 3AREC 2GIYA 1OAKL 4HUUA 4K9EC 4R8WH 5CGMA 3FFCD 3WLBA 3GSXA 4MS8C 2J8UA 1S8DA 3UTSE 1DQDL 1A8JH 3BGAA 3MCKA 1B6UA 3O8XB 4OT1H 1QNZH 4IRSB 3T1FA 5HYEA 4K3HA 5HHMB 5FF6B 1I9IH 3MRMA 4RMRA 3RGVC 3U9UB 1JI1A 1OQXA 4Z78A 1MI5D 4J23A 3FQNA 2D31B 4UDUB 5I0ZA 1DBJL 4O2CA 5GGTH 4Y4HC 1FO0H 5JDJA 3OV6A 4GAYB 5DD3H 5I17A 1JHTB 2J8UF 2CDGA 4KZDH 1TVBB 3QUXD 5C2BL 5I19H 1R3HA 4OCYL 1NEZA 4QRQB 4WO4B 5CP7A 4LFHG 5CHNA 1JPSH 4LLYB 4APQD 3FO2A 3GMMB 5I76B 1A6WL 3VE0A 5E70A 3O6LL 3CFKA 3D39E 4FZEH 3AXLA 1MEXH 1SY6L 4Y8AA 5F1SA 2VAJA 2GTZA 2VWEC 4YDLC 3WYRA 5MEPB 2PUQT 1B88A 5DC9B 2HVJB 2FO1A 2DYPD 2XTJC 1UJ3C 2FJFB 1WJ3A 1XMWA 4PIRF 5D2NC 3IXTA 1L4IA 3DHMA 3TYGH 3CZFB 3BIKA 3N9GH 1F58L 1RJZB 1YQVH 3WFDL 5D93B 3VXMD 2G2RA 2HFGH 3DGGB 2F15A 5D4QA 4ZAKB 5IM7A 4B5EA 5DJZB 4C56B 4ZTOH 1L0QA 2CRMA 5IW3A 1JGVH 2A1WL 4MZ2A 2X89D 5JR1L 4TTGA 4K9EH 5JXAH 3SDAA 3TM6A 5HJ3A 1R24B 2UWEE 2XWTB 4ZNEA 1FE8L 2BY0A 1RJLB 4GW1A 3CLEH 5GRZA 4DZBB 3B9VA 4BH7B 2BNQA 4JFFD 5F7NC 1BECA 3EDJA 4MQTB 3Q3GB 5C0ND 5BOPA 1I7RB 5I74C 5C3TA 4LCYB 2R0LH 3B2UD 4JFOB 5DHVA 1BIIA 5I1HH 3NIDF 4HWBH 4X6CE 3BQUA 3ZHLA 4XVSL 3FFDA 1GOGA 2XN9E 3G6JE 4JRYD 1QR1A 4YQXH 5J7CC 4MJIB 5JA9A 3SE8H 3L3JA 2A9MH 3HKFA 5BQ7A 1ZLWH 3VFTA 1HDMB 3CX2A 4NQUA 3V5KB 3MODH 1LE5A 2DKSA 3O6FB 5FEBA 3UP1A 3VFRB 1ZANL 4JM2C 1X5ZA 2EYTA 1UB6B 2OZ4L 3L1OL 4NBXB 3S7GA 1DN0B 2DWEB 4D9LH 2Z31B 2BNUB 3HC0B 3SKMA 3MRHB 3QEQB 4WU7B 3BJLA 1AIFA 4UTBL 1J10A 3U7YL 3ULVD 3OKDA 1FIGL 3QRGH 2LAAA 2A9NL 5FUCE 1IMHC 4HDIA 2VDML 4WENB 5J4MA 1YY9C 3ZKXB 4MHHG 2YXFA 2OQJA 3ZYIA 1CXIA 4MD5A 2WBKA 3QEUA 4NFDA 3GMRA 5D70L 3H3PL 1T5XB 5LWYL 1HKFA 3NCFB 1CLOH 4L4TD 3VWJB 3FQRB 4JFEA 1VACA 3K80A 2Y07L 4JFHD 3TA3C 3U9PL 1J1PH 2W0KA 1ONQB 1B4JL 3R0MA 4D0CA 1R3LB 2NLJB 1JNLH 1KELL 2ZOKB 5E8OA 4X7FC 2AK1L 4R90H 4UT9H 4LSRL 2DQHH 2J5LC 5LGKA 3K81A 1HHJA 3ULUF 1CDJA 2W65B 1FIEA 5F1IA 4XRCB 4IOFD 4WI6A 3O6MH 2N4IA 3N85L 2PR4L 3RUGA 5IEHA 5I1CL 4M7LL 3OR7A 3HNTH 3BN9D 2B0SL 5L88L 4RAVA 4P48A 5HVHC 4X4MA 1U91A 1F4WL 5HYSA 1MRDL 5TPWL 3L6FA 5FYJH 2GT9A 3FJTA 4Z0BH 5D7KE 3HC3H 3BHBA 4ELMA 4JFDB 4LSTL 1ERNA 3WXVH 1EJOL 3TLRA 1C1EL 3QDGA 2NY5C 3HZMA 3RUGF 3V8OA 3MPCA 4QRPD 4ORGB 3NAAH 3L95B 3EBAA 3EGSA 2YPLB 2P48B 3UJIL 2P5EA 4M7ZB 1MJJA 4UV4L 3LKOA 2EZ0C 1FVCA 1GGIH 2DQFA 1MQKL 4IDJH 4ZFFB 3ILPA 1WITA 5B21A 4ELMF 3SCMD 5IFHL 4WEBL 1CGSL 1CE6A 5ADPH 2HJFA 4LKCA 2WIIB 4HMEA 4PP1C 3MRFB 5K9OA 3JZ7A 35C8L 4N0FB 1WISA 1E27B 2R56L 4P4RA 1F45A 1QACA 1LE9A 4AH2A 3JWDL 5IKCB 1O5DT 1TQCC 4NOFA 5CBEA 2W60A 1NCCH 4YHMH 3ROOA 2QSQA 2Y36H 3DUSB 2CKBB 3DRTA 5CINH 5D71H 5C0CD 1U9KA 3KJ6H 3UCRA 1F5WA 1T21B 4G8IB 1A5FH 5HYJD 1NH6A 5DRXA 2QJDA 2OSLB 1YEEH 3Q1SL 3VD7A 3WFBH 4FQQA 1MCPL 2O5XL 5D6CB 3WNLA 3H3KA 4PLJC 3HNSH 1GOFA 1RUQH 4XMPL 4LSSL 4YXHH 4ODUA 1J0KA 1CGXA 4GXUN 2GSGA 4CN6A 3D39A 2NY5H 4D2NA 3PJSA 1S7RB 2FYYB 3NZHL 1IEBA 1AJ7L 4OZIF 3VXTB 4KRNA 4U1IA 3HZKA 4U1SA 2RCSH 5CJBA 2LAGB 3CMOH 4M48L 1VADA 1KCKA 3L3HB 3DI2B 1KNOB 3MOBH 4DQOH 1BJ8A 4BKLB 2Y4SA 1DBBL 3VI4F 5I1JH 1S9VA 5EWIL 1YN6B 1MH5A 4N8CH 1GC1C 1X7QA 4LL9A 3B2VL 3KJ4C 1BZ7B 5EOCL 4ZD3L 1G7MA 1BVKA 1MF2H 1H5BA 1YNKH 4ZSOB 4KJWC 5D8JH 5H35A 3O0RL 4ODXA 1AHWA 2GITB 1OPGL 4C83B 1T5WA 4ZUVB 1FZKA 5F7EL 2UWEA 3LY6A 4QHNB 6FABL 5JHDE 5EZLB 3FTGA 2NY1B 2RGSA 2BHZA 3UAJC 2FDBP 2VDQH 5IP4A 1RURH 4RGMC 2VDPL 2V2XB 3JXAA 1A6VL 4R4BB 1FL6B 4MXVF 4QHLB 2DM2A 1R3IL 1NBYB 1N59A 5CMAA 4PYHA 4X6CA 4W4OA 1KIQB 3VRJA 5LCVL 3BRDA 2IFFL 4OM0H 4CADB 4MAYA 5FOBB 4XPFH 5C9KA 2XN9A 3S88L 2CDFB 3G6JA 4Z0XB 5IR1A 3IDNB 4J7RA 1ZLUH 3CSGA 4PP2A 4QY8A 1TQBB 5CILH 2CIKA 1DQML 4PR5A 4YDJA 4OJFH 5CSBA 4HX1B 3VDCA 4H20H 4JQVC 1T1XA 3HG1E 3EFDH 2AAVA 4LIQH 4X6CF 3FO0H 4KI5F 3T3PE 8CGTA 1NAML 1A1OB 3SGKA 1DZBA 4NQEB 3P4NB 2VDRH 2Z4QA 4DEPB 2C7UB 2XZZA 3OMZA 3B5GA 4ODHH 1A7NH 1AO7A 4KQ4L 2P42B 2VXSL 4XXDB 1LQSR 3QQ4B 1Y0LA 2E7LC 4ZFZA 4FQXA 2PYEB 4R7DB 2H26B 2ZWLT 5IVZA 4MSWB 4HC1A 3GSVA 3C5SB 2OXGA 4X80L 3O11A 3LMJH 5DF0A 4JB9H 2CK0H 5HI3C 3QUML 2J2ZA 3L3OB 4PJ8B 1FNEB 2F53B 5IK3A 2V5SA 4WNQB 5JPNB 2BCKB 3NA9L 1UM5L 1ZSDA 1OSZB 1BQSA 3CFIC 4KMLB 4MAUL 1NBVL 4AENA 4H8WL 1AR1C 5F6HI 3IDJA 2E6QA 4TVSa 4KK6D 1ES0B 4F2MB 1PKQB 4G9FE 3RVUC 1NGPL 1M71A 3CFEB 1AGCA 1SJHB 4HPOL 1B90A 2VLRE 1FYTD 4M8QB 1LK3H 1FVDB 4XVUD 1Q0YL 1CT8B 5FYLL 4L1DA 4OCXL 4F3FB 4M1CD 2AKRA 3VGDA 3GSUA 4NSKA 5B3JF 3MA7B 3MV01 1G6RH 2K9UA 4X6FB 4WI5A 3FN3A 4WHTA 3MCG1 5DJ6A 1T22A 2QR0B 1G7QA 2VQUA 3GBNL 4KK9D 4PRDA 3TNMB 5DVNA 2VDOL 5F89A 2FZ3B 4H0GA 5DD6B 1UEMA 3FO9A 3FOMA 4FMFA 4YFEA 5LXGL 1MVFA 1EERB 1XZ0A 4YXKL 4KKLD 3DROB 5C9JB 4FFYH 4HK3J 1LDPL 3KS0H 5D1ZD 5HYQB 1AXIB 1U41A 2FL5A 1V7ML 2R0ZH 2P44B 1QBBA 1RZIA 2I26N 3OB0H 2NY0B 2ID5A 4JZJC 3MRNA 1PEWA 5MI0B 3CVHB 1KV3A 3IVKB 3MBEB 4XVTH 1N5YH 3QQ3A 3OF6D 2IAMD 4GKOA 1CXEA 4PRHB 4WU5A 2OP4L 4NC2B 1RZFL 1V3LA 3T0ED 1UKSA 1EV2E 2DLGA 4QXGH 3KG5A 4Y2DC 2XQYK 1UXSA 3CFBB 3H8NA 2AEWA 1SY6A 5CEZH 5HXMA 2FWOA 1LEKB 4RRPA 1BGXL 4KUZH 3TH3T 3TH2T 3UTQB 4MWFA 1Q0XH 2Z8RA 3HE6B 3TBWA 4Q9CA 2R4SH 5DD1L 5EO0B 1ZHLB 2FBOJ 5H94B 1NAKH 4FXKB 4ETQA 3DUUB 1XF3A 4X7TA 4JY4B 4NZUH 5T3XH 3UBXB 3NCJL 4LCUB 3MZGB 2C4XA 4GBXD 2FD6H 3MA9L 3KPSB 4G42B 4DOHE 2HVKA 3E2HC 1VFUA 4FN0A 3MLYL 1JMXA 4S1SL 1OLZA 4JANB 5C0EB 3P0YH 2HG5A 1T20A 4TSCH 5FCUL 4XP9L 2I9TB 2NY3C 3DV6A 4GAGH 4TRPH 5JHDA 2YMXL 2KBGA 1BLNB 2VXQL 5DDHA 5FA4A 5A2FA 5C6TL 1WK0A 4NDMB 3D48R 3WS6C 3IFOB 4G5ZH 4YO0A 1I3RA 4UILH 3U6RA 4UT7H 5T1DL 5BVJA 1RZ8B 5ALCH 5B8CB 2ZG2A 1EMTH 2J12B 2AQ3A 2QEJA 5IJVB 2FBJL 1D5ZB 3ZE0E 2BSRB 3MUHL 4X5LA 4C57C 3KHOA 25C8L 2XA8H 3O45A 1HILA 1G9NL 5I8CA 5IG7B 1D5MA 1A3LH 3JWOL 4L8BA 4A6YB 4EI5A 3BEWB 1BQLL 3O6KH 2AGJH 1QKZH 4FP8L 1C08B 3BEVB 4NQCB 4QXTA 5T1KB 1IGTA 4OCRH 2CO6B 3BH8A 2F54D 3Q6FB 3U4AA 3HG1A 2NTSP 2PW2B 1FCGA 4WCYL 1C12B 4GW5B 2VXVL 5GSVB 2OZ4A 3S36L 2HJLB 3FOLA 4RMVA 5I18L 3PV6A 1MCWW 3QDJB 2R2BB 3FT3A 4K8RH 3HI6L 2DI7A 3VJ6A 2VSCA 3C87A 5CP3H 5DXWA 4PRAB 2F5AH 4X6BB 5A40E 2VNCA 2VXUL 5CD3A 1E4KC 5DYOA 2Y23A 3T65A 1HHHA 2QADD 3W5NA 1DQLH 1KCSH 2HT4C 4NKDA 3I9GH 3QNYA 3ARUA 2A6KA 3QUXC 1P4IL 1HXYA 3A6CL 3MV7E 1ZGLA 4CN4A 4YUEL 1RZ7L 1UA6H 4APQC 3DX6A 4KI1A 5CS7A 1F90H 3PHQA 4EOWL 1I8KA 3VXRB 5IVNA 2Q8BL 3E3QE 2QQLL 5FM5O 12E8H 1N64L 2GFBA 4HUVA 5INCA 4M4PA 3TWCH 3ZTNL 5MEQB 1BD2D 4IHOA 1K4CB 2W0FB 5EH1A 5IFJA 5TGBB 5ICYB 2D03H 5AAWA 3GO1L 3LKQB 4TQEH 5EZJA 3CCHB 4IM8A 2WBWB 1U3HB 2Q86B 1FBIL 4YH6A 3LCYA 3HNVH 3EFFB 4XCEB 4UINH 2R8SH 1I8LC 1YN7B 2A0LD 2DQJL 1SJVA 5DVOA 1H3UA 4NQDD 2V7NA 4NQXA 1P2CB 3VH8B 5C09D 5HJ3B 1T0PB 4FQCH 5IESH 1PX3A 2EEDA 5FYLE 2VLRA 3MRQA 3ZDXE 3P0VH 1PAMA 2GJ6E 2AJVH 3G6DL 1HYSC 1DUZA 5MP6H 4GSDH 2X1PA 4LK4A 4UNTA 5D6DA 4HGWB 5EU6B 2QLVB 2Q76A 1B6DA 4BFIA 1IQWL 2X4PB 1QLRB 5HHVH 5C0NC 2XWJB 4LLWA 5J1AB 1CCZA 4XHQA 1AGBA 4HG4J 1T83C 5DC0A 3BP4B 2H2SD 1QSVA 2VISA 4UBDD 5E2UL 3W81A 2P8PB 1J8HB 3G04A 4Z7UE 1G0DA 5EZOL 1RHHA 3LRGA 5F7KC 2ZOLA 4BSVA 3WHXB 2DQUH 3D9AL 1JTPA 4LCCC 1K2DA 2ADGB 1LE5B 3SPVB 3OKKA 1H3WM 4R8WL 1ZLSH 1NSNH 4G9DB 4V2BA 5FK9A 4I13B 1CGTA 1NGYB 1U8OB 5KS9A 3QA3A 4OT1L 1QNZL 3LN4B 4QT5B 3BKYH 4ODWA 1I9IL 3RPKA 5D7IB 1A9EA 5C0GB 4M6OH 1NKOA 5IB4B 5I73B 3BIBX 3VRLE 5EDXA 5DTFB 5GGTL 1FO0L 3K1KC 5GGUA 2A6DB 2H9GB 2I9LA 2OQJB 3MCLH 3QUYB 5DD3L 3ARTA 4I0PB 4KZDL 5GSRB 5I19L 4I3GA 5KS9F 3VD4A 4PJIE 4JFYA 4CW1B 3DX9A 4OLYH 4LEOA 5IBUG 1JPSL 4YHZH 5IVXB 2Q3ZA 4QHMB 1NGZA 1MVUA 1AD0A 4UB0H 4FZEL 1MEXL 2VN4A 5KZCD 1HSAA 3EOYG 3O3AA 3MLZH 2DBJA 4DFIA 1T0NA 2Q6WA 4RZCA 2JIXA 4X7DC 5DT1H 1KJ2H 4PTTB 2AXGA 3MO1A 4QOKB 4NRZB 4EEEA 3TYGL 4IOFC 5AZEH 3MQIA 3K7UA 3N9GL 1TVHB 5D7LB 1YQVL 2O5ZH 5JW4N 2B5IC 2HFGL 1X4ZA 1IE5A 2IH3A 3TC9A 2CRIA 4ZTOL 4OLXH 3BN9C 1CG9B 3RKDD 1JGVL 5HVWA 2X70A 4J4PD 4HZLB 4ZO6A 4Z7NF 3LRSA 2JCCB 4K9EL 1OT2A 5JXAL 5D72H 2HLAB 3MFFA 9CGTA 2HLFD 1NGXB 1EA9C 2DQTH 4NO0A 5ERWA 5K9KA 1S7WA 4XCCH 3CLEL 4RX4A 4ACPA 4OZHB 2BVOA 5I2IB 1M7DB 2I07B 3R8BB 3IXAA 1RU9H 2M8XA 4PJ9B 4ZPVA 1NBZB 4CMHB 4GG8A 5C71A 2EXWC 5ADOH 3BPLB 2R0LL 4XP5H 3SCMC 4U3XA 3MMEB 5I1HL 4HWBL 4QXUH 4KV5E 4ZQKB 1HQ4A 4N0YH 1KTLA 1M7XA 2BX5A 3GZKA 3UTSB 5ICXA 4YQXL 4OF8A 2WINA 2V7HA 3M45A 2AK4E 1NAMA 1C5BH 1HI6B 2GUOB 3SE8L 4AEEA 4RAUB 2A9ML 3UZVB 1UXWB 4LLUA 2YUZA 4PTUB 4RFNB 2DQCH 5DQ9A 4TN9A 3MODL 1INQA 4P46D 4YGAB 3BISA 3SDCA 1PG7W 3GI9H 3LV3A 3SDAD 4ZYKA 4F9LA 1A7RH 3PWNA 1BZ9A 1WIPA 1MCJA 5HD8C 4KGJA 4OFDA 4D9LL 3ARFA 3RDTA 3QNZA 1PY4A 4CJ1A 2X4NA 4LRNH 2JJVA 2AEPH 2BNQD 3QRGL 4WI7A 4D0DA 4FQLH 4OGYH 3VCLB 2PTTB 5EBMB 3MV7A 4F8QA 3I3DA 3QUMA 2R1XA 2VIRB 3RVTC 3MFGB 3ARDB 4RQQA 4GRWE 1CLOL 3DVNB 4AG4H 1VGEH 3BQUD 5F9OH 3VXNA 1LEGB 4Z7VB 5E8PB 4KRLB 1U2HA 1ZS8B 4F7CA 1J1PL 4HEPG 3TF7C 3ZL4H 1CIUA 4JPVH 3X11B 1JNLL 1YQ2A 1PQZB 3NH7H 3MLTB 4R90L 4UT9L 5KSUB 3SGEH 2DQHL 5IB3A 5KG9A 1S7SB 4HIHB 2I24N 4G6AD 3O6ML 1WZKA 5B38B 5EUOB 2IWGA 2CIIA 3HNTL 4JRXE 3EJJX 5JDSB 5D7JB 3BPOC 4PV9B 1TTGA 3DVFA 4HK0B 5FYJL 3IAGC 4Z0BL 3IAQA 4M62H 2GJ6A 4ELKA 4S11A 5MENB 3HC3L 3NFPB 3EO0B 2C3VB 5SWZB 3WXVL 4IEFB 3OJ2C 2UYLB 5F9WC 1I3GH 3B9KB 4PBXA 4XNMB 3NAAL 3ULUD 1BP3B 2ADIA 2AJUH 3WL9A 2X1XR 5EU3B 5F7HA 4EN3B 3FZUD 5ISZB 3ZDXF 1UACH 1BREA 3BP6B 4KHTH 5F7UA 1GGIL 1D3CA 4Q58C 1KACB 4IDJL 4TPRH 3QIUD 1V8HA 4Q6IA 1ULVA 3H9SE 1MCLA 4IJ3B 3PWPD 4U1GB 4Z7UA 1NPUA 5BXFB 3DGCR 3X3FH 2IANB 2GJZA 3BVNB 4X6EA 5F1OB 5SX5K 5DLMH 3VXOB 5L8KB 4F7PB 4KTEH 1RZGA 3GMQA 1JJUA 4Z7UF 4Q2ZA 1NCCL 1WGOA 3LS4H 5DUBA 4YHML 4BK5A 2Y36L 5CINL 1PKOA 5D71L 4ODSH 3KJ6L 3L5XH 3QXAB 1UZ8B 3EJZD 4PFEA 5BJTA 1A5FL 4WEMB 2XNAB 4NNYA 2AVGA 1I7TA 3EYOA 1YEEL 1DQTA 2A77H 3D25A 3OR6B 2P5ED 3WFBL 3VGGA 4HIJA 4OLZH 4G7YH 1AQDB 3LOWA 3GMPB 4PJIA 3BX7C 3U0PA 4MYWB 3HNSL 3TO4C 4WWKA 3GUTA 1RUQL 5FKAA 3WJLA 4YXHL 1YY8B 4FTVA 2NY5L 1E4WH 3S37X 3ALPA 4ZDHA 1U8LA 4L8SC 3MJ9H 3EDEA 4MX7B 1J1XH 2RCSL 5GGQH 3CMOL 5ILTH 2C3XA 1ITCA 2EC9U 5GGRY 4PJIF 2ZNXA 3UZQA 2RHEA 2JK5B 1REIA 3MOBL 3VRIB 4DQOL 4J2XA 3ARWA 3S97C 5BS0E 5GS1C 4XP4H 3C8KA 5I1JL 4HWUA 3PXHA 3C09B 4Y5YB 3W11C 3QDHA 4N8CL 3MYJA 3ARBD 2ZJSH 4QTHA 3GJFH 3F7VB 1MF2L 2Y6SD 1YNKL 4KK6C 1YMMA 5D8JL 1JF6A 4F15C 4YE4H 1W8NA 1HN1A 3QO1A 4PJ7A 1EEYA 1QSED 5HPMA 1Z0NA 3V7AE 4HK3N 5E1AA 1A1NA 4XVUC 3RWCA 1XGYH 4EIZC 4XH2A 1S5HA 2BC4A 3LN5B 2VDQL 1RURL 4XAKE 4NHUB 3GMOB 3IETA 3DV4B 1MCNA 1JCKA 2NY6B 4V1DD 5HBBA 4RGNB 3MRGA 3ZT5A 3SKOA 1AP2B 3F8UB 5EOCJ 2W9LA 4PJ7F 2AJZA 2H6PA 1XR9A 3NTCH 2QQKH 3CXDH 3HZYA 4ZOCA 4NKIH 1VKXB 1EK3A 3IU3A 5DHYA 4OM0L 4X5WB 4XPFL 3KLAB 4FXGB 4PGEA 3BDBA 4LDOB 1B4RA 4OKVB 2VWEE 1FN4A 3MGAA 4KKLC 2AK4A 4G80A 3VFMB 3GSWA 2FGZA 2PKDA 4PG9B 5CILL 5F8QC 2BOCA 4OJFL 1E0OB 4H20L 3OAUH 3EFDL 2XTJE 4LIQL 3FO0L 5D2NE 4KV5F 1T2JA 2VC2H 4QRSB 4JDZA 2UZIH 2DS4A 4ZXBA 4WTZG 1G9EA 3SGEI 5BZDB 3UTOA 2VDRL 5C0DB 4N0CD 4QRRE 2IAMC 4ODHL 1A7NL 1MCWM 4KJYA 3CFJB 5JXEA 3T0EC 3MV9E 4X83A 1IZJA 5JPMA 2G5BB 4NNPH 3MRCB 3NCYP 4XI5D 1WT5A 1HNFA 3LMJL 4JB9L 2CK0L 2WBJB 1A6ZB 5E2TH 4KI5D 4Y4FD 4EXPX 4H1LH 5I9QC 3QIWD 4PPTA 5TDPB 3P9MB 1YJDC 1RV6X 3MJ7A 1PG7X 5EPMA 3K74B 3SDDA 5D9SA 1EZVY 1YPZA 4R4FH 4KKBD 4CVXA 3RTQC 1WLHA 3SDXE 2H2PC 2WUCH 5J13C 5DVMA 1ZA6A 3C60B 2ATPA 5DJCA 1ZA3B 3IKKA 4JRXA 3QJHB 1NMCB 3MRBB 3MREB 4WW2B 5FYJE 4HKXA 4LVHC 1W8OA 5EIIA 3N1QC 4GUPA 4PRIE 3DMMB 3NPSC 3NCCB 4CN1A 5JOFB 3PGFH 3QXDA 3WE6B 5B4MD 5AUMB 5ANMB 1NC2A 3ECBA 4LLQA 1AO7D 1YPZF 4QYOA 1G84A 1J18A 4IRJC 4S1QH 1DEEA 1NCWH 2IMMA 3TESA 1LK3L 3MNVA 5SWQB 3NABH 3VFPB 2Z91A 1FORH 1HH6A 5HHOD 1G6RL 3KGRA 1S5IH 2DI9A 3ES6B 3QCUH 2V2WB 2QKIB 4DKEH 4Z8FH 3I85A 5I16A 3DO3A 3H9SA 5E2JA 4U6TA 3D85A 1KXQE 3MXWH 15C8H 5F1NA 3F7YA 2MSPA 2LV4A 1YNTA 5I1IH 4LHJB 4KDTC 4Y1AB 2BNRE 3QI9D 5DQJA 1MREH 4FFYL 3O9WA 1FNLA 5D7IF 1YJDH 2R0ZL 2D7MA 5GGTA 1FO0A 3I2CH 5ACZB 1ZHBA 4XNZC 1JI2A 3O41B 4XVTL 1EDQA 1Q9LB 1N5YL 1IILE 1JPGB 1N0LA 4FG6C 2EE2A 5IB5B 3PWJB 3RWJA 2YZ8A 1DDHA 3OG6B 3AS3A 5B39B 2RB8A 2IALA 4E41E 1PSKH 3MUZ1 4QXGL 3WS3B 2XTLA 4Y16A 5E1HB 5IB2B 2R1WA 5CEZL 2XFXA 3TJHD 3UDWC 4KUZL 1P9MC 3QWRA 1I85A 4NN5B 1Q0XL 4NUJB 4UZGA 3VGAB 3P11H 2IH1B 5ID0A 3RU8H 5L2KE 1P4BH 4JVUA 2K1MA 1NAKL 4OCNC 5GGSA 1XIWB 2CLRB 5DMKA 3ZT6A 4HULB 3QH3B 4L5FH 1F3RB 2MHAA 5L9DH 1FSKC 1XCTA 5IHLB 4NZUL 2O5YH 3H7BA 5BS0A 3L7FA 4Q6YA 3AFLA 1BX2B 5T3XL 3RY4A 3KWWA 3VFOA 3LQMA 4G9FB 3HS0A 2FD6L 5JO5A 3TV3H 3AREA 4GLRH 5F7WC 2JCCF 1PYWA 1OGAE 3MJ8A 2J7LA 3DX8B 3IGAB 4JZOA 4MVBD 5F97E 3P0YL 4BFEA 4K71B 3KYOA 4TSCL 1VFMA 4HFWA 4OZHF 4NO2A 2HWZH 4GAGL 4XNUH 5FA3A 4TRPL 3CDCA 1WIUA 2VLME 2XZAH 5FYKH 1ZLVH 4Y4HA 3BWAB 3RFZC 2Z8SA 4G6FB 4G5ZL 4C56D 4UILL 1U92A 2NMSA 5GIRA 5KOVC 4UT7L 3BWUC 5ALCL 4HWBA 3IYLW 1ZVHA 1EMTL 3D0LA 3F7QA 4XB7A 5CGTA 2XA8L 2H2SC 4UBDC 1A3LL 3BH9B 4LF3A 3O6KL 2AGJL 4QWWD 3MRKA 1QKZL 2Y5TA 1J0JA 3RL1B 1EAPA 3NACH 2H8PB 1C8PA 3WDIA 4OCRL 3RNKB 1YZZA 1VSCA 2V17H 3IDIB 5CIPB 4AL8H 1UJ3A 7CGTA 5D2NA 3V52H 4PGBB 1PVHA 1FL5A 3FB5A 1K6QH 1UQSB 1P7HL 4GMSH 4K8RL 2R1YA 3I6LE 5DSCB 5TE7H 2F5AL 1FZJA 2VSDA 1MCKA 4QRRA 5JW5A 1EO7A 4YDVB 3TT3H 2YUWA 2H32A 1DQLL 4LAQH 3S5LA 1KCSL 3MV9A 3I9GL 1CDHA 3RVXD 4TUJB 1F42A 2X4SA 5T1LA 3TIDB 3O6FD 4PG2C 3KXFE 1FNGA 1OAZH 3QFJE 2KQNA 1IGYB 3DI3B 1UA6L 5DHXB 1KXVC 1F90L 3QEQD 1I7UB 2Z0BA 4H26B 4YZFE 12E8L 4A2MA 3EYVA 1RK0A 2DIAA 2BY1A 3TWCL 4OFVA 5JZ7C 3B9AA 2MQ0A 3X13A 2D03L 3RZCC 4DOHB 4TQEL 1FZOB 3SDXA 5T3ZH 4Y89A 3NIGE 2QSCH 3CFDB 1NCAH 4NO3A 3BESR 4POZC 2A6IB 2FSEB 5A16A 3HNVL 3DTXB 4UINL 3VWJD 4PV8A 2R8SL 3EO1B 3W9DB 3GGWB 2GY7B 1Q94B 2GK0B 4PRIA 1WCQA 1YEDA 4HBCH 4P4KB 3B43A 2AV7B 2WQRA 5I8OH 3QO0A 3RKDC 4FQCL 3MLWH 1KIPA 2X7LB 5IESL 1JHLH 4J4PC 5I1DB 3P0VL 4JM2A 3FQWA 3MV8E 2AJVL 5MP6L 2KPNA 3PWLA 1DQJB 4YHKH 2C1PA 4GSDL 4XZUB 2HLFC 1I1AB 1BM3H 4X0KB 4HAFA 4PY7A 4M03A 2C1OB 2XG5A 3ILQD 3GDBA 5E56A 2VL5B 5HHVL 4OLVH 5HGDB 2BXYA 1ZVSB 4JFDD 2LVEA 3ZYOA 3NIFE 3CSYB 3PGCA 1DVFB 4P2RE 2Y5EA 4U1JB 4KUCF 1AE6H 5LAXB 3TA3A 5EU5B 2YPLD 5F7LB 3MGTA 4PJXB 2DQUL 1A21A 4X4YA 3KPRB 1I8IB 2PXYB 5DUPH 2EYSB 4R0LB 2DWDB 1ZLSL 1NSNL 2FLRT 4U6YB 1S78C 2ITCA 1OAQH 4PRBB 1FFOA 4UIKH 1U8PB 1HXMA 1AD9B 4IDLA 3O3EB 2VLRD 2Z93B 4P46C 3SE3A 5KSBB 1XGRB 4LKXA 3BKYL 3SDAC 4M6OL 4M8VA 3RIFF 4KKCD 1WFNA 4NNXA 3FB6B 4LLMB 3EIFA 1TZIB 2AI0H 3RJDA 4E41A 4P23B 4U31A 4IMLA 5CEZE 3MCLL 3GSNB 4QLRA 1XF2A 3TPUA 3FQXB 2E6JA 4OLYL 2BZDA 4YHZL 3JTSA 3R06B 1ZLWK 3HPJA 1MLBB 3RJQB 1KJVA 4U7MA 4BZYA 4UB0L 2ESVB 3REWB 1BIHA 3E6FA 1CI5A 5KVGH 5EN2A 1OSPH 5KVDH 5DJ2B 1GYAA 1VDGA 1CR9H 3MLZL 2ICWB 5T3XE 1CD0A 2EDKA 3BGFC 3MLVH 3P73B 5DT1L 1KJ2L 2KKQA 5CJQH 4IIQC 2A74A 2YA0A 3VWKC 1CFTB 2IADB 1C5DB 1W72B 3CSBA 3MRJA 5BOZG 5AZEL 4G6AC 4EUPH 2O5ZL 1CDUA 1OGAA 4G8FA 1D7FA 2VLJE 4OLXL 5IW6A 4IOSD 2DTMH 4I77H 3BAEH 3T0VA 1CE1H 1VFBA 4GKZA 5D72L 5BW7A 1NDGA 1F3JB 5INDA 5HI4C 2DQTL 1NC4B 3QIBC 1BQHG 5FDWB 4XCCL 5C0JB 2QL1A 2BY3A 5H2BB 1UH2A 1ORSB 1KUMA 3KNBA 2C4FT 3SHSA 3WN5C 3ULUC 2JB5H 3BZDA 3KYAA 3MRRB 1K9TA 1G9MC 3PV7A 1RJYB 1RU9L 4FFZH 1N5AA 1FAKT 3HA0A 1CGYA 2EKJA 2J6EH 5ADOL 1RZJC 4XP5L 3QIUC 1S7TA 3V9FA 4J1UB 4Z18A 2IPUK 3WMSA 5EBLA 4QXUL 4ZUUB 2DJUA 4UAOB 3IFPA 1H3VA 3ALXA 3WIIH 4CNIB 4QNPF 5LQBH 4N0YL 1IBGH 3SJVA 3GMNB 5E24E 2PN5A 1C5BL 2QQQA 2IBZY 4NO5A 1P4LB 1T1YA 3FN0H 2DQCL 4L3CB 4R9HA 4PGJA 3HLAA 1FVEB 3GI9L 1INEH 1YA5A 5E6IC 2GYSA 1A7RL 2X1WL 3FCTB 4NO0D 1QEWB 3EJZC 3U4EA 3RAJH 4RX4D 4GW4A 1XR8B 4P5MA 32C2B 5E9DB 2E3VA 4LRNL 2AEPL 3KHQA 4JG0H 4P5TB 4FQLL 4OGYL 5KVFH 4E0RA 2K7PA 1DJSA 3FT4B 3KXFA 3VXPB 5HY9A 3QFJA 2HFEB 4WFGE 1BFOA 3FQTA 3MNWA 4CMMB 4PLNC 4YNYA 3RIFK 1X44A 4AG4L 1VGEL 5F9OL 4D0BA 3AVEA 4JKPH 1JNNH 1IGIH 2V6HA 3LS5H 1U8IB 1G7JA 3ZL4L 1G9MH 4HF5H 4QHUB 3FMGH 4JPVL 1NFKA 3G5XB 2H1PH 3NH7L 1T7VA 4WW2F 1TZHA 2ZPKH 5FO7B 1WAAE 1T3FB 4JKMA 2V5MA 4PJDB 3G5YA 4QO1A 3VGHA 1CL7I 1S7QB 4YZFF 3SDCD 4Z7QE 4HKBA 1DANT 1NANH 4WIQA 2EDFA 1VEOA 3T2QA 4JQVA 1YYMH 3WXWH 4XT1C 2F8OA 3ARBC 4ZUSB 3KR3H 4O51B 3FQUA 3RDTD 4LHQB 4JPWH 4TNVK 4C4KO 1P7KA 3FFCE 4M62L 3MV8A 1KTRL 1V3JA 4AIZA 3HAEH 1LWRA 4NP4H 3HR5B 4KROC 3MUY1 3RNQA 1G6RA 3VFUA 3TZVB 3GIVB 5IIEA 1C16A 4RWYH 1BMGA 2DDQH 2E7MA 3JSSA 4KVNH 4EVNA 3MV7D 4HH9B 3MRIA 3O2DH 1I3GL 4S1RH 1TJIH 1LO3H 5BZWB 2DI8A 5F3BA 2AJUL 5J6GA 1UACL 1M6OA 1Z3GH 2EC8A 4KHTL 4RIRA 5CJ8A 5JORA 2BMKB 2HFFB 4P2RA 3T77A 4YK4C 4TPRL 4X5XA 3THMH 1FC2D 1RPQA 3R1GH 1OTTC 3STLB 3X3FL 5EULV 5J3HD 3E0GA 4MJ4A 4L8CA 1JWUB 3KPQA 1KPRB 5C8JB 4LQFH 3E6HB 5DLML 3NIFF 4ZODA 3JV4B 4JN2A 5GRJH 1BZQK 1FNFA 4KTEL 4N8PA 1H15A 3SY0A 1CDIA 3KPPA 3MJGX 1AH1A 4JLRB 2GJ6D 3LS4L 1M7IB 3BN3B 3T09A 5F6HJ 4Q7DA 3RWDB 4OBRA 4XCYA 3VXME 4ODSL 3GI8H 3L5XL 1OB1A 1RVFH 4YBLC 2YPVH 2X4TB 4N0CC 4X6DB 2NW2B 3BW9A 4FQIH 2A77L 3RWGB 3ARYA 3WKMH 4XMKH 4P5KB 4L8DA 4XBEH 4OLZL 4G7YL 3G08B 1FG2A 4KPHH 3K8MA 3KPOA 4F7TB 3U4BH 3KLHD 1JNHA 2NY0D 5CSGA 3HE7C 4KTYA 4H1LG 3RWFB 4PRNB 5KSVB 4H5SB 2R2CA 5I1GH 4YHOH 1E4WL 4XI5C 1TJGH 4HUNB 4JFFE 4Y0GA 4PRHD 4U6HA 3MJ9L 3V5DB 4KI5C 2VUYA 2AV1A 4Y4FC 1J1XL 5IMLB 3C6LC 5JW4M 5GGQL 3QIWC 3U7WH 3ARVA 5ILTL 5AAMA 3H3BC 2P8MA 1D5XA 5HDOA 3GJEA 1N4XH 2IPKB 8FABB 5K9QI 2ATKA 3LB6D 3CH1B 3UJTH 2L7JA 3QUKB 3OHXA 4XP4L 4KVCH 1KPVB 3KYMB 1S7UA 1QFHA 1DP0A 1WBXA 5IB1A 2ZJSL 3SGKC 2DL2A 5HHPB 5JIIA 4PJFB 3VG9B 3WFHA 5DK0A 3TH4T 5ENWB 4JZJA 4UUJB 4YE4L 1WV7T 1TXKA 4JGJA 3EYSH 1BBJB 2Z35B 1ACZA 1OTSD 1WWWX 1XGYL 4N8VB 4WWKD 1UVQA 3H0TA 3PIQB 2LABA 4MCYA 4N68A 5IFAH 1IEAA 4PBWD 5FXCH 2X9XA 4JFQB 4FTVD 4HS3A 4D9RD 5F93C 1HOCB 5EC2A 4OF5A 3DRQB 4Y2DA 5D96C 3R8QA 3PWUB 2DQDH 5DQDH 5DS8A 4P2OB 3NTCL 4EXKA 2QQKL 3CXDL 5D5ME 4F33A 2DMKA 5HPOA 1JV5B 4NKIL 1JZ8A 4O5LH 3NN8A 1K3ZA 4JFHE 5BRZE 3LKPB 4MLIA 4LVNB 3QI9C 2FX8H 4U33A 3SBWC 2DRUA 3FB7A 2GHWB 5CP3A 3OAUL 3QDMB 1U8NB 1YMMD 2VC2L 1ND0A 1JGEA 2CLZB 1ZT1A 2BDNH 2UZIL 1ORQA 2CK2A 1QO3A 2V5YA 3IKCA 5D1XB 4Z77A 2NPLX 1JL8A 4H88H 2VR9A 1U8QA 4ZS6D 2FX9H 3VMPA 2WANA 5TDNB 1FC1A 1NANI 2YUVA 1ZHKB 2Q87A 3WUWB 2VLKE 3EW3B 2WK2A 3WS6A 3QDJD 3UPRB 2VKXA 4KRPB 43C9B 3O8XC 5DURB 4QRPE 4OGAD 3QCTH 5IW1B 4NNPL 4MNQB 1ZT4B 5SV3A 5GGRA 1ZWIB 2ZUWA 5E2TL 5DMKB 3Q5TA 5CSZA 3OB0K 2WLYA 1U2CA 2AJ3B 1T0MA 3D3VE 2NXZB 2X4UA 3FN9A 1I4FA 3F62A 4LNRB 3E1F1 1ZOXA 4GOSA 4MD0A 4WEUD 3I50H 1GOHA 4R4FL 4WO4C 1UH3A 2WUCL 4WV1B 2CXGA 5I8EA 4PJCB 1FFPB 3UC0H 2N56A 1CFBA 5KTEH 4J3XA 3RGVB 4L29B 4Y8DC 3PGFL 4ZUWB 1MWAB 2XKSA 4DCQA 1U3HD 3MV11 4WUUE 4R7NB 2HFTA 5F3HB 4S1QL 5L7XH 1NCWL 3WEXA 3NABL 5JIPA 1E4KA 1FORL 3TBSB 3EO9H 3PP4H 1IM9B 1S9WA 5DJ0B 1CQYA 5HYJE 2EO9A 1UZ6E 5C6PB 4ZAKC 4J8RA 3ZKNC 1S5IL 4R2GB 5FM8A 4OZFG 3QCUL 5E8NB 2BVPA 5ID1B 2Q20A 3QUXA 1TETH 4DKEL 4Z8FL 1AY1H 3RX7A 4PJXF 4APQA 3MXWL 15C8L 4ISVB 4PJGB 3L9RA 5I1IL 5KSAB 4C54A 4WW1B 1N2RB 2HMIC 5CAYB 1A22B 2DF3A 4QWWC 3PG2A 1NUDA 2ZG3A 3S37H 3I6GA 2COQA 4OZGB 2OTWA 1MREL 3CIQA 4JRXD 1QRNB 1LK2A 4QCIA 5KSBF 1V3KA 5E00A 4J12A 1YJDL 3F5WB 4OUUA 1I8LA 1GGCH 2I5YH 1NC2D 3VXMA 3FT2B 3I2CL 1W2KT 4HUWA 4JG1H 4FABH 1IAIM 3CSPA 3V0WH 2QV2A 3IF1B 4OI9A 5FV1L 2X89A 1JYXA 1LO4H 3ELAT 1PW3A 3UYPA 1KENH 3U83A 4D8PB 2YRLA 2D7NA 1PSKL 1IM3A 5H37G 3RVXC 3U2SB 1YMHA 3S35H 3MR9A 3KS0J 1AKJB 2CGRH 2D3VA 3LPGA 4HV8B 3O6FC 4HS6B 4BSWB 1IJ9A 3O4LA 5DR5H 1YEFH 3FKUS 1D9KB 2Z31C 2ADJA 43CAA 5AG9A 1KJ2A 3P11L 3TBTA 4UQ2A 1T83A 3RU8L 3BGMB 1P4BL 5EOQH 3U0TB 3ZKSD 1VCAA 3T0AA 2NYYD 4LSVH 3VXQB 1G1CA 4L5FL 1OP5H 5L9DL 1AGEA 3ZKXC 2O5YL 1UM6H 3O9WD 2FH8A 3S34H 5K33A 1HZHH 1JUFB 3LKSA 2DBLH 2ITDB 1BOGB 4LCCA 3TV3L 4DW2H 4NZJA 3VWJC 1Q38A 5ESQB 1CYGA 3F58H 4D9QE 1B3JA 2O61B 4LCWB 1MIEH 5E2WH 5CD5C 3X14B 5C0AE 2X4RA 1I7ZA 3OXRB 2CJUH 4F37F 1AGDB 2HWZL 3MUGB 4XNUL 3TVMB 1SYSA 1MHCA 4JCMA 3LKRA 5CZXC 4NKOB 4HXAH 2XZAL 5FYKL 2OK0H 1SYVA 4Y16D 4XBPB 5C0IB 5T5NF 2DTSA 3EOAB 1BFVH 5D1QB 3WNKA 1JBJA 4D3CH 1A1MB 1H8SA 3FONA 3RWIA 5CLWA 4EJ1C 1NGWA 1QLFB 4NPYA 5D5MA 2AABH 2BNRB 3L5JA 1QFUH 3NZ8A 4BQCA 3TO2B 1T4KA 4OKDA 5BS0D 3TCLA 5BRZA 1ZHNB 2CMRH 2J5LB 3JBG7 2VOTA 4PGCB 3EDDA 4W4NA 3NACL 3RL2B 5F6IB 4M7ZC 4PJ9D 3ARED 5L6YH 2V17L 4IOIB 4OI8A 3KYKH 4AL8L 1YUHB 4LBEA 5D5MF 3V52L 4MS8D 3NFNB 4HBQA 2OMBA 2IMNA 1K6QL 3LD8B 1PG7H 2FECI 4GMSL 1T03H 3FRUA 1MCRA 1IFHH 4YGVA 1Q9OA 5TE7L 4L4JA 4NQVB 2OR7A 3G9VA 5J06A 2NTFB 4O2FA 4XAKD 3BRFA 2VZ3A 4KKCC 2VO5A 4HJGB 3OKLA 3TT3L 4JPIA 5J11B 4XNQB 5JLZB 2VLKA 4LAQL 4XTRC 3DPBA 3IFLH 1EGJH 4M5YH 1FYTE 2XPGA 4AM0B 5FGCE 2HT3C 4QRTB 1WTLA 4QRPA 2CUMA 4N1HB 5L2KB 1VGKB 2EYRB 1OAZL 4DAGH 5CBAA 5EORH 5JA8B 3PGDA 3EJYD 1I1FB 5EC1B 5DEGB 5DJYA 3D18A 3D3VA 5E5RB 2VR5A 5HGBA 4HW6A 4PJDF 1MRFH 3SCMA 4N0RA 2XY1A 2DQEH 5T3ZL 4WUKH 2XTJD 3D0VA 2QSCL 1NCAL 4ZO9A 1ACYH 3GM0A 3MC0A 1TQCB 4L9LB 5CEYA 4QF1B 4Y88A 5TFSH 1WFOA 4HBCL 4QRRD 3S96A 4NM4H 5A43C 1UT9A 3KAAA 4M3JA 5I8OL 4WUUA 4S2SB 5J12C 3MLWL 1JHLL 1H3TA 3MV9D 4FQHB 1X3DA 4WDIB 4YHKL 4MJ6B 5HYJA 1BQHA 1EJ6A 1OY3B 1AXSB 1BM3L 1S9YA 4UI2A 3P4OA 1A6TA 1LO0H 4C59B 5D7JD 3PDOA 3QEHA 3ZE2F 3E8UH 4MNHB 2YD5A 5DD5H 3T0EE 5KN5A 4OLVL 3TBYB 1IGJA 5MEND 4F37K 2HKHH 1P7QB 1Z5LB 1CVSC 2BVEA 2GKIA 2YPKA 1RFDH 3IJYA 1PZ5A 1AE6L 3REVA 2NY1C 1JYVA 3CH8A 2CKBH 1IQDB 1IT9H 1JK8B 4HWEL 1TFHA 1MCBA 4ORZC 5FYJD 1P1ZB 5ISZD 1XF4A 1X6NA 3IB4A 2BVQA 4NQSB 1AXTH 5DUPL 2CSPA 1XT5A 4FFWD 5F9JB 1T7WA 1S3KH 4JJ5A 1A4KB 1OAQL 5GS2H 2EIZB 4OFPA 1NFDE 2VABA 4UIKL 2HTKD 4X6DF 5CEXA 4NC0B 2DD8H 3WUZA 1DUYA 3T0XA 4YHLL 3ZKMC 4KUCD 4GRLB 1JPTH 2R2HB 2VITB 1TQBC 3GB7A 1WCBA 2AI0L 3ARZA 2P24A 4RGMB 4YC2C 2VYRE 5EA0H 3DXAB 4M02A 5EFIA 4WHCA 2R15A 3MJ9A 2X9WA 2SEBA 2VLLA 2K3TA 3IDMA 3K2MC 5EOTA 1KN4H 2YD3A 4MDJA 1I1YA 4DEPC 2V5RA 1KFAH 4M9PA 1MNUH 3O3DB 1DQQA 5KVGL 2FRGP 1NDMB 1OSPL 5KVDL 2OX5A 3C9NB 2GEEA 5DJ8A 1CR9L 2HN7B 3S4SA 4YHYB 3MLVL 2CR3A 5J9PB 1FV1A 1HQRB 2XIDA 3TT1H 5CJQL 3LSOB 1RMFH 3BKMH 1WBZB 3GJFA 1D5BA 1EIBA 3QNXA 1EXUA 2YA1A 3O2VH 4GQ9H 2IQAB 5LVEA 3HAEG 4XGZB 2F54E 4PJ8C 5DJXA 3BZEA 2WM0A 3OKEB 5C0AA 4Z9KB 1J5OH 5HYSG 3O81A 2DTML 1LDSA 4I77L 3BAEL 3HN3A 1CE1L 4LHUB 4AY0A 2A83B 3QJFA 4YIQA 2XA3A 5IT2H 3MRIB 3N1MC 2YWYA 1R3JB 2FHCA 1X4YA 4LLDB 1TITA 4EUPB 2NQCA 1T2XA 4TSAH 4G7VH 1DL7H 4YHPA 2P5WB 1INDH 1WWBX 4GG6B 5JNYA 2JB5L 4G8GE 2HJKB 3PP3K 4FFZL 4P2QA 3TO4A 3L3KB 1BFSA 2J6EL 2DLIA 4LVOB 1MHEB 4HUXB 1BVLB 4H8WC 4MQSB 1U8MA 5EO1B 4L8SA 5I15H 1O0VA 3QWOB 4MNGE 1TNNA 1Q9WB 1U95B 4N9GB 5EO9B 5F44A 5AYUH 5J3HC 3WIIL 1C5CH 5LQBL 4BM7A 4M43H 1IBGL 2NY6D 3HMWH 1FZMB 4QXWA 4MD4B 4RGND 3D1MC 1PJ9A 2G75B 1ITBB 4NM8H 4DK6A 3CJJA 5AYQA 5GS1A 1EEZB 1JZ5A 3FN0L 4XCYB 5ETUA 4DVBA 4LRIC 1ETZA 1INEL 4L4VB 3D69A 1PGRB 2VLMD 3BRGC 2EDBA 1PLGH 5ELIA 3RAJL 5A2KH 4U1LA 5C09E 1RUKH 1R5WA 4IS6B 2A2QT 2CXKA 4PJEE 5CZKA 4JG0L 4X9FA 3DIFA 4HT1H 5KVFL 4PLJD 5BVPH 1A4JB 2CDEA 2A73B 1RULH 2E7HA 1J9CT 1VENA 3DSFH 4H1LA 3KLHC 2NY0C 5C6WH 5SX4H 5MI0C 3MBEC 5J57B 4TTDD 3VFVA 1S9XB 2MKWA 2HYMA 3BO8A 5L8LB 4JKPL 1JNNL 1IGIL 3PNWA 3LS5L 4RGOH 3U0WH 4OIIH 3TBVB 4J6RH 2XICA 1G9ML 1KJMA 2Z92B 3FMGL 1IAKA 4HF5L 3SJVD 4WI4A 2H1PL 2GCYA 2ARJA 3M17A 3CVIH 1E28B 2ZPKL 2R2EB 5JMRA 2VLJB 5EZIH 5IHZA 1J87A 3I6LD 3LB6C 3BP7B 5MEOA 2JB6B 3EUUA 1UB5B 4BZ1H 5DRZB 1YYML 3WXWL 1M05B 3A67H 5AD0A 1JGDA 4KKAD 3KR3L 2RBLA 1JWSA 4JPWL 1L6ZA 4JFXB 3VD9A 3IAPA 3DBXA 4NP4L 1U3YA 5E5MA 5GJTH 1FL3A 2VH5H 3EYQD 3I75B 4RWYL 2W0LA 5EBWB 2DDQL 3HUJE 1GPOH 2EE9A 4KVNL 2IAMA 3QXVA 1OTSC 3O2DL 3QFJD 1TJIL 4S1RL 1LO3L 5EU7C 5F9AC 4OV6F 4M6NH 1XGQB 3T0EA 3DMMD 1MUJA 3VXUB 3EYFA 3P9LB 2D0FA 5CJXC 2EDXA 3S98A 1Z3GL 4ZOEA 2BSTA 2ZKHH 3OJMB 4OGXH 3RWHA 3THML 3ZDYF 3QG6A 4G8EB 2XQYG 4OZGF 3R1GL 3VFGH 5GS0H 4DN3H 3OGCB 2QHRH 3CVHH 3U46B 4C58B 4KK8D 1HWGB 1A6PA 4LQFL 1F6AA 5JMOC 5B8CC 1DE4B 3RTQA 1N8ZA 3MRDB 5GRJL 3EAKA 5SWSB 1A6AA 1NFDA 3C2AH 1GZQB 3MV8D 4FHBD 4AT6B 2J8UE 4Y1AD 2XACC 4LP5A 3GI8L 4OTXH 1DLHA 1RVFL 1K8DB 2YPVL 4ZS6C 4UIMA 4IRJA 3T4AA 4FQIL 1SEBB 3WKML 4XMKL 3KPLB 4XBEL 4NRYB 4RA3A 4KPHL 2XWBB 3GNMH 1EFXB 3MNZA 3U4BL 1OCWH 4G3YH 3MGOA 1N6VA 3AY4C 2PO6A 4NT6A 5FKPB 3EHBC 4OGAC 1EBAA 3QWQB 4K23H 4YHOL 4E5XA 4Z5RB 5HI3D 5I1GL 1TJGL 1MLCB 1ADQH 2N7BA 1YDPB 4OAWA 3ESUF 2EDOA 3HCVA 1XF5A 3W9EA 3VFWB 5HHNA 1A7PH 3U7WL 5GGVH 4OCWL 3VD5A 3PQYB 3L7EA 3RWEB 1KPUA 3VFSA 1N4XL 4KDTA 3V0VB 1L7TH 1V05A 4CVZB 4UOW0 1AR1D 4HEME 3UJTL 4N5ED 1U8JA 1U8HA 4KVCL 3FFCB 5ICZA 2F54A 2LU3A 3NCBB 3WIFB 4OFKA 4ZFOL 3RVUD 1MOEA 4FQPA 4JY6B 3U36B 5IOPB 1MI5B 1BAFH 3KPMA 5CEZD 1U3HC 5DWUH 3EYSL 3GSQA 4JO1H 3VGEA 1L0XA 4Y5VB 2PCPA 1Y6MR 3MLRH 5F21B 4I48B 4IRZH 2NW3A 4M93B 4A6YH 1B0RB 2C5DC 3NIDE 5E6YA 5IFAL 1A7QH 1S7VB 1G7PA 3M1BB 3EOBA 4G8GA 4M61B 3Q2CA 1WT5C 3OKNB 2KH2B 2DQDL 1YEIH 3VD3A 1L9MA 5DQDL 4XHJC 1P9MA 2X4QA 3LKNB 4JDTH 1A2YB 1EZVX 5T3XD 1GAFH 1I9JH 4RISH 4YHNB 1R5IB 4EDWH 4GKSB 4MNGA 3U48A 4N1CA 2EIEA 4JZNB 1S7XA 4O5LL 4GKNB 4WFFD 1U0QA 2DYPB 2X05A 3MRPB 2FX8L 3MOAH 4DFHA 4XPTH 1A7BA 1MHHA 3OBAA 4TUOB 4UQ3B 2XKNA 2EDWA 2GY5A 1T1WB 2BDNL 2YK1H 2EXYD 3UYRH 3RPIB 4H88L 2W91A 5C09A 3T0BA 5KVMC 1A9BA 2FX9L 4HH8A 1TCRB 4KMQA 3WV0A 4PJEA 4LGRB 1UH4A 2A6JA 3DYOA 4NRXB 1H8NA 5TH2A 3L5IA 4JFFB 2YBRA 4HWZB 4RRPG 3LHPH 1E4XH 3DVGA 3QCTL 4I0CC 3ULUE 2ICEB 3L5WB 5J89A 1NCNA 2R23A 5I73C 2YS4A 3BYYA 4JAMB 3C6SB 3EDFA 4KTDH 1MAKA 4X4XB 5FB8A 2LTQB 3C5JB 4K8RD 2FX7H 4I0PC 4XCNA 1QVOA 5I66A 4RBPH 4JRYB 3I50L 3PWPE 2EICA 1Q9KB 2B7DT 3O9WC 4U6XB 3QUZB 3UMTA 1V7NH 1AGFA 3UC0L 2OTUB 4X99A 4HHAA 4M7KH 4UNUA 1J0IA 5KTEL 3AU1B 3PABA 4ZUTB 4UDTA 5E03A 3QZWB 1B0WA 2NY3D 3MROB 1CF8H 1IAOA 1YEHH 1WZ1H 2KQMA 3B8SA 5L7XL 3CGTA 5I71B 3HUJA 4HMCA 4ELME 2OJEB 4WFGD 4F7MB 3ARGB 3EO9L 3PP4L 4DKFH 4NC1C 5FUZH 2BOBB 3V6FA 3P77A 2V9RA 5I1AA 1KIRA 4Q0XH 5C92A 1I85C 3DX7A 4W68A 1TETL 4L4TB 1KT2A 1JGUH 4U1NA 2MCPH 2AW2A 5CGYD 3HTLX 1T1ZB 1QSFE 5BCAA 3VFNB 5GS3A 2M2DA 1R3KB 1F6FB 3S37L 3T4YB 3RZCA 1IAIH 4EI6B 1ZLVK 4W6YB 3UBXI 4PJ9C 1G7IB 3U30B 3RIAF 4CMHC 3GFUA 1H0DB 2DQGH 3HPLB 4F7EA 4NUGH 3BPLC 3KYNA 1T7ZA 3LQAC 2X41A 1GGCL 1HHKB 2I5YL 4U0RB 4R3SA 2Q7NA 2UY7A 4JG1L 1KLGB 5ESAA 1CGWA 1KLUB 4FABL 3IJHA 2E7BA 3B6SA 4JKLA 3KPRD 3V0WL 1YNLH 4J4PA 4HLZH 2EDHA 4H25A 1CLYH 1LO4L 2HT4D 4OZIE 5KW9H 1KENL 3OJDB 4MA3A 4JPKH 4RFNC 1QSEE 4I4WA 3S35L 4MDIA 3W0WA 4U1HB 1OP9A 2CGRL 1UC6A 4HKZB 4NJ9H 1UKQA 5LGJA 5ITFB 4JHAH 5DR5L 4NZRH 1YEFL 2WNGA 4V1DE 3HFMH 3VI4E 3EJYC 4K7FB 1RUMH 5EOQL 2P7TB 5CWSB 1J05A 4LSVL 4G43B 2GSIA 3I02B 3LEXA 4PRPA 4I18B 3CPLA 3PL6B 4XWGH 1UM6L 2YKLH 3S34L 3X12A 1GGBH 1HZHL 3UX9B 2MNUA 2DBLL 1T6WA 1XGTA 1OF2A 3ARDC 1CFQA 4P57A 4DW2L 3BD3A 3F58L 4N0UE 3FO1B 1K5NA 3G5ZA 1MIEL 4X8JB 2FB4H 5C0CB 1K8IA 5E2WL 4ZOAA 1WC7B 4P46A 5IF0A 2VZ1A 4MXVE 4LVEA 4GG6F 1HYSD 2CJUL 4HKJB 3CDGB 3IRZA 3ZSSA 1W0WB 1LNUB 2X6MA 3LQAH 5I75B 4HXAL 1Y18A 5TDOA 2OK0L 2ZSVA 5J6HB 3JUYA 1WFTA 3ZTJH 1FJ1A 4YPJA 2AXHA 4L3EB 2J6EA 4PJ5B 1BFVL 3O4LD 4D3CL 1JN6B 1MFBH 1SJEB 2YSSA 5D7JC 2FJHA 3VI3F 5ESVB 5L2JA 1K4DB 2WZPD 1HSBB 5IBTH 1HIMH 5CKGA 1ED3B 1Q72H 2AABL 3BPCA 4HIIB 4ZPTA 1QFUL 4UU9A 3HZVA 5DGQA 1T6VN 2F74A 3N0PB 1TJHH 4NKMA 1JWMB 2VQ1A 2CMRL 3B9KC 4KI5E 4I2XE 1QFOA 2ICCA 5JW4Q 1E4XI 1CICB 5DFVD 5L6YL 1LD9A 3GSRB 4IIQA 1CD1B 3OTTA 5FGBC 3VWKA 3H42H 3KYKL 2FHBA 4FFWC 4YPGA 3L3GB 3DO7B 2ZSWA 1PG7L 1I3UA 2E9WA 4U1GC 5JIKA 1T03L 2NR6D 1IFHL 2AQ2A 2J8OA 2HTKC 3B3IB 4EQ3A 4RNRA 4KFZC 4WI8A 5FDYA 1KULA 1GJIA 1T04B 1NJ9A 3RIAK 4BQ9A 2FR4A 1J7VR 5I1EH 5IMOA 1AO7E 1IZKA 2AP2A 3IFLL 3QIBA 1EGJL 4M5YL 5A2JH 3BZ4A 2OL3B 3ZLQC 1JGLH 3UTTB 1LVEA 3WN5A 1F11B 1V3MA 4YR6B 2WWMC 2PYFA 5HHOE 4DAGL 1NCBH 5EORL 1Z0MA 3LQZB 4OZ4B 2ERJB 2KUTA 3KDMA 5BRZD 5E9DD 1X5FA 4U1KB 3QIUA 1F3DH 1MRFL 5GGVY 5B22A 1I8MB 2XRAH 4J3WA 1HEZB 1XGPA 2DQEL 3PWPA 5FUOH 2EKSA 1X9QA 4WUKL 3LDBB 3C5ZA 3KPNB 4JO2H 3MLPA 2NZ9C 5A2LH 3V5HA 1ACYL 3GHBH 3NFSH 2PW1A 4PBVC 3BYTA 1WBYA 5TFSL 3HAEA 1HHIA 3Q6GH 3MRLB 5DO2D 3SE3C 5IWLA 5B3JE 4EDXA 3L3DB 4NM4L 4YHIA 3G5VB 1U93B 2UZXB 3O2DA 5E6IA 5E8EA 2AXFB 5C07E 2VLKD 3CLFH 3QULA 4UT6H 1RK1B 2ZCHH 1NLDH 5DRWA 2UZYB 2CLVB 2FIKA 3HRZA 4Y5YC 4BH8B 2EDDA 1LO0L 3NVQA 1U8KA 5AWNH 2HRLA 3OKOA 1Y6NR 3E8UL 3T2NH 2EECA 5DD5L 3NGBB 3PWVB 2P8LA 1ZTXH 2EXWD 2FO4A 3JTTB 3D3VD 1KG0A 2I60L 2HKHL 4MQ7A 4XX1G 3AROA 5HHME 5T5FH 2EDTA 4MJ5B 5EUKB 1QSFA 2V2TA 3FB8B 3JV6B 3WNOA 2CKBL 4E9LA 1IT9L 2FATL 1CD9B 1NGQH 1G7LA 3DARA 4RFEA 2NY6C 2G9HB 4RGNC 5A3IC 1AXTL 1B0GA 3ULSB 1S3KL 1LEIA 3IDGB 4WWID 5IHBA 5CCKH 1P5VA 3G6AA 4WUUD 2C3WA 1TDQA 4LLVB 4J3TA 1FFNB 5K93A 2BJMH 5HD8D 3ARBA 5BW7C 2DD8L 4OGZA 5GRYA 1JPFB 1NFIB 4ONHB 1LP9A 1GZPA 1FYTB 4X9BA 4OZIA 1RUAH 1JPTL 5DA0B 4PGDB 4KMTH 1QSEA 3TEUA 5EA0L 1VFOA 4PJAB 4QRUA 3BP5B 2YC1A 3IDUA 2PNDA 1QFWM 3RVTD 4O2EB 1BQUA 4KWUA 1F4HA 4XBGA 1Z9MA 4GT7A 1KN4L 2BSSA 1LP9F 4K3DH 4V1DA 4C56E 3GBMH 4P2YA 4TTDC 1KFAL 1KCLA 1MNUL 5DJDB 3TYFA 2IBZX 5IQ9B 4NYLA 1U6AH 2VAAB 1KTDA 4E42A 5FECA 4X98A 3VXSB 3TT1L 1RMFL 1CVRA 3BKML 4JFPB 5D1ZB 4ZFOA 2IG2H 3O2VL 5DUMH 4GQ9L 3OAZH 4N0UA 4KU1A 5C0BB 2EDEA 3AAZA 1KLFA 1KYOK 1J5OL 1FL3B 4KKAC 5F7DA 2MWCA 2E9BA 2Q7YA 1NCDH 3BDYH 5F72S 1MCIA 5IMKB 5IT2L 1UYWH 3BZFB 4WHYH 4U1MA 4FNLH 3C60C 3EYQC 4TSAL 2ENSA 2VE6A 1DL7L 4G7VL 1U58A 1INDL 4WW2C 1NMCC 4AQOA 5ITBH 4MJIE 2H3NB 2NX5B 5EU4A 2UVEA 3O2WH 1MFDH 2K7QA 1OAYH 3DMMC 1DBKH 3QHTC 4I8DA 4PJBB 3HE7A 5CJOH 3O3BA 2NNAB 1CDGA 4L3AA 4P3WA 5I9QB 5KJRH 3F12A 2AJYH 1OM3H 3IJSA 3BUYA 2YEZA 5T1MA 1XCQB 2XZCH 4I5BB 4I2XA 4Y4FA 5I15L 3C6LA 3QEQE 5AYUL 3QIWA 3WJJC 2PTVA 5DK2A 1C5CL 4M43L 3TIEA 3HMWL 3CNKA 3GMLA 4D9QD 4KK8C 5HHQA 2MPAH 2Z9TA 3GRWH 4GBXB 4NM8L 1DBAH 4GRMB 2NY2D 1W0VB 3O4OB 2JJSC 4P2OD 5HGAB 1XH3A 5C0AD 3DURA 2FEEL 5IEKA 4R97B 3P4MA 5DFWH 2ZCLH 5FHAH 1EHNA 4WJ5A 1PLGL 2X10A 5FO8B 4X9GA 4P3DB 1RUKL 3D2UB 4DUVA 2X5PA 1IKNC 3QDMD 5KANI 3V6ZB 4HT1L 5JOPD 4P2QD 5BVPL 1EHAA 2HP4A 3TO4D 1BF8A 1RULL 1FGNH 3DSFL 5F88A 5HHOA 1H3XA 4HIEA 4M1GL 1BWMA 3NCEB 5I8KH 1JP5A 4RGOL 3U0WL 4OIIL 4J6RL 5DI8A 5E94B 5B3NA 4I3RH 3L3IA 2RFXA 3OX8A 4JFDE 4X9HA 3STZB 4KRPD 4X9IA 1OW0C 3CVIL 4YAQB 3UTZA 4TOYH 4KDWA 2OYPA 1N3NB 3TN0B 3RRQA 1X5HA 4U2ZA 5DURD 5EZIL 1QQDA 5MERB 4MNQD 3OKMA 3QI9A 2YPLE 1HNGA 5FO9A 3W11D 4NN5C 4N5EC 3SBWA 3T08A 3VGAC 1D6EB 2DJ4A 4MCZB 4BZ1L 1KCRH 2Y7QB 5GZOC 2GTWB 3A67L 2YZ1A 1XIWC 5C07A 4OD2A 1F6LL 3HI1A 5F8RC 5I1LB 3OXSB 2DMBA 5GJTL 4Z76B 3BXNA 2QADB 2VH5L 3PHOB 4KGLA 3T8XB 2GAZA 3I6KA 2EC9T 5DEFA 1GPOL 4JQXC 3H9HA 4OZFB 1UWXK 2OR8A 1HH9B 1ZT7B 4DZ8B 4XPAH 4M6NL 1QG3A 3DVIA 3SO5A 4TULH 4K71C 3O8XA 4IRSA 1WQVT 1BJMA 1YECH 2ZKHL 2BVTA 4OGXL 5FF6A 3U9UA 5C70A 3RX8A 5C0FB 3OZ9H 1BD2B 2D31A 4UDUA 2BXZA 2VDMH 3VFGL 5EB9A 2Z8WC 1VEPA 4DN3L 2QHRL 4S1DD 3CVHL 3DHJA 4OQTH 4GAYA 1JHTA 4XVJH 2IC2A 4PREB 1TVBA 2W9EH 3AS1A 3FAWA 2C3GA 1HKLH 4QRQA 3WFCH 4WO4A 1KB5B 3IDXH 5E4EB 3TNNB 4NQDB 4LLYA 3GMMA 4AQ1B 5I76A 3K4ZA 3VG0H 3C2AL 5D2LB 1MSPA 5KSAD 5HI5D 5KS9E 4P59H 3QFDB 1EUUA 3RVWC 4OTXL 1SQ2N 2EXYC 4MLSA 5MEPA 4JKKA 1QA9B 2W9DH 3GSOB 1QRND 2HVJA 1X5YA 4Z7WB 3RZWA 1OGTB 2FJFA 2FJGB 3CZFA 1DR9A 3GNML 4JDVB 5FYKU 1SMAA 4BZ2H 1RJZA 1OCWL 4G3YL 4Y19B 3DGGA 4ZAKA 1EBPA 5DMGC 1OQOA 1TIUA 5DJZA 4C56A 4K23L 4K3JH 1CFNB 4M4RA 3T2PA 1ADQL 4C55A 4ZSOE 1HHGB 4A2LA 4CVUA 1R24A 1A7PL 3SKNB 5GGVL 1IL1B 2UY6A 2XWTA 1R5VB 1RJLA 4K8RC 4JN1H 3RTQD 4DZBA 2H2PD 3W39B 1L7TL 3MLSH 4QHKJ 4DWHA 5IV2B 4Z7NE 4BH7A 4FFVD 4Y5XB 4LAJH 3AB0C 3Q3GA 4NN6B 1I7RA 1RIHH 2D4DA 4LCYA 2X4OB 4Z95H 4S0SD 5AZ2H 1JF1B 4JFOA 1LO5B 2MJWA 1XGUB 3CUPB 1BF2A 1BAFL 1GSMA 4IRJD 1CFSB 4NFBA 4PJHB 5DWUL 4JO1L 4LMQI 5E8DH 3MLRL 4IRZL 3ROLB 4MJIA 4A6YL 1F4XH 4OV5B 2PO6D 4F58H 1A7QL 1RD6A 5DJAB 3RI5F 4P4KC 4Y4KB 1HDMA 3V5KA 5JUEH 4NWUH 3OGOE 1YEIL 3DNKA 3O6FA 5CIPH 4JDTL 3CC5B 3VFRA 1GAFL 3TVMD 1I9JL 1UB6A 4RISL 1NMBH 3GKZA 1DN0A 2DWEA 4NQEE 4EDWL 1GRWA 2Z31A 2BNUA 3HC0A 4XX1E 5IMMB 3MRHA 3QEQA 3T04D 4WU7A 4NCC2 1I1AC 3EZ8A 2JTDA 5CGYC 1MJ7H 4OLEA 4HUUB 2KZWA 1M4KA 2W38A 5DZLA 3WLBB 3GSXB 1BVZA 2J8UB 1S8DB 2PYEE 3MOAL 4XPTL 3MCKB 2VDLH 3T1FB 4U3HA 2W07A 3MRMB 5FYKD 1DVFC 1T5XA 4YDKH 4KAQH 4Z78B 3VWJA 3FQNB 3FQRA 1MRCH 2CH8A 2YK1L 1NCUA 4OB5H 2IJ0C 3A0OA 4O2CB 1ONQA 3UYRL 4FG6D 1R3LA 3ZMRA 1EGJA 2NLJA 5JIHA 2F53E 2ZOKA 4MXQD 5I17B 2CDGB 2YA2A 2PXYC 4W70A 2ICES 1R3HB 4G8GD 4R0LC 2W65A 1NEZB 1QBLH 5CP7B 4NZTH 5CHNB 4XRCA 1OL0A 4LSDA 3FO2B 3VE0B 1VHPA 3PF2A 3CFKB 3AXLB 3LHPL 1E4XL 1ZAGA 4M5ZH 2GTZB 3GKWH 1HE7A 1PKQE 4XXCC 1CK0H 3LPFA 2I27N 2DOCA 4JFDA 4P23C 4KTDL 4O4YH 1EPFA 1OD7A 3IXTB 2FX7L 4ENEC 5BV7H 4KKNA 3BIKB 1FPTH 4ORGA 2JE8A 2G2RB 3L95A 2YPLA 5IM7B 2F8XC 4BYHA 2OI9B 4I9WD 4YX2H 1V7NL 2VDKH 4M7KL 4ZFFA 3SDAB 2RIKA 3VA6A 1CFVH 5FGSA 1Q1JH 1CF8L 1YEHL 2GQHA 1WZ1L 2WIIA 4GW1B 4MGXA 4WVRA 2V5TA 3V7AG 3MRFA 2HT2D 1RI8A 2BNQB 1F02I 3VGBA 4N0FA 3QXWA 5GZNC 1E27A 1OP5K 4DKFL 5FUZL 2FEDC 4JRWA 5IKCA 4Q0XL 4LGPB 5DHVB 1BIIB 5T3ZD 3DUSA 3DUHA 1JGUL 2CKBA 3BQUB 3FFDB 3SGDH 1IC5H 1T21A 4G8IA 1R0AH 1QHOA 3K8KA 4QTIH 2OSLA 1QR1B 4PRHE 1WICA 3RI5K 3L3JB 5DZOA 5D6CA 5BQ7B 1IAIL 3VFTB 1K85A 1A3RH 3QQNA 5DFVC 2EH8H 4KQ3H 2DQGL 4LPXA 4NUGL 1P7QD 3N1GC 3WO3B 4QGYA 2EYTB 3GSNH 1S7RA 4MA1B 2FYYA 2OLDA 3SKMB 2UVFA 3VXTA 2NR6C 1AIFB 3ETBF 3HI5H 4UAOC 1CQKA 3OKDB 4FQ1H 4PJAF 3L3HA 1YNLL 5T33H 4HDIB 3WD5H 1KNOA 1CLYL 5GJSH 2BVUA 5KW9L 3S5LG 1KBGH 4BKLA 4MD5B 3QEUB 4JPKL 3GMRB 3INUH 1YN6A 4LNVA 3ZYJA 3KPSE 4F9PC 4JFEB 1BZ7A 4GO6B 1VACB 4NJ9L 5EU7E 2V9TA 1W72H 4ZSOA 4JHAL 3PXJA 4D0CB 4FTVE 4D9RE 4NZRL 4GRLD 3QPQD 3HFML 5E8OB 2GITA 4C83A 1RUML 4M7LT 4ZUVA 1NUFA 5JZ7D 1HHJB 3DXAD 4QHNA 3RZCD 1T2QH 4OD1H 4ODTH 4P5TC 5F1IB 5EZLA 3RUGB 5IEHB 1FCCA 1WF5A 4RMSA 4XWGL 4LDLB 2YKLL 4POZD 1GGBL 3OR7B 2V2XA 4RAVB 1AR2A 3WHE1 3I3EA 4R4BA 2IPUG 1FL6A 1U91B 5HYSB 4QHLA 3L6FB 2GT9B 1MJUH 3QISA 1NBYA 1QBAA 5DO2C 2NCMA 2FB4L 3BHBB 4ZO8A 4ELMB 1KIQA 3QDGB 3HZMB 1YMME 5FOBA 4CADA 2CDFA 3S3SA 1FP5A 4Z0XA 4XAWH 5HVGB 4U4BA 4M1DH 3EGSB 3LQAL 4PJ7E 3IDNA 2P5EB 1OD9A 1MJJB 3W0WD 4JREB 3LKOB 1FVCB 4HX1A 1CXKA 2DQFB 1I1CA 3ILPB 1MFBL 4U6VH 4LHUD 1CE6B 3QDJE 5GQBA 2HJFB 5IBTL 1A1OA 1HIML 4LKCB 1Q72L 2N1KA 4NQEA 3K0WA 3P4NA 2D7TH 3TZVC 3MZTA 5K9OB 2C7UA 5IROC 2YD4A 1TJHL 4PRPD 2P5WD 5DVLA 4P4RB 4XXDA 3QQ4A 1LE9B 2PYEA 4AH2B 4R7DA 2H26A 4UOW1 5CBEB 4YWGH 4MSWA 2W60B 3H42L 3ROOB 3C5SA 1S78D 3DRTB 1SVCP 4CVWA 3SKJH 5IHUH 4HCRH 5DRXB 3VXRE 1U3ZA 4PJ8A 2AXJA 1GXEA 1FNEA 2F53A 1ZE3C 4WNQA 5JPNA 4KC3B 2BCKA 2NY4B 4FQQB 4GS7B 4LGSB 1OSZA 1TVDA 4BK4A 1JZ4A 5I1EL 2GW5A 4ODUB 2GSGB 3D39B 3PJSB 1JGLL 1IEBB 1KGCE 5E08H 4GJTB 4U1IB 3HZKB 4U1SB 1NCBL 1ES0A 4F2MA 1PKQA 4JHZA 1VADB 4ZNCD 2B8OT 3CFEA 1F8TH 1SJHA 2VZUA 4M8QA 4OD3H 1NUNB 1FVDA 2XRAL 1CT8A 4KY1H 1Z9LA 4F3FA 2VL4A 3ET9F 3VWKD 1S9VB 1MH5B 3ZO0A 1X7QB 3MA7A 2BHUA 1YPZE 1L6XA 4JO2L 4X6FA 4EKXA 1G7MB 5FOJA 3RY5A 5EU6E 3DJ9A 1BVKB 3PP3H 1H5BB 1KXTB 3GHBL 3NFSL 3SGDI 4WFHE 2QR0A 5H35B 3QAZB 3Q6GL 4ODXB 1AHWB 1FFQA 3TNMA 1T5WB 1FZKB 5L0QB 2UWEB 2FZ3A 4LRIA 4LEXH 4YBLB 5DD6A 3T3MF 3FTGB 2BK8A 3WBDA 1J8HE 5HI4D 3NCMA 3CLFL 4UT6L 4GXVH 4XMLH 2QBWA 2ZCHL 1NLDL 3QIBD 3DROA 5C9JA 2GI7A 5HYQA 2CRZA 5AWNL 5M7QA 1N59B 5CMAB 4X6CB 3T2NL 3VG9C 1ZTXL 4XP1H 3VRJB 1T89C 4MAYB 3CVHA 1KN2H 3IVKA 2XN9B 3MBEA 3G6JB 5T5FL 3JVGC 4BELD 5IR1B 5D7IE 5ADPL 1BHGA 4PRHA 1O7VA 2ICWI 4ONFH 3MJ6A 4PP2B 3RHWF 4QY8B 3C5ZD 2CIKB 4PR5B 4YDJB 3Q5YA 5IGXH 4S10A 1T1XB 3VXUD 1NGQL 4K7PH 3P30H 3X17A 2D4FA 4HJ0C 4Z7OE 2IF7A 3VU2A 1LEKA 1F97A 1N6QH 2NY2C 3LVEA 4P2OC 3UTQA 5CCKL 5DK3A 4KJPC 2Z4QB 2ILLA 4FMKA 5FV2A 3HE6A 5KVEH 5E6ID 3QHFH 5EO0A 3DOSA 3GO1H 1ZHLA 4Z7WF 2BJML 1QFWH 5H94A 1QYGH 1AO7B 4FXKA 3DUUA 1Y0LB 4ZFZB 1LO2H 4FQXB 4LVNC 4JY4A 2NXYB 1RUAL 1WWCA 3J8F7 3B5TA 4JY5H 5IVZB 1UKTA 4KMTL 3UBXA 3GSVB 4LCUA 3ZHDA 3KPSA 1ADQA 4G42A 3O11B 1X5XA 2F58H 2FLBT 5D7LE 5D1XC 1NBQA 4LSPH 4NC1E 5CJXA 4K3DL 4JANA 5IK3B 3UTPE 5C0EA 1JIBA 3GBML 1QSFD 5ACMA 2WQ8A 2Q8AH 1PEZA 2I9TA 1ZSDB 1FFRA 2MQ3A 3WSQH 2JCCE 1BLNA 1NLBH 1U6AL 4NDMA 4AENB 3OB8A 1EFXD 3QI9B 3P40A 1QRKA 4KRPC 1JFQH 5HDLA 3IDJB 3IFOA 1FYHB 3IT8D 4OZHE 4RDQF 2WWKO 2IG2L 4ZS7H 4RWHA 5DUML 1RZ8A 5B8CA 2YR3A 2DJSA 5IJVA 1M71B 1D5ZA 1X5AA 2BSRA 1AGCB 4PJHF 1J0ZA 2NXZC 3PQYD 5F1KC 5IG7A 1NCDL 3BDYL 4A6YA 3BEWA 4KROD 3S35X 2AKRB 3V7MA 3GSUB 1C08A 4NSKB 1UYWL 3BEVA 1NMAH 3IFNH 4WV1C 4NQCA 1MCEA 5CJ5A 4FNLL 5T1KA 3Q6FA 4WHTB 2PW2A 1T22B 5DJ6B 2UUDH 5ITBL 1G7QB 1C12A 4GW5A 4PRDB 5GSVA 2HJLA 1VA9A 1FNAA 3O2WL 1MFDL 1OAYL 1DBKL 3QDJA 5F89B 2R2BA 5CJOL 3AY4A 3QSKB 4PRAA 2XV6B 3FO9B 1O7SA 3FOMB 5LKNA 5KJRL 4X6BA 2AJYL 5E95B 1OM3L 1XZ0B 1OTTD 3IS0X 3HC4H 2XZCL 5B39G 2EO1A 4BFGA 4S1DC 2JKXA 2WMPA 4R2GC 2FL5B 2MPAL 1T7YA 3GRWL 1DBAL 1RZIB 2FCBA 4XPHH 4PYGA 3MRNB 3LZFH 3QQ3B 3VXRA 5KSAC 5HI5C 3RHWK 2ZCLL 5FHAL 4WU5B 4Z7VE 5MEQA 1K4CA 1QOKA 2W0FA 5TGBA 5ICYA 2B2XH 3FHAA 3LKQA 3CCHA 4P0DA 1U3HA 1UXSB 5DC4B 2Q86A 2FWOB 2ZUQB 2VXTH 3EFFA 4XCEA 4MWFB 1YN7A 3HE7D 4N1EA 1FGNL 3TBWB 5EUOE 1P2CA 3VH8A 4ETQB 1XF3B 1GH7A 4X7TB 2DMCA 3C6LD 5I8KL 4LARH 3MXVH 5MENE 2LFGA 4I3RL 5SWZE 2XXMB 4CAGA 1MPAH 1MWAH 4TOYL 4TYUA 4HGWA 4WI9A 5EU6A 2HVKB 2VMFA 1TZGH 1VPOH 1G0XA 4FFVC 1EFQA 3MLXH 2O93L 2X4PA 1LGVA 1QLRA 1LHZA 2HG5B 1D9KC 5J1AA 1KCRL 2XWJA 1T20B 5ISZE 5C08D 1WVZA 2W1NA 4FZ8H 4NZDA 3BP4A 3H7LA 3DV6B 5JHDB 5DDHB 4U7SA 1HCVA 5FA4B 2P8PA 1J8HA 5DGRA 4YO0B 1I3RB 2IANE 3WHXA 3QUZD 3C2SA 4OIBA 3U6RB 2DM7A 4MQXD 5BVJB 1MHPH 2ADGA 3SPVA 2OR9H 2PO6C 4XPAL 4G9DA 1QFWI 3O45B 1NGYA 1HILB 1U8OA 5I8CB 4TULL 1D5MB 3TCXA 1J0HA 1YECL 3LN4A 4L8BB 4EI5B 4QT5A 5C86A 4HQQH 1RQ5A 5D7IA 2XYCA 3TVMC 5C0GA 2YRZA 3OZ9L 5IB4A 3ARGD 4QXTB 1IGTB 3WO4B 2WWKT 4OM1H 3BH8B 5DTFA 3HG1B 1FHGA 2A6DA 2H9GA 3QUYA 4J3UA 5D1QC 4Q9RH 4OQTL 3QPXH 2H32H 4JGMA 2Y72A 3L5HA 1CN4A 4I0PA 4U05A 4XVJL 5GSRA 3FOLB 2W9EL 1HKLL 3PV6B 3FT3B 4TSBH 4CW1A 3WFCL 3HRPA 3IDXL 3VJ6B 2CPCA 5IVXA 4YEEA 1KJ3H 3VG0L 4QHMA 5C07D 1MFNA 5CD3B 4P59L 3IDYB 5DYOB 3T65B 1HHHB 4NKDB 4Z7OF 2W9DL 1UJTA 5F6IC 4GXUM 4MXQC 3QNYB 4PTTA 3P9WB 1IKFH 2A6KB 4QOKA 1HXYB 5IVXF 1ZGLB 4NRZA 5LJYH 2VRAA 3DX6B 3LD8C 4BZ2L 1TVHA 3O8XD 5D7LA 4IRSD 3PHQB 1I8KB 3MX0A 5HHMD 4BQ6A 2GFBB 3JV5A 5INCB 4HUVB 2BRQA 1CG9A 4EIGB 4K3JL 4IHOB 5IFJB 1AI1H 2R4SL 2IFGA 1IARB 4HZLA 4DKAA 5EZJB 2JCCA 2HLAA 5J11C 1NGXA 4YBQD 2ENYA 4N90D 4JN1L 3V4PH 4WO4D 4OZHA 3MLSL 3V6BR 5FIEA 5I2IA 1OLLA 3D5OF 2V7NB 1M7DA 2I07A 4NQXB 3RVVC 2RR3A 1IGCH 4PJ9A