1HXMB

Crystal structure of a human vgamma9/vdelta2 t cell receptor
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
230
structure length
230
Chain Sequence
AGHLEQPQISSTKTLSKTARLECVVSGITISATSVYWYRERPGEVIQFLVSISYDGTVRKESGIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALWEAQQELGKKIKVFGPGTKLIITDKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWEEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a human gammadelta T-cell antigen receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords GAMMA-DELTA T-CELL RECEPTOR
total genus 39
structure length 230
sequence length 230
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2001-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hxmB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hxmB01
4L9LA 1S5IH 3IAQA 2QQQA 1S7RB 2ZUSA 3A6CH 2XTJD 4MQXD 4D2NA 1RIHL 2CLVB 4JY5L 2E3VA 1UVQA 1R3HA 4W6XB 3WS3B 1CDGA 2ED9A 5JHDE 2LFGA 3CU1A 1BFVL 1O0VA 2VUYA 4PGDB 4FABH 2DQCH 2WINB 4FQJH 3LRSB 2R1WA 1FZJA 5K59F 1MJUH 5C0IA 1KG0B 3QB7C 5D1XA 1IJ9A 1QKZH 4POZC 1E4WL 4L8DB 2F5AH 4NM8L 5I17A 2Y5TA 2K9UA 3MROA 4Z7OF 3T3MF 4UT6L 3UJIL 4KU1A 4OIIL 4QRTB 4ZOBA 3HN3A 2NX5D 5EDXA 2YR3A 5JMRA 3QUMB 4XNXL 1X5GA 4YDLC 3RWHB 2A83A 2HA1A 4YHLL 4OB5H 1CGTA 3WS6C 2WWMC 1M7DB 3KPRA 1MQKL 3TZVC 4KGJA 4HBQA 3IDIA 4L4TA 4KTDH 4G7YL 4Z7VF 5CP7A 4MA8L 5MERA 2GSIB 4XNZB 1MVUB 3VXRD 4LPVA 4OFVA 3GHEL 3PGFL 3NABL 1M71A 1QACA 3BIBX 4ESKA 1EUTA 4OAWA 1HK6A 2X2YA 5JOPD 1N8ZB 5D1QC 2HG5B 3TBSA 3HUJF 3TEUA 2DDQL 4DVRL 3MRGB 1N5AB 1JGVL 1TETH 1CXIA 5FDYA 3N1QC 3KYMA 3AREC 4QTIH 5GIRB 1C8PA 4WU5A 2BY3A 1H3VA 1I1AD 3HAEG 4E41A 5JO5B 5FB8B 2EDJA 2LTQC 1C5DA 4HCRH 3TN0A 2ESVB 2J12B 4YWGH 5AZ2L 1YMMB 3EO9L 1HILA 5TH2B 3MGTB 3HE7C 4HMDA 4V1DD 1XCQB 5CKAA 4KKCD 3O8XD 4FQQA 4YO0A 2PYFB 4JY6A 4OZGA 3ZKXB 4Z95L 5D9SA 4ISVA 1MEXL 1PJ9A 4YAQB 4G6AD 4WFHE 4U6HB 3B43A 4D9QD 3MGAA 2UUDH 2W0FA 2PO6A 4NO5A 5D7KD 2XWJB 4I48B 3RP1A 3VGAB 5LGJB 5CZKA 2P5ED 4OZHE 1I8IB 5J1TC 2Z91B 3NFNB 4MJ6B 2EYRB 3V5KB 1HHKB 4E41E 5I19L 4CU7A 3O0RH 1QA9A 3QG6B 4APQA 2XT1B 1WZ1L 3VFVB 4IMKA 1JMXA 4B53A 1FAKT 4E42A 3D5OF 5F1NB 1JGUL 2QQLH 1T2XA 1V7NH 3OR6B 4ORGB 5B3JE 1CWVA 1FFQA 3QQNA 2VXQH 3BDBA 3AAZA 3HNSH 1BREA 4RAVA 4RGMC 4R7DB 5CJOL 5FF6B 1XF2A 5DD0H 5HHOE 2O5YH 3DSFL 2FBOJ 4P3DB 3NZHL 3SDCB 5JR1L 3O11A 1MRFH 2B4CH 5IW6A 3VWKD 1EBPA 4XBPA 1ACYH 4JANA 4PRBB 4QT5B 5IM7A 5FF6A 1XF2B 1EH9A 5DJCB 4PJAB 4XRCB 3BP7B 3BPNB 3S36H 5ITFA 3V4PH 4ELMA 3LMJL 1D5MA 1V7ML 3RDTA 2H9GA 5E0QA 3VWJC 4OCWH 3QUXC 3VW3H 1K2DA 2W0LA 3WFEL 5GS1A 1P84K 2ZG2A 3IDJB 4I18A 3L3OB 5CGYD 4KDTC 5ID0A 4JDZA 2B2XL 4L4TD 5KAQF 3WXVH 1KG0A 1EO8L 2F15A 5E5MA 4GLRH 1S9VA 1KN2H 2DLFH 4XPTL 1B0RB 1KJMA 1KCKA 4P4RB 4P3CL 4DN4L 5C0CB 1EO8H 5DFVD 3CVHA 1QSFE 3IJYB 3IF1A 4X6DB 4XWOD 3L5WB 1KB9K 2AEPH 3F12A 3PNWB 4DN3L 3GFUA 2R39A 2CKBH 5DJYA 4BH8B 4LCCB 4AMKH 3LRGA 2IFFL 1IC5L 1HHKA 3O41A 3JWDL 1VESA 2R2CA 2W0PA 4KJWD 4DKAA 2Y9RT 4NQDB 5E99H 4XBGA 4HLZG 4Q6IC 4KVCL 4YBHA 1LO5B 2L4OA 3EYOB 1I7UB 1AI1H 1YMME 4ZO7A 1YPZF 4U6HA 1L7TL 4M48H 3ZKMC 3C2SA 1AJ7H 3VWJB 2EC9U 1MWAA 4MXVF 3OKLA 5DD3H 1IM9A 3MX0A 5D70H 3Q3GA 5HD8D 4F7PB 1T0PB 2D7MA 3FQTB 2GY5A 4EOWL 4HUWA 3DMMA 3S4SA 3L5IA 3P11L 1GAFL 5KZCB 5EOQL 5KSBA 3FOMA 2RB8A 4X6CF 2F19L 1L0YA 3SDYH 4JRYA 2XKSA 3IDXL 1IC5H 3IETB 5D72L 2A74A 1SY6H 4FQLL 4EDWL 1IBGL 3HE7B 4M3KB 4PJ7B 3QQ3B 1B2WH 2BERA 1YYLL 3HI6L 3MODL 4Q6IA 1ZEAL 3H6JA 1BQHG 4K7PX 4A6YB 4XWOC 2G2RB 2QR0A 3OKOB 2V2XA 1IBGH 1MFCL 2Z4QB 2Y7QA 2Y5TB 5GJSL 1OTUC 1A6WL 1JK8A 4JPKL 1UQSA 2AS5M 4P9HC 1OAZH 4FQXC 4EI5C 2VISA 3O0RL 3FHQA 3QO0B 3VMNA 5EOQH 5D8JL 4GKSB 1IC7L 1DLFH 3V4UH 4JZOB 4ONGL 2OL3L 5TDNB 4Y5YA 1BBDH 2UZIL 2AJXL 2MKWA 4HCRA 2P24A 5E1HB 2AJYL 2FX7H 3RWJA 5FCSH 2BSED 3E6FA 1JUFA 2CUMA 3S97C 1HWGB 2DOCA 4PRPA 4R2GD 5ID0B 5F7MC 4PB9L 3IDJA 4ODTL 3U7WH 1IRAY 1LDPH 5C0BE 1MNUH 5J11C 3CDYA 2UVEA 3RX8A 5L2JB 4QOKB 3I50L 4OT1H 4XZUA 2XZAL 4WO4C 5K9OA 7FABH 2EH7L 3ARGD 5CLTA 3OG4B 5EZLB 4JG0H 1F3DJ 4LLMA 5SWZE 1Z9SA 2DQFB 4WFGE 3KPPA 4GW1A 4U0QB 4KV5F 2VR5A 4L3CA 4QTIL 2EDBA 5IM7B 1LP9E 1AD9B 4DN4H 3HE6D 1KT2B 3G5XA 4KTDL 3RWGA 3N9GL 1P7QB 2ARWA 1MVFA 4JY4B 1FNSH 4MZ2A 5D71L 2HJKB 4WJ5B 4I9WD 5MEQA 2R15A 5EIIB 4FXKB 3HC4H 4RMTA 1G7QB 1TJGH 1DJSA 4WUUA 1BJMA 3RZCC 3NACH 4UTBL 3H9SA 3NAAH 2XZCL 1UWXK 1I7ZA 4DTGL 2PKDA 4NBYB 4X6CB 2WUBL 4MDIA 2VDKH 1PD6A 4RMWA 4JVWA 4AH2A 3DRQB 2QADC 2ZUWA 2BSTB 1ZVSA 1H9VA 1WEJH 1A3LH 5SWZA 3O6ML 4NQEE 4KJQC 1YMHB 5IBUB 1QA9B 5DWUL 2J5LB 1A1NA 1T1ZA 2Z8SA 2J6EA 5EORH 2EYRA 3VGFA 1MCPL 5F9OL 4LPYA 4N9GA 5C9JB 3RRQA 1A8JH 1XF5A 2AJSH 3BD5A 4H5SA 4OCMC 3SDXE 5F3HA 3EOBA 4MB4A 1SBSH 1MFBL 1Q9KB 1QR1B 3P30H 4GG6B 1EHNA 3HMWL 5K9KB 1L7TH 2BVTA 2YPKA 3AS1A 4M48L 5JOFA 1ZHBA 5F8RC 4E0RA 4L1DA 3K2UH 4JM2D 1KB5B 4FXGA 1UJ3B 2YD9A 1RIUL 4UOJA 4OF0A 4LVHC 4OKVA 1TLKA 5DK0B 4YHIB 5T3ZH 3RTQA 5KVFL 1P7QD 4G8GA 1QLRB 3CFCL 5E6ZA 4C57C 1PGRB 5CEYB 4NN6B 2UYLB 4J3UA 1OAZL 4QRQB 4K3JL 2RHEA 4FXLA 2OXHA 4NQDA 4ACPA 1MJ7L 3EDEA 3GMNB 4U6YB 1F11A 4LIQL 4PGEA 3ZDZF 1RZ7L 1QG3A 3LDBC 1EEYA 4DEPB 1ES0B 1KN4L 3VI3E 1UM6H 4RFEB 4NC2B 1C16A 2GJ6A 4XPGL 4EVNA 5BQ7B 3U4BL 2X44D 1BZ9B 3QUKB 2C4FU 1S9XB 2E5EA 5GGRB 1YEIH 3VXPB 4LSRH 3UTSE 3U6RA 1U8IA 3DWTA 2YPLD 3MLRH 2F8VA 5AD0B 2WQRA 4A6YH 4PV8A 3OPZH 4Y4HC 3T0AA 4ZFZB 3LN9A 5F7EH 1CG9B 3BIAX 2FD6H 4EDXB 3TWCL 1NCAL 2HJKA 1HH9B 5IQ7L 4WWKB 1MY7A 5TE7H 5E8DL 5IVXE 2OJZH 1LEIB 1S9VB 3WHXB 3UJTL 5I71B 2XWTB 2ZCHL 4MA1C 1KEGH 3H7BA 2JB6A 4R4ND 2Z93A 4XGZB 5IJVA 1X6NA 4ZDHA 1I8MB 4PJ9A 3EO0B 4OSUL 4U6XB 5GRVL 2P5EB 1OTSC 1VA9A 4ZUUA 2C9AA 3P4OA 3C60C 5CEZD 3DMMC 5CZXD 4FNLH 3ULUD 4KZDH 2Y6SD 2ZOKB 5LGJA 3CH1B 5D7IE 4U0RB 4MB3A 4QYOA 1NMBL 5ICYB 1YPZA 3T0EA 3M8OH 2NX5E 3C6LB 4KQ4H 4P2RE 5TPWH 4U1IB 1NGWB 5GGSY 5D7JC 1BQSA 4JM2C 4LEOA 1RZJH 1IGCL 2BVYA 5I1GH 4XPHL 3UJTH 3OR7B 3DXAD 1S7QA 4ZPVA 3WNMA 3H8NA 1UXWA 3NCMA 1UA6L 3SE9H 3SDCD 4PY7A 5D7LE 1SHMA 5HPOA 2R8SH 1DDHA 5I8KL 1QBLH 1JWUB 5J11B 2CLZB 4PBWD 2BCKA 4GS7B 2Y36H 3PXJA 4V1DA 1U8KB 2B20A 3HAEB 3LKRA 1A6ZA 2JKXA 3FO1B 4MJ4A 5HBBA 1CFQA 5AD0A 3TT3L 3JV5A 2AJVL 4EIZC 3RPKA 12E8L 3ZE1F 3KPSA 4ZFOA 1TVDA 4Y19B 1U3HC 2IPUG 4NT6B 3BDXA 5EB9A 3NGBC 3QIUD 4WTXA 5IF0B 3KG5A 1RZ7H 4O02H 4CAGA 4MA7L 2UWEB 1P4LB 2LABA 4IS6B 4CDHA 1CR9H 1E27B 1JBJA 2A9NL 1KJ3L 1H3UA 3Q3GB 1FIGL 4CW1B 4MA7H 3VG9B 4K3JH 1MCJA 4G9FA 4F37F 1WISA 4G8GD 2W60B 3VJ6B 2YKLH 4N1EA 3BKML 4X0KB 1NL0H 1X7QB 4K9EH 1I3VA 4CBPA 1EGJL 3ZHKA 3IYLW 4U1JB 1KCLA 3R8QA 1N2RB 3HZMB 2JIXD 3GSOA 1HHHA 2RAMA 1FZJB 4GMSL 1T22B 3BISA 3CXHJ 4R4BA 4JG1L 3O41B 2ZUTA 2PR4L 4QRPE 1T2JA 43CAB 2DTSA 35C8H 1HI6B 3LS5L 4OM0L 1GGUA 3FO0L 1YN7B 2WMPA 2YD3A 3EZJB 3DOSA 3EYUH 3B2VH 1NCDH 3LZFH 3BW9B 1MCRA 4G6FD 2APXA 2NY4B 3W0WD 3I3DA 3LQZA 1MHPH 2P49B 1G1CA 1AXIB 3X13B 3ZSSA 3A6CL 3FB8B 2IGFH 3F7VB 1EGJH 4DCQA 3OXSB 3L6FA 3MOAL 1ZVSB 3QJHB 3Q6GL 5GJTL 1ZWIA 1QSFD 3KNBB 3OZ9L 4K7PY 1U8QA 1A7PH 2AK4D 2ENYA 3K74B 4EN3D 3LN5A 1CBVL 1UFUA 5GGUA 4R8WH 1KEML 4F8TA 3S4SG 2YRZA 3NFSH 5DT1H 4PJCA 4WV1B 1RZKH 2WINA 4JHWL 4R3SA 1U2CA 5C07B 4DUWA 2BHYA 4IIQB 3HE6A 1CT8A 1TZIA 1KPRB 3BO8A 2NY6C 5I1EH 5F89B 3PDDA 3G5XB 1RZGA 1DUYB 3S3SA 1JYXA 3GHBL 5ABDE 1QRNB 1A5FL 3BSZH 4L3CB 5CJXA 5BOPA 5E2UH 4O51B 5D6CB 4X7TB 3BQUB 3SGJC 4KKAD 1F6FB 3U7YH 3LEYH 4JZOA 2J8UF 5F1NA 2W65A 4GOSA 3MO1B 3M45A 5C07A 4M9PA 2HTKD 2GJ6B 4JHAH 1G7LB 4DOHE 4UDTB 4XVJH 4PJFE 3RVTC 5BVJA 4OCXL 1PDKA 5D2NA 5JNYB 4ZSOA 1F42A 1P4IL 1RULH 1FRGH 3CCHA 3BPOB 2X4TB 1VDGA 1J87A 3QO1A 5ENWB 4DUXA 5GRXG 1RK1B 5CP3H 1MLBB 3ZT6A 5IESH 5ESAB 1MCIA 4GO6B 5FUZH 4G8IA 3O4LD 2CMRL 2FZ3B 4MA8H 5F9DC 4PLJC 1EHLL 5E8EA 2H6PA 1ZA3A 3GIVA 1KIPB 5TE6H 3OQ3B 2QKIA 4QHUB 1JFQL 2DLHA 1QSED 1NC4A 1KCSL 2YEZA 3V6BR 3K4ZA 1XGPA 4N68A 1BD2A 3EBAA 2R2HB 1QBAA 3C60A 4K3HA 5FYKL 3QA3A 3AMLA 4QEGA 4NRXA 4Q6IB 3ME0A 1M05B 1K8DB 2FIKA 2QADD 2HKHL 1UENA 3CZFA 3O81A 1D6VL 4M8VA 3DIFB 3DNKA 1NUGA 5TF0A 2IGFL 3S96A 5F97E 5D1QB 5EO0A 5J13C 3C6LC 4MXQC 3UPRA 1QRKA 4CN4A 1BIHA 4KUCD 2XYCA 3JWDC 4M02A 1NGZA 4NDMA 4WUUD 3TBYB 5IQ7H 1EZVY 4PJGE 4G9FB 2Z8VC 2H1PL 2OTUB 3KPNA 1EERB 5E70A 4Z18A 5DJYB 5JXEA 4XH2B 2X40A 4OZIB 1Q0YL 1CGUA 1U92B 3SY0A 5F9OH 5CMAA 2VDKL 3RVXD 2NY3C 3UBXB 4AQOA 1H5BA 3RWHA 2DS4A 1NBYA 2VXQL 3JTSB 1R24A 1OWWA 1B0RA 1FYTD 4JCLA 4XCEA 4BKLA 4IBLT 3SKJL 5CWSA 5C0ND 2VUOA 2NNAA 1Q8MA 2GUOA 4NQXA 4OZFB 5FGCE 3UAJD 4R96B 2ADFL 4PJAE 3PQYA 3V6OA 5I1EL 2F58L 5GISL 1CZ8L 1K2DB 3MJ8B 5FV2A 4FZ8L 2VLLA 3VFGL 1AGDA 4UT7H 1OAYL 4OCYH 1PYWB 1NDMB 5IB3A 4P23A 3QPXH 4X6EA 3OL2A 4PY7B 4HS3B 5T3ZL 1OTTD 4JDTH 4LL9A 4QRPB 3UJIH 1WV7T 3BKYL 3X3FH 5HD8C 3MV7B 5ITBL 1YQVH 4NJ9L 5GGTH 4G8GE 4RGOH 1TNNA 4PJBA 3QA3B 3V4PL 4EN3A 3WSQH 2XZAH 1GPOH 1TVBB 5IIEA 5BZDA 3QJFB 4ZUVA 4J12A 1JHLH 1A02N 5FECB 3U48A 4U49A 4F57L 3HPLA 3LPWA 5CILH 1ZV5A 2ZOKA 1ZA3B 3NIFE 1P84J 2A38A 1NCCH 4QT5A 3ZDZE 4FQHA 1LHZA 3VGBA 4ZNEE 2G75B 5CBEA 4PRIB 4U1KB 1EAPA 2G2RA 2QR0B 5BO1L 2R69H 3DJ9A 3H9SE 2YPKB 4JG1H 3TH3T 4LLVA 3KR3L 3M1BB 5DD5L 4YE4H 3NACL 3Q6FB 1KIQB 1YNKL 2X6MA 4Z8FH 5EPMB 4DTGH 5IEKA 3NPZB 4I2XB 5ICZA 4XWGL 4P23C 3HUJE 3ZYZA 5DJ6B 4LDOB 2IBBA 3EDJA 5HVWA 2BNUB 4OZHB 4X6DE 3WIIH 4RMQA 5IMOB 1D5BA 2YA2A 3S8WA 1RJYA 4OI7A 3D85D 4G80A 5DHYA 1NH6A 5C08B 2OTUA 2CDFB 3MRDB 5IKCB 4CDGC 2BVEA 3I6KB 4JREB 5KVMC 5JIIA 1XR8B 2BNRD 5DD3L 4GRLC 1X4YA 3EO9H 3SCMD 4WUUB 2B1HH 3O8XA 3CD4A 3FO2B 4YGVB 4FXKA 2HKFL 3HI5H 4CVXB 4XBGB 4NKMA 1P6AB 2WANA 4KQ3H 2VLJE 3IVKB 1A6PA 5TF1L 4RGND 5IP4A 2DICA 1M7IA 3SJVA 1MAMH 4WI2A 2CK0L 3PIQB 4FFYH 2FSEB 5F1SA 3JV4B 3KNBA 3AMKA 4RFOH 4NO3A 4GXUM 3BAEL 5H37G 1INQB 5J1AB 3LV3A 3ZE0F 2J2ZA 3QWOA 1MELA 3LHPL 5E95B 1GGIL 4WNQA 3RI5K 4JZNB 2VN4A 5DUBA 1PEWA 3HMXH 3QFJD 3D3VA 5CEXA 3CPLB 1WCQA 4UT7L 2BJMH 3GBNL 3RL1A 4JFEE 5HYFA 3LKQA 3C5JA 1NBQA 3VXUB 3L5XH 1DSFL 5DK2A 4NUJB 2O5XL 1DE4A 1YEFL 5HYIA 5F1IB 4LCIL 5I74C 2VTFA 1MRDL 2Q3ZA 4P2OD 3MODH 4HIEB 3UTSA 3I9GH 4K23L 5HDBF 5BCAA 4M61A 2Q76B 2AAVA 2YPLE 2F5AL 5BVJB 12E8H 1UYWL 2KDGA 3O6FC 4TSCH 1VEPA 5DJCA 1CD0A 5C09A 3CFKA 2IH1A 1A6TB 1WC7A 4XC1H 4PJIF 2D0HA 2MKLC 5EUOB 2QTEA 4I3RL 3MJ8A 1MWAL 5KS9A 5IB2A 3BQUD 4L9LB 1YNTB 2OK0H 2DQJH 5HPMB 1JTOA 1AC6A 3CX2A 2DKUA 1AJ7L 2H26A 4IIQA 1VPOH 4GQPH 4WTZG 4MCYB 1CXEA 3MRLA 2OR9H 3FB6A 2Q8AL 4D9LH 2R0KH 2EE3A 1T04A 3FN3A 4PR5B 4C4KT 3EGSB 3ARPA 1HH6A 1RUAH 1MCWM 1RI8A 1JFQH 4HMEA 3NIDE 3E8UH 1OGAB 3KYNA 5DI8B 4Y5VB 3EYQD 4PJ5D 3I3BA 3ULUE 5FYKE 2DQFA 1WFNA 3X13A 1A4JA 2DM2A 4HW6A 5I18L 1VFAA 1KV3A 1I7UA 4Z5RA 3GDBA 5MEPB 1KJ2B 3W0WB 4EXPX 5FGBA 2GJ6D 1CVSC 2A9ML 1W8NA 1TFHA 5SX4H 4NJAH 2QQNH 4X9GA 2X4SB 3B2UD 4S2SA 4YLQT 3PP4H 5HI3D 2JE8A 4MNQB 25C8H 4GW5B 5D93C 4YWGL 3CLEH 2DMCA 4BZ1H 1ZKAA 1FGVL 3IF1B 5D93B 1WSST 2FBJH 3SDDB 5LGKA 4NBXB 2ZSWB 3KYKH 4R26L 4NQTA 2HTKC 4YZFE 1X5IA 1MFAH 1GC1C 4CGTA 2W60A 4AIXA 4HXBH 2XQYG 3X11A 1BQLL 3SE9L 2VAAB 1RMFL 3TYGH 1TZGL 5T1MB 4BJLA 5BVPL 3HC3H 5DJDA 1K6QH 1DLFL 4OUUA 4JPIB 1H0DB 4QO1A 2Q6WA 5MP6H 2I60L 3TJHC 4XAWL 2O5YL 2XOTA 3CDCA 5SX4I 25C8L 1ZLVK 2PCPB 3TJEH 2GJZA 3WIHL 4QRSB 1LK3L 5GJSH 5IIEB 2PXYA 4IRJC 3VXSB 1BHGA 3MROB 4PJBB 1I7RA 5GGVY 3S4SB 3RGVB 4XCCL 3BP4B 2O61B 1WIPA 1JNLL 4OB5L 2C3HA 1CFQB 3RGVC 2X9WA 3NN8A 4Y2DA 2MHAB 1J0HA 3GK8H 3WEXB 2EECA 1JUFB 3EO1B 1NC4D 1T3FA 3L3JA 4XP4H 5T3ZD 3HI1B 4KRNA 4LQ1A 1A22B 2IH3B 1LP9B 5DYOB 2HVKB 3PWVB 1K6QL 4LKCA 4UV4H 1R3HB 3WS3A 3O4LA 5BJTA 5I1JH 3IDMA 1JN6A 1A14H 4WCYH 3THMH 5CP3A 3RKDC 4OQ1A 3N9GH 3CUPA 4LDEB 4HGMA 2K7QA 4IOSD 3CC5B 1AGCA 1UACH 5IEHA 1HQ4A 1Z9MA 3FT4A 3PNWA 4NQXB 4IRJA 1AGFB 2ZUQB 4P46C 2NY0D 5SWZD 4OFYA 1FFOA 6FABL 4QRQA 3ARUA 5DVNA 2FL5A 2GK0B 3F62A 3L1OL 5ACZA 1HEZB 5B39B 5HTSA 3OKNB 1OF2A 4RWYL 5EFIA 5TE4L 1UJ3C 3D18B 4HS6A 3OJVC 5CMAB 4BZ1L 1UM4L 4XH2A 4GBXC 4JKLA 1MUJB 1TJGL 2NY7H 5GS1B 1PKOA 4OQTH 3REVB 2CKNA 4PJXB 4HK0A 4R2GC 2L7UA 1MHCA 4KQ4L 1M7IB 4M6NH 1MCEA 2Y07L 1G9MH 4JO4H 1AGEB 3TNNB 2P44B 3TPUB 3V2AR 3LH2L 2IEPA 2HN7B 4JR9L 4LARL 2VAJA 1RZIB 4YR6B 2EICA 1NEUA 1IE5A 3QXAB 4H25B 1RK0B 2BSSB 3D0VA 3FMGL 4PJIB 1LE9B 1FAIH 5CP7B 5MERB 4KDWA 3OBAA 3T4AA 4KUZL 1NKOA 4XTRD 4QGTA 1KCVH 1VCAA 1QYGL 3SEPA 1CXFA 3BEVA 4H26A 3CVHB 4M5YH 3SDYL 5T1DL 2VDOL 3I6LE 3QHFH 3S34L 2J3SA 4Q7DA 4F80A 1MCPH 1OQXA 2BZDA 2DRUA 3BP6A 4ELKA 2YUWA 2DMKA 2VZTA 1FPTH 3S88L 1JTPA 4UNUA 1CDBA 4XC1L 3S35L 1AFVH 2FATH 1QSFA 1A6ZB 4WO4B 1CICD 1N0XL 4ETYA 4KRPC 1RU9L 4WI8A 2R23A 4D9RD 3VDBA 5ALBH 3T3ME 2H3NA 4JY6B 4OZGB 4MNQA 4X7CC 4N0UE 3MNVB 1W72B 3G08B 1IKNA 3OAUL 4LASH 4PV9B 3PL6D 3ECBA 1QFUH 3ARDB 5EZJA 1A7QL 4RNRB 5IW6B 1BFOA 1XGTA 3K4AA 1J0JA 1QBBA 4Y8AA 3MREB 4D94A 3CXHK 5EZOL 4EUPG 3KLHD 3O2DH 4EEEA 1XT5A 1A4JB 4JQVA 5FYKU 2YUVA 4NN7C 4UTAL 3SGKC 3UP1A 1U6AH 3G9VA 3VFWA 4DGIH 2BNQE 1FVCB 5D96B 4HF5H 4AZ8A 2RQ8A 3LEVH 4JEGB 1NDMA 2NZIA 2V2TB 4GH7B 1F6AA 4K3EH 2X1WL 5IFHH 1M71B 1C7SA 1YA5A 4Q2ZA 2EXYC 3QUYC 5LWYL 4N1HB 3KXFB 2B1HL 3MUHL 4HUKB 4CVUA 2AJ3B 2HKFH 3HI5L 3CFKB 5L9DL 5EU4B 4UV7L 1OLZA 5I6XB 1UH3A 5DGRA 3JWDH 3PGDB 4DQOL 1AIFA 2YD1A 2BX5A 2P5EE 1VSCA 2ENSA 1TJIH 3GHBH 1JPGA 3IXAB 5EORL 4ODHL 2VR4A 4TUJB 5C08D 3O3EB 4X6BB 4EDXA 3FOMB 3MRCB 5JXEC 3WCYA 2BSRA 2BY1A 1HSAA 2C3VB 2VWEC 2XV6B 1G7HB 1YEDB 3PGCB 5BZWA 4FQXD 5FM5O 1H3XA 5MI0B 1E28B 1HXMB 5DJXA 5EZLA 4MXQD 1KF9B 2DQIL 3BUTA 1G6RA 2Q7YA 1ZK9A 1UC6A 3RGHA 1FNGA 4YFDB 1R3LB 3LEXA 1OM3H 2YMXL 3B3IA 4WW1A 2MFNA 3RDTD 3IGAB 3FONA 3UC0L 1NFDF 2FSEA 2HT2D 5DK3A 1O5DT 4G8FB 4QLRA 3SJVB 2YPLB 3FT3B 4JZJB 3T4YB 3BP6B 3OKEB 4YDKL 3F12B 1TPXB 2HT3D 3QQ9D 2R1YA 1FP5A 5GHWH 4PP1D 4DAGH 4Z78B 4MB5A 2R56H 3FTGA 4ZXBA 1MY5A 3UTOA 3I6KA 2XPGA 5DS8A 1MOEA 3TA3D 4BSVA 4UV4L 3BQUC 3MNWB 3UYRH 1FJ1B 2XN9B 4NRZB 2VJXA 1GGYA 3QDJA 3BVNB 3QUXB 3ARDD 4W81A 1IQDB 2B4CC 4XNMB 4UTAH 3V9FA 3FONB 3QUMH 2CLZA 4XPFL 2DQGL 3QPQC 1DLHA 5CJ8A 1NCBH 3V52L 2I9LB 3HLAB 4F7CA 3RDTB 2BRQA 4K3DH 1ZE3C 3S5LG 3T3PF 3MRDA 2Q3AA 2Q8BH 5HGHB 4ZG1A 1JGEA 2BSSA 2EYTA 1UCTA 3QUYD 2EXYD 4ZPVB 2VXVH 5FGRA 3DBXA 4N0RA 5IMKA 5TE6L 2EDWA 3NFSL 1JHKL 4R97B 5D7SL 1T66C 4O4YH 4F7MA 3T3PE 3IAGC 2W9DH 1Z0NA 1G6RH 4N0CD 2G9HA 5DRZB 5MEPA 3A67L 3MJ9H 1UKTA 4TULL 3OZ9H 1Q0XL 2MNUA 5F6HI 1KENH 2DQEL 3QUZD 3W11C 1MAML 1T7YA 2AI0L 3A6OA 2G9HB 1ZT7B 1VFUA 2PYEA 2ICEA 2XIDA 2GTWB 4XC3H 3DX8B 3EOTL 4HS6B 1FBIL 4PLKD 5JLZB 1J12A 1TTFA 1FVCA 1ZGLP 1JZ6A 3VD5A 1IGCH 4YBQD 5T5NF 1S3KH 4LLWB 4MHHI 4C54A 4HZLB 4H20H 4MJID 3RDTC 4S1SL 4K9EC 3JSSA 4HKZA 3RTQD 3IDYB 4F33A 3HE7D 1WZ1H 1D5XA 2D0GA 3SQOL 2GJ6E 3ARFC 2WNGA 1A4KB 4TUOB 4GQ9L 4RA3A 4AEHH 2NX5A 5CSZB 3B5GA 4DEPC 4XNXH 3T04D 3F7QA 2DQUL 4YZFF 2AGJL 3Q6GH 1L9NA 3CDGB 4DKEH 3D87B 3HR5A 1IEHA 4YXLH 1MI5E 2WIIA 1X5JA 1Z5LB 4FP8H 1CFNB 2JJSC 5IR1A 1FPTL 3O6FB 2ZPKL 1T21A 4Y2DD 1TQBB 5BO1H 2IAMA 5D7LA 4AIZA 5FAAA 5IFAL 5FUZL 4I1NB 4TPRH 1W72H 5I2IA 4O2EA 1MFEL 1XGYH 4LVNB 5CKGA 2Q7NA 5DHVB 1MVUA 2Z9TA 4RAVB 3LIZL 4HKJA 3UO1L 3ZL4L 4A6YL 3V79C 3LEXB 3L7EA 4PY8J 2KZ1B 2XTJE 3Q1SL 4ZFFA 3FJTA 5D96C 1GZQB 1LO2H 3ZDXE 5EU5B 3SE3A 4M7ZB 3AS0A 4EI6A 3CVHH 1A7OH 2OBGA 4PJGB 1I9JL 3VFTB 4NWTL 3MV9D 5E99L 4JGMA 5ILTH 3QEHA 2WV3A 3K4DA 2I9TA 2OTWB 1EHXA 2EYSB 4YEFA 3ZYJA 1B3JA 4FZEL 3O6FD 3BRGC 1ZSDA 3HS0A 3EIFA 2JCCB 1MHHA 3BKJH 4G9DB 2ATPB 1CLZH 3OKLB 1KYOK 1J8HE 4JFDB 3LSOA 4XMKL 2CKBB 5E2WL 1A2YB 1F45A 5HHVL 1CBVH 5B4MD 4OF5A 1U9KA 2WBJD 1JWSA 1J5OL 5D9SB 1IQWH 5I1KH 1CTNA 1IGJA 3DURA 3PHSA 1YDPA 5A3ID 1T80A 2QJDA 1GGTA 1FL5B 5IVZA 3UYOD 3IDNB 2WWKO 4WI4A 4DWHA 3KXFA 3WNKA 2FJGA 5EC1A 5IMMA 1OCWL 4TUOA 2F74A 1AO7B 2V2TA 1NFIB 2N7AA 3DX8A 5FUCE 2ATKA 2X1XR 4JHZA 5DJ8A 4WWKD 5HY9A 4OJFL 3IU3B 3DVFA 5EIIA 2AABH 3I3EA 1C12B 1S7XB 2R0ZH 1Y0LA 4H88H 4NN5C 4ONFH 5E4IA 1QP1A 1OVZA 2FNBA 4R4FH 32C2B 3H9ZA 1BEYH 4LEXL 3QCVL 5BVPH 5KBNC 4GAJH 1W0WA 5FA3B 4QHLB 2A6KB 4DFHA 2PTUA 3WE6A 4NWUH 4FQJL 4Q97A 2HVJB 4KK9C 3CC5A 1QUNA 4PJ9B 4OV5B 4NQSA 3Q5OA 3JV6A 5JW3L 4JAMA 1MJ8L 1WAAA 4J3VA 5IFAH 1ZHKB 1OCWH 4X6DF 5AUMB 4P2OB 3C6LD 4YBLC 1FDLL 2BFVL 4FHBD 2IAMD 3S98A 5FOJA 3EYSL 4P4KB 2IQAB 4PRPB 1BZ7B 4NM4H 4O2CA 4Y4FD 2HJFA 5DUMH 1NFDA 2GYSA 5DRXA 5ADOL 2EZ0D 1I1CA 2YC1B 2EDYA 2UVFA 4S1QH 4KMQA 1OD7A 3KPOA 4PP2B 3MV7A 4DCQB 2FO4B 1WK0A 1DEEA 1JHTA 4LIQH 3GI8L 1U8IB 4O5LH 1RUKL 2G5RA 1CL7I 3LKOB 4MX7B 5F6HJ 4B7IA 4CU6A 4WNQB 5EUOE 1JMZA 3RWFB 5CZVL 1TPXC 1OAXH 4WTZA 1U3YA 3OJDB 3WXWL 4JFFB 2BVPB 3JV4A 4OLXL 3QCTL 1KC5H 2V5SA 5KVEH 2YZ8A 4KZEL 2CDGB 1EEQA 4HEPG 3MLRL 2UUDK 4GRMA 1T7XA 1OTSD 4M62H 1IC4H 4NNYA 1KTLA 1U8LB 4GMTL 3IT8D 5DFWH 3B3IB 4BK5A 3FO2A 2Y6SC 1ZSDB 1E6OH 3IJSA 3VXRB 1ZA6A 3GSQA 3BIKB 2CRMA 5EBMA 3U4EA 5JZ7D 1G6RB 2VDQL 2DLTA 1YN6A 2BC4A 4WI7A 4PGBA 5CINL 4WRLA 4KXZI 4CW1A 3MLWL 5I18H 3L5JA 2NY6B 1F8TL 3NIFF 1YN6B 4QCIA 5H37H 1GZQA 4UQ2A 3MRBB 3BGMA 2NYYD 5D7SH 2CLRA 5M95B 4JFPB 1NC2D 4R8WL 5C08E 2DYPD 3ZKNC 2ZKHH 3LS4L 3BWAA 4JB9H 4OQTL 1U91B 3BGFC 2YRPA 1G84A 1DBAL 4JFEB 1IAOB 2ESVE 3GO1H 1MCQA 4ZUTB 2AW2A 4HH9B 5IEHB 1CD8A 4IS6A 4KY1H 4WFED 3H42H 2EEAA 2IALA 2E27H 2APVA 5KSAC 1FBIH 5E6ID 1CGVA 1Z5LA 4KXZH 4X9BA 5IWLC 2D7OA 2FECL 1LO0H 4NFBA 3VWJD 1ZHNA 1TZGH 2P7TB 4KK5D 4UBDD 1MF2L 4NZTH 5D4QA 3W82A 1CK0L 4DK6A 4L8CA 4ZXBD 3T0WA 1KB5L 1H3WM 4P2RB 2AXFB 4CL7A 4LGPB 1KJ2L 3TCLA 1QNZL 2CR3A 1GRWA 5DO2D 3HNSL 2H2SD 1H3GA 4N0UA 2IAND 4UT9L 5HHMB 3FQXB 4GS7C 1MQ8A 5D2LF 5D1XB 4HAFA 2O5XH 2BNRB 4X83A 1KJ3H 1RHHA 3K46A 1D6EA 3GI8H 1AXSA 1VHPA 4DZBA 4YE4L 4OV5A 4XBEH 1Z6JT 3HHRB 1FQ9C 3SO5A 2E9IA 1MCHA 1IM3B 3L9RA 5DQJB 3ILQC 3QNXA 5GXBB 2QLVB 3EYFA 4JRXE 4OCRL 3HCVB 4Z0BL 4B0MM 1F3JB 4QYOB 3TN0D 1EAJA 4Y19E 1MHEA 1MREH 3VXOA 1T7VA 2CUHA 2DWEB 1HH9A 1PYWA 3SBWC 4LLAA 3PQYD 3VFUA 1HWHB 4E42B 4PRPE 3O9WB 1AQDB 5FO7A 4KAQH 3KYAA 3DTXA 5C0EB 6FABH 1A7NH 4QRRD 1JPSH 3BN9C 5MHSE 7FABL 3MCG1 4LGRB 4D9LL 1VKXB 3CVHL 5EU3B 3TIDB 3GM0A 5D1XD 4HGWB 4LSUH 3VXPA 4OD3H 3GMPB 2KKQA 2I9LA 3D85A 1DBJL 4HF5L 1NGQH 2O5ZL 5F9WB 3T0BA 1R6VA 3KPRD 2DWDA 3ARBD 1ZLUH 3PXHA 4Z7UE 4JJ5A 1S9WA 4MYWB 4O9HH 5DQDH 1JGVH 1ZLSL 2PTVA 1FIEA 4KY1L 5TDPA 2XTLA 3GGWA 2AXGA 3MUY1 4QHMA 4OFDA 2C7UA 4RQQB 3WLWC 3DSNA 2ZUUA 1KPUB 3D39A 4KTYA 2BOCB 1M1SA 4NBZB 4PLKC 3IJSB 2D31B 3FQTA 2ZCLH 1T04B 5GS0D 3DV6B 4OIAA 5BV7H 3TLRA 5IT2L 3KPLB 3TN0C 1MH5B 3KLDA 4J1UA 4S10A 3S96B 4WU5B 1D3CA 5FM5M 3VMOA 1JNJA 3OKNA 3Q6FA 3QNZA 2SEBA 3WKNA 4MNGE 4ODVH 1BD2D 4LVEA 3WNLA 2XXMB 1URLA 2FATL 4NHUA 1SY6L 4FQLH 4EDWH 2WBWB 2RBLA 4LCWA 4OF6A 1N0XH 4X8XA 2YXFA 1II4E 4MD5A 1MCKA 1BLNA 3KPRB 2PNDA 2EO1A 1C1EH 4QHUA 2CXKA 5D2NB 3IDIB 4L4TB 3RAJH 3RL2B 1PG7H 3MA9H 1OD9A 2OP4L 3HAEH 2A6JA 3P11H 3QZWB 4Z7QE 3QDJE 5IF0A 4XMPH 1K9TA 4MMXC 1VACA 4JY5H 2VKXA 5CD3A 1H8OA 3BMWA 3UTTB 2MMXA 5EU6D 2X4QB 1KCVL 5TFSH 3LD8B 5I8CA 4XMPL 4QOKE 4PJHA 2PO6C 1RZ8B 5CSZA 3SE3C 3X3FL 2R4SH 3ZDXF 3N50A 1YEIL 4RCAA 2AJXH 5JW5A 4QRUB 3QIBB 3CFDB 3RIAK 3MLSL 3HMXA 1IAKA 4XT1C 1F6LL 4PGDA 2XKUA 3MR9B 2E9BA 4LLWA 2JIXB 1EHLH 4HFWB 1R24B 1EJ6A 1I9EA 4OFYD 1H5BB 3TP4A 5LBSH 2XZZA 4S1RL 3ROOB 4P5KB 5C09E 3VGEA 4AT6B 1NCBL 1GOFA 3V52H 3QQ9C 1QPPA 4YHYB 2YD2A 3MRIA 2DJSA 3G6JA 4LKXB 2F53E 5D5ME 2CQVA 3ALXA 4ZNCD 1I1YB 3SPVA 4P5MA 4NQCA 5DGQA 3GUTB 3C8HA 4U0RC 1AR2A 3CH1A 1NLBL 4OTXH 5EWIH 3ROLB 2ILLA 4GMTH 4CU8A 5E9DD 4HS8H 3DI2B 5HI3C 4URTB 4QY8A 2Q87A 3STLA 4N9OB 2YPVH 5HDLA 2AEIT 5DTFA 3FCTB 3U4AA 5GRVK 4Z7UF 3U46B 1NDGB 4KQ3L 2YRLA 3HE6C 1ZANH 3NH7L 5HI5D 1U8OB 5I71C 1FSKC 4MJIA 1UB6B 3GSXB 3MRMA 5HHNB 1D9KB 5IBTH 4F58H 1A3LL 4QRRE 5A43C 5E7FA 2VXTH 4X98A 1KIUA 4QHNB 5E8NA 4J2XA 4ZUWA 3LKPA 5F7NC 1J0ZA 3CLFL 3BZFA 1EZVX 4UTBH 3SGDH 3P77A 1YEEH 4J4PC 3E6HA 3TJHD 1XGUA 2PETA 4RRPG 3N1PC 4GKSA 3MXVH 4R0LC 5ETUB 3HE7A 3CFEB 1ZHNB 3TZVB 2Y5EA 3MJ7A 5E9DB 1SJEB 2BVUA 1RZFH 5T33H 3UPCA 2YD8A 2DQHL 4HKXB 4UDTA 1KB9J 2RIKA 4PJAF 3MV8A 4WU7A 2CIKA 5GPRA 2Y07H 3GSUB 3LHPH 2XZQH 3QT2A 4D3CH 1TVBA 3VGHA 1UWEH 1FFRA 3EAKA 2FX8H 4WEBH 5CGYC 3B9KB 3U9PL 5FA4A 4APQC 2VLRA 2P43B 5CILL 3WFEH 4EUPH 1DUYA 4PD4J 2PR4H 1Y6NR 4OLWH 1PKQA 1OP9A 3FMGH 4HH8A 3ZO0A 3PWUA 4KMTH 2Q7YB 4H0HB 4W6WB 3JZ7A 5LWYH 1JRHI 4WHTB 4MMZC 3NZ8B 3QDJD 3WKMH 5IVOA 3PGCA 5I76A 5HPMA 1U8JB 4KTEL 1BECA 1DQQB 3ZYIA 1HNGA 5J9PA 5EUKA 2XZQL 4GKZA 4TVPD 1TETL 2NXYB 5K9KA 3VWJA 1G7PB 3MOQA 4Z77A 2X4QA 3PV6B 4GKNB 4XVSH 1CGSH 5I1HH 2C1PB 3O3AA 4YHNB 5DJ2A 4M9OA 5TQ2H 1KLUB 5A1AA 2P8PA 4U1NB 2IFGA 3ZKMD 3TZVD 1A6VH 3HZYB 4DZ8B 1RVFL 1EPFA 3SKUD 1HE7A 5E03A 4P4KC 1YMHA 3RY6A 5GS1C 3GI9H 2ADJB 5C0AD 3MYZA 3O4LE 3ULVD 3N1MC 4FN0A 3HPJB 1ZAGA 1RUPL 5HSFA 4L3AA 1ED3B 4UDUB 2F54E 5A2KH 1AHWB 1NC2A 3QDME 4QWWC 1GIGL 2E8ZA 3H9SB 5L8LB 5KSAA 2FRGP 1J11A 2BY0A 3LS5H 4X5WB 2ZCKH 3C5SB 4GRWF 1D9KD 1MH5A 1ZANL 3NH7H 2FHCA 3WFBH 4YX2H 3Q0HA 1CDHA 1D5ZB 3B6SB 5GSRA 4YHNA 3WO3B 4DW2L 2Y23A 3H2WA 2I26N 1XGTB 2OJZL 2HRLA 4R26H 1F58H 3O2VH 2I25N 3E2HC 3GMOA 5C08A 2EDLA 3FN0H 4C56A 3HB3D 2DN7A 4HUXA 4XHQA 4M7JL 1I3GH 5DO2C 3WNNA 2Q20A 3RZCA 2DBLH 5I8OH 4ENED 1MPAL 1Y18A 1Q1JH 2CO7B 3SDAB 1OW0A 1KIPA 3FQWB 3MV7E 3CSGA 5CJ5A 1ZLWK 5C2UB 2B8OT 1MFDH 3QDMA 2YUZA 1C7TA 2IPUK 1GVIA 4FZ8H 1H15A 3OMZA 3MNWA 4ODSL 1K5NA 1QEWA 2W92A 4RMUA 3RY5A 3QO1B 3OB8A 3SGKA 3CMOH 5DLMH 3WN5C 3FO1A 5BRZB 4YHLH 1DN2A 2Q8BL 3O3DB 3RFZC 4HQQL 5CD3B 3SJVE 1MQKH 3QYCA 1DZBA 1P1ZB 1ODAA 3T8XB 3KGRA 4N8VB 3EHBD 4X99A 4WEMB 5KANI 3ARYA 4LLDB 1TZHA 4X80L 5J12C 3RX5A 1FZOB 1I4FB 1Q1JL 2GCYB 5J7CC 3VFPA 2HMIC 2R1XB 5IHBA 2NW2A 3EYFB 4U6YA 1BOGA 5J1SC 2ESVD 3VXNB 3L9RB 1YMMA 4LNRB 4OFIA 3QXAA 4K71B 4PJHF 1WWAX 4HC1L 4PJFF 4D9QE 3SDDD 1TXKA 1FNGB 3MLZL 4N0YL 1CT8B 1DVFB 5KOMC 4G8GB 1S7VB 4PP1C 5F8QC 4EI5A 2BNQD 1CTOA 3C5SA 4AL8H 1Q9OA 2DAVA 4W4OA 2NTFB 4OCNC 3U4BH 4RIRB 3D2UB 5BZDB 1TENA 3IFNL 5KVDL 5JHLL 3O2DL 1CE1H 2VDML 3SCMA 1NJ9B 3T0VA 4NFDA 4LLYA 4X9IA 2F8OA 4JFDE 4Z0XB 4P2RA 4ONHA 3EOBB 1I3RB 4LSQL 3J8F7 3STLB 5DDHB 4LP5A 5TPWL 2JK5B 4JB9L 3C6LA 3CDFA 3H7LA 2W1NA 1U8LA 2WLZA 1G7QA 3VH8A 1DBAH 3GSNB 1YEHH 3EDDA 3BH8B 3ARFB 1Q9LA 4L29A 5D71H 3AS2A 5J12B 5FHAH 3FB5B 2C1OB 5EZIL 2DQUH 4Y5VC 2XWBB 4JPWH 5B22A 3P4OB 5D7JA 3MLXH 1BMGA 2EDNA 3DARA 3SO3C 1QSEE 4ORZC 1W8OA 4Z7UA 3BXNA 2ICWJ 1SJHA 3IU4H 3MLTB 2J8UA 4YK4B 3HZYA 5E7BA 5FKPB 3O6FA 4WJ5A 3F58L 3MV9E 3PWPA 4P23D 2AJVH 3MLUH 2HLFC 4LHJB 1RMFH 2IBZY 4PRNB 3IAPA 4U1SA 4JQVC 3BUYB 3S37H 2IH3A 4IOFC 1J1PL 4KRPB 4OJFH 1G7PA 5FEBA 1A3QA 2YC1A 4TTDC 3DECA 4UIMA 1MFAL 1MRCH 3TA3B 2K1MA 5DMKB 1W72A 3WJLA 3SCMC 1KTDA 3UC0H 2EE6A 2W9EH 2M1KA 5CZVH 3FN9A 5CJOH 3P9MA 4XZUB 5ITBH 3WJJA 1C08A 5F3BB 4CMMB 3CMOL 5JOEA 5MEOA 1PG7L 3P73B 3PDGA 4PJAA 2UY6A 2GT9A 1OAYH 1MFNA 3V4UL 5K9QG 1CFTA 3TCLB 1A3RH 1W0WB 4OBSA 4PGEB 5AAWA 5C9KA 4JPVL 2AXFA 1KN2L 2DLFL 3QXDA 1A64A 1ZT4B 3FKUS 2X10A 3RUGE 2F53D 3MLSH 1NMCC 3G04A 4R6UA 4TOYL 5TQ0H 3TO4C 4JM2A 4KI5D 1TQCC 5ADOH 3MRNA 1FVDA 3RU8L 3G5YB 4MSWA 4Y5XB 3R1GL 4GG8A 3HNTL 4ZS6C 3WFCH 2DD8L 2HTLC 1UQSB 2DYPB 3QUML 4XPFH 4WW2C 1KLGA 1UM5H 4Y1AE 2Y7QB 3U0WH 4E5XB 4LVOB 1WQVT 1JHTB 3QG6A 4KVNL 4JVUA 4QKXB 1NCDL 4TTDD 3QXDB 4Y5YC 1DBJH 5C8JA 2JLLA 3ZSTA 1CICB 2HN7A 2VLKE 1NGWA 5T1KA 1KJ2A 4O2CB 4GUPA 5I1CH 4OZFH 5HHQB 5INDB 1YECH 1F4YL 5H2BA 3K81A 5JA8B 3IETA 1MHHB 4LLVB 1HCVA 4PJXA 1KLFA 3ZLQC 3ET9F 5D5MA 2HLAB 2VH5L 1PX4A 4KRMB 2WWKT 1S7WB 3L3KB 1IM9B 1F4XL 1XEDA 5H94B 5J06A 2BC4B 1IGIH 2NTSP 4PR5A 5FYJE 3LH2H 4ZFFB 1NGXB 2FR4B 4GW1B 3BO8B 1ONQB 4NQDE 2YD5A 5JTWA 4MNHA 5AAMA 1E4JA 1C12A 1F4HA 3C9NB 3RI5F 3T1FB 5FKPA 1F5WA 1RZJC 2NW3A 5ANMB 3GSRB 1CZ8H 3QIBA 5IUSA 5E2WH 2YHGA 3I2CL 2FECI 3QUYA 1CFVL 1S7SA 5C07E 4FTVB 5IB2B 4XAWH 1Q72L 4PJBF 4PJFB 3PHOB 4B50A 1LD9B 4H0IA 2P5WD 4XXDB 3GMRB 4OLUH 1U42A 4OLZH 1NFDE 2NXZD 1VADB 2NY3D 3GSVB 4LKCB 4M00A 4IDJH 4DZ8A 3ZE2E 2Z35B 1U8NA 2Q76A 2GJJA 4KZEH 3WEXA 1LMKA 2NY1C 1X7QA 5ICXA 2BXZA 1I3RA 3RAJL 3S9DB 4Y16C 4LSPL 4MD5B 3MRKB 4IRSB 4Y16B 4LCWB 1S7UA 2HFEB 1CFVH 2FX8L 4JFQB 1YC7A 4ONGH 1D5MB 5E2UL 3QHTC 4BSWA 1VACB 3GHEH 5JR1H 4H26B 3AU1A 4LASL 2A74B 4FP8L 3CSPA 1OP5H 3JWOH 4WI3A 4S1DC 5FHBL 3VFOA 3F5WB 4BM7A 4Q9CA 4KJYB 2Y72A 1R5WB 5KSBB 2VLRB 1PKQE 4M7LT 4MJ6A 1BX2B 3MLYL 3ARWA 4OZ4B 5FYLL 5I30H 3VFWB 3L7FB 3BE1L 5CLWA 2I27N 4EI5B 5C0FA 1XIWB 2CSPA 3TPUA 3RA7H 4L1HA 5BXFB 4PJ7F 4PY8I 2NZ9D 1YUHA 3BOVA 1VENA 1FYTB 4ZUSB 3U0TB 4HUUB 2D31A 5GS2D 1CXLA 3AREB 3QXTA 4X7EC 4AL8L 2NY6D 4P4KD 4XP5H 3HG1A 5EC2B 2XG5A 2PO6D 4RIRA 4KPHL 1X5LA 4O9HL 1QEWB 2DYPA 4KVNH 1I1AB 2NY0C 4NIKB 5EU7C 1HQRB 3OF6D 1IEBA 1MIML 4LHUB 1KXQE 5MENA 3O2WH 3MSPA 3FZUD 4Y88A 1S5IL 4BSJA 5BXFA 3IS1X 5DQ9A 1GIGH 4HK3N 3L7FA 4KJPC 1MCBA 4YDIH 5JPNB 5ESVB 1YZZA 1EVTC 4D8PA 3QNXB 2R1XA 4JO4L 2ZKHL 5AWNL 4LSSH 3RJDA 1NCUA 4I18B 4K94L 3VU2A 3H3BC 2DQHH 2J4WH 2EE2A 4OZGF 1A6AA 3MRHA 3N06B 4W4NA 2IF7A 5LG1A 4CKVX 4B41A 4FG6D 1OSZB 5BJTB 4Y4KD 4NC1E 2IPKB 2BNRA 1KTDB 1TQCB 4ODSH 2VLRE 3H9HA 4OI9A 3U79A 3BYYA 1B4JH 3DYMA 5DMKA 2ZJSH 5BS0A 3HG1D 3GMOB 3V4VH 1A21A 2Q86B 2R2BB 5AZEH 1ERNA 3S36L 1DN0A 4QXTB 3ULVF 5DRWA 4XP1L 5E2JA 5J6HA 4JN1H 4MCZA 1T4KA 4ZAKC 1KB5H 4QRPA 1JGEB 3X14B 3DX6B 3DUSB 1WFTA 4RGMB 1ZHLB 5F1KC 4YJZL 3T0ED 5L8JB 5F88B 2GY7B 4ORGA 1WUNT 4J3WA 1PEZA 2XQBH 2YK1L 1BZ9A 3UO1H 3WYRA 2ADGA 3TBWA 1LD9A 3BZEA 1CDJA 1XGRA 1WFOA 4BFGA 5E6IA 1SYVB 5E6YA 4F7TB 2V7NA 3MA7B 4GLRI 5DZNA 2I07B 2BNRE 4OZFA 3SDCA 4YQXH 3GMLB 3C5ZA 4PRAB 4K9EL 3OKOA 5K33A 4OKDA 1TTUA 3F6LA 3V5KA 2GITB 3O4OB 2LVCA 3P4LA 3ALWA 2FJFA 5I8CB 1AIFB 1T03H 5B3NA 1HCFX 2D3VA 1NMCB 4NO3B 1QLFB 4XB8A 1QVOB 4YIQA 2VLJB 1FH5H 2VC2H 2DF3A 3RU8H 3MXWH 4ISVB 2W59A 5JLZA 3JTSA 4YC2C 4JN2A 3I75A 3UTPE 2RGSA 5C2BL 5IOPB 3B9KD 2E7LA 4P3CH 1X5FA 1SEQH 5DF0A 3HG1B 5EC2A 4WGWB 3EOAB 4FFWD 3WL9A 1DFBH 4I9WE 2R69L 1VGKA 2NLJB 3RY6C 1KEGL 4PTTA 4YQXL 5C0AA 1IGJB 3DURB 2B2XH 5CEYA 2FR4A 5J8OA 1NAMA 5FYJU 1GYAA 2AV1A 5JIPA 4E41B 1LGVA 1UXSA 5F9WC 4NC1C 2QEJA 2QQKH 4BQ8A 2OS7A 3RTQC 4I2XE 1RJYB 4GRLA 1LK2B 1C5CH 3CVIH 1GGIH 4H88L 4ONFL 1XGUB 3VFPB 1HILB 4I3SL 2BVOB 3WDIA 4NRXB 4PD4K 5GQBA 2I9TB 5EOTB 1TDQA 1HOCB 3QZWG 1DCLA 3KDMB 5B38B 1CL7H 2OL3H 5I15H 5F3HB 3WN5A 5AZEL 4I3SH 4IRJD 5C70A 1XH3B 1FVDB 2DM4A 4Z7WE 4YFLI 4MJIB 3L7EB 4OUUB 2AJ3A 4K23H 1G9ML 4JRYE 4M8QA 1FL6A 1I7TB 1G7MB 4IOFD 2EZ0C 2CDGA 2YA1A 3UTTD 5E1AB 1WT5A 5ENWA 4FMFA 2V7NB 1RZFL 3MA7A 3TIEA 5DTFB 2A9MH 3I2CH 3MRKA 2BVPA 4FQHB 3BP5A 4J3TA 1YEGL 4M4RA 4NKOB 2R9HC 5GGQH 3W39B 15C8H 5IGXL 4OM1H 4TVSa 4LSVL 5EU6B 5IFJB 1MAJA 1EFXA 2G60L 2CGRL 3UDWC 5A16A 1UXWB 4CRPA 3JTTB 2FO4A 1EA9C 1MJUL 5AEAA 3S3JA 2NY5H 2V9QA 1W0VB 3MRFB 5L2KD 5EN2B 1IKFH 1A0QL 2HVJA 4M7LL 2XFXB 1NSNH 5J13B 5K9JH 1GCFA 1WBYB 5EZJB 2LU7A 5C0BB 5F1OB 2KQNA 4V1DE 1XCTA 1J8HB 2GQHA 1JYVA 2F53B 4N8CH 5GS3A 4CMMA 3WBDA 3HC3L 3QIUC 3Q5YA 5CJBA 4KTEH 4MS8C 1QOKA 3QI9C 4PREB 4HUNB 2YPVL 1GXEA 5DJ0A 4MA1B 1H3PH 3IU3A 2F53A 4ODXB 4KVCH 3TA3C 3FT2A 4TTGA 3MLZH 3OXRA 4KK8D 4NKDB 2EKSB 4JFXB 1UM5L 5IOPA 4MJ2A 5T1LD 4HG4K 1A14L 4WCYL 3THML 1DL7H 5IHLB 3LN5B 1JL8A 1NMBH 1OF2B 5JOPE 3EJYC 2AEPL 2HT3C 3BT2H 4BA8A 1FL5A 2NXYC 5EU7E 3DVGB 1ADQH 3WLBA 5D1ZD 1NUNB 4PJ7A 3PGDA 4P2YA 1DBBL 1QSVA 1NGPL 5MENB 4Z8FL 3RKDD 3FHAA 1IGYA 2OSLB 4PJHB 2VZ1A 1TQBC 2OZ4L 1IQWL 5DHYB 4EXKA 1QFWL 5I1KL 2JELL 5E1AA 2BVOA 2DJ4A 5DMIL 2VYRE 1Y6KR 1A1OB 1MFDL 4NN7B 2DKMA 3PWPD 1BQLH 1RIVH 5JUEH 3FRUA 5DHXB 2RR3A 4HJJL 3NIDF 2A77H 2VIRA 1WBZA 4X8JA 5BOZG 3KPLA 4OFKA 4F7EB 2LE9A 4HIEA 3D0LA 2V9TA 1FZMB 1NAKL 4HPYH 5CEZL 4I0PB 3R0NA 2JJSA 2NY5C 3TBSB 3RNQA 2X89A 2OP4H 3ULVH 3FQRA 3LPFA 3DGCR 3MZTA 3U7YL 2XRAL 1JGLL 5HYSG 5I8KH 3F5WA 2ERJB 4OLWL 2XTJC 5SV4A 1M7XA 3UTZA 3PJSA 4DW2H 3GIVB 3SKMB 3DX7A 3DO7A 3QISA 1N64H 4ERSL 3T8XA 1N7MH 2A83B 5ISZB 5E4EB 3D39E 3QUMA 2VWEE 4ZXBB 3FTGB 4ETQA 1OQOA 4P2RD 4PGCB 2HFEA 1NCTA 2AQ1A 1HIML 4HLJA 3L3IB 4Y19A 4WW2A 2XA8H 3LKNB 4JFOB 2OR7A 5T3ZE 3WJLC 2ZJSL 3DMMD 1PSKH 3IRPX 3GGWB 3IB4A 4G8FA 5E6IB 2GW5A 5GS0H 2QSVA 4XCCH 1MFCH 1S9WB 2RFXA 2MCG1 2EEBA 3F8UB 2OLDA 1X5ZA 3PWPB 4Y2DC 3NMEA 2VLLB 1FCCA 2UZXB 4ERSH 1U3ZA 1EFQA 3C2AH 1J8HD 2EH7H 2MHAA 3B2VL 5E2TH 5TDPB 2VSDA 1FGNL 4V2CB 1INEL 3QDMB 5SX5K 1YY8A 1BIIB 5LGHL 1JPSL 1PG7W 5A16B 4PG9B 4M1CC 1IMHC 2WM0A 1T5WB 3EUUA 5IFHL 4HZLA 1WF5A 1DQJB 3L3GB 1Q9LB 2DKSA 1TVHA 4L29B 2VRAA 2VO5A 4HC1H 3TC9A 1KFAL 5DEGA 4BFBD 2FH6A 2F54A 4G43B 5C7XL 4K3GA 1MNUL 3EOTH 3UTSD 1EMTH 5FO8A 5EU3A 2B5IB 1RJLB 3JVGC 4U3CA 4GSDL 4MWFA 4U6XA 5CEZE 1LDSA 1RURL 4KJYA 4R7NB 4G9FD 3BI9X 4ZUUB 5AYUH 1GJIA 1R5IB 2ADJA 4MLIA 3QIBC 1KENL 2YWYA 1YY9C 3KPNB 5LCVL 1GH7A 4DGIL 4KROD 2CKBL 3X11B 5HVFB 3LQZB 2IFFH 3QEQB 2CR6A 4YHPA 5KSUA 5LJYH 4QRUA 1RJZB 2A1WL 3OR6A 1LP9F 1U3HA 5I1IH 1YEEL 1TTGA 1S7VA 1OHQA 4HWNA 5CGTA 1T0MB 4C56D 3P0YH 4KHTH 2AGJH 2D0FA 3U82B 3DXAA 4GKZB 5AG9A 1BJ1J 2XY2A 1L0XA 1U8PA 4KKLD 3G6DH 2VXTL 1T20A 5KVGH 2V5YA 3ARZA 5D2NC 1BOYA 1I8IA 3NCBB 1FDLH 3CLFH 2Z31B 1YEJH 1NC4B 4QWWD 3E2HB 1RFDH 3IDNA 3TVMA 3VXQB 2PYEE 1S9XA 4FFVD 2VISB 3RBGA 1ACZA 1AGDB 4U05A 3IDXH 3ARGB 3S5LA 2GHWB 4RFEA 4G6MH 3KYMB 4JM2B 4RGNC 1T0NB 4Y4HB 3V6ZB 1EGJA 2DMBA 1GOHA 4IMKC 3PHOA 1QYGH 3EYVB 4APQD 1J8KA 3JUYA 1FFNB 1MSPA 2OR8A 4YX2L 4PJEA 1MFBH 2FX9L 4JFOA 4I77L 3LB6C 5ACMA 3RZWA 3DSFH 3HB3C 3QPQD 1T1WB 2ICCA 4P46D 3RQ3A 3BJ91 3OAYH 1RZKC 3EW3B 4KHXH 2HFGH 4YPGA 5EBWB 3OAZH 2R1YB 2BY2A 4OKVB 5LAXA 4TOYH 3DX7B 4LPCA 1QRND 1KIRA 4U7SA 3EYVA 4FFZL 3UJJH 1HHJB 1S7UB 3ZE2F 4Q0XH 3FFDA 5CHNA 2FGWL 1G9MC 4NCC2 3MRCA 2KQMA 5I2IB 3U4EB 4KC3B 5E8PA 4YGVA 1AQKL 5I1DB 3D0LB 1WWBX 1BVKA 4PJDA 3TZVA 3ZYOA 2EDFA 3QUZC 4L8SA 1HKFA 4U7MA 4W6YB 5AYUL 2OL3A 2QBWA 3P4NB 3HRZB 4XPTH 1E28A 1HXMA 3IXTA 5DJXB 4P2CG 4R9HA 5SX5H 1J1OH 3A0OA 2VE6A 1IGMH 3UTSB 1K8DA 2VXSL 1V3JA 1QO3B 3CFBA 5E24E 3L3HA 2EIEA 2AKRB 2AK1L 4KKAC 5FOBA 1JZ8A 3MRJA 4K7FB 2MWCA 5FUOH 4OGYH 3VRLF 5TF1H 5AZ2H 5BRZD 4LQFH 4FRWA 4XNYH 1C5BH 1A5FH 5GRYA 3SOBH 1NL0L 3L95A 3OGOE 4LF3B 3PP4L 1HKLL 3W2DH 3HUJB 3U46A 5GS2H 4NGHH 4G6KH 3KYOB 4AT6A 2KH2B 1MCWW 1RZKL 4JHWH 5CBEB 1HYRC 2ID5A 2X4TA 1LWRA 3VGAC 2FEDC 1F4WH 2A6KA 3W9EA 3FT4B 5J9PB 1U2HA 5FA3A 4WDIA 2YMXH 3B9DA 4NNXA 1DQTA 3N85H 1G7JA 3KXFE 3PL6A 2X7LA 1ZHKA 4JFZL 4KKBC 2ZCLL 5J6HB 5IK3B 2NXZB 4QHKI 3MXVL 3ZMRA 3VJ6A 2YA0A 2KUTA 4UT6H 3ZZ1A 4OV6F 5HHPA 2CDFA 3ETBF 4UB0H 1CICA 5HYEA 4L3EB 4R7DA 2HRPH 4UIMB 1BZ7A 5KN5A 3NN8B 4HFWA 1OAQH 1VFOA 2R9HD 3LCYA 3E6FB 1E27A 3MR9A 4F15C 5IG7A 4BELD 3P4MB 1CDIA 1A6AB 3MRHB 4JO3L 4R3SB 2FX9H 4MD0A 1S5HB 4IIQC 3RUGB 4NQSB 4LLQB 3V8OA 4ODWB 3VD4A 3WHE0 1D7FA 4I0PD 2V7HA 3EZ8A 5DSCA 3MNZB 3BXNB 1KGCD 3LKNA 4H0GA 3WUZA 2E6PA 1QQDA 2I5YL 5KS9F 4OGAC 2HH0H 4Z76A 2XACC 2Y4SA 3MC0A 4JQXC 3C09C 3P0VL 2A2QT 2FX7L 4JRWA 3EOYG 4ZSOE 4OZFG 4HUMB 4K8RL 4EI6B 2APTA 1IVLA 4RMVA 2XQYK 5E6IC 3QZWA 3QCTH 1DQLH 1NBYB 1IGTA 2AQ2A 3QQ3A 3UEZA 4NUGL 5GZOC 1R0AH 3MZGB 4YHML 1WZKA 2ATPA 5L0QB 5HHNA 4KK8C 2NY2B 3GBLA 4JFQA 4O02L 4OCRH 4Z0BH 1QFOA 1TCRB 5HVGB 4PGBB 1FNSL 1EJOL 1QO3A 1FV1A 1HSBB 2AXJA 1CR9L 3QH3B 3RVXC 2H2SC 1QPXA 5A2FA 4HT1H 5JO5A 5ILTL 1GGBL 3KJ6L 4YXKH 1T0NA 1EJOH 4PJHE 4I3GA 3CMGA 2DWDB 3KPTA 2MJWA 2Q1EA 5AYQA 5E5RB 4LSQH 3ARED 3BN3B 4XCNB 3ILPA 1P2CA 4PRDA 4POZD 4N90E 5TGBA 4CUCA 1QBML 1NBVL 2R2HA 5GGRY 5C7XH 1N4XL 3W0WE 2C7UB 4RQQA 3TO4A 3V0AC 4KJQD 4MDIB 3FFCA 1ZS8B 3MFFB 4Z7WA 4P0DA 4PLNC 1QFWM 2A0LD 4FTVD 4PYGA 3O9WA 3ZTNL 3AU1B 1WBXB 2DL2A 4N8VA 3FB7A 5H8DA 2CRIA 3KJ4B 4IRSC 4MAYC 3IFLH 2P47B 3NFPA 1A7RL 4YXHL 2DTML 4PS4L 4L8BB 3TH4T 4HWEL 1RFDL 3DV4A 1U95A 4HUVA 3O3BA 5A3IC 4HIIA 2X4OB 1GHFH 5EUOF 3NPSC 1ZS8A 5DEFB 4OM1L 3MLXL 3NZ8A 2BHZA 1BJ8A 4QHKJ 4HKZB 4MNQE 4NM4L 5E2VH 3BZEB 2LU4A 5F7HA 5CAYB 2DWEA 2P8LB 4RX4A 2AERT 4UINL 3CAFA 3EHBC 2APFA 4EVNB 5BQ7A 2Z31A 1XCTB 3UPRB 5J3HD 2XN9E 2PXYD 1CGYA 2CH8A 2GEEA 3LRHA 5F9JB 5FFLA 2CMRH 1AFVL 1HN1A 2FIKB 2GTWA 5B21A 3TT1H 2IQ9H 1A1MB 4M7KL 4UILH 3RVWC 1CE6A 1T03L 1D6EB 1LK3H 5CCKH 2H8PB 3HE6B 1G6VK 4KK6C 1UGNA 1RULL 5GGSB 1CD1B 1XGPB 1J7VR 1BFSA 2YK1H 2EYTB 3GSNL 4LSTH 1G0YR 3W39A 4ZAKB 3VCLB 1MWAH 1TJHH 2ZP0T 3T2NH 1GPOL 3BWUC 1B0GB 1J05B 2N1KA 4P9HL 5GRWA 1U58A 1FYHB 4M62L 2D7TH 3OKKB 1UJ3A 4KMTL 3QUXD 4GJTB 1G7MA 4MA3A 3TBTA 2ERJC 4GMSH 3SE8L 4DGYH 1OAUH 2VE6B 1UKQA 1NCWL 3PIQA 1S9YA 5E8OB 3UBXI 4WY7L 1I9RH 2CIIA 2IWGA 4N1CA 1LO4H 1KTKE 4HIJA 4ELKB 4G8EA 4MQXC 2OL3B 1P7KA 3BW9A 2IPTH 4JKPH 4XP9H 4ZTPH 4O4YL 4Z6AT 1E4XL 1MJJA 4HV8B 2DI8A 1P5VA 2CLRB 4I8DA 5JQ6H 5FDWB 2EC9T 3L3DA 3G5ZB 3JWOC 4HT1L 4XNUH 3SJVD 2JELH 4FQQB 4ZFGL 1Y18B 5HHOD 1DFBL 4ZS7H 4B7LA 3OGCA 2A0LC 5HHVH 4O51A 4X7SH 4GRWE 5HHME 4OLVH 4YBLB 3TN0B 5H35B 5KSAD 1BF2A 3RNQB 1BVLB 3VE0B 2VABA 2DIAA 4WV1C 1J10A 1TIUA 2XA3A 1FFPB 3HMWH 3PL6B 5ADPH 3KR3H 4RAHA 4JFED 1LEKA 3WL9B 3REWA 4BH7A 1KJ2H 1N5AA 3VFNB 1EDQA 1F4YH 3QH3A 1SJHB 4S1DD 1N5YL 4OZ4A 1H8SA 4KRLB 4NZJA 2V2WA 4KUCF 4PGCA 4CADA 1MF2H 4NO0D 5E08L 4PRIA 3F7VA 5ID1B 5BV7B 1FO0A 4H1LA 3D18A 1IAKB 3BH8A 1CIDA 5FYJH 5F44A 1YEJL 5L2JA 4LMQI 1G7HA 4JDZB 3V0VB 5EU4A 5C09D 1OARH 3O6LL 2WBKA 1SYVA 4XP4L 2OI9C 3OKKA 1U8KA 1E4KC 1PBYA 4UAOB 1AGFA 3CFBB 1T83A 3PF2A 2EDRA 4ZYKB 4ZUWB 4L8DA 1RY7B 4MAUL 3LOWA 5I19H 2D4FA 1QLEH 5IV2B 2CRYA 3DX6A 1IARB 1WCBA 2QHRL 5D7KE 3TBVA 2BSRB 3WXVL 3QFJA 3BDYL 3N1GC 3OR7A 4XPAH 1R3IL 3GSWA 4PB0H 5C92A 43C9B 4LFHG 2MQ3A 4D0CA 2LAGB 4NUJA 4PBVC 4U1IA 3MV8D 2H32H 1IGFL 2C1OA 1UCBL 4Q9BA 3LQMA 3UBXG 4CJ1A 5I75C 3NIGF 1A7OL 3VW3L 4QOKD 2VDQH 4MZ3A 4PJXE 3HZVB 3QBTB 4AY0A 4A2MA 3KHQA 1N6QH 3SPVB 2AJUH 3ZHLA 2EXWC 2AXHA 3QWOB 4LKXA 1GZPB 5IFJA 1SM3L 4NO2A 4QRSA 2ATKB 1ONQA 1BAFL 3VXME 4NSKB 1K4CB 2FWOA 2AK1H 3RWGB 3LMJH 4ZOAA 4HWUA 2VMFA 3UAJC 2D4DA 5MEND 3H7BB 4HUWB 4HBCH 1KYOJ 1IGML 3VFRB 4ODXA 3W81A 5T1MA 3DETC 4PBXA 4X5XB 5EWIL 4BZ2H 3WIIL 5K9OB 2A6IB 2W9DL 4RX4D 2EDTA 1UWGH 4KJPD 4P5TA 4EBQL 1IQDA 4XNMA 1NKRA 3D85B 3QFDA 4TVPE 4NKIH 2LV4A 1LE5B 1B4RA 1EBAA 4Z9KB 2XI9A 3DUHA 5EA0H 5LVEA 4G8EB 4HUXB 4XWGH 1PZ5A 4H8WH 2X9YA 4CNIB 3ULUL 3BGFB 2R0KL 1FG9C 3H9SD 2ED7A 2VLMD 1YDPB 3N85L 1JNNL 4ZQKA 1I1FB 5CUSL 4X7DC 1SVZA 3MJ6A 4NQEB 4YFLF 3P30L 5JIHA 1CGWA 5FK9B 4W68A 1Q0YH 3L5HA 4LAQL 4HJ0D 4TQEL 3QO0A 4JFDA 3QDGE 3T0XA 1GAFH 1HIMH 1KNOB 2ZG1A 3K2UL 4LLUA 4RBPK 3BRDA 1ES0A 2CDEB 3AVEA 2AK4B 2PTTB 4MQ7B 3GKWH 2P8MA 2VQ1B 3QEUB 5E8PB 1CYGA 1GGCH 1N8ZA 3MRNB 1KUMA 4M93C 3IFLL 4XNQB 2VDNH 5DURB 2BDNH 4M43H 2E7LC 1LO0L 2FYYA 3TFKC 3H9YA 4WW1B 5F96H 1ZGLB 1KPVB 3I50H 4OT1L 4M7ZC 4OGAD 4GAJL 4MXWL 2NY3B 3MFGB 3IDGA 5LAXB 4WFFD 4MVBD 1NGYB 5FYJD 4JLRB 1QLRA 2YOCA 3QDGD 1DQML 1T1YB 3WSQL 3IDYC 3LEYL 5JZ7C 4W4OC 2UV3A 3MO1A 1WTGT 1M6OA 5HDBE 1XR9A 4JQIL 1MI5D 3O9WD 4Q9QL 3BEWB 1OSPH 3H3PH 4YR6A 5DC0A 4H8WC 1DQQA 5HYJD 4LCYA 2B39A 4X8JB 3BDYH 3MV8E 4YDLB 2I07A 5C07D 1AE6H 3CX5K 4NZRH 4S1QL 1DBBH 2NNAB 5GZOD 2ADIA 2A73B 4NQVB 3H3PL 1KPRA 1VADA 4TSBL 2NZ9C 4HBCL 4WY7H 3HR5B 5C09B 2DQDL 1R5VB 3B9KC 3SDXB 5CIPA 1DQDH 1CDYA 5LCVH 1CDCA 5IBUG 4ZTPL 1KBGH 1LEGA 4XP6H 4BFIA 4D0DB 3ZTJH 5IBLD 2XKNA 3OXRB 4JN2B 5DURD 2X4OA 3L5WA 1YECL 3QDGB 5FYLE 4YH6A 1R5VA 4JFDD 3C6SB 4ZPTA 4LQFL 3SDXA 1ZMYA 4NHUB 1XR9B 1J18A 2GK0A 3ILPB 3GSUA 4ETQB 3ELAT 3CVIL 3FZUC 1U3HB 3PWVA 2D03H 3D39D 2EEDA 4Z77B 2H1PH 2HMID 1J0KA 1AGBB 1KOAA 1N6VA 5EO0B 4G9DA 5I0DA 5HYJB 4UBDC 5DD6B 2X1PA 1BGXL 1KELH 3EO0A 1QZ1A 3G08A 1IEAB 1EK3A 4E0RB 4JE4B 1MI5B 3UDWA 3TBWB 5L2KA 3VFSA 4DVBB 5FHAL 3VFTA 1Q9KA 5C0BD 1HYSD 2EE9A 5JPNA 2VZOA 3V6OE 1JNNH 4G7VH 2B0SH 3VGDA 5CFHA 2W0KA 2EIZB 3BGAA 3TESA 4HDIA 1NLDL 2F58H 1CDUA 5HHXL 4EBQH 3CZFB 2P24B 5I1IL 4PYHA 2HJLA 2YS4A 4S2SB 4EI5D 4H20L 4HEME 4L4VB 4ODHH 4Y2OA 2HFGL 4ALAL 4LK4A 5HGHA 5KG9A 3HLAA 4NWUL 4Y5XA 3QFDB 1T1XA 1LE5A 2YD4A 4NSKA 1OGTA 2GKIA 4F3FB 3SDDA 1OTTC 4HFUL 1FRGL 2CJUH 1NEZB 4ZFOL 4AM0A 4C59B 3LPGA 2DI7A 3VXMB 2IALB 4WWID 1MJJB 1FN4A 4HV8A 4RGOL 1K85A 5C0FB 1FZKA 1EEZA 2OQJB 5F7EL 4X5XA 2WK2A 3BN9D 2VAAA 4WI5A 1V7MH 2KL6A 1SYSA 4M5YL 5D6CA 1OGAA 3KYNB 4BQ9A 3MV9B 4JDVA 5GGVH 4NJ9H 5GGTL 1YEKH 43C9A 4PJGF 1A9BA 1YJDH 5C0DA 2W0FB 3WFZA 1NAMB 1U58B 2OX5A 4KI5E 1KTRL 5B38A 3TBVB 4Q9RL 1U8HB 3FRPG 4YAQA 5E2TL 1I3UA 4Z7NF 4MCYA 1B90A 1KN4H 2VOTA 1IEBB 3HPLB 3NABH 5BW7A 5DK0A 15C8L 4JAMB 4K8RC 2X4SA 1BP3B 5I30L 5D7IB 5GGSA 5B3JF 3QDMD 4FNLL 4KZDL 3MV11 5ALBL 5DUPH 1CLZL 1A6UH 3JV0A 4GXVH 3ALPA 3MXWL 4K55A 2EDHA 3MJGX 1KCSH 1EEUA 1N59A 5FB8A 2VIRB 2W91A 3NCEB 4FFZH 5L88H 1K4DA 4EQ3A 1PSKL 1NCWH 3OJ2C 1LO5A 4P46A 4TYUA 5FGBC 5F7FA 1S7XA 2NY7L 5BMFL 4JJHA 4P5TC 1G9NH 1KGCE 5IB3B 2HT2C 2O93L 3ROOA 2ORBH 4X4XA 2AEQH 1MIEH 1LO3H 5D7JB 5DR5H 4M93B 1ZLSH 1NCNA 1MHPL 5T3XD 1AD0A 3K8MA 3RWFA 4HIIB 4XP5L 1F4AA 1BGXH 5E00B 4BQ6A 3V0WL 4A2LA 5IB1B 1YJDC 3QEQA 1OY3B 2WBJC 4PRID 5DWUH 4GFTB 4TNVF 4JZNA 1T4KB 4MCZB 1YNTA 2HWZH 3AS3A 3KPSE 4IM8A 5GZNC 3L3OA 4ZOEA 4C4KO 4KUZH 4TULH 1I9IH 2C3GA 4IRSA 3QXUA 4TN9A 2V2WB 1OP3K 3G6AB 1N3NB 2J6EL 2V5RA 1HDMB 2XZCH 1H5BC 3QEHB 3ECBB 2JJVA 4NRZA 4LARH 3GO1L 5EIQA 1JGUH 3MNVA 2XN9D 4G43A 2F54B 1ZTXL 4JFEA 3VWKC 4AG4L 2R0LL 3L3GA 2X70B 4AYFA 3JWNC 2MQ0A 4BH7B 4JLRA 1UH4A 5HJ3A 2BJML 2DM7A 4M61B 1TITA 1JPFA 1A3RL 2H41A 3BGMB 4RDQG 1B88A 1NQBA 4QCIB 3CFCH 4RWHA 3MBED 4GRMB 5HYQB 3BHBB 2OQJA 3E3QC 5IMOA 4LLDA 1YY9D 4PJIE 1JGDA 5ESQA 2BVQB 5HYSB 3BZ4A 1MCFA 5EBMB 3RX7A 4XPBL 2CIKB 4ZMAT 4NM8H 1A9BB 2D7TL 4NN5B 4PB9H 1F90L 5CJQH 3VD7A 4U2YA 4PTUA 1XF3B 3KPMB 4DAGL 4PJDE 3TNMA 1OPGH 4GXUN 2P42B 2H8PA 5IB5B 1FN4B 2E7CA 4IMLA 1YNLH 4DZBB 1AO7E 1NEZA 4X6BA 3EDFA 4X4YA 4KROB 2JF1A 3BPNC 1XIWA 5F88A 5INDA 5HHQA 3ZE1E 4ELMB 1KIQA 3D2UD 4OIBA 3UTZB 1F02I 1F97A 4XVTL 3RUGA 1HHIA 2HKHH 4NYLA 1FC2D 4OZGE 1GSMA 2OZ4A 5EOTA 4RZCA 5IG7B 3HC4L 5EULV 3JV6B 5IROC 5C3LD 2BNUA 1BZQK 1NGPH 4JO1L 4FQ2H 2FLRT 1BF8A 4P2QE 1NANI 1Z3GL 3EYQC 3RY4A 5GIRA 5IEKB 4GT7A 5FM8A 1MCNA 1KELL 4P4KA 5DUPL 2WWMD 5IB4B 4Z7OE 2J6EH 5IK3A 1OWRM 4YHPB 4WENB 4HX1A 1I1YA 5T3XL 3VXRE 2LVEA 3PABB 4WFHD 1RUMH 1L9MA 2AJSL 4BH8A 3BFOA 4OF8A 3DGGB 4U6TA 1WCBB 1UEMA 3AM8C 3NTCL 5E9DE 3FOLB 2AEQL 4XVJL 5I16B 5CEZH 4YDVB 4GAYB 1J1PH 3OJMB 5M94B 4BSWB 4LVHB 5TGBB 3MQIA 4HXBL 1LVEA 2ARJB 3VA2C 3FB5A 3HA0A 2YD6A 4NHCH 1CFSB 2CRZA 4ZYKA 4QRTA 3VH8G 4HD9A 4IRJB 2RFXB 3MTRA 1XGYL 3JVGA 5C0AE 3MRJB 4OCYL 4R96A 5ICXB 2O61A 1R3KA 4JFZH 1Z9OA 1FSKB 4L5FL 4KKCC 1D5IL 2X4RA 2X4PB 1UWEL 4OZIE 4P23B 4F9LC 5DUBB 2FGZA 3VFMA 1BD2E 3MOBL 2HVKA 1Q72H 1ZA6B 3GSQB 3S35X 3UJJL 3FB7B 3KAAA 3HI1A 3VI4E 2R0LH 3BZ4B 3EDKA 3GSOB 3QAZB 4HKBB 1C16B 3GEWB 3G6JE 3MGOA 5LXGH 1VGEH 1KPVA 1EEYB 4KHXL 4YNYA 4IJ3B 4Y4FC 1YNKH 5GGTA 5EO9A 5C0JA 2AEWA 1JZ5A 4GRWH 4U1GB 1AY1H 1MAKA 1P4IH 3VFOB 1HHJA 3RWDA 1SQ2N 4HIXL 1CQYA 1RZIA 1DBKL 1E4WH 3ARGC 2GCYA 2HH0L 5F70A 1XF4B 4PJXF 4OZIA 1D9KC 3VFMB 1IT9L 1WJ3A 2ITDA 4AQ1B 4MJIE 5C0GA 2BOCA 2DLIA 1X44A 4XNQA 1PW3A 5IBLC 4MLSA 5JOFB 3V6OC 4OD2B 1OAXL 2P8MB 2VQ1A 1MUJA 2R0ZL 4I0PA 4TPRL 2XWJA 4I48A 5ICZB 4YHKL 3HR6A 4EZMA 5DSCB 5EPMA 3WN5B 4V1DB 3S5LB 2G5BA 2WUBH 4ENEC 4JFHE 2MOVA 4F2MB 1REIA 3ULUH 4WI9A 4OLVL 1Z3GH 1ITBB 3UMTA 2PYED 3D69B 3B8YA 3C60B 4TSAL 2A1WH 5SWZB 3SO3B 3VXNA 3OAYK 5F7DA 1RVFH 2NR6D 3UX9B 2VDRH 4I13B 3I84A 4Z7VB 3P0YL 4NOFA 1X5XA 3A6BH 1VERA 1C5DB 3P0GB 1JWMA 2NW3B 4LLQA 4P5TB 4DKDC 1QSEB 3V5DB 3ARBC 1T0MA 1HYSC 3OV6A 3MRQB 2VXUH 5GRJH 4P4RA 4FFYL 2H26B 1QR4A 3SE4C 4PJCB 4WV1A 4EN3B 5I1AB 2MCPH 1MPAH 5JHDA 5I66A 1RIUH 5MENE 2BP3A 3CCHB 1CL7L 4P59H 5LQBL 3UXFA 1WITA 5J89A 3T1WA 3MCKA 3LQAL 3O45B 2DJUA 4LFHD 5DRNA 3HPJA 4HS3A 5HXMA 3MRRA 3S37L 4X4ZA 1ZLWH 3D69A 1TJHL 1N4XH 3L6FB 3RVVD 1JGLH 5AUMA 5GS0C 4P59L 4I0PC 4XPAL 4CVZB 5DMYA 3IXTB 3CIQA 3K0WA 5C71A 5EU6A 5KW9H 1OOAA 2PCPA 4OLUL 5B8CC 4J7RA 1FLTX 1BVKB 2JCCA 3QWQB 4PJDB 2H32A 4WEBL 3TA3A 4L4VD 4D0CB 1BIIA 2Q6WB 2NMSA 4QHLA 1UM6L 1XGRB 4F7MB 1Q9WB 4F37K 2IC2A 3HUJA 1CFBA 5CSGA 1SMAA 3U7AA 4PLJD 5BW7C 1PAMA 4HJGA 3QWRD 3M17B 3DX9A 4M8QB 2V17L 4XCFH 3U9UA 1FH5L 1KLGB 2Z35A 4P2OC 3WD5H 4HWBA 1TMCB 3EJZC 4CVZA 3D25A 4K94C 4FQIL 5E00A 3MMEA 4PGJA 5DMGD 1CIUA 2VLKA 5B38G 4I0CC 3PL6C 4UAOC 1I9RL 4UINH 5DD5H 2OXGA 4TUKL 5DK2B 4AIOA 3UTTE 5EO1B 4UI2A 1FLRH 1ZXQA 3T2QA 1CLOH 1FORL 4WEUD 4OQTA 5EU6E 1F6AB 3RVUD 4O2EB 4LP4A 3B4NA 5FGSA 2DIBA 3QUYB 3G6JF 43CAA 5HHMD 1CICC 4AIZB 5I75B 3HFML 1HHHB 4Y7MA 3QIWD 2ITCA 4NO0A 1NUFA 1DTUA 4M03A 1XH3A 5EBWA 3O8XB 5L6YL 5L2KE 2BOBB 2APBA 1XIWD 3R06A 4LOUD 1N5YH 4XVUC 3GSNH 4HWZA 3ES6A 5C0AB 4JRYB 3J7HA 3HFMH 3TVMB 1HI6A 3VXQA 4OD3L 5H94A 4HK0B 2X4RB 2X4PA 3WFCL 3GZKA 4Y8DC 2NX5B 5JQHC 3C5ZD 3I02B 1KIRB 5MHSD 4TQEH 4WHTA 2VXSH 4GAGH 4KAQL 5SWQA 2FB4L 3WIFB 3D3VD 4DN3H 2UWEA 5HDQH 3U2SA 4Y4KC 2ZWLT 3ULUC 3VE0A 1EXUA 3FO9B 2BOBA 4OI8A 1KCRL 3EJZD 2ADFH 1HQRA 2F9BT 5IKCA 4JO2H 3RWEB 2ITCB 1S9YB 1EVUA 1MCCA 5GZND 1YEGH 2R4RL 4DGVL 1D5BB 4I5BA 2C5DC 1AD0B 3BPLC 5T3XE 5I1LA 2KBGA 1YPZE 5FKAB 4JRXB 3FAWA 2C3WA 5FDWA 2BCKB 3EJYD 3HI6H 4JFFA 4HWBL 4KV5E 5I0ZA 1QVOA 4YIQB 2L7JA 3SGJA 2YUXA 2M8XA 2W65B 1KCUL 3QIWC 4ELMF 1F3JA 3MUZ1 3LQAH 4G6AC 4L5FH 1S8DB 1OP3H 3VH8B 2EC8A 1ZHLA 4LCCC 4WFGD 1UEYA 1N59B 4D0BB 1BQHA 1F3DH 2VSCA 4FABL 3F7YB 4ODTH 4LSTL 3RPIA 1H8NA 2MTPA 3BPO