1HXMB

Crystal structure of a human vgamma9/vdelta2 t cell receptor
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
230
structure length
230
Chain Sequence
b'AGHLEQPQISSTKTLSKTARLECVVSGITISATSVYWYRERPGEVIQFLVSISYDGTVRKESGIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALWEAQQELGKKIKVFGPGTKLIITDKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWEEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAMMA-DELTA T-CELL RECEPTOR
publication title Structure of a human gammadelta T-cell antigen receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 230
sequence length 230
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2001-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hxmB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hxmB01
5C2UB 3KS0J 4M6OH 3Q6GL 4P9HL 3CDGA 4YEFA 2XN9D 3L5XL 3QUXD 2CLVB 4HKXA 3ARZA 2APVA 1KB5H 4JDVB 4WFFE 1CVSC 5DVMA 4EKXA 3TCLA 5DRNA 1WC7B 5HDBF 3UX9B 3EDEA 4M5YL 1D9KC 5F7WC 3S6CA 3AY4C 3ZHDA 3MOBL 4WUUA 1OM3L 1U0QA 3KPSE 3PWVA 2VTFA 3OR7B 1B6UA 1H15B 3UYOD 5F9OL 3HPJA 4HDIB 1UWEH 4HJJH 3CVIH 1FFPB 1CFVL 2QBWA 1AC0A 4Z7OF 4U1IA 4JPVL 5DJ0A 1G0YR 3LVEA 2HVJB 1ZHLB 1KPUB 3U9UA 3O45A 5I1IH 4PS4L 3L3IB 5FO7B 3I3DA 3KPMB 4P23C 3OKKA 4CMMA 2F54A 1CDUA 3BN3B 4X7SL 4L4VD 3BD3A 3WUZA 3LH2H 4JPWH 5IROC 3W5NA 2JCCB 2F58H 2OMBA 4DTGH 1G9NH 35C8L 4W68A 3S88L 3QUXC 1JTTA 3HG1B 2KQMA 4XPFH 4XWGH 4ONHA 3TO2B 2Q3ZA 3C5ZB 1I3VA 4TNVF 1N64H 4H26B 4UB0H 3PV6B 3GSVA 4RMVA 4NQSB 1WVZA 4F2MB 2OQJA 1G7MB 5HYJD 4PBVC 4XNMA 4XGZB 5L0QB 4Y5YB 1N3NA 2WMPA 4PJIF 3W9DB 1A7QL 2WINB 3TT3L 3UO1L 1IAOA 3L3GA 5F72S 1IILE 2DQDL 1KBGH 3ZTJH 1NDGB 2EEAA 3MLXL 5EWIL 1AD9B 1X9QA 2VXVH 1NGQL 1LNUA 1GGBH 4OLYH 3RTQC 3TZVD 2DDQH 4MYWB 3FB5A 4LGRB 3VDBA 3WXVH 2BNRB 4F15C 5ICYB 2PETA 2VAAA 4M1CD 2JCCE 2XTJD 3BD4A 1SY6H 1ZE3C 5EO0A 3TJHD 3IDJB 1QBAA 4OZGF 3V0WH 1KTKE 3HG1E 4ZYKA 4LMQI 3MX0A 1UYWL 3LKPA 5KVDL 3MNWB 4GW1A 4RGNC 3FTGA 5GJTL 1AHWB 3QA3A 5HHMB 2LVEA 4YBQC 3U7WH 2OSLA 3GSRA 1IC1A 4NBZB 3ESUF 3J7HA 1MFNA 3O11A 5L9DH 4ODTL 3N1PC 2C1PB 2KQNA 4L1DA 3T2QA 2DLFL 4Q9RH 4NO2A 3BZEA 1S9WB 4P4KD 1JHTB 4F37F 4PG2C 5KSBF 2HN7B 5CHNA 3D18B 4PP1D 1JWSB 3MRFB 3QI9A 4NQCA 2DI8A 5TF1H 3TZVC 2CIKB 5LBSH 4OF6A 2V9RA 3GIVB 4Z5RB 4Y89A 4NZUH 4M1CC 5T3XE 2XTJC 2B4CC 1UEYA 32C2B 4JO2L 3HC4L 4BZ1H 3TJHC 5L88L 4NOFA 3G9AB 4BFBD 2R29H 1YUHB 3CLEH 1PZUB 1J0JA 5HHME 4KKCD 1DE4B 1B4JH 3OAZK 1Y6KR 4YBLC 3MOQA 1ZGLA 4OCWL 2NTFA 4TUKL 2VQTA 3K2UL 5DEFA 5HHVH 1NC4A 1X5FA 3WFHB 4IRZH 3T4YB 4HF5L 2XY1A 4HIJA 1AJ7L 3LZFL 3RVXD 3EO9L 3C5JB 3ALPA 3LIZH 3F7QA 1I7ZB 1XIWA 5D1XB 2AQ1A 4XP9H 5E6YA 2OR8A 4YNYA 1X5AA 1YPZF 2FX8H 3QDGD 4P4KC 4PR5A 5GGVL 2EE6A 5CLWA 1CS6A 1ADQA 2X1XR 4PP1C 1S5IL 1AQKL 1CICD 2O5YH 3QXTA 1MI5D 4QRSB 3L3JB 4UDTA 3S4SG 4BH8B 3U4AA 4OZIB 2AXGB 2WIIB 4U1JA 4ZPVB 3FQTB 4OBSA 3S37L 1YEKL 5HHQB 2OR9L 1ZHKB 4NM4L 3DURA 3QHZH 3G5VB 2FH8A 3ZKSD 3QEUA 1T3FA 4JM2A 3K8LA 25C8L 2C4XA 1QYGL 1I1YA 4KHTL 4KKCC 3QUYB 4DN4H 1WCBB 2B0SL 4PTUB 3AM8C 1OSPH 5ALCH 1U8PB 2QSQA 2BZDA 1UWXK 1JV5A 1C08A 4P2RD 4I77H 2R2HB 4J4PA 1DQDH 3SKNA 5IKCA 3Q48A 3RVXC 4DKFL 5FM5M 5FM8A 3AROA 5CBAA 1GZPA 1CXIA 3BXNA 3GFUA 3WBDA 3VMNA 3MSPA 3S9DB 4U2ZA 3DUUB 2PO6A 4IS6B 4OZIE 1TVBB 1T1XA 3O9WB 5DZNA 4H88L 3RGVD 4XNXH 2BCKA 5DK0B 1XGQA 1CICC 4KTEL 2J2ZA 1IAIH 2ILLA 4F7TB 3RWJA 4PV9B 5CLTA 1CDGA 1H5BA 1AY1H 2Z8RA 2UY7A 4ZOBA 1NEZG 2I60H 1PGRB 2B1AH 2P5WA 4NM8L 1JZ3A 5SWSB 3NCCB 4QHLA 5IG7B 1FDLL 2QQQA 3OKEA 3IRZA 1H9VA 3RP1A 2Y5TB 4ODVH 1KCSH 1IAII 1NMCC 5K9OA 3GK8L 3HC0A 1JFQH 1EMTH 4KTDL 5E2JA 5MEPA 3VFGL 1BECA 1DANU 4DGVH 3G5ZB 4D0CA 1S7VA 1BJ1J 4X7FC 1JPFA 5FYKL 5IMOB 5K33A 3SE3A 2Y4SA 1I8LC 5IUSA 4NBXB 3ZLQC 1R0AL 1OGTA 1CZ8L 1R5WB 3MLYH 4NC0B 4HUUB 5IM7A 4Z76B 5FECB 3SO5A 2EH8L 1NLDL 1RURH 3VD4A 2C3HA 5GPRA 4GBXA 1F4WH 4M8QB 1NSNL 2JCCF 3RGVC 2ZKHL 5KSAB 4CMHB 2H9GA 1ONQB 1IEBB 5CAYB 1H3UA 2W0FB 5SWSE 1CDJA 5F9DC 4NKOB 4XB7A 5I76A 1ACYH 5DMIH 3V0AC 5DVNA 1NFDB 4OZFA 5HYSB 5DEGA 5L7XH 4PY8J 5I1HH 1RI8A 1QD0A 1JGVH 3MRLA 3ZKQD 2VWEE 3DIFA 1GGIL 4IJ3C 3WUWB 4I48B 4WO4A 2P48B 1A1OA 4RAUA 3MROA 2BOCB 3ARXA 5GRUL 4M7JH 1RJCA 1AR2A 2BJMH 4QHMB 4U3XA 5I1AB 2XA3A 1W0VA 5EO9B 1CE6A 2IGFL 3H2WA 3T4AB 1KJMB 3QXDB 3EYSH 4RBPK 3OXSA 5DUMH 1YYMH 1W8OA 5DEZA 5E8OA 3JV0A 4G3YH 5C0JB 2AJUL 3VXMB 4EN3B 1YEJH 1UA6L 4FQJL 4OZ4A 2CDEA 2UVFA 5TE7L 3GJEB 3MV7A 4LAQH 1ZVYA 4HBQA 4HWNA 4NRZB 1NFDE 1DCLA 1QBLL 1ZSDB 1NGYB 2R2EA 4PJ8A 5ADOH 1CGXA 4NUJB 5J1SC 1R3IH 2PYFA 4EI6B 1A7PL 1BVZA 3O4LA 2HLAA 2FECL 2XWJB 1I85C 3JWOH 5C0FB 1IARB 4HZLA 4HLZH 4WFFD 4YHNB 4OM1H 5DJ6B 3NACL 1MCRA 5I18L 4QTIL 4ELMA 3TCXA 2LQRA 4QRPB 4JN2A 2DQJL 1H3PH 3WHXA 4WHDA 4X5LA 3TBVA 3TH3T 3KPSD 3T2OA 2BXZA 4TVPE 3VXME 1MIML 1GXEA 2P49B 4QKXB 4PGCB 1OAQL 3LKSB 1WUNT 2B2XL 3HFML 1EEYA 3TN0B 1JZ8A 1E6JH 3CH8A 2YUVA 3OJ2C 3GNMH 2HRPH 3WD5H 3SOBL 5FKPA 2VXTH 4I0PB 5F6HI 4LIQL 2IADB 2D7TH 3QIWD 4NC1E 5EU3A 3TBSA 5HHXH 4FQXD 1UM4L 1AXSB 1XZ0A 1IQWH 3FFCA 3LB6D 1I7UB 1BFOA 5JA8B 1KC5H 4DUVA 4D9LH 3VWJC 5F9JB 1Y18A 1EIBA 2AJVH 2QQLH 3WJJC 4YAQA 1FFOB 3UPAA 4QRPE 4K9EC 4CJ0A 2H3NB 4PJCA 4POYA 5L2KB 3PL6A 2WBJC 3VXRD 1XR9A 2IC2A 4Q6YA 1ITCA 1A3LH 1U3ZA 1Z3GL 4OZIF 1QNZL 3MYJA 3OKDA 5BQ7A 2KZWA 4R0LA 3P0YL 1AGCB 3DPBA 2PR4H 5EUOB 4L9DA 1QFUL 3MCLL 4MWFB 3QPXL 4XP1L 5L8JB 4UT6H 3MBED 8FABB 3ULVE 3PABB 4X7TA 2O93L 3CSYA 5C6PB 1QPPA 3QIWC 3BH8A 3GIZL 4FQXC 3LQAH 5JDSB 2BRRL 3AVEA 2Z93B 1YY8A 3HI5L 3P11H 3IU4L 5BW7A 3SKOB 5L2KE 1LE5A 3NCMA 2BHYA 2OL3H 2IQ9L 3I6LD 4Z18A 5BVPL 3WS6C 5HI5D 4YFLF 4WUKL 3UYRL 5GGVY 5TE6L 4YHOH 1CD9B 1S7QB 2XQBL 5ITFB 3OXRA 1IGFH 1RJZB 4JG0L 2JIXA 5J1AB 5C0CA 5D2NB 1XEDA 3WIIL 1QFWH 3QNXB 3B2UD 2AKRB 1X5KA 4HAGA 5EUOE 4AEFA 3UZEA 2X05A 1GIGH 2FGWL 4OD3H 3E6HB 1LO3L 1TQCB 5D7JA 1EAJA 4P3DA 3WDIA 3T2NH 5E08L 5F89A 2AXFA 1EVUA 1QFWI 4R7DA 4GG8A 5F1NB 4OI8A 1QSFB 3MGTB 4ODXA 2H32A 5DD5H 5IIEB 4QXGH 1AE6H 3CFDA 1WIPA 4OKVA 5T3XD 4XMLL 3RWIA 1Q9KB 3U46B 2FRGP 3WFDL 4BSVA 1JYWA 4HK0B 1UCBL 2GJ6B 5D7SL 3ZO0A 3FQUB 1E4WH 1FBIL 4Z7NE 1WBYA 3FOMB 5HI5C 2IH1B 2YRPA 5D2NE 3F8UB 5F7UA 3V52L 1FVEB 4Y5YC 5L0QC 1FE8H 1OW0C 3VW3L 1P1ZA 4HGWB 5HYQB 3LMJH 3GB7B 1PSKH 3PWLA 3B2UC 4G8FB 2YD1A 3FN3A 4QRRD 2A2QT 1NFDF 4RRPG 3G6JA 4NO5B 3VE0B 1FJ1B 2YD7A 1KB5B 2F53D 2X6MA 2AABH 2UZIL 1NBQA 2V5TA 1NMBL 1V5JA 4CW1A 1IEAA 1S7XB 1UQSB 3DECA 1OPGL 4X9FA 4H8WH 1FO0A 5HTSA 12E8H 4NNYA 3QWRA 4Z7UB 3X14B 5IB1B 3FONB 2ESVB 2ICES 1AHWC 1A7OL 2BDNL 1NFIB 4GKOA 5I71B 4OF7A 2CKBA 1EZVX 5BV7L 1KGCD 5CD3A 2VR9A 1FNHA 4LSUH 1HXYA 3DI3B 3BIBX 2NZ9C 4L4JA 4WJ5A 2W9DH 4JO3H 4ZUUA 1OGAA 1PW3A 5D1XD 3D39B 1YEIH 1QBML 3VRJB 2WWMC 4E41B 2WAHA 3E0GA 1QRNA 5IQ9A 1O0VA 2FWOA 4LARH 5FF6A 1QVOB 1A8JH 4FP8H 1CN4A 2IBBA 2OTUA 2XXMB 5IHZA 1ZHNA 1VFUA 2NY7H 3RWEA 4Z7UE 2QSCH 2DJSA 1U8HB 2VXSL 2EDWA 3HE7A 5DF0A 2ESVE 5EBLA 3MR9B 5E9DA 2F74A 4NO3A 5F21B 3H9SB 3BDBA 5JO5B 3N1GC 3HMWL 2OM5A 3ZDZE 1NCWH 4D0DA 1YJDL 1V3LA 3ARBA 4LEOB 4G6FD 3CK0H 5JUEL 1P9MA 3BUYA 1MVUA 3MLUL 1WIUA 2P7TA 2NXZB 3GHBL 1LE9B 1DVFB 2NW3B 3F5WB 5D7LA 1A4JA 1PLGH 1CE1H 4KVCL 4E41E 1FLTX 3JVGA 4Z9KB 5D1XC 4OF0A 2EYTB 5DHXB 3DXAA 4C4KO 3O3AA 5IMMA 1FCCA 2CDFB 5CJXC 4I3SL 4QHUB 2BSED 3A6BH 2YWYA 4KXZH 3ULVF 3V4VH 3AUVA 3ZTNL 1BBDL 1K9TA 4PUBH 1DEEB 2PUQT 4FZ8H 5GSRB 1UADC 2MCG1 2PXYB 3MRIA 1EEZA 1KXTB 1I9JL 5MEND 1S7TA 3H9SE 5LAXB 4QRTB 4KXZI 1R24A 4JPKL 2AK1H 2XOTA 5T1DH 4ETQA 3ZDYE 5I6XB 1CLZH 3QFJA 1FRGH 4Y5XA 2QQNL 3REWB 2FX9L 1CD1B 3ULSA 1NLBL 1J1XH 1SEQH 5IMLA 2M2DA 1WZ1L 2X42A 3QYCA 5TGBB 3TVMD 1YMMA 2FJHB 2MWCA 5EUOF 1GH7A 4Z78A 3L3KB 4OQTH 4KPHL 4H20L 2J88L 4UUJA 1OAYL 5TQ2L 4OB5L 2E9WA 4JFFB 4KKBC 3ROLA 1UXWB 5GS0D 1JRHL 5HY9A 3B3IB 1VADA 2XZCL 1UJ3B 4YWGL 2YSSB 3ROOB 2V9TA 3O9WC 3M1BA 2XY2A 4LCWD 3RA7H 3I02B 4HIXH 2VAJA 4ZFOL 3OAZH 4ONFH 1HQRB 2NX5A 3HNTL 1M05A 4JHZA 5DJCB 2HKFH 4I3RL 2W9EH 4LU5L 1KIQB 2DQIL 2PTVA 1MWAH 4TRPL 3KPLA 5J4MA 2IFFH 1RZGA 1X44A 3ZL4H 2DYPA 1BQUA 4Z7NF 2PW1A 4Z8FL 1FFNB 2CQVA 5LVEA 4FABL 4U6VH 3LEVL 5C1MB 2VWEC 5FA3B 4PLNC 3WFCL 4MB5A 5IGXH 1T83C 3N85L 1NJ9A 3TVMC 1JPSL 4JFFE 5T3ZH 3QFDB 3QP3A 1TXKA 4J2XA 3SE9H 1P84J 3VXMD 5TH2B 4EN3D 3MV11 2V2TB 1WBZA 5LGHH 2AJYH 4AL8L 2NY4B 2VABA 5DJ8A 3THMH 5B8CA 4CL7A 3MJ9A 3FCTB 2X4SA 2H2SD 3C08L 5JHLH 3BEVA 3KAAA 5C9JA 4G5ZL 4AM0A 1UWXH 4NJAH 1B2WH 2AQ2A 3ULUH 3D85B 5JOPD 3MYZA 1GC1H 4XNUL 3I6KB 1ZEAL 3V5HB 5J7CC 3BP4B 4I9WE 1DLFH 3O2DL 3GRWA 5I2IA 2GTWB 4CVXB 5HVFB 3BHBB 3QG7H 2EE3A 2VDPH 3N06B 2X4PB 7CGTA 5ITBH 1BF8A 3TJEH 3LN4B 5T33L 2VDNL 1KJ3L 2X10A 1DSFH 1EVTC 3GMOB 1DBKH 4JLRA 4EN3C 2ZOLA 2D7PA 5LWYL 4KZEH 5D6CB 4IM8A 4Z7UF 4PB0L 2J8UB 3VFUA 1MRCH 4GAGH 4PJDA 2H2SC 3DLQR 4Y4KA 2BERA 4MJ5A 3FRPA 2O5ZH 2N7AA 3TA3B 5GS0H 3S4SB 4OV6F 2OJZL 2JB6A 3DO3A 3ZDZF 4NC1C 2X1QA 2XKSA 4K3EL 3OGOE 4R26L 5EOCL 1RUKL 1T80A 4NCC1 2P1YA 1V7NH 1LD9A 4NPYA 1BX2A 1GOFA 3P9LA 4FXKB 2F15A 5J11C 1EAPA 3I6GA 2IAMB 1WK0A 2DIJA 5A3IC 4DUXA 3NAAL 3QCTH 4GQ9H 3I3EA 1E0OB 4P3CH 5D7IA 4HWBL 2EDFA 4OGAD 4WI6A 2OS7A 1TCRB 3FT3B 4GG6A 5JIIA 1QR4A 3H3KA 4PRIE 2UYLB 3ZMRA 3MGOA 2C7UB 4F80A 2HFFA 5E94B 1HHKA 3TN0C 2J8UE 1YEHL 2ZOKB 5LGJA 1VKXB 5TQ0L 4WTWA 1I3RA 2CK0L 5D1QA 1P7KA 2QL1A 3OKOB 1TLKA 3HS0A 3OAUH 3ULVC 4RAHA 3ZDYF 1T1WB 4ZNCD 3LKRB 1NEZB 3KPOA 1JYNA 3MRRA 4RBPH 4P2YA 4OJFL 1K8IA 4YDVB 4LDOB 1C12A 3SDYH 1F3JB 4YR6B 1I75A 2FATL 5IJKA 3SE8H 4QF1A 3LY6A 1DQMH 1DN0B 1LK3H 3O6FD 3CVHH 1HSAB 4IIQB 4LAJH 4O9HL 3LS4L 3BN9D 3L95A 2AJSL 1N4XL 2QTEA 2ZG2A 2OR7A 2DWEB 2IALA 2OTWA 4LKXB 2EYRB 1VFBA 1HCVA 4L8SB 4OFKA 2YPLA 2AV7A 3T77B 4KRNA 2R0WH 3ARDD 1GPOL 4RMQA 4LLUA 3OAYK 3I2CL 5D5MB 3VH8A 5I15L 4XVSH 2J5LC 4MCZA 5BRZD 2VE6B 5E2VH 4BUHA 4N9GB 4Q2ZA 4G43B 3B9EA 1BZ7A 4NRXB 4DGYL 1FZJA 4UMGA 4G6JL 1BIIB 3F65A 5IFHH 2EDJA 4GFTB 3P9WB 5KS9A 43C9A 1JVKA 1NCNA 1PKQB 3CFBA 3GBMH 1PQZA 2YD8A 4YLQT 3DTXB 3V6OE 5HDQL 3CX5K 1VSCA 4EXKA 1RVFH 1EPFA 3RZCB 5D2NC 3ZT5A 2YKLL 3R1GL 5TDOB 5JPMB 1ZT1A 1S7UA 1C5CL 3O6FC 4J1UA 4N8VG 4HWEH 4ODWB 3BN9C 4QGYA 4UQ3A 3VG0L 2O61B 3B9AA 1BZ9B 1TQCC 2AJZA 1OAZH 1KCLA 1OY3B 3WKNA 3LEYH 3FL7A 3PIQA 4P59L 2VIRA 1QBBA 4JRYB 2RCSL 3KPRD 5D6DC 4GUPA 2AAVA 4TUOB 5C08A 2ITCA 2DTMH 3B9KA 5FDWB 4WEBL 5CSZB 4CVUA 1I8MB 4LBEB 4G8IB 4Y1AB 1KOAA 1FG9C 2JTDA 3WNNA 4LCCC 4UOJA 4NSKB 3FB6A 5F3BA 1EV2E 3MJ6A 2R0KH 4HMEA 5IK3A 1MHCB 4HIEB 1FG2A 1ZT7B 1FYTD 5AYQA 1KCUH 2XZQL 3RHWF 4PJHB 4E41D 3BYYA 3VXTB 1YN6B 1KYOK 2A38A 4JRYE 1DTUA 3KHQA 3PNWA 4U05A 4LSPL 1I1AA 4R2GD 4LDEB 1IKFL 2NR6D 3BKJH 3VGGA 5K9JL 5KW9L 4GRWH 4UOW0 1J5OH 1F3DH 3IDYB 4DEPB 5C2BH 1D5IL 5D1ZB 3P4MA 2B8OT 4TSBL 1LO5B 1MHPL 1LVEA 5J13B 5T1LA 4Y1AE 4F7PA 5EUKB 1BZQK 3WJLA 2NY6D 2OTPA 4G7VH 1BOGB 5EULV 2HVKB 3OKYA 4YXLH 5DUPL 3IJYB 4TOYH 4MD0A 4FS0A 4UIMA 4MNQA 2Y1VA 4DZ8A 1DQLH 4ELKB 3P0VL 1QQDB 1KG0A 2IJ0C 4Z77A 2NXYD 2E7CA 5ID0B 3LEXB 1KN4L 4PRDB 4G9DB 1K4CB 2NY1B 4DKDC 1U3HB 1EFXD 3IF1A 3LRSA 1NGXA 2J8UF 1AFVH 3IDIA 1LEGB 1RZKL 1PYWA 4APQA 1ROWA 3QZWA 4N5UA 3UC0H 5HYIA 2OZ4A 1T66D 2YA1A 4Q0XH 4X6EB 1DQJB 5ICXA 3HRZA 4R2GC 4XXDA 1IMHC 3WN5C 3HZVB 2R9HD 3KLAB 2NR6C 1B0GB 3QEGL 1GGYA 4WWID 4X5XB 4KMTH 1U6AH 1J0IA 1MAML 1CL7L 1AR1D 1DUYB 1IM3A 4G8GA 4KH2A 1ZA3B 2Z4QB 4J6RL 2PNDA 1SYVA 5FYKE 4Z0XB 5D7KE 2NY6C 1INQA 5JXAH 1IJ9A 2DQCL 4NQDA 2NXZC 3W39A 6CGTA 4WI8A 2A77H 3H7LA 1A5FL 6FABH 5I1KL 1N2RA 5CUSL 5HBBA 3GI8H 3NZHL 4LLWB 3RL2B 2NXYC 1DJSA 4XWOD 3EHBD 3KDMB 3SJVB 1MREH 3EFFB 1F11A 2Q76B 5FA4B 1T1YB 3S5LG 3H9HA 3MLVL 2DOCA 4KAQH 2OLDA 3VXSA 2APFA 1XH3A 2PXYC 2R9HC 4QRUA 1QEWA 2Q7NA 1JGDB 4KUCD 2CO6B 5I1JL 3U9PH 1OARL 5DUBB 5J12B 3G5YA 5JQHC 4XH2A 1CGVA 1EJOL 1AR1C 3U1SH 4XXCA 4U1KB 1OTSC 4MD5B 2VLJA 3UTQB 3MA9L 1P2CA 3TIEA 3VD7A 4ZO8A 3X3GH 2D31B 1MCKA 2EDXA 3MLZL 2EE2A 1C5DB 3NFSH 1GOHA 2WP3O 2VDQL 3TO4B 4XNYH 3N0PB 5IBTL 1G7HB 4BZ2H 2BSRA 5MEOB 1U91B 5IVNA 3K4ZA 4CU6A 5CMAB 1OWRM 2EXWC 4M3JA 2NY4D 1UJ3C 2E6QA 3EHBC 4JG1H 4LEXL 1E4XH 3ZKND 5IV2A 2ITDB 2LU7A 3WSQH 3RFZC 4NWUH 1BQHA 2HT2D 5CGTA 3U36A 4WTZA 3TYGH 5CZVL 1INEL 1UACH 4HAFA 3GSOB 4X6CA 3MACL 3H0TA 3C60D 4BQBA 3KYNB 4AG4H 2GUOB 5JR1H 3D85D 4MLIA 3K4DA 1MELA 1F4XL 2HWZH 1U8MA 3DMMB 2UWEB 3T0WA 1A6UL 4D3CL 3BH9B 1CGSL 4K94L 4S1QH 4FQ2L 3KPQA 5I8KH 1J0KA 1UB6A 1G0XA 1ZS8B 4RZCA 1GGTA 4CDHA 2VDML 2ZSWB 1DDHB 1Q9OB 3L7FA 4NT6A 1CDBA 1EX0A 1GGUA 3H42H 3V5KB 4PRID 3QAZB 4JFZL 2NY4C 3MRDB 3ZKNC 4LIQE 4G80B 3IU3A 3UBXA 1M71A 1RZJC 1SBSL 4NKMA 2BY1A 2HT2C 2NY2B 4PJ5B 5E03A 1Q9WA 1MHHB 4L8CB 1FV1B 3TC9A 4X99A 4P9HC 4H5SA 3TA3D 1HHGA 5DJYB 4YHYB 4O2FA 4ZOCA 3D2UB 1NAML 2UWEE 3WFZA 4ZFFB 2OZ4L 3TM6A 1RIHH 4RFEB 4JO4L 4JHWH 4EVNB 5HXMA 2IAMD 4WGVB 1WGOA 5IW6A 4EOWL 5DA0B 3GMNA 1JNHB 4QWWD 4J3TA 4AENA 3IS1X 4KKLD 1KCVL 2QHRH 1XR8A 3SPVB 4AT6B 1HKLL 4KRPD 1G7QA 1N0LA 3WXWH 2EC9U 5E5MA 1I9RL 4M1DL 4PPTA 2BNUA 5H37G 4C56B 5AD0B 3N1MC 3S34H 3ARUA 4JRWA 1DL7L 2AGJH 4U1HA 4UQ2A 1LEIA 4NFCA 3GJFA 4JY5H 2B1HH 1IGCH 1MWAB 4PJ5E 1B88A 2OI9B 2VDOL 4PJ9A 5SWZB 5K9KA 3FRUA 3ZKXB 3AREA 5EU6A 4Z7WB 3NTCL 4XCEB 4TVSa 3U4EA 3TA3C 2AEQL 1RJYB 4Z95L 1HYRC 5EIIA 2HRLA 2N7BA 1RSFA 1UXSB 1TMCB 4QT5A 2I5YH 4KFZC 1HDMB 1FZOA 1SQ2N 1UM5H 3BDXA 2XWBB 1FQ9C 4ZAKA 1CIUA 4LHUA 2IAMC 5E00A 1MCOH 4XTRC 2DWDA 1NBZA 4QWWC 1EERB 3A6CL 3HE6B 3H9YA 3NPZB 4TNWK 4KKLC 4C56E 4XZUA 4YHZL 4KRPC 5C7XL 4EZMA 1HN1A 4OLWL 4LCYA 5IHBA 1BVLA 4I4WB 4EUPG 1GAFL 4LLAA 4MZ2A 2YA0A 3QULB 4JY4A 1T03L 2HT3D 1YMHA 1OM3H 5SWZE 2UY6A 2R1YA 4Z7WE 5A2FA 3GSNA 5ISZE 2ORBL 5KZCD 4TUJB 5I19L 4M62H 1MCSA 5GISL 4NZTL 2YUWA 4HZAA 1IGTA 4X6BB 2H1PL 5HGDA 5GGTA 3B5HA 2ZUYA 1OF2A 3M45A 3D5OF 1DLHA 5GJSL 4D94A 1T04B 4Y4FA 5H37H 3QUML 2OXGA 4GKZB 2IBGA 4PS4H 2EEBA 4RX4A 4X4XA 2ZPKL 5CJ8A 5BV7B 1RUAL 1XF3A 2XG5A 1CFNB 4GXVL 4ZS6D 2E27L 2AS5M 1HSBB 2A9ML 5DI8A 1D9KA 4XAWH 3AY4A 4I2XA 2A6JA 1FFRA 3V6OC 4IIQC 4MCYB 1U8QA 5KANG 4V1DA 1SVZA 1RAMA 2ZCLL 4BFIA 4DCQA 5I1EL 1A9EA 1U2CA 5A1AA 2HT3C 3DGCR 2XRAH 1S9YA 4JFEB 3NIGE 3MREB 3FQXB 4E5XB 3GEWB 4PJEA 4HH9A 2YK1L 2DRUA 4KROB 2D7MA 5C0AB 3ZHLA 1NGPH 1NC2B 2CUIA 2DQDH 5D71L 2PCPA 4JPIB 1RK1B 4C4KT 4P23A 5HGBB 4OTXL 2C3XA 2QKIB 3QQ4A 4N0YL 1TZHA 4KJYA 5IROA 2BHZA 2JJSC 3Q1SL 4X80H 5I0ZA 3MODH 1AGEB 1MJJB 4EUPH 2XN9A 1BAFL 5FYJH 3QUXA 5GS1A 2F54D 2XPGB 4QTHB 5KVEL 1U8KB 4ZPTA 4ZS6C 3DVGB 1IFHL 2ADJB 1UYWH 4TSAH 5KVDH 4JFHD 2L4OA 1F90L 4NN6C 3RZCC 4CDGC 4ORGA 1YQVL 2BVEA 3GMQB 3CC5A 4JQIH 4YHPB 3AU1B 3MRCB 4JFEE 1QHPA 3BIKB 4PG9A 1IGIL 2GFBB 3MNVB 4KRMB 4C83B 1U58B 5T5NG 4F9PC 3E2HB 2UUDK 5C0AE 2YBRB 3JUYA 3CMOL 4S1DD 3RTQA 4RMUA 4IMLA 4JKLA 3LRGA 4XMPL 1KIRA 3CNKA 1MHEA 3KXFB 3WFBH 2UWEF 3DX6A 4CADB 1LO0H 4U7SA 5E7FA 1RZFL 1ZHBA 4KKAC 2VZUA 1TZGH 3PHQB 4LSTL 4DQOL 3CVHB 1J8HE 5IB2B 1H8OA 1IZJA 1R3KB 4F58H 3ZZ1A 1FAIH 5FYKD 3HC4H 5D7KD 1V3JA 3T1FA 5KANI 5HHOB 2ICEB 2Y6SD 3QNYA 1RK0A 4MXWL 2VDRH 5INCB 2R0ZL 3O6KL 3T8XB 5C6WH 1J1OL 1UZ8A 1B0RA 5CEYA 3OAYH 1SJEA 1AKJB 4AH2B 5IW1B 3ILPB 3U7YL 4PG2A 1AJ7H 3TV3L 3K81A 2BOBA 4ZFOB 2IG2H 5DHYA 4R4FH 5E1HB 3HNSL 5E2UL 3TZVA 3VD9A 3M07A 3IVKA 5LGKA 1BP3B 5D1ZC 1I1FA 4K8RH 5H8DA 5KSUA 4M7LL 5I66B 2E9JA 5DD1L 3SKUD 4JVPA 3U7AA 2B20A 3S37H 5HHOE 2OR9H 1BFSA 1IBGL 1CFBA 4EDWH 1L4IA 4F7EB 1SMAA 3EFDL 2RQ8A 1U95A 3GI9H 3DGGB 1JYXA 2P8LB 4W6XB 2AV1A 3FO9A 5ERWB 4PJ7B 5HYEA 2R15A 1QSEB 3ET9F 3DRQA 3F62A 1NCDL 1FNEB 4Z7WF 4PRBA 5IOPB 1NC4D 2XQYK 4WTXA 2E7MA 3EO1A 5DJXA 3QRGL 3QNZB 2CMRL 3BEWA 1EHLH 4P4KA 4EQ3A 3W0WA 1S8DA 3SO3B 1X5LA 2A73A 1XIWD 3VFRB 2N4IA 4JB9H 5CEZL 3O81A 3GBLA 3O41B 4OFYA 1KLGA 1MFBH 4JR9H 3Q5OA 4MA8H 4GKNA 4HJGB 4NCDA 2XKNA 2DD8H 4AEHL 4P2OB 4HX1B 2ZUQB 5ANMA 4H88H 2ZCKL 1G9MC 4IHOB 4YQXL 4XCYA 5CGYD 2DKSA 3JSSA 3L3HB 4NCC2 4NM8H 3BMWA 5ADPH 3OR6A 4FTVB 4OI7A 1U93B 1QSEE 3VGFA 1EFQA 2ZSVA 3RIFK 3FQWB 1JNLL 3TO4D 3SDXB 3G08B 2AI0H 3KJ6L 4YDIH 1NUNB 4GW5B 1CR9L 3NIGF 3ZE1E 2GKIA 3DHMA 4J4PD 1ND0B 4Z0BH 4R97B 4ZUWA 3DOSA 3INUL 3QDGA 4N8VB 3CZFA 1XIWC 5EIQA 4LSRL 5F6IB 3OPZL 1HH6A 3PQYB 1CICA 4HS8L 2PO6D 2OBGA 4LLQB 5IFAH 4P5TB 1FPTH 3IFNL 5HPMA 4XVTL 5SWQB 3BRFA 1EH9A 4HS6A 2ZKHH 4PY7A 5EZJB 4U2YA 3DMMD 4NNPH 3S35X 4M7LT 1CT8A 4FTVE 5BS0B 1I8KA 3V6ZA 3E3QE 4WHCA 4YIQA 2ADIB 4EBQH 5CZXD 3HI6H 1K3ZA 1W72L 4UT9H 5ACZB 2YRLA 4WNQB 1C5BH 2WUBL 1I8LA 4XVJL 2EYSA 3NFPA 3WLBB 4BFEA 1YNTB 3IXAB 4OLVH 3TO4C 4OF8A 4EDXB 3GMMA 3O3BA 1HNGA 1INDL 3KLHD 4X9BA 2R2BB 1BF2A 2V2WA 4X98B 5KG9A 4ONGL 5GRJH 4FNLH 3PGCB 5IP4A 3PQYE 4NQVA 5DT1H 5GGUA 4PJ5D 4PJIA 3SGDH 1HINL 1A6WL 3MRJA 5IVZB 3RGVA 2ZUSA 2AERT 2C9AA 5EOTA 3RU8L 2JELL 1R3LB 3NCYP 3D2UD 2AJUH 2PO6C 3BD5A 2VL5B 4QY8B 5TE7H 5BS0E 4L8BA 3SGDI 4DN3H 3KYMA 3CCHB 1DUZA 4IOSD 1KJVB 3C6SA 3DMMC 2AEWA 1H5BC 3NZ8B 4Q6IB 5EZIH 4RMRA 3FB8A 4OZGA 4K7PL 4YPJA 2VXQL 2Z92A 4NHCL 1ADQH 5I75C 5CZXC 1NL0L 2BVPB 3QCUH 2A6KB 4L3EB 5JIPA 4GQPH 4U1SA 3A6OA 5DTFB 2ADGB 5I18H 4CGTA 2DQJH 3FT2A 3KLHC 1QOKA 3F7PC 5LCVH 2KZ1B 2VITA 1MJUH 1KEGL 5ISZD 2NY2C 2A9NL 2XWTB 1KCRL 4LSQH 2Y5EA 3V6BR 1EO7A 1QLFA 2XZAL 3PXHA 3GO1H 5DC4B 2MSPA 2WSKA 2QSTA 3MV7D 4W81A 2VLKA 2R69L 3QO1B 4H0GA 3MNZB 2F9BT 1I85A 4PJ8D 2GAZA 4LLMB 2LAAA 4XCCH 4L3EE 5DFTA 5C70A 3KNBB 1U8NA 5DMJB 4HFUH 5JPNA 4PYGA 4DUWA 3UJJL 1T7WA 2BMKB 4ZS7H 2FJGA 2NNAA 2V17H 4POZD 2BSSB 3CFEA 4OCLC 5CEXB 3PWPA 4HKBB 4MA1C 3BPCA 5DO2C 1LP9B 4M03A 5BO1H 4EEEA 2HG5A 4KTYA 5CCKL 3FHQA 1ERNA 3QDMA 2OI9C 1MCFA 4OV5B 1K5NB 3T0AA 5B4MC 1KLUA 2R4RL 5F7MC 1XCTA 2RB8A 5KAQG 3F7YA 5EBWA 2W65A 1YPZA 3UP1A 4JDTL 1T1ZA 3ELAT 4XCNA 3S5LB 1ODAA 1BOYA 3QPXH 5CJQL 5D72H 3ECBB 4GS7B 4JZJA 3BP6B 1H0DA 4O51B 4JREB 4OIAA 3EJYD 2VQUA 4YE4H 2IBZX 5DFVD 4PJ7F 5DS8A 3VWJA 3QR2A 3QBTB 5A2LH 5EH1A 1ETZB 2PW2B 1JHLH 2L7JA 3CFCL 5DRWA 5BOZG 1A14H 4FFWD 2WBJA 1P69B 4NN5C 2CLRB 1EZVY 5A43C 1OD9A 3ZE1F 2Z91B 1LP9E 4X7CC 2E7LC 1WFNA 2H45A 2N1KA 1L0YA 3SDDD 4POZC 5BXFB 3KPSA 1WICA 3SCMB 4QO1A 4P5KA 5JW5A 2ZNXA 3X3FL 3V7AG 3TT1L 3RPIA 2A6DA 3MRBB 4K3JH 4O4YL 4S2SA 4RGMC 3WIIH 1TDQA 4FA8A 2WLYA 1NC2D 4U6HA 1QSZA 4HBCL 5EOCJ 1FZKB 4ZFGL 3O3DA 3PGCA 4O5LH 5D70L 3T0BA 5KJRL 1JNNH 3KR3L 3HCVA 3WLWD 5M94B 1J0YA 1BBJB 4FQXA 3VI3E 3F7VB 4YFDB 1KXVC 4JDVA 4O58L 5BV7C 5DFVC 5FB8B 2FBOJ 1J8HD 2XA8L 4M1GH 3WS6A 5EFIA 5LQBH 1ZT4B 1HILA 1UCBH 2ARJQ 1A22B 5ESVB 4KV5E 1YDPB 5DRZB 3DYPA 2VLLB 4OCYL 1N6QL 3OR7A 1H15A 1MCLA 2NY5H 1QRKA 1MJ7L 4HDIA 3QUKB 2Q86A 2V5SA 1FFPA 1LHZA 3AS0A 3SDDC 1WWWX 3V52H 2X4OA 2DBLL 3VW3H 3IJSB 4KROC 3NCJL 1KELH 4RAVB 2HVJA 1F6LL 1KPUA 2BK8A 4R0LC 3VRIB 3L3IA 5D7JD 5FO7A 1YEGL 3KPMA 2FD6H 4I0KA 3PDOB 3RVWD 2XT1B 1L9MA 4W4OC 5ALBL 1I1RA 2JCCA 1JIBA 3WLWC 4HUWB 3WS3B 2UVEA 2UZIH 3KJ4C 3U30C 2FBJH 1FNSH 5ECJE 1NMBH 3CXHJ 3HG1A 1HI6B 4Y8AA 3TO2A 3C5ZA 4UINL 5HHOD 3MRQA 1CFTB 4H26A 4KGJA 4S1SL 3PV6A 4NQUA 4NQSA 4F2MA 1G7MA 5B39G 5GRYA 4JAMB 4XGZA 4H25B 5BVJB 5BW7C 4Y5YA 1OW0A 1A1MA 3QWQB 4AIOA 1AKJD 3W82A 3W9DA 2EKJA 2QQKL 1JWMB 1Q94B 3ARSA 2DQFB 2C3VB 5L6YH 5IF0B 3G04A 3E2HC 1NDGA 1Y0LB 1AD9A 2P5EB 3B8YA 2CJUH 1QBMH 2WP3T 3DNKA 5IR1B 1P4LB 1MH5B 4NQXB 2R2CA 2GITB 5ICYA 2EC8A 3AAZB 2PKDA 4MNGB 2GHWB 3BKMH 1EGJL 2F19L 4YHIB 3JTTB 1CXHA 3ARFB 1AGDB 4OGYL 3MNWA 4YHKL 5J56B 4LNVA 1AHWA 3QWRD 4DGIH 4JCMA 1OB1B 1AP2B 3FMGH 2YMXH 3GBNL 1VACB 4HV8B 5HDOA 2IMMA 4F9LC 5IB4B 5DRXB 2JJUA 1AQDB 1QSED 4P46D 1D7FA 1WZLA 2C1PA 4L9LB 1YJDH 3V5DB 3C6LB 4KQ4L 3K80A 5I1DB 1XGRB 3RIAF 3MTRA 2P5EE 1IZKA 2YC1A 1S9WA 4DAGL 1L0QA 2ZUVA 3HR5B 1JHTA 2OP4L 1A0QH 1N59B 1OGAD 5E2WL 3VJ6B 3CUPB 4PGDA 3HNVL 3D18A 3CFIC 4EUPB 4UTBL 5H35B 1VFAA 2R1XB 5F7EH 1QRND 4B7LA 4MNGE 3W2DL 4P4RB 3MJGX 3GIVA 4K7PY 4Z5RA 3QIBB 32C2A 5IFJA 5FGSA 1MCPH 1MFCH 4JDZB 4X8JB 1OT2A 2E9IA 1YYLH 2AK4B 4H1LA 2I9TB 3CDFA 5E9DD 4JFQB 4JPKH 5FV1L 4XPBH 1LP9F 5HGHB 1JGEB 2UUDH 3EYVB 4M6ML 1NDMB 3WFHA 1Q0XH 3SDCB 4P46C 3QO0B 2JKXA 3S36X 5J0BA 2Q3AA 3C5JA 4MNHA 2H32H 4ODHL 4F7CB 1I7ZA 2HLFC 5D1XA 3K46A 3MOAL 5CSBA 4MLSA 5FYJE 3BKCH 5CJXA 5HVHB 1ZTXL 2BC4B 3EW3B 2XQYG 4H20H 1OAYH 4QRSA 4WWKB 4OB5H 3L3JA 4OZIA 3BQUB 4BH8A 2AXGA 3UROR 2WIIA 4ZXBB 4P5TD 4ZPVA 3FQTA 4YWGH 3PG2A 4P2OC 5C0EB 5HHQA 1R3JB 2WIMA 2ZUQC 3VI3F 1L6ZA 1YA5A 1ZHKA 5GRVL 3MJ8B 2WWKO 1YN7B 2AK4E 3GMRB 1S7SA 3BAEH 3QISA 3HNTH 1WWCA 3N9GL 4Y2DB 1WCBA 1U8PA 3GKWL 2Y07H 3CDGB 1SHMA 4KV5F 1CBVL 3BPNB 2X4TB 3E3QC 1JNJA 5FOJA 2EDLA 3QFJD 4OFPA 4FABH 3I9GH 3LEVH 5DRNB 3PJSB 5HDLA 1P9MC 2JJTC 4OI9A 1P7QB 5CD5D 5FUOL 4PREB 1FO0H 1RUQL 2JB5L 4RFNB 4R97C 3DUUA 5KOVC 4FMFA 1TVBA 3GSWB 3O9WA 2HJKB 3QHFL 4BH7B 2VB5A 4PB9H 4PRPE 1NGWB 5F6IC 2FB4H 2CKBH 1H3WM 1QKZH 4F7TA 4ODSL 4PV9A 4P5TC 4AL8H 5EA0L 3O8XB 1VGEL 1H3GA 4U1IB 5SWSA 5INDB 2VC2L 5DJ0B 2ICWJ 4XX1G 3K1KC 4NKDB 3C08H 1UH4A 3U9UB 5I9QC 2Y5TA 1EO8L 3VG9B 3L9RB 4HS3B 4KY1L 2CO7B 2M8XA 4L3ED 2DYPD 3G5ZA 1DFBH 2HMID 3ES6B 4WU7A 1WTLA 1RUPH 4D9RE 3TVMA 4MMZC 3L6FB 1R5WA 2ZJSH 4HKZB 5CD5C 5FECA 3U2SB 3V0VB 1J9CT 1PD6A 4M8QA 4G6KL 1CLOL 1ONQA 2BP3A 3SE4C 3U0PB 4YHMH 4NKOA 2VOTA 1JK8A 4PLKD 4IDJH 3SDAB 1NBVH 3QUMB 5HYSA 3MLPA 1VCAA 1V3MA 4HSQA 4WEUD 4PB0H 1CGYA 3VDAA 4FQ1L 2VAAB 1NCAH 3IGAB 4GH7B 3H9ZA 1NCCH 4I48A 2CUMA 4R90H 2OJZH 1L9NA 2BOCA 4YO0B 1EXUA 4ZYKB 4X7DC 2ATPB 4QHMA 3V8OA 3VXOA 4N1CA 5I1AA 4RGOL 2HMIC 1BM3L 5EO9A 4R6UA 3GSRB 3DSFH 3T4AA 1KJMA 3QXDA 2VUYA 3NAAH 2EDYA 3KPNB 2AJ3B 2ENSA 5B22A 3QT2A 3VXMA 2RGSA 4GAJL 4EN3A 5JW4N 4DK6A 4YC2B 3GJEA 3MV01 4FQIH 3TBTB 2K1MA 3OZ9H 4NRZA 3QCVH 1ZSDA 4S11A 1NGYA 2E3VA 5CHNB 4PLKC 3Q2CA 4NUJA 4NQCB 4UAOB 4EI6A 9CGTA 4Y4HB 4Y4KD 1JZ2A 1BWMA 5C0FA 5KVGL 5D4QA 1PY4A 4YHNA 3IFLL 1G7JB 3T0EB 2CXGA 4PRAB 1F00I 4QRPA 4UDUA 3LPGA 4L5FL 1LO4H 4FQCL 4QCIB 2P42B 2XICA 1GGCL 1CVRA 4LFHG 4PD4K 2W1NA 3GJFK 1X4YA 4YUEH 2FATH 4PGCA 1TVHB 3RY6C 3AS3A 1CF8L 4OCXH 1UB5B 1VDGA 1SM3L 3TN0A 4GXUN 2UZXB 2J6EL 3D1MC 2G5BB 3WIHA 1N4XH 3CGTA 4HT1L 4MJIE 3F58L 3V95A 1ORSB 1FH5L 4FFYL 4WHYH 5ICZB 3FRPG 1AXSA 4LK4A 3HAEG 1A7NL 1I7UA 5D1QD 3I2CH 5DQDL 5F9JA 4Y4KC 3RAJL 2CRIA 1II4E 1RMFH 4XPHL 3T0EE 1FFOA 3S8WA 1YECH 1A3RH 2H3NA 4XBGB 1VB9A 5L2KA 1T3FB 4JM2B 2X5PA 2AEPL 4G6JH 3MJ9H 3MO1B 1ZAGA 3G5XA 3DV6B 4TQEH 5IESL 5FCUH 3SCMC 2VH5L 1T2JA 8CGTA 5TF0A 1AGCA 4OLXL 5EUOA 3SKJH 3C87A 3ZSSA 4MWFA 5CBAB 4I8DA 4YH6A 8FABA 3PABA 5KTEL 4IRSD 3GRWH 4KVNL 2YPLD 1A6VH 4P59H 4MJ4A 2GK0B 3UTTE 4X4ZA 3MBXH 4XPTL 5CP3A 4KK9D 5D1QC 3SKOA 4HG4J 1AI1H 5I17B 4WEBH 1F02I 1X4XA 3D9AL 1S7QA 3HC0B 5ITFA 1M7DB 1RJZA 5J1AA 1G7IA 1KFAL 5D2NA 1Q0YL 5GXBB 1RZKC 2PTTA 4CAGA 5KSVB 4OM0H 3T1WA 2AKRA 5CJOL 5IJKC 4N1EA 1IE5A 5JLZB 1OGTB 4Y8DC 4YPGB 3OJVC 3V4PL 2J1KA 5D6DA 5DZLA 5F1NA 2CGRL 4GMSL 5L2JA 4XP5H 3MGTA 5A2IH 1MF2L 1T6WA 2VMFA 3VH8G 4J3WA 5IIEA 4IRSC 1KIUA 3MA7B 4TVPL 3VFSA 4K07A 3BRDA 1Q9KA 1IAMA 2BVTA 4HK0A 1CXKA 1BFVL 1P4BH 3MLWL 4E0RB 5DLML 4KK9C 4RNRA 3FQUA 3UDWC 4AEIL 3JBG7 4YXKH 5GGRY 3KYOA 2IH1A 4KK6D 1F6FB 2H2PC 3MRLB 4M00A 1FVEA 4YDKH 4DVBA 2C26A 3C6LD 5C07B 3MROB 3GHEL 4HGWA 5HYQA 3GB7A 4HC1L 5CEZE 1T20B 2VDKH 1R3HB 1JTOA 3VFMB 3P0VH 4CRPA 3S3PA 1DBBL 4MAUL 2CDGB 4NO5A 3HA0A 1FJ1A 4HCRA 3RDTD 2NY0D 1X4ZA 4ZO6A 2ED8A 4YGVA 1S7XA 1I1AD 1UQSA 2CDEB 1MQKH 1DBAH 1N5AB 4Z7UA 4GOSA 3X14A 1T0PB 3T09A 3FONA 2ESVA 5D93C 3KLDA 1RPQA 2R2EB 5T1LD 1VGKB 1C7SA 5FHAL 3QQNA 4QHNB 3NA9L 5HPOA 3ULVL 5C07E 5CINL 3PGFL 3O4LB 5IQ7L 4J6RH 4KK6C 1DBMH 4L9LC 4S0SD 4U0RB 4XHJD 2HFGH 3WHE1 2NYYD 4PJFB 1CXFA 3C6LC 1KN2L 4ELMB 2F8OA 3VRJA 5JQ6H 1T2QL 1CTOA 3BPLC 4E41A 5E70A 2H41A 5E8PA 5HI3D 1QFOA 2ZUUA 5CUSH 1JZ7A 2Y06L 4IRJB 1QVOA 2I07A 3TBVB 2EDKA 1MCWW 4YDLC 1MRDH 4J8RB 2LABA 1A6ZA 4PRPD 1IAKA 3RDTC 1R5IB 4CU7A 2NY0C 3QIBC 2NPLX 3C2AH 1E6OL 4LCIH 4I1NB 1U8HA 1J8KA 2XACC 1I1AC 3MR9A 1IT9H 3H9SA 5JO5A 1JUFB 4Y2DD 4GMTH 2BHUA 4K94C 4TPRL 1Q72H 2FEDC 3B5GA 2Z0BA 4LEOA 5I1JH 3M8OH 4XMKL 1U8IB 1XZ0B 3FFCB 4PJFE 4WW2B 3FN0H 1CFQB 2NW3A 3F5WA 3JWNC 1G7LA 3QB7C 2Q8AH 4KDVA 5HGGS 1YEEL 4RISL 4XHJC 4D9RD 1BREA 4NQDD 2IPKB 2NYYC 5C0IB 2EYTA 2A1WL 3PL6B 3MRHA 4WI2A 1NUGA 2FHFA 1OAXL 2CDFA 1HOCB 5HVHC 3O2VL 3N1QC 2A0LC 3V7AE 4FFZH 1N5YL 3EGSB 4WWKC 3L7EB 4WFGE 1DEEA 3OKDB 5GSRA 1J88A 3NCBB 2PXYA 2WW8A 1WISA 2MPAL 4MZ3A 4N0UB 5E2TL 4QRTA 5LAXA 3UJIH 3VXSD 4JM2F 3BISA 4U31A 1INEH 4YK4C 4Y88A 4Y2DC 3FFCE 4X7TB 3REWA 4X4YB 2HKHL 1CD1A 3U4BL 3BPNC 5AEAA 5EC2B 2HH0H 2K7QA 1EK3A 1IGMH 2FJHA 2FIRT 3IJHB 1LE5B 2FHBA 3L3KA 5TE4L 1ORQB 1J1PL 2E5EA 4XNQB 4FFVC 4NFBA 1MSPA 4M6NH 5GRXG 2MCPH 1ZANH 4JFFA 4DFHA 5DQJB 5B39B 1UXWA 4LDLB 3B3IA 1HXMB 4ZO7A 1UJ3A 2CSPA 2YSSA 4LL9A 1ES0B 3ROOA 4G42A 4JRXB 4ZTOH 1A47A 4E9LA 2W60B 3I02A 1JMZA 4N0UE 4UTAH 3I50L 5JHDB 1A64A 3Q6FA 1HQRA 4MA7H 3SDAD 1JHKL 1Q8MA 5DJCA 1T21B 1FIGH 2ERJB 5DMYA 4M6OL 4P3DB 1KIQA 3JWDH 3EAKA 2ZUTA 4YFEA 3HZYA 2Q6WB 1KB5L 4ODXB 2MQ0A 4OT1H 5ACMA 1ZLSH 5DJDB 4JJ5B 1FIEA 4QXTB 4JO4H 2EH7L 4TNVK 3WDHA 3FO1A 4WFED 1MJ8H 2VZVA 2GCYB 5EU7E 3QFDA 4ZFZB 3VXUB 2MKLC 1UWEL 4HJJL 3IDGB 4JRXE 1O7SA 3CVIL 3T0DA 1CDHA 4MDIB 5E8NB 3JV4B 4KQ3H 4QOKB 5JHDE 1EBAA 3UTZB 1JWUB 5DJ2B 1YEDB 5FUCE 3FCTA 5FDYA 5I1IL 5LKNA 3SDAC 4MJID 3S98A 1L6XA 1B0WA 2VDLL 3RJQB 3UZQA 4JPWL 4Y4HD 2M1KA 3MRKB 4Y5VB 2KDGA 3D85A 2F58L 4DTGL 1FGVH 1N6UA 4CW1B 3I6KA 4XPFL 5IVOA 2VZ1A 1FO0B 4LQFH 4NNYB 4UB0L 3BP4A 2GTWA 4CVXA 2AJXH 3H7BB 3BHBA 3VXUE 2Q8BH 3EOTL 5H94B 4YBHA 1TJHH 4LSSH 2CKBB 1E4JA 2X4PA 4Y19B 2E7BA 1HXYB 4QOKE 4A6YB 3BP7A 4L3CB 5HJ3A 2YPVH 3LN4A 1VEMA 1KBGL 3GMOA 3T0XA 5JOFA 4PRIA 4HUXB 4MDJA 5BOPA 2VXVL 5D6CA 1GGBL 2W91A 4OLYL 4YC2C 4YX2H 5KAQF 2DDQL 1SJXA 3WXVL 2J8UA 4F37K 4LGPB 1LO2H 4PJXB 4OAWB 5GHWH 1Q1JH 1REIA 3TA3A 1CI5A 3S4SA 3V0WL 4KKNA 4UAOC 2RIKA 5DJZA 3VWKB 4Y4HC 4ZUSB 2HJFB 3UTTD 3MQIA 2H1PH 3BSZH 2B5IB 4FXKA 1Z9OA 4PJFF 1NKRA 2IAMA 4Y0GA 5EBLB 5T5FH 5M95B 1CD0A 3U7WL 4NO3B 3T0EC 4HFWA 2NLJB 4Y19E 1ZLWK 3ZE0E 5L9DL 3ZYOA 1PBYA 3MLTB 1H8NA 1IM9B 4I5BB 2VLRB 4RMWA 1CGUA 1TCRA 3LAFA 4Q9RL 2IPTH 2UYLA 1KT2B 1XAUA 3JV5A 1JPTL 4U1NB 5GQBA 4U1LB 2ZOKA 4PJXE 3VFOB 1VKXA 5CKAA 5TF1L 1FL3A 3BE1L 3DXAB 5LBSL 2A6IB 3OQ3B 1S3KL 1JCKA 4QRQB 4NZUL 3OKOA 4G9FB 4WI9A 4ZSOB 5JZ7D 2CPCA 4BZ1L 2I27N 1I7RB 1T1WA 2R29L 5KSBE 2QLVB 1RUMH 4WW2F 3ARPA 4XB8A 5FHBL 3LKRA 2PYEB 3MRIB 5MHSE 4MS8D 2NY3B 1B4JL 4M5ZH 4XAKE 4Y4FD 4X4ME 4YDVA 2DQHH 5CSGA 1F3JA 4KZDL 5JORB 4JZNB 4YR6A 1VPOH 2VLRE 4RX4D 4KMLB 3QEQB 2YZ1A 5HHVL 2DBJA 3SKMB 4IRZL 5E99H 5KVEH 2FR4B 1DN0A 2DS4A 4HWUA 3FN9A 4OD1H 3V6OA 4IIQA 1NUDA 3LIZL 1D9KD 3OV6A 1C16B 1M4KA 3UBXI 1IFHH 3BZ4B 4XP9L 5CEZD 2DWEA 4WCYH 2FX8L 1YMMB 4N0RA 1EEUA 4Z78B 4L8SA 2VLMD 4V1DD 4UUJB 1G7PB 1NFKA 1KJ2H 2O5YL 4G9FE 3ROLB 3VCLB 1KXQE 4ZSOE 5JXED 3S35H 1RIVL 3WL9B 2DQGH 1WTGT 2VE6A 3ARGD 4J3XA 3Q5TA 1KPVB 4XPAH 4N9GA 2PYEE 4G43A 3WO4B 4EI5B 1X5HA 2ARWA 3HUJB 5JZ7C 4MHHI 2JJSA 4NRXA 3QQ9C 4XX1E 1BIIA 4P23D 1D5ZB 4DN4L 2P24B 3R0MA 4MS8C 4LKCB 3QEQE 1OSPL 3GJFH 3DRTB 5ALCL 4Y4FC 1RZGB 2V2XA 3DTXA 2WWKT 4LSTH 5D2LB 4DQOH 5F1SA 3ZTJG 4I77L 4FQLH 3EZJB 1DQDL 3JUZA 3RZCA 1KV3A 4AIZB 5TDOA 2XV6B 5JPMA 2LVCA 4ZODA 4HIIB 3UXFA 3VD5A 1CXLA 4ODWA 4OCRH 2O61A 5FKAB 4ZUTB 4F9PA 1BZ9A 1NJ9B 1J1OH 1OCWH 3BP5B 1IC5L 1A6TB 4HEME 3P77A 4CU8A 4KI5E 4XNXL 4JRYA 1W0WB 4C57C 3VGEA 1IAIL 1JL8A 1OL0A 3IETB 1WBZB 3HUJE 5JXEC 1AY1L 1Q38A 1WV7T 2I60L 3RTQD 2B1AL 5MI0B 2JJWA 5T1MA 3ARGC 4LVEA 5DURB 1FGNH 2Z31B 1FVCB 1WAAE 5FDWA 5CSZA 3HN3A 1I8MA 4MQSB 4LBEA 1KCSL 4G8IA 4Y1AA 1TJGH 4NNXA 1JFQL 3TWCH 4WFHD 1EMTL 2QJDA 5IEKB 4NYLB 3FZUD 5D2LE 4J3VA 1ULVA 3DI2B 5CIPH 4DGVL 2H26B 1WCQA 3GSNH 3D25B 3OGCB 3QJFB 4RGND 1MHCA 3IDXL 5GS1C 4ZNEE 1ZT7A 3IXTB 2BNQB 4YBQD 4UILL 5CILH 4ESKA 5GGTH 1OTUD 1MCJA 4HKJB 3MLYL 5EB9A 3IDMB 1JGLH 1N26A 5I2IB 1YN6A 5GGRB 4UU9B 5FGBC 1JP5A 4JQXC 1F4WL 4MVBC 3EIFA 3MZTA 4WFGD 4MJ6B 2X4NB 5LJYH 1ACYL 5DMIL 2VZTA 3MPCA 5D1ZA 1P53A 3KPPB 4C59B 4QHKI 5JTWA 1CLYH 5L7XL 3V6FB 1F3RB 5I1HL 5EUKA 3G6AB 1BJ8A 4FQQA 1BOGA 5EBMB 3HAEB 7FABH 3ZE0F 3IJYA 3FZUC 2BNQE 2BJML 1DZBA 3EOBB 2EDQA 1HWHB 4ELKA 1BX2B 1QQDA 5ID0A 3NIDE 4D0BA 4PRDA 3RPKA 4G9DA 1K4CA 1Z6JT 1OTUC 3BVNB 3EYSL 4UZGA 5DUML 4LRNH 1LEGA 1Z5LB 4PJXF 4G3YL 4W6YB 3AGVA 1IGYA 4LVNC 4D2NA 1DQJA 4JEGB 3ZDXE 3W5MA 3HZVA 5FOBA 2ZUWA 3KLAA 5TDNB 2X9YA 4KMQA 4UV4H 1ZLVK 4X5XA 1HHKB 3W0WD 2BNRE 2X9XA 1MEXL 1GVIA 1MOEA 1WZKA 2CRYA 4M8VA 4OFYD 4RDQG 1R3IL 1DUYA 5I16B 1BHGA 1I3RB 3K0WA 1ZA3A 3OJMB 4NIKB 2Z4QA 3JWOL 3KVQA 5F8QC 4Q9QH 2GTZB 5MEQB 2A83B 1KCKA 3FFDB 1PG7X 2XI9A 3RBGA 4WW2C 1ZMYA 2AVGA 5CZKA 4DW2H 3QIUD 4LLWA 1H3PL 2P8MB 4KK5D 4L4TB 4WV1C 3FHAA 3RL2A 1CDCA 3I85A 1P7HL 3KDMA 3L5WA 4JRXD 2WUBH 4KUZH 3EFFA 3NPSB 3C5SB 1G6RH 2Q76A 5DD6A 4BQCA 4M7ZB 5FA4A 1YC8A 1S9VB 1KB9J 1RULH 2HRPL 3GNML 1INDH 3BOVA 2VXUH 1CXEA 2VXTL 1P6FA 2D7TL 3K2MC 5HHXL 1IC4H 3IFPA 3FT4B 4HXBH 1IQWL 2JELH 2COQA 1KC5L 1ZLUK 3VH8B 4U1KA 4D9LL 4OIIH 5LG1A 5EZOH 3UJTH 1LMKA 4MD5A 2AJVL 2QQLL 3DBXA 1KLFA 3UTQA 1MCWM 1RZIB 4L4TE 3CMGA 3WMSA 3O6LH 2BVOA 2D31A 1C5DA 3QIUC 5F97E 5HHNB 1A3LL 4KK5C 3TO4A 1SBBA 1MLBA 4XNZB 1G7HA 1UWGH 3WNLA 1U91A 1R6VA 1XGUB 2B4CH 5EU7C 5JW4Q 4KI5F 2D0FA 4GW4B 5C0GB 3EYFB 2PR4L 4RIRB 1A2YB 2GT9B 3HUJF 5DVKA 2Q1EA 4NGHH 1UVQB 3GSOA 3NABL 5FUCC 2AJZB 2ERJC 1TQBB 1WAAF 4RRPA 3ALXA 3KYNA 2GUOA 1I9IH 1KEGH 1PKOA 3LQAL 4JFDB 5D2LF 3DMMA 2UWEA 3TH2T 3BH9A 5C08B 2FSEA 2OL3L 4N68A 5AYUH 1L0XA 5JA9A 1PZ5A 2J8HA 5C92A 3BYTA 2DN7A 3KLSA 4YHOL 2C3GA 5F3HB 3MUHL 3RI5F 1ZS8A 4Y19D 1IGFL 3DX8B 2ZSWA 1DDHA 4MSWB 5A2KH 1Q9OA 3D0LA 1CFSB 3F12B 3UPRB 3GSQA 1GIGL 3V5KA 4OD3L 5MP6H 4WW1B 1FG2B 4G80A 3JV6B 3IS0X 3G6DH 3QDJB 4P2QB 2MJWA 1LK2A 3LKQB 4PJ5A 1MHHA 4L8CA 1FV1A 1FFQA 5DJYA 5E4IA 4HLZG 3D2UA 4JFDE 1AE6L 4F57H 4HUVB 4LF3A 3MUGB 4LSVH 1TITA 4ZFFA 4Y5VC 4RFEA 4EVNA 1T0NB 5MHSD 4GAYB 1U3YA 2W92A 4AMKH 5BJTA 4LNRB 2VLKD 1E4WL 5I8EB 3U0WH 3TBWA 4BQ9A 4KC3B 3NIDF 3SPVA 4AT6A 4X8XA 1IM9D 3C8DA 4D9QE 1AO7B 2Z8VC 5CP7B 1G9ML 4QYOB 1T7XA 3CLFL 5C71A 1KACB 4C56A 4CKVX 5AD0A 4K2UH 3GM8A 1XCQA 4UIMB 4MNQB 4BKLB 1N7MH 3QDJE 1HHJB 3ZDXF 4P2QE 2ZG1A 1KG0B 1MWAA 4Z77B 1C8PA 2WQ8A 2RAMA 3PWPD 3C09B 5SWZA 3FKUS 4Z7WA 5ISZA 1FORH 4YJZL 2AABL 1PYWB 3QDMD 2HT4D 3MV9B 3RKDD 4H8WL 1RJYA 1F4YH 12E8L 4N5ED 3HRZB 1UXSA 3VWKC 1HDMA 2YS4A 1IGJA 4ZFGH 2EO9A 4AQ1B 5I1LB 4HEPG 2B5IC 2D03H 1EHXA 3PF2A 3LV3A 1IL1A 5DD3L 3KR3H 2ZUXA 3S36H 1Q9LA 1AO7E 3QEQD 4MD4A 4ODUB 3HE6A 4G8GB 2ADFH 3K1DA 3VWJD 3OJDA 1SYVB 1MCDA 3L5HA 3MRNB 2VO5A 2W9DL 4JO3L 2E7LA 3LOWA 4KI1A 4J7RA 1XFPA 4I4WA 2DQEH 2WBJD 3UZVB 3QULA 2X4UB 3B2VH 3S37X 4LARL 4LRIC 1OAKH 4XC3H 3QEHB 4KGLA 4FP8L 4E42A 4TUJA 3FO0L 2AEIT 3MV9E 2F5BH 3RGHA 4X6BA 2NY7L 2X41A 2QSCL 2HT4C 1T04A 3JTSA 1MRFH 2DQTH 3A0OA 3RKDC 1H3XA 4N5EC 4QGTA 4GKZA 4KRLB 5DHVA 3R06A 4U1MA 1NCWL 1KUMA 3CK0L 3DROB 5I73B 1HSBA 4JZJC 5FYLE 3WNOA 5E6IB 4ZUVA 1PLGL 1CE1L 5GS3A 4UINH 4XC1L 1X5YA 5J8OA 1UFUA 5EO1B 3SDDA 1XGPB 2QADB 4JFEA 3A6BL 3MREA 2P8PA 4E5XA 5M7QA 4LLDA 3V4VL 3OKNA 4PUBL 5C0AA 1NC2A 4N90E 1RK1A 2IEPA 1MY5A 5C09B 5HGBA 2F8XC 2QKIA 3WO4C 1CU4H 4HULB 1A6AA 2EIZA 4W4OA 1ZLWH 1PFCA 1AGEA 2AK1L 5T1DL 3H0TB 2XPGA 1CLZL 3OKMB 4QTHA 1FRGL 1O5DT 1U8KA 2WUCH 1J8HA 2QSVA 1J1XL 1U8LB 3DVGA 3L5JA 1SEQL 4CNIB 3HG1D 5IHUH 3C5ZD 4DZBA 4HHAA 4AZ8A 5IT2H 3GMQA 2X70B 1PDKA 4BUGA 1T0MB 3AU1A 3MRCA 3BIKA 2GFBA 3MNVA 4C83A 4U49A 1U58A 2ATKA 1NANH 3RA7L 4LLVB 5EOQH 5GGSB 4KQ4H 2VKXA 4HIXL 1OD7A 5C09E 4K9EH 4ONFL 4DFIA 4CADA 2D4FA 3VGDA 2HKFL 1NANI 3HNVH 2W9EL 5MI0C 4UTBH 2Z31C 4M7KH 3BKYL 2BNRD 1MWAL 2IFFL 5J89A 3W2DH 3QRFM 1Q9WB 4U6YA 5EIVA 3CVHA 3BO8B 4RWHA 5IB2A 2GY7B 1QFHA 3U83A 3STZA 4U6VL 3QWOB 2H8PB 4JFPB 1A4KB 5HHOA 4CN4A 4F9LA 1TETH 1TTUA 1HE7A 4S0TD 5AZEH 2YD4A 3RX5A 5IGXL 5C9KA 5INCA 3T8XA 2BY3A 5HHMD 1KJ2B 2NTSP 3C5ZC 5T3ZL 1PJ9A 4AENB 1H3VA 2Z35B 5FAAA 1AKJA 1BLNB 1DBJH 4PJBB 5FO9B 2YD6A 4HIHB 5EU5B 5ID1A 3SE9L 1HWGB 5IW1A 2NZ9D 4O2CA 1G7QB 2JLLA 4L29A 5LGHL 2AJYL 3N1FC 4PTTB 1P84K 3THML 4ZFOA 4NP4H 2W0KA 4R7NB 1BQLL 3I84A 2WWMD 3ARYA 1HHHB 4U1HB 5JHLL 1LEIB 3GJFB 2YD5A 1ZTXH 1RQ5A 4H0HB 1T2XA 1B4RA 2CRMA 4NJAL 1QSFE 1B2WL 3ULUL 5EU6B 5IMKA 3IRPX 5I66A 1AGFB 1V7MH 2V7HB 3TGXA 5D8JH 2P46B 1T89A 2CIIB 3U4EB 4M48L 2GSGB 1RFDH 1YEFH 4F7EA 3E8UH 1DLFL 2GJ6E 5I74B 2X4QB 4L4TD 3DGGA 2P8LA 1SJHB 5ERWA 4PJBE 4HGKC 3QG7L 1QSEA 4P46A 2ZP0T 4BJLA 2G9HB 5ITBL 1FNEA 3TJEL 5IOPA 1U3JA 4XI5D 3QNZA 4G6ML 1DSFL 2EIEA 2WK2A 1DBKL 4M02A 5TFSH 2G75B 4LCYB 4KZEL 2E6PA 2V7NB 2UZYB 1RUQH 3C8KA 4GAGL 4JY4B 4HJGA 2UV3A 2BXYA 4P2OA 5CIPB 4HX1A 3QHFH 3GSNB 3TP4A 3LKOB 2FEEI 4I3GA 4IHOA 2DICA 1FC2D 3X12B 4AY0A 1BJ1H 1C1EL 1PX4A 1V7NL 1QP1A 4H1LG 2VC2H 4FTVA 3O2DA 5E1AB 1Y6MR 2XKUA 5F9WB 2ARJB 2FYYB 1U93A 3SEPA 2X4RB 3QCTL 2Q7YB 4GQ9L 3QUYD 5IJVB 3FQWA 4P3CL 1XF3B 3V4UH 1F6AB 3G08A 1TJIH 3IFOB 2JJTA 2D7NA 3QJHB 1CGWA 5DC9B 3BW9B 2CLZA 3D39E 4XI5C 3NPSC 5T3XH 1M6OB 4M7ZC 1K8DB 1U8QB 3HHRB 2VERN 4KKBD 2DIAA 4DCQB 3EYUL 3PQYA 1A9EB 3PGDB 4LLQA 1UGNA 3K7UA 3O9WD 4P5TA 1S9YB 1PY9A 5SWQA 3OAUL 4JANB 4P9MH 4PJEB 4JFDD 5EZJA 1NEUA 1AIFB 4PY8I 2APTA 5BS0A 4XBPA 3KGRA 4DKEL 2PTUA 5SWSD 3KYKH 1DANT 1TZHB 2ADIA 3GSUB 2BSTB 1NCBH 3SDYL 5D9SA 4JCLA 2XN9B 3SE8L 4HWBA 4N8CH 3QUXB 1DQML 4WNQA 3QUYC 1FZMB 3WLBA 2XIDA 1CWVA 1LK3L 1YNTA 3IXAA 4D9QD 4TULH 3CVHL 4EDXA 4JGJA 1WITA 5F7FA 1R5VB 4ZD3H 5EN2B 3ARRA 4LMQE 1ZLVH 3RKPA 4PP2B 3FB7A 2R2BA 4X98A 1S5HB 3VU2A 4JY6A 4H1LH 2R0WL 5IVZA 1RU9H 3AMKA 4ZQKB 3SE4A 1R3LA 4XVSL 1DR9A 3NMEA 1WJ3A 3LPFA 3E1F1 5E2VL 4M93B 5F96H 4QY8A 3HC3H 2APBA 5KSAD 1KTRL 1NMAH 2X2YA 3CCHA 1KJVA 3DX6B 5T1KB 2W59A 1T4KB 4M4RA 3NZ8A 4Q6IA 5IFHL 2X44D 3RWHB 1MNUH 1XT5A 3GBML 4L4VB 4YHLH 5H2BB 2BVPA 2GSIB 4L3EA 1NAKH 1G6RB 4ZTPH 1RVFL 1D5BB 3O0RH 5HSFA 1ZA6B 5DTFA 3T3PE 4LOUD 2ADGA 5ILTH 4HWEL 3QNYB 4OLUH 3T3ME 1GJIA 1AXIB 1UZ8B 1OAZL 2R56H 4HPYH 5HYJB 1GGCH 3LEYL 4XP4H 3BX7C 5EORH 4PJAB 2F5AH 1ZLUH 2GJZB 5TDPB 1LEKA 2XWTA 4TVPD 2CH8A 4OCMC 3WHE0 1D5XB 5J06A 5AZ2H 1A6PA 2BOBB 5DHYB 4LQ1A 4B53A 3W81A 1BFTA 5KSAC 4CMHC 3TZVB 3QO1A 4HT1H 1MIEH 3L1OH 4U33A 3MNZA 1QO3A 4L4VE 2APWA 2BVQA 4LLMA 4FFYH 1ZVSA 2XNAB 3KNBA 4PJBF 5I30L 3REVA 3QUZB 3EO0B 3D0VB 2R0KL 3MJ7B 1T7ZA 1XGTB 2VUOA 3A67H 4YFLI 4YBLB 4QXUH 3T65B 2BMKA 3SGJC 4NJ9L 5A3ID 2XZZA 1KCUL 3AFLA 2ICCA 2BSSA 1QLRB 3S96B 4QRPD 4XCFH 5HYJE 1LP9A 4LOUC 2AEPH 1J0HA 4PJAE 3RY6A 1J86A 5A2JH 4PRHB 1MCBA 3DRQB 4OV5A 1K5NA 3C09C 4K7FB 3MXWL 5CBEB 3IDNA 3EO1B 1U36A 1J5OL 4TSCH 3TN0D 4OLXH 4UIKH 4N90D 5C2BL 4FZEH 3S5LA 2A73B 2EDOA 4HUNB 3ECBA 3BP6A 5IB3B 4I0PD 4O51A 3CAFA 1AXTH 2XKNB 2YD2A 3WYRA 4KVNH 4G7VL 3ULVD 1ETZA 2JK5B 4TOYL 1I8IB 3P4OB 5E6ID 1RHHB 2EKSB 1D6EB 1DQLL 2CLRA 1CG9B 4Y16B 4ALAH 2W9LA 4Q74A 5L2KD 5C0BB 4PRHE 3WKMH 5BXFA 2QADD 3SCMA 3SGKC 1SYSB 4I18B 4OLZH 2OXHA 2D0HA 3U6RB 3UC0L 3PXJA 1F8TH 1JPST 1KEML 3EOAA 3EDKA 1S7WB 2Y36H 1FC1A 1BQSA 1MFEH 2AP2A 2YN3A 5HD8D 5C09D 2NW2B 1K2DB 4KMTL 1FHGA 1U6AL 4Q97A 3QDGB 4N8PA 1DQQB 2HJLB 3BWUC 3BWAB 1MI5B 3F7VA 4I0PC 3CDYA 1OAUL 2QR0A 4JHAH 5FB8A 1AD0B 5I73C 5C3LD 5B38G 5C0DB 1IC7H 4D8PB 1ZV5A 4JN1L 4MA3B 4X0KB 1UM6H 1UH3A 4YXHH 5JXAL 4I13B 3BESR 4IBLT 2A77L 5E6IC 5C0BE 5ESVA 2YPKB 6FABL 5DRZA 3GI8L 5FYJU 4AEIH 2P44B 4P49A 3QUKA 4XBEH 4Z7QE 4HD9A 1MREL 2QADC 3TNNB 5A16B 3NFPB 2VQ1B 5LXGH 3IJSA 4P2RB 3GGWA 4RQQB 3O2WH 1X5GA 4RAVA 4KAQL 3DWTA 3O6ML 5KVFH 1JGUH 3O3EB 3VRIA 4ERSH 5HD8C 1DBBH 1U2HA 3PDOA 1MI5E 4IRSA 4K3GA 4NQVB 3RBSA 3U9PL 1RIUH 4PJIB 2LU4A 2DLTA 4HQQH 1QSFD 3WS3A 3U1SL 4GJTB 1VFOA 4OZHB 3MRMB 1VENA 1N0XH 1F42A 1HI6A 1RJLB 4EXPX 5ENWB 4LHJB 2ICWA 3VRLE 3UDWA 1CFTA 4NUGH 4ZDHB 2P4AB 4JFOB 4L8BB 1E28B 2OK0H 3T3PF 4JAMA 3WIHH 2GJ6D 4H25A 3EJZD 5BVJA 3NFSL 3T3MF 5E0QA 1F45A 2GYSA 4XNYL 2I9LB 1Q94A 5AUMB 4BZ2L 4P2RE 3ULVH 2DQFA 2C3VA 2NZIA 1KIPB 1WEJL 5IF0A 3SY0B 3HKFA 4RWYH 5FUZH 2ZCHH 1QR1B 4JG1L 1E4XL 1VHPA 2R4SH 2P5EA 3WSQL 2YN5A 1MCQA 4NWUL 5J6HB 4C54A 2ENYA 3MLSH 3TYGL 1EEQA 5IR1A 4M6AA 4NQXA 2GITA 3FT2B 4FQPA 4WRLA 4MNGA 2VITB 4AG4L 5E24E 4OZHE 3X13B 5JR1L 4M61B 2B7DT 5D5ME 4YHIA 3N50A 3JTTA 3PE9A 2HWZL 5I1CH 4JFYB 1IEHA 3I75B 1E6OH 2DQUH 1WBXB 4OSUH 1OB1A 4X6FB 4S1QL 2FL5B 4HV8A 1VACA 1MFDH 3TNMA 2ESVD 5I8KL 2I24N 5DRXA 5IB4A 1AQDA 3L3OB 4AYFA 1PKQE 3MLRH 4KHXH 4L9LA 3V5DA 3EJZC 1KTLB 4PJAF 2EZ0C 1U8NB 4XMKH 5HI4D 3C6LA 5I1DA 1XGRA 4QNPE 1GHFH 3H42L 3HZKB 3HR5A 1DEDA 2DM3A 1N59A 3VJ6A 3D39D 3CUPA 2FJGB 3CFEB 5H35A 3EYOB 2R1XA 2EIDA 3HMXA 3OHXB 4KJQC 4P4RA 3RDTA 2HG5B 3DVIA 1XMWA 3QIBA 1G6VK 1V3KA 3BT2H 4EJ1C 3BZDA 3MCKA 3TYFB 5DQ9A 3MXVH 4JDZA 4X8JA 3FQRB 4HMCA 4OCSH 2BVUA 1RIHL 2J4WH 5F7KC 4R8WH 4JHWL 5JMOC 2OL3B 4OIBA 2AK4A 2I9TA 2X9WA 1T1ZB 1AGBB 1FL6B 5CJBA 3P2TA 3H9SD 4JFQA 1UKSA 4O02H 5IWLC 4OLEA 5HGHA 5I74C 1JGEA 3RX7A 2QHRL 1ZVHA 3EYVA 3RWGB 1NDMA 4OFVA 3WXWL 3QO0A 5I71C 1BEYH 2NXZD 5I1GH 4XPGH 5HI4C 1DVFD 2AGJL 3FQNB 4U6XB 5GZOD 4JY5L 4PJHE 4RMSA 2B1HL 5DSCB 1IGCL 1I9EA 3LHPH 4WWKA 3BQUA 1T22B 2R39A 4ZXBA 4P5KB 5JW5B 2SEBA 4PRPA 3RPIB 1NAMA 2BFVH 1R3JA 3PP4H 4NO0B 3B9VA 3PV7A 1OQOA 1G9NC 3MJ8A 3IB4A 1YN7A 3FO2B 4U6HB 2I5YL 4HPOH 2PXYD 3I50H 1UM5L 4PV8B 2FX7H 1JHKH 2M26A 3LS5H 3HLAB 4M9OA 4Y2DA 3JXAA 4GRLB 2W0LA 4WI7A 3T2PA 1MCOL 3U82B 3HCVB 3QIWB 5F9WC 1QLEH 4FQXB 4GLRH 2X4TA 1X3DA 3STLB 2IWGA 3TPUB 2RFXB 4HCRH 5SX4H 4K55A 4OFIA 1OTSD 4X6DB 2DM4A 1GZQB 1M7IB 3RY5A 1YNKH 4Z7QF 3PJSA 3QPQC 4GAFB 3D69B 1P7QA 4PREA 4GLRI 5EFIB 2C1OB 1HILB 5DD0H 2EH7H 1DVFC 5SX4I 3VXRB 1CGTA 1EO5A 5GZOC 3GSWA 1UCTA 2HJKA 4BH7A 2IANB 1FLRH 1NGWA 4JFFD 4M62L 2YHGA 4M43H 5GRWA 2Q86B 2WLZA 5FO8A 2EXWD 1EA9C 3EDDA 4WHTB 2X4OB 5EBGA 3O8XA 5INDA 4K3HA 4NKDA 5T1KD 5EU4B 3PWJB 5B21A 3VRLF 5C0RH 1MAKA 3MBEB 4PRNB 3L9RA 5C8JB 4HS3A 2VDLH 4NHUB 1S9XB 4X6DE 4XAWL 3LKNA 5F6HJ 3ES6A 4NKIH 4R4BB 5I6XC 2KH2B 1P5UA 4Z7VB 3L6FA 3MRQB 4K3DH 5F1IB 3VXRE 2XTLA 2ZWLT 5DR5L 1XF2B 4HKZA 5GS2D 5CFHA 3U2SA 2IANE 4I9WD 5DWUH 3V0VA 3M17B 3BDYH 3EOTH 3MUZ1 2XRAL 4JFXB 4P57B 1UG9A 1A1MB 5JW3H 3UTSB 3SJVE 3HI1B 2D3VA 1XF5B 1ZXQA 1CK0H 2KPNA 4CVZA 3U0PA 1NGPL 3G04B 4OZHF 5D5MF 1EUUA 3P4NA 3SDAA 1MPAH 4M93C 3QUMA 2OX5A 3RWDA 4BSWB 4X80L 3SQOH 3MODL 3TH4T 3GSXB 4UV7H 3AXLB 5FYJL 3HMXL 5DDHB 3TBYA 3IGAA 4K23H 3FJTA 4XRCB 3IAQA 2KBGA 2FJFA 4YO0A 3QUZD 1K85A 2ATPA 4Z7VE 4TSAL 3WIFA 1BGXL 1G0DA 5ESAA 3I6LE 4QNPF 1RHFA 4JQIL 1LDPH 2DKMA 2FZ3B 4DJMA 3H3PH 3KPNA 1XGYH 4PRHD 2AJ3A 3UTSE 3MV8B 4FQHA 5EZLA 4A2MA 4UBDD 3PWUB 2G2RB 3TBTA 3HPLB 2O5XH 2YC1B 3WFBL 4PJGB 1LO0L 1JPTH 4X9GA 4ORZC 4PGDB 4QRRB 1VFAB 3CXDH 4MJIA 1TZGL 3BE1H 1HIML 3OF6D 4Y4HA 4RCAA 1TZIB 3WV0A 1S3KH 2F53B 3FOLA 4F58L 5IFJB 1FAIL 1EBPA 5DXWA 1G7JA 3QUZC 3T0EA 4PRAA 1B3JA 4B0MM 5FHBH 4JKPH 4O2EA 4Y16D 2VDRL 4S1RH 4QCIA 4H1LB 4CN6A 5CGMA 5C0BD 4XTRD 4HWZB 4PJHF 2V6HA 4KZDH 3MV8E 3SBWC 1TVHA 1S7RB 1KTDB 3PDDA 3GMLB 4WEMB 1UB5A 5JNYB 2IG2L 4MNHB 4PJGE 4R4FL 2G5BA 4UBDC 1CTNA 1WLHA 4QRRE 1YNLL 3U79A 4WDIB 2VISB 5F44A 2FO1A 5GSVB 1ORSA 5GS2H 1XF4B 4K8RL 3C9NB 5ICZA 2F53E 4PGZA 1L7IH 1X7QB 1HNFA 5FK9B 1JF1B 4UNTA 5C6TH 1D6VH 1PG7H 3HR6A 1P4IL 1RIVH 3ZYIA 4JQVA 3UTTA 3QHTC 1HEZB 3D87B 2Y25A 4EDWL 4XBGA 3VXNB 2DMBA 1S7SB 1N8ZB 1RZJH 3GI9L 3QQ3A 3MO1A 2XG4A 4Y16C 4U4BA 1KGCE 3LQZB 5AG9A 3Q6GH 4P9HH 2I26N 5E4EB 3DV6A 4G6FB 3HZMB 4HK3J 3DX7A 2C4FU 3L5XH 4I18C 2XFXB 4O00A 2YXMA 1EHLL 4P5MB 2EDDA 4JKWA 4JB9L 1JPGB 3P30L 4M5YH 4JR9L 1MFBL 4MA8L 2YUXA 3MOBH 4R96B 2DD8L 5E8EB 1IC5H 5IW3A 5E5UB 5FCSH 5F9OH 1JN6B 2GK0A 1CFVH 4X6DF 4XP6L 4RFOL 1B90A 1HK6A 5ADPL 5MENB 4GRMB 5T3ZE 4JPVH 5ABDE 5I17A 1ZWIB 3RNKB 4YDJB 4LP5A 1M7DA 1NGZB 4X7SH 2AI0L 4YDIL 3MFFA 5KSVA 4WU7B 35C8H 4HXAL 3S88H 3IDXH 4Z0BL 3RZCD 4L1HA 5JLZA 3TVMB 3VXPB 2DL2A 5DMKB 1OP3K 4UILH 2D2OA 1MUJB 2I25N 4YPGA 3CPLA 3CX2A 3ULUE 4POUB 5IFAL 3OTTA 5JXEA 1FPTL 3DVNB 5MERB 4L8SC 3CJJA 4JRYD 4N0CD 3ARGA 3AC0A 3MA7A 3PP3K 1A7QH 1X5JA 3TT3H 4LCWB 2YD9A 3JWOC 3UO1H 4NNPL 5MENE 4MQ7B 5E56A 2GI7A 1JK8B 4E0RA 3MLXH 4Z7VF 1L7TL 5EWIH 4KKAD 1NGQH 4EBQL 3HI6L 4X83A 4IOFD 1IQDB 4MX7A 4UT9L 3RRQA 2LTQB 4Y1AD 3RL1B 4MAYB 3P3YA 1C5BL 1IKNA 5J6GA 5C07A 4OLVL 3NH7L 1EXUB 3X11B 4LLYA 4B5EA 3QG6A 3PHOB 5BMFL 3VXOB 1T20A 5SV4A 1R3HA 1F4HA 3VFMA 1MY7A 5F7DA 2KUTA 5FGBA 5GRJL 3T08A 4FNLL 5GJTH 5HYFA 1CD8A 4JQXA 5J9PB 4NWTL 2CDGA 5DT1L 1F2QA 4NN7B 1ED3B 1WF5A 3TF7C 4ODTH 4LCWE 3NIFE 3E6FB 4N0CC 2DLFH 4DN3L 1N5AA 4JVUA 2Y7QB 5HHPB 3DV4A 5D1ZD 3CFJB 3TEUA 3RWFB 5EZIL 3VFPB 1MEXH 4OUUA 1W72A 1VGKA 3MCG1 4QHNA 1ADQL 4IMKA 1OSZB 3QCUL 4IOFC 4N0FB 3HRPA 5J11B 1KENL 4PJFA 4OF5A 4FN0A 4JO2H 5L88H 2D9QB 4UDUB 4PJGF 4J12A 3RVUD 3GDBA 3LSOB 4IRJA 5LCVL 5GGQL 2NY1D 1P6AB 3L5IA 1U3HD 1VFMA 1MJUL 4OCWH 2OJEB 4TUKH 4J8RA 2YEZB 1E27A 4F3FB 3CSBA 3K2UH 1IAIM 1R5IA 4WGWB 4LSQL 5IBUG 4NO0D 4U0QB 4W6WB 4HF5H 3W9EA 3LZFH 3EO9H 3GO1L 3KXFE 3LQAC 1RD6A 2KL6A 1JUFA 4GRLD 5DGRA 3IDYC 4DEPC 5GGVH 1Y6NR 4XCCL 1QFPA 5JOPE 3ALWA 4WU5B 4X5WB 5J13C 1S5IH 1AQKH 1U8IA 1RZ8B 4HFUL 5IEHB 2GW5A 3ZKMD 4WW2A 1CFQA 3RVVD 5B38B 1YEKH 4ZS7L 4WV1A 2V17L 4NM4H 3V79C 2IPKA 1U8JB 5C0IA 25C8H 5BO1L 1QYGH 2Z8WC 4DVRL 4KHTH 2X1WL 2EDHA 1HOCA 2IAND 3RVUC 1GL4B 2B0SH 2FIKB 3EGSA 3CU1A 3G5XB 3L7EA 2NY1C 1U3HC 5AWNL 2VR5A 3SJVD 4OUOA 4N0UA 2FO4B 4DKFH 1T5WB 2HP4A