1HXMB

Crystal structure of a human vgamma9/vdelta2 t cell receptor
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
230
structure length
230
Chain Sequence
AGHLEQPQISSTKTLSKTARLECVVSGITISATSVYWYRERPGEVIQFLVSISYDGTVRKESGIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALWEAQQELGKKIKVFGPGTKLIITDKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWEEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords GAMMA-DELTA T-CELL RECEPTOR
publication title Structure of a human gammadelta T-cell antigen receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 230
sequence length 230
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2001-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hxmB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hxmB01
2AV1B 4MJID 1IAKB 4NHCL 5JNYB 3GSNB 3WIHL 4CU6A 3SE8L 2IG2L 3U30B 4H1LH 3AC0A 3H7BA 4JO2H 1V3JA 4PJGE 3GB7B 1MRCH 3CSYB 3X12A 1E4KA 4GBXD 2FHBA 1ZEAL 4NPYB 1RZGB 3MGAA 4LGPB 4DW2H 4LU5L 2XNAB 2Z4QA 2DQEH 4KZDL 4OBRA 1U8KA 4NJAL 4LVHB 4BZ1L 5EU7C 4NWTH 5CJ8A 4BQBA 3QXUA 1AKJB 1F6FB 3BSZL 4HJJL 5EBWB 5GHWL 3NGBC 4FA8A 4KPHH 2DQTL 4OD2B 1GGCL 4X4ME 2DQUL 4J1UA 2MPAL 4FHBD 3L1OH 1L6XA 2A9NH 3Q1SH 5E6IB 4F7EA 1J0YA 3D2UD 3OB8A 2HFFA 4ALAL 1WBYA 1FCCA 4C4KO 3MLWH 4P4RA 4P9HH 5IF0A 3KPSE 2NLJB 1YMHB 3I50H 4NO3B 3MV7D 1D9KC 4QXTA 2Y5TB 4XP9L 3L95B 4P2OB 4CMHB 1H3VA 3MA7A 3SHSA 4J8RB 1RZ7L 5SWZA 2HWZH 3VFVB 5GIRB 5E1AB 3KXFD 3MJ9H 3VFNB 2F53B 5FYLH 4X6BB 1C08A 4M43H 1NAKL 1KN4H 3PV6A 5D96B 4L8BA 1WWWX 2AXJA 3WJJC 2R1WA 5CIPB 4MS8D 4DN4H 1JRHI 3PJSA 1T3FA 4UQ2B 2VWEE 1FSKB 4XNMB 1A7PH 1YEGL 3ARBD 8FABB 1HHJB 1PKQB 3GJFH 4ZYKA 4GBXC 4X6FA 1NC4B 1T1XA 2ZCHL 1MQKH 5HHNB 4Y4FD 4YPGA 1G1YA 4NQEA 4QRRE 1A6VH 4OM0L 3P2TA 2BJMH 2YSSB 5I1CL 1L0XA 5JORB 1FV1A 2FLRT 3ARED 4FQJH 4XNYL 1EXUB 5DDHB 4L8CB 4BQ8A 1JNJA 3QDMB 1QKZL 4BUHA 1S7SB 4G9FD 3VXPA 1LE5A 3WIFB 4YEEA 5HHOD 2BNRE 5D5MA 5IWLC 1J88A 3QCUL 3GSNL 3L5XL 1K6QH 1QO3B 1OWWA 3RDTC 4KROB 1OPGH 1MFDL 3HZVA 3VRIB 4LPTA 5D2NA 1EVTC 3DBXB 1PDKA 4PJFE 1BIHA 4WW2F 2BNUB 1RUAH 1MJJB 1M7XA 4FP8L 5FUOL 1OQXA 1CDIA 1JWUA 1ZWIA 1BVKA 4BSVA 2YEZA 2LAGB 1YEIL 1D7FA 3QFJD 4OCNC 4P23D 3OR6B 4PJXB 2YRLA 1BECA 2A38A 4NKDB 4QOKD 4HS6A 3C5SA 4PTTB 3K80A 2VDKH 3JWDC 3AM8A 2N56A 2QQKL 4CDGC 2BCKB 4ZNCD 4M7JH 2ILLA 1KNOA 4KJYB 1HH9B 1KN2H 3ARBC 4ZMAT 1U8PB 4QF1A 1HN1A 4NCC2 1U58A 3DUSB 4UMGA 2DIJA 4XBGA 3F7PC 4R4BA 5DWUL 5I1KH 4S1RL 1QYGH 1FLRH 4Y4FC 1U8IB 1KBGL 4OCWL 4PGCA 1NFKA 1P1ZB 3VGHA 5GRYA 4LSUL 5CWSB 5C0DB 1CGSL 1L7IH 1KFAH 2ZOKA 4KI5D 4OV5A 3T0AA 4HUKB 5FYKL 1YPZE 2QSCH 4EZMA 2V5TA 5B22A 5I15H 5H94B 4DZBA 1F6AA 1BZ7A 2MSPA 4P46D 1C5DA 1QR1A 1D5BA 4R90L 4H1LG 1FGVL 1YMMD 3QUXA 3NA9L 3DVGA 2NYYD 4H1LA 5E2UL 2AK1H 1YEHH 1PZ5B 1YYLL 2VLLA 3UMTA 2J12B 1S7UB 2Z35B 3QNYB 3JWOC 3F5WA 4PJDE 4HWBH 1ADQH 3MRBB 4YHOL 1V7NH 5DTFA 1KPRB 1J5OH 1HHHB 1NUGA 3ARGB 5GS1C 3RZCC 4P23C 3TCLB 3B9VA 3FKUS 5FUCC 3QHZH 3B8YA 4GRLA 3LKOA 4XBEL 2YPVH 5IBLD 5JOFA 4MMZC 3TP4A 3EOBA 5DJ6A 2FL5A 1NL0L 5I6XC 5JW5B 1FN4B 2GK0B 1VCAA 4N1CA 3RX5A 2JCCF 2OJZL 4D0DB 5HHMB 5JOEA 1ES0B 5DYOA 1CTOA 1HI6B 4RGOL 3WXWH 3CK0H 1OP3H 1P5VA 4NT6A 3CDGA 5KAQF 4RAVA 4LAJH 2DL2A 1RZIB 4UBDD 2LE9A 2RGSA 1AH1A 2YKLL 3J7HA 4KI5C 3AY4A 4ZODA 2WQ8A 3MJ9A 4MA8H 5CAYB 4JCLA 2G75A 4OBSA 3WFEL 2BRQA 4QTIL 1W2KT 1NCAH 2P5EB 1MJ7H 4TUKL 1U8QB 3MNVA 4P46C 3IT8D 3IB4A 4X6EB 3U46B 1S78D 5HHXH 5ESAA 5F6IC 1XFPA 1P7KA 2ESVB 1AJ7L 4KXZI 2CK2A 3RQ3A 5GRUH 3RA7L 3WV0A 2NYYC 4XHJD 3DURA 1UKSA 1ZT4B 4NFDA 2PW2B 5TQ0H 4LL9A 4RFNB 4LQFL 3LH2H 1CFTB 4PJ9D 1ROWA 3MLUL 4LLWA 2NX5D 4GXVH 5FFLA 2BSSB 1U42A 2MKWA 1XMWA 3S5LB 4RDQG 1FFNA 3QHFL 1KGCD 4LPUA 1JN6A 3FOLA 5EULV 4Z95L 1OARH 2W60B 1MHCA 3IGAB 3MLYL 1GZQB 3U0PA 4W6YB 3LVEA 3G6JA 2VITA 1DE4A 5IP4A 3HFML 3FFCE 3UAJD 1NFDB 5CEZE 4JFZL 2A77L 4N90E 2FYYA 5KN5A 4V1DA 5IBLC 3FT3A 5JW4M 4FQXB 4Z8FH 1JRHH 5ETUB 5L2KE 2VTFA 4WHTB 5AAMA 1FL6A 5IKCB 4IRZL 4L3CA 2G5RA 3TPKA 3HI5L 1A2YA 3GMLA 2Z92A 1DANT 3STZA 1UEYA 2CLRA 4UBDC 1WAAE 2FX7L 3IFOA 3VU2A 2UUDH 3CSPA 5LQBL 4I5BB 4FS0A 5I8OH 4KTDL 4R96B 4G8GE 3PL6B 4YXLH 2X70B 5D72L 2B0SL 1Q9OA 1XR8A 4KWUA 2ADFL 3O4LB 1J8HB 5D7LE 1DQML 4XHJC 5DD3H 3HNSL 5JPMB 2F53E 3F7YA 3E6FB 1RJZB 3BKYH 1A7RH 2Z0BA 3GMPA 1IGYA 2WIIA 5GGRA 5E9DA 4JDVB 3F12B 5IHZA 3WN5C 3M45A 4Y5VA 1IEBB 3QCTL 4BFIA 4Z7QF 4TRPL 3X14A 5I1DB 3UAJC 1K2DA 3H9SE 2C7UA 1ZSDB 2FO1A 5FGBA 1X5KA 2VQ1A 1TQCC 2R2BB 3QNXA 3HAEH 5I71C 4WI8A 3NGBB 4NP4L 3ZKXC 4WNQB 3I6GA 4YDVB 1YC7A 4ZUSB 2FD6H 1DBJH 4D0BA 5T3ZD 1S9VB 3BWAA 2D31A 1MJUL 2J1KA 1SQ2N 4JFFD 3NBNA 1J12A 4ERSL 5FKPA 4U1LB 5C2BL 1INEL 5DK0B 1RUKL 1S9WA 1XGRB 2PO6D 5IB1A 5E6ZA 4YDKL 1D9KB 5AWNH 2QKIA 4HWBA 1EGJH 5B39G 1ADQA 4LPWA 3R1GL 5DMKB 4MNQB 3S96A 1AO7E 1RU9L 3C08L 1GSMA 2AK4B 1PJ9A 1WIPA 2XN9A 2CDFB 5C0IB 2UWEB 3OPZL 1S7WB 3CXHJ 4XAKD 3QIWA 1HXMB 4HF5L 2UZIL 4MJIB 1EJOL 5E08L 1FVDA 2I07B 4JRYA 2R2HA 1G0XA 5A1AA 3MCKB 2ZG2A 5HDQH 5HYJD 3GSQB 4HJGB 3BZFB 1FZJB 3C60D 1UCTA 2VE6A 4YHKH 2FB4L 4GBXB 3MTRA 3F58H 1G7PA 1UM5H 2LU4A 2EDXA 3ARQA 3CVHH 1R5VB 4EVNA 3UXFA 1CF8H 2XKNA 1SEBB 3GRWH 4F8TA 1I4FA 1Z9SA 1JNHA 1MJ8H 2JELL 1UVQA 3I9GH 4U1JA 4MA1B 3HMXH 1UACH 3WS3B 4AENB 5E70A 1Q8MA 1AD0A 4X4XA 3CCHB 3QQ4A 1TJGH 4WEUD 3EZ8A 1C12A 4TQEH 4WHYH 3SPVB 3JTSB 4Y89A 5DJDA 1CD1B 4NO0D 3RDTB 2A6IA 2VSCA 5E8NB 4HH9A 1N3NB 2H3NA 1CGYA 1X9QA 1YUHB 5C3LD 3B8SA 2PO6C 4UU9A 3VXUA 3OTTA 3MV7B 5TH2B 3SGEI 4N8CL 1HKLL 1R3KB 4O2CB 4AH2B 1RHFA 1Y6NR 5F96H 3RY5A 5IIEA 5C0EB 2GIYA 1N5YH 3N1FC 3RX8A 1SBBA 1DVFC 5T1LB 4ZQKB 5EZJA 2NMSA 3LS5H 4OFYA 2D2OA 2D0FA 3TWCH 1RUMH 3H3PL 3T4AB 3U4BL 1YECL 3WFHA 2EKSA 3LQAH 2OTUA 4AM0B 4KXZH 4Q2ZA 3BH9B 3RWEA 4YHPB 1L9MA 2C3VA 4D2NA 2OQJA 1T83A 1KCUL 3ULVH 3C60C 3ARBB 4DKAA 3W0WD 3QP3A 1FHGA 5F9DC 1EO7A 4UUJB 4Z7WF 35C8H 4K2UL 2Y07H 1WGOA 3LZFL 1ZK9A 3PWUA 1A47A 1I1YA 4K8RD 4NWUL 4Y4FB 5AUMA 1L7TH 2W9LA 1CL7I 5GSRA 2DL9A 3C8HA 2F15A 4UINH 5FIEA 3EJYD 3O0RL 2ZKHH 4HUXB 3O3AA 3OKLB 3D87B 4XCEA 4M9OA 5GGUB 4R4FH 5SX5K 5DS8A 3CC5A 4G9FB 4N0YL 3T2QA 1VDGA 5HHOB 3VGEA 3BYYA 2YXMA 1NEZG 3KPLA 3IDGA 3OGCB 1QFPA 1NAMH 4R0LA 3FO0L 3RZWA 3EDFA 1NEZA 5E4EB 4JY6B 1IMHC 1CLYH 4U1SA 2WAHA 4HPYH 4PRNA 1TIUA 2XZCL 3MQIA 1OCWH 2D7PA 3LIZH 3QEQE 2FX9L 3TA3B 1UWEL 5BJTA 4NUGH 4L5FH 3UTTE 4MJ5A 3BP4A 3IRPX 3VDBA 4GG6A 2LU3A 2J4WH 5JOPE 3SKNA 2YD9A 5C0BA 5INDB 3HAEG 3ORJA 5J06A 2LQRA 1NGXA 3RZCB 5GS1B 4MGXA 2ICWB 4P23B 4QOKB 4HGKC 4YDJA 1C1EH 1PEWA 3HAEA 5I8EA 5L2JA 3B9AA 1KTKE 5EIQA 5EOQL 5E7BA 5FA3A 3OKMA 1IL1A 1QFUL 1E27B 2K9UA 2CXKA 3VWJD 4IDLA 3WBDA 4PV9A 3G5VA 3BOVA 3LRSB 3DUUB 2RCSL 1I8KA 4ODSL 4WWKA 4G6KL 3VFWA 1SJEA 2PR4L 1V05A 3UPRA 3HG1D 1MREH 4JN2B 5EFIA 4K8RC 3STBA 1LNUB 1KSRA 1UH2A 2APXA 2OTWA 1EGJA 3EJYC 1I9EA 5CJQH 2CJUL 4OGXH 5B3NA 5LGJB 1NLDL 4N0UA 4Z5RA 1FO0B 3JWDL 5KSUA 1JK8A 5EWIL 1M05B 3W39A 4ZFFA 3KLAB 5F6IB 4MCZB 3ZYIA 3QULA 1CU4L 4PLKD 4PG2A 5T3XL 1BAFL 3QBTB 3NTCH 4TNVK 4EIZC 3VXRB 5AG8A 5EG6C 5EZIH 5E2WH 1EEZA 4RMWA 3FB8A 5TPWL 5CGMA 3CVHA 5F7DB 1OP5H 2ZCKL 4H8WH 4U05A 3O6KH 4X5LA 4FZEL 5EPMB 2B4CL 2EYRB 3SE9L 3GRWA 3QB7C 3QT2A 5FDWB 1D6VL 2P8MA 5DGRA 4G7VL 3INUH 4N5UA 2GTWB 1CFVL 1NBQA 3HMXA 5CSBA 2R29L 4JPKH 4LCWD 3WLBA 2OI9C 4WHYG 3MRKA 5MI0C 1IKFH 3HNTL 1D5ZA 3IETB 4G42B 4NYLB 1O0VA 4IMLB 5E2TL 4NJ9L 2ZUTA 3UYRH 3FN3A 1WIOA 1MRDH 3VFUA 3JWOL 3OKNA 3V6ZA 3F6IA 3QDJB 4RISH 3ARRA 5HBBA 2EDKA 4JJHA 3MZGB 3WDHA 3UX9B 3BI9X 4YHZH 2AV7B 3IXAB 4N0FA 3L3JA 4O00A 3L3GB 4G8FB 3SDXA 4C83B 5BVPH 4X98B 2P5WD 5E7FA 1FPTL 2AJYL 4NHCH 3U36A 1A6WL 3S4SG 3MLSL 4BKLB 4RWYH 1AQKL 1TDQA 4PLKC 2HG5B 3QIBB 5I16A 2DQCL 3S4SA 1YA5A 3T1FB 4GW1B 4LRNL 2BNQB 5C9KA 3IJHB 5FO7B 5F7UA 3IDNA 5HSFA 3IAPA 4HFUH 4OZIF 2NX5B 3VG0L 3EYVB 4F7CA 2FGWL 1AXSA 1MVFA 3QA3B 4S1DC 5DFWH 3RHWF 1JGLH 3SGEH 3NIFE 3BEVB 1FDLL 5IFJB 1J8KA 3K0WA 3QCVH 2I5YH 3C5ZD 4NQCE 3L5WB 4KJWD 5J12C 5DQDH 4NKOA 4PJGA 5HPMA 1NANI 3SKJL 5I17B 1IGFL 3T0EE 5FGRA 3SCMA 4E5XB 4KRPD 5DGQA 1FO0L 2GTZA 4Y7MA 2A0LD 1VKXB 1TQCB 1YZZA 2DQUH 2MPAH 1S7QA 5DA0B 1KTDB 3IFPA 3TPUB 3S35L 4PP2B 4U1NB 1NAMA 3I2CL 3LV3B 3ZKXB 4NQVB 2XRAL 5BS0E 4HCRA 1FYTD 1HZHL 2YPLD 6FABH 1XCQA 3QO1A 1JI1A 1JZ8A 4MA3B 4HXAH 3PGCB 2VXVH 3ZYJA 1AD9A 1NC2D 4X4MA 4PRHB 1BM3H 5GRWA 3TESA 5IJVB 2EC9U 3GM8A 1RZ7H 3UBXI 1UZ6F 3V5HA 1CL7H 2FNBA 3SDCD 3SDDB 2P7TB 4UNUA 1JZ5A 1JPSH 1Z9MA 3AS0A 5IB4B 3KPSA 2R23B 4AL8H 2E9JA 3IKCA 4XP5L 3U7AA 4X4YB 2AKRA 2K1MA 1XZ0B 2CRMA 3GMRB 4ELME 5DMJB 1B90A 3OXSB 5ANMB 1OAYL 4U1GC 3MLXL 4CUCA 3C2SA 3ARFA 2E9WA 4OLVL 5IR1B 3IFLL 3K81A 4FQIH 3OKKA 1Q94A 4ORZC 4OZHE 5EU3A 3VXOA 4KK6D 4AT6B 1NBYA 1C5CL 3AAZB 5I1IH 3C5ZC 1PBYA 4MD0B 3RWGA 3GMQB 2CKNA 3GFUA 3MRRA 4BK5A 5GJSL 3BP7A 3ARVA 4X6CF 1MCSA 4EBQH 4U2YA 1AXTH 1DEEA 2WBJC 1F3DJ 2A0LC 2VB5A 4KKAD 4FFYH 4FQ1H 4S2SB 3TN0B 5MERA 4QRRA 1F3DH 4HUWB 5DJZB 3NN8B 3MBEB 4WFEE 2EYSB 4YFDB 5B8CC 5CEZH 4I48B 4B53A 5J3HD 5JDSB 1HQRB 4MB4A 1RK1B 2XZAL 3MMEA 2HLAB 2BNRA 1MY7A 4G3YH 2HFEA 1SHMA 5KVFL 1XGUA 3IS1X 2PO6B 3BZEA 3SDCC 3BDXA 4YDLC 2R2CA 3AB0C 1U8LA 4QXGH 1FFPA 4O58H 3WSQL 1KEGL 5EU6B 3VRLE 1YEIH 1DLFH 1DVFB 4YQXL 1OAQL 4PJFA 1UB6A 1N2RB 1ZA6A 1PLGL 5C3TA 3UZVB 1G9NL 2C9AA 4RGNE 2CKBH 4MAYD 3RWJB 1UH4A 4PR5B 4G8EA 5GGSB 3IKKA 5EN2A 5B3JE 4OI8A 2DKMA 4PJCE 4K7PL 2EH7H 2X89D 1QLEL 1JUFA 3BPNC 5I1HL 2VYRE 4KK6C 5DWUH 5HYJB 4CVWA 1YNKH 2BVPB 3C60B 4NNXA 4YHIA 1BBDL 3UTPD 3SE3A 3TF7C 3CMOH 4IJ3C 3HS0A 3U9UB 1IT9L 3NABL 1IC7L 4QTHA 3G5XB 4CNIB 3KLSA 3BD5A 4LSUH 3OAZK 3TV3L 4HAGA 4P9MH 4QEGA 2CUHA 3K4DA 2F74A 1Z5LA 3CX2A 5EO9B 5EO0B 4JRXB 2FJFA 3EGSB 4OM1H 3NFPB 5ESVA 4PGZA 2PYFA 1WTLA 4KKAC 2VAJA 4WW1B 3WFBH 4OI9A 1OSPH 2XQBL 3S34H 4R90H 1RPQA 4HUUA 3IAGC 3OHXA 4AEFA 3FONB 1FZOA 1IAII 1NGQL 2PYEE 2Y5EA 3ME0A 1YPZA 5J3HC 4HLJA 4OF5A 1EBAA 4NO0B 3L3HA 4HGWA 4YDIH 5E8PB 3F6LA 3TO4D 3UJJL 1GJIA 5HGBB 3D0VA 5KVEH 4XC3H 4P4KD 3ULSB 4XH2B 5DHVB 4P5KA 5FO8A 1QLFA 3QIUD 4HC1H 2C1OB 1EEYB 3FB6B 5KSBF 3DX9A 1ETZB 4QT5A 1MNUL 5IBUG 3MLTB 3TM6A 1T4KA 1OTUD 2XWJB 2FO4A 4PJDA 4MAYC 3MXVL 1NUDA 5E8DH 1Z0NA 1KACB 3U0TB 1ND0A 3QRGL 5FUZL 2CGRL 5T3ZL 1I7ZA 3SY0B 3U0WH 2FJHA 4EDXA 1FORL 5E5UB 3KLDA 1C5BH 4HDIA 3CPLA 3MCLL 3H6JA 1IGML 1QSEB 5GRJL 3W0WB 1KCVH 3MX0A 1T66D 1IM3A 4X99A 1F4YL 2CIKB 2YN5A 1E4WL 3D39D 2WWKT 5I76B 5T1DL 5JDJA 1ERNA 3KYMA 5CJOL 1DQDL 1N8ZB 1VPOL 2VLME 3GSXB 1NANH 5I74B 2FH8A 1G9EA 5I8KH 4RAUB 4JVPA 3W82A 4OSUL 4AEIL 1KLFA 5D1ZC 4HK3J 5B21A 3TZVA 3IYLW 4OGYL 2I60L 4U0RC 4NNPH 5TDOA 3QPXH 5JQ6L 4QRQA 2GUOA 2GSIA 4LQFH 4XVSL 5JW4N 3TO4C 1JHTA 1MLBB 4HWEH 3DOSA 1H3XA 5FCSH 5D7IE 4Z95H 4P4KC 3MRPB 1NCCL 1Y18B 2LVCA 3EDKA 4TUOA 3QIUC 4MD5B 4PRID 4B0MM 5MEQA 2OLDA 4L4TD 4ZOEA 4X0KA 4HT1L 4DN3H 4G6FD 2VLKD 3QSKB 2W91A 1OW0C 4ZG1A 4Z6AT 1CD0A 1OTUC 3RAJL 3NCYP 1INQB 1WTGT 1QHPA 3OJMB 1SM3H 4PJHB 2HRPL 4BH7A 4WGWB 2BP3A 4LIQE 3FFCA 4LCCA 3RNKA 3RWFB 1U9KA 4M03A 4N1EA 4KQ3L 2L4OA 4UDTA 3QG6B 1T66C 3EZJB 3NH7L 3QDGB 1WBXB 5FXCH 2FX7H 5L2KA 3DX7B 4ZXBD 4BFGA 2XTJE 4WCYL 1B9ZA 3WL9A 1EMTH 3MNWB 1GAFL 2EIBA 3CMGA 2Z91A 3DMMD 5CJ5A 1SJVA 2RB8A 5SWQA 3L7EB 3DVIA 4N8PA 3ULUE 3SKMA 1NCWL 4ODVL 3CSBA 4D8PB 5A16A 4Z7NF 4I0PB 4XRCB 1WAAA 3QUZA 3ZL4L 5H2BB 2CKBA 25C8L 3DNKA 5TDPA 3TYGL 4G8GA 4WFGE 4YPJA 4RRPG 3PHQA 1F45A 4OTXH 5L8KB 1NEUA 2IPTH 3FQTB 1CDHA 2NY5H 4ZUUB 4RRPA 3IDJA 5DRNA 3TIDB 4GRMA 1PSKL 4N8VG 2OJEA 3I3BA 4ODUB 4LP4A 5D7LA 5F71A 1WBZB 4EI5A 5DVOA 4N8VA 2VRAA 3QCTH 1ZGLP 3BW9A 3FFDA 1BFOA 2GFBB 4TRPH 4Y0GA 5J12B 1A9BA 4D0CB 3A6OA 1T5XB 1MCKA 1T1WA 3H0TB 3NIGF 4NFBA 5IVXF 1T7YA 2VDNL 3BZ4A 3TJEH 3FB5B 2OS7A 4NKIH 1HSAB 4LCWB 3HUJF 2AAVA 3EJZD 1F3JA 1Q9KB 4LSQH 2H32B 3H9SA 1MRFL 4JFEE 4JZOB 3P9MB 3NZHL 4PJEF 1F8TH 1LQSR 4WEMB 2A6KA 3FCTA 4ZXBC 5SWSD 4F3FB 1A3QA 3FN0H 2DOCA 1E4XI 4NZTH 3O6LL 1A7QH 3DMMC 4HC1A 1CD9B 2W65B 3P4LA 1CIDA 1GGBH 2XZZA 4WV1A 1P6AB 3WMSA 1LDPH 1NGWA 3QXDB 2GCYA 2IANE 3P0GB 5JMOC 4HG4K 3E8UH 5F3BA 2P5WB 3MFFB 1FNHA 2UZIH 1AO7A 1VACA 1FG2A 1IAIH 1RV6X 4U1GB 2Q3AA 1GGIL 4RX4D 2OCFD 3GGWA 1UZ8A 1MI5B 1TTFA 4MDIA 3QFDA 5CD3B 3PDGA 5JA8B 4QY8A 4GMTL 3ECBA 4JZNB 4MJ6B 2NY3D 3EIFA 5IFAL 3VG9C 4P3CL 5MEPB 3MO1B 4RBPK 5DD0L 1JYNA 4BZYA 2WBJB 3G6DL 4XXCC 4KK5D 4QRTA 1A6ZA 3BKML 3EJZC 4LASH 1YYMH 1FVEB 1ZS8A 4GRWE 4QRUB 2FR4B 2BVTA 4JDTL 3X11B 3PHOB 4TVSa 5ICYB 4G43A 3MRDA 4R9HA 4PTUA 2BSTA 3OG6B 1NC2B 3UBXG 2Z8VC 5TE4H 4XVTH 1EZVY 4KY1H 4XPAL 3BUYA 5JXAL 3UBXA 3SDCB 4O02L 3ZE2E 3HLAB 3AB0B 4GG8A 4KRLB 4AYFA 1HQ4B 1U3JA 2JJSC 2WLZA 4C55A 4Z7VF 2YWZA 1MHHB 1NQBA 3G5YA 3A67L 4LEXL 3S88L 1I3GL 4HHAB 5A2JH 1EBPA 3X13B 3LHPL 1RFDL 1CFQA 2J88H 3P0YH 3RY6A 1MWAH 5SWZD 3RBGA 5I1GH 3BPNB 4Z77A 4RFEA 4WFHD 3HR6A 1FAIH 1M7DA 1S3KL 1F13A 2NZ9D 1P69B 3VXME 4IJ3B 2HTKD 4WJ5A 4RCAA 1EK3A 4UOW0 5JIHA 4QYOA 4Y2OA 3H3BC 4NSKB 1QFWM 2CMRL 3C6SA 1IGTB 1N26A 4XNQA 1DBMH 4XNUH 3TIEB 3QWRA 2NY4D 3UCRA 2X05A 4KK5C 1U8JB 4NNYB 3O3DA 3ZHDA 2MKLC 4Z76B 4P59H 1HXYA 1FGNL 2X9XA 1P5UA 3TBTB 2ZCLH 4NQED 1V3LA 1CE6B 1MHPL 3T65B 3G04A 1HHIB 4NQTA 1ZTXH 4YNYA 1GZPA 1O7SA 1UWEH 3H9YA 4Z7OF 2V9TA 3B43A 4YZFE 1XGQB 5EU5A 2VDQH 3BHBB 3MLVH 4PJAF 3V0AC 3IJYA 2QQNH 4YWGL 4XBPB 4EN3D 3QEQA 2NW3B 3FO2A 3MUY1 2GKIA 2VZVA 3D85A 3UTTA 1OM3H 5FECB 1QFUH 1UCBH 32C2A 3C8KB 4ZO6A 4HQQL 3VFSB 5TE6H 5CKGA 4N9GB 4PJ5D 1WZLA 3BT2H 4XWOD 4X6DB 1NKOA 4ODSH 4DKEH 1MFNA 4G6KH 4YXHL 1NBVL 4M7LH 1NCDH 5KS9F 2NZ9C 4LDOB 4DFHA 2HTKC 3O2VH 5IMMA 4I9WE 4QNPF 4GOSA 1LE9B 3UJIL 3VWKD 3N06B 4B5EA 2P8LB 4P5MB 2NY4C 4L8DB 3IFNL 5FYJU 1TZGH 1QRNB 3VXSE 3RUGE 5D1ZB 4GXUM 3EO0A 1BQSA 4Q7DA 1LWRA 5I66A 2ZOLA 5CLWA 4UT6H 3ZSSA 4D9LL 4U0RB 1YY8B 4WENB 4OZFH 3BPOC 1XF4A 3EUUA 4S1SL 3VD4A 1MSPA 3BD4A 4HS3B 1GOFA 3TO4B 2E7CA 3HCVB 1BBJB 1OAUH 3D1MC 4LHQB 4WWID 7FABL 1JNLH 2PCPA 2HJLB 4PJBF 2JF1A 1E4XH 1UADC 3QIUB 5ID0B 4FZEH 3O2DL 3CFDA 2VR4A 4ODXA 4EN3C 3HPLB 5C08D 2MOVA 5IBTH 1AGFA 4YAQB 4L9LA 3ZYOA 4NBXB 3ZDZF 4U6HB 1NCTA 1AGCB 4U6XB 5D2NC 5EUOE 5GRVL 5DJ0B 3GK8H 4DQOH 3MRHB 3LEVH 4C56D 4PJ7F 1UWXK 3MV9D 2IH3A 3TGXA 3HPJB 4URTB 4OCYL 1ORQA 3KDMB 2NY7L 2QHRH 5H37H 3RTQA 1PQZB 5C0AB 3GMNA 1X5GA 1G7HA 1MOEA 2GJJA 5FK9B 1N64L 5IHUH 4NDMA 3AM8C 4GRLD 3VWKC 4HIHB 2KL6A 3P73B 4F9LC 4NRXA 4LLUB 2J2ZA 2H1PL 5EA0L 3W2DH 1WLHA 1MAJA 2VDML 1EEUA 2D7QA 2VDLL 2BY2A 4PRPB 3KPMB 2DB8A 4C59B 3I6KB 3KYAA 1WEJH 2DYPA 1FPTH 1ZT1B 2AEIT 3S8WA 3NIDE 3S37L 1MCPH 4FQLL 2KBGA 4NQDA 3NMEA 4DCQB 1HYRC 2OMBA 1MWAA 2GSGB 2ITDB 5I18L 3MACH 1RIHL 4UILL 3BRDA 2FGWH 3L3OA 3OL2A 3M8OH 1TZIA 3HZYA 3DO7A 3GUTA 2O5YL 3QQ9D 3HZKB 5C7XL 3CU1A 3UTQB 4KK8C 2NTFA 4L4TB 2EDNA 2VISA 2FSEA 3QPQC 2R69L 5TFSL 1IBGH 2VLKB 1NLBH 5GS2H 1R0AH 4WI7A 4NC0B 1HDMA 3QEGL 4DEPB 1VADB 3OR7B 4HXBL 3FQWA 3KPRE 5CLTA 1AC0A 4M48H 4NQCA 4M00A 5K59E 4C4KT 4GKZB 5J9PA 1IGIH 4X9HA 2D7OA 2EC8A 1KG0A 5F21B 3T0EA 2J3SA 3NA4A 5JHDE 5FYJL 1CE1H 4WEBH 1QLRA 2V6HA 4YFLF 4PGEB 1IILE 3BIAX 3ZLQC 3C9NA 4CVZB 4IM8A 1DJSA 4K3DL 3MJ8B 4FQPA 1KENH 5F93C 5BS0A 4GRLC 4ZXBB 5ABDE 4V1DD 4M6ML 3WS6C 3M1BA 1CDUA 1E6JH 3DMMB 2DN7A 5A2LH 3VXTB 2VIRB 2BVQB 3OKEB 1HH6A 3LQZA 4ZUWA 4XP5H 2VXTL 3FQNA 2FZ3B 3DIFA 3VRJB 1ACZA 3GZKA 4P9HC 1UA6L 2DMBA 1LK3H 4CGTA 2X7LA 1CK0H 5BRZE 2P24B 1OSZA 4TSCL 5F1IB 4OAWA 2WANA 2VC2L 3BE1H 3AY4C 5EBMB 5L0QC 1BX2A 5ADPH 1DQQA 4ELMA 2ZG1A 4V2CB 3QQ9C 4D9RE 3HE7A 2GJZA 4ELKA 1G6VK 3BO8A 1FC2D 4CW1B 1P2CB 3QO0A 2HT3D 3TH3T 4LAQH 4OZHA 1YJDH 1BD2B 3CXDH 3MOQA 5DD5L 2ATPA 4O5LH 1P9MA 4QRPD 5ITBL 3JV4A 3X3GL 3HHRB 2VLRE 3O3BA 4H88L 4Z7VA 3RNQA 3SKOB 4R7DA 1E0OB 3TYFA 1YEKH 2VDOL 1MPAL 3V52H 5JTWA 4OZFG 3TH4T 3OZ9H 5E9DD 5DSCA 3FOMA 3BJ91 5J56B 4OZFA 2VLJB 3SE4A 1VFOA 5T1KD 3QUKB 4APQA 3LN4A 1E6OL 3SKUD 1OB1A 4PJIB 4GW4B 1PG7H 3CSGA 4K23H 4G8IB 4QRSB 4LIQH 3MRQA 2GITA 1KEGH 1R3HB 1AIFA 5DO2D 3V6FB 3BEWB 3FQRA 4YQXH 1JF6A 4XCYA 4KMTH 5I1LA 1ZANH 4YX2L 4ZD3H 1S7XA 1JWMB 5DQ9A 1IFHH 4RWHA 1A3LL 3SQOH 2O61B 1G9NH 5GISL 2ZSWA 5CFHA 1Q1JH 4PLNC 3QJFB 43CAB 2YD7A 2BSRA 4BH8B 3MRLA 3GKWH 4K3JH 3T4YA 1XIWA 2VAAA 5C0CE 3ZKQD 3ULUH 4GKOA 5EIIA 5H37G 2YUVA 2NY1C 2X1OA 3MRCA 1WC7A 2HKFL 4M1DH 1DDHA 5DZLA 3FT2B 5J89A 3QAZC 4DVRH 1EDQA 1TJIH 2D9QB 4I4WB 3TO2A 2Q8AH 4CRPA 3SJVB 1BFVL 4PJCA 2XN9D 2HT3C 1TCMA 3PGDA 4F7PA 1CICD 2W9DH 2YD3A 1HKFA 1FZMA 4JRYD 3U4EA 3KYNA 2QJDA 2AI0H 4JO3H 1NFIA 1AY1H 3H7BB 4YK4C 4OLWL 3T0DA 2VR9A 3X12B 1UYWH 4KUZH 1WF5A 2NXYD 3D69A 4WU5A 1UB5A 1F90H 4Y5VC 1LVEA 2AP2A 1G7JA 2Z4QB 3K4ZA 3K3QA 1U8KB 4UT7H 2CK0L 2FEEI 5FGBC 1LGVA 2V9QA 4G7YH 5T1MA 1TVHA 4M6NL 2PYEA 2ZPKL 4CADA 3OAUH 5KVGH 2AJXH 5DO2C 1MFEH 3A6BH 1ORSA 5C0JA 4J1UB 2X1XR 4LSTL 4RMVA 5GGTH 3BDYH 4BELD 4JFXA 2C1PA 1LO2H 5FYJE 2F58H 4F7EB 3UO1L 2QQLL 3DV6A 4ISVA 2HFFB 4QCIA 1WBYB 4JPWH 4P4RB 3BAEH 5IF0B 5CZXD 2DKSA 2PW1A 4QXTB 3UJTH 2C5DC 5D71H 1TJHH 1A3RL 2R4SL 1BMGA 4F80A 4ZNEE 3WNPA 4M1CD 3MA7B 5DF0A 3EOYG 5SWZB 4TNWF 3FMGH 4I3RH 2Q3ZA 1CZ8H 1A1MA 1FNSL 2DLHA 1IC5L 1C08B 3HTLX 2DM4A 2OMNA 4JPIA 3QIWC 3PV6B 5GGVY 4FRWA 4L8BB 2O5XL 4NZUL 2R1WB 1CR9L 2CDGA 3PJSB 1T3FB 4AEIH 2NY4B 3KJ6L 1OAZH 2RBLA 5C6TL 1J05A 3MUZ1 4FABL 4ZYKB 4E42A 2NXYC 4X6FB 1T1XB 4NRYA 5F6HJ 5JQ6H 1LP9F 4QHLA 1VGKA 3LDBC 5GGSY 4YPGB 5C07E 3DSFL 4NQEB 4H0IA 4NZRL 1CQKA 3BPOB 1QSFE 1CGVA 4S0TD 1FV1B 2WQRA 4UV4L 3FRPG 5H35A 4ODTH 4GRWH 3VXPB 4Z7UF 1RURH 2B2XH 1LE5B 3FRPA 5D5MB 3G9VA 1JHKL 5BZDA 3O2WH 5D7IA 2IC2A 1QZ1A 2X41A 4L4JA 3HZVB 2JCCE 5I30L 4OJFL 1KIPA 3GO1H 4RA3A 5IB2B 5CZXC 5IESH 4JRWA 4Q9RH 5D2NB 2ADIA 4B7LA 1FFOA 1ZHBA 4DGVL 5K9KA 4M1CC 2XA3A 2VSDA 2IGFH 3SDAA 1JWUB 1ZWIB 1CXKA 1BVKB 5LXGH 4BSVB 2Q86A 5HVHC 1P53A 2YEZB 4U1IA 5C0BD 4XPGL 3OAZH 1DBAH 3P3YA 4HS6B 3C5SB 2DTMH 2Y06L 1TVBA 5LCVL 1NGYA 3JVGA 1PVHA 3E0GA 1RAMA 4FFZH 3SGJA 1KNOB 5IUSA 1U95A 5JO5A 1MIMH 4QF1B 3V4VH 1U58B 4WWKD 4XBGB 4R4BB 3Q6GH 3TYGH 2W0PA 2EICA 4PGCB 5IFHL 4KV5F 3HR5A 4MB3A 4JFYA 2ZOKB 4LVEA 4OV5B 4OIBA 2DKUA 4LOUD 1KCRL 1DSFL 3S36H 4JEGB 4DZBB 4M61A 1F6AB 1AGDA 1BZ7B 1OWRM 1T6VN 3DLQR 4K71C 2W9EL 1J0KA 1C5DB 4P2CG 1QR1B 1D5BB 3QUXB 1HEZA 1NJ9A 3PG2A 3UPCA 3DVGB 4H1LB 4POYA 1WK0A 2VLLB 3ZE0F 4CVXA 4LSPH 5BW7C 2EE3A 1M71A 3F5WB 5DT1L 3EYUH 2OSLA 2FATL 3ALXA 3P9LA 2WK2A 3ZDXF 1DBKL 5DTFB 5CBEA 3WEXA 1MCQA 4R26H 3KXFE 4PGDA 4Z0XA 4ZOAA 3ZT5A 3V7AE 5BXFA 4OCSL 2D4FA 3D25A 4GRLB 3LKOB 3CH8A 2DQJH 2HRLA 4K07A 5JOFB 4JFEA 5FOJA 5GGTA 5E24E 4H20H 3EOBB 5DJ6B 3B9KA 2FL5B 3HMWH 1EAJA 3CNKA 1CDYA 4WWKC 4GQ9L 2YR3A 3T3MF 1HILA 3WXVL 2ZNXA 3HI1A 5DYOB 5BOZG 4PGBA 2NY2B 5E0QA 4NT6B 3CDGB 4GMSL 1GIGL 4PBVC 4RAVB 2MCPH 4BZ2L 1MFCH 5C1MB 5D7JD 4XPFL 2IANA 1MCFA 5L0QB 3RIFF 4RMUA 4Z7QE 4H25A 4K3GA 4LOUC 2G75B 3JTTA 4DGIL 5C0FA 1RULL 3PWJA 3OSKA 3MNVB 2XACC 1J1OH 3RHWK 4EKXA 4HS8H 4YE4L 5ESAB 1P7KB 5ERWA 2AW2A 5DURD 4JHWL 3DURB 3ULVD 1ZHLA 2Q6WA 4LLWB 2ENSA 5IW6A 4AEHL 3BZDA 1NGPH 2GHWB 4RNRA 1FFNB 5CEXA 1JN6B 3FOLB 1HINL 1EVUA 5ISZE 1MHCB 2YK1H 3V6BR 1NCBH 3U0PB 4N0RA 1MUJA 3G6JB 2VITB 1DE4B 2UY7A 4ETQA 2BDNH 3PP3H 1RIUH 3SCMD 3B2UD 5DFTA 4IS6A 3QFJE 2FYYB 5F9OL 5EORH 5KN5B 4V1DB 3WJLA 1KEMH 4OZGF 2DJUA 3FT3B 1F11A 4NN6C 3V6OE 4ZFGH 1F2QA 1FL6B 3ZSTA 5CJXC 4K55A 4L3CB 4JO2L 3EYOA 4LEXH 3BP6A 2VH5H 2J8UF 2ZSVA 2H32H 1RFDH 4DW2L 1A2YB 3GMLB 2Z92B 3V0VA 3QJHA 3VJ6A 2DD8L 3STZB 2DQEL 5DQJA 2CLRB 5D7JC 3UTSE 3IFOB 3NCFB 3R0MA 2NY1B 3B9EA 2X4SA 4GUPA 1KJ2H 1WV7T 5BZWA 4YJZL 2LV4A 4HFWA 2WUBH 4ODBD 1S9KC 3B6SA 2MQCA 3QAZB 1Q72H 2BFVH 1WFUA 4KQ4H 4M5YH 1HIMH 4KPHL 1Q9OB 3NACH 4R2GD 1XR8B 3LQAC 3L1OL 2A9NL 2X9WA 3Q1SL 1Z9OA 4PGJA 3UEZA 5AZEH 2EDLA 3E3QE 3ARFD 3ULVC 1YMME 2CO6B 2BVYA 5INCB 3VXMA 3MLWL 4JN1H 1YDPA 2F8VA 4P9HL 3F7YB 4YK4B 4JM2F 3U2SA 3GMPB 3OAYK 5E5MA 3REWA 3VFMA 1IGYB 2XY2A 5GGRB 5E9DB 3T3PF 5IHZB 3P40A 1FNGA 2HWZL 3GI8H 4XP4H 4Y5VB 3MJ9L 4BFIB 4P3DA 3X14B 2AEWA 4MCYA 5KVDH 5FYLL 3SCMC 1K2DB 3DX8A 2C7UB 3B2UC 1R3LA 5IW1A 2X1WL 2VQ1B 4M43L 5DD1L 1KN4L 4KKBC 4PBWD 1FNLA 1YEFH 1QSVA 3OJDA 5EOTA 5AD0A 4HG4J 4DN4L 1EZVX 3I6GB 4XMKH 1BVZA 1S9XA 2R9HC 1JNNH 3BN3B 4D0BB 3BYTA 4LPVA 5HYSG 3BWAB 2V17H 1YEJH 2D31B 3WNNA 1A7PL 5I73B 5JQHC 1GPOH 3C87A 3PXHA 4XAWH 5HYSA 5FKPB 3PQYD 1IM9D 4XP6H 1MQKL 4DAGL 4Z7WE 1S9WB 1OGAE 1RJCA 5IB1B 2ZUQC 1RZFL 2YD6A 1A6VL 2QKIB 2QADD 4GXUN 5D70H 3C2AL 2BJML 4GKSA 2ATKA 4FQJL 3S96B 5FGCB 4M3KB 3QG7H 2Q1EA 2FLBT 3DARA 4R7NA 4J4PD 4XXDA 2XN9B 4HUNB 2YUXA 3B3IA 3TNNB 2ZUUA 2NZIA 3KPNA 3QIWB 1K6QL 3ARFC 1JZ6A 1FVDB 2BVOA 4JRYB 2LU7A 1OPGL 2R2HB 4CN1A 1DUYA 1FNEA 3WCYA 1ZKAA 2VE6B 3Q48A 4LCYA 4ZFOA 43C9A 1RUAL 2NXYB 1G7PB 2G5BA 1KGCE 2VWEC 1D6EA 1MF2H 3LDBB 4EVNB 2JTDA 3DSNA 2X1PA 3F8UB 3HE6A 2HTLD 2XKNB 5HHVL 3VXSA 2KZ1B 3RUGA 2R0WH 4DOHB 1MIEH 1REIA 3MLPA 1MCJA 1GGTA 1I4FB 1JNHB 5TF0A 4HAFA 1UVQB 4JKKA 2VDKL 4U1JB 3V9FA 1HSBA 5SV4A 3NAAH 2ZUYA 4M7JL 1CYGA 4JHBA 1AD0B 4X4XB 3QQ4B 1KN2L 4NOBA 5E5RB 4OCLC 1C12B 1LO0H 4I13B 5A2FA 5I1AA 4NCDA 5DJDB 2A6IB 2SEBA 4HH9B 1LO3H 1PX4A 5D8JH 1WQVT 2H3NB 1QYGL 1FLRL 4UB0H 4IOIA 4UU9B 3VXUB 3DGCR 2EXYD 2QTEA 2I9TA 3HRZA 5IIEB 2QADC 3AMKA 3RGVA 5EUOA 5A3ID 1R24A 4DJMA 5EZJB 1IC4L 4JGMA 1P4BH 3PP4H 1X6LA 3QUYA 2BHYA 4KZEH 3D9AH 5I15L 5LKNA 4ZAKA 1I7UA 1AGEA 3RU8H 3GMOA 5DRWA 1Y6MR 3WFHB 2EKSB 2OTUB 3U1SH 3VFVA 2VDLH 4Q2ZB 4ZFZA 3RWEB 1H15A 2AK1L 4H0HB 1WUNT 1I1FA 1YEHL 2C3VB 4CU8A 5IHLB 4U6VH 1G0DA 1G7MA 3SE3C 2AABH 2EEDA 3OF6A 3PWUB 4WRLA 1I1YB 5AUMB 4HWBL 1ADQL 5I18H 1EHNA 5GSRB 1V7NL 5DLMH 1J5OL 3ZE1F 1KJ2A 3O3AB 2MNUA 4XCEB 3HRPA 3Q0HA 3TT3H 3V2AR 3L3IA 4OT1H 5DS8B 4LHJB 3CC5B 5A43C 1S7TB 2YPVL 4XB7A 5DK2A 5KJRH 1FL3A 3QRFM 4LLAA 2DQIH 1QP1A 3IDGB 3KPLB 4R0LB 4K71B 5IVZA 1NEZB 1BREA 4U1SB 1BGXH 4PRNB 4MVBC 4JFFE 1NCUA 4GH7B 4UV7H 1MFBH 2YS4A 2EXYC 3CK0L 3WXWL 2WIMA 4HBCH 5BJTB 4MXWH 4K3EH 1MAMH 3GI9H 5FYJH 5FM4A 3H9HA 5C09E 4MJ5B 3BP4B 3RJDA 2V5SA 4FXGA 1T2JA 4MA8L 5A3IC 3KPRA 5F44A 4GG6B 2Q7YA 3NCEB 4PRBA 3SKNB 4L4VE 1R3IH 5C0BB 5GGQL 1JV5A 2VZ1A 1NCAL 1NGXB 5KVMC 1MJ7L 2FHFA 1FL5A 5JHDA 1T89A 1JGEA 3HAEB 5I8EB 5L2JB 5HHXL 4ONOA 5LAXA 5FA3B 3OKMB 1IL1B 5GRUL 3KYOA 3MRGA 5DJXA 3LPGA 5ACLA 5TQ0L 4WU7A 5CEZD 4PV9B 3G5VB 2XT1B 4N90D 2CLZA 3TVMA 4ZUVA 1I8KB 3RI5F 4WWKB 3L6FA 1N6QH 3VFWB 4BFEA 1SJEB 5EH1A 3UPRB 4OZIE 5J4MA 1OARL 5EFIB 3UC0H 1KV3A 4FXLA 5ADOH 3K8MA 1A1OA 2OTWB 3E6HA 2ZNWA 3KYKH 5IQ7H 5KG9A 4WTZG 1AQDA 5E1HB 4K9EH 5GSVA 3ELAT 4WTZA 4NQSA 5DK3A 5BRZA 5D7SH 3O8XA 3TZVC 4N0UB 4Z5RB 1KCSH 2OM5A 4X80H 4AJ0A 5E6ID 5KSUB 1JK8B 3IU4H 4YBQD 4O2EA 3W39B 4ZFFB 4Z8FL 1F2XK 1JRHL 4POZD 5ICZA 4G8GD 4PP1D 3N9GH 4ZS7H 3QULB 4G9DA 3OXRA 4TULH 4HKZA 2OR7A 2DTSA 2HT2D 5D7LD 4MDJA 5CZVH 1TVDA 1EEZB 4POUB 3FB8B 1CT8A 3CVHB 2VLRA 3V4UH 5I8OL 1UZ6E 1E6OH 2F53D 2H8PA 4KGLA 5FYKD 4HK0A 4YXLL 3CFCH 2P8MB 1ZAGA 3SQBA 2ICEA 3T0VA 3IJSA 3WLBB 3F7QA 4J12A 3U30C 1IZKA 3MRKB 5DD3L 4NN6B 5DFVD 1D5ZB 3H9SD 4LCCC 1KYOJ 3LKQA 4HKXA 3BKYL 5D2LF 1A7RL 1NC4D 2BOBA 2D7TH 2EE6A 4GAYA 4XTRD 4AMKH 7CGTA 1UXSA 5T5FH 3VFUB 1XR9A 3OKNB 4PJ8A 3V6ZB 2VXSH 1ZGLA 1F4WH 1T20A 1KLUA 4IOFC 3V79C 4N0FB 3L3JB 2WNGA 4X6CE 4AEEA 3V0WH 3SDXB 4LCIH 5C0CA 5JXEA 4N5EC 1CXFA 2A83A 1KPVA 1PEZA 1OHQA 4YBQC 3AGVA 1WCBA 4CKVX 4POZC 2UY6A 4PV8A 2OP4H 2FD6L 3BWUC 1DBJL 4PP1C 5FOBA 3U36B 4KROD 5CP7A 4WGVB 2MHAA 1RZJL 5I16B 5DURB 3S4SB 4HWZA 1M4KA 3IDNB 5L88H 2YPKA 2HT2C 4F7CB 1AXSB 1AC6A 5F7EH 4EQ2A 5AWNL 2X4UA 1SEQH 1EGJL 1S5IH 1EAPA 1D5MA 2ARJQ 2EDEA 4RGMC 4O4YL 4NKOB 4PJGB 3B83A 5HPMB 5AZ2H 3SCMB 1M1SA 3UYPA 4MJ4A 5LGHH 2GTZB 4RAHA 4XP1H 1J87A 4WW2A 4HV8A 1S7QB 2JK5A 3IFPB 1RI8A 2AGJL 5DFVC 1NAMB 2G60H 2GYSA 5K9OA 1GC1H 2DQHL 5HDQL 1TPXC 5GS0H 2QR0A 4XTRC 3B5GA 3QEUA 1XCQB 2QL1A 3QO1B 4YHKL 1I85A 1AD9B 3F58L 1UM5L 3HG1E 2ERJC 3CVHL 4FQCH 2ZUQB 3V5HB 1CF8L 4LFHG 3VH8A 4F33A 2FIKA 1UWGH 3EDEA 3GRWL 4WV1C 1FNSH 3KPSB 1T0MA 4NM4H 3WHE1 1MJ8L 4QXWA 3I9GL 3IKCB 2AKRB 3HMXL 1UACL 1YY9D 4K7PX 4ZNEA 3PGFH 1IGJA 1TJGL 2V2TA 4KROC 4P5TA 4X9IA 4JPVH 1KULA 4LHUA 4TQEL 4X7FC 4MWFA 5I0ZA 3ARFB 3HKFA 2IQAA 3F7VA 3GMMA 3OKKB 1Q94B 5EU3B 3VXOB 1CFBA 1NBYB 4EXPX 1HYSD 4HIEA 5F96L 5JW4R 2W0LA 3K46A 2D03H 5JW4Q 1N5YL 4W4OA 2HMID 4M5ZH 1S7VA 5F9JA 3RWGB 3V4PH 3MRRB 5JHLH 1FLTX 3LS5L 3BP7B 2BK8A 3TWCL 1RUML 1WISA 1H3GA 5EOCJ 1DEEB 2F19H 5KSBE 5C07A 5EOCH 2CH8A 5MERB 4QRRB 3LQAL 4NC1E 1JHKH 1JFQH 4FFWD 5KSAD 2APTA 4AIZA 4IHOA 5ACMA 4R6UA 1EFXA 3ULVL 4I2XE 1GCFA 2JE8A 5DI8A 1W72H 3MMEB 1SMOA 2GAZA 3T0XA 1QA9A 2Y07L 2BNRB 3LN5A 1U0QA 4PYHA 2HFEB 1XGUB 1FZKA 3DYMA 2YHGA 1L7TL 3BZEB 3ZHKA 4KHXH 1ITBB 4UINL 2ZKHL 1U8LB 3DV4A 4OB5H 1FFPB 1U2HA 2JCCA 2APVA 2E8ZA 2JJUA 4FOMA 1TITA 3S7GA 1YN7A 4R4FL 3MOBH 3QEQD 4PJFB 1UB6B 1YY9C 1ZA6B 1H3PH 1OVZA 2V7NA 2ESVD 5LCVH 2Q76A 1NAML 1JZ7A 3PWPE 2EDWA 3H2WA 3TC9A 5DZOA 4G8EB 4HCRL 4Z78A 5F72S 1NMCC 3EFDH 4PREA 5EN2B 1MCDA 3RY6C 5D1QD 1CLYL 1Z2KA 1T21A 4HPYL 5KANI 1JUFB 3N85L 4TN9A 4AIOA 2LABA 3KPOA 1HYSC 3LIZL 4NNXB 4YHIB 3EHBD 1OL0A 4NUGL 4L5FL 4WO4A 3HS0B 2HMIC 4QTHB 3WJJA 1RD6A 1MHEA 2J4WL 2F74B 3OKOA 4GQPH 1Z5LB 5DMGD 2FJFB 1KCRH 5ESVB 2PYFB 1C1EL 4DK3A 4FQXD 4F8QA 2A6JA 4Y19E 5KSAC 3H8NA 3OWEA 4HKJA 5DJAA 4HUUB 5BO1H 3OHXB 4JFHD 1FZOB 1YPZB 2HKHH 5ID1A 2R8SH 1FYTE 1TTGA 3L3HB 4HGWB 2YPLE 3CFBA 1MREL 2ICCA 3D0VB 3DTXA 3CX5J 2AXFA 2DQDH 4QHNA 2O5ZH 4P5KB 4MA7H 5FO8B 1QLFB 3D2UA 5CJQL 4OGXL 5IV2A 1B0WA 1OQOA 3DX9B 2BMKA 4QT5B 4GT7A 3S97C 3U9PH 2A74A 5HDOA 1T4KB 1J8HD 4Z7NE 2FO4B 4PJDB 2XIDA 4PY8I 3MODH 1ND0B 5LWYL 1K8IA 2UYLA 5D1QC 1I7ZB 1ZE3C 1QBLH 2FJHB 3KXFA 5DUPH 1XH3A 5DEZA 3V7AG 4EDXB 2A1WH 4U6YA 2EH8H 4GQ9H 4HDIB 3TNMA 1UJ3A 4P57A 3CPLB 3GJEA 3NTCL 4R3SA 1O5DT 3RTQD 3EHBC 4JG1H 5EZIL 5E2WL 4I18A 4KUCD 4JGUA 1IM3B 4X99B 1IQDA 4H8WL 1F4HA 3O6KL 1YQVH 4M62H 3CD4A 3KYMB 4AG4H 1I3UA 4I1NB 3FT4A 3INUL 3RWCA 3K1KC 1T2QH 3NIGE 3BGAA 4JPKL 4LSVH 5IVXE 2DYPD 4ODWA 2YBRA 4OLXH 3TZVB 1IKFL 5HXMA 1JBJA 4PRDA 3T08A 3HUJE 3MSPA 2I25N 4WTXA 5TDOB 2VJXA 2E7MA 4LRIA 4QRQB 3AREA 2GUOB 1KJ3H 5C0ND 1V3MA 3UYRL 4P2RE 1ULVA 1NGZA 1JHTB 4CMMA 2PXYA 5CJBA 4O51A 4PJEE 5JR1H 4TUOB 4F2MA 5GZOD 4OD3H 5DMIH 2VUYA 2GT9A 4MNQD 5MEQB 4YHZL 1RMFH 4X0KB 4PJXF 5FHAH 2Z8RA 4UTBH 5BVPL 5HHPA 1MCBA 5ISZA 4NQCD 1I7RA 5DHYA 4RWYL 2YMXL 2HVJA 4BH7B 3T0ED 4K7FA 3FFCB 4P0DA 4LCCB 2VZOA 4B50A 5BMFH 3E2HC 3TEUA 3RNKB 3QFJA 1CDBA 4OV6F 4HFUL 3RTQC 1W72A 4UDTB 3JXAA 3TJHC 1CTNA 1WSST 4S0SD 4EQ3A 1JGLL 1QNZH 1FIGH 4NO5A 2DD8H 5BS0D 3QCVL 1E28A 3V6OA 2I5YL 4P2QE 5L2KB 4MD4A 4JLRA 5DQDL 3WL9B 3BDBA 3DYPA 5DMYA 2Z91B 5SWQB 4JHZA 1QBMH 2ITCB 3SKMB 3LN9A 1VERA 5A16B 3BN9C 3VFTA 5GZNC 5JPNA 1CXEA 4X8JA 3MFGB 3UTSA 4NN5B 1EUTA 2CKBB 3CDCA 1R5WA 5I1JL 3K8LA 3HC0A 5TDPB 5IK3A 4G8GB 3RDTD 2YUWA 4ODHH 3PHQB 5C0NC 6FABL 3LCYA 2YXFA 4HXAL 2VXVL 2I27N 3IDJB 5DRNB 1BM3L 4GRMB 1OTTC 3ARSA 2OJEB 4BQ9A 2XICA 5GZOC 2HT4D 4P46A 5D7LB 4EI5B 1CL7L 4N8VB 3T09A 5T1LD 1YMMA 1F02I 3BW9B 1QD0A 1JPSL 3FFDB 1BFOB 2DIBA 4PD4J 4Q6IA 4RGMB 4AL8L 5HJ3A 1A9BB 1NDMA 5D9SA 1T1WB 1CXLA 5DD1H 4X4ZA 4UTAH 4Z7VE 2WINA 3RWDA 4HBQA 1T5WA 3BZ4B 5GGVH 1K8DA 4F57H 3REVA 2QLVB 3BJLA 1F3JB 1QVOA 3T0EC 4DKFH 2AXGA 3H9SB 5E4IA 2VUOA 3BUTA 3L9RA 3KLHC 1II4E 5T3XD 4LSRH 4FQIL 3SGDI 2BOCA 2P46B 1TPXB 4YLQT 1KJMA 3IDMA 3MUHL 1OAKH 4DAGH 4W4NA 4JFDE 5I1IL 1RZFH 1PZUB 2A6KB 3FCTB 5GS3A 4WFED 4YEFA 3IETA 3LEXA 1VGEH 2ERJB 3C2AH 3HA0A 3D39E 4G6AC 1C8PA 4EBQL 4JY4A 5BV7H 1AXTL 4MA1C 2P47B 3NCJH 3IXTA 4WV1B 4Z7WA 1OGAA 1KCKA 1NGWB 4FFYL 4FQ1L 2DMCA 2GCYB 4JQXA 1F97A 3V8OA 1JL8A 1AO7B 1XIWD 3FJTA 1VACB 1FG2B 4M02A 5CEZL 3C8DA 1X5HA 2XG4A 4ZSOE 4WY7H 3QXTA 1RY7B 2X6MA 3TA3D 3GGWB 1UZ8B 4G3YL 2NQCA 2HT4C 3VXQA 4Z7OE 4MDIB 3QFDB 2ARJA 4JQVA 4QXGL 4O58L 5HHVH 5I1EH 4PRIE 2N4IA 3BISA 4QY8B 5E00A 3ECBB 1DLFL 1NFDF 3RZCD 2PN5A 4PJ9A 2J7LA 4IOSD 4PJAE 3HI6H 4TVPE 1A7OL 3H7LA 3BKJH 3MZTA 5DJYA 5HYQA 2CKBL 3MJ7B 4YHYC 4KFZC 4QRTB 1A6ZB 4ETYA 3WN5A 1FH5H 1ZS8B 5D6DC 3BIKA 2EH7L 1T2XA 1R5IA 1YNKL 4G43B 3RL2A 3MRDB 2H26A 3GSVA 5TQ2L 2AJUH 3SO5A 4PTUB 5LVEA 2BSTB 5IEKA 3CMOL 1WJ3A 5KS9E 2P48B 3BUYB 4P9ML 3UBXB 1CIUA 2B4CC 5GGRY 4GG8B 5I2IA 1IC4H 1EIBA 4OM1L 3GBMH 3P0VH 3ILPA 5F1OB 3BXNA 3WFBL 1U6AH 1OSPL 4TNWK 5CSGA 2R15A 4K8RH 3S34L 3G5YB 2DI7A 5E4EC 1XIWC 2YC1A 2IPUG 1CFQB 4XNZC 5KW9H 2J5LC 1NMCB 3TA3C 4YDIL 3VXRD 4HKBA 4Z77B 5KVEL 4XC3L 4RFEB 1M7DB 2DI9A 1R3JA 1Q9WB 4WJ5B 4HC1L 2DLEA 4QYOB 4F7TA 2FH6A 2OZ4H 3ARZA 4PJBE 2JJTC 4DZ8A 5CBAA 4MNHA 3C6SB 4XNQB 4LVNC 3PE9A 5F7NC 4BQCA 2IPKA 3ROLA 5E8DL 1NMAH 3MLZH 3U7YH 3O3DB 5FEBA 3U0WL 1BJ1J 5F9WC 1HXYB 5KSAB 2VLMD 3WE6A 3CFKA 4BYHA 3IDXH 1J18A 3WFZA 1C5BL 4PJ7E 4FTVE 1BJ1H 3ES6A 4PY7A 1I9RH 5HPOA 2DLFH 3G04B 1KCVL 1ZLUK 4LKCA 4YNYB 1GZPB 3MYZA 2DQFA 3QDJD 1CS6A 2Y6SC 4CJ1A 1H8SA 1QACA 3GJFK 5SWSE 3QQNA 5EU5B 4HEPG 4R4ND 4OUUA 4JFFA 5CMAA 3IJYB 5GGQH 2E8YA 5I8KL 2UWEF 3QEQB 3FO2B 1AGBA 3D85B 1YEEH 5C09A 3UTTB 1J0ZA 3RRQA 1IZJA 32C2B 3QIBD 4KKLD 4NNPL 1IE5A 3QPXL 2BNQD 4L4VA 5D1QB 3JV6A 1QFHA 3SDAD 3N1MC 1LILA 2B39A 1JMZA 4HWEL 5KBNC 3PUCA 5HTSA 4F15B 2R0ZH 1T0NA 2FJGA 4JB9H 5IMMB 4HW6A 3MR9A 4DN3L 3PNWA 3C5JA 4CBPA 4OZIA 3T04D 4MNGE 4GKNA 3CU7A 5IB3A 1W0YT 3K1DA 1G1CA 5D4QA 1SM3L 2XWTA 2XTJD 3EO0B 5I66B 2ZOLB 3CZFA 5E03A 2Y25A 4M7KH 4PRHD 2N7AA 3EOAA 3SGDH 1XF4B 1BFTA 1C16A 5HY9A 3CFEA 3I85A 3CLFH 1P4LA 4JQIH 3SDYH 5ENWA 1UEMA 1H8OA 4WFGD 3SDDD 2P42B 2Y36H 4JKMA 1EMTL 4R4NC 3I6LE 2PCPB 5EZOH 2CRIA 3CFDB 4ODXB 1AGFB 2J8HA 4L9LB 2K7PA 2CDEA 1EJ6A 5CHNA 1PY4A 1PGRB 3QIBC 4KKLC 3TH2T 5MP6H 2DDQH 3MRIA 4OTXL 1JGUH 2IPTL 2IH3B 4OF0A 2NNAA 1N6VA 3EYSH 2NY5L 3SDAC 5GRXG 1ORQB 4NGHH 3QXWA 1U2CA 2EDHA 5DD6B 3E2HB 3RTQB 4XVJH 1A9EA 2AQ3A 4HK3N 5C70A 1DFBH 3GMNB 1G7HB 2KH2B 5T33H 3VW3H 4NDMB 3JVGC 2NXZB 3HB3D 4JFED 4W81A 3SGJC 4EDWL 4NRXB 2O26U 3X3FH 1MH5A 3TN0D 3I75A 3TJEL 1G9NC 2XTJC 4NKIL 3RIFK 2DYPB 3MBED 3FQUA 4LSQL 5FM5M 4S10A 1RZJH 1Q0XH 2IH1A 4X6CA 3GSWA 1GGUA 1ONQA 4YBLB 1MWAB 2IAND 1JE6A 3DVNA 4JVWA 2ED9A 1F8TL 3L3OB 1TZIB 3HZYB 5IT2H 3DO7B 2VDRH 3GUTB 1A02N 3SDDC 3FN0L 2XG5A 3S9DB 1R6VA 3WD5H 2ADGA 5SV3A 5HDLA 4NZTL 1A7QL 1KJVA 3U48A 5EU6D 1I7TA 1DVFD 2NTFB 4O4YH 2OZ4A 1CBVH 1GGBL 1T1ZA 2VISB 1KUMA 2FSEB 5K9QI 1I1RA 1MLBA 1LDPL 1FNFA 3VA6A 1HDMB 4HPOH 2H9GB 3W81A 3O45A 3E8UL 1LHZA 1S5HA 3A6CH 3FQWB 5F7HA 5F88A 2E7LA 4NQCB 2B1HH 5J9PB 2AGJH 5JIPA 1HHGA 1MCIA 1IAIL 2DQHH 2EIZA 1KG0B 2R0KH 3T0EB 4PJ5E 3RL1A 4U33A 2EEAA 3D3VE 1QLRB 3KPPA 5I9QB 1AFVH 4BK4A 3C9NB 1ZLSH 1T1YA 4TOYH 2AJ3A 1BQLL 1U3YA 2EE2A 4BFBD 5BS0B 3C6LA 4O2FA 4JY5H 2AERT 2EDBA 3VWJA 4KI5F 3HB3C 4JRXD 2OTPA 2X4PA 2MJWA 1FVCA 5HD8C 3M1BB 4RMQA 3TN0C 3DJ9A 3DETD 1HH6B 3LQZB 4ZUWB 3IVKA 1H5BA 2ENYA 3HG1A 3FQNB 3DIFB 3MBEC 3DX7A 4GFTB 1UM4H 4LASL 4A6YH 3UROR 1YYML 2X7LB 2OR9H 4OF3A 5F3HA 5TJWK 1OSZB 1J9CT 4OAWB 5C9JA 1BX2B 1CLCA 1DQQB 4ELMB 5TE4L 2JJVA 4XVTL 2KQMA 4KY1L 3HE7B 1NUFA 2GJZB 4ELKB 2VL5A 2HJKA 3BO8B 1F58H 3TBVA 4Y5XA 3ZT6A 5TE7H 3UP1A 2B5IC 3QO0B 1JF1A 2BX5A 4QGTA 4HZLA 4OZHB 2Z31A 4L3AA 2ATPB 3GIVA 5C08E 3NPSC 5DC9B 3JV4B 4HD9A 1RK0B 4M93C 3O3BB 5HI3D 4TYUA 1X5LA 2WUCH 3RNQB 4LKXA 4R7DB 4U3HA 4YHYB 3TYFB 2J88L 3OX8A 4TSBL 5H8DA 3P0YL 4C56E 1MWAL 1QSED 3MV9E 2EZ0D 5DSCB 3FOMB 5I1GL 5KSBA 4OZFB 3D6GA 1BIIA 5DEFA 3LS4H 4E0RA 1WFOA 3DECA 3LN4B 4APQB 1FAIL 1OB1B 4KDVA 3WJLC 1XF3A 1N0LA 3MRQB 4I2XA 2GITB 15C8H 1YNTA 4EEEA 1AIFB 3RWIA 2IFFL 1P6FA 3DETC 3LKSA 3FQRB 1DBML 4Y4HA 1ZVHA 4XNUL 2DBJA 4XCYB 5I1LB 2XPGA 5C0RH 1S7XB 5DQ9B 1VA9A 3P11H 5LBSH 4Y2DA 4U49A 2AEQH 2ZSWB 1GOGA 4P59L 4HCRH 2BSRB 4GW5A 3VE0A 4XPHH 3MRLB 1D5XA 3T4YB 3MJGX 2ZCLL 1XIWB 2VAAB 4LLVA 3N85H 4XNZB 4DGYH 1LP9E 5EIIB 2WMPA 2J5LB 1ZTXL 3MRCB 4KKCD 1WC7B 5F8QC 4ZDHA 2G2RA 4RGNB 2BY3A 1DDHB 3PWPA 4YHLH 1KLGA 4WI5A 3TO2B 4PJCB 4WUUE 2HLFD 4D94A 2VDQL 4Z7UE 3PGDB 3MLVL 5GPRA 2C3WA 4F7PB 3KWWA 2QQNL 2R1YA 2IBBA 5TGBA 1B4JH 1FZMB 1OM3L 3U4EB 5HI3C 3KYNB 4LVNB 4E9LA 1UCBL 4I9WD 1NFIB 1C7SA 5TE6L 3C5ZA 4K94H 1A5FH 1AI1L 3BT2L 3D69B 4OI7A 2EZ0C 5F9WB 4WU5B 1UB5B 1XF5A 1TLKA 4DKEL 3P4NA 1MCOH 2LAAA 4OKVA 3N1QC 1G7JB 4EUPH 3HE6D 3QDGD 5DUBA 4M7LL 3VXSD 1NCDL 4YUEH 2R4RH 3CXHK 4XZUA 4Y19A 2E6QA 3AS3A 4DTGL 2W59A 1JPTH 4ZTOH 5T1MB 3O2VL 2N1KA 1TVHB 1JTOA 3FO1A 2PYEB 4CADB 5I74C 1FYTA 2XZQH 5C0JB 1ORSB 5B8CA 2YPLA 4YFLI 4I0PD 4JFXB 4NO2A 2C1PB 1L0QA 4FQHA 2ZZUT 4JREC 3DV6B 1TZGL 4ISVB 4OGAD 1NDGA 3WUZA 4QCIB 4UT9H 4ZO9A 5LWYH 3K74B 5EBLA 4MMXC 4OLEA 4UT6L 1QEWA 1VFMA 2PW1B 4XMPH 5IMKA 4JHAH 3ZTNL 4KKCC 4JVUA 3RGVD 5F7MC 4KV5E 4NHUA 1B0RA 1OAUL 4S1DD 1A1MB 3QXVA 2VABA 3QUYD 3AU1B 1JNLL 2HLFC 3AFLA 5HGAA 1E4XL 1RQ5A 3QH3A 4JPIB 3MA9H 5IBTL 4XPBH 1QHOA 3IDYC 4UZGA 2AVGA 4QRPE 1A0QH 2CDGB 5F7WC 4H26A 4LF3A 1QBBA 1CN4A 2XXCB 3GK8L 4DQOL 1CD8A 4A6YA 1J05B 4OLUH 3LEVL 3CFJA 4E42B 3OF6D 3ZE0E 4IEFB 4NRYB 3MRNA 4QHLB 4TVPH 1VGKB 3HE6C 5JMRA 2CO7B 2QHRL 5IVXA 3ZDXE 3IDIA 4IDJH 4U0QB 1GXEA 5DRZA 2HA1A 2C3HA 1UM6H 5H35B 1FRGH 3HUJA 1GGYA 5IHUL 3GHBL 3CFIC 4NKMA 5FO9A 3WFCH 4G6ML 4P2RA 4I0PC 3W2DL 4NQDE 3DHMA 5BZDB 3ARDA 2RHEA 5D7IB 4OGAC 4PJEA 1A64A 1PFCA 1OAXH 1WEJL 5DJCA 4QXUH 5E94A 1KIPB 3SEPA 2YMXH 5DVKA 4C57C 2ADIB 3T3ME 1MCPL 1FFOB 1SY6H 4OFIA 1QFWI 5IG7A 1ZHBB 4OCMC 5K9KB 4UIMA 5CCKH 4KC3B 1MI5D 4HSQA 3RGVC 3MACL 3SDAB 1ZOXA 3KPRD 3M8OL 3MGOA 5F9AC 1G6RH 3HN3A 2Q86B 4GAGH 1X6NA 3DXAE 4U1IB 3TT1H 3QUYC 5J1SC 1DL7H 4QHKI 4ZAKC 4MAYA 4PBXA 5ITFA 3W11C 3BP5A 3RI5K 4JE4B 4G80A 1TVBB 3VMPA 2P43B 2X89A 1IAOA 1NGYB 3L7FA 1IBGL 1KPUA 1NLBL 1R0AL 4YHMH 2WBJD 1U95B 4YGVA 5JO5B 1J10A 4AQOA 4M48L 4P2QA 3TVMD 5C0GA 4MHHI 1IGIL 5ESQA 2XTJB 5I1JH 2L7UA 1XGPA 2EDTA 1X3DA 3SBWA 2IFGA 5CKAA 4ORGA 2ARWA 1CE1L 4WEBL 1N7ML 3HR5B 2H2PD 2L0DA 1P4IH 1ED3A 2HFGH 4RSVA 1KENL 3CDYA 1B2WH 3BH8A 5BRZD 3O8XD 3BIBX 2PTTA 4M61B 1AGDB 1E6JL 2C4FT 4OZGE 5FV2A 1SJXA 1HEZB 1NJ9B 1U8NA 2GJ6E 3CAFA 4JAMA 1LK3L 4P4KA 1CK0L 1TXKA 1WWAX 3EOTH 5DA4A 2J8UE 4CVXB 1JPFA 2YD4A 1P84J 1MELA 5FA4A 1M71B 3BE1L 2X10A 2OSLB 2VLRD 1EEQA 1U8HA 4NQXA 2EDJA 4EUPA 1XCTA 4ACPA 3P9LB 5ADPL 3QHTC 4XX1E 2IADA 1AXIB 3FAXA 5CBEB 4WFFE 3WEXB 2DQGH 2JB5H 2CXGA 2Q20A 3H3KA 4P48A 2X4NA 4PGDB 4WIQA 4Z0XB 1OOAA 2A2QT 2F54E 3MRMA 4KTYA 5BXFB 4MXVF 2P1YA 4LAQL 1BF2A 3D25B 4Z0BH 1YJDL 2Z93A 3CXDL 2A6DA 4O5LL 4JFEB 1KC5H 2EYTA 4JO4H 2X40A 4JFDA 2W92A 3B9KB 5D7KD 3D18A 4Y8AA 1OP5K 3TVMC 3DX6A 5CILH 1EHAA 2YN3A 1YEKL 1HILB 3D39A 4Q0XH 3V52L 3HI1B 2X09A 4PGBB 3OZ9L 2RFXA 4HZAA 1I9JH 1JYWA 2H2PC 4MB5A 2IANB 3T3PE 4OQTH 3KPMA 3VFGH 1PG7L 3EYFA 4K23L 4XCFH 4H25B 4LIQL 1KB9J 3LRGA 3JTTB 3O8XC 5C0FB 5C0CD 4M4RA 5JXED 4NN7C 1IGCH 1EA9C 4L3EE 3PWJB 4ZSOA 3UTZA 1LO5A 1N0XH 3W9EA 2X4OA 5K9QG 3BMWA 5FHBH 2B5IB 4EIGB 1SYSA 1AHWC 4KMTL 1ZANL 3GIZL 4ZD3L 3KPTA 3BPLB 4J3WA 1A7BA 1A7OH 1IFHL 3P9WB 5ERWB 3SQOL 1HOCA 4PJHF 3NPSB 5IB5A 3F65A 1PD6A 1ZHLB 4M93B 1Q1JL 4FFVC 2Q6WB 3QI9A 4PRIA 3GKWL 4K3JL 5IW6B 1LK2A 3ULUL 1BVLA 3GSUA 4RNRB 5CEXB 4L29A 4XMLH 3BD3A 1INDH 4PJAA 2K7QA 3O41A 4Y1AE 4YFEA 2ED8A 5TQ2H 3K4AA 1MUJB 1X44A 4M1DL 4FQ2H 3RUGF 4ETQB 4DVRL 1TJIL 3W9DA 2Q8AL 5K9JH 1DN0A 5I8CA 4GRWB 3VI3F 4IS6B 3WHXA 5EZLA 2HVKA 4NCC1 3NZ8A 6CGTA 1F11B 2D7MA 2W9DL 3CLEL 4XC1L 1RUQH 4ZO7A 5JIIA 1QRND 5D1ZD 5KS9A 2AI0L 4JO3L 1AY1L 3EYOB 3BP6B 4HH8A 1FBIH 1UYWL 2ZSVB 3MGTA 4UDUA 4KUZL 4X9FA 5E8EA 1BQUA 1SY6A 1F90L 2RJMA 5FYJD 3QJHB 3V0VB 3VJ6B 5E8OA 5HGHA 5DQJB 3SOBL 3AS1A 4UT7L 3VRJA 1SJHA 1G6RA 3MRFB 2X4SB 4GUPB 5BZWB 4HFWB 4G7YL 4U3XA 4ONGL 4LFHD 1N5AA 3B6SB 2CPCA 1ZA3A 4WDIA 5JXEC 1NMBH 2A73A 5HHQA 3OAUL 4LBEA 2AJXL 3T0WA 4JFPA 2OBGA 5A2IH 2K3TA 1RSFA 1MFEL 3A6BL 2ADJA 4P3WA 5GGTL 3BDYL 1LO2L 2A9MH 2F58L 5F1NA 1QUNA 4LNRA 3G08A 2YD8A 3K8KA 3VXMB 4JPWL 1YDPB 3BAEL 3DRQA 4YR6A 3VI4F 3O81A 1QSZA 4PJBA 5E2JA 1BLNA 5D71L 3UJTL 1TJHL 3U2SB 1XGYH 4Q97A 1QFWH 5DC4B 5E5MB 3REWB 3VFMB 2M8XA 1A6UH 2FECI 1MLCA 3TBWA 1A4KA 3MUGA 3RKDD 1FNGB 5ACZA 3LKPA 3FMGL 4I3RL 1CZ8L 1BOGA 1VEPA 2D0GA 5C0AD 4P3DB 4MCYB 3MOAH 1GHFH 3MREA 3DX8B 3LPWA 1R3LB 5IW1B 4B7IA 3Q6FA 1J1XH 1BZ9A 1O7VA 4PJ7A 4FTVA 4F7MA 2VERN 2HJFA 1S7RA 4R97C 4M7ZC 3OJDB 5EOTB 5AD0B 4WI3A 1PAMA 4PRPD 1QSFD 3KVQA 1S9XB 3L3DA 1EFXD 5CSZA 1OAZL 5E2VL 3QZWG 4JREB 1I85C 3D48R 2DF3A 5HYSB 5SWSA 1OD7A 1DUZB 5JUEH 3QZWA 2JKXA 5J11C 1GVIA 2V9RA 4N9OB 3QISA 2YRZA 4GKSB 2ATKB 3P4MA 3RVUD 5JLZA 5DUML 2M1KA 2OK0H 4J3UA 5HVGB 3ZE1E 4ODTL 2DM3A 1RURL 1RVFH 2B2XL 3FHQA 4R7NB 4XXDB 3B3IB 4P5TC 2GY5A 3KPNB 4KVCH 4QHUA 3O2WL 3QDHA 4X9BA 4H0GA 2BVOB 2XOTA 3IDYB 1I8MA 1BF8A 4NM8H 5FKAA 1RIVH 1DUYB 3GO1L 4Q9RL 1MFAH 4XI5D 5IESL 1PY9A 1KIRA 2E3VA 1FNEB 2QBWA 1FAKT 4JZJA 4A2MA 2PETA 4LCYB 4ZFOB 2FWOA 43C9B 4WO4D 3DROA 4PIRF 4W4OC 2G5BB 1VFAA 2IGFL 1MCCA 4MNGA 3RKDC 1D6EB 1LDSA 1MCNA 5LXGL 3K2MC 4U7MA 3HE6B 4OQTA 2WV3A 5F7KC 3VXSB 4K9EC 3RUGB 3QNZA 5KZCB 3MV8E 2LTQC 4ZTPH 1DBAL 1MEXH 1TZHA 2DTML 3PWLA 1DQLH 1EFQA 3DPBA 2L7JA 4YO0A 1HSBB 1BHGA 4FFZL 5MENE 1IC1A 4WTWA 5EU4A 1GRWA 1MIML 1NH6A 5F7LB 3IU3A 4Y88A 5I1AB 3V4VL 1P7QA 4IRJA 4U1KA 2SEBB 3Q6GL 4IOIB 1BEYH 4ZUTA 9CGTA 2I9TB 3HRZB 3AXLA 4X7SL 4XWGL 3HC4H 2NW2A 4LP5A 4ZPTA 2HP4A 1CG9A 1IEAA 2W1NA 1QFOA 3RGVB 3RVUC 1IARB 1FE8H 5EUOB 1R24B 4J7RA 1F4XL 4OCXH 2OYPA 4TTDD 3SO3B 3QUYB 3S36L 4HWUA 5FYKU 4ZAKB 3RPIA 4CJ0A 1I7UB 1U92A 1T22A 1AGEB 1BD2D 1TQBC 4AY0A 3GMOB 5DRWB 4DEPC 4EDWH 2VQTA 1J7VR 2YWYA 1V7ML 2VDPH 1ZHNA 4ZFZB 1H15B 5GS0D 1I1FB 4KVNL 4XI5C 4MZ2A 3VMOA 3ARYA 1G7MB 1TNNA 3L3KA 4LSPL 2KUTA 1M6OA 2F5BH 4WO4C 5IHBA 3S6CA 4KDTA 5IMLA 4JANA 3V5DA 2VLJD 1YEDA 3EYUL 2EKJA 5EDXA 1ZLUH 4D3CL 2R2EA 3ARUA 4OCRH 4YC2C 2LVEA 3H42H 1KJ2B 4R26L 1J0HA 2QSQA 2ZUWA 1TETH 3L3IB 1JGVH 3CUPA 4EJ1C 2JLLA 2ID5A 2KDGA 2DQJL 4RFOH 5DK2B 1FL3B 1HHKA 2DWEA 4H20L 3U7WH 3MCG1 1A4JA 3V5KA 3HMWL 2X9YA 5IVZB 3OKDA 3T77A 1I3RA 4ZFOL 5D2LE 5FF6A 5M95B 1EUUA 2BVEA 2PXYD 3PQYE 4X6DF 5K33A 3CVIH 2MCPL 3LOWA 3H9HB 1MFCL 5FCUH 1L0YA 1KXTB 4EN3A 2OL3H 3GBLA 1TMCB 4JG0H 4FXGB 4OD1H 3T2OA 1RZKH 3KPRB 5L9DH 2FEEL 3SJVD 1U3ZA 5ICXA 2Q7YB 4TTDC 1BQLH 4PRBB 5IB2A 3AROA 3QUMH 5IJKC 1JV5B 3VFOA 4AIXA 4LLQA 1DANU 1FL5B 5JHDB 1J1OL 5ISZD 4PJ5A 1JGEB 4HS8L 4M6OH 5LAXB 3KNBA 3GSOA 3D3VA 4JKPH 1GC1C 4JR9H 3VGBA 3KYOB 3MRGB 5DJXB 1U91A 2H6PA 5GS0C 4MHHG 1UJ3C 4WU7B 3EO1A 4LLDA 2CLZB 3TVMB 1YNLH 3BGMA 2P45B 2QHLA 4FNLL 4UOW1 4ZUVB 3L6FB 1NGPL 4I18C 1CDGA 1MQ8A 2AJVH 3VWKA 4MS8C 4OFPA 2YK1L 1NCBL 4F9LA 4HWNA 1A1OB 1PG7W 3G6AA 4NZJA 3E6HB 2BDNL 3MLRH 1DQJA 5KG9B 4U7SA 1RIUL 1AQDB 4KTEH 2Q8BH 1KF9B 3ZO0A 5GSVB 4NQSB 5EORL 5BRZB 1KEML 4LCUA 3O8XB 3UTSD 4NFCA 2ORBL 4NN7B 3KGRA 1G9MH 4Z9KB 4O2EB 4ZFGL 2VL4A 4PLJD 5ICZB 4LRIC 4KAQH 2UV3A 1AHWB 3AREC 1CFSA 4ENED 2VH5L 4G9DB 1JHLH 1T7ZA 1X5JA 3OXRB 2PXYC 4S11A 1DBBH 4TSBH 4HKZB 3CZJA 2CR6A 1QOKA 2HH0H 3B2VH 4MDJB 5C08A 2COQA 1U93A 2IBZY 1CT8B 1KJ2L 2VLRB 4Y16A 2WUBL 2H8PB 1UQSA 4RQQA 5FAAA 5DR5H 1XEDA 4HK0B 4IMKA 5J6GA 1Q72L 2BFVL 2AJSH 4KQ4L 4M5YL 1WWBX 1HIML 2UZYB 2XI9A 3I3EA 3NACL 4C56A 1CVSC 4BSJA 3MV9A 2JIXA 5IVNA 2ICEB 2IFFH 3BVNA 3IJSB 3TCXA 5AZEL 4IRSA 4G5ZH 4H5SA 3TBYA 1W0WA 2H2SD 4JN1L 3LKQB 1RZ8A 1E4KC 4HKXB 1KIQA 4OIIL 2BOBB 2QV2A 4GAYB 2HAZA 1A22B 1J1PH 1ZLWK 1UXSB 4JO1H 1W8OA 3V6OC 4TPRH 1XR9B 2F5AH 4O9HH 4PJ8B 4U1HA 3WS6A 1ZGLB 4E41E 3GI8L 4UNVA 4XP4L 1T20B 1KLUB 1OGTA 5KVDL 3T2NH 1EO8H 3VXNA 4GAJH 3W5NA 3OQ3B 4TSAH 4G6JH 3ROOA 3BRGC 1D5IL 1OGAD 4M9PA 1G7IA 5C0CB 2Y7QA 1YEFL 5AEAA 1LP9A 2A83B 1KPVB 4I77H 4MSWA 1WCBB 4PV8B 4PLJC 4XMKL 1JNNL 5FOBB 2M2DA 2V17L 1Q0YH 1YEJL 2Y23A 3CH1A 5CP7B 4ENEC 1GPOL 2MHAB 4CN6A 4XAWL 5T5NF 1KB5H 2BZDA 4WUUA 4XP6L 4HWZB 1CGTA 3VGGA 4Z7UA 3LB6D 1AI1H 2YPKB 1KT2A 2PTVA 3BQUA 3E3QC 2X4UB 5D70L 4XT1C 2YA1A 1EAPB 1LO4H 1D5MB 4Q6IC 2VXUL 4XNXH 4DTGH 3QG7L 5HVFB 3WKMH 3GJFA 3FO9A 4GSDL 3PABA 5DRXA 3ZMRA 4WW2B 5KVGL 4HV8B 2JK5B 3O6FA 4R97B 4M7ZB 1HK6A 1QPXA 1KXQE 2UVFA 5K9OB 2H2SC 5GQBA 2XA8H 2FBJH 4ONFH 3HC3H 2QR0B 4KHTH 3QQ3A 5C6WH 3QEUB 1UC6A 1NSNH 2V7HA 1MVUA 4KI1A 3ZTNH 1MF2L 3NCMA 3MYJA 4TUJA 5J11B 5BCAA 2OL3A 3D0LA 1RJLA 3VH8B 1LMKA 2R0WL 3S3JA 4F33B 2FIKB 1MIEL 4DUVA 1T0MB 2J6EH 1CXHA 3QUMA 4JQXC 4YXKH 4KK8D 3NAAL 2X1QA 2DBLH 3N50A 5J6HA 1IGJB 2VQUA 2X44D 1OF2B 3LSOA 3QUXD 3EO9H 2FX8H 3QPQD 3RKPA 4P5TB 2V2TB 1LO0L 4LHUB 1T04A 4MWFB 5D1XA 5E99H 5J13C 5D8JL 1LO3L 2IQAB 3F7VB 1S8DA 3GMMB 5MEOA 3LB6C 4UB0L 5CEYA 4KDWA 5C92A 5LGKA 4X8XA 2DWDA 1S78C 1WZ1H 3RWHA 4HIEB 4JQVC 4OKDA 2WBKA 4QRPA 1RHHA 4RA0C 4D9QD 4PJIF 1S7VB 5F9JB 5INCA 3THMH 4PJ9C 1P4BL 3PP4L 2PF6A 4KZEL 3D9AL 5FYKE 3OV6A 3GHBH 2LTQB 3RU8L 4G6MH 5SX5H 5C07B 3U6RA 5F7FA 1CI5A 3U1SL 4RMRA 5T1KA 3BPCA 1LEIA 1QSFB 4AIZB 2XQYK 4IHOB 1JJUA 1EFXB 4U6VL 5DI8B 1PKQE 4X83A 2NY2D 2AABL 4PYGA 2GAZB 1QA9B 3O6MH 1PKOA 2CD0A 3LN5B 3UPAA 5FM8A 2HN7A 1FZKB 3UDWA 1OLLA 2Z8SA 3GHEH 1CLZH 5DLML 4YIQA 3DV4B 3ARPA 3FZUD 5FYLD 2JCCB 4NRZA 3TT3L 1A6TA 1KELH 1YN7B 3QDME 4OT1L 4OFDA 5C09D 4HUVA 1T03H 5KJRL 1I1CA 4LMQE 1CXIA 2V7NB 2MCG1 5FB8A 2Q76B 3Q3GA 3QUXC 3GDBA 2DQIL 4J3SA 1TQBB 1CVRA 1FFQA 3DXAA 4Z78B 4OZ4A 4L4VD 4PREB 5B39A 5I19H 4M1GH 1BGXL 1T21B 1G0YR 3E1F1 4UV7L 1MFBL 2WZPD 3KPOB 3PWVA 4HBCL 1U8OA 1CFNA 3TNNA 4MXWL 4K3EL 1MAML 3GI9L 4WO4B 3ZYZA 1CICA 3IF1A 1N7MH