4JDEA

Crystal structure of pud-1/pud-2 heterodimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
144
structure length
144
Chain Sequence
SQLTRRTAKVSIDNQTGSHFKFQVTHKYTGWDADKSDVVMFQPDEVKEIFKSVAYNTGFLTTGVDNWLVDGTMVQERTEVDNKGHQIGKKSYIEHAKFISDSRSWKQHMLTAEDDGKTTTIRVFPTEIHFISPSGESTTTFTKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Protein F15E11.13
publication title Characterization of PUD-1 and PUD-2, two proteins up-regulated in a long-lived daf-2 mutant.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 32
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2013-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18457 PUD1_2 Up-Regulated in long-lived daf-2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3820 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jdeA01
4JDEB 4JDEA
chains in the Genus database with same CATH superfamily
2XVKA 1DLFL 3SKJH 4M9OA 5AL8A 5LGHH 3TO4C 3F8UB 4CNIB 2PXYC 5DJXA 4AYDC 3DBXB 4NQDA 4UILL 3U25A 4E5XG 2VZ3A 2WQSA 3IXTB 3MTXA 2ZKWA 3KCPA 1EEZA 4F8OA 3TBYB 5IROD 1EX0A 5ANME 2C1OB 3QUZA 1NCTA 4FFWD 2NY2C 2E74C 5B39B 5L2JB 1D6EA 4R96A 4WO0A 1ES0B 4HVBA 4KJQD 3GC3A 2EH8H 1DUZA 1HL5A 4Z7UE 2E7LC 5TQ0H 2Y5TA 3T8XB 4G11A 5KSBA 1EHXA 1NINA 1CG9A 2P4AB 1KBGL 4DVRH 3HCVB 2YEZB 4GXUN 3VW3L 2WBKA 5IB1A 1EZLA 4QXWA 4BD4A 3OXRA 1MSPA 1FSKC 1RK1B 1W6LA 4K3HA 1GOGA 3QNYA 4DETA 2SEBB 1WIUA 2B16A 3B7UX 5C0FB 3B2PA 2A7BA 1I1CA 3GIZH 5D5MF 3WE6B 4U7KA 3QQXA 4HMDA 5FO7B 4PRAB 4J7RA 5LGKA 1TEGA 2VDKB 2BSED 2J1YA 2X0UA 3JQOB 3SD5A 2X6CA 3ZQXA 3QJTB 5A2FA 4D2NA 4NKQB 3IDJB 1GIGH 1X7QB 3F01A 4X99B 5FX3A 5T3ZH 4XE0A 3H4HA 3UPAA 1FFNA 2OP4L 2OCFD 3H9SE 2NY4D 4FJYA 4S2SB 3TO4B 2PXYB 1ZLUH 5KS9E 1NGXA 1OQXA 3IDXL 4KKLD 4MJHA 4GB9A 1ND0A 5FA3B 4PLOB 1X4YA 5E8OA 3S9DB 1KCUL 2NNAA 2V5YA 1OAQH 3KDMA 4KXBA 3T1WA 1MUJB 2NY2B 2IH1B 2HTLD 2VAAB 2WKLA 2ZP9A 3PU7A 3A4DA 4L05A 4HXBL 4ZK8A 3ZHNA 4XP6H 5TH2B 4NQVA 3HN8A 2XN9E 1TSRA 2F5BH 2IANE 3NA4A 4J3BA 3CPLB 4LGSB 2I9LB 4Z7NF 5CP3A 3IJ9A 1KTDB 4LOFA 3MFGB 1E6JH 5HD8D 4OJEH 4X99A 4DZBA 1F13A 1AKJA 3OMZA 2WOYA 2YUZA 1BJ8A 2Y7QA 2AZAA 4QXTB 1FSKB 2NLJB 2WYHA 3IAQA 5HDOA 3NGBC 4PCKA 5EU5B 4W9IC 2YRBA 1AE6L 2PXYA 2AEPH 5CJ5A 4P3DA 2WN3A 2OR8A 5FA3A 2YLHA 4N1CA 4UWQB 1TOXA 2EUWA 3LYRA 4O2CB 1NUDA 5I6PA 3UYRL 3ILPA 4G6FB 5E6SB 1XGQB 1QW9A 3SY0A 3MZTA 4EUPA 4KGLA 2E7LA 1ZTXL 4PYHA 4F2MA 3KPNB 1BQHB 1QFWL 3Q9QA 3EHBD 2EABA 5CGYC 3SDCA 4XXDB 2WVUA 4PWIA 4A7QA 3P4MB 4Z3JA 4LARL 3S35L 4UMGA 3BP7B 5JZ7D 1ZSDA 4CADB 1NH6A 3B5GA 3DGCR 2HLAB 3C6LC 2D7PA 4BZYA 5IWLC 1PG7L 4NBXB 1LEGA 3PHOB 2IMMA 2ZXWB 4OY9A 4Q7DA 1MW1A 1JPEA 4S0HA 1EXUA 4O2CA 4QHMA 4R8WH 1EJFA 4BCXA 4N86A 1T22A 1DQQB 2X4RB 3WNPA 5C0CE 2ED7A 4RBPH 9CGTA 4UDTA 4HUVA 3CG8A 2X4PA 2NQ3A 3T4AA 4I3RH 5J4MA 1JJUA 5E56A 5G5DA 3EXLA 1N2RA 1BWMA 4Y2DD 2DOCA 3AZUA 5J1AB 4M00A 1UJTA 2YXWA 3LSOB 1CFSA 3S34H 2ROYA 4LCWB 6PAZA 1DCEA 3PHOA 3VI4B 4WDIB 4U1NB 1F0LA 2HKFL 3MUGB 4N8CH 3HG5A 4WEBH 4FXKC 1FJ1B 5BMFH 3PL6C 1VA9A 3C8HA 1H0DB 4DVBA 4ADGA 1NC2B 1X4ZA 3L3JA 4QCIB 4ZMQA 3IS0X 1URIA 2J6EA 1UWEL 4NUGH 4F37K 1F58L 2EYRB 1L3WA 1DQML 1JZHA 3NCMA 2IBGA 3BC9A 4PJHE 4UU9A 3ILEA 4Q6IC 3VFSB 5LAXA 3S4SA 3C6LB 4WIQA 1U95B 3DVNB 2ADIB 3BZ5A 3TFKC 3T0ED 4B9JA 2W07A 3SQRA 4RGMC 1QVOB 4TVPL 1DVUA 4MNQA 4UIKL 5C09D 4B0MM 3AG1B 1JGDA 5I17A 3HVNA 5AB1A 4H2AA 1AZUA 2ZD0A 3AG2B 3TM6A 4NQUA 5JUEH 4LDLB 4X7SL 1ET8A 3CWGA 5K39B 5F3FA 1JZEA 3PGDB 4N0FB 3O6MH 4M8RA 3V4UH 3VU1A 4K5LA 4JFZH 5L2KE 4U1MB 2VL5B 1JYVA 4NHUB 2Y69B 2A6KA 4QCIA 3NSJA 3IF1B 3MV9A 4MD5B 3MLSH 3UERA 1VADB 1L0XA 3OKEA 1EAQA 3L7EA 1DBJH 4GIAA 1F4WL 3R0NA 2XN2A 3DKHA 4BK5C 4MJ5B 2AEOA 2C9AA 1U95A 4H8WC 1Z5YD 1A3ZA 3FU6A 3DV4A 4DNLA 5DQDL 1KJMA 3H7LA 5F1KC 1BIIB 3H3PH 1IGJB 2AF2A 4J8RB 4KXDA 4FXKB 1YJDH 4XMKL 2G0LA 4FYSA 4KI5C 2N59A 4Z7VE 1ORQB 4YGVB 1XX9C 4XPAL 4WRLA 1MCHA 5SWQA 5ACMA 1DBMH 1L6ZA 3CBJB 5K39A 4PUBL 5GSRB 1M2VB 3GSQA 3GSVB 3PGDA 4N0FA 4WENB 4X83A 1JL8A 4TSBL 1LP9A 1C7SA 4PY7B 4PLJC 4U1MA 4NHUA 4Q6IB 1U8IB 4RMRA 1MH5B 3TL5A 4MD5A 2WVVB 1IKFH 5C0AE 3RIFF 5MEQA 1FA4A 5GZND 3QZNA 2CO2A 1K6QH 1HNFA 4MNHB 4RGMB 3K6SB 2MFNA 5DSCA 2ZX6A 3UAEA 5TE7L 5IJVA 4K3JH 3KL0A 4BM7A 4Q97A 1N6QL 5D7LE 1ZT4A 4WSGA 5E9DA 1F97A 2N1KA 1O7SA 4U1LB 5E8DH 1BIIA 3PWNB 4MMYB 4J8RA 1R5IA 1A6WH 1TR7A 3P77A 2OBGA 3PL6A 4GRWB 4M3HA 4HBCH 4ORGB 3DXAD 5GS0C 5D1XE 5D71H 2WBJA 1AXSA 2Q8BH 5GSRA 5KSBF 2WZAA 4L1HA 2EC9T 3QYMA 4JM4H 4PY7A 1SFHA 4KROD 1KPRB 1MH5A 5HYFA 1TVBA 3IDMB 5IHUH 1MRFH 1LO3H 5AZ2H 3S3CB 3RDTB 4JJHA 4DGYH 3K6SA 5I1DB 2DQIL 4IEFA 5IREA 2JSFA 3F2LA 3JWNG 3P0VH 3EFDL 4IRZH 4PJAE 4XPHH 2PPAA 2AQTA 2WV3A 1OTUD 3GMNB 5F1NB 4F3FB 4ADIA 4GNKB 2ZX7A 4G9DA 4AYMC 1KB5H 1GRWA 3CZSA 3A4EA 1E9PA 3PDDA 4GJTB 1ADWA 2GUOB 5HI5C 1RSFA 1ACXA 4WQOA 3TBVB 3V2AR 1JCVA 1EZSA 1CDYA 3FQUB 3UZVA 3NJVA 4JL1A 3VXOB 2F54E 5KVGH 3GXTA 5FWRA 4LLVA 2BJMH 4OLZL 1RMFL 3U6XS 1B0IA 3IJHA 4HFWA 3RYMA 3MLUL 1UZGA 2Z7ZA 2JTYA 4OV6F 2J2ZA 2L7UA 4Y7MA 3OKDB 1G7LB 4E9QA 4MDJB 4NO2B 1TNMA 1NFKA 4FHKA 2X44D 2OXHA 2ZONA 3BUBA 4JRWA 4OF8A 2NMSA 4WI0B 4C56D 3TNNA 3EKCA 2Q7YB 3FRPG 4BH8B 3ZYOA 1TYJA 4UOQA 5KVFL 2GBTA 2IF7A 5GS0L 5FGBA 5EN3A 2V17H 5GGTH 2HT2D 5GRXG 2AVGA 3SE3A 3PGCA 2CCWA 2EDTA 2WLIA 2YD2A 3O2VL 2WB1A 3P1VA 3VDAA 3EGXB 3OR6B 1AS8A 1UXWB 3MBXH 2GUOA 2HFGH 4Y5YA 3FFCB 4NOBA 4M1GH 3Q7JA 2YD4A 4YHIB 5HI3D 3SBQA 3SGKC 1TO4A 5IOKA 3Q9PA 4YQXH 3VJ6B 4XPTH 1CBVH 1OAUH 1RIHL 3JYBA 4K7PL 3T65A 1T6VN 2A6DB 2AV1A 5E6YA 2C4FU 5A1AA 5IB3A 3BKCL 1G7LA 3OKDA 1CFBA 1XAKA 3IMBA 1FVCA 1BFOA 1W8NA 1JZ5A 1EDQA 1NL0L 1Z3GL 4MAZA 1M3IA 4YHZL 3SGJA 1E8YA 1L9SA 3B2XA 2AXFB 2VCOA 1KLGB 2AXGA 4MBRA 1DJYA 2FWLB 4A6YH 5HHQA 4QHNA 1DQLH 2PCFB 2P5EB 4N2CA 1NC4B 3EH4B 1QA9B 5EIIA 1S4IA 3GRWA 3QEGH 4LKXB 4M6OL 4KRNA 3CFBA 2FVNA 2XWDA 2J71A 1U3HD 2DKMA 4NI3A 4WGKA 4BINA 3WXWH 4X8JA 1DZBA 1RUPH 3MRMA 4UT6A 3QCVH 4B50A 2VMCA 3DHMA 2V9UA 4BFIB 4UQAA 1A64A 2GEQA 1BZ8A 3EO0B 5I6NA 3WEXA 1CE6A 2BRRL 4HIXL 4XWGH 43CAB 4N2EA 1MF2L 2ZJSH 4I48A 2AXFA 1CYGA 1XGUB 3ELQA 1WQVT 1AZRA 2V5SA 3WS6A 1EEYA 3VD7A 3RGVB 3QDJE 2PCFA 5KG9A 2P5EA 5ESAB 4ZD3L 1KBPA 1E4HA 1DO6A 3BGMA 3Q5TA 4FQIL 5ADPL 4QXVA 1N67A 3QXUA 5KJ4A 1PKOA 2O61A 2H9GB 1U8KB 3MRHA 4PJIE 2LFGA 4L8BA 1J12A 2AKRA 5JXAL 1DSFH 2FZ3A 4F9LC 4N20A 2I25N 2UXTA 3IJSB 4S10A 4UOJA 2AJYL 4EN2A 1EDYA 3AROA 4BE5A 4OCSL 3ALWA 4G9FB 4U1JA 1E5YA 3FF8A 4W4OC 1NCOA 1WAPA 3WSQH 3FU9A 3HNSH 5AEAA 5B1CA 5FYKE 3SHSA 5E8NB 1WFUA 3B43A 4UB0L 4Z7OB 3VTAA 2D31A 4PJ5B 3I75B 3WHE0 1HHHB 3MLWH 1RZFL 3L1OH 3QFJD 2CBTA 2DQHL 2JF1A 2PN5A 2PP8A 4HULB 4PJ7E 1WVZA 4NDMA 1FNFA 2FJSA 3X3GH 3V7MA 2KZBA 3OV6A 3ZLQC 1MI5B 4Z7AA 3R8BB 1QACA 2X2YA 4XBEL 4FG2A 1ZD6A 3L4UA 2HRGA 1ODAA 1YZZA 1AGFA 1E9QB 1TJGL 2WO4A 4HUXB 4X4MA 4YHOH 2ATAA 5T1MB 5F9AC 5F9WC 1RIVL 5HHXH 1PDKB 2IOMA 5AW7B 4HOZA 1SN5A 5DHMC 3WXVH 2JMRA 3ME0B 3OZ9H 1YNTB 4K94C 1NOAA 2A3TA 3WD5L 3QORA 3RWCA 3T2OA 5LN8A 1GJWA 3GK8H 3V0EA 1E30A 3D87B 3OB0K 4LNVA 5GJSL 2GSGB 1LTXA 3MBWB 4GQPH 2Y23A 5BRZA 4G8IB 3N2JA 3T09A 4CN6A 1QHPA 1E0OB 2IQAB 5FECA 1TZOA 4HKJB 2CR6A 1LP9F 1J5OL 4ZSOB 4G72B 1TJHL 1RVFL 1LHZA 2QZQA 3T0BA 1LD9A 2F53D 1CZ8H 5DHVH 4GBXD 5CCKL 4QY8B 3SYCA 3QXVA 5C08B 5T1MA 1C5BL 1WFOA 3MYZA 1J1PH 1FIGL 3I9PA 5DUML 2WLLA 1CJYA 1X44A 2OK0L 3DUUB 3LPGA 3E3QE 3EYUL 2R27A 1HQ4A 1XQ4A 4L4VB 4MYWB 4F9LA 1M7IB 4LHUA 3PHQB 2E7CA 1CFVH 3QVAA 1ZMYA 1NGZB 4TNFA 3LVEA 2EVFA 3FQTB 4JFOB 3R0MA 4W4OA 4GRLA 2P45B 5F9WB 1ZE3H 4X4YA 4JO2L 5ERWB 1AQDA 4UM8B 1EHLH 4XAKE 4RLDA 4E0RB 3TBCA 3VFGL 2LR4A 3APCA 3CLFL 4UZGA 5I16A 4QY8A 2FJFA 2Z35A 4RMVA 2VITB 1T20A 1ILUA 2WGXA 2WXOA 4K94L 3REVB 5INDB 3U4EB 2MOVA 2NSQA 4X9FA 5TK2A 3T3PB 3W5NA 5DA4A 1KC5L 2ADFL 4ZAKA 5LDSA 4I77L 2BERA 2GPZA 4LBEA 3O81A 2PP7A 2AK1L 2IOIA 2CO7B 1DTUA 3QJZA 3ML8A 1KJVA 4O2FA 1KXQA 1M7IA 4XMUA 3LV3A 3PXLA 2QVIA 4MCYA 4YPGA 3FT2A 4YSRA 4YBLB 2F19H 3UH8A 2OMZA 4JFOA 3QWRA 3OG6B 3EAKA 5J11C 4EQ2A 5IGXL 4OZIB 3MRLA 3NCEB 2B1HL 1QKZL 3QQDB 3U4KA 1UYWL 3BXNB 5BZDA 4KI5E 4NM4H 1DVFC 1IZKA 3L3HA 5D4QA 3QUXD 3UG3A 2VITA 3E7JA 5HGDB 5IBTL 4ZMNA 1XGYL 1K9TA 4PRHD 2XYBA 4NJ9H 2JH2A 2R1XB 1C16B 5HI4D 4ODXB 3DSNA 3D5OF 3PNRB 3WTXA 3ARBA 2O6CA 5B7MA 4MNGE 1IM9B 2FLRT 3GUTB 1P0SE 4ZMLA 5B38A 3L9BA 1KCKA 1M4KA 4LDEB 3P0YH 2X3CA 3L4WA 3MPCA 1QOKA 1CXLA 2BK8A 1RZQA 2D0GA 3R18A 2CGZA 2XKNA 4N0UB 5IG7A 4ZTPH 5JHLL 2E86A 4PTTB 3SDXA 3BVVA 1MFVA 1K85A 3HZVB 4JG1H 3T6VA 4UNVA 5H37H 2DD8L 4JHWL 4FFYA 4NZDA 3CZJA 4L0YA 5FHBL 3BE1L 1HINH 4YDZA 3HZMA 2V5TA 1I8LC 5J12C 2ADGA 2VLRE 3CLEH 4JCMA 3WMSA 2Z0UA 1VPOH 2AJ3B 2WVTA 3BZ4B 3NP3A 2WNKA 4M7KL 3ZN6A 3QQ4A 5I6MA 4JKPH 2VXQA 1RZGB 1MRDL 1T2QL 3GS7A 2R9HD 4KK8C 4YHPA 1AGDB 3ZYIA 4XMPH 5IEHA 1JRHH 1MQKH 1FFQA 1NMBL 5J11B 2KQMA 3FFCE 3ESUF 5JHLA 5A7BA 4HK0A 4FQHA 2D73A 3GMLA 3PS6A 4EEEA 3M1OA 1DVFB 1EZVX 1A3LL 1DUYB 4PTTA 5HHMB 3BJLA 2R0KH 3VB9A 1NZRA 3ARFD 1F45A 3S7GA 2DQEL 4RESB 2BIIA 4H2CA 3FU7B 2CRYA 2XXMB 1RV6X 5K59F 3R19A 5GJTH 4FJ6A 1A9EA 3HHSB 1AZCA 2XZQH 3B9VA 3M45A 2Q2LA 1B0RA 3P02A 3D18A 4QAWA 3IU3B 5EH1A 1NWPA 1NBZA 4S0SD 1CLCA 3V7AG 2OKMA 3AXLA 2G5UA 3H54A 1OK8A 4JFEB 2YA2A 2YK1L 2F1EA 2DBJA 1Q8MA 4KOBA 4OD2B 4WNSA 1ETA1 1B6DA 3WNOA 5MHSE 2OZ4L 5DK2B 2DI7A 2YAEA 2NOYA 1QI3A 3QYCA 1Y0LB 2D7TH 4N5ED 5F71A 4EI0A 5J12B 3KEHA 4P5MB 1A6TB 2ZSVA 1VZIA 4P57B 5BVPH 3RIFK 1XHHA 4CL7A 4YDKL 1F2XK 2DLGA 2ZG1A 5TDOB 1XF3B 1BBDH 3ZTJH 2OA9A 4BA8A 4DUVA 5CGMA 4KKBD 5FHAL 3EOTH 2IXQA 2UYLB 3MJ9H 4I4WA 2YN3A 4PGJA 4G82A 1VFUA 4EMZA 1T0OA 3WIHL 2DMKA 3JTSA 3B2UD 3NIFB 2ZCHL 4XCEB 5MP6H 2OZ4A 5ID1B 5BZWA 2BNRD 4N0YL 5CIPB 2VDQB 2OJEB 3PJNA 5EZOH 1O6SA 1L7IH 5JW4M 1OEZW 4RQQB 1P7QB 5BV7C 2VLKD 4JRYE 2XIDA 5FYLD 5I28A 1PYWA 4L8DB 4QRUB 3D52A 4HX1B 3BVNB 3TPUB 5DO2C 1A6AB 2EDEA 3SD2A 1A7NL 1ZA6A 2OMXB 2SODB 3P2TA 4MS8C 4I87A 4KAQL 4OM0H 3GKZA 4G9FE 4K5NA 3WIHA 4MWFA 3KLAA 4NO0D 2YWYA 3FF7A 4NQCD 4YZWA 1ODUA 4QJ5B 4Y4HC 5G2NA 3STLB 4KY2A 2WMPB 1I8KB 4JFDE 2ZPKL 5JXEA 1PY9A 4QNPE 3II3A 1MEXH 2QV2A 1GHFH 5CIPA 1JDDA 5HJBA 2OJEA 4PJ5E 4AYID 1BEYH 2GJZA 1YEHL 4X5PA 1ID5I 3CVHB 1AD9B 2V5RA 1ORSA 2Y2TA 1J1OH 1V5JA 4JPQA 3VG0L 4NQEB 4LU5L 4TXVB 2LVEA 1RURL 5E00B 3K7UA 3NCWA 1HHIB 3HE7C 2WP3T 2KI6A 4ZQKA 3CVHL 3HC4L 1SEBA 2XFXB 4ZFGH 1MI5E 3VGDA 3HUJB 2DI8A 4XVTH 1BQKA 1U8NB 1JNNL 1MPAH 3FT4A 5EA0H 2ARJB 3F04A 3QDMA 4NZFA 3O8XD 3BRDA 1R3LA 2XZCH 1NBVH 2BXZA 1AJ7L 2Y2WA 4HV8B 3WEBA 4HWUA 1BYNA 2IC2A 1IU1A 3MOQA 5BV7B 5EF0A 3DNKA 5KSAD 4WNJA 2XV0A 3TIEB 3I6LE 2BDNL 4HUUB 4Y9GA 4MRCA 3S98A 1JVKA 2GJJA 4XVUC 5BV7L 4MQ7A 3T1FB 4Q74A 4NIYE 4IRJB 1YNTF 3LS4L 3MGTB 1RHFA 3WELA 5CBAB 3FSAA 5ALCH 3KPRD 4WU7B 5EIVA 3A47A 2ITCA 2V9RA 4YEFA 4JVWA 2FIKB 1MIEL 3L1GA 4Y4HB 2ENQA 3UTTB 3HUJA 4CC4C 3OAZH 3QR2A 2WUBL 4ZSOE 2YD9A 3DLQR 3OJ2C 4KGJA 1JMXA 4BFOA 3TEZA 3QH3B 1S9KC 2L4OA 2HJFA 3K72B 2KLSA 4OZHA 3FUMA 1ZV2A 4Z7IA 3ETBJ 1UXSB 3LKRA 3I9GL 4FTVA 5DUBA 1KXVA 3RTQD 3VWJD 4EI5D 3FCBA 5CCGE 3OC5A 2RACA 1KYOJ 3RVWD 5BOJA 3I9IA 4JPVL 4IKNA 5BVJA 1TZHA 1YYCA 4POZD 1QHQA 3HE7B 5KVDL 1G9MC 3QEHB 1SHXA 3M7FB 3TPKA 1W16A 4UTBA 4N24A 3WGVB 3NCXA 1ESOA 1Q38A 1S9XA 2HX9A 3BW9B 3IJEA 2RHEA 4O02B 3RILA 3VRLE 4PVBA 3E8UH 4DCQB 2IPTH 3IGFA 1BVZA 3L2NA 3LPPA 3UTTA 4AK1A 4NHCH 3NJNA 3ARYA 1YYML 5AB9A 3RIAF 3WKMH 4ZOAA 2C9VA 4KHXH 4G80A 5D6DA 3JWDH 4L8CA 1ZA3B 3OX8A 4NENB 1YMMA 4WK4B 1MG3C 3V4VB 5K9QG 1UXSA 4Y4KC 3TWYA 5CILL 3DMMB 4UANA 3X1BA 3T3PE 4PP1C 2J8UB 4XX1G 1MCNA 3K8KA 2FCBA 3V4VL 4DQAA 1I82A 3V5DA 3VXSD 1IEHA 1MHCB 4Q8BA 3NRPA 3ORJA 1H6TA 1X4XA 2W60A 3D39A 4M6ML 1YQVL 1KY7A 2WKOA 2X4SA 2YAMA 3MAWA 1CD9B 3MUUA 5FW8A 5GGVL 1OO2A 4X0KA 4DKTA 3BW9A 1ZVSB 1M2OA 2QELA 2MCMA 5H94A 4FI8A 5AAWC 3WBDA 3DGDA 5AB0A 4G6KH 1D5XB 3TZVD 3WNNA 3GSNL 5DZNA 1ZAGA 2DLIA 1QG3A 4Q89A 4U49A 4OZIE 4IQHA 2APWA 1QSEA 4Y89A 2V8LA 1AANA 2I07B 4NPYA 3K74B 2JIXA 3LPOA 3ZHKA 4X6FA 1RPKA 1ZA3A 3SDXF 1LWHA 35C8L 2VDPB 2JXMA 1ZLWK 3V4VA 4NRXA 1SYSA 4M5YH 3KPLB 1HQRB 4GAJL 5JO5B 1WICA 4IRSA 4L4JA 2FNWA 4NSKB 2NXYD 1NUFA 2RCSH 3RWDA 2VDPL 1G9ML 2R23A 5IB4A 1H19A 1JWUB 4A2DA 1WC7B 3POCA 3QYNA 2DLFH 3T71A 3QWQB 4CC4A 2PABA 1BFVL 3GSNA 3GBMH 2Z93B 4KO9A 3VFVB 3D05A 1KCWA 4AJWA 4D9LL 2RFXB 1ZVSA 4B0MB 2P24A 1KY6A 3MJ7B 3KCWA 4N0UE 1D5XA 2EKJA 3S97C 3TGXA 5GGUB 4M56A 4JFXB 4MB4A 3NAAL 4NNXB 5JORB 4Y4KB 4G8GB 3VD3A 5KUKA 1T03L 1NBQA 5CP7A 2EDLA 4HA1A 1T7WA 2GI0A 2LLGA 4V1DB 5C3IA 3VXRB 5I8OH 4Z3EA 1OCZB 5I0ZA 2C1PA 4JFTA 1SXNA 3P4NB 1LO0L 5ACZB 3HAEH 2HLFD 1PU0A 3WENA 1NCGA 2Y5QA 3SDAA 1SJHB 4NRZA 2G9HA 1CXEA 1KLUB 2GITB 1A4KB 3D51A 3S35X 3L5WB 4Q14A 2RFXA 3D33A 5AKRA 2PWEA 1GGBL 4TLKA 3V8CA 1JDCA 3L4ZA 4JANA 5HTSA 4JN2A 1UWXK 1PG7X 1DEEA 1HZHL 1KTLB 3P30H 4K3EL 4KTEH 4MZ2A 1T4KB 2IPKB 1PVHA 2Q8AL 1BZEA 5E6RB 4Q0XL 1JP5A 4FI6A 1U2CA 5LUMA 5I1AB 3KBPA 2BY0A 2VMFA 3CN4A 1MCBA 4G1MB 4H40A 3T0VA 1ZANH 1R3JB 3VXUB 3IETB 3VFMA 3FDWA 1BVLB 4RDQF 4HALA 1PIGA 3UTZA 5BS0D 3O6FC 1UA6H 4PH8A 5E5LA 2JCCB 1B9ZA 2QHRL 4EUPG 1LK3L 4AEFA 2GITA 2XNAB 5EZIH 1DLHA 4YSDA 3WO4B 1QTSA 5JHDE 5EO1B 4JLRB 5EU6B 3G08B 4JX0A 3W2DL 3TN0D 1N64H 3BRFA 2ZG2A 2FL5A 1QW8A 3OAYK 5FFGA 2OR9L 4KZDL 5E5MA 3QRGH 3I74A 2IDFA 1GYUA 3NIDB 3VDCA 2P3YA 5A2JH 4RA3A 3IMVA 4JZJC 2AQ1A 3G5YA 2HWZH 3FU8A 5JIPA 4PG9B 3ABMB 3FQWB 4JO1L 3L7FB 3FO9A 3H9SA 5BRQA 2NY7H 1VERA 1F4XL 2MQ3A 2H8PB 4ZTOH 4R5TA 3C9NA 4KJYB 4ZS7H 5KS9A 2GJ6D 3IPEA 4JFSA 3DGGA 1NAML 5LWYH 1MN4A 5INCB 3CX2A 2EUVA 4P46C 2BX5A 3THML 1A1NB 1P2CB 3TVMD 1RU9L 4LEBA 2VW7A 3G08A 5AVWB 1WT5A 4ZT1A 1OY3B 4FHJA 2FBRA 1IAKA 1DFBL 1Z9PA 2VJXA 4CVZB 3KYAA 1FNEB 1KEGH 2XN9A 2IANA 3O6FB 4CRPA 2OYLA 1A3QA 2XWCA 4JHUA 1QRNE 1FFOA 2VERN 4S1SL 3L95B 3MROB 1NLDH 3QO1A 5JYMA 4M62L 1FLRL 1R19A 3HPLA 1G4MA 1HH6B 3PUUA 4DKFH 3GUFA 2GY5A 1GGCL 1XSIA 4PJ8D 2F58L 4XNYH 5IROC 4N1HB 3QULB 3OKNB 2OMYB 2ZICA 3B83A 1NAMA 3L2MA 5CEZE 1ACYL 1CL7H 1MCQA 5L4IA 5T8IA 1M7XA 3U46B 3WDHA 3Q2WA 2MMXA 4LCIL 3FUNA 2AJZB 2WCSA 5ESVB 4WFHE 2UZPA 3S4SG 3P3SA 5T5FH 2Z64C 1SNRA 1P2CA 3QRFM 3VH8A 4OF5A 4WEMB 1KN2H 1CLZL 2I60H 4JZJB 2BFVH 1Q90A 3ZL4H 2X2UA 3U0PB 3FTSA 2AJUL 1BVKA 3DX2A 5LBGA 3FBQA 3DBSA 5FKAB 4EE2A 5A16A 3VFTA 4E41B 4XCNA 3HBQA 3PDOB 2WNWA 2FBOJ 4JQVA 4K5MA 3WFCH 1LNUA 2PR4H 1SFDA 1ML0A 2XUWA 2P7TA 1OSEA 3HUJF 1DQIA 2NZIA 3PQYB 5GRUL 5C0GA 5IVXE 1U93B 3QULA 4L8SA 1IGML 4P46B 2WD0A 2OMYA 1AGBA 4OZHF 3SKUD 2WWOA 2XWXA 4OLVH 2VO5A 4FQ1H 3WJLC 3KNBB 4QO1A 3IFOB 3KG5A 1Q9KB 4TNWK 1T6BX 5K69A 3QEUA 1MWAH 4W9CC 2FEDD 1L0PA 3CPUA 4KKLC 4DPCX 3KBEA 1IKOP 1TQBC 4OLWL 1QFUH 2DJSA 3C5ZD 5C0CA 4WHYH 3H42L 5HY9A 5FKAA 1XH0A 1TG8A 5DMKA 1XD0A 1RZ7H 3QXDB 1FLTX 2CPCA 5IFAH 3BCFA 3SJVD 2ISDA 5KYYA 3ARPA 2K1MA 1TZIA 3CFJB 3PABB 1W6WA 3PF2A 2FJGA 4MD4B 5HHOB 2I24N 3SGEI 3QJOA 2GSMB 4MAYD 4XPGL 5EWIL 3H85A 1FL6B 1ZOXA 4OLYL 4PWKA 2AP2A 3KWTA 5DJAA 1MCWW 4OCRH 3UIZA 1DBKL 2WZ6A 2B1AH 2ESVB 2WKOF 1XD1A 5CLYA 3MOBL 4FS0A 4N2OA 2N4IA 5DR5H 4XMTA 1ZHKB 3ZY7A 5AZUA 1DL7L 2R8SL 4NNPL 4ODSH 3H3BC 4YAQB 5TE6L 1WDAA 5D9SA 3MRFB 5DHYB 1OGAD 4DH2A 5KVEE 3BZDA 3ZOAA 5IHZA 1A6PA 3HPJA 1MHEA 3CQFA 2BCKA 2NY4B 5A3IC 2A9NL 4OGYH 2EDDA 2MNUA 1J1XH 2J8UE 1KCRH 3EHBC 4JCLA 4HKBB 3NN8A 4MD4A 2H45A 4PG2C 4PJCB 4JO8A 3I6KA 5I0DA 1OCCB 1GY2A 1TQBB 3CDGB 5C7ZA 5BOPA 3RB5A 4PV9A 3E9TA 3C87A 1QTYT 4QXGL 3GXDA 4DP9X 2OL3H 2XZZA 5LBSH 3HZYB 3GTNA 3S88L 3LZPA 2R69A 3WN5C 4XE5B 5D70H 3WLBA 4P5RA 3V0AC 3APDA 1NSNH 4QD2E 1CLYH 2QTEA 5K9OB 1JNHB 3ZDXB 3SE8L 4K7PX 4LSTL 4PJ9D 4F15B 1MCWM 2A74C 3LDBC 1A4BA 4WUKL 4EN3D 5EU4A 4YFEA 2E8YA 3OXSA 2MHAB 4A1RA 4JO3H 3SB3A 4Z7VA 3OHXA 3MCLL 1U8LB 4NQXB 4UV4L 2DYRB 1QR1B 3GJEA 3PP4H 1EEUA 4LE8A 1EFXD 3TIDA 4Y2DC 4W1TA 1WUZA 5A40E 5F1SA 1MREH 4LASH 2P8LA 4QTIH 1Q94A 2BY1A 3H0TA 3WL9B 5AOMA 4C54A 1S7TB 3C5SB 4FNQA 4WKZB 2X70B 5C0AA 4CSSA 1PY4A 2E6QA 2CLZB 3HE6A 2ITDB 4H13C 3ARTA 4HUNB 3EHBB 1JNHA 1YEGH 4V1DE 4EIGB 2ZOLA 4ODWA 5D7LA 4LPXA 1OZUA 1BGXH 1M7DA 1IRAY 2BSDA 3KPPA 4BSWA 4QLWA 5IQOA 4FGMA 1MCKA 2DQUL 2APXA 4J3XA 5FDWA 3HFMH 4ZI8A 2PYEE 5D1XA 5DVMA 1GS7A 1U8CA 1UT2A 2OXGB 1G7MB 3V0IA 3WN5B 1JF1A 5DMGC 1AG6A 3T0EC 2V3FA 1JGEA 4HQQH 4PGBA 3ULVC 2ZOWA 3Q8AA 1DHKA 1OOWA 1P6FA 1SJMA 1U4EA 2YXFA 4QRRD 2EIZB 3T4YA 1FGVH 3HHMA 4A39A 5HHPA 2A74B 2XG4B 3EOYG 1XR8B 3LDBB 4E9SA 5C9KA 3B1TA 4FQQB 4JVUA 1EXHA 3GMPB 2NXZD 4OV5B 5CR1A 1EJ6A 5EIIG 4PG2A 4PJAA 3EXJA 2BS9A 5CINL 4KVCL 5J6GB 4MCZA 1KYUA 1SOSA 2DYPB 3PG2A 1KXTB 1I3RA 1NOFA 4MDIA 4XNUH 4Y2DB 1UCTA 5J5EA 4PMEA 3L3IB 1Y07A 4JHAL 3O6KH 4NO3B 2DQMA 3FH8A 2AJVL 4RIRA 5CN2A 1PLAA 4OQTH 3GZPA 1IL1A 3BQUA 1NM4A 4YJZL 3WLWC 5DWUL 5GRZA 4QDGA 3WYRA 3ARDC 1P4IH 2F54A 5KS9F 3ZPDA 2ZXCA 4U1KA 4N2NA 1ZS8B 3FHAA 4FLOA 3SIKA 3H6JA 1HZLA 3HI5H 1HX0A 4GUOA 2FSEA 1QSZA 3DUHA 3NIDE 5F9JA 3A22A 4GEIA 3IKCA 3JXAA 5EORH 3NCBB 4NGHL 1JDAA 4LGRB 4BQCA 4N9GB 3V0WL 5GZNC 1I1YB 2TAAA 4UI2A 4XI5D 1HS6A 4OGAC 1FPTH 4ZXBC 3T0EB 4N85A 4XMWA 1KGUA 4H20H 3NFPA 5ADOL 4M8QA 1FNSH 2CWRA 3EOBB 5L88L 3ULVL 3MLRH 3NQKA 1TKWB 2IWEA 3I50L 3GSOA 5HDQL 3SBPA 4U6HA 2R1YB 5I1GL 5GISL 3EH3B 3IE9A 2BVEA 2RBLA 3P40A 2FB4H 1G7HB 1KCSH 3IFLL 2P5WB 4ZMAT 2EIDA 1SDYA 3CXFA 4F7CB 1YUHB 4APXB 2XBZA 4QF1A 2ZKHL 1A7PH 2JI1A 4MJ2A 2DI9A 4XC3H 1CVRA 3CXDH 5EB9A 4JDVA 4HW6A 3GLZA 3VXME 4HPOH 4HU2A 3QNZB 1IBDA 5DHEA 5DJ0B 3Q0HA 1AQMA 2Y6SC 2ZUVA 5DF0A 2VSCA 5E2VL 2R4RL 1W2KT 3D9AL 3EJJX 5EUKB 4L29A 3KWWB 2R39A 1OTUC 1G7IA 5AWNL 1NGQH 1WG3A 2GK0A 1JXFA 2NY1D 4WF7A 2MSPA 3ECQA 2NUPB 4HK3J 2R2BB 2ATKA 3UTPD 2B08A 5DD6B 5BZZA 2B14A 2HLEB 2YGVA 1N6VA 1CFTB 1XMEB 2D0FA 3MRQA 4ZXBB 4U1GC 3VXTA 3OB0H 4N87A 4G7VL 1JK8A 2H32B 1OPGL 1MVYA 4ZFQA 4PJFB 2NPLX 1IFHH 1V7ML 4G6ML 4DO4A 3KVQA 3PQYE 3IU4L 3UBHA 4QOKB 2AABL 2HVJA 3ARDA 1ZDSA 3TYGH 4BKTC 4Z3TA 1ONQA 4Q52A 2V2WB 4BFGA 2G60L 1R33A 3QDJA 5EUKA 1ECZA 3B3IA 4PB9H 3RP1A 3ZKMC 5E8EA 3DX0A 5CZVH 2VUOA 3QW9A 1BX2A 4P2QB 5DD5H 3F5WB 3W0WB 4XVJL 2R2BA 1FYTA 4KROB 2R0WH 3P2DA 3LIUA 1VSCA 3QG7H 2P52A 3OKMB 5GZOC 2N7BA 4Z0BL 4Z7QF 4FXLA 5C71A 4JJ5A 4UUJA 5FYJL 5K9JH 3CFUA 4NP9A 4QRTB 3RPKA 4OIBA 1D9KD 2EINB 4LHUG 3KD4A 3ILQD 2EE2A 4AUYA 4HG4J 4NKOB 5L4JA 4QOKA 4LK4A 1E5ZA 2HTKC 2DLEA 1U41A 3WDIA 5EEUA 2ZXDA 4KNTA 3M17B 1RFDL 1D5MB 4Y9BA 3CX5J 3E6FB 3NSDA 4U1GB 2VLJA 3GMOB 4GKLA 1HN1A 2IGFH 1A5FL 3RX8A 2DS4A 3C08L 3R7QA 4ZFZB 4G5AA 4L5FL 1J9SA 3WAJA 5JHMA 2BVOB 4MX7A 1NTDA 1IBGL 2ZKXA 5DEGA 3W39B 2CUAA 4C56B 1XF2B 4AEHH 1RUQH 4LEXL 3TBTA 5I66A 1JFQH 2MOQA 2G3ZA 2VXVH 3GI9H 5ILTH 4F8PA 5FYKU 5AAPA 3D85A 4I8DA 4TRPH 1CURA 3FB5B 4L37B 4Y1AD 4P8QA 4XNBA 1N26A 4N68A 2BIOA 4PJCE 4WI7A 5DFAA 3V10A 1RJYA 2H2PD 2YSSA 4KTDH 4WUUD 1GPOH 3NYKA 1AFVH 3EH5B 1J9QA 2VLLA 4OLUL 3DTXB 1X5ZA 4Z7VF 2IG2H 1YRKA 1G1CA 4G59C 3OKOB 4B9IA 1JOIA 3GSRB 5I76B 1I9RH 2ADJB 1F90H 4KDTA 3CK0H 5EO0A 3QZPA 3KH3A 3D2UD 3QEQD 1MFDH 3MSPA 4TS6A 5JDSA 2BIHA 4V2CB 1WIPA 4TULH 5A2KH 5I1CH 1UQSB 3UBFA 2QSTA 3TO2A 2X09A 1CDIA 4NT6A 4LCUA 3ZDXE 5JHBA 4L0ZA 5B38G 1KXHA 2WAHA 4A38A 5EBLA 3VTMA 2DWTA 1IC7L 3EYQC 4ZO7A 2NY0D 2VRKA 5EHFA 3VXPB 3HNVL 2CALA 4LBAA 1OHQA 2Z8SA 4JFPB 1BYOA 1ZLEA 4J3OH 1UJ3A 2ZSWA 3N1GC 5D4IA 4BFKA 3MRBB 4PRNA 5GZOA 1IBBA 4GY4A 5KW9H 2X1PA 1Z5LB 4KX9A 1KJ2A 4HIJB 3DTXA 5AVQB 3N9GL 4IU2A 3MV8A 5MEPB 3DRTB 1A4JB 3I6SA 2JK5B 4WI3A 5FLUA 2FEEI 1JXKA 4ONFH 5H4ZA 2OI9B 5JLZA 4HAKA 3ROLA 4WWKD 4A04A 5F1IA 5CMAA 4HFUL 5I1HL 4OD3L 2B77A 2A0LC 4FD0A 1N70A 5C1MB 1N19A 2WXLA 1T66D 1CICD 2PMZA 1ETZB 1IGTA 1JXJA 3K2MC 2O5NA 3MLYL 4HMEA 4NRYB 4G42A 1NKOA 5BPPA 4H1LA 2MTPA 1N0XH 4PJAF 2BOBB 2PW2A 5T1KD 1TQCC 3S96B 4JPKH 3IT8D 1LL1A 1W9XA 1RJZA 5CFAA 3ZT6A 5IT2L 1CC3A 3GMRB 3WN6A 1HH9B 2X4UB 1U9KA 4GKSB 1ZXKA 5DI8B 5MEPA 3VMNA 1UT9A 4XBPA 4PJGB 3ARZA 5H2BA 5CCJA 1IBFA 4JFFD 5HDBB 3S8FB 3RZCC 2XY2A 1AP2A 4DWHA 3CHRA 3BSZL 1I9IL 4YVUA 3DV6A 1C08A 2UZYB 4D3CL 1FVDB 1CK0L 3RAJH 3VD1A 1S3KL 2CQVA 4K55A 5I15L 3FQXB 3AS2A 1S9VA 4KNSA 2Z0BA 3HLAA 4MVBD 2XN1A 1JXDA 4GBXC 2NX5A 5KYWA 1AS6A 1KENH 3N44F 3LKSB 3MV11 4CVXB 4X42A 4HKXA 3KPMB 1ZT7A 3BIKB 3MNWB 4MNGA 4EKXA 2ZUQC 3QFJB 3VFUA 3QDHA 2B0SH 3GJFB 3O9WD 5C0NC 3O3DA 3FO0L 2LU4A 4ILDA 4JG9A 2EEDA 3LIZH 1A9BB 4O9HH 4PJGA 1QLEL 4MJ6A 2WTRA 1N7ML 3OKKA 4RWYL 3IPBA 3NFSL 4APQA 4XN5A 2FO4A 3A23A 3FOMA 4YNYA 5HPMB 1UWYA 1RXLA 3L5JA 5IHBA 4HS8L 4EPSA 1WBXB 1TQCB 1DCLA 2OMWA 5DRXA 3VFPA 2VLRA 3AUVA 1YY8A 1L9NA 5C09E 2H1LM 3C75A 2EEXA 1HAUA 1R17A 5M95B 1IEAB 4JAMB 4PSPA 1IVLA 1KBVA 2DLTA 5E0QA 5I0XA 5FAAA 1SZNA 3LKSA 1BZ9B 4XP9L 4C8XA 4F58L 3D3VB 2Z91A 1ET5A 5AVYB 1VFBB 2ZOKA 1ZHNB 4OSUL 3RZCB 3ULVF 1SJVA 4J6IA 1GH7A 4R7LA 3F64A 3T77B 5EBMA 3TONA 1JFHA 4LPVA 1L9RA 3SE6A 4LRNH 1XF1A 2N7AA 3IJYB 3ES6A 3EOAA 4G43A 5FFOA 1KBGH 2MTAA 4GBXB 2JB6B 5DEJA 3D0AA 3BVUA 2YKLL 2OMVB 4G6JL 5IMLB 1T83C 2YSTA 1D5ZA 3M88A 5F0JB 5D7JA 2CGRL 3MXVL 4JRXB 4LP5A 1AGEB 1II4E 1LEKB 1PJWA 4IGBD 4KJPD 1I8MA 1Y6KR 1BZ9A 3LEYL 4NN6C 4P4RA 1BM7A 1WD8A 3U9PH 1GW0A 1ZHNA 3RZCA 2BNQD 2YUWA 4BQ6A 1Y1DA 1WZ1L 1FN4B 3V4PL 2J6WA 3JBG7 5HI4C 1GXEA 2YEVB 1F6AA 4K3GA 5I1KL 2VDKH 1Z32X 5LQBL 4IHOA 4XNQB 2OP4H 3KWVA 1ASQA 2CHDA 3IJYA 2PPFA 2FD6H 4XCYB 1TTUA 4CMMB 3F6LA 1QPXA 3HG1A 5EOCH 3FQ4A 1KCUH 6TAAA 4L9LA 3WEAA 5C0BA 1BP3B 4Y2OA 3K8MA 4XP1H 2MQGA 4M1DH 3DXAE 1EQWA 5CXPA 5F7EL 4PLNC 3V4PA 1R1CA 2D7QA 2F6AA 2WHVA 3GRGA 3HR5B 1M6UA 1EUTA 2DQTH 1LDPL 2R9HC 1FN4A 4JRYA 3AS0A 1XF5A 5AVVB 4LFHD 3UJJL 3GSWA 1NLBL 1KFAL 4IMLB 1G84A 4BFFA 3A21A 5IBUB 4XNQA 1T04B 3ARGA 4KK5D 1FGNH 4NS0A 4KMQA 4X6CB 3BHBB 3MCKA 4BWWA 4DIXA 4PJDB 4WNQB 3QUXB 4Z77B 4H0GA 3D1MC 3HHRB 4NN6B 4LLYB 2NNXA 2XRAL 3NDZE 4PRHB 3PAZA 4U2YA 5C0IB 3ZE2F 3QDGB 1OPOA 2EUXA 5DRZB 1OSZA 1I3UA 3GHBL 4JFDA 4YFDB 4YLCA 3T0AA 3FYEB 2A38A 1I9JL 4H8HA 3EJTA 4J3TA 1AXIB 2Y1YA 4XB7A 4TOYH 1YC8A 3ARED 1QFWH 4U4IA 3QIWD 3TCXA 4AH2B 4X5WB 5DD1L 2NR6C 2YFOA 2NYYC 3CC1A 5PAZA 1ZJAA 1T83A 5F88B 1YY9D 3QR1A 3KYNA 4P9ML 1CS6A 4WTWA 1E8WA 3N41B 1OP3H 3S35H 5L6YL 2AQ2A 4ONHB 1WCQA 3BHBA 4X6CA 4BH7B 3H4FA 4YK4C 4C56E 2EO7A 4WI9A 4WAFA 1IC1A 1PG7H 2OMUB 4UZSA 4G8EA 2YUXA 2E27L 5C0IA 5SWZD 2Y4SA 1NANI 3QDGA 3US1A 3DARA 1A6VL 4ZUTA 4P5KA 4WEEA 3D0VB 3SODB 3Q2NA 4GAAA 1R46A 1KZYA 4HC1L 4R4ND 1T1WB 3UBXB 1CT8A 3BFWA 4N6RB 2N01B 3GS0A 1MAJA 3KJ6H 5CS7A 1TDQA 1AYOA 4PJEA 1UZ6E 5GGRB 3BZEA 1ZLWH 2MCAA 4D7PA 5ISZB 4X80L 1IJNA 1HKLH 2QPSA 3WFHA 4PU2A 1RUMH 5CJBA 5FM8A 4WO4A 4HS6B 1XGRB 4KX8A 4BZ1A 1GMEA 3KJ4C 1DANU 4OFYA 4Z7WB 4ODHL 2AQQA 5FYKH 2V2TB 3HB3D 4HC1A 1RZ8B 3NCYP 1M05B 3EYSL 5SWSD 3P2BA 1T1ZB 4UQ3B 5K9QI 2BSSA 3TBSB 1X5XA 1MFEL 3SY6A 5BQDA 4AQOA 2IBZY 5D96C 1ZK9A 2HP4A 4N26A 2Z3FA 2FAUA 5I82A 2HT4D 2NT1A 4ERSL 4PGDB 1F58H 2H0PA 1DQMH 2J43A 3C12A 4B9CA 4HJIA 5IHLB 2AK4D 1J9TA 2D3LA 3K81A 4YK4B 2Q2EB 1HJCA 5J6HB 4JDZA 2NZ9D 1AS7A 2WQ8A 2X28A 3FH7A 4TNVK 4TVPH 1WLHA 4YSPA 3QFGA 3N1FC 1HHJA 3LHAA 4K5PA 4P3WA 1WA0X 3FO2A 1R0AH 2CA4A 2BINA 5LXGL 1D6VH 3BN3B 3UJTL 4PRPD 4Q2ZB 4TQ8A 1LO4L 4GI9A 4HISA 4AQ1B 1FG2B 4PBXA 5E03A 5C0DB 1T1ZA 3PWPA 1UWXH 5T3ZE 4ZPTB 1WK0A 5IMOB 5JR1L 4YO0B 1P5VA 3WS3A 3TBWA 5MENB 3T9WA 1K8IA 4DKDC 3FRUB 4GG6A 5IVNA 3P73A 4QT5A 1XB6A 4DP0X 3I02A 4HLZG 1DSWA 2CDEA 4FMKA 4MMXC 1ZVYA 1MKFA 1X7SA 3KJ4B 3EH1A 5JIKA 4M02A 2XWRA 5F70A 5J6HA 3SPCA 4U1SB 3O2WH 4MB5A 3CSYA 1L9OA 5HDBE 5DQDH 3FPYA 4PIRF 3WUWB 4PS7A 3QZBA 4AT6B 1T7XA 1DDHA 3V5KA 4PJGF 4WI5A 5D96B 4DQOL 1AOZA 4NO0B 4GW1A 1Z0NA 1RHHA 1MFAH 2VR4A 4PUBH 4JM0A 1BLNA 4MYPA 3BPCB 2K8QA 3T8VA 3OAYH 4I2XE 4JY6B 3TYFA 5MENA 2G5BA 2VDMB 4UYPA 1QBAA 3B1UA 4I18A 4XHJD 4NCDA 2J57A 5IMKB 3O2DL 1X7TA 3BKMH 3BT2L 3QFJE 1RPQA 2O72A 4NQSA 1N6QH 1U42A 5IK3A 1WGVA 5C92A 3FB6B 2WLKA 1GC1C 5H4YA 1DE4B 4KXAA 4TPRL 2ATPA 2FX8L 1WBZA 2VXUH 4MMZA 4U3SA 2DWEA 4HIEB 5AVXB 5BUGA 4AT6A 3RWEA 1S7VA 1W0WB 1P6WA 5IP4A 1AY1H 3D48R 4GRWH 3ESMA 4AYGA 5TF0A 1BVOA 5CD5D 3MA7B 3HRZA 2WUCL 1EA9C 1S7SA 4X9IA 5I8KL 2A9CA 4UQ2A 3QRLA 5E2WL 1QSFB 4OAWA 3L08A 4EIBA 4HHAA 4F2FA 1DBBL 2BOCB 4H8WH 2DQIH 3C2SA 1VGKB 3SKOA 1K4DB 3FFDB 4JS7A 4AV0A 4F33B 4QRSA 5AW4B 4LVHC 1K2DA 2ZG3A 3LKQA 4Y0GA 5FOBB 2F53E 5IOPB 3TS8A 3L4TA 4XGZA 4OW6A 1UURA 3TZVC 3SQOH 4F8QA 4YSCA 3LXAA 4UT7L 4DKAA 1NEZA 4FQXA 1HOEA 5CJQL 3MRNA 3VWJB 3WNMA 3VH8G 3W5MA 4FZEL 5DVOA 1QFWI 2WINB 4MMXA 1KF9B 2K70A 2Y06H 3N50A 1RMFH 1LO5A 5IW3A 1IQDA 3FMGH 2UY7A 1M71B 3MZGB 4UQ9A 2CDFB 5JHDA 2X7LB 2DQDL 4NQDD 3WFDL 3QA3A 1NUGA 4YXKL 4PJBA 3SBRA 4TLTA 1HEZA 1K4DA 2XWBB 1AYRA 4H0LC 4S1QH 1J11A 2W0KA 5HJ3B 4XH2A 3WKQA 4DN4L 2WZ5A 1T5XB 2P47B 5GS0H 2X38A 3CFKA 4KX7A 5GPRA 3DTDA 1FE8H 1J0YA 1E6OL 3MLTA 3QUZD 3RVXC 4DP1X 4EDWH 1YEKL 2NNCA 3O2VH 5FOBA 4DP8X 4H26A 5IOPA 4ZFOA 1P1ZA 4OJYA 1RZJC 5KYUB 1P4BH 3VD4A 2MNJB 2EJ1A 1AD0B 3W9EB 4WHTA 2WINA 2OM5A 4KKCC 1RIHH 4K7PH 3HMWH 4Y9EA 5DCCA 4EQ3A 4GAGL 3MX0B 2WQWA 5CSZB 1HI6B 1W91A 4NYLA 4TTDD 2CJ3A 1WH0A 1G1YA 1INQB 4LVHB 1MCIA 4C4BA 1IC5L 2VMJA 1KIUA 1GKEA 1R3HB 2AITA 2VM4A 3CDFA 3JV4A 2J1KA 2J5WA 1NL0H 1Z3GH 1IGIH 2XTJC 5HJ3A 2F7RA 3TZVB 4D0DA 1ZIBA 4CW1A 4AIOA 1XCWA 3AY4A 1KDJA 1FZJA 1VDGA 1UATA 4N22A 4N2BA 3SZ6A 3BEVB 4A55A 1OGPA 1QRNA 4Z5RB 1E65A 4PRHE 4F1SA 1QRKA 4X6CF 5FUCE 2ZYSA 2D2OA 1TETL 3L1EA 3NP4A 3ZGIA 5IBLC 3HNTL 3V0FA 2IADA 3HZKB 4Z3GA 3BH8A 1S5HB 2B59A 4LXFA 4GSDH 4HJEA 2CJUH 2BSRB 2QZ5A 4QWWC 3NSFA 1F3JB 2CKBL 2IMNA 4HIXH 1NFDA 3CXHJ 3EGDA 4PJEF 1MF2H 1R3KA 5H35B 5I5RA 5GHWH 4I1NB 1AIFB 1Q9OB 1RZJL 4M3KB 3BEVA 3VTTA 3RU8L 4PJXB 4ALAC 4ZD3H 1AOHA 1J8HB 3LRHA 4FYRA 3K5RA 3OR7A 3VQMA 4HH9A 4W9HC 4L48A 5IVXA 4X6EB 2XXFA 2PXYD 4F80A 2DQFB 4HGWA 3S5LB 3MR9A 3X14A 3HS0B 3H2QA 4NAMA 4FXGB 5J9PA 2XTJB 5I19H 5IJKC 4HWEH 5KBKA 2B39A 3QJVB 4RGOL 3ZTEA 3BQVA 2AJYH 3F12A 3KW8A 3GS4A 2CKBA 3A6BH 2R83A 1NDGB 1RUKL 2BSRA 2WLYA 4NKDA 3KH4A 1NAKL 4X2UA 5C9JB 5D2LA 4OTXL 1XCTB 5FXCH 3RL2B 3RVTD 3L54A 2DMCA 4D9RD 2VO8A 1QO3B 4FNLL 4QRQB 3DX7B 5T1DL 2WTPA 3CZFB 3PJSB 4J23A 3X11B 5AL0A 2JCWA 5H35A 3VRLF 4X7TB 1BDYA 3SDCD 3TVMC 4UB0H 2AGJL 4QPEA 1VENA 4PJXA 5EBGA 3BP5A 4K2UL 2XXCB 1RZFH 4YBHA 3MGAA 1UVQB 3AU0A 3Q44A 3VRJB 2ZUYA 5T33L 3Q1EA 2QLVB 2DQHH 5BS0B 5E7BA 1QX1A 4NUJB 1UCBL 3NABL 1R75A 1I7RA 2OTWA 3UBGA 1J48A 4RISL 5AVTB 1RH8A 3ZE1E 4PJ8C 3M86A 4Y1SA 4LCYB 2Q86B 4M8VA 2QQLL 1ZHBB 1TJGH 1UM5L 5FEBA 2ZXQA 4GG6F 3DIFA 2H6OA 2XVBA 3LD8C 2H6PA 3IN0A 2XWEA 4O5LL 1NCWL 2DV6A 2VWEE 4GMTH 3OWEA 5HVGB 3U0WH 2Z92A 3WD5H 2X4TA 2DQ6A 3TC9A 4ALAL 3EYVB 4BFEA 3V6ZA 3EJUA 4BUGA 3X3FL 3OAUL 1D5IL 1OL0A 3FTZA 1V3JA 1J10A 5T3XL 1OE2A 1LO2L 1EV2E 1UVQA 1QEXA 3MNZB 2ARWA 1G7PA 3T2PA 1D2PA 5E08H 4CAGA 2OQJB 2CR0A 5L8KB 3F00A 4RVBA 3VE0A 2BNRE 2Q76A 2C3VB 4K15A 1RCYA 2VLKE 5FYLE 1X9RA 1YEDB 4EBQH 1E40A 3RWFB 1AXTH 5D2NE 3TVMB 5CCKH 1YAIA 2PTUA 1RP9A 1FIGH 1UZ8A 2JKLA 4KK9C 1G0XA 5CO1A 2QQNL 4L2LA 1KACB 5I0YA 3BVDB 4XXCA 2ITEA 4IW4C 1UM6L 2IVFC 2H5UA 4UT9L 4BIKA 3F7VA 4YZFE 4JKLA 3H6AA 2FEDC 7TAAA 3EYUH 3VI3B 4NQCE 1HILA 5IJKA 4I5BB 4Y16C 1PAZA 4OFQA 4QTHB 2HPTA 3KYOB 4AGLA 5AD0A 4HF5L 1KELL 3GXNA 4PJ8B 2EH7H 3GB7B 4F93B 2G2RA 3PV6B 1JN6B 5EFIB 5I73B 3V9FA 2QVFB 4LCWD 1L6XA 3U0TB 3X13A 3DJSA 4B5ZA 2M2DA 3LD8B 4JO2H 4P2OA 4HGMA 1SOKA 2NYZA 3L3KA 1IILE 3VFGH 2KZ1B 3DIVA 3MV9D 4OJDH 4MQTB 4K94H 3D09A 2IH9A 3V0HA 5I0VA 4MAYC 4XB3A 4CILA 5D1QA 1QNIA 3JYCA 1GMIA 1KC5H 2ADFH 1OARL 3ZDYB 3RY5A 4TVPD 3L81A 4LSUH 1NPUA 4N8VB 2IQ9H 3C6LD 3U36A 1AHWA 4MHHG 3G6JB 4E5XB 2Y7NA 4QTHA 2P8MB 3ESOA 1PLCA 5KSUA 2Z1KA 1IT9L 4R0LC 1MW0A 4BXVA 4FABH 2H47C 4ABVA 2D7MA 1I53A 3ZL2A 3FAWA 5IGXH 1RIUH 5JW4N 5HGBB 2BVUA 4C4UA 1P4LA 3C09B 3VM7A 4L1BA 4XRCA 3REWB 2YXMA 3KPRE 3SGDI 1T2XA 2WN2A 5JPNC 3CFCL 3PWLA 3BWAA 1FYHB 4Y16B 5DS8A 3U7WL 3T5WA 4EI6B 2OAAA 1UD8A 4U6XA 1ZLDA 4N8VA 4PJBF 4K9JA 4EIUA 5DURD 3FN0L 5LAPA 5F6HJ 4K7FB 4ZUSB 3SJVB 3FCSB 2P8MA 4OF7A 4J4PC 7FABL 4OCWH 3KWXA 4WTXA 3PL6D 5HJDA 3RUGA 4TUJA 4WV1A 3ZU8A 3H7BB 4N8PA 1AO7B 1VEMA 2MH4A 3OG4B 5DJ6B 2WBJD 1TVHA 4GQZA 3PHSA 4MAYB 1XWVA 1K5WA 2DD8H 3DROA 2DIAA 5FHBH 1KIPA 1URZA 2JFCA 2LFEA 2QR0B 3QC6X 3T2LA 3ULUC 3AWEA 1HDMB 4FNTA 1BZQK 3JTTB 1HNGA 1P5UA 3QIBA 3TFKD 2ZNXA 4M7KH 3K1DA 3HRPA 4G3YL 3QGVA 1T2QH 5C3TA 1GY1A 3ALPA 2EC8A 4R0LB 3DO7A 2O26U 3D6GA 3AGWA 3WNJA 2HUEA 2PCYA 1NMBH 1QFPA 1CDJA 3WJMB 3OZKA 4F57H 1A65A 1OGAB 3EFFA 5E6IC 1J0IA 3QHFL 3UC0L 3UEQA 5J1SC 4JK0D 1UWFA 2UY6B 5IVOA 3P3YA 1T5WA 3TEXA 4LIQL 2WSKA 1JHKL 1A3LH 4I0CC 3F7QA 4FZ8L 3VXSE 1UM4L 3PE9A 4GO9A 4MJIB 1OW0C 2DQEH 4GUPB 1MFBL 4HCRL 3MRIA 4TNGA 2NDFA 2QPUA 3FONA 3L5XL 4PR5A 1M6OA 4AM0Q 2QR0A 3NZHL 3MUZ1 4GKNA 4QRPA 1NGPH 1Z9NA 1YPZB 1N5YH 3H9ZA 2AS5M 4M5ZL 3RDTD 1JZ3A 1MRCL 3CMOH 1SXZA 4DKEL 4NPKA 1IV8A 1JZ4A 1MJUL 3MJ8A 4AIEA 4R0LA 1I7TB 3MYJB 1X5GA 5D4HA 2QKIC 4WI6A 3U9UB 1TIUA 3OD3A 5DJ8B 3VXMA 1NFDF 4XP4L 1KT2B 3RKPA 2CAKA 2HJKB 4YXHL 1S3RA 1ZPLA 3SOTA 3LRKA 4GUQA 4HCRA 2DH3A 4H0IA 5JPNA 4XNXL 2HKAA 5AYUL 5HYSA 3KXFE 3GKWL 4M1CC 1QLFB 2V5MA 4IIQC 5B1KA 5JIQA 1GSMA 4BDVB 3VFOB 1MHHB 4GXVL 4WFED 1M42A 5IVXF 4AXWB 3ULUL 4AEEA 1K4CA 2JQMA 3M7OA 4L4TB 1N59B 2WLZA 1OHZA 2XWTB 5DRNA 4AVIA 1QNZL 5FHAH 3TA3C 1KFGA 5DD3L 3IDGA 4KNUA 3FOLA 4LSVH 5IR1A 5AVRB 4ECNA 3QUYC 5C7XL 3N0PB 1CI5A 1QPKA 5GS0D 1YEFL 2AXHA 1SVBA 3GJFK 3SE4C 2ZCHH 5D2LF 5FV1L 3MCYA 3ULAB 4QRBA 1O75A 2KBGA 4HJSA 1T1XB 1SXBA 4HT1H 3QUMB 4ZUUB 5CIPH 2VDQH 1DJHA 3ECBA 4PJXF 5DXWA 2LOEA 5BCAA 4X9YA 2VDNL 3ASNB 5I71C 5IQ7H 1OLLA 1PSKL 3STBA 3TV3L 3QUML 1A7NH 1QZNA 2X1WL 1D7DA 4MCMA 4UQCA 4ZUVB 2J1ZA 4L4TA 5DZAA 4LCCA 1CYXA 2WYIA 4RNRB 4WCYL 7CGTA 5CLXA 5AW8B 1RAMA 5GGSB 1D5BB 2QKIB 2VOTA 3PWJA 2PP9A 1U8MA 2WGNB 1A7RH 1GKOA 4R3SA 3H8NA 1ET7A 5E6IA 4ODUA 2PCXA 4D0BB 2H3KA 4XAWL 4QJ3B 4PWJA 5DDHB 3CCHA 1I1FB 1ZV9A 1QBLL 3EG9A 4ZW6A 2A6IA 1RJLA 3OLGA 4FJZA 5HI5D 4IIQB 1EAPB 1I1RA 1NCDL 3DPDA 3NCFB 1YEHH 4ETQB 5CEZH 2WCPA 2Z31A 4QHPA 2A1WL 2QDVA 3ZHLA 5BS0E 4OGXL 4HD5A 5TGBB 3TA3B 2P5ED 1BOGA 4HDIB 3FUHA 3CVHH 3HC4H 4F7MB 3QUYB 5ICZA 1MCDA 1JPFB 1JNNH 3RWIB 4Q6YA 1RL1A 1LE9B 3GIVB 1AJ7H 1D5BA 3S0PA 1MCFA 1WCBA 2P44B 5FUOL 4H1LG 2GC4C 3BCDA 4RCAA 4XCCL 3MGOA 5CZKA 4A7GA 1CFNB 4NJAL 5DDHA 2BSEA 4QUOA 1AI1H 1I1FA 2BDNH 4AQZA 3LN4A 3FB8A 4Y5XC 1JV2B 5K33A 1FO0A 1DZ0A 2ALAA 4MLSA 5BV7H 1JTPA 2HAZA 4JPWH 5I71B 3VM5A 2VKWA 4E9RA 4OI8A 3QIUC 1AG0A 4U6VL 5D7SL 1JNLH 3D25B 2J12B 1FVEB 5JQ6H 3EIFA 2ZAGA 3EFOA 3LKOB 1XFPA 2PYFA 2GJ6E 4AZ8A 2C9SA 2JI2A 5CKGA 5IQ9B 3BO8A 3QARA 3SE4A 5TFSL 1BAWA 1R3IH 2HVBA 5AW3B 1EXGA 3G5ZB 1UG9A 3JWNC 4IK7A 2O5XH 1OWRM 2V7HA 5EBWA 5E94B 4DSYA 3MREB 3L9RB 4FP8H 5JW4R 2WLHA 3KYMA 2VSMB 1IGFL 5EO9B 1JV2A 1MIMH 3VI3E 2CNZA 4ZUWB 1C7TA 4KMTL 1GYAA 3A67L 2P43B 3LRMA 4X8CA 4ZNEE 4ISVA 4DAGH 5CUSH 2ICEA 4HJ0D 3MOAH 3UX9B 3WTSA 4FQJH 4BELD 2IDQA 3MXWH 2DEYX 1FORH 3HTLX 3ZIMA 2E3VA 4O02H 5LJYH 4JG0L 5F7DA 1ZHLB 1JHTB 1YYMH 2H1PH 1HXYA 4OZFA 4MFHA 2JJWA 3UMNA 4Z76B 5JOFA 4Y5XB 3CTTA 2W94A 4KFZC 3LPFA 3FCUB 3QIUB 3SDDC 2BSBA 4FCAA 1UKTA 1I7UA 1WEJL 3D50A 3VRIB 5CEXA 3ZDYE 4LLUB 2F8XC 3V4VH 5EO9A 1G0DA 1TZGL 3TP4A 2APSA 2YMTA 3WIFB 3APMA 2FNBA 2IALA 3VVWA 1YQVH 2X88A 4KQ3L 2LE9A 5GGVH 4ELMB 5F89A 4EXPX 4EVNA 1XXDC 3SPGA 4JQIH 3MODL 1ZEAH 2GTZB 1ZGLP 3W9DB 3DIDA 4RSVA 4DZ8A 1PCSA 3V0VB 4KZ0A 2VR3A 3RUGF 4LAJH 5I1JL 3D07A 4GRLD 4G7SB 3SO5A 2WNGA 1B4TA 35C8H 3C6SA 1Z9LA 4MGXA 2H2PC 4P2CG 1CDGA 4FI7A 5CEYB 4DFHA 2UWEB 1VCBC 1B2YA 2P5PA 2V33A 5FGCE 4GAJH 4N4YB 1F02I 1H3PL 4LOEA 3II2A 1G9NH 1HCYA 2OTUB 2N7SA 1G9MH 2VDPH 3L3OC 4LSSL 5DZVA 5C08D 1HEHC 3CVBA 1N4XL 4LEOA 5LNEA 3F83A 2G3NA 5CGTA 5ABAA 3SJVE 4YSUA 5HHVL 5C07B 4I9WD 1FDLL 4D9LH 2YZ8A 3UPRB 2VJ0A 2GVYA 4HSQA 4HJGB 3BMWA 3EDKA 3QXAA 4FNSA 5IW1A 2XPGA 1EMTH 5EU3A 4XPFH 1F4YL 3NDYE 4L4VD 3W9DA 4OCMC 5DLML 3UYOD 3FRPB 3SDDB 1B2WL 1OQOA 4HPYH 1U30A 4NNYB 3A6OA 2DWDA 3FK3A 4LAQL 1J5IA 1LO0H 4H44C 1SLVA 3T8MA 1HYRC 4ONOA 2YPLB 1DQJA 5DJDB 1PL3A 1TEYA 3RBGA 3PUCA 2QSCH 1SQ2N 4BSVA 1F11A 4X8XA 3NIGB 1OGAE 4W93A 1M1SA 1RZKC 4Y1AB 2UZIL 4WWKC 5C09A 3QB7C 2VAJA 5D7IB 2FBJL 3U1QA 4J6RH 3DWTA 1C9SA 2ZOOA 3EJRA 4PHXA 5DJYB 3KHOA 5AUMA 3WHXA 1HZHH 3BVTA 4K3EH 4OZGB 4PGEB 1C5DA 1A6UH 1JZ8A 5IB5A 4BZ2L 5FPIA 4Q0XH 5K9KB 1PKQB 5EC2A 3L3OB 3QR0A 2P28B 3RNKA 1A7QL 3BISA 3UTSE 3QEQB 1CXFA 4R7NA 4ICWA 2YPLA 2LAGB 1KCVH 1X9QA 4P4KA 5DJDA 2EADA 2VLMD 3TCLB 2QHRH 3GSUA 5KJ7E 1LK3H 3G5XB 3U4BL 4KQ0A 3A6CL 3UIYA 2CIKB 4JBSA 1KJ3L 3CAFA 4HEPA 3UEZA 1TF4A 2DL9A 2V7NA 5E8PA 3KPQB 5CM1A 4OLXL 3O45A 1KYFA 4BZ2A 1IM3A 3W2DH 4ESKA 2ZIDA 1ZRUA 2WIIB 2H3NA 2OR9H 4IOFC 4PGEA 5AG8A 4KZDH 4XOAA 4B9YA 2CKNA 3QJFA 3ULUF 3GRBA 3ZTCC 4YDVA 3NA9L 4OZ4A 3DYPA 3V6OE 3UGXA 4PW4A 4AQ8A 1QEWB 4LKCB 1SDAB 1MCLA 4HUWA 5D6CB 4JO1H 4WWKB 3O9WC 3NT0A 4JUTA 4RAVA 2YN5A 1ADQL 3LPWA 2Y36L 4PBVC 1F4XH 3NCJL 1T0MB 3G5XA 1UENA 1N3NB 1RZKL 1RZIB 1XAUA 1EWHA 4MKMA 1L9MA 1ZT1A 3F58H 1OAKH 4PP2B 3T3ME 2CM6A 2MQCA 4HAGA 4LOUD 3THMH 3U6RA 4ZMWA 3CH1B 4I3SH 1T1YB 1RU9H 2FO1A 4M8UA 5T1KB 1Q9LA 1FHGA 1Z6JT 2KH2B 2CHWA 4UQBA 2ZOTA 2GHWB 3VD0A 4P23C 3AFLA 3LN5A 1DFBH 3E0GA 1J88A 4TLUA 1K5NA 4Y1TA 5LBVA 4KQ4L 1H8SA 3FSOA 3NJIA 2Z8WC 4BKLB 3PWUA 1BXXA 1FNGB 3BLBA 4QRRE 3CFDB 1A8JH 4JQXC 1RLWA 4S1SH 2UUDK 2H4EA 5HHMD 2VABB 3CC5B 4M62H 1IGCL 4LKCA 5EN2B 5DC9B 1MCCA 1Q0XL 5JOPD 2X6BA 3PWVB 2JB5L 1IGYB 3ZL1A 4FC3E 1RQ5A 5K1JA 1ACYH 1VGEL 5FW7A 2D9QB 1CQYA 1P7KA 2ZZUT 3BDXA 4LCIH 4X9BA 4BV1A 5CBEB 2KERA 4CVWA 4A7GF 4PP2A 4WU5B 1HYSC 2VZUA 3C5JA 2CH8A 4JFED 5JHAA 3B2VL 3HMXH 4M7LT 4UIMA 3TNMA 1CLZH 3CHXA 4PCTA 3LS5H 4CSPA 2PWGA 4G1EB 1JVLA 1QUNB 2DTML 3WFZA 3RFZA 2BS8A 4I7ZC 3O9WB 2R2EB 4GOSA 1UH2A 1P1VA 5CWSA 4YHZH 2PTTA 5GRUH 3P9LB 3TBBA 1DN0B 3BZFB 4QJ4B 1ITCA 2R0LL 3W82A 1EO8H 2R1WB 4KK8D 1ASOA 3DX4A 4AMKL 2C7FA 2W0FA 4P23B 2FT8A 5LDUA 2CR3A 1B3JA 4R4BB 3T0DA 1HOCA 1DYZA 2A9MH 4XXWA 5JXED 1VAHA 5DTFB 5EU7E 5DYOB 4OB5L 4AQEB 1R5VA 1S6NA 1JV5B 2QGBA 3IB4A 4G1EA 2ZYRA 1P7QD 4OLWH 3MRGB 3PNWA 3STZA 2FR4A 3H42H 3TF7C 2R2EA 2OSLB 2ZUXA 3BAJA 2WLNA 4TUOA 4DVRL 3BKJH 2MNWA 1INDL 1BFTA 3GINA 1B0GA 1EHKB 4TUKL 1NDMB 1U8HA 3BZFA 2B15A 3TH4T 2R1WA 1QFHA 2UV3A 2XVGA 3AAZB 2AV7B 2X89D 4WHCA 5CZXD 4XPGH 1OD9A 4ZYKA 4QHLA 5DYOA 1I1AC 3KM1A 1Y18A 3P4OA 4M4RB 4PTUB 3DOHA 2Y72A 5T3ZL 2Y2YA 4GP5B 1FZOB 4NNPH 4NQED 5TE6H 4DW2H 2OSLA 4IMKC 4Y19B 3WG7B 1M7UA 3UTPE 4GAYA 5HHNA 4ABQA 2IV8A 3FQ1A 1BSIA 2ILLA 1CGVA 5KVMC 1U3HA 2A99A 1FZMA 1PLGL 2JKNA 2XKSA 1OAQL 1JG9A 2A9NH 3NJJA 3QIWC 3K71B 3ISYA 4MA1C 2IFGA 4KTGA 1WV7T 4K8RC 2KL6A 2XQYA 4TQPA 1B3IA 2M8XA 2X1OA 4RETB 2ICWA 4GT7A 2AANA 4OBSA 2F5BL 3J27A 4YR6A 4ODVH 5DO2D 4K7PY 1DVSA 1S7QB 3B7RL 4ELMF 5IFJA 4MS8D 1OAJA 1MELA 4H25B 1ZKAA 4G2AA 5A2AA 4X98B 4AGOA 2UVFA 3S8WA 4C58B 1NEZG 3FQRB 1S7RB 1GJUA 2VMEA 1SRDA 1T3FB 4Y4HD 3UTTD 1OGTB 4HZLB 1E90A 5LCVH 5DMJB 2PPCA 2N3JA 4TVUA 3ZT7A 3MCLH 4JGMA 2GT9A 5GGQL 4KDWA 1YMMD 5HYJB 2BSTB 4LVOB 2UWEF 1HTYA 5DEFA 3MV7B 2GKIA 5EPMB 2VW4A 1BAGA 2IO5A 3D06A 4I2XA 4OJAA 4LLWB 2F0CA 4LF3B 5D5MB 1N5AB 2NW2A 2AJSH 3D39D 4FQPA 4TF4A 1CGYA 3AREB 4K71B 4D8PB 1CLOL 4H25A 3RL1A 1RK0A 3QIWB 5C2UB 5KOVC 3VD2A 4MA1B 4WEUD 3VXQA 4Y5VC 4KZEH 3C8KB 3Q8BA 1TTRA 1RLBA 2W0PA 3BD5A 1JZGA 4K8RL 4PW3A 4Z78A 3TIEA 3IGAA 1I1AA 4R97C 1J05A 2F1BA 4R8WL 3AUWB 4XVUD 3E6HA 2WXFA 1F3DJ 2W65B 5FF6A 3NZ8B 1NM9A 3ATBA 2E4FA 4Y1AE 4JM2A 4IRSD 2F7OA 4M48H 4OUUA 2R0ZL 1MJJB 4L23A 3DOSB 4WKXA 3NIGF 1N5AA 3POHA 4I3RL 4WUUE 3SPVA 3D4ZA 2G0KA 3MV01 4GIOA 1HE7A 2AI0L 3G9AB 3HBGA 3KGTA 4ES9A 2VC2B 1JD7A 2O5YL 4Z7NB 1THAA 2BNUA 5D7KD 2I9TB 3FH5A 3BSGA 3QEQE 2JJVA 2IDTA 2YBGA 2YQ2A 3BFOA 3B8YA 4N8CL 4GMSH 3LZFH 3PFQA 5GSVB 2F53A 2AJVH 4ZRGA 3QXWA 2VDRB 4BCZA 4NO5B 4RA0C 3DHUA 4NUGL 3DRQA 5SWSB 3UZQB 3KLQA 1E28B 4IM8A 1C8QA 3SDAD 1CLVA 1JZDC 2VDRL 1S8DA 3LZOA 4NZ8A 3IK2A 4Y5VB 4M6NL 2JELL 5E4IA 1PQZA 1C12A 2GFBA 2WQAA 1TITA 2MCPL 2AK4B 3O4LB 1B4LA 2O6PA 3UABA 3LKNA 4O51B 3QFDA 1OXYA 2YS4A 4R97B 2XA3A 5KUMA 3TURA 1GR7A 5FO2A 4IOSA 3V0WH 3U6XA 4S11A 3RVUC 5DRWB 4G8GD 2D2CC 4GS7C 5AKTA 3BVWA 3O6ML 4PP1D 4TN9A 1J5HA 1A2YB 5ADOH 5GS1C 1DJZA 3VXRD 3ALXA 4PRPB 2TSBA 1TPXC 4TL4A 4PREA 1GTNA 3CD4A 4A67A 4JZOB 3GBNL 1DBJL 3I50H 3QG6A 5HDQH 1YEIH 3MN8A 4J5VA 5I1GH 2VIRA 4PS8A 4F7EA 1OCRB 2FECL 3IFLH 1EUUA 1S7WB 4QHKJ 1DSYA 3U4AA 1O6TA 3ZIYA 3D34A 1O9ZA 5DVLA 3O11B 1FAIH 3H3PL 1EDHA 1YJDL 2ZKHH 4GQ9L 5B8CA 4YL9A 5A2CA 3S36X 3N1QC 3JV6B 2ALWA 2OMTA 3HEIB 1E27A 3LQMA 2JLLA 4JFFE 2FE0A 1JPST 3L4VA 2HN7B 1KPUA 3ULSA 5ENWA 3LEXB 3UZEA 1BPLB 2Y5EA 1ZLVK 3BIBX 4JDEA 2FLBT 1TTAA 1NCBH 3BKYH 3CNKA 3R4DA 4FKKA 2DEWX 3VXUD 3ZE0B 2CDGA 5IMMB 3N5AA 3G5VB 1K6QL 5C0EB 4FDWA 1GOHA 4WGVB 1KB9K 1JK9A 4K3JL 1KEML 4NZTH 2XYCA 4GW5A 5EF2A 2NRDA 4RFOL 2Z4QA 2CCLA 2OX5A 3BPLC 5CN1A 3QCTH 4ZPVB 1UWGH 2KT6A 3EYOB 4IBTA 3LMJH 3QQ9D 4GS7B 4G7VH 1A1MA 5CU9A 3IDIA 1A0QL 4FQ2L 1T4WA 1L7TH 3KPSB 4KTYA 4QRAA 5GS1B 1A6WL 3TFBA 2BMKB 5EU6D 3C2AL 4NM8L 5D71L 2FJHA 2GAZB 4ZOCA 1V7MH 2H0FA 2YD8A 1TPXB 1WSST 3RIKA 3IU4H 3WTTA 2DEXX 3TXAA 2H32H 4IDJH 2XN9D 2FLMA 3IRPX 1FZKB 4JM4L 3BESR 2BXYA 4JFYB 3IXAB 2DM7A 1A4AA 2XQBL 2W9EH 1LLAA 1A7BA 1MRFL 4X6DE 1TYEB 1LO3L 5C0EA 2CRIA 3QUZC 3H9HB 1HXMB 2DWSA 1XTMA 3E2HC 3GF8A 3KPOB 4IRZL 4XNMA 3P0VL 4XPHL 3X12A 2D3NA 3NSCA 4Z0BH 3SQBB 3FUDA 3BAXA 1FUNA 2WYTA 5DQJB 2A73B 2H2SC 5HGAB 3NEEA 3UMTA 2V9TA 3KPSA 1DVQA 2Z65C 5I30H 4PCYA 1TLKA 4JB9L 1F1DA 1F86A 5MEOB 3PRZA 4TTDC 3BP6B 2Q6WB 3ARFA 2CLRA 4RGNC 4HIHA 1OD7A 3VCLB 5KVGL 2BJML 1HIMH 1MAMH 3BH9A 5IM7B 4IRZA 4XBGA 4WSKA 2YRZA 3B9EA 5E99L 2A83A 1G6RB 5I2IA 3GBDA 4DGUA 3FTYA 4QIRA 4DP6X 2BC4B 2OMNA 4ZDHA 3CFTA 1DVXA 1KB5A 3J2PA 3F65A 4GEJA 4YHLH 5F7NC 1MJ8H 3NRQA 5IIEA 1IBGH 2BNQE 4HD9A 5AW2B 3T2QA 3WJJA 1URLA 2V17L 4UINL 5DJXB 4NQDB 4LEXH 1O7DC 2VM3A 5D7HA 3KCPB 3D08A 1EO5A 4J28A 2HFGL 1TQTA 3RHWF 4M1GL 3QUZB 3S6CA 3CDCA 4E41D 3E2HB 4FNPA 1D6EB 4R96B 4U6TA 4XPTL 3VCLA 4Y8AA 4DT2A 5I1IH 5HXMA 1DUZB 4E68A 1E4KA 2A77L 1S7UA 2Y5TB 3PV7A 1JMZA 5KSBB 4P46D 4OLUH 3FULA 3U82B 1CG9B 1NFIA 5IB1B 2FGWH 2KUTA 3CDYA 3OXRB 4N8VG 4HWZA 3P9MB 1I31A 4J8QA 4RGNB 1N9PA 2VLKA 3QNYB 5DU7A 4AYSA 4P49A 5D2NA 3ZRCC 4XNAA 4A6YL 3B7SA 4C4KO 1DQLL 3VMPA 2Y1ZA 1IUZA 4B60A 5SV3A 4YSTA 3LKPA 5AB2A 2WQUA 2BVTA 2DQJH 3ECUA 3VA2C 1KGIA 1V54B 3RVTC 4NQCA 8PAZA 3I6GA 3LY6A 1CDHA 4MHHI 1J5CA 1FFNB 4BWTA 3N9GH 1RUPL 2HXAA 5DC4B 5HHOD 3SDCC 1NGXB 3QCVL 4A2EA 1ND0B 1XZ0A 2TRYA 5D5ME 5E8OB 4DK6A 2NNAB 3PAUA 4A6YA 2A4EA 3KDMB 4JM2F 3IJ8A 4XWGL 3P9MA 4PGCA 4Y4FC 5IV2A 1PZ5A 4HFUH 2WXNA 3LTVA 5I1HH 4OD3H 3WIIL 4ZO8A 3BAEH 4LVNB 2ESVD 2FEJA 5E70A 2WZPA 4CMHC 3BDBA 4NQVB 1T0NB 2X9YA 3MLYH 2FO8A 2MCG1 3OMAB 4A7TA 1N12A 3O8XA 3LZLA 5E1AA 5D1ZC 4JN1L 4DZBB 2EDRA 3CSPA 3WNKA 1AKJB 2Y7QB 5SWZE 3CLWA 1IZJA 5DUPL 2DY2A 3VD5A 2I7SA 5F6HI 5KSAA 2FYVA 4P3DB 3T4AC 1HNYA 5ID0A 2PUQT 3HN5A 4UCFA 5F96H 5ECJE 1H15A 1NCAL 2RTTA 3RNQA 4FFTA 3WSQL 2NUTA 4HPHA 5T1JA 4DGWC 3U83A 2HRPH 1BFSA 3HNSL 4NN5C 1E8ZA 1AQKL 1OTTD 2WBWB 2BH0A 3BSZH 3ILPB 1I9IH 5E5UB 1L4IA 1JGVL 4QEGA 3KPRA 3SY0B 4AIZA 4Z7NE 5IKCB 1SF5A 1S3KH 4EUPB 1MNNA 1YCSA 4F2MB 1T0NA 1QYGH 3OF6A 3HE6D 4L3CA 3ABKB 5HYSG 3RQ3A 1NIAA 3WTVA 5HPOA 3SDCB 4MXVF 1J9RA 3MC0A 4R5VA 3S5ZA 1CXKA 5IW6A 4YE0A 5DC2A 3QO0B 3V6FA 3V0JA 1JUFB 5SWSE 1ZSDB 4Y88A 4EI5A 4Y4FB 1ICTA 2PKDA 3RTQA 4AGPA 5I9QC 2L7JA 3U1SH 1WO2A 5C8JB 6PCYA 1GS6X 2L0DA 4AKOA 5L9DH 3QCUL 1RI8A 5FO8A 1N7MH 4YHOL 1PBYA 2VISA 1LEGB 1D5RA 3GJFH 3OGCA 4DK3A 5HHXL 4AG4H 1EXUB 3VQ1C 1C5CL 3WXVL 2GIXA 1S7XA 4QHMB 3OZ9L 4IBVA 2AK4E 4G7YH 4ZMTA 3KLHC 5IKCA 5D1ZB 2Y07H 1T22B 1UACL 1YMHA 3L45A 3GD1C 4FFZH 5A3ID 4UDTB 4HUVB 1XR9B 1YHPA 4LOVA 2X4PB 3T4AB 2J88L 3VVVA 1XEDA 4PRPE 1NDTA 5G5DB 1N2RB 3GXFA 3QO0A 4A66A 2XKUA 1JUFA 4NN5B 4Y4FA 4EDXA 1CFSB 5C8JA 1LXMA 2XFGB 2XWZA 3MBEC 3KL5A 2ZWLT 1BW8A 4GUCA 4G7QB 3JVFC 3BQUD 3VXSA 1J1PL 3VX0A 2FIRT 3N04A 1KV3A 1S46A 1T89A 1CFQA 3M1BA 4UQEA 3ETSA 4I89A 4DVBB 3WFBH 4B97A 3L3JB 3EJQA 1Z66A 3K6NA 4G6JH 5D1ZA 2EEAA 4GI8A 2NW3A 1PCXA 4YSAA 2CIIA 5FK9A 3LNGA 3RWGA 3NGBB 4UU9B 1XR9A 4R6UA 2J6EL 5I9QB 5LAXB 3H9YA 3S4SB 4W9ZA 5JOEA 2F74A 2WLMA 2DYPD 2ZWSA 1P84J 2W07B 5B1BB 5D55A 3TWCL 1EHLL 4MNQB 4MDRA 1I7ZA 4ANXA 5DK0A 1JGDB 2EDJA 5I17B 1SVZA 1SVCP 3PAVA 1PZCA 3AWGA 3QWOA 5C0JA 4JGJA 3ZE0F 2A2QT 4XMLL 5I1KH 1P9MA 1XH1A 3KXFA 4EO5A 3KW7A 5LQBH 5I1LA 5LNGA 3SKNA 1IFGA 2OPCA 2WZ0A 3DURB 3GMMA 2A6KB 1GTFA 1SN2A 3UG5A 4QRFA 3MV9B 5DFTA 1H3XA 4IBUA 2WBJC 3OKEB 1KGCD 3MNMA 3L7EB 1H9DA 2IBZX 2HB0A 3MACL 3OKLA 4L3EA 1UUNA 3U30C 1HL8A 5F7EH 2F19L 5F3HA 2IJ0C 5DMGD 3DV4B 2VGLM 4Q4IA 1KJMB 5M7QA 1S5IH 25C8L 3ULVD 5JW5A 3F84A 5GGVY 1EIBA 4V2BA 4NM4L 3UJJH 5SWQB 5I23A 1NLBH 3CFQA 3V8OA 1U8OA 2X0VA 3GSQB 5T1LA 3VMOA 4NJ9L 1LP9B 2G75A 3DURA 4AJ0A 1XIWC 43C9A 5HVHC 3QI9C 2E0PA 4RZCA 5MEQB 2YO3A 2XRAH 4B3VA 2P5WD 1AGCA 3ZE1F 3U9WA 3LXBA 5DSCB 5IJVB 3DI3B 3AM8C 3GHBH 4GPVA 3ETBF 4R4FL 4NIKB 3MBEA 1QSVA 1ZT4B 4J1UA 5E9DB 4ZTPL 4A37A 3LQZA 4NXKA 5DURB 3FL7A 7PCYA 3WLWD 3F62A 5L0QC 3VGHA 4JG1L 5C6PB 1R5IB 1GZQA 4OZFG 4BKSC 3P77B 3ARDD 3PL6B 3FZUC 3T6XA 5DVKA 1K3ZA 5E51A 2R2HA 3DSFL 1VJSA 5AW9B 4GSXA 2WBJB 1AXSB 5A6LA 4UTAH 5F9OH 3CLEL 1E7UA 3J07A 4P9MH 5FGBC 2J20A 3SE3C 4NCC1 2UX6A 1FYTD 3U30B 4Q9QL 4NQDE 1TVBB 2GTWA 4LNRA 4Y5YC 3KM2A 4XMPL 3FXIC 4OGAD 1JRHL 1Q0YH 4N0RA 4OIFA