4JDEA

Crystal structure of pud-1/pud-2 heterodimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
144
structure length
144
Chain Sequence
SQLTRRTAKVSIDNQTGSHFKFQVTHKYTGWDADKSDVVMFQPDEVKEIFKSVAYNTGFLTTGVDNWLVDGTMVQERTEVDNKGHQIGKKSYIEHAKFISDSRSWKQHMLTAEDDGKTTTIRVFPTEIHFISPSGESTTTFTKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein F15E11.13
publication title Characterization of PUD-1 and PUD-2, two proteins up-regulated in a long-lived daf-2 mutant.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Unknown function
total genus 32
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2013-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18457 PUD1_2 Up-Regulated in long-lived daf-2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3820 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jdeA01
4JDEB 4JDEA
chains in the Genus database with same CATH superfamily
1T0MA 3SDXE 5AFAA 1RUAH 1S7UA 5HHXL 3FTUA 3L3HB 3IETB 5C0CE 1AO7A 5FC9A 4MAYC 1SXAA 2AW2A 3JVFC 3FU7B 4X8JA 5SWZA 3IF1A 4ZUVB 1OT2A 4L0ZA 1N59B 2JIXA 1A6AA 4UU9A 1TZIA 1R19A 1E90A 4U1LB 4M48H 3AWEA 4ZOCA 4YSUA 2ZKYA 2BDNH 5E99L 5EU6E 2F1EA 4JHAL 5KTEH 1YEHL 3HLKA 3W39B 4FHKA 4X50A 3FFDB 3N1MC 1H3WM 3KVDD 4LHUB 2ZWZA 3T3PB 3TYFA 2H9GB 2X2JA 3HBGA 1YY9C 4G6JH 4ZTEA 5FGBA 1ZLWH 1ETZA 3KPNA 5E6SB 2NZ9C 4A2LA 3BRGC 3LSOB 5FLVA 2R1XA 4YXHL 1BM7A 1KCUH 3KXFA 4EUPG 3R19A 3H3BC 1BBJA 3TEYA 4U1JB 1LE9A 2OMUA 1V3JA 4JFFD 4BRVA 1SJXA 1T7WA 3MGAA 4EMZA 5I66A 3TESA 2NZIA 3U4BH 1AD9A 3MX0A 4WSKA 2X40A 2WVTA 1JDAA 4M4RB 5FV1L 4DP8X 3PL6C 4ZMTA 3PGDA 2JKTM 4W9DC 4AYFA 3CC1A 5K9OB 4G80B 2HRHA 2J8UB 3JYCA 3ARQA 1PYWB 3F05A 3GIVA 3UEZA 3VCLA 2C7UB 5DS1A 5IM7A 3WFHA 3OKKB 4OFQA 2VLRB 1RZIA 3LIZL 1BQKA 3WY2A 4Z76B 3OC5A 1HI6B 4LEBA 1H3GA 4DETA 3F6LA 4XO4A 3SN6N 1G7HB 3SO5A 3EYVA 5GS0H 5KVMC 2AQTA 4PLOB 2IBBA 2WLLA 1MPAH 3BAYA 4XO9A 2R7EA 3P2TA 4EXPX 2HN7A 2CHDA 5K9KA 5FUZL 4N90E 2E47A 1JYXA 1CD8A 4RLDA 4AQEA 3WJJC 4KMTH 2JH2A 3NSYA 3TF7C 1N68A 1GY2A 4LCVA 3UAJA 2BHYA 4O4YL 1FZKB 5GZOA 2RFXB 2OJEB 1HOCB 1IGTB 5FPIA 1XH2A 2A6JB 4JRYE 1YDPA 1ZPUA 4BZ2A 4E42B 1HH9B 5FYLL 1JYWA 1VFAA 1K8DB 4MLIA 1ZV2A 3P2BA 4YAQA 1JSYA 1TLKA 1QBAA 1RKRA 1PIFA 2XKNA 3L9EA 1BHGA 2X6AA 4NERA 2OMXB 3GSOB 2XN9A 1WCBA 3QZLA 4OKDA 4B7LA 4PG9B 4X4MA 1AMXA 4J23A 5IP4A 1J12A 1RJZA 4S0SD 2R4RL 3K6IA 3JTTA 3KAAA 4B3VA 3VG9C 3BQUB 2WLZA 3GJFK 3FUFA 4DVRH 3MQIA 1B0IA 3MA7B 4KHXL 2ODIA 3MROA 2AJ3A 1CTOA 1DVFB 1BZDA 3PJLA 1KIPB 3PWNA 3NG5A 4RETB 5D6DA 2NSQA 4HUWA 1UOWA 2CO4A 4QXGL 5TE7H 3V9FA 1KIQA 2K0RA 4PCYA 4H44C 3IMTA 1TQCB 3UJTH 4Q2ZB 5GISH 3D8MA 5AOKA 1OSEA 3QEUA 2E75C 4KU1A 4Q6KA 3LH2H 1JVOA 1P5VB 3EGSB 3P30L 4LEEA 2VC2H 1EMTH 4TNWK 4E0RA 4OAWB 1PZDA 4PS8A 3B9DA 4FQXD 1MQKL 4PCSA 1DUYA 1RP8A 2E6JA 3VUAA 2Q6WA 1NL0H 3RGVD 1HNGA 4N87A 1CIUA 4X7TB 3MCG1 1DP0A 3VXSE 2X2UA 5IR1A 2D0GA 2W0KA 3H7LA 1OGAA 3L1FA 4PS3A 5PCYA 1PSKH 4B9IA 4AGPA 3L48A 2NNFA 3LHPH 3W81A 2RAMA 2ZCHH 1D7CA 5IREA 2OFQA 3C9NB 4BQ6A 3P77B 1D2PA 1BVLB 4MNQB 2YUZA 1C16A 3HN3A 1BGXL 5CINL 3RG1C 4OZIA 1U2HA 5ADOL 5HYQB 3FMGH 4W6XB 4TLSA 2PTUA 1WS7A 3CFKA 2YRZA 2HJLB 5KZCD 4KK8D 2IAMB 2KHAA 5CM1A 2X6MA 3IFPA 3VXQA 1MXGA 5D2LA 4L4VB 5EO1A 4K9EH 3MUJA 4PLKC 5ICXA 4W9FC 3B9KD 3FUMA 4QHMB 4HMEA 2K6ZA 4HJEA 5FHBL 4C59B 1QW9A 1G9MH 4AQAA 4G9FE 3DNKA 2YK1L 1DJSA 2JXMB 5C07E 4KKLD 4NO2A 2LFGA 2NW3B 1SDYA 1OXYA 2B59A 1RK0A 4QXUL 3RFZB 4U31A 3MUGA 3OD3A 1MAJA 1I7RB 1FO0B 3HMWH 1B88A 1BPVA 2AMGA 2Z93B 2HLFC 5E2TH 4NAQA 2JJSC 1ZWIA 2A74B 1F3JA 4WKXA 1B6DA 4LP8A 4HH9A 1YMMB 1WO2A 3MJ9A 2Z7YA 2QADD 3SGKA 5J56B 3TCLB 1TSRA 2B8OT 1QKZH 2ZCKL 2UXFA 4OZFH 4CVUA 4G6AD 5EBGA 3OAZK 2W9EH 1Q8MA 5F89A 2W91A 3M6DA 3AG4B 4F7EA 4ZXBA 4M03A 4X6CF 3E6HB 4XP4H 5F9AC 3SE3C 3CC5A 4WWKA 3T65A 2NX5E 3EUUA 4NKIL 1YNTF 5HDBB 3UIYA 2YS4A 3QVAA 1RUPL 4X9IA 1MG2C 1VDGA 3OF6D 4HGMA 5DJ8A 2QSCL 1YEWA 5D5MF 2DZEA 3MV9B 3MLTB 3QDME 1TEYA 3HRZC 4WI7A 2VYRE 5K9JH 1DBMH 2F53A 4Y9EA 3KPMA 4GW5B 4N26A 5I5RA 1RMFL 1IBYA 3D0LB 5TJWK 4GKOA 4XGZA 1BG9A 1E30A 3C75A 3O4OC 1IQWH 4HIHB 4JFZH 1AY1H 3KW7A 4JN2A 3EBAA 2DWXA 3LS4H 1QR1B 3ARYA 4OGYL 1Q72L 4YQXH 4PREA 4FXKB 1HCFX 2BRRL 2GK0A 4PJXA 1N67A 1QEXA 3MHZA 1X5JA 4GKNB 2F5BL 4YX2H 3P4MB 3UJJL 3QUKB 2UVFA 5MERB 4QIRA 3CLEL 1M9SA 4PJEF 4MAZA 1XZ0B 2F7RA 4GOSA 4NS0A 4DN3L 3FAWA 3G6DH 3QUHA 5D93B 1O5DT 4U3SA 3L45A 3NEOA 5T1MB 3ZHKA 3A4AA 4O58L 1AE6L 2EEAA 3HPJA 3HG1D 5L4MA 1Q9WB 5D1ZC 4QF1B 2UZXA 4JCWA 2R4SH 1I1FB 1U2CA 2E27L 2V5YA 3U4KA 2JKNA 3IGKA 1DJIA 3TTSA 3UTTE 1DHKA 4E68A 5KVDH 1Z2KA 3HC2A 3HUJA 4OCSH 1B6UA 5I6LA 3BZ5A 4YE4L 4PS7A 5I74B 1MW3A 4Y0GA 5DRZB 5LKNA 2FLRT 3IMWA 3PWJB 4BHUI 4H8UA 3DOHA 1AGBA 2HX7A 4O02L 2LOEA 5CWSB 4RGNC 4OJFL 3EO0B 3GT6A 5EO0B 1QRND 3DI3B 2Q86B 2H0PA 5KSAA 3OMIB 4EPSA 2EXSA 3IGAA 3I75B 4XVSH 5HHQB 1P5UB 5DUBB 3EO9L 5DWUH 5I1KL 5ENWB 4FFWD 3QRBA 3HR6A 3GSWB 1A9BA 2DI8A 3QIUA 1XSOA 2OTWB 4TMPA 5GRUL 5E24E 3WUWB 3AS2A 5C9KA 1I1AA 3MKGA 5HDOA 3ESNA 1HXMB 2JNZA 1RJCA 1LE5B 4IW4C 2ZP8A 3LEXA 3QXAB 1IFRA 2W0FA 1XCTA 4BH7B 2CHXA 1N0LB 4KKAD 5JA8B 2V3EA 3QJZA 5DURB 1SGKA 3LKSA 1KBKA 5T5FL 4DIXA 1S5IH 1WFTA 2Z64C 2HVJA 2PYEB 3QORD 3LEVL 1YEIL 1UWFA 3L2LA 3CDYA 1TNNA 2YZ1A 4CNIA 3QYCA 5M94B 4FI6A 4JPKH 5D1QE 5F3BB 1MAKA 4JREB 5AKSA 3GSUB 3W0WE 4KK5D 4LP5A 4OZ4A 4XMUA 3P73B 2YPKA 5DJAA 4AEIH 3HVDA 1FPTH 3N1PC 5IJKC 5F9DC 2DYSB 4JFFB 2H7WA 2F5AH 4KROD 1TZGL 4BELD 1AXTH 1USQA 2H8PB 4M6OH 3BVNB 2L7EA 1R33A 4LCWA 2JSFA 4MHHI 5BW7C 1RUKL 1XIWC 3T1FA 4MQXC 4A7GF 4XNQB 1SYVB 4CJ0A 2EDEA 2AJZA 3EZ8A 5T5NG 1VFOA 5TDPA 1CFTA 1M7IA 1PD0A 3HE6D 4LLQB 3SDCD 3IWUA 4UM9D 3WE6B 4QT5A 5E4EC 5CEXB 3RUGA 4YHYC 4NZ8A 1O9WA 2BLFA 1M4KA 3P69A 4A6YA 3SZ6A 3HNTL 1FBIL 1TCRA 2H2SC 4QRRE 1SY6H 1CF8H 4HZLB 4WI2A 2ISDA 3AQZA 5EEZA 2FX7L 2P8MB 1SYSA 3QAZC 4ELKA 5EU5B 3MI6A 2W65B 4XNBA 2Z1KA 4FHBD 1GAFH 5EZJB 1K8IA 3MLSH 3RZCC 5DUPH 1HHJA 3NPSC 4A67A 3NJLA 3SBQA 1TEGA 1LVEA 4JFSA 2R56H 2AEQH 4JHBA 3SE6A 2VLJE 2R23A 3BWAA 1ROWA 1ETJA 2X41A 4RSVA 2ZQKA 2KPNA 5DJCA 2ENYA 3BKCL 1H6TA 4F58L 2E0PA 3FFOA 4GT0A 4QRTB 3S37H 1QBLL 3JWDH 4E5XB 4HIJA 4WWID 3RJDA 5IW6A 1MSPA 2BIHA 2W60B 2VWEC 1OM3L 1SEQL 5EZLB 2O6FA 1MCCA 2X44D 1TETH 1WTLA 4I3RL 1NC2A 3UZEC 4HOXA 1GJUA 2J6EH 3MRBB 2ITCB 4QOKE 2EUXA 3NIFB 4ZUTA 3CVCA 5MEOB 2WWKO 1FNFA 7FABH 1L0XA 3HZYA 3I02A 2QMKA 3C5XA 5DVLA 4FYSA 1MEXL 4ODHH 4KXZH 4JQXA 1ES0B 2XX0A 1UKTA 2FB4H 4UNTA 4URTB 1TTCA 3ZLQC 1NQBA 1UTDA 4G6KH 2FNBA 1LO2L 4PJGB 1PKOA 5CLXA 4OFIA 5E6ZA 1SM3H 2H6UA 2R2EA 3IYLW 2EO1A 4N2BA 2ERJB 5DZVA 2R69A 3DYOA 3HIZA 4LEXH 5J1SC 3QBTB 3OKOB 1EAPB 5GRWA 1X4ZA 3CX2A 3RWDA 4OGAC 3DECA 2CWRA 2GPZA 4FQXB 3T3MF 2FLBT 1BQSA 4JZJB 4PJ7F 4XWGH 3B7RL 5CNHA 2EIEA 4BH8A 5C0EA 3T0EA 3PDGA 1PDKB 2HRLA 1ZKAA 5FYKD 2XZAL 4YR6A 3VXMB 3PQYD 5TQ0H 2A6IB 3QO0B 4MBRA 3OHMB 1J88A 4MLSA 4ZMNA 1FO0H 1JRHL 1XB8A 2L7QA 1KT2A 1TJXA 3GXMA 2Z7WA 4XTRD 4Z3HA 3PE9A 4W81A 5KUMA 1MHHA 4Y5XC 4K3HA 3JWOL 1T6BX 1LEGA 4KKNA 3DO3A 2D7MA 2J8UE 1TEFA 1O5PA 2RQEA 3BH8B 3GMPA 2X9YA 5TF1H 2LLNA 2BWIA 4NQEA 3VNYA 1XGYH 4LOVA 2VLRE 4G43A 2CUHA 1EVTC 3KEHA 3TBCA 1ZGLB 3X1FA 1PLBA 2OMBA 5HHNB 3B9KB 4M7ZC 3IDJA 1TZOA 2W9DL 3WO3B 1UEMA 4ORZC 3MOAL 3QS3A 4KHTH 4CSTA 2XVBA 2A9AA 4FXGB 2J4WL 5FCSH 3VACA 1MHCA 2C1PB 3WTYA 4J3OH 5D71H 3MRQB 1MKFA 1OTTD 4R4FL 4LLYA 1AHWB 3L1EA 4R26L 2KL6A 3DROB 4U6HB 1ZT7B 4FQCL 3U0TA 1JHLL 5DCCA 4Z7NE 1Z6JT 5BVPH 4OGXH 4NKMA 5JOFA 3FU6A 3U1QA 4MASA 2D8KA 4U1GC 4F57H 4KKZA 4WY7L 1IEBB 2MCAA 5E94A 4PJ5D 4L8SA 1H0DA 1TLMA 5FWRA 1N2RB 4FQPA 4IBUA 2QFRA 3LYRA 4IIQC 4JQIA 1SXNA 2VSMB 2VXVL 4IJTA 5K39A 4OB5H 4PRID 1R0AL 3TOPA 2GSIA 3I84A 2YIHA 5EEVA 3BP6A 5IEKA 1LWRA 5C8JB 3DYPA 3MACL 2AJSH 1PIGA 2IADB 2R59A 4OW6A 4A7QA 4NQXA 5D7KE 1ZDSA 2I7OA 2GVYA 4UTBL 2PR4L 3SDXA 5I1EH 3IVKA 5F1NB 3VFSB 4S1DD 3SE8L 1IC5H 5C0CA 1E4WH 2R1YA 3PWLA 5HVWA 4YXKL 4DZBB 2CR0A 1QUPA 1XZWA 4R7NB 4EI6A 2QPDB 1YYCA 3HCVB 3OMZA 4P9ML 1KEGL 1NANI 3C5ZB 4P2OC 4TSCH 4KZDL 1JE6A 1FFOB 2Y07L 3QJOA 4DQAA 2H47C 1M3JA 4KJPD 4QLWA 5BJTB 1C12B 2IBZX 3EJRA 3T6VA 1TYJA 3B8YA 1IKFH 3O3EB 4U0QB 1KB5A 1ZXQA 2VXTH 1N3NA 2UUDH 4PY7B 3OGCB 2FZ3B 2B2XH 2GAZA 2B20A 4LQFH 1SXBA 2CQVA 1VSCA 1EV2E 3T2NL 5IMLB 1AH1A 1RY7B 1AHMA 3FK3A 3M17B 5EZOH 1J0YA 3K2UH 2JJUA 2H2PC 3QEGH 3SCMA 2VMDA 2YRLA 5MP6H 1VKXB 5DRNB 1KPRB 3V5DB 1AZCA 3MRPA 1BQLL 4KPHL 5CZXC 5H37A 5IVZA 3WNOA 3IN2A 1GJWA 5I18L 3G6JF 1A4AA 1P4BL 3BHBA 4LPUA 4NM4H 4WCYL 4GSXA 1VZIA 4TNWF 5IHZB 2VR8A 2GYSA 2XRAH 4PB9H 1CE1L 1OE3A 3DUSB 3HG1B 4HUMB 4NUJA 4PPTA 3WKYA 1EDQA 3GXDA 3PWUB 2AJXH 4JGNA 2Y4SA 3D85A 3QIBB 4FQQA 5DLMH 3K6NA 1T04A 2AQ2A 2OW6A 4GSQA 3L3DB 1IBFA 3GEWB 3BXNA 5EOCH 5DJ6B 1MW0A 3JV5A 3MLYH 3Q1SH 2YKKA 4XBPB 4HIXH 3ZTNH 5BMFH 3KYKH 1Q4NX 3L3GB 3RY6A 1OF2A 3CHOA 4KFMA 5IB1B 5T33L 3UAFA 4H26A 5IQOA 2H3XC 3R4DA 3N43F 4AYID 1KCVL 4KITB 3OKNB 3IPBA 3FUNA 1X7QB 1UM6H 1QRNB 3SOTA 2V9TA 3DGGA 3NYKA 4MMZA 3CBKB 3VD0A 5GGSY 5IQ7L 2CJ3A 2H1LM 3MFFA 3L16A 4GUCA 4WO0A 4PJ9A 4N9OB 1GS6X 1K3IA 5GGSB 5AL0A 3AG3B 2AJUH 2YC1A 1OM9A 2ZX8A 5E9AA 4NWTL 3CVHL 2EKSA 4G7YH 5E8PB 1LNUB 3QJFA 1M05A 3BE1H 1IC7L 4UAOC 1KB3A 2Y2YA 4MZIA 1SJEB 2JWYA 2LFEA 1D5IH 3F7QA 3NP4A 4I0PD 5CBAA 2P8LA 4LE8A 1R5VB 2B0SH 2FEJA 2BOLA 3VNZA 2WTPA 2Z8RA 5HDBE 5B7MA 4K3JL 1DBKL 1DQDL 4GI8A 4MS6A 3QUML 1RH8A 4PWKA 3HE7B 1FHNA 2OW7A 4GNKB 4JFUA 5GS0C 2ADGB 2YGOA 2K4AA 4TQEL 2G2RA 1YA5A 2LABA 3MV9E 2KPWA 3A24A 4HS6A 4KVPA 4BFKA 5D1XD 2GTZA 3QFJB 3FH8A 3TV3L 2IPKA 2A83B 4XP9L 3BPOC 2DICA 1X5KA 3GKZA 2SEBB 4YGVB 1II4E 3G9VA 5CAYB 3C6LA 4IRZA 3O4LA 4LNVA 4WUUA 1SBBA 2HMID 2BOBA 2KI6A 2CDGB 3OM3B 5CIPB 4GIOA 2VDML 3F7YA 3MJ8A 3FW6A 2XT1B 1EHNA 4EZJA 5DHXB 4RGOH 4G8IA 4WHYG 3DVGB 5SWQA 4ZFOA 1C8PA 5TE4L 1NBVH 4CSSA 1EFXA 2XWZA 1A14L 5AG8A 3HE6B 2Z7UA 5F3HA 3LMJL 3ENEA 4R8WL 3SDCB 1OCCB 3VXSA 1AZUA 2GJ6D 2Z6FA 4UM9B 4DGYH 2VRAA 4MA7H 2DYRB 4ZSOB 4XB7A 3BEWB 1T66C 4ONFL 4FRWA 3BP5B 1BV8A 4S1QL 3M1OA 5EEYA 1NBZB 4FNLL 4NZTL 2JV6A 2YQ2A 3OG4B 4AC2A 2DKSA 2R9HC 2ZYIA 3MTRA 3WS6C 4I18B 4G42B 4B97A 1IGCL 2BP8B 4JVPA 4OR1A 3P3SA 2VDOL 3BW9B 1LD9B 1I8LC 3KHQA 2JCCF 2OJ1A 4GMTL 4NQDE 5DMIH 2DMCA 1OO2A 3HFMH 1NINA 4YLQT 5DSCB 2YKLL 3CZJA 2NR6D 4KNUA 3II3A 1B0RB 4DKDC 1CFBA 3AY4C 1RZKH 3FN3A 3MLRL 1HHGB 5FHAH 5HHVL 4GBXD 3WFBH 3GBEA 2B14A 4EKJA 4L5FL 3B5GA 2EAEA 4QD2E 3DX8A 3IM1A 4G9FA 4LARH 4PFEA 4PGCA 1RIVL 4HIEB 1U4EA 4UOW1 5TH2B 4DPAX 1MCSA 1S3KL 4BSJA 1A3LL 3QUZC 2PN5A 3VRJB 1G7PA 5A7BA 4LVEA 2Q7NA 2JK5A 4EN2A 1EVUA 2WMPB 3EH4B 4OF5A 1AS8A 2OL3B 4L3ED 1U8PB 3B7UX 5IB4A 4BFEA 5IVXA 4Q9RL 1UB6B 1INDL 3U1SL 1GRWA 2AHIA 1LDPL 2Z8WC 3VX1A 2WXRA 5D72H 3FQTA 3AU1A 2Z0BA 2I32A 4NQVB 3ZQ9A 5I8CA 1ZLSH 4QHKJ 5C2BL 2ADFH 4UWQB 1FL5A 1UH2A 3X17A 1NUGA 3UGUA 3ZVVA 4LAJH 3RKDD 2Y3NA 3KPLB 2DQHH 1NMCC 2AV1B 3U1PA 2Z9TA 4FJ6A 4QTFA 1INEL 3TIEB 3V0WH 1SLXA 1KGIA 1FIGL 1BQHG 3QXDB 1KTDA 5HGGS 2CH8A 2NX5A 5JXAL 4O2FB 1OF0A 1EEYB 1CT8B 3G5ZB 4N8CH 4GSDL 3EYQD 1W80A 2EDTA 2XYCA 2DKMA 2CRIA 3PQYB 4JFFE 4RDQF 5A2LH 1A5FH 2ZXGA 4HS8L 3QDMA 2F19H 4XVJL 4KY1L 2M1KA 1ZA3B 5E8EB 5EU7E 1FFTB 1WUZA 2O5XL 1BZ9B 1HHHA 1DSFL 3NK3A 1T2QH 3BH4A 3RTQB 2NLJA 4MDIA 2A77L 4YHML 3B7SA 3MRJA 5FKPB 5LGYA 3IDGA 5JXEA 1A6UH 2PXYC 4FCHA 2E7LC 4Z3FA 1N7ML 4GSUA 5IQ9A 3S8GB 4CBZA 1IVLA 1L7TH 2BP5M 5I8KL 1MW1A 1E4KA 2WWMC 2RA1A 4ODVL 5SX5K 4XE5B 4CDHA 3OR7B 4HLZH 2XPZA 5ACMA 4NSKB 3EDKA 3WN5A 1J05A 3IDUA 1BAGA 4TLUA 5F70A 3TT3L 3J27A 1OSZB 4KUCF 3KR3L 1YJDL 1H9DA 1T21B 2E46A 3DBXB 4X7SL 5FB8A 4NJ9L 3MLXH 1BOYA 5B1BB 4EF3A 5DMKB 3TNMB 3BUPA 4S1RH 3BKML 1IC0A 1UA6L 1YZZA 3OSKA 5FA3A 4BWUA 2P5WD 1ZD6A 3FOLA 5IMKB 5E1AB 5I2IB 1FVDB 5KW9H 1JPFB 1X9LA 3M46A 5LBSA 1HHIA 2XZCL 4IHBA 2AJVH 4P46C 1DCLA 1IAMA 2NQDA 4H8VA 3WEXB 1JGVH 4JFXA 5AUMB 3PXHA 2BRQA 3NIFE 4LLVB 1D9KC 3AM8C 4ZW6A 4GG6F 3I3BA 4PWEA 2V7NB 4Y5VB 3AREA 4PRIB 2AK4D 3M1CA 5J6GA 1S9XA 3U4EA 1SMAA 1WZAA 2X3CA 2HT3C 2BFVL 5AW6B 5FLUA 2FSDA 4W9EC 3EJTA 3QHZL 1A3QA 3HAEA 1XGZA 1IL1B 3U7YL 5DHMC 3SQOH 1RZGB 5J3HC 5JIPA 5FS5A 4KJYA 4PJGE 1BQUA 2R27A 3PDOB 3WIIH 4JFPA 4CN6A 5CCJA 5EFIB 5FF6B 1UCTA 3EFDL 4HETA 2FDBP 1G5GA 4Y1AD 3K2KA 2AKRB 4H20L 1AD0B 4LPCA 2VCOA 3GBDA 3UACA 4RAHA 4PJBE 3SKOA 3VSTA 3QR0A 1WAAF 3P02A 3DX7B 1RZJC 3GSXA 2AXFA 2NW2A 4X6CB 5TD4A 4HU8A 2WZ5A 1N12A 5ACLA 3CFMA 4XWOD 4GQQA 1YNTB 2FNWA 3BN9C 2X89A 4ZD3H 4GXFA 2XWJA 3AXLA 3B9AA 3EHBD 5D96B 3P3YA 5D5MB 1HNYA 5AYTA 4FG6C 4NFBA 5D7JD 1MFVA 3QEQD 2QVMA 3MRRA 5FYKU 2Q10A 3ASNB 5E2VL 3WBDA 5L2JA 2WNKA 4NENA 4NUQA 4M8QB 1V54B 3ZDYF 5G5DA 2H6OA 5D1QA 3BAJA 4APXB 1N19A 3ALPA 3W0WA 3EXJA 3KNBB 1DQML 25C8H 3AB0B 5IKCA 2WCGA 5H2BA 3M8OL 5D8JH 3PABA 2MWCA 4OCMC 3KLKA 4Z77A 4FABH 5KJ4A 3MBXH 4RH4A 3UTZA 1ERNA 3VH8A 1ANUA 2GI7A 5KYUB 1MCFA 4B0MM 3UYPB 3CZGA 4UBDD 2PP8A 3QE5A 4GP8B 2QL1A 3GBNL 1NKRA 1OANA 2KDGA 5H35B 5I0ZA 3D69A 2LVEA 2V2TA 1XEDA 5HGBB 1SXCA 3D87B 4Q0XH 2WLNA 2X4TA 3MYJB 2Z91B 3QWNA 3U2IA 2C7FA 4CRPA 2EH7L 3REVB 2WSKA 4NRYA 4QRRA 5KSVB 3VU2A 3U9UB 3B4NA 5ANMA 1G7QB 4N8VG 3I6GB 4XBGA 4AOFA 3FYIB 1FH5L 1TT6A 3H7BA 1MHPH 3KVPA 3O81A 2B1OA 5DYOB 4ZMWA 5DVPA 2FD6L 4TNVF 1YEJH 3CPLA 3N1FC 4X6FA 4YGAB 5CIPH 2Y1VA 4AQZA 1S5HB 1TJGL 3NACH 2YUVA 1DQLH 4X6BA 2E7HA 2L4OA 1Y0LA 2IDCA 4RMRA 4U1MA 2NY4C 4IBYA 5KJRH 1W72B 1MRCL 2R39A 1QZ1A 4I0PB 2C1OB 1QFUH 4FKHA 4PHXA 2EE0A 4QOKA 3QHTC 1I8MB 3TA3A 2EQDA 1BZOA 4M4PA 1GA2A 4G8FB 2OR7A 4NFDA 1VERA 3OPZL 1N59A 4YUEL 1HKFA 3K6SA 3LN4A 3B34A 1KNOB 1UZGA 3K74B 1LJMA 4BZYA 1IAIH 5EORH 1NGQL 5MENB 1OK0A 1LYQA 4LHJB 1FZMB 3V6ZB 3LRHA 5I1HH 4F7CB 2ROXA 3C08H 4HK3N 1BJ1H 5DFTA 2DEXX 3FFDA 2D3LA 1YQVH 2FRGP 1A02N 4LHUA 4Z7UF 4JRXB 2H9GA 2BJML 4JO8A 2Q87A 1M71B 3LSOA 4I3GA 2VQ1B 1JP5A 1ZANL 3G08B 3ROLB 2RIKA 3E38A 5FECB 4P23B 3WXWH 2G75B 1U95B 2OZ4L 1Q0YH 1ML0A 5HYIA 5I0DA 3T2PA 5IBTL 3N1GC 3TEXA 4X7DC 1AGFA 4YHZH 5EBWA 4N5UA 1EH9A 1XF3B 5T3XD 4P8QA 2BHFA 3SDAA 1BOGA 1X5LA 4HWBA 2OL3H 4WO4A 4M4RA 3SPJA 5HYFA 3HG1E 4ODSH 4JS7A 2ICCA 3F58L 4OD1L 1V7NH 2GITB 1CK0L 1WLHA 5K9OA 2P80A 2PPAA 4G80A 1DJYA 3NCYS 2O5ZL 3F04A 4MD5B 1UKQA 4CN4A 2FX8L 5T1DL 1OGSA 2FATH 1HL8A 1YYLL 3NRPA 4ZYKB 4IMKC 4CW1A 3VGHA 1BFVL 2WXQA 3B2XA 3OKKA 1C5DB 2VLRA 4M93C 4B9JA 1DL7L 4Z76A 1XVSA 2O5YL 4NUMA 4CKVX 3O9WC 2ZUTA 3ZMRA 2C3VA 1FC2D 2OMWA 1SJHA 4GW1A 1OZUA 3NBNA 1B4LA 1G7HA 4IRSC 2K8MA 3VGBA 4M5TA 1EZVX 4X9HA 1Y6KR 8CGTA 2WYHA 1QRNE 3B7YA 4IMLB 1XF1A 4BWWA 1AG6A 4G7VL 4YSPA 4DVBB 2EEXA 1L9PA 2H0EA 2ATPB 4DN4H 4OTXL 1M7UA 2ITEA 3CDZA 4P4KD 3MRIA 4TQHA 1MVYA 1W6WA 2C4FU 4W9IC 1JZ2A 2XXMB 2ARJA 2WAHA 3QQ4A 1NGZA 4MMYA 5TFSH 3N0PB 3TZVD 4H13C 3WKPA 2RFXA 4FFYH 1HOCA 1IGTA 1W8NA 4I9XA 2Z1PA 4L3EB 4I3SH 4TULL 4CJ1A 4H0HB 5FUOH 4J6IA 1A7OH 3IN0A 5C97A 3FFCA 2V9RA 3CNKA 2ALWA 4W68A 1JYNA 3LH9A 4FQLL 3N40F 2K7QA 2NY6D 4MNGB 1MCPH 5L7XL 4ZX6A 2ETWA 3C6SB 1EJ6A 3BQUA 4L37B 4HWZB 1I3UA 5IHUL 4GQ9H 3MA7A 3UTOA 4N2MA 4B9ZA 1DQIA 1JNJA 5E9DD 1KFAL 5GGQH 1NMBH 1N64L 2WBJD 3RRQA 1NLDL 1JHKH 5JW5A 3U0PB 1SN5A 2ZF8A 1QQDB 3AGVA 3QC6X 3B1TA 3LOWA 4GMSH 1P5VA 3BVTA 1UACH 2G60H 4GSRA 5I30L 3EGSA 3LD8C 4OFPA 2B1HL 1F3RB 3MR9A 1WDAA 3T3MB 3LV3B 2YUXA 3ARGD 3R1GL 4PJ7B 4U4BA 4XXCA 1MREH 3SD2A 5T1LB 1URIA 3SPCA 4OCNC 5DUJA 4D9LL 2XTJD 5F0PB 4E9QA 2BVEA 4UZGA 2BIIA 4ZSOE 3VB9A 1S7TA 3ZL1A 2E86A 2VR7A 2VUOA 5IIEB 4ERSL 5DJXB 1T7YA 2O6CA 3ULVD 2X1OA 3L3KA 2YEVB 4QXTB 3ECBA 1P4IL 1P4LB 3H55A 3SGEI 1M1XB 3ULUF 1JPSL 2JI3A 3MU3A 5FM4A 3TWYA 5IB5B 4AITA 4XNMB 4AMKL 2HJLA 1KY7A 3E3QE 5CFHA 5EC1B 5HI3D 1LM8V 1F8TL 5C3TA 4DKFL 1JZ7A 3K4ZA 4BK8A 3VWJB 4FS0A 2BO0A 4ILDA 1FRGH 3MOBL 3VQMA 2Q7YA 1MCBA 3IRZA 3SQBA 1X7TA 2VR9A 1CGUA 4K3EL 3EJPA 3HA0A 4EOWL 4TVPD 3WGVB 2CCVA 3GEFA 4IK7A 1T0NB 4KUCD 3L81A 1VEOA 2C9PA 4HT1H 3BWUC 1U3JA 3NUKA 5F6HJ 3RFZA 2BSSB 2WVUA 3PV7A 2AK4B 3QP3A 5DTFA 3TH3T 5EU4B 3V4VB 4XHJD 3GS0A 4K5LA 1FFNA 1TTFA 2Z93A 5TQ2H 5EUOF 4Y2LA 4RFOL 2K78A 4YVNA 2MIZA 3CLWA 2NY3D 2G3NA 2CGYA 3APDA 5JO5B 5EHFA 4Z8FL 4KRPD 1ETB1 4J8RB 1JFQL 4Y1AB 4UV7H 3I50L 4J3SA 4QRUB 4K55A 3T4AA 4ALAC 2DJ4A 4JFED 2TSAA 3FO2B 1HE8A 4JAMB 1H15B 3IJSB 5ETUA 4PRDB 1HYRC 1FN4B 3CJJA 5DWPA 1MY7A 4GAGL 4JPIA 4Z7QF 2DOCA 3PHQB 1HTYA 4UB0L 1P4UA 5FYKE 1XWVA 2ICEB 4ONOA 3CXDL 3PQYE 2X1WL 2HKHL 3K81A 3UBXG 3EHBB 4LL9A 3D3VB 1CL7H 4R97B 4H8WC 3TH2T 3MLTA 3QJHB 3BPCA 3QEQB 2X0UA 1FL3B 1A6VH 2AK1H 4J4PA 4YDZA 3CWGA 4GW5A 3CFCH 4JFWA 1MJJA 2MRYA 3TBWB 3CFJA 5L6YH 1E6JH 1JZDC 5F6IC 1U4FA 1MFUA 5IG7A 2CM5A 1R3JA 4U6TA 4UANA 1U3ZA 4HIHA 2XI9A 3EJZC 4UT7H 3TU6A 4M1GL 1N6VA 3IDXH 5ANHA 1NFIA 3GJFB 2R83A 4NQCD 1A7PL 1W72H 3UAEA 4C56B 2ICES 5GS3A 2P26A 3FRPB 1T89A 4KGJA 4F8LA 2HJFB 3GRWA 1PZ5B 4S0HA 5MERA 2Y1YA 1AQMA 2DWDB 4WWKC 4BFOA 1N0XH 1UXMA 1XZ0A 2CLZB 2DPKA 3OB0K 5T5NF 5DZNA 3ZKQD 4E9XA 2XTSA 3G6JB 3FNKA 3LZOA 5EN2B 1KTCA 1R3IH 4NDMB 3MCLL 1JNNH 1Q9WA 2P3YA 2N7AA 3FPYA 4NAMA 4QF1A 1GOHA 4XCNB 1MWAB 2FJHB 4IRJA 4ZMXA 1U8LB 2DMKA 4PJ5E 3FSZA 4XPAH 5CSZA 1KBVA 2A6DA 3UG4A 1CFMA 4YE0A 3JWNC 5BUAA 4NQDA 3PGFH 3NFNA 1AZZC 4FFVD 2NY2B 4GUPB 4PRIE 4X9GA 5HDQL 2CXGA 1JK8B 4HLEA 2Q76B 4HH8A 4YSDA 2QTEA 4PRBB 5CWSA 1XMEB 4AVKA 1HEZB 3N43B 3EO0A 2X4OB 4BZ2L 1ZXKA 1IGJB 3FQYA 3O0LA 1XTMA 1X44A 4X4XA 1M56B 4TSAL 3FCSA 4X83A 2V5TA 5D7IE 3VXRB 1P5UA 1U6AH 3KL0A 3OLDA 4WW2A 5FV2A 2PW2B 5B4MD 2YA0A 1AP2B 1WP6A 4MCZB 2QHLA 2OTWA 4NJAL 4QHNB 3WUWA 2EYRA 2X4PB 1IARB 2D7TL 2Q9OA 2ZOKB 3D25A 1AQKH 1IM3A 4XAWL 4JQVC 2OMZA 3NEXA 4KVCL 4X6CE 3QXAA 4LKCB 4JDVA 4U1HB 4JRLA 4NYLB 3LAFA 3E9UA 4K23H 4K7PL 5GJTL 1MJUL 1N0LA 1UURA 1W8EA 2Q7AA 1WCQA 2HTKD 1ZSDA 4TUOB 4FQ1H 4JZJC 2DEWX 1XSIA 2PO6D 2CUAA 3EFOB 3FJTA 5JDJA 4ES8A 2BZDA 4JRFA 1S7SB 3MV11 4BFNA 3CHSA 4UNUA 4MVBC 3OAUL 4C57C 5LQBL 4PGBB 1DLFH 2AITA 3JXAA 4HDIA 5F2FA 2M83A 2C9QA 4DKEL 1WFJA 4L4JA 3ILQD 3QUYB 5F3BA 2NY1B 2ORBH 2BW4A 3GS7A 3LKNA 3W5MA 1CBVH 5FO8A 2FWLB 2COQA 3U0WL 4JFFA 2ZCZA 1N10A 3V0IA 1MUJA 2W07A 5ITBH 3LKQB 4D7BA 4AGQA 4HJUA 4EI5C 2WQRA 4BFBD 3QIUC 4A2GA 1SHMA 5JOPD 5D9SA 1JGDA 3T6XA 3O0RL 1I1AC 4JDEA 4NO0D 2CM6A 4PBDA 4XNQA 3VFWB 4AXWB 1JGEB 2GIXA 3BP4B 4AEHH 3EYOB 3Q6FA 3HG3A 1FVEB 4OLWL 1LK2A 3RX9A 4PJEE 1HCVA 2D2CC 2AI0H 4RIRA 2JKIS 3OAYH 4JCLA 4FXGC 2ICWJ 4HWUA 4PLNC 5LGJA 4QTHB 3H85A 2IH3B 1AHWC 2P8MA 3VGAC 1NLBH 5EU5A 1QBBA 3IMUA 3UZVB 3DBSA 2NSMA 2HT2C 4AY0A 4JM2D 5FCUH 5DA0B 4HPYL 3DJZA 3QZNA 5DK2A 4H8WL 2XWBA 2CPUA 5C0GA 3EJUA 2E74C 2JCCB 3BO8B 4Z0BL 2YD9A 3NSDA 3WFZA 1QFWI 4HJGA 4ZMAT 2DQGH 2EDBA 4Z3IA 4AYGA 2W80C 4X5QA 3CVIH 4HSCX 3MOQA 5A2KH 1XCQB 2V2WB 2W60A 3R06B 3TJPA 4DQOL 4PJFF 4AVIA 1NAMA 3FQRA 1S6NA 4F7TB 3G3LA 4S0TD 1GXEA 2NXZB 3MJ9L 3MRBA 2ITCA 2OYPA 3LPWA 1NCGA 4HC1A 3V5KA 4ZNCD 5MEOA 2DF3A 2NY6B 3OKMB 1NDMA 5G2NA 4YDKH 2ESVE 5D1XE 5ABDE 3QQDB 1HNFA 3DV6B 2EEFA 2XIBA 3DWTA 2JKWA 3WG7B 3O6KL 4POZD 2YAQA 4LLUB 3RE0A 3UG3A 1OPOA 1WYJA 5E9DB 4CVXA 4I5BB 1DVZA 4PJGA 1C1EH 1DJXA 4PBWD 2EVFA 4LRNH 3V0FA 2HFTA 2WBJB 1AZRA 1GZQA 2OX5B 4F27A 5BVJB 2VE6A 1FFQA 3KPPA 4MZ3A 5GJSH 3OKOA 4LQ1A 4JUTA 3T2LA 3IGFA 3IU3A 4PJBA 3TBYA 2VXSH 4U1IB 2PYFA 4NB7A 4FQXA 2CK0H 2UZYB 1KG0B 5DD1H 3RGVA 3ARGB 4D94A 1S7WB 1UWXH 2RTTA 2GJ6E 1E28B 4R2GC 1TVDA 2CBPA 1FCCA 4PB0L 5B1JA 1WSST 2EO9A 5A2JH 4OCXL 3V6FA 1RPKA 3QDGD 4ENEC 1WZKA 3V4VH 1XD0A 4ANKA 4LL4A 5JR1L 5DF0A 3FU9A 1BEYL 3K5SA 1KLGA 2XV0A 3CV5A 2PF6A 3P9MA 4L1HA 4XVUD 3MRMB 3CSFA 4P57B 1GGCL 5DFVD 4AW4A 3BH8A 4IOIA 3GWJA 5ESAB 3Q2VA 2LT9A 3D33A 4R7DA 5EF0A 4HOWA 2Z31B 2AAAA 2OM5A 2ZJSH 3QIBC 4N86A 1AYOA 1VIWA 4K94L 3PNRB 5D7LD 1J9QA 1NCIA 4Z7OF 3W11C 1ZGLA 4M7KL 2QV4A 4CBPA 1ZVHA 5HHNA 3VFVB 3DHUA 3QCTH 4OY9A 5HTSA 5I24A 3ULUD 2NOYA 3GC3A 1C5CL 2BNRD 2PCYA 1MDAA 1SQMA 1UUSA 1URZA 3T0EC 4K3DL 2NY5H 1XF4B 4ZX4A 2VZVA 4HX1B 1PZUB 2F7OA 2MOGA 1YN6A 2KQNA 4PV8B 3CDFA 5EIIG 4AM0A 1WT5A 3DROA 2W59A 1A47A 2NPLX 2UY7B 4I8DA 4QI3A 5ESQB 3KPRD 1RV6X 4L3EE 4XP1H 3VQLA 3QJSB 5FUCC 2ED8A 2NT1A 2NY3B 32C2B 3WNJA 4HIIA 5AB2A 2FIKB 2VDRB 1SOSA 3BAWA 3EG9A 1I4FA 1OK8A 1DVQA 1MCNA 4R4BA 1EZLA 3DTDA 3GJFH 4G1MB 4YSQA 4GG6B 4J6RH 5D70L 4X6EA 4MNGE 1Y18B 4FFTA 5FO7A 3HE7C 5ALCH 5IMOB 5F7LB 3NIDF 4JFEB 1NCWH 1J8HD 1JGUL 4PSRA 3VGGA 2IADA 3LKRB 3X13B 3KW8A 4N5ED 4YDNA 1FDLL 1G1YA 2IOOA 3FZUD 3S4SB 2Z3FA 2Z92A 1E5UI 3KPOA 1UJ3A 5IUSA 4YHIA 1B3IA 1IO4C 4KI5C 5C0RL 2YAOA 5CP3H 5DZPA 2OTPA 3R8BB 4CN1A 4C47A 3T4YB 4DZBA 2ZUUA 3VMNA 4R7NA 4Y19D 3BSGA 5ALBL 1JWUB 5T3ZL 4Z9KB 3NCFB 1MWAH 1R46A 2D03L 5FFLA 3U7WH 3OZKA 2FYVA 4TOYL 1ET8A 4FQJL 1CXHA 2QGCA 3LB6D 4X0NA 3WY1A 3L3JB 3T3ME 5BPPA 2EE9A 4YNYB 3DETC 5HD8C 2FBJL 3K0WA 3WNNA 4L8SC 3RWCB 3JUZA 1SN0A 4A04A 4CGTA 2HLAB 3STLA 5I6MA 4K8RL 4RZCB 1WRFA 4UILH 3FBQA 3GIZH 3BKYH 4KZ0A 3ATEA 1G9NC 4ODUA 4NQCB 5IMLA 2MPVA 2W5PA 4FI7A 2EVIA 4PYGA 1G6RA 4XNZC 3MUY1 5E5UB 1GIGL 3BDXA 3HG0A 3ZDYB 4XCCL 3V5DA 5E8DL 3H9YA 4IKJA 5ID1B 3OTTA 3Q8CA 2F7PA 2ENJA 5I1IL 5IT2L 3MRGB 3NH7L 1OPGL 4EUPB 4A6YL 1W2KT 2C9VA 3CZUB 1SHSA 2I69A 4J39A 4X9FA 3K5RA 1CD1B 3HG1A 5FGRA 1BVZA 4LOUD 4OUOA 1JG9A 2ZAIA 1CICB 2P5WE 1JFHA 2EXWC 3QULB 3CFDA 2XKUA 3HI1A 4HMCA 3ROOB 3WJMB 4NOBA 4P04A 5C9JA 1OWRM 4L0YA 1ZLUK 4F5CE 1R6VA 5BZWB 3LTVA 4P4RB 3N9GL 2UV3A 3PFUA 3V7MA 4RRPA 3NSXA 1UCBL 1AR1C 1AGCB 2J20A 3BEVA 4JL1A 3IFOA 4L1LA 1NCOA 2MHAA 1KGWA 1F45A 3GMQB 4UOQA 5I8EA 4Y4HB 2AK4E 2CHZA 4TN9A 2XY1A 3CHRA 4WHTA 1WZ1H 1QWNA 2UXGA 4Q4EA 1X7QA 3WHE1 4YHNB 4HFWA 2IFGA 1EHLL 4G6MH 1S9VB 3BT2L 1RIUH 4R0LA 3H3PL 4H1LB 3EDEA 4JO5A 4UI2A 5GGSA 4HKXB 3OAZH 5T3XH 2RCSH 1L9SA 1BFOB 2AERT 4M02A 2EXTA 1GYCA 2DD8L 4Y1AE 4FFZA 4I2XB 3ESOA 3ARVA 4W9JC 3RWEA 3BESR 4OFYA 3S37X 1GMIA 5D4QA 1JI2A 5JORA 4L0PB 1NPUA 2DQTH 2GJPA 3MV7A 3TEWA 4Y1SA 4R4ND 3I6KA 4YHOH 1VA9A 2J57A 1GR7A 4LRIC 4XCFL 3B7TA 2Q1EA 2L0DA 3BCFA 3DXAB 4XI5D 1JTTA 2ADGA 2AXGA 2PO6B 1AGEA 2NTFA 2R69L 4FNTA 1KEML 2FJFB 2CJUH 4G1EB 3QEQE 4S1SL 4NN7B 2ZAHA 3QORA 1XBDA 3VDCA 2WINB 1BBDH 3QZPA 1XF2A 5I75B 4N24A 4NFCA 4PQXA 5LG6A 4ZFFB 4JKNA 1GS8A 4Z3JA 2A83A 4WZ9A 1C9SA 3MN8A 3WL9B 2DTSA 4UV4L 1JPGA 1OAQH 2SEBA 4EIUA 3P4OB 4ODTL 3WJLC 3RTQC 1EJOL 3N1QC 4XZ4A 4OLXH 4UT6H 2PABA 1DCEA 2F15A 4Z7UB 2VDKB 4NN5B 2R0LL 1UZ8B 4NPYB 4NO0B 5GGRY 2QSQA 1N9PA 2YPLD 2G9HA 4OZHF 3VFMA 1UD5A 1KGXA 5GGRB 5IHBA 3ARBD 1F3DJ 2JELH 1BMWA 3F7VB 3SDCA 3PGCA 4UM9A 2FTAA 3LJ3A 4GINA 2A6KA 4MS8C 3NSJA 1E4XH 1NEZA 3QT2A 3G6JE 15C8L 2B9BA 2TSBA 3CIQA 3HS0B 5ID0A 5DK0A 1BSIA 1FG2B 3O11B 3LS5H 3MXWL 5E1GA 4OT1H 2W9LA 3M88A 1OW0A 2H41A 1MFNA 3WXVH 4P48A 2BP8A 2AXWA 4YWGH 4LDOB 4NNXA 2IAND 1DDHA 2WXGA 1I9RL 3OZ9L 3QQ9D 3HZKB 5JLZA 1QOKA 4HALA 4OBSA 4FA7B 4U0RC 1BW8A 2IMNA 3RVUC 5GGTA 3HC0A 1QUNA 3C6LC 1ACYL 1RVFH 3GJEA 2N56A 5DSCA 4DP7X 5FDWA 4HHAB 2QVFB 1R5WA 1HCYA 1VFBB 2QPEB 3DOSA 5TDOB 1OAKL 5INCA 5ICYB 3ZUCA 2BY0A 3HI5L 4A2FA 1TTRA 4P2AA 3K6OA 4MJHA 4FF9A 1EXUB 2MQCA 1Z5LB 4KAQL 1ZA6B 1IM9A 3P0VH 1RZ7L 3SO3C 3ZR5A 4EKXA 1NUFA 3BGFB 3CHPA 4HFUH 5FYJL 2EYTA 3ZQXA 2CE6A 5C0JA 1G9NL 4XPTL 2WXJA 3OAWA 3UCQA 1MG3C 1EUUA 3T0BA 1MFEL 4FCAA 4H2CA 5DJZB 1XGQB 3GK8H 4N85A 4N2AA 1SUJA 2OL3A 4GO8A 3HR5A 4LCIL 3SSGA 3TIDB 3X12A 4D3CH 4TTGA 2G3ZA 5JHLL 2YD2A 1BAFL 3H9ZA 4HXAH 4NQVA 5E2UL 1HX0A 4OLZH 3P9LA 2ZYHA 2WSDA 3QSKB 4XPGL 3GSVB 2GT9B 1I1YA 5AALA 1FNEA 3VFTB 1U8HB 4D8PA 3N41F 3BN3B 3SY0B 1JVLA 3TIEA 3J7HA 2XTLA 3QR2A 4BINA 5IQMA 2JKJA 2ZKWA 1ROCA 4F7MB 3FTXA 2J12B 1P53A 1YY9D 3IFNH 4PRHD 3MNZA 2A1WL 4WEUD 2NZ9D 4O2FA 4PD4J 1CFSB 4X80H 4J2XA 1CT8A 3G5ZA 3T09A 4KV5E 4XH2A 5D7SL 1V3KA 1G0YR 3NCJH 4FXTA 3SGDH 1EXHA 3PQYA 4N2EA 1CE6B 1DEDA 1WWBX 5F21B 4KZEH 5T3XE 1QX1A 1ETA1 5IQNA 3QDGB 4IOSD 2NYKA 4MJ6B 3G5VA 4D0DA 4WI9A 4FFYA 1BZ9A 3T1WA 1N5YH 1FC1A 3VRIB 4UDTB 1G84A 2NT0A 5KG9A 3PL6D 4L3CA 4LNRA 4R83A 5FKPA 1OAYL 2GTQA 2VDRH 5EBMB 3ULSA 4E5XG 1VRSA 2PCFA 3LIZA 3UTSD 3BX7C 1OKEA 1QI4A 5CJBA 4LLMB 2B39A 1MAML 4APQD 2BMKA 5D7LB 4XBEL 4YSTA 2NXYD 1NKGA 4ZMVA 5KOVC 4M5ZH 4U49A 3U82B 4PGDB 1CZ8H 1ZRUA 5EMYA 1S3RA 4B41A 3V4PL 4EVNA 1TTGA 4QUOA 3ML9A 3G7TA 1U3HC 1SBSH 3GKWH 3BZ4A 4WSJA 2BNQD 2HFFB 5KSBE 2FHBA 2GEQA 1I7ZA 8FABB 4KTDH 4GQZA 4UIMB 3FB6B 3MGTA 4XNYL 4BV1A 1CDJA 1KJ2L 5JA9A 1KGJA 3TWCL 2GSGB 4P3CH 3KL5A 2EDOA 3LQAC 3Q2NA 4JFYB 4OF8A 4QRQA 1TDQA 1JD9A 1A3RH 3WNIA 2IC2A 4ANWA 1I8KB 4OV5B 5IMKA 2JI1A 3H9SA 3X3GL 2P4AB 4MJ5A 4P05A 5AVRB 4PJ5A 4JN1L 2ZXAA 3UO1H 1Q94B 2AJYH 5E0QA 1SNRA 5CKAA 2ZSWA 1KN4H 4X7CC 2HB0A 3PUUA 4NNPH 4LLVA 4LCCA 4Y5VA 2V7NA 5JDSB 2ZE0A 5EEWA 3CMGA 2VDQB 5SX4I 3S2CA 2X70B 3QZWA 5BQDA 3BPLC 3WNMA 5L88L 3O2VH 4PV9A 3TO2A 3QFDA 2D3VA 2VDNB 1E4KC 4BCZA 3ISYA 4OJEH 1QSZA 1J8HB 1FE8H 1M2OA 3P0YL 3QCUL 3W9DA 5AENA 5EUOB 3K72B 2EVGA 5GRXG 5GSRA 1ZS8B 1JNLL 1TQVA 3D30A 1RZGA 2A9MH 4GAYA 5D7IA 3RVTC 3ES6A 2VABB 5E9DE 2XN2A 3GSQA 5C08D 4EUPH 1BLNA 4Z7IA 4LPVA 3QUXA 4P9HH 1CBJA 2VKWA 1ZMYA 2AKRA 4GB9A 1R5IB 4Y19B 4ZAKB 1KBGH 2ZUSA 1ZLEA 4H4NA 5EU3A 2R29L 4XXWC 3AAZB 3DX7A 1FWXA 4A2DA 4M8RA 4AENB 5FW7A 4M7LH 2CKNA 4FULA 2GUOB 3MBEC 3IJ8A 4M43L 3MV8D 3DSFH 4YOKA 3S5LA 1KXQE 4Z7QB 3D52A 4HUCA 5I23A 3FQXA 4XX1G 4QO1A 4DAGH 4IRZL 2XTJE 1BM3L 3LRSB 5HYJD 4MA1B 4WHDA 3ORJA 4WEBH 3LEYH 4JHUA 1E9OA 3I9GH 3ULVE 3N6YA 3T8MA 4PJ6A 1PW3A 1HT6A 3VFGL 2HVBA 1OEZW 4ZFOL 4UQEA 1FI8C 1LO5A 1J8KA 2MFNA 1XL6A 1NCAL 1U91B 4H1LH 1DUZB 4GPVA 1W0YT 1Z5HA 3M1BA 3ARFC 4LIQH 1EDYA 2DTMH 1OARH 4JFQB 4A39A 1RUAL 5A2AA 5E6IA 1L9OA 1U8NB 1Q9LA 2HA1A 5F9OH 3EOTH 1FF5A 3GNML 3L54A 5JW3H 3FB8A 3IKCB 1U92B 1KENL 3KYOB 2AQQA 2DBJA 2ZCLH 3TBTB 1ZLVK 4TVPE 4PLKD 5EG6C 1PBYA 2ZSVB 4M48L 4N1CA 4PJEA 2VITB 2DLGA 2FUQA 3CFBB 3MGOB 2OZNA 5F7UA 5KTEL 3RVXC 1JF6A 1ZE3H 2Z91A 2W88A 3BQVA 3HHSB 4PP2A 3MNWA 5DD0H 3SKJH 3V4UL 4TQIA 5KSVA 5DJYB 3K80A 5HBBA 4PJHF 1MRDH 3P11L 4LCUA 4B95C 2Y5TA 3WTTA 4DO6A 2H6PA 3CFNA 5BS0B 1BMZA 3SYPA 2G0LA 1RJYB 5D1QC 2FWOB 1WITA 2HLFD 4B5EA 2DM7A 4DGVH 4D0BB 3FT2A 3ZPDA 3QISA 3WLBB 4HD9A 4GG6E 4XPFH 2VDKH 3FQNA 4UQBA 3AG1B 3KLAA 1U8CA 4JFEE 4MJID 1QNZH 2L7UA 4DZ8B 3MC0A 3TO4A 1GS7A 4KUZL 3KZ8A 4KO5A 5MEPA 4HBQA 3FT4A 1UD8A 2IV9A 4MMXB 3NGBB 1FL6A 1IQDB 1UD2A 4FZEH 3FCBA 2FL5A 1NAKH 5B3SB 4LDLB 3K3QA 1C7TA 2GY5A 3L7EA 2FJGA 2ESVA 3V95A 5D1XA 5J0BA 1JZHA 3V5HB 3IJEB 5FWQA 1FV1B 3BZFA 4MHHG 1MPAL 2ODHA 2CIKB 1Z3GL 5DT1H 1NBQA 4HG4J 2XKSA 2XJKA 3BLKA 1FZMA 4JKKA 4LFHG 1ZV9A 3ZMEA 4FQIH 5BXFA 4QRPD 4KMTL 4QWWC 5J13B 5CJXA 1FNHA 3OXRB 1R4XA 1ZTXH 3LXUX 43C9A 4NQCE 1G1CA 5GGUB 1EZUA 1M71A 7PCYA 3DTUB 1YEKH 1LEKB 3G08A 3F5WB 4ODBD 3ZDYE 3ARBB 2OMNA 3RL1B 4J3TA 4AG4H 4KGLA 3LIUA 3ZL4H 2GJ6A 2VR5A 1P7KA 2E8YA 3CE1A 3A3YB 5HGAA 3O2DH 4Q9QL 1PQZA 1RCYA 2CA3A 2ADJB 4RFEB 4TVUA 1U8OB 1PVHA 3TA3C 2A73B 2IJ0C 5C0IB 4AYSA 2A3TA 1RIHH 1U8QB 3LKPB 3OHXB 3WDHA 1KGUA 4A7GA 2KC0A 1TQBC 5DZLA 2AQ1A 3VQ2C 1AI1H 2WNXA 5D1ZD 4WV1C 2VQTA 2D3NA 4G71B 2IANB 2BZ7A 4O2CB 5TE7L 4MRBA 4FHJA 5L4IA 3T6QC 4DUVA 1P0SE 4XE0A 5CEZD 3UJTL 1Z5YD 5AAMA 4FL4C 4YZFF 5GISL 4NOFA 1QFOA 2ATKA 3SDDA 1E9PA 4PY8I 3WEOA 3NRQA 1NC4B 5IJVB 3ZYJA 3IXTA 2VC2L 4V1DB 4GBXA 4BSVA 1J9TA 1TO5A 3H8NA 4DVBA 4RGND 2AZUA 3AWFA 3WD5H 5LBSL 4GXUN 3B56A 3D12B 1NL0L 1BCIA 1AZBA 4P5SA 4F15B 3FT3A 5F71A 3FTZA 6PCYA 3TFKD 2OV0A 2WTRA 5E70A 4P2QD 2XV3A 4D0CA 3VW3H 3WSQL 1DVUA 1M7DA 5JW4N 3U36B 3LHPL 4XXDB 1HEJC 2ZCHL 3KWWB 3OJMB 4ZW8A 3ZYZA 4BA0A 4GKSB 3ARXA 4L3EA 4WO4C 4MAYB 2F0CA 3LNGA 5FK9B 4HLJA 1HH6B 5AVWB 5JTWA 4M3KB 2P49B 3HMXA 1L5GB 4HBCH 2NUTA 4OF3A 4PJFB 3X1BA 2GKIA 3TBSA 1IB5A 4WTZA 2FE0A 2ROYA 3FMGL 1AHKA 4GO6B 4ZW5A 4AQOA 3CU1A 2ITDB 3QH3B 4YFLF 5J89A 4AV0A 2YJLA 4DW2H 4ISVA 3ASWA 2V8MA 4YC2C 4MNHA 2ICEC 2HT4C 4U1NB 4K9EL 4YPGB 1HC1A 4L37A 3U7AA 3QXVA 4IBLT 1W0WB 4N8PA 3ULUH 1CLZL 4OCRH 3KYMB 4FC3E 1BIIB 5IROA 4PRHB 3W2DH 2P44B 5SV3A 2J5LC 4I0KA 3S5ZA 4Z7AA 5E6UB 2R2BB 1YAIA 3S6CA 5SWSD 2O61A 4NKOB 2CRZA 2YPVH 1QQDA 1T4KB 3TCXA 2BIPA 4Z7UE 3P54A 1P1ZA 5JOPE 2V3FA 2PP9A 3KYNB 4LSPH 4MB5A 3C5JB 3NA4A 3LV3A 3PL6B 2DIAA 3LNHA 1DQKA 1XIWD 1MCKA 4MQXD 4G9DA 1JUFA 4XO3A 3ZTEA 1QMUA 1TITA 4UIKH 4AT6A 4I77H 5IIEA 5HYSB 1XGRB 2VDQH 2MJWA 3Q6GL 4RQQA 5DJXA 2X4SB 5B8CA 2VDNH 1UFGA 3IJYB 5G4NA 2IH8A 3IDIA 1DJHA 4QAMB 1SEBB 1ZDQA 2W9EL 1P4LA 3PXLA 2V2XA 3JT2A 2BY2A 2EC9T 1A7QH 1M1XA 2Z4QB 4XP4L 2H2SD 3DX6B 2I26N 2BNQB 1YPZF 4XNMA 1JRHI 3WMSA 1MELA 3VI4E 2X28A 3NRFA 3A6CH 1IC1A 1CLOL 2GFBB 5H37G 3U30C 4P5KB 3O41B 5DFWH 1XB3A 3ARDA 4WK2B 3UG5A 3IXAA 4Z7OB 2E6PA 1D5RA 5B3JE 4CAGA 3UMNA 3EYSL 5DGRA 2OXHB 1I3VA 2GK2A 5K9JL 1DBML 2P5WA 5E1QA 3F85A 1KPVA 3WLWC 4F5CA 1E27B 4Z78A 4NQSB 4PJCF 3EH5B 5GGVY 1T0NA 2OS7A 3BH9B 3EOBB 4GLRI 4X6DA 4XXCC 4JG0L 1A2YB 6FABH 1EHAA 1S9WB 4Y4FC 1FVCA 1T20B 2BSSA 4ECNA 2AK4A 2B1AH 3DVFA 1F41A 3LS4L 2X1PA 3LZLA 3CU7A 2KBGA 4YQXL 1QTPA 2HJKA 2EP6A 5EU4A 3V4VA 5HHXH 4JKMA 3TVMA 3BDBA 3ZSTA 3LKOA 1DR9A 1ONQB 2H1PH 1ZK9A 4OSUL 4A2EA 3KLSA 4LF3B 4FQHB 4H25B 5JIDA 5C08B 3WMPA 4GG8A 5JO5A 2OQJA 1HDMA 3BP7A 3HEIB 4CVZA 2XPGA 2WBXA 4XC3H 4J8RA 4UOJA 5A16B 5DGQA 4G7QB 2CLVA 5J1TC 1YEHH 1CJYA 3R8QA 2GBTA 5HHPB 2R4SL 3NIDB 3PAZA 1XGPB 1FN4A 3FKUS 5FFGA 1ZHKB 3AT8A 2WLKA 2V6HA 5L0QB 4OGAD 1Y1DA 4TVSa 4X5XB 2YWYA 2GW5A 3MJ6A 4L23A 4PGJA 5F7MC 4YXHH 9CGTA 4YN3A 2NY1C 4ODXB 4FZ8H 3QDGE 1AQDB 5D7JA 3IEAA 3QEQA 2DEYX 1FL3A 3WUZA 1SDAB 2YD3A 3HI6H 4NN6B 1H6UA 3ZK0A 5C6TL 4YLCA 3TBWA 4K15A 4XVSL 4BSWA 5EULV 3GHBH 2CDEB 4X5WA 3VI3F 1PJ9A 5DWUL 3BAEL 1PLAA 5F7KC 4FAAB 5SX5H 3GXNA 5D7LE 3DC0A 3VFPA 4PH8A 5DJ2A 2MNUA 5I82A 3IK2A 1UFUA 4PWIA 3NTCH 4N0UA 3T4AC 3UC0H 3L1OL 2VN6A 3ME0B 4LVHC 1YHPA 2DWDA 3ULUE 2N3JA 2AABH 4KNSA 2BNRE 1I3RB 4DPCX 4ANUA 2DWTA 4G5ZH 4FG0A 3MSPA 2X1XR 1A64A 3G6JA 1QASA 1IEAB 2WKOF 5CP3A 5C09B 4FNRA 1UZ6F 2ZOWA 4AL8H 4NDMA 1XT5A 4NBYB 3KPRE 2BVUA 4Q8BA 1MFDH 1MWAA 4YDVB 5E00B 1FA4A 4XVTL 4J1UB 1PAZA 1U8LA 3SKMA 4JO1H 1TUPA 3POHA 1CDIA 1MN4A 2ZNWA 3NCXA 3IKKA 1LO4H 2GHZA 5E1HB 4Y4KA 5GS2H 4PW4A 4PHZA 4XCYA 2WLIA 1FPTL 2AGJH 2XICA 4LSUH 1K4DB 2ZKXA 1D5ZB 2F5AL 1AXTL 2IIJA 1PX4A 1UWEH 3FSAA 3QUGA 2H32A 5AW0B 4M6OL 2HFEB 3UPRA 4UT9H 4MJIB 1IGJA 3L4CA 4UTBA 4HCFA 4YSAA 5EUOE 3JSSA 4M7LT 1T89C 3L2NA 1JF1B 1OCZB 2X2IA 3MNMA 3ZXAC 3WI9A 5I15L 2F74B 1T1XB 1H5BA 4LHQB 2ZWLT 5HDRA 4XMKH 1IIIA 1OHZA 1BJ8A 1WFOA 1X5GA 2VKXA 4GIAA 4MCZA 3VYNA 1BPLB 5CHNA 4HKBA 3RDTA 1CF8L 2F8IA 5GZNC 4HXBL 4LGSB 1IAKA 3D39A 1FYTA 2Y7QB 3HRZB 4IRJC 1GAFL 4Z7QE 3F7RA 5DUPL 4PD4K 2J44A 1BVNT 5B39A 1MQKH 1CFVH 2AEQL 5LO7A 4I89A 4QRPB 5JIKA 2NNAB 3EF7A 3VD2A 1S7SA 3MBWB 1HQ4A 5ICZA 1KJVA 1CFQB 3O4OB 3S37L 3JWDL 2XFGB 3SD5A 3Q8EA 1JYVA 4QYOA 3B2PA 2HFGL 2IXQA 2Q2EB 2ZG2A 3WMQA 4FG2A 5ACZB 2DWEB 5F7WC 3MRCA 5B21A 4IBVA 1TETL 5HJ3A 1BGXH 2QHRH 4ZTOL 2H2PD 1XBRA 2J6EL 3BJLA 3BDYH 2Z8SA 3CZKA 2ADIB 3LKQA 2BM3A 3WHE0 5BOPA 2QR0A 1F58L 4M1DL 4PJIF 3VFWA 4AH2A 4BXSV 1KTRL 4ODHL 3CGTA 5BO1H 3NEEA 4OZHB 1YEDB 3EYOA 1QSFB 5EDXA 2DQFB 1J0IA 4N0CC 3AACA 5INDA 4PG2A 3RL2A 4GO9A 1HE7A 4O9HH 4WFGD 1O75A 3L4WA 5EZPA 4LEXL 2VJXA 4HEPG 2YK1H 1V7MH 5CJQL 2XACC 2ZONA 4RMQA 3VWKB 5F1IA 2JJVA 3UZVA 3EGXA 5KSBA 3OKEB 2FECL 4RGNB 5I1CL 2YHGA 5GIRB 1K85A 1WBZB 1JZIA 1MIMH 1KJMA 5KYXA 4KMLB 4MDJB 1RK1B 2YRBA 4P4KA 4WTWA 2FGWL 3GMLB 2PPEA 2ED9A 3BO8A 4OQTH 1H3TA 2P24B 2CJTA 4KDVA 4JK0D 3H6JA 2BSDA 2WLMA 3TZVA 5EDSA 4PU2A 4I87A 5KYWB 3LZQA 5BUPA 5K59E 3NJGA 4YFDB 2V2WA 4AGOA 3R06A 3OJDA 3WS3B 4QRSA 3E0GA 1JZ5A 2WZ0A 1QFWM 1B4RA 4RNRA 2YFOA 4QRAA 3SOBL 4AK2A 2OR9H 5TF1L 4X9YA 2DQDH 1XGYL 2C9UA 3INUH 4Y2DB 4PBXA 4NKIH 1LXMA 4KH9A 5AAWA 1CB4A 1N5AB 3L5XL 5GS0D 2CO7B 3CN0A 4JDZB 1U58A 1A1OB 1G1KA 5DJDB 4KNQA 5JNYB 5JHDD 1OAUH 5AG9A 4NO5A 3DV6A 5DRXB 5CN2A 4X8GA 3P4NA 1ZGLM 1EEZB 5E9DA 3HAEG 2X4QA 4KHTL 1P7BA 4XOCA 2G5BA 4IS6B 4NI3A 3ZYIA 3RGHA 5SWSB 5D71L 3X11B 5GXBB 2OX5A 1UXSB 4IIZA 4PS4L 4XP6L 2M26A 3NIGF 2FSEA 5IUCA 1RZFH 3THML 3W9EB 3BCDA 1GVIA 2LAGB 1Q38A 5BVPL 3N41B 4OGXL 4K3GA 2JQAA 2YPLE 4F57L 5FFOA 1V55B 1X5XA 4OGYH 4NQTA 3WNPA 2BRRH 2R0KL 1KXQA 1E28A 3B5HA 5KVGH 4BQCA 3ABMB 1EHKB 3UJJH 1SJVA 2PWGA 4DERA 2QEJA 3UDWA 1D5XA 2Y22A 1EK3A 2IQAB 4OFDA 1MZZA 2UWEE 2XZQL 1F1GA 5HDLA 5E4EB 4DNLA 5I1DA 2EDLA 1T66D 3MRFB 4MTMA 3TYGL 2E5EA 4YHYB 1ZIAA 4WI5A 4BFIB 3AVEA 2JTYA 3GRWL 2WXKA 4JFTA 2AJSL 2BVYA 1K2DB 1AE6H 3MRMA 4YZWA 4P57A 4Z3GA 2R9HD 4BE5A 3ZE1F 1A4CA 2IANE 4UTCA 3KLQA 3UPCA 5I1EL 4RA3A 3D2UB 3SGJA 1QG3A 1DBBH 4YFEA 3RZCB 1IC5L 4N2HA 3CCHA 1E4WL 2OPCA 3BIKB 5FAAA 2IG2H 1ULVA 3GMOB 5D6CA 4YE4H 1NWPA 2D7NA 4LOEA 2X4RB 2Y36H 1TVBB 2Q8BH 5F7BA 4HUXA 5A2IH 4TSCL 1EGJA 3QJTB 4JGMA 1GYWA 4JPWH 2VISA 4JM0A 4OJFH 4X2UA 5BCAA 1BVKA 3RGVC 1IKFL 3SODB 5HDWA 4O5LH 4JW3A 4PV8A 1TKWB 4AV4A 4ETYA 2P5PA 5B1JC 4EN3B 2B2XL 3U46A 3EO9H 5HGHB 4LQFL 5I1KH 5ESQA 3V52L 4Y16B 3QUZD 3A21A 4PGEB 2V17H 3J07A 4AX3A 2GTWA 1L9MA 1ZCRA 5EZOL 1LLAA 3D1MC 4AZUA 3RAJL 1ZIBA 3RWIA 3K2UL 1M2VB 4PJFE 4QNPE 3AABA 2BC4A 5MP6L 3DX4A 3CXHJ 2Q8AH 1EBPA 4MZRA 5BRZB 2VZTA 4N8VB 3ZZSA 1VGKB 4OI9A 4XZUB 2C3HA 1O9ZA 5GSVB 1BIHA 1OD9A 4G1MA 4YFLI 2DN7A 3RBGA 1NGYB 2HYMA 3IDYC 1KC5L 1NGWA 2DJSA 1T2JA 1TIUA 2XRAL 3Q8BA 4PB9L 1U8JB 1CTMA 4XCEB 1R3LB 1D6EA 2PMZA 1DFBL 4W1TA 1WA0X 1ED3A 2DQJL 2AJXL 5T5FH 3SEPA 1ZE3C 4C83A 3T0AA 4WHYH 5DLML 4PRHE 1XF5B 5EOCL 4JX0A 3MLYL 3PV6A 3ZTNL 4HG4K 4YMPA 1P7QD 5BMFL 2LU3A 3LPGA 4KKLC 2BSED 5AWNL 4PRNB 3HZ3A 3FONA 3TN0A 4RRPM 3E2HC 5EF2A 4R6UA 4FP8H 1VF5C 1E4JA 1FZJB 5E8OA 5JZ7D 1TZGH 3SE4A 1UM6L 3RWHA 3L3IB 3NN8A 1J0HA 3TBVA 3T6WA 3WY4A 2FBRA 3MRDA 1BECA 1HXKA 2KS0A 2PTTA 4Y5XB 3UTSE 3OQRA 1MLBB 1Y07A 1PY4A 2XWTB 2LVCA 4FOMA 1YQ2A 3RWCA 3VMOA 3MUHL 4HK0A 1TXKA 2PLTA 1UM5H 2AJUL 4XPBL 3BLPX 1UOVA 4RBPK 4G7YL 2PXYD 1H8NA 5KS9E 4Y2OA 1U8KA 4TQ8A 1NCNA 3KGTA 4HJ0C 5KVEH 1GC1L 3KDMA 3QUMB 1KPUA 1H8LA 1D5MB 3WO4B 4RMSA 3PHOA 1D5IL 2WWMD 2BWDA 1I7UB 3HS0C 5ECGA 3GM8A 3HNTH 1AZVA 2BNQE 4O2EA 1UM4H 4NKDA 4M7ZB 4PRAB 4EQ3A 1UJ3C 5F7EH 4EUPA 1MCWW 1J10A 1QBMH 1BZ7A 3ETSA 1T22B 5LGHL 2OJZH 4BK5A 3HPLA 1ACCA 5F3FA 3BWUF 4KJWD 3B6SB 4L4TA 4GKZB 5IEHA 3QULA 3WJMA 3ECUA 1KLUB 3O45B 4Z0XA 3HG5A 3SDYL 3BKCH 2OCFD 4F33A 4TNEA 1BVNP 5J1AB 1ET7A 2OI9B 4P4RA 5AOMA 5CGYC 3MCKB 3ZE0F 1CFNB 1TTBA 2KLTA 1OM3H 4OZIF 5CJ8A 5KVGE 2KYIA 2EO7A 3AFLA 4P2CG 3ZRFC 4PVMA 7CGTA 1QI3A 3RKPA 5F9JA 3EIFA 4FQ2L 4I3RH 4IIQB 4AQ8A 1JXGA 5AYUH 1D9KD 2OSXA 3OR6A 4YHNA 1W0VB 4PJHB 3QWOB 2G4EA 1YUHB 1RK7A 5AW2B 5GPRA 5D2NB 2HT3D 4OCYH 2B4CC 4HKXA 3JV6A 1U8IB 5C08E 2OP4L 4LMQE 4DGYL 3GSNB 4MA7L 4HC1L 4HJ1A 5J3HD 1FZOB 5E4IA 2DMBA 3LPPA 5MEQB 4ZFZA 1T7ZA 2R0WH 3QDJD 2W1NA 4GQRA 5B22A 4X7FC 1ZSHA 3DUHA 3IGLA 4PJ8C 3MV8E 2VDPL 3FRPG 2EEBA 4Z95H 4ADJA 4AC4A 2YWZA 2TRYA 4P2OB 4U6YB 5CEZH 4CADB 2PO6A 5HYJE 2QGEA 3CPUA 3T77A 4M1CC 2EIZB 3OXSA 2YBRB 5AEAA 2FJFA 2VDLB 3HFML 3BN9D 4G1EA 1ASQA 4LAQH 3DK0A 4LASH 2N0KA 5EA0L 2XZAH 2O1AA 1QO3A 2X4UB 3IWVA 5T1KA 1RZKL 4FG6D 4Z7VF 3LQZB 1H3VA 3DV4B 2EDXA 4K0OA 2VUKA 1PZSA 3A6OA 1HVXA 3LH8A 3O3AB 3WIFA 1ICTA 3VFRA 3BZEB 3DMMB 3VSQA 4G8EA 1F0LA 4YO0A 1QFWL 4Z7UA 3NZ8A 1O6SA 1WTGT 2VZUA 1WGOA 2F7IA 1HHKB 4KOBA 1FAIH 1BFTA 2VO5A 3OB0H 4HSAC 5GGRA 2JI2A 3ABGA 3L9RA 1F00I 3SBRA 4E41D 3CZFA 4PP1C 1T6WA 3ZKXC 1PY9A 1QI5A 5TK2A 4KKAC 2HPTA 2W9DH 3GXUB 3IS0X 2MNJB 4Y7OC 1H3UA 2RJMA 4HS3B 3FU8A 2DQHL 4WJG3 2JJTA 1DEEB 4LKXA 3D51A 2A99A 2CO3A 1FFPB 1KTBA 4R4FH 3V0WL 4E9LA 5EEXA 1JD7A 2CIIB 2A9CA 1D5BA 4JY6A 4FQCH 1JHLH 1Q0XH 3OZLA 3QIWA 4JM2A 3GSRA 4QLRA 3G5XB 4PJXF 4ICWA 4ETQB 3VI4A 2LQRA 1T0PB 3FC8A 2C3XA 3RVWC 1ORSB 4NZRH 3VXOB 3O6FC 1D7FA 3WTWA 4YSCA 3C8KB 2FIRT 4KROC 4HHAA 1A5FL 4NM8H 3GTTA 3APFA 5ICYA 1FNLA 7PAZA 3I9PA 5I16A 2VXVH 4MJIE 5KVEE 4YLBA 1GZPB 4OD2B 1R0AH 4UAOB 1G7IB 1T2QL 1KXTB 2NY4D 3AROA 4HUVA 2ID5A 1MI5A 1A6UL 2HWZH 3PHSA 2EIKB 2X05A 1K6QL 3EOYG 4JZNB 1E3ZA 3O3DA 4P5TC 2VR6A 3GZKA 1L7TL 1F6AB 4MX7B 5DJZA 5IB2B 4YEFA 1DVFD 3SE8H 1UASA 4X4KA 1SXZA 3W3BA 2CGRH 2E7DA 1ZT4A 4YXKH 4ZAKC 1F4AA 4AZ8B 3K6DA 4JZOA 5LDUA 1WBXB 4NHUB 1OW0C 4NP9A 3C2AL 4Z5RB 4PUBH 5B1AB 2WQSA 2QVKA 4KZDH 4QRPE 5DC4B 4ZO6A 1I3GH 2B9AA 2H5UA 3BPOB 3MLXL 1ID2A 1CURA 5EBLB 4LEOB 1JGLH 2PCPB 2PETA 1BFSA 2YEZA 2YSSB 1Q9OA 4OZGF 4PRPA 5DHEA 5EOCJ 4BK4A 3PP3K 1KTKE 5KW9L 2EDFA 1CFSA 4KZCA 3GBLA 2XWXA 3IAGC 1A9EB 4BZ1H 2AJVL 2JB6A 3PWPD 4N9GA 1CE6A 1JGVL 4GH7B 4MNQD 2FEEL 3JV4A 5DHDA 3CH1B 3QNYA 2C9SA 1GGBL 3ZO0A 2NY7L 1ZHNB 2ZF9A 3UBXB 1G6RL 5I18H 5HY9B 2AAVA 2BP3A 1TVHB 1CS6A 4OZHE 5ITFB 4OKVB 4HUKB 1KTLB 5HVHC 5H8DA 2AVFA 12E8H 1CE1H 2IAMD 4OUUA 4W9ZA 5EBMA 5SWZD 3SQOL 2YA1A 3GXIA 3WFCH 2NMSA 2BY3A 4L4VD 4LLMA 5IBUG 3WTXA 2JIXD 4OJDH 3VTAA 4G82A 3WIIL 5D7LA 2XNAB 5CEZE 3NK4A 1OAZH 4OCLC 4P3DA 3L8QA 2K3TA 3VM5A 4UQ3B 4TSBL 3H9HB 3QJQB 3O2WH 3O9WD 5AVZB 2P52A 5T33H 5L2KA 4HJTA 2DBLH 3LZRA 3OVUB 2ZX7A 1QLRB 5F7HA 4IRSD 4RGNE 3F12A 5FA4B 5ADPL 4ZTPL 1GTFA 1YPZB 2WO2B 2BNRA 4KVNH 4UIMA 4I1PA 1EO5A 1O7DC 3QW9A 2CKBB 2G4GA 3MZGB 5KOMC 4ZD3L 1UQSB 4ONHB 4P2QE 3UO8B 5LGKA 2WO4A 2ICWI 4ZMQA 3S3JA 1RULH 2QKIA 4P3WA 3KPRA 1XX9C 4MB1A 3QUZB 4MXQC 3CFQA 3RUGF 4NWTH 2JKLA 3S8WA 1O6VA 1YMMD 4WW1B 3HJEA 3MRNB 1IC7H 1WJ3A 3WHXA 1MCIA 5IOPB 1MJ7L 4FYRA 1JAEA 4PJCB 1GTNA 1ZVYA 1I7TA 25C8L 5CILL 2CR6A 1ZT1A 2FLMA 5HHOA 5D8JL 5KN5B 5JDSA 4FFZL 1PD1A 3NGBC 2XA8L 1DQDH 3MBXL 2Y3AA 4FABL 4PWHA 3QUMH 1G7JA 5E7BA 5C0BB 2YMOA 5I6KA 4AIZA 2GEEA 2O6DA 2XG4A 1Q9KB 3KWVA 4RDQG 4PJAB 1WC7B 3CHXA 3ZZLA 1CTNA 1NMCB 3QQXA 2EVJA 2L04A 2Y23A 2WO3B 3DJRA 4MD0A 3S98A 1KYFA 1MVUA 2FVNA 4NPJA 2WYTA 5E2WH 5SWSE 3TNNB 4FLOA 1EPFA 5JPNA 2BW5A 4L8BB 4G70B 1T3FB 1U3YA 4XP9H 4J8QA 4NLHA 2D31B 3I85A 1W6LA 4NUGH 2XWCA 3VD5A 2QELA 4UNVA 4M9PA 1S8DB 2GUOA 2X9XA 1FLRH 1MHPL 3EGDB 4FEIA 3B9VA 3C2SA 1A4JB 3EO1A 4DF9A 2ZWYA 2V0AA 5JIMA 43CAA 4FJZA 4QTIH 3NACL 4LCCC 1DQLL 4DCQB 2R15A 1SN2A 3K8LA 3FTGB 4DP0X 5DRWB 5KJRL 5HP5A 2BSRA 5EZIH 5DK3A 1AS7A 2DM3A 4IU2A 4F7PA 4NZTH 1DUZA 1QFUL 4DHLA 2BX5A 2ZX5A 3DX9B 4U4IA 1I9EA 4XP5H 3S96B 3GSNH 3OHXC 2DM2A 3VI3B 3QXWA 4ZJ9A 3WYRA 3TC9A 3ZE2F 1CI5A 2UY6A 4S1DC 2F61A 1U8NA 2AMUA 3ISRA 3QUXC 4MCYB 4LK4A 3IKCA 4HCRH 5CBEB 4GMTH 2ZG3A 1MNUL 5AOZA 1R1CA 2YKLH 1Y6NR 4JFOB 5J8OA 2AV7B 2ZSVA 1IAIL 3B5TA 5EORL 3ECWA 5DI8B 2VITA 2F58L 2VWEE 3IAQA 3MLRH 3CFBA 5HHVH 2CBTA 1W16A 1BWMA 1DN0A 5A7EA 3S4SG 4PTUA 2VDLH 3CDGB 3E6FB 3E80A 3HHSA 1PCSA 4I4WA 4KKPA 1YQVL 4P46B 3SBWA 4F15C 1CVSC 1RIVH 3JTSA 3F7PC 2VAAB 3VSUA 2JKRM 3BD4A 5AW3B 5BO0D 1OGAD 1A3LH 5A40E 1LP9E 1ZHLA 1HSAB 2D7PA 4EE2A 3WXWL 1JXKA 1WG3A 2YD5A 4L9LB 4M5YH 4KRLB 1AFVH 2CAKA 5I73B 3VDBA 4KRMB 2FWOA 1Q0YL 1WFNA 1IBZA 1JK9B 3RPKA 3ZRSA 3OX8B 4D0BA 4KOCA 3G9AB 2CO1A 3MTXA 1RZ8A 5E6IC 4KI5F 2OL3L 3QDJB 4R96B 2C8NA 1UB5A 4NEHB 4ODSL 3QR1A 3ZHDA 3SYAA 1AGDA 3IJHB 3ZR6A 3OSVA 2X6CA 1J0JA 1U9KA 2IGFH 4LSQH 5DURD 1XR9A 3L7FB 2BVOB 1AZNA 1AKJD 1R3HB 3QG7H 4X99B 1YN7A 2FATL 2PYED 2ZAGA 4FLHA 4K71C 2XY2A 4M8VA 3U6XS 4KKRA 2XQ0A 3TX4A 4MQ7B 2XV2A 4MSWA 3VU1A 4CA4A 3FQUA 3H3KA 1UD4A 3CVBA 3EDJA 4RMWA 3N5AA 1PAMA 3KJ6H 4FE9A 4S2SA 3ZX1A 4N3UA 5I1LA 2B08A 2X87A 3H0TB 3MLVH 1L9TA 3T0VA 4IM8A 3LVTA 4UDUB 4XVJH 4JVWA 4KY1H 4NNYA 5AVXB 3FO1A 5FYKL 2CO2A 1CGSH 1EFQA 1QPKA 4DN4L 3JVGA 3U2SB 4WDIB 3TPUB 3DO7A 3L5WB 2C34A 2YA2A 4PEEA 5TFSL 2WZPD 3PNWA 4JNXA 2APXA 2WIIB 3EJZD 4FFYL 4JO3H 4E2OA 4HKJB 1VEPA 1A1MA 2YPLA 3CFEB 3EOAA 4UT9A 5I8KH 2PP7A 5GHWH 1VACB 3APMA 3ARBA 5FUOL 1HYSD 1S7VA 1A7OL 2Y25A 3TO4C 4E41B 1JV5A 4BKTC 1T03H 2FQEA 4JFDA 5FGCB 4Y1TA 1A8JH 3EH2A 1TU2A 4PAZA 4WWKD 4H1LG 1PX8A 1YEFH 4LPXA 4MB3A 3NCWA 2UWEA 3FU0A 1MCPL 2BCKB 2A73A 5AVVB 2FYYB 2IALB 2CPCA 4QGYA 5C0IA 5I6OA 4MGXA 1PLGH 1U8QA 3COOA 4NJ9H 4PJIB 1CDUA 4UTAH 3DLQR 2WKLA 4W4OA 5D1XC 4GQ9L 4LLWB 1F56A 1UA6H 4QAWA 3MZTA 1OLZA 3BUBA 4O2CA 3WEMA 2F53D 3IDNB 3SKNB 3RA7L 2EINB 1JHKL 3ZJAA 4ZFGH 2RR3A 2XZCH 5LCVH 4A7UA 4CMHC 3F6JA 4GMSL 2VL4A 1UACL 4QHPA 1E0OB 3V6OC 4PJHE 2NY4B 2H0JA 4Y9FA 1CXLA 1UG9A 5H94A 1HAWA 3DRQA 1E9QA 3GUTA 3REWA 1GGUA 3CXHK 5K33A 1UD6A 4OBRA 5JHMA 4X4YA 4OFKA 5TPWH 4XB3A 1RHFA 5K1VA 3DUUB 1MLCB 5DQDH 3IFLH 4WNSA 5EIIB 3RWFB 3Q3GB 1HH6A 5KUKA 2FR4B 1L5GA 4HU2A 4MD4A 4PJFA 1G7LB 2PTVA 4BCYA 4M56A 3TP4A 1AXSA 4AKQA 3QNZA 4WI0B 5DC0A 1Q1JH 4TPRH 3ZHLA 1BEXA 3PP4H 3TTYA 2ITDA 2OYLA 3KPSB 1BAWA 5L0QC 1XR8B 4WKZA 1ZJBA 1HSBA 5AAMC 1RFDH 1SVBA 2EE2A 2XXGA 5B38A 3DVNA 4WU7B 1FGVH 2H1XA 1W0WA 3SDDC 2X0VA 4GAFB 1VGEH 3KYMA 3VXMD 4F2MA 1BIIA 1JPTH 4PRHA 2NQCA 2ZP9A 2QQKH 2CKBH 2WZ6A 3L95B 4N0YH 5ERWB 1U93A 3PWPB 4NN6C 5ESVB 4B3EA 4IOSA 1VADA 1MH5A 2G5UA 4R9HA 3NIGB 4AVJA 3A6BH 3KG5A 1KV3A 1MF2L 2OMTA 1NUNB 3FQ4A 1G94A 2OTUA 4B0MB 1RLBA 1AO7B 5TQ2L 4EI5D 3RVVD 3A5VA 3D7PA 4NP4L 4IK6A 3PL6A 4EBQL 4X8JB 1D6VL 3IF1B 4GRWF 5SWZB 5F44A 4XMLH 1I1AD 3UTSA 2VIRA 1KYOJ 1T5WA 4UYPA 3FB7A 3QXUA 4APQA 2JIXB 4J2QA 1N6QL 1A6AB 4UU9B 4WFGE 4XPHL 1TZIB 3FHQA 3V0AC 1E67A 2OCCB 5KS9A 3IJYA 1KMGA 2DDQH 3FH7A 4M93B 4UV7L 1MCJA 3LVEA 1LHZA 5I1JL 4NT6B 3O9WB 4PW9A 3QEHA 5F7AA 2Z4QA 3DX6A 1CGVA 2BNQA 4IRSB 4HULB 2DQCH 3S88L 3UGEA 2OR8A 3TYFB 5IROC 3ZE1B 1ETZB 2E4TA 3KPNB 4UZSA 5D7HA 5CD5C 5IZ7A 3EYFA 1FH5H 2HRPL 2HT2D 2R1XB 3GRBA 4P5KA 3RURA 1CL7L 4YZFE 2FD6H 5TGBA 1DBAH 1NWOA 1BXXA 1B4JH 3BUQA 2OMUB 1F2XK 2ZG1A 1LE9B 3OKYA 2AK1L 1ZOXA 4NI6A 4OH2A 3SE9H 1TTAA 4BDVA 3HC3H 3A67L 3VXTA 5I66B 2ZXBA 3CFCL 4NQSA 3KPQB 1AD9B 4Y88A 4Y9BA 1BJ1J 4DSYA