4JDEA

Crystal structure of pud-1/pud-2 heterodimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
144
structure length
144
Chain Sequence
b'SQLTRRTAKVSIDNQTGSHFKFQVTHKYTGWDADKSDVVMFQPDEVKEIFKSVAYNTGFLTTGVDNWLVDGTMVQERTEVDNKGHQIGKKSYIEHAKFISDSRSWKQHMLTAEDDGKTTTIRVFPTEIHFISPSGESTTTFTKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein F15E11.13
publication title Characterization of PUD-1 and PUD-2, two proteins up-regulated in a long-lived daf-2 mutant.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Unknown function
total genus 32
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2013-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18457 PUD1_2 Up-Regulated in long-lived daf-2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3820 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jdeA01
4JDEB 4JDEA
chains in the Genus database with same CATH superfamily
1CFVH 1GZPB 3SHSA 1HXMB 4Y19D 1FO0L 1Y07A 4F8PA 2AQTA 5I30L 2X6UA 1OCWL 4M6ML 1RHHB 1NMCC 3IJEA 2N4IA 5JIKA 2R7EA 3IGLA 4GG6F 3OHXB 2YMOA 3HHSB 3K81A 4B9CA 5DTFA 1ITBB 4LF3A 3S5LA 2COVD 3KPPB 5EBMB 1TVBB 4JFFA 1CE6A 4OJCA 2G3XA 1V10A 3HMWH 5I6MA 3HS0C 2ZSVB 4MA7H 3T2NH 2ADJB 2ZOKB 5ITBH 1IQDA 2ZWNA 5D70H 1UM6L 4LKCB 1DL7H 4UI2A 3VG9B 5H37H 4B9FA 4ICXA 2VTFA 1PTZA 4JDTH 4YBLC 4NQEB 3Q48A 2YRLA 2AI0H 1EO8H 1L7IL 4BSWB 4F93B 3ZSSA 5IQ7H 4IHOA 1NSNH 4K07A 3PP4L 2QZQA 4CVZA 2JCCE 3Q43A 5L4IA 1BYNA 5EU7E 3IJ8A 5CBAA 1G9HA 32C2B 1U3HD 3MI6A 3H2WA 3SKOA 4HWBA 1CDCA 3UPAA 2GTQA 5KS9E 4X4ZA 3BH9B 1EUTA 1H3XA 1A4CA 4K23L 4JFYB 1RJYB 3V4PA 2XIIA 4JCMA 2V7NB 4OVUA 1E5UI 4HUWB 2OA9A 2QADB 3WXWL 4XPTL 1J87A 4N0UE 1DZBA 1FE8L 2CJSA 5IFJA 2PPFA 4CMHB 4V1DB 4XMPL 3GSNL 4YMPA 5IB1B 3GMPA 1RUAH 4PYHA 3IJ7A 3LKRB 5TJWK 3ZKNC 1OAZL 3BSHA 4PR5B 1EFXA 3PHQA 4C59B 2DJMA 3CVCA 1JHLH 4MQSB 2WWOA 3Q9QA 2XN0A 3FUDA 4JFOB 3VSTA 5F6HI 5HJGA 3ARGD 3U7WL 2CDFA 1JHKH 4JM0A 2BZCA 3VCLA 4JZOA 4H26B 2GY5A 3AITA 4DEPC 1SDAB 1PKQA 2NNAB 5MEOA 2KPWA 3FU9A 4JY5H 4M1DL 3RZCB 4EDXA 4JY4A 1MDTA 2UWEF 5T1DH 2AJVL 5LCVH 3RL2B 1KBBA 5HTSA 3S35H 5I0YA 2VRKA 4LRNH 4KXZH 2LHAA 3CVIL 4KGJA 3GMRB 2R0KH 1F3JA 1A6PA 1B4LA 2NY5C 4E9TA 2K0RA 2Q8BH 5ITFA 3QQ4A 3UO1H 5TD4A 3APCA 4EKJA 4LSVL 4N0FA 4AV4A 1FL5B 5HYJB 3JTBA 4ZUTA 1S9KC 5KAQF 4TRPL 3L2LA 3EZ8A 4HPHA 1AGFA 1E9QA 2D4DA 1UA6H 3A0OA 3KHOA 2OLDA 4XH2A 3BUPA 2FHFA 1SQ2N 2WTOA 4H1LB 1AZCA 1IO4C 4P4KA 4JE4B 5E2VH 1F00I 3BFOA 3FTGA 3NK4A 3U1QA 4X6BA 3NP4A 4PS8A 2M8XA 4PJAA 2D7TH 3SPGA 2VLJA 5T1LD 2ATPB 2W0FA 2L7UA 2J20A 5ILTH 2WINB 3U4BH 2C7UA 1ASOA 3C6LD 1OP9A 5GS2H 1A3QA 2NUPB 4UYQA 2DQGH 3IDXL 3VGEA 1TEFA 1XB3A 2P1YA 2GUOB 2TSBA 1PLGH 1QLEL 5CGTA 3VG0H 5ES4B 2MSPA 3FUNA 1RIVL 1UC6A 4FNRA 4L2YA 2VDOL 2VUOA 3FULA 1R1CA 4XO5A 5I18H 5FM4A 5B8CB 4LMQE 4H0LC 4RISL 2R0WH 3P4MB 2YSSB 3AS0A 5H4ZA 1MXGA 5GRUH 1WV7T 2EUWA 3NH7H 4OD1L 3IJYB 3NTCH 3MRPA 3JV5A 3VSQA 1I8KB 4PWHA 3W38A 4N8PA 2QKIB 1IAII 1SFHA 4NM4L 3SPVB 2AABH 1C8PA 1EHLH 2J6WA 4KK6D 3V5KA 5FB8A 2R69A 4KQ3L 4P23B 4NBZB 3X2QB 43CAB 1M57B 2GAZB 3CVHA 4G1MB 2ZNWA 4BQ9A 3AACA 3E7JA 4TPRH 1VDGA 2Q87A 1GGIH 2UZXA 3HCVA 1CD1A 4UT9H 2GJJA 3EOBA 5E4EB 3HNVH 1V55B 3NEOA 4WHTA 2W60A 2ED7A 1GKEA 5D2NA 2HJFA 4C56D 1ND0B 4CC1A 2PO6A 2PYEE 4JMXA 1AOHA 2WNGA 5HDOA 4AKPA 1T5WA 3I6LD 3WD5L 3D2UB 3JZ7A 1SJHA 4KJPD 1NEUA 1OB1A 2J5WA 1YNLL 1GGBL 5EULV 4XNXL 1SM3L 4GUQA 1G84A 2UX6A 1HHHA 3K2IA 3FFCE 1NFDA 1PKOA 1MQ8A 2DEXX 5DQJB 1MCCA 5EZJA 4JVWA 4Z7OF 2GK0A 5B3JF 1O0VA 4QRBA 3FB5B 1CLZH 2XFXB 3G6JB 1EJFA 1WGVA 2QQKH 2HT3D 4HZ1A 4LLQA 5I17A 1WTLA 4OM0H 4RGOL 2BVPB 3L95B 4BJLA 2QFRA 3UZQB 2BZ7A 4J23A 4UMSA 4UQAA 2UX7A 1RK0A 2Z35B 1ED3A 1FJ1B 2R4SH 3V9FA 1MCRA 3QUYD 3HB3C 5D1XB 1V54B 1B6DA 1QBAA 5D6DA 4XPBL 1U8MA 2IPTL 2Y36L 4AV5A 2JTDA 3NAAL 5I5MA 4GI8A 2Y7QA 4G8AC 5A2CA 4QRPB 1NLBH 3SYPA 1BBDH 1ZA3B 1HI6B 4P4KC 1F90H 4K2UH 4KRLB 4JN1H 4QI3A 3H42H 3FO2B 2F18A 4ZFFB 5D2LF 3ML8A 4BZ1H 3TA4D 4MA3A 5FA4B 3E9TA 4AZ8A 5FUCE 5JIPA 3P0GB 3PWNA 1E9PA 2C3XA 4FXKB 2ALWA 3TC9A 3DJSA 1CR9H 2DV6A 2CKNA 3O81A 3BP7B 4X8XA 5D4JA 1J0IA 4L23A 5FFGA 4TUJA 2BH0A 1F0LA 2UUDK 1ZT4A 4YBHA 3GSVB 3K2UH 1DBAH 1CB4A 1CDYA 5HYJE 4D0BA 1IGFH 2EDNA 1HXYA 3TBYA 2EDTA 1AO7A 4F80A 3ARBA 5T3ZL 3QB7C 1G9NH 2E9WA 3ZE2E 3L5WA 3CZFA 3SZKC 2BX5A 4GINA 2ORBL 1RZFL 4RIRB 5FFOA 3VE0B 3EJTA 4OW6A 5BVPH 5DJ2B 4BXVA 4TOYL 2O61B 1HZKA 3PDOB 1LD9A 3QHTC 5IV2B 1W16A 1QFWH 2CGRL 5IB2B 3D87B 3MLWL 1A1OB 2R1XA 4UDTB 2AJYL 3L3DA 3EIFA 3CFKA 5IW6B 2WXJA 4JM2A 3VB9A 1OTSC 4FFYH 1UD4A 5JORB 2D3NA 2JMRA 1Z9OA 1GKOA 4U1SB 2FIKB 3ECBB 3G3LA 5JUEL 5KYWB 2YPKA 4Y4HB 2ZCLH 4HIXH 2CIKA 5HHVL 3BJLA 5C08B 2OM5A 2BFVH 4YH6A 3KS0J 1HCZA 1KCVL 5D2NC 4ZAKA 5HDQL 2PO6C 3LEYL 2XWZA 5EO9A 3VWKD 3VMPA 3QJRB 1PX8A 1WUNT 1I1AA 3MJGX 1P9MA 2FJFA 3ISYA 3LZPA 1R3IH 4OZFG 4WJG3 4Z3IA 4NBXB 1DDHA 4NZTH 1JTTA 3CZGA 5ABAA 1AJ7H 5DZAA 2QDVA 3BSZA 1ET8A 2C5DC 1C5BL 3GMOB 3P4OA 5JXED 5GS0D 3ZSTA 1CXLA 3LRHA 3NJLA 2XZCL 4Y0GA 3UG3A 2YUXA 3KDMB 1JTPA 2OCFD 3Q3GB 4IOSD 2YAHA 3OKEA 4HJSA 4KK5C 3NCCB 4G7SB 5JO5B 4DN4L 1CTOA 4D3CL 3FSOA 5EMYA 4AX3A 2WJ7A 3LMJL 2VXSL 3LZOA 3I6KB 4LOUC 5BO1L 4L3AA 2ZKWA 3MUJA 2FJHB 4AJVA 1CQKA 3KPMA 2NY2D 1MI5B 4L1SA 3GUFA 4CBPA 4NFBA 4YDKL 5D7KE 4RSYA 4FN0A 4LCCB 4YR6B 1ZGLP 1ZIAA 4WZ9A 1G43A 2BVQB 2B3IA 3HMXH 4BCYA 1RVFH 1Q1JH 3SGEH 4IBLT 3X3FH 3COOA 4RLDA 3TJEL 3G08B 2VLKB 3ILQD 4FF9A 2W8CA 2R0LL 2ENQA 5CLWA 4ZRGA 1GPOL 1G1OA 1A14L 3EGXA 4HT1L 4YXLL 1FRGL 1CYXA 4YE0A 4DGUA 4XPAL 4JFDA 1PCXA 1QKZL 3N5AA 3RI5F 2NCEA 1WAEA 4FXGB 4ZODA 5C0BA 3WTWA 4N6RA 3ZUNC 2E6QA 5HY9A 1RH8A 3KHQA 4Z0XA 2FR4B 1DUYA 1JNHB 3ZYJA 4I0PB 5FO9B 3NCYP 1Q0YL 3ARBC 2JQMA 4PV8B 4UTAA 2HFEA 5IP4A 4JPIA 1B0GA 1NCDH 4GXVL 1N0LA 2ZUVA 2C3VA 2O6EA 4I9XA 1IM3D 2XLLA 2BCMA 4LLWB 5DC2A 3QUMA 5DWPA 4B41A 3FQNB 4QRPE 1VPOH 2DQJL 2MCPH 2WOYA 4HS6A 4D0CA 5TE6L 1PU0A 3SO5A 3UZVB 2Q7NA 1QRNA 4BZ2H 1IJ9A 4OJEH 4OD2B 4JM2C 2AQRA 5DHVH 1CU4L 4IMLB 4MBOA 2JB5H 3SN6N 4U1KA 4YDIH 3SOBL 2Z31A 5CZXD 4HJGB 2D73A 4HU2A 3SQOH 5HHOB 4B53A 3DYPA 3PJSA 3FO0L 1FAKT 4ZUUA 4PRIE 4OGAC 4ZAKC 4OZGB 2NY5L 5DGQA 4UT6A 5ANME 5AENA 1UQSA 1OEZW 2B9BA 4UAHA 4G5ZL 3GZPA 1I1AC 5DA0B 2H9GB 2NUTB 4J12A 4L4TE 4R5XA 4JE0A 3DIDA 4P57B 2L4OA 4QRUA 2EYSB 4KRPD 3PAVA 3SE9L 3WFDL 4A7GF 3LNFA 5LB1A 4F24A 5I0ZA 5E5UB 3ULVL 3AUWB 1T21B 4LL4A 4ELKB 3I9PA 3PE9A 4NWUH 4O00A 3GZQA 5HHME 2ROYA 4GOSA 4H8VA 2JVUA 1S9VB 4YFEA 4KXDA 4FQQA 4AQ1A 2UZYA 5AZEH 1RIHH 1MCNA 1DJHA 3OD3A 3Q6GH 4URKA 1R3JA 1F4YL 2P49B 2Z7WA 4H1LH 5BUPA 1AG0A 5TF0A 1NAKH 2BHFA 1K5WA 1OK0A 1I3RA 4ZUWA 1EXHA 1O5PA 2HRPH 2VH5L 4WFEE 3ZHNA 1A7RL 2IQ9L 4PJBE 3T71A 1KZQA 5FYKU 2JCCA 2CA4A 4PRAA 3PXLA 1EHAA 1L5GA 2P80A 4IRSA 1A6UL 2HJKB 4F91B 2PN5A 2MMXA 2Q8AL 4HWBL 3X3GH 1QLFB 4F2ME 3TN0D 3U48A 1QUNB 5D7IA 4X4ME 4E5XB 4XBGB 4ENED 4HFUH 3P9MA 5B39B 1QNZL 1LQBC 2XRAH 5FHBH 1JPGB 2ESVE 2BFGA 4YVUA 2B4CH 2XQYK 2VDNH 2WKOF 2LVCA 2W65A 3OF6A 4XX1G 3ZMRA 3MCKB 3MRHA 6PAZA 1CYGA 1BFOA 4JGMA 1MI5E 2F19L 2EDDA 4JKWA 2AK4E 4PTTB 2ATKB 1BJMA 4XMKH 2LOEA 5IM7B 5JPNB 2JIXB 1I7TA 4JDZA 4RMWA 4C55A 5I74C 4GBXB 5D7JD 4IRJA 4XPHL 1JV5B 4KWUA 3RWIB 2PTVA 5CM1A 4JHWL 5EEUA 1FL6A 2FWSA 5D5ME 1J1OH 1JFHA 4J28A 2F08A 4YHYB 2OTUA 5TDNA 4YHIA 3S0PA 3LH9A 2WXKA 3KE0A 3BAJA 3E80A 1BAFL 3U30B 1VFAB 2QSCH 2XA8L 2Z93B 3GKWL 4AUYA 1M56B 2X1PA 4TUOA 4APXA 3KLAB 2Z31C 2WZ6A 3KPLB 4DZBA 4KKLC 5IQNA 2OSYA 3NIFB 2KKQA 2O5YL 1GJUA 4ZUVB 2W59A 1L6PA 2B8OT 4NKMB 5TDOB 4URTB 4KV5F 4Y2LA 2WWKT 4N2OA 4N1HB 4UM9D 1BMWA 4K9EH 4OT1L 5SWZB 3NOIA 3W39B 1E40A 7PCYA 1G0XA 4CN4A 5E03A 3P3UA 3ZE1F 2ZF9A 4KVCH 3DX9B 3QFJB 1V7ML 3ECVA 4RFNC 2BIOA 1LGVA 4PS7A 3OSKA 4XCFL 3DOSB 4DNLA 5IQ9A 4A2MA 5TGBA 4NO3A 3A67L 4G8FB 3EH4B 3SY0B 3V0AC 3VXRE 1ZA6B 1YEJH 3FU5A 3LSOA 3LY6A 2ZYSA 3WXVL 3WKYA 1VJSA 1XIWB 3A3YB 4M8RA 5EO1A 2Z8VC 4AQ1C 5KANI 3T8XB 1OY3B 1TTRA 3U2JA 1G7PA 4DP0X 2DQTH 1AI1H 3WTXA 1AQDA 5BXFA 1JZDC 5J1TC 2LVEA 5KWYC 3JYCA 4JUSA 4OZGE 5FYJL 3ZRCC 4DFIA 5MEQA 1C9SA 1OHZA 3IETA 1OP5H 4DAGL 5EU7C 4IRSC 1HZHH 1S7SB 1TJMA 2DQUL 4MD5B 3M17A 3O45B 3NFSL 4MTMA 5D6CB 3N9GH 1ET5A 3VNZA 2YIHA 4QJ4B 1N12A 1GYUA 3KEDA 3DO3A 4Z77A 5T3XH 2AJUH 5E2WH 3OLIA 3M45A 2MCMA 1OAQH 2CM6A 4NC1E 2MNJB 2FD6H 3RAJL 2VQ4A 1I9RH 2OYMA 2OP4H 3ARPA 1OP4A 2R69L 3SCMB 4MRCA 4Z7UE 1WGOA 4ZTOH 1PFOA 3RJQB 4P59L 3GLZA 3WS6A 2MPVA 3FQRB 4XPGL 3VXSB 3KDPB 4HYTB 1A0QH 1QO3A 3JUZA 1HC1A 1KGJA 3OB0H 4RA0C 1TEGA 1P1VA 2CUIA 4DWHA 1HKLH 2PCFA 3FCTB 1G7MA 1SDDB 4X9FA 5C09B 4H8QA 4IRJC 3ZDXB 1G5GA 3HKFA 4WSJA 4XX1E 1BSIA 4OCNC 3HLAB 3BGFB 4ONHA 4H8HA 4KUCF 1G6RH 4GRLB 3B7YA 4OSUL 2WANA 3PHOB 5I1JH 4NO5B 3CZUB 3Q5TA 2OYKA 1I7UA 4QHNB 3PWVB 1KWGA 4CC4A 4QGYA 2FWLB 4KU1A 4YXKL 4Z78A 2ZP8A 3C08L 4IKIA 1YYLH 1U8NA 1AAJA 3D69A 1XGQA 4KX7A 4PMEA 3PAUA 5DRNB 2WB7A 1JPSL 4AEIL 1ETA1 4GAYB 12E8H 1QFOA 1OARL 3Q44A 4G6AC 3S34L 3B7TA 4H2AA 3ETBF 4OLEA 1YEKH 2DMGA 1T89A 4P2QA 4R4NC 5G4OA 2WP3O 1XV8A 2HX8A 2ZUUA 4PJ8B 1J8HB 1DLHA 4NQED 1KGXA 4K73A 2OZ4A 3RHWF 3WLWC 5IMKB 3QUGA 3TNMB 3HI1A 2VR3A 1NCWL 1XSIA 4XHQA 4Z7WF 3KBEA 1ORQA 3QR2A 4QJ5B 2CLRB 1UHVA 4AM0B 1Q9WB 1IFHH 3BISA 3G5VB 4K5NA 3PUCA 4LSTH 3ULUE 3CZJA 3KR3L 4XVSH 3WIAA 1AG6A 4D7PA 3WJMB 2DICA 1F42A 4IOFD 5E1GA 1E28A 4ZFQA 3T04D 4HJTA 1K85A 4XO9A 3ETSA 1YEHL 4OVVA 2QQQA 2C26A 3D85A 4W93A 4PEEA 4BDVA 1SEBB 1JS4A 2QADD 5IR1A 2IOIA 3CZEA 5KANG 1I8UA 1TJGL 4IKKA 2AC0A 4V1DD 1GA2A 4XAKE 3DXAB 4N0CD 5CJXA 5F2FA 5LBSL 1H3PH 5D72L 1FDLL 1WH0A 5HD8D 6FABH 3PWLA 2BW4A 3PGDB 1XHHA 1NJ9B 2B20A 5ALCH 4U6TA 1AS8A 3QJXA 2VDML 2NX5A 5IUCA 4LKXB 4NFDA 1FLRH 4HSAC 2R8SL 1OWWA 3ZKMD 3WS6C 2WXPA 1CJYA 1ODAA 3BKYH 1HH9B 3RZCD 1KFAH 5B1AB 4QGTA 4PJ7B 1LE9A 3CDGA 4LSSL 3VRIB 3TLRA 4FNSA 1BZOA 5CD3A 2QSVA 4JJ5A 1UWGH 4FQ1H 4ODTH 5D2LA 1KYAA 2CJTA 4PRPB 4MB3A 2Z7YA 2BP3A 4FULA 2W95A 4LGSB 3MV7A 4NN6B 2G4GA 5DO2D 1VFUA 2WUCL 2NSXA 5EU6E 4CC4C 2EILB 3LZFH 4DJMA 4KKCD 3C8KB 1BZ9B 2DM4A 3WIHA 3DJTA 2O6PA 3S36X 1TYJA 2X4NB 4OZ4A 4YXHL 5GS1A 3LKNB 4QD2E 2DH2A 3DV4A 3AT8A 2IH3B 1IC5L 2VDQB 1ESOA 4YIQA 3D4CA 3QC6X 3UO8B 4ZX5A 4P2RE 3SD2A 3SYOA 1UADC 4K7PY 1QI3A 4LSQL 4QXVA 2IO5A 2BJMH 5IVZB 1BM7A 4NAJA 1UYWL 3MRBB 2DMBA 1J9QA 2ZX5A 3ARFB 3FB8B 3ZLQC 2BS9A 3VXSE 3C5JB 3AQDA 1T89C 1LP9F 3NJKA 3CH1A 1QR1B 2VLLA 1MHHB 3EOAB 1JGVL 3QP3A 1C5DB 4ODBD 5IJVB 2V0AA 3UZEA 4ZMQA 3F6LA 4ISVB 1WZLA 2UY6B 1KUMA 1W72A 3ISWA 4M8UA 2X87A 1KG0B 1JK9B 4LQFL 4Q6IB 4AXWB 5GJTL 2XJLA 4P5MB 5I76A 4WI3A 1DVFB 4FZEH 4WY7L 5IB5B 3IDNA 4ZFOA 4ZQKB 4JM4H 5FUCC 1X5KA 3DJ9A 4HW6A 2EAEA 3QFDA 4XAWL 1T6VN 4U1HA 5MP6L 1X6NA 3VWJA 3QZLA 4EN2A 4FQXB 1DSFL 3SSGA 3WKQA 3WDHA 4ZD3H 4LDEB 4P23D 2VUKA 4P46D 3UBGA 1PD6A 2J1KA 4NJAH 3ULSA 3HZMA 3QHZH 4LPUA 4OLWH 2NW2A 5CJXC 2WK2A 1NMBH 4UTAL 2R29L 3QZWB 1G7HB 1A7NH 1KYDA 1T66C 1M71B 5D7KD 1XGTB 4JKNA 1EHXA 1NICA 5C0RL 4AVIA 1WG3A 3BRGC 4HC1H 3QUML 5IEHA 1Y18B 3T0XA 2HLFC 2YN3A 1R5VA 3EH2A 3H7BA 4POZC 2P8PB 2IMNA 1HESA 1HHGA 5LDUA 1KTDB 4Y2DB 3MRCA 3CHRA 3IFNL 4XI5D 5BQ7B 1U3ZA 5IF0B 3QDHA 2I5YL 2WB1A 3D2UD 5FO7A 4I3GA 1HSBA 4JFEA 2E7MA 4N2CA 3UABA 2DI9A 3RTQB 4ERSL 3N1FC 1M2OA 3S8WA 4PRIA 5MENE 2WBKA 3MBEA 4UT6L 1GC1L 4M6AA 4R8WL 4NN5C 1JNLH 1OPOA 5GHWL 1KCUH 3QK0A 3P02A 4F8LA 2WYZA 1U93A 3PGFH 3PREA 4L4TA 5GS1C 5INDA 3FQTB 4NWTL 1QTPA 4XNQB 4A2LA 3U0TB 4X9GA 5EC2A 3PDGA 4EF3A 5ADPL 1RQ5A 5LVEA 5D1XD 3S96A 5C3LD 2A4CA 4QRRB 1B9KA 3NCJH 3OJVC 4OZFA 3GSQB 2ZOUA 4KZDH 3UAJA 2HMIC 2HVKA 4QRPD 1HHKA 3HPJB 3FTYA 3TGXA 3KMDA 2A6IA 4X5RA 3FPYA 5D8JL 3WNIA 2APTA 2IH1B 1LQSR 4Z3TA 1ETJA 5DYFA 4OUUB 4KTDL 1WZ1H 2PR4H 1W91A 4MDIA 4FJ6A 2AXFA 4U1LB 4X9HA 3UZEC 2YS4A 2A5UA 3QJHA 4YHOL 4YHNB 4PJIF 5LDSA 2Z92A 5HXMA 2A9DA 1MAKA 3D52A 4BCZA 1EXGA 3B34A 3N50A 3FOMA 4PJBA 1T0NB 2ZWZA 1W15A 3O2WL 3EYVA 4MMXA 3CPLA 5T3XD 2A38A 2NPLX 2JKXA 3F84A 1A65A 5DK3A 4G80A 3FTWA 4PJEA 3S37L 3RGVA 2C9PA 3OAYK 4D8PB 3SBWA 4L8DB 4WW2F 5CU5A 2K4AA 4JPVL 1T0PB 5KOMC 1J7VR 4LGPB 2V33A 4Y1AA 3VWJC 4X4MA 2CAKA 2EDRA 3QRBA 3L4XA 4A7GA 1PX3A 1QNIA 1XQ4A 2ESVA 3D05A 3LKOA 2J1WA 2ZKXA 4I77H 4QY8B 1M7XA 4QYOB 1TENA 3OZ9L 4ODXA 2XCMC 3KL0A 3RU8H 3P3TA 4F7EB 3KBFA 4AT6A 4EI5A 4GPVA 5GGQH 1I8IB 3MLUL 1MZZA 4AL8C 2C1PA 3FRUA 4Y4HD 2Y2WA 1JAEA 4LXFA 4OIIL 5C08D 1SHXA 3QJTB 4K71C 3MV8E 3FBKA 4MDRA 1JHTA 2A6DA 3EDJA 1TPXC 1G4RA 3L7EB 4PJDE 5J6SA 5HGDB 3V4VB 1CGXA 1NEZB 3KGUA 1GZQB 1HEHC 4HEME 2F58L 1GMIA 5E0FA 3WEXA 1KMGA 3HZVA 3GJFK 4RSVA 1TNMA 4UTBH 4PJFF 4E42A 3QULA 3Q06A 1EDQA 5DK2A 1SJEA 3BHBA 3L1FA 4DN3H 5I1KL 4OB5H 2AEQH 4WTQA 3BVNB 5BS0B 2C8NA 2GFBA 3EYUH 3MBEC 4GIOA 4HQQL 4JG9A 2G4EA 4OCMC 3QT2A 3WN5A 3O6KL 3KLHC 1ZT1B 3BEWA 3NSXA 4WI0B 5D93C 3RWGB 1NCCH 2WO2B 5EORL 4GW5A 4ZW8A 4M5YH 4D9LL 4P48A 4WNSA 4XP5H 5F1NA 4BFJA 1A1MA 1T3FA 1S3RA 5K9JH 4PGDB 4RAHA 5GGSY 3RB7A 2JNZA 2WKGA 2ICWJ 1NC2A 2DI7A 1MUJB 1JGLL 2FQGA 2VZSA 4H2CA 1I1FB 1ZY9A 3UAJC 1VB9A 3OXRB 2VLKD 4I13B 2WUBL 2F7QA 3K1DA 4K7FB 4X0KB 3O41B 3FAWA 1UATA 5IT2L 3REVB 2FX8H 2WXNA 3OMIB 1S7TB 3HG1B 5D7LE 4N3UA 3UJJL 3WFCL 2IWGA 5MHSE 3JXAA 3LZRA 2H8PA 2AEIT 1YQVH 1BG1A 4JO4L 3O2VL 3ZTNL 5FAAA 1SN0A 4YSOA 3FHQA 4RWYL 4RRPG 3AB0C 3ZHKA 1OXYA 3TYGH 3STBA 3EUUA 5HI3C 2AV7B 4OGYH 3T0EE 2BLFA 3ZDZF 4FNQA 4LT7A 4BQ6A 4EOWH 2EDJA 4MCZB 4BE6A 1T1ZB 3TV3L 2VM9A 5E00A 5IIEA 1T5XB 2MQ3A 4MMXC 3KYNA 2VC2L 3D6GA 4LO9A 4R5VA 3VFSB 3BWUF 3BVDB 3C60B 3S8FB 1EO5A 2UZIL 3H6AA 4I0PD 2R2BA 3INUL 3RGVC 1MVUB 4NRZA 4IS6B 5AOIA 3SBWC 5CCJA 4O9HH 1OGSA 4HKXB 4PRBB 2CBMA 3IMUA 2NY4C 1J0ZA 2Y9RT 2A0LD 4PCSA 2OTWA 4OZIA 2IBGA 3AROA 2E6JA 3B9AA 1ACZA 1A8JH 3VGFA 2KDGA 4U1JB 3ASOB 5MEPB 2CRZA 3CFCH 1GSKA 4OQ1A 2B5IC 3D39A 4Z7UA 3OX8A 3P11H 2Y5TB 3HVDA 4HJJL 4ZYKA 3SPJA 5D1QB 5B4MC 1K5NA 1NZRA 4EI5C 1SXSA 5HHOD 4CGTA 1NIBA 4GIPD 3NGBC 3MXVL 5CJQH 1ZWIB 5KVEE 2DLEA 5EUKA 1IC1A 5DMKB 2YD2A 5EO0A 5EZIH 2P42B 1E5AA 4EMZA 2BNQB 2Z91A 3PV6B 1VEMA 4MJ5B 1UZ6E 1PGRB 3UG5A 3F01A 1CDGA 4AYFB 1X5AA 4N5ED 2XBZA 1FFTB 1PZSA 2OMXA 3CFQA 4ZBJA 3CUPA 5J12C 2P7TA 3I6GA 5FUOH 4Y9CA 1C08A 2J43A 4C8XA 1KCSL 3SJVE 1DVYA 5TDPB 2DWDA 3CXHJ 2OW7A 4PJGA 2JCWA 4W6YB 4IIQC 5E6IA 2VM3A 3UYPA 3WN5C 4HSQA 3FTSA 4EKXA 4X7DC 4GKSB 5AFAA 2FZ3A 2YD5A 4A7VA 5FGCB 2J6EA 4AK2A 1RZ8A 2VDQH 3CC5A 5JNYB 3D0LA 4JZJB 2WO3B 4KK8C 1RURL 2Z8SA 4MHHG 4O4YL 4GSXA 5E6RB 3PY9A 1BQKA 1QA9B 4KXCA 4I8DA 3WI9A 5ACZB 5DD0L 4F37F 4I18A 4MXWL 4QAWA 4P2CG 5KSBB 1N5YL 5IW1A 1XGPB 1YECH 1NM9A 4TSAH 4YFLI 1N26A 2OZ4L 1D5BA 4OQTA 1L9MA 2JF1A 4UV4H 4N24A 4NKDA 1DE4A 5JYMA 1OSEA 3FH7A 5ESAB 2BMKA 1CFNA 4WNJA 2ENJA 5TFSH 4G6KH 2FNBA 3BVXA 4BH7A 3NMEA 1AHKA 3HBQA 4Q9BA 1WFNA 1DBMH 3SBRA 1CL7H 4ZSOB 3GM0A 3ET9F 2OTPA 5ID0B 1B2YA 5DZPA 3GGWB 2XN9E 4PY8J 4XC1L 3Q9PA 4HKZB 4Y5XA 4GAAA 1J8KA 3BFWA 3T0AA 5DR5H 4N1CA 3QDAA 1TQCB 2YGQA 3L5XH 2YFOA 3QAQA 5CEXA 5AUMA 5F89B 4DP9X 2QT6A 2YLKA 3P3SA 2ZXBA 4Y19A 3U6RA 3K6OA 3QHFH 4HJIA 5E4AA 3N0PB 4BWUA 1BMGA 1MAMH 1G87A 3CCHB 5T1JA 3BWAB 2DEYX 4A7QA 2VXQA 3K71B 4G8EB 1T80A 1VRSA 2QSTA 1KEGH 2JIXD 3DX2A 5HJDA 3QXAA 3ZBMA 2VZOA 4GBXD 1IC4L 4UB0L 1S9WB 3CNKA 3PWPE 5IBTH 4NC1C 1TNNA 1COBA 4DQOL 5K9KA 3FQUA 4Q9CA 3N6YA 2J4WL 2GJ6E 3OGCB 3T4YA 1TZOA 2VDRL 1XSJA 4M6OL 4HLEA 1HEJC 3T4AA 4NCC1 1I7ZB 1DHKA 4OLZH 4PVNA 1BXAA 4LDOB 1T0MA 2KZ1B 1S7QB 3BN9C 2F74B 4YSQA 1M1XB 4PN6A 1NGXA 1A6AA 4N2LA 3NUKA 3W2DL 3BP5A 3FQXB 4WU5A 3RHWK 1KY7A 2FQEA 2PCYA 3D18B 4IOIA 4FP8L 4HIEB 1S9XB 1OALA 1MWAB 5EHFA 4E41E 5KS9F 4EDWH 5EU6A 1RK1A 4HZLB 5SWZD 1U3HA 5JIMA 2OMTA 5ESVB 2DD8H 2HT2C 3G9AB 5JOEA 1OM9A 3QFJD 4GKZA 1NBVL 1D6EA 1XGYL 5IHZA 5HDBE 4DETA 2A9MH 5IEKB 2A9NL 4OY9A 4YK4B 2ZAGA 3NYKA 4P2RA 5I1CL 4ODHL 2SEBA 4EJ1C 5EEWA 1T1XB 1I8AA 1FG2A 2VDPL 1QHPA 1WUZA 1ZV5A 2D4FA 1E67A 1XIWD 2BDNH 1CICB 1S7UB 2DIEA 2ZXQA 4DFHA 2X3CA 4D9RE 1ILSA 5HYSG 4I18C 4E68A 1HU8A 5CP3A 1AKJB 3ZDYB 5LBVA 1NL0H 2TSAA 3NDYE 1NCBH 4J3SA 4N2GA 1PSKH 3I6SA 2D3VA 1XCXA 1B4TA 1X5YA 1W72L 2NY3B 3CBKB 4PBWD 3ARGA 4K3EH 3P2BA 3BQUD 1IVLA 1FFNB 4XOBA 1OW0A 5D96B 4GMSL 1OLZA 1EXUA 2OXHB 3PIQB 5KVEH 3ULUC 3QNYA 3D3VB 4QHKI 3EDEA 3E3QE 3BI9X 4ZFOL 2RHEA 2IVFC 1KDJA 2RQ8A 3PPEA 4Z7QB 5T1KB 4XNZB 5EG6C 4Y5XC 2YEZB 2E47A 5EIQA 5AD0A 3FH5A 4MA1C 3FFOA 1MH5A 2EDOA 3KJ6H 3SCMD 3VI3E 4HFWA 1DN0A 5F9JB 3QWOA 2F54E 4ES8A 1N64H 3JTTB 2HKAA 4FS0A 3BWSA 2OAAA 4ZMYA 5FX3A 3THMH 1N0XH 4UOW1 4LHUB 1EJOH 4DP4X 3QPXH 3LB6D 5C09D 4WHCA 4JO1L 2C4XA 4K94C 4O5LH 1MJ8L 4GRLD 3RKDC 3KWWA 2X4QA 3FS9A 1E6OH 3LZNA 1B4JL 1UJTA 1KC5L 5AVQB 5CINH 4NSKB 1VZIA 3R0NA 3T4AC 2I25N 5J0BA 4FKKA 5DC4B 3C6SB 4HCFA 2BXYA 5FIEA 5T1LA 1H8NA 3QUZC 4Y4FB 3SKMA 2QGEA 5E8OA 1VEPA 5DA4A 3PQYB 4FI8A 4O02B 3BAIA 4JO3L 4V11A 2EXYD 3C6LA 5IKCA 3V4VH 2HKFL 6PCYA 1DSWA 1ETB1 3GSWA 5MENA 1T03H 1XF2A 2NYYD 2WLIB 1BVKA 2R0ZL 1SBSL 1RUMH 2I9TA 2DKUA 2NSMA 3SBPA 4XB7A 1IAIL 4I0CC 1RJLA 4HMCA 4FI6A 1RMFL 4PJ8D 1J8HD 3RFZB 1J5OH 4C4UA 4YS4A 3ZTJG 4PYGA 3R06A 3CXDL 4JG0H 3TO2A 1NAML 2PWGA 4KHXH 4YDJB 1M2VA 5ABDE 1H8LA 3SB3A 3ASNB 4J2QA 5DJCB 1WC7A 2W94A 3QIBB 2B39A 1KN4L 5CKAA 2YJLA 1LE5B 3CJJA 4HUCA 4NRYA 1IGTA 2I85A 3NZHH 1CI3M 5EU5A 3BZ5A 4CMMA 2GC7C 2EXSA 2DEWX 1DQLL 4HS8H 1PIGA 1N59A 2GIYA 2C9RA 1UGKA 3W11C 3ZPDA 4G9FB 1A1NB 5HPMA 1QI4A 1A6ZB 1G9MC 1MHEA 2H26A 3ARGC 3QDGB 4XCEB 5C2BH 1E43A 2HG5B 2H32B 5T5NG 1OW0C 3DBSA 3GRBA 3VFUA 3U7YL 1LEIB 5IB3A 2VITA 4NM8L 4PB0H 3KPNB 5SWSE 5HSFA 4FQCH 3DXAD 1IEAA 3GS0A 3NIDB 2EDHA 5F8QC 4HG4J 3L3OA 4WUUB 4Z23A 1BZ7B 3R19A 3QJVB 5DMJB 5E2JA 1K4DB 1JOIA 4YC2C 4ELMA 1DSYA 4QRFA 3GSRA 4ZDHB 1TJIH 1IGML 1KB5B 2CRIA 2ZWYA 4GS7C 4DSYA 1MAJA 5EBWA 5DQDL 4ZG1A 4ZMLA 2E7DA 3AMLA 5DJYB 1LO4H 3HNSL 4FTVB 2IGLA 2WW8A 4V2CB 3QUYA 1QAWA 4P2AA 1CFTA 3RWHA 3QZOA 2FL5A 5F3HB 4X4XB 3TVMB 3WOVA 1OE2A 2ENPA 1BJ8A 4PRPD 4ONGL 1A7QH 5CSZB 2V7HB 1CD0A 5IK3B 3MV8A 3BPOB 4AYBA 1A6VL 4GH7B 4WIQA 4HOWA 4PJIA 4DGVH 3LXBA 4PJ6A 4PJDA 1SOXA 1UVQB 3LQZA 4GUPB 4R4FL 3X1NA 4QTFA 3BKCH 1UJ3B 4I3SH 1ZE3H 2YZ1A 4XVOA 3O6FB 5DJDA 4ETQA 2CDEB 3CX5K 1NKGA 2FCBA 3C6LC 4YX2H 1P4LA 5DT1L 3P30H 1F56A 1PY0A 4B9JA 4JKMA 2XFGB 3H9SB 2LTQC 4UU9B 4NC0B 1ZXQA 1ZHNA 3L8QA 5BJTB 5J5EA 5T5NF 1I31A 4HLZG 5ICUA 5GGUB 3FRPG 1K8DB 3IFLL 3ARFD 2LAAA 3V0FA 1FZOB 1Q9LA 1S7WA 3AT0A 3DURB 1P7QB 3C5SB 4B3VA 4JJHA 4F92B 5IMOA 4AY0A 2H3NA 3ARWA 4BFIB 3SDAA 4IU2B 5EIIB 3ZL4H 3BKML 1P6FA 1SOQA 2P3YA 3NSFA 4OCWL 2C9AA 5JMOC 4I9WD 1CT8B 1PIFA 4GEJA 4GW1A 2EC9U 1E4XH 2RD0A 3W9EB 2A2QT 4F7MB 1U92A 5A40E 3VW3L 5DUML 3IDGB 2WPGA 2ICEB 1CBJA 4PI2A 1QPPA 2ZCKH 3PP3K 5D7LA 5JA9A 4R84A 3S4SA 2AJ3B 3JV0A 3EF7A 3VFNB 1RERA 3Q0HA 4LEXH 1XGRB 1I4FB 1YA5A 1UWEL 4ABVA 1N6QL 4WKZB 1TTUA 3NCFB 3VTAA 1XCWA 4LLVB 3MOBL 1G0DA 5JW3L 4FQXD 4X7SL 3D25A 4IU3A 1P5UA 4U3CA 4XCNA 5DHEA 2GUYA 2VB5A 5HI5D 5CLYA 1ZT7B 3PYCA 2CO1A 4ICWA 3MFGB 4EIZC 5ALBH 1P69B 4JRYE 3L3OC 1WICA 1XMEB 4PW3A 4JFWA 4LFHG 2Z7ZA 5JXEA 3LRLA 3B43A 4DTGL 1AACA 2B1AH 5A3IC 5CZVH 3DLQR 1HNGA 1VFBA 4N2HA 3MZTA 4IOSA 3MJ8B 1JXGA 2HT3C 3D5OF 1H6TA 2APVA 2VGLM 4DZ8A 3UERA 3BT0A 4G3YL 2WMPA 4WFGD 1JWMB 1CK0L 3GIVB 4Y2DD 1MCBA 4NB7A 2F1EA 4DQAA 2Q2LA 5MHSD 2ZUQC 3T6ZA 3RQ3A 3L3HA 3TIEA 3QUYC 1KYOJ 4R26H 4X0NA 4HETA 3MRNB 4TL5A 5BUGA 2AJXH 2DQIH 2OL3B 5DMIH 1WFOA 1U8QA 2CLVA 3J7HA 2VSDA 2GJZA 4XCCL 3RTQD 3SE6A 3UL4A 3D9AL 5JQ6L 2CCWA 3I3BA 1BQHG 1RZKL 2HKHH 3TFKC 2W9EL 5AKVA 3E1ZA 4AYDC 3QDJE 1H3TA 5IROD 4ZFGL 3UCRA 2IFGA 1LVEA 5E1QA 5F7LB 4UDUA 3G6JF 1CLOL 1ZLVH 1CF1A 2CHZA 4R2GB 2F7PA 1MWAH 5A16A 4MS8C 5CD5D 1XH2A 3NPSC 15C8L 4QRRD 2CNZA 1JXJA 2D8KA 3SJVA 2XA3A 1ORSB 2BSED 4NNYA 1Z3GH 1JRHH 1QBML 2CNYA 5J13C 1UWXH 2CUMA 4FG6D 1UB5A 1CFMA 2RA1A 1JGUH 3QUXB 4ODSH 4EZLA 2C1OA 2OMUA 1N3NA 2YKLH 2I27N 1D7BA 1YAIA 1Q0EA 3FCSA 4L8SA 3FN0H 3BAXA 1INQA 4YO0B 3X1BA 4FNTA 3SDAC 1UZ8A 2D03H 1RHFA 2X0VA 4MCYB 3TZVA 1SLXA 1AQHA 3LHPL 1DR9A 1IM3A 1I7RA 5HGAB 3GI8L 1U58A 1CQYA 3TYFA 4ATWA 3BIKB 1VGKA 3UBFA 3V0GA 3QJOA 2B1OA 4QXGH 2FX7L 3NSDA 2GSGA 4FQLL 5FA3A 5L0QC 2ODHA 4L0ZA 4DK6A 2BY0A 4F2FA 5C0FA 1S3KL 4JRWA 1R19A 4JFXB 4J7RA 2ALAA 4HUXB 3O4LE 5DD5L 2QR0B 35C8L 3CDYA 1T1YB 2XTSA 4S1RH 2XN9A 3LPGA 2GB2A 3D4GA 3DVGB 1JXKA 2OPCA 3DRQB 3NJNA 2XZAL 5A2KH 2ZXWB 1P5UC 1A6WL 2JELH 4RRPA 1ZHBB 4HBCL 4F7PA 3NDZE 2CMRH 5JHLA 1DVSA 2D7NA 3WFEL 1FVCB 1QRKA 1T20A 3JT0A 4FMFA 5IVXE 3MAWA 1IGYA 1ZLSH 3E38A 2WLJA 3ARZA 4LP8A 3IU4L 2VXQL 5JXEC 4XXWA 2YRBA 3MLVH 4FQIL 1XF5A 3UTQA 1K2DB 3W5NA 1AYOA 2ZYHA 1P2CA 4RFEB 3OJDA 1D6VL 5JW5B 5ISZE 3WHE1 2IQAB 4YVNA 3AZUA 4K94L 4YSRA 1KELH 1YEFH 2I9LA 3PWPA 1F8TL 4LDLB 3VXNA 1NWOA 2X41A 5LLIC 4KPHH 3A23A 1HYSD 3TX4A 3L1GA 2EACA 2WVTA 2KL6A 1BEYL 1HWWA 3CIQA 5IVNA 1TUPA 4YDVA 2ZTBA 4M3JA 4PCYA 1YYMH 4F37K 5JPMA 2X1QA 3HE6B 4Z76B 1UASA 4J4PA 3ARUA 2N0MA 4TTGA 1NGWB 1PMYA 4EI6B 1CD9B 1YMMB 5BS0D 4LLDB 4DESA 2DJ4A 1SVBA 1YJDL 1E4KC 4L3CB 2V5SA 4E41A 2D0FA 2J25A 1JPTL 3K3QA 4O02H 5TPWL 1C5CH 1DLFH 1CURA 4RBPK 5H94A 2JLPA 5ADOL 4LCYA 1QSEB 3STLA 3ZZSA 3T1FB 4NIKB 4MJJA 3BWUC 1HK6A 3QCUL 1YPZB 2Y7MA 3WUZA 4Z18A 2F1AA 3WUWG 1IBGH 3FB7B 3DPBB 1QFPA 2HH0H 2JQAA 3JWOL 2KZWA 2XOTA 3QWQB 1TZIB 4YZFE 4L8SC 5IBLD 5GJSH 1B6UA 3HG1D 1F6FB 1PQZA 2K78A 4WHYH 5FXCH 5AYUL 1UOWA 3RGHA 3LKQA 1JZGA 3TZVC 4KZ0A 5F7HA 3HNTH 2QVIA 3BOVA 4NQXB 1F4XH 1X5XA 1YEIH 2ZYRA 3V0VB 3V55A 1KIQB 2BSTB 1ZJAA 4HBQA 2YD6A 4JR9H 5CHNB 1BD2B 2JWYA 3TU6A 3WDIA 1G9ML 3CFEA 4AKOA 1AQMA 1KJVB 4LVHC 4L1DA 1MFBH 4AQZA 3P9LA 4LCWE 3EXJA 1ETZA 2OK0L 5C1MB 1JDCA 2LLLA 3WELA 1E27B 4YUEH 3RPIB 3UBXB 1JFQL 4HS3B 5LAXB 1FNHA 3QNZA 1F45A 1A21A 2OX5B 2L7JA 1ES0A 5DUBB 5BPPA 2WWNA 3VTMA 1TLKA 4O58L 2H32H 3N1MC 4TSCL 2ITEA 2WLKA 8FABB 5DJAA 1G7JB 1R3LA 1VADA 3EYQD 2CK0L 4M8QB 1HE7A 3MRGB 3I02A 4GYBA 1WPCA 3MA9H 4U4BA 2VL5A 3QZPA 2UXVA 2HJLB 3DUSA 2G2RB 1VAHA 4UM9A 5TE4L 3W37A 1PZ5A 1MCHA 2E75C 3HG3A 1JSYA 2F54A 4X6DB 4UUJB 1LDPL 1KBGL 4LSPH 1TIUA 5D1QD 3GXFA 1GGTA 2FWUA 4KRPC 1T4KA 3N1PC 4D8OA 1MIML 1KB5H 2VXTL 2IPUG 3VGGA 5JOPE 5CWSA 1XSKA 2BNQD 4AC2A 4HLZH 1ZPLA 3O3BB 4L5FH 4OZGF 4WV1B 1KENH 1P4IH 1QWNA 1T6BX 3PDDA 5LKNA 1AP2A 4NN7B 4J4PC 4X9YA 2P47B 5DK0B 4H88L 4K4KA 5SV3A 1VERA 3GMQA 2YGPA 5C3TA 5JIHA 1C12A 2XV0A 4JLRB 4NGHL 1NCTA 4YE4L 5CEZD 5KSUB 4Q9RH 2QFPA 3O4OC 4ZS6D 3NP3A 4S11A 2Y3AA 2EVIA 2P5EB 2DDQL 2FBJL 3BUTA 4PG9A 4HCIA 5F9OL 4M48H 3IXTB 3EFOB 1VESA 3FU3A 1KBKA 1NMAH 3TO4B 4HIIB 1MEXH 3M1BA 1ONQB 1NDMA 1D5IH 4OZHB 1NOLA 3SPHA 3B3IA 4Z0BL 1MLBB 1BZQK 3EOYG 3MO1B 2P8LB 4BD4A 3IAPA 3BESR 4KDVA 2V3FA 2PR9A 1P4BL 3OQRA 1BYOA 4ECNA 3HRZA 3VFTB 2Y7NA 1ZV2A 2QHRH 4GAGL 1AGCA 2NCMA 3CFTA 4L29B 4MD0B 5KVFE 1LEGB 2PUQT 1Q9OA 1ZE3C 1HKFA 5E51A 4Z1PA 4JEGB 1OGAE 4FHBD 2FH8A 2H2PD 3BH8B 3DSFL 3T08A 4NI6A 1NPJA 3WIFA 3IT8D 4MAYA 2OBGA 1HXMA 1WBYA 4GY4A 4DGWC 3QDME 4OFDA 4B5EA 2ZX7A 1HHJA 5SWSA 4NP4L 4NUPA 2AK1H 4EZJA 3KS0H 3B1UA 3NG5A 5FW8A 4QTIH 5FDWB 1TVBA 1TSHA 5HVFB 2J7LA 3BVUA 5JR1L 1MRCH 1OTTD 5JW4Q 4BEIA 4BUHA 1KOAA 4NQCE 3RUGE 3G9VA 2ZSVA 2MHAA 2X7LB 2J8UE 2ADJA 4F3FB 1I3UA 1UCTA 4AYSA 2OXGB 3GI9L 4Q14A 3S97C 4HDIA 3U7AA 1OVZA 4LCVA 3QXTA 1INEH 4YLQT 4EUPH 2NDGA 3WIIL 1WTGT 3KXFB 3P0YL 4NQEA 3QIWA 1IZJA 3HJ0A 3BLKA 4I0KA 1FCGA 1KEMH 4BSWA 1AY1L 1A47A 1CIDA 4ALAH 1A9EA 3C09B 1BXXA 2PPDA 5C0IB 3QS2A 2X0WA 3NIFF 5I1HH 4OCXL 4U6HB 2OL3H 3Q8EA 1ACXA 4X5XB 5J9PB 1S5HA 2OKMA 2ZT9C 2AITA 3KLLA 4WF7A 3BH9A 3QYCA 4KQ4L 1MFEH 3LV3B 4DGIH 3KPQB 2FLRT 3MREB 5AW4B 1A3LH 1OF0A 4NNXA 3QO1A 4RMBA 5I75C 4HUWA 2O5ZH 2RCSH 1RZGB 4NQDE 3IF1B 1CICD 4NXKA 5I6KA 1A4JB 5IB1A 3GK8H 5GISH 1LTXA 2OI9C 5DEGB 3WJJA 3RY5A 4WI9A 5GGRY 2X2HA 2VMFA 2XTJB 1J5CA 1X9RA 4IRZA 3E8UL 1UXSA 4JFOA 3P9WB 1XF4B 2WO4A 2VZVA 2EIMB 4W9CC 3QUKA 4HPOL 3OPZL 4QYAA 3S5YA 3FPXA 2NY3D 2O5XL 5HJ3B 5JQIB 5G4MA 2CXGA 4F7CB 4CKQA 4FERA 4O2EA 2Z64C 4XVUD 3VXUB 3IMBA 1PZBA 1U33A 3HRZC 4KO6A 1CL7I 2IAAC 1JTOA 3D3VD 5BV7B 5IHHA 3IMWA 4D0DA 2P24B 1CFVL 3QRFM 3WO4B 1QYGH 4LPYA 4NZJA 4XMVA 1DQIA 4PJCE 5T1KD 4JQIH 1THAA 5AZUA 2NTFA 5AAPA 1CD8A 1JNNH 5AWNL 3O3AB 3BAYA 4KAQL 3VJ6A 3EJZD 4HHAB 4XCYB 4AEEA 3FAXA 4MAYC 4Y5VC 1QFUL 5TQ2L 1R5IA 4G7VL 5LGYA 5F1SA 2X05A 2VAAB 1GTNA 2NNFA 3HMWL 3OKLB 1G1CA 4MA7L 3MRIA 4QWWD 4Q0XL 3HZ3A 3N1QC 1BWWA 3HC2A 5GS0L 4ODWA 5CNHA 5D70L 3ENEA 3PNRB 1OSPH 3HN3A 4L1TA 2EVHA 3VRLE 3H53A 4TL4A 4F27A 1IX2A 1EIBA 4KKAD 4P9HH 1CGTA 1BM3L 5J56B 5C0DA 1QFWM 1MWOA 4Z95H 2QPUA 3HE7A 2FEDC 1N4XL 2OSWA 4XMZA 3CZNA 4G1EB 3ZDXF 4GQZA 2CO2A 5JQHC 2AEPH 1EEZA 1ZTXE 3DVNA 5AAWA 3B9KB 2Y6SD 4TKWA 4Y4FD 3D07A 1J5DA 1Q0XH 5DYOB 2ZKHL 3KPOA 2E27H 3QIWC 3BIBX 5DD1L 3DUUA 1XCTB 3PQYD 4P4RB 2YK1H 4X8JB 4HK0A 5DJ6B 1LK3H 1FNEB 2RR3A 1UM4L 5ID1B 4ODUA 4KZEH 3P40A 4M43L 4RX4D 1SYSB 5F96H 3CG8A 5FK9A 4PB9L 4UZUA 3J27A 4XMLL 5C0AB 5KVFH 2XY1A 2E8ZA 3QDJA 4QRSB 1FSKC 2DLIA 2IOOA 5DMGC 2JI2A 3HI6H 3BN3B 3PWJB 3DIFB 5IVOA 3P4MA 1X6LA 3K4AA 1MFAH 3K80A 3MLXL 5E08H 3IJYA 4EQ3A 4OJYA 1OCCB 1I8KA 2DWEB 2JKSA 1RUAL 3HR5A 3MNVB 4NOBA 1X44A 3UTZA 2OQJB 1KCRL 2QKIA 3POHA 2CUAA 4DKEL 3GINA 5DHMC 3U0PA 4X6CB 4YAQA 2N1KA 4CW1A 1IE4A 4G8GB 1LMIA 4P46A 3QIBD 4QF1A 3QNXA 3ABGA 3GXMA 4JFPB 3GSOB 3EO0A 3QJQB 1ITCA 4KRMB 4YNYB 3WJJC 4MNGE 4B95C 1JHKL 1IBZA 4J6RH 4WFHE 1MKFA 3RDTB 5HVHB 2FX9L 1ZGLB 4G9FD 1WFJA 4JY5L 2K8MA 3FRPA 4Y9FA 3N06B 4ETYA 5KSVB 3B5GA 4MDJB 5K9QG 3LHAA 5T1DL 3ZE0B 3RURA 1R5WB 4X6FB 2LQRA 2ZXEB 3QDGD 3S35L 3IN0A 1LK2B 4L8BB 4GW4A 1TOXA 2MOQA 5DHYA 1WD9A 4OGQC 3ALXA 4PGZA 5CS7A 2R1YB 5E56A 4ZTPH 3BLPX 3RVVC 3IGKA 4FMVA 4EAEA 4GMTH 2BW5A 1KF9B 4GFTB 1DBKH 3D2UA 2Q8BL 4HKBA 1Z9SA 3L7FA 4KXAA 3SDCB 4QNPE 3LH2L 5I1LA 2I7SA 2H2SC 4WUUD 4WFFE 3OKYA 3O0RL 1BPVA 4L4VB 4XNUH 1T22B 4KROB 1PG7X 3FB5A 2XFXA 4X6EB 3G6JA 3VSVA 2PWHA 4KI5D 5DO2C 2FSDA 3TNNB 1UB6B 4MSWA 1W8EA 2P5PA 4IBUA 1FBIH 1UA6L 1UM5H 3L95A 4PJXE 2KYIA 1A9VA 3TBSA 3KCWA 4X4YB 4NRXA 1E65A 1AHWB 2H45A 4K5MA 1IZKA 1UG9A 1O6SB 1FZMA 3EO1B 4TULH 1JZ7A 2H0PA 1CF8H 4FTVD 3RVTC 5LHDA 5E2VL 3TT1L 5F9WB 2F8VA 3BEVB 3MRFA 5F3BB 5BRZB 3TVMD 4B9GA 4OV5A 5ISZA 2EDBA 3VXPB 1OT1A 2CCLA 4PJ7F 1ZA3A 3KPRB 1RK7A 2MOVA 4K8RC 4RMSA 4XWGL 5I66B 2YC1A 3HE7C 3U4BL 3MLRH 2BP0B 4ZNCD 4XO3A 2J12B 3CMOH 4IKJA 1XL6A 1FF5A 2DQGL 5AAWC 4F33B 2WIIB 3O6FD 5FA4A 1Z3RA 5DUPH 5IOPB 2ODIA 2OSLB 2KLSA 5I5RA 5JW4N 1UD3A 4MFHA 3N42B 5B7FA 5DD3L 3BP7A 3KVDD 3O8XB 4ZW6A 5CAYB 2R0WL 3H9SD 4TNGA 5A1AA 4Q9QL 3Q8BA 5IESH 3ARDC 5GRUL 1ZHLB 3NA9H 5I6OA 2ID5A 3GSVA 3NH7L 3VXMB 1OP5K 5FW6A 5F6HJ 2DBLH 2PW1B 4OTXH 3UJTL 3A24A 1ZS8B 1WBXB 1IC7H 1UCBH 3CN2A 3RIAF 2AABL 3TEYA 5AB2A 1P7QD 1EHLL 2KH2B 4XNYH 5LQBL 4JHUA 2XZQH 3MHZA 1BQHA 1OTUD 2BSSB 4PS4L 1USZA 2Q86B 2VSCA 4QRQA 4DF9A 1IBYA 2X53A 3AWFA 1TQBB 2JJWA 4XRCA 5DJ2A 3QGVA 4TPRL 5F7YC 1HHIB 3F58L 1ZD6A 4S0SD 4DO4A 1GGIL 5EC1B 1KB9K 4BKLB 1SYVA 2ISDA 1R3KB 4OLVH 3FT0A 4P46C 1EO7A 2WM0A 5IB2A 3LIUA 4UT9L 3T3ME 3HUJB 2CLZB 5IW6A 3HNVL 4RGNE 2NY1B 2P9RA 1R17A 4GO6B 4BK5C 5JORA 3OB0K 3EW3B 1KN2L 2H7WA 2XKNA 1NGZB 3RWFB 3QEHB 3RVWC 5KYNA 4HAFA 4JN2A 1OLLA 4Y4HA 2N01B 3EJCA 4PREA 2CU9A 2F7IA 3UTTB 2J3SA 3OXSB 3WAJA 3QCVH 3VA6A 3HPLB 3ORJA 3NABL 4GJTB 1IKFL 5E2UL 5BCAA 4PJ9B 4ES9A 3FT4B 4J3OG 4B7LA 5BZXA 2V8LA 1EDHA 3ABZA 5ICYB 1AXTH 4ZNEE 4KJWD 1CLZL 3EAKA 4L18A 4JY6B 4JO2H 1WAAE 4OM0L 1BX2B 3GMOA 1AOZA 3IDJB 4Y2OB 1MY5A 2JI1A 3WNOA 1U41A 1OSZB 3IMVA 1WDAA 3KDMA 2Z4QA 2AV1B 2CR6A 2MNUA 1FYTB 4ZK8A 1A2YB 1JWSA 1ZTMA 2AVFA 2QVTA 5FV2A 2F6AA 4X6CE 1VFMA 2CO6A 4GQPH 4FADA 2QGCA 3SKNB 4PGEB 3C5ZB 5DFVC 5FLUA 5JHDE 2KLRA 3LX9A 4M1GH 3KLKA 4BRVA 3F7VA 4MB5A 1BBDL 5FYLE 3QI9A 4ANVA 1WYJA 3T09A 1OPGL 3R1GH 3F6JA 4K2UL 4LAQH 4WVRA 5E8NB 4LCCA 4YR6A 5DF0A 1N19A 3ARTA 2ICWB 1H0DB 3I75A 4BZ1L 1MFVA 1QLEB 1OF2B 3L17A 3G08A 3L9EA 2VLKA 4NQTA 2MCAA 4XBEL 3CLFH 3PPSA 1E3ZA 1CR9L 2KQMA 4MXQD 1OL0A 4UCFA 1CN4A 3ZJAA 4M7LT 4YGVA 4JAMA 5AYQA 3UJIH 4GXUM 4DKFL 4KNSA 3QEQE 3GIZH 4U33A 2VN5A 3ZGIA 2X5PA 2G75A 3K2UL 4CRPA 2X4UA 4R2GD 1WT5A 1ZSDB 2CHXA 3ZK0A 4BE5A 4DKAA 1WITA 4I2XE 4JKPL 4G8IA 4FXGA 1G9NL 4R7DB 4A55A 4FQ2H 4HF5H 3PU7A 3HG4A 1OO2A 1J48A 1A5FH 1FHGA 3QUXD 4QRTA 1D5RA 4KTEL 5KVDH 1P0SE 3P69A 3TWCH 4YQXL 5BVPL 1Z5LB 4I0PA 4JANB 1DBBL 1IGCH 4GSQA 4WEBL 3S2AA 4JPKH 3KVPA 3GJFB 5AVTB 4LLWA 1WBZA 5BRZE 4ZOBA 4LCIL 3QZBA 3T0DA 4MMYB 1HL5A 3V0DA 3EGDB 1IGIH 2CUHA 2Y1YA 1MOEA 3ZXAC 2JKTM 2CKBA 3UZVA 4HIXL 3WUWA 4AGLA 2OZNA 4M3HA 3T77B 1MCFA 2PNDA 1KPUB 4IMLA 2HLEB 1S8DB 2VXUH 4N1EA 3IM1A 4Y4HC 4WU7A 1R3IL 1YO4A 2R4RH 3ZDWA 2IF7A 4F15C 4IJTA 3MDJA 1Q8MA 2YPLE 3TM6A 3ZT6A 5BV7H 5I1GL 2Y2YA 3LNDA 4ZS7H 5E9NA 3VD1A 1OT4A 2H9GA 4NKOB 4MD4B 3MLZL 3QDMA 4P5TB 1JD9A 2P43B 1HTYA 2XPGB 4P57A 5FKPA 3SKJL 3HZYA 2EYSA 2Y5EA 4I1NB 1HEZB 1GVIA 1W0VB 3BP4B 3MNZA 3QEGL 1E30A 5GGTA 4HPYH 2VDLH 4KC3B 3UC0H 2CJUH 3WL9B 1T21A 2B14A 2G30A 3FT1A 5J8OA 4CNIB 5D1ZB 4YDZA 2GTWA 2FIRT 1F97A 2MJWA 1SVCP 3VRJB 1FH5H 3RUGA 2QQNL 5MERA 3ELAT 4OF7A 5F21B 3DJZA 2FYVA 3VGHA 1RVFL 3QYNA 3WY4A 3ZQWA 2AQPA 4XVTH 5A6IA 5F7BA 1P4UA 3DPDA 5KYYA 3QI9C 3QNFA 5GRVK 1RSYA 2PYFA 3MMEB 4LSUL 2YBRB 1ZK9A 2AMGA 3HE6D 1RUPH 1IGJB 3SO3C 2A4ZA 5F70A 1NFAA 1F4WL 3JWDH 3H0TA 1YMMD 2WXHA 3HA0A 3GBMH 4PJHB 2WQRA 1XR8B 3X14A 4A2FA 5EEVA 1RUQL 1RJZB 2EINB 3DETC 3BZFA 1ECYA 4ANKA 2R59A 3ARYA 1QSED 3LPFA 3QXDB 2A83B 4U3SA 3WNNA 4KVPA 2X42A 4GT0A 3ZE1B 5FPIA 3RWCB 3FMGL 4FXGC 3P1VA 2YD4A 4N2BA 1P7BA 5FCUL 4AENB 1JPGA 1NCAH 5EWIH 1EJ6A 4M7ZB 2Y5QA 3IDMB 5CCKH 1L6ZA 1QSFE 4NQDA 4RDQF 1YY9D 4I0PC 3W0WE 3G7TA 2Y7SA 3DX7A 5DVKA 1YUHA 2HRLA 2NXZB 5JLZB 2MCPL 1ECZA 3U36B 5F9DC 3NIGB 3NJVA 5JHMA 3MV9E 4GB9A 2ZXAA 4N2FA 5FEBA 3U9PH 1KGCE 3T65B 3VFGH 1JV5A 1IKNA 4O2FB 4YSDA 1BD2D 4GI6A 4YDIL 1IFGA 2XQBH 3DTDA 3OAZH 5F0MB 1BVLB 3RX5A 3VFWB 1D2OA 4ZPTB 1JJUA 2XVKA 3B2PA 2FJGB 5EUOB 3CSBA 2ICCA 5EPMB 1L9SA 1NMCB 3QRGH 1E5BA 4I5BA 1HCYA 4TN9A 1KLUB 3B2UD 1L0PA 1XZ0B 3KPLA 4ADIA 2ADFH 5I30H 3GHBH 4ZUVA 5CN1A 2DQMA 4M6MH 3HS0B 3OL2A 5I1AB 3CDFA 4NKMA 5GRWA 3DMMA 5AOKA 4A04A 3MPCA 2R9HD 5DSCB 4JG5A 3MFFA 5ICXB 3UH8A 1WA0X 1KNOB 2QMKA 4OLUL 2J88H 2DYRB 5SWZA 3RWDB 3U4EB 1A25A 1J11A 1ADQA 3MRDA 4NWUL 5GSVB 5B22A 2ZONA 2V2TB 4U0QB 5B21A 5PAZA 1EGJA 2AJZB 3DOSA 1TO5A 2PW2B 1TJHL 1SLUA 3CHPA 2RJMA 3D1MC 3BDBA 3F7YB 3VI4E 1PNCA 1ZA6A 5C9JB 4UNIA 1L7IH 5DDHA 4PRHB 5GQBA 4K8RL 1XIWA 1J0KA 2MQCA 2GY7B 3PP4H 2HRPL 4NX0A 1CDBA 1IILE 3REWB 1Q94A 2NNCA 3HC3H 1SXAA 3O6ML 3P4LA 1NOFA 1CDUA 2O72A 4LNRA 3JV4A 1VCBC 1F1DA 3F64A 3NZUA 3IE4A 4OGXL 3VGBA 4R6UA 4JRXE 5KUMA 1FIGL 1B3IA 1MCPH 2BIQA 1JF5A 4J5VA 3BQUA 1S7RB 2EE6A 3PL6C 4W6WB 4K23H 5I82A 1X9QA 4MD5A 1T83A 1OIOA 5FHBL 2X12A 2P5ED 2LABA 2WBWB 4M4RA 3WXWH 1N7MH 4XPTH 1FE8H 4YLBA 1SEQH 3ARRA 4XMPH 3GSNH 4NQSA 3PNWB 2EH8H 3TO4D 1L9OA 3MRQA 1SJXA 4YSEA 1QUPA 4Z3HA 4LU5L 4ODVH 1FNSL 4B9ZA 2JKRM 2OV0A 2WN3A 3CVDA 1DQJB 5ECGA 5ESQB 4A6YB 4AGOA 4DEPB 2XBTA 5AOLA 4OM1L 4Y8AA 5KSBF 3EYFB 4WNQB 1J88A 2VMDA 3IJSA 4FNLL 5LNGA 3JWNG 3N91A 2WBJC 3U7WH 3GF8A 4Q56A 1L0XA 4HH8A 4MNGA 3IVKB 3MROA 1U8LB 3GMLA 4U1MA 2Q5BA 2KT6A 2IDTA 1IKNC 4Y16A 4ZT1A 2AJVH 1WJ3A 1E0OB 2QSCL 2E86A 4IEFB 1UXLA 4GRLA 4Y9BA 5MI0C 1U8KA 3PHOA 3OAUL 3CVIH 3BUYB 1XBRA 2JTYA 2MQGA 3QEUA 3PWVA 4KMQA 2QMJA 4EEEA 5T3ZE 2C9VA 3MRKB 5ICZA 3FQ2A 2R7EB 3CPUA 4J39A 3ETBJ 4LPWA 4L4JA 2TAAA 3EG9A 4LF3B 4U7KA 3SYCA 5FECA 4JFFB 3CTTA 4K9EL 4WWKA 1XSOA 2BVTA 1IQDB 5I0WA 1XGUA 1O7SA 3DMMC 1QACA 2GABA 3FN9A 3WFBH 3M88A 1CG9B 4QDGA 3WEMA 4P5SA 2DQEL 2OCJA 1D5ZA 2ADYA 3NRPA 5E1HB 1XH3B 3ZL2A 1HJBC 1JF1A 1YDPB 3EH1A 1YEJL 3V52H 5I8OL 2IDSA 2FGZA 2XETA 3KXFD 1J8HA 1YY8A 2EO1A 2MIZA 5FC9A 5IMKA 4CVZB 2P5WE 2DQTL 1AI1L 4HSCX 1DP0A 2PWEA 5CBAB 1L9NA 3WNMA 4XZ4A 3S5LG 1M3IA 1KGUA 1Q9WA 1QP1A 3G5VA 3VFVB 4AM0A 2OCCB 3SKOB 4XMUA 4G43B 3IDXH 3NVQA 2IANE 1QLEH 3DUHA 1CVRA 4WK0B 5FO8A 3ZTCC 3Q6FB 3V4PB 2WQ8A 5JOFA 1N68A 1OAXL 3FQ1A 1HZHL 5IZ7A 1M6UA 4U1GC 3KL5A 3DGDA 2F2HA 5F7UA 1JXDA 1EBPA 2IH9A 1QG3A 2QVMA 5IFJB 1FIEA 3BQUC 1SEBA 3I85A 1MVYA 2GSIA 2QPDB 1THCA 3QWRD 2WQXA 3GMPB 4P06A 1AGDB 1U30A 4RMTA 5T3XL 5AW3B 3RIFF 1T83C 2CA3A 3D30A 4NM4H 3CE1A 2EC8A 5E2WL 5I8KL 3PHQB 1QSZA 2JQZA 2FD6L 3DXAA 2RMNA 4KQ3H 3BRDA 1IT9L 2B7DT 1U36A 4MMZA 4CGUB 1A6TB 4Y1SA 4ZTOL 3U9UA 1RXLA 2XTJD 1LP9B 2KUTA 5DD6B 5GGSA 4HWEH 3RBSA 1NJ9A 2CDFB 3IBEA 1KJMA 3VCLB 3QORA 4L3EE 4JZOB 4Q2ZA 1U2HA 1MCLA 4MJIE 2GIXA 4LKXA 4NO2A 1HKLL 3PUUA 5MEOB 4EN3D 4EDXB 4JY4B 4G42A 3ZDYF 5FYKH 5F7KC 3VXUD 4K3JL 3WDJA 3LIZH 3LQAH 3MR9A 2HVBA 4S0TD 2VR5A 3JYBA 1F3JB 3DWTA 2DTML 5JDSA 3VRIA 3KCPA 4XN5A 4B6ZA 3WD5H 4DKTA 3MJ9A 3JWNE 4Y16C 4FYTA 3BXNA 5ITFB 3KPTA 2DQCH 5B38G 1UURA 1SM3H 4PRPA 2BNRB 1YYLL 2BWIA 3WMQA 2JKLA 5KEZA 5CJ5A 4A1RA 4Z7QF 1HJCA 2L7QA 1AGFB 1E9QB 2EH7L 4W70A 5SX4I 5BQDA 2QPEB 1U3JA 2TRHA 2WVVA 1Z9PA 3D0AA 2IH3A 1WAAA 4XH2B 4WWKC 5F88B 2VWEE 1AIZA 2P28B 5CR1A 1AZZC 4U4IA 5E9DB 1YEKL 3QS3A 1HINL 1UD5A 1UGNA 4P4KB 4ABUA 3FTGB 4KFMA 2BPBA 2XDHA 4XPBH 2NYYC 2W07A 1P84K 2IPTH 1NLDL 2HX9A 2Y36H 4PWGA 2EIZA 4X6BB 4BK4A 1GYAA 2VLJB 2W0FB 3FB8A 3RIAK 4LBAA 3B9KD 1QR1A 2C7UB 4W9JC 5IJVA 1PD1A 2L3BA 4GSDH 2VKWA 2QDWA 4ISVA 5E23A 1OCZB 2WIMA 4PGBA 2UY6A 4HKJA 4G70B 4Z7VA 4C4KT 5BNXD 1FO0A 1KG0A 4PJ5B 1JK9A 2EC9T 2FO4A 4XWOC 2WWMD 1HAUA 1SOKA 1MNNA 4PP1D 4MNQE 2PP8A 2CHDA 4LLMB 4P5MA 5C0AD 4ZUSA 1MFDL 3QEQA 3MRPB 5EFIA 2BRQA 1H6FA 4KJQD 3VQLA 3ULVE 4GQQA 1NGYA 3IRPX 1WE5A 4UIMB 5T3ZH 3HFFA 2YOCA 4JQXA 4I2XA 2BOCA 3X12A 3CZSA 1LO3H 1RZFH 3CVHB 1NH6A 4G8GD 3EXLA 3T2OA 2GBUA 1W8NA 3FT3A 4TOYH 4H8WC 4APQA 2UZXB 3HCVB 4HD5A 3SD5A 2CGRH 1G7HA 3MLWH 4MMZC 2VLME 2AJYH 4YHKH 4PH8A 1R34A 2C4FU 2Z9TA 2PCPA 3ES6A 1QPKA 3RDTD 5CKGA 4WHTB 3PWUA 3BKYL 4BELD 2VL4A 5D2NB 1KFAL 2IH8A 2PO6B 3QORC 4Q74A 4HIHA 2E7LA 2D31A 1WS8A 1T5WB 3GTVA 3IN2A 2EE2A 4KKBD 1UXMA 4O51A 1S7XA 3I74A 3GRWA 3FH8A 5HDQH 1KCVH 3U1PA 3HRPA 1FGNH 1WISA 1D9KB 4RGNC 1HHHB 3GS4A 3R0MA 5EZJB 3SDCD 1DQQA 1Q72L 2GK0B 2M83A 3PV7A 3LZFL 4AMKH 1ZIBA 1OGTB 1YNTA 4GRWE 4LLQB 1UT1A 3RTQA 4PPTA 4QHUB 5I17B 4L4VD 1B4RA 3L9RA 1C5BH 4KROD 2RACA 5KVMC 3NIDF 2XZCH 1RK0B 3KBHE 5EIIG 5F7WC 1ED3B 1N10A 3NESA 1WP6A 5L88L 5I1EH 3D08A 2VQ1B 4AJYV 5C0EA 1SLVA 1YC7A 3FQTA 1GAFH 4PRDA 4BWTA 3EDDA 3MXWL 3MNWA 3Q8FA 3U0TA 4KI5F 2VXSH 1DQML 3CX5J 4FZ8H 1MCEA 5LXGL 1KPRA 4DIXA 1NANH 4UF7C 5GGTL 5GRVL 5BRZD 3GSQA 2BSEA 3LAFA 1DQDH 3H55A 3OJ2C 3U2SB 1PKQE 1ZV9A 3BC9A 3KPRD 3OLGA 4JVPA 5EOQL 4CILA 3KM1A 4XN7A 4JDVA 1PZAA 2IH1A 4MA3B 3TJEH 5AB9A 3QXWA 4WTZA 4AZ8B 4OUUA 3FZUD 1E9PB 3B4NA 3PWNB 4R96B 1BFTA 3JT2A 3GXTA 5L2KB 3ABLB 2OMZA 2R0LH 5J89A 3TH2T 3LNIA 4TUJB 4NCC2 4WI7A 1GPOH 1A14H 3O8XD 1FRGH 4A2HA 3WE1A 4LSRL 1QKZH 2VO8A 1GGUA 1HXYB 4X8CA 1GW0A 1AO7B 4M02A 2B0SL 3VXMD 3DARA 3ARBB 3GDCA 3VXOA 3L5WB 2ZCHL 2HUHA 4PQXA 2DLGA 3TA3B 4ZD3L 1RPKA 2VDMB 3BAWA 4FLOA 3LTVA 3PXHA 1LD9B 4Z5RA 1Q0YH 5B1BB 4AIEA 1PJWA 4WI4A 4MQXD 5F1KC 1JZ8A 4JQXC 2F1BA 1YN6B 2R1XB 1MJJA 3CFKB 4WI6A 1MIEL 4JM2B 2ZE0A 1EANA 4PJAE 4K7PL 4QOKD 4QY8A 1QSFA 4JL2A 3DBXA 4QYOA 4APQC 3UACA 3HC4H 4KKNA 2WZAA 2DQJH 1XBDA 1AFVH 2NY1D 5TE6H 4F7EA 1I1YA 2MCG1 5F72S 1EMTH 5DXWA 2CIKB 4A6YH 5B1CA 4BK8A 1CU4H 1CGUA 4ZAKB 1HDMB 3ATAA 2OMWA 5FYJE 3UTTD 5EO9B 3SOBH 1I1AB 5D7SH 2R2HA 5H2BA 3L7EA 4FL4C 3OM3B 2NY5H 2E6PA 1GZQA 3DJRA 2GK2A 4AGPA 4G5ZH 5TQ0L 3DHUA 2F0CA 2OMYA 1YMHA 3EGSA 3PGFL 2GW5A 2D9CA 3ZTEA 3HLKA 3L9BA 3VXQB 4WWPA 3SGKC 1FYTD 3WFDH 2YA0A 5EOTB 4B3EA 3FT2A 4R9HA 4FA7B 1ZT1A 3KPMB 3D7PA 3C5ZD 3NCJL 4GT7A 4Z7NB 2I60L 4KZDL 3T2PA 3L4ZA 2VO5A 3BSGA 3CFDA 1ADQL 1N6VA 1OK8A 5FM5M 2LFGA 3BVVA 3DHMA 4J3OC 4PGDA 4A39A 4WAFA 3M86A 4OIBA 4YWGL 2GJPA 3G6DL 2J8HA 5HI4D 1WZ1L 1YN7A 1SLWA 1F4YH 3MN8A 4X0KA 5T5FA 4CJ0A 1YEGL 1VA9A 2FLBT 3BDYL 2GITA 4Y4KC 3REVA 1A7RH 2IQ9H 3EGXB 3GXUB 4PD4K 3LEXB 4XNMB 1NFDE 2W80C 3MZGB 4JFDB 1ZTXL 3T0WA 1A6UH 3LS5H 4GLRH 5C0BB 5JW4R 2AV7A 5F6IC 4HWBH 3OKOA 4N6RB 2D7PA 1QMUA 5F7EL 3TBBA 5KBDA 3DO4A 4Z0XB 2EZ0C 5HY9B 1SPDA 1T1ZA 1RP9A 1X5MA 3GM8A 1T5XA 5AVYB 3GLEA 4M1CC 2HFEB 2YQGA 1DJWA 1QNZH 5CEYB 2AP2A 3V4PH 3VDCA 1N0LB 1BF2A 4JJOA 5KUKA 2ZWSA 1RIUH 1IAKA 3CX2A 2VJXA 1VCAA 1YHPA 5I74B 2KDYA 1TZAA 4I77L 4NKQB 4X7EC 5FYKD 3HEIB 3OKDA 2F19H 4HS6B 3RU8L 5C0ND 1DUZB 2HB0A 1EJ8A 1JERA 4UZSA 1AC6A 3FSAA 3WLBB 4U1JA 2V4LA 3F8UB 2EIKB 4XPHH 4CAGA 3MLYL 4MKTA 2P8MB 2ADIA 2Y5TA 4U1KB 4JHWH 2Z31B 1L3NA 4H5SA 2VDKB 5FO2A 1F3RB 3LZQA 5I8CA 1AR1C 4H44C 3PJSB 1YSOA 3BQVA 4AYMC 4ZUUB 5DO8A 1BAWA 1KV3A 4TVPH 1BAFH 1ACCA 7FABL 1ZWIA 1XAKA 5K5YA 4WGKA 3L54A 4L37A 1HAWA 4QXUH 5DMKA 2D2CC 2XVLA 3CN4A 5FDYA 3OLDA 4HGMA 1HYSC 2V3EA 3PV6A 4JPQA 4AV0A 2AEQL 3OZKA 4QRUB 2VLRE 3BW9A 1OM3H 1ZEAH 4AYFA 1MNUH 3MRRA 3EYUL 1FZJA 4P5TD 4W4OA 4RFNB 2X2UA 3KH3A 2H5UA 2CE6A 3BGMA 4JB9L 4Q8BA 1IJNA 1TZ8A 1NCCL 3K6IA 4OT1H 1HQ4A 5GZOD 1GW6A 3F83A 4M5YL 3FTUA 1HSAB 5K9JL 2XWRA 5C07E 4JUTA 5D1ZD 1V7MH 4WTWA 3V8OA 3VGDA 5J06A 4FQQB 5I5JA 4AQ1B 3GPEA 1ACYH 2UZYB 4GKSA 4PHXA 5DJ0B 4DPBX 4M5TA 2EDEA 3QAZC 4JZJA 4MQ7A 3SDDA 4ILDA 5J11C 3SDXE 4QKTA 1YQ2A 5F7FA 1I3RB 3PJNA 4ZUWB 1XGPA 2F53D 3O9WA 1XWVA 2CHWA 3CHSA 1WD8A 1W6WA 2JCCB 4PRAB 4WGWB 2WXGA 4PW9A 4IRSB 1RZPA 5ESAA 4CL7A 2O6CA 4YOKA 2J56A 1SUHA 4EOWL 3US0A 3PRZA 5FWQA 1EAQA 5D7IB 3FOLA 2CIIB 4FRWA 2Y2TA 4XO8A 2EICA 2DQUH 4HIQA 1MVFA 3FB6A 4HX1A 2UXTA 7CGTA 1FORL 2FWOB 1BREA 1CDIA 3F2LA 4WO0A 3BKJL 3BAKA 3DROA 1ZDQA 2NZ9D 2W65B 3W9DB 5F89A 2R51A 3MRHB 1BFOB 5DRWA 5FM8A 1SFDA 3RAJH 4H8WL 3APNA 3PFUA 4JDZB 2R69H 2NXZD 2QGBA 3DX8B 5E99H 3CFCL 3MRLB 4G8EA 1E5ZA 1QTSA 4P59H 2WAHA 4PI0A 3CVHH 4XPGH 2H6UA 2D2OA 1FL6B 1S9WA 2XQYG 3AC0A 5I26A 2OTUB 2UY7A 4L3EA 4YHIB 5TDNB 1KIPA 4MJIA 3VXTA 4F7TB 2LT9A 1G7IB 3QYMA 1F1AA 5DI8A 4APXB 3IU3A 1V3MA 3KYAA 1U8IA 4DZBB 3CXFA 1VGEH 4XMTA 1I7ZA 1UH3A 3AS3A 1LO2L 3BPLB 2WZPD 3UTPD 5E4IA 3LD8C 1NDGA 3CSYA 4NUQA 1M1XA 1XCQA 5K33A 5HDLA 5C0BE 3ROLB 2PWFA 3D18A 3K72B 2BC4A 4HIEA 4NHUA 3RGBA 2APBA 2WNXA 1JCKA 3TJHC 5FUOL 2XWEA 1P5VB 1WAPA 2J73A 5AKTA 3VSUA 4AEIH 2XWJA 4JZNA 4HXAL 1BLNB 1NM4A 4N8VB 5DHDA 5G4NA 4W4OC 5J7CC 1PLCA 4E9LA 4S1QH 5J3HC 1OARH 5IQ9B 5E1AB 3QPQC 2PPEA 5TGBB 1ZLVK 8CGTA 5AKRA 2NQDA 4GP8B 2XYBA 1QBLL 2HRGA 5FOBA 1J9TA 3VQ1C 5J6HB 3LSOB 3QQXA 1LEKA 4X6DF 1QRNE 5EO1B 2EADA 5E4OA 1UWXK 2DL2A 5SX5H 3UTSA 2COQA 4PRHD 1NCWH 1AQKH 3DK0A 4JZJC 4UINH 1CICA 1S7UA 4UV4L 4DERA 5KBNC 3RIFK 3O6LL 3SDDC 3ILPA 2BSDA 2IOMA 3CSPA 4XP6L 5BXFB 3A6CH 5CGBA 3O9WC 3TEZA 2C9XA 4S1SL 3KR3H 5LN8A 5MEQB 1CL7L 4L2LA 2W1NA 2X9XA 1DJZA 4ZFZA 1I53A 4F57H 2EEAA 3M17B 4E9QA 1YEHH 2WXFA 4C4BA 3LS4L 2FTAA 2OXHA 2OMVB 2BIIA 3L5XL 4MNQA 3TJPA 3D3VA 1SXBA 1JPFA 4Z77B 3AQZA 3V0HA 1UKQA 1U21A 3QHFL 3AG2B 3WNLA 4WO4B 2FB4H 1ADWA 2IXQA 2YEZA 2H41A 2ZP0T 3MJ7A 1FDLH 2ZUXA 1F86A 3EOTH 2XWBA 4TQ8A 1KEGL 1XH1A 1T04A 4AVJA 3B56A 1JI1A 2V37A 2VDMH 5F9JA 4UAOC 3RVUC 5IBTL 3E2HC 3I50H 5F1OB 3TEWA 4M7LH 2HPOA 1OE3A 3ESOA 1G7MB 4OZHF 43C9B 4ANUA 1EHKB 3VRLF 3TCLB 2R8SH 2IAMA 5DRXB 4ONHB 4HOMA 3UCQA 4XHJC 5I19L 4Q58C 5H35A 2XHNA 4RFOL 1KT2A 1KTKE 4R83A 2PYEB 3WG7B 4NUJA 2E7CA 3X1FA 1MHCA 5KAQG 4Z78B 2XNAA 4TNVF 4NSKA 4U31A 3GRWL 5EZOL 4NHCH 5FUZL 1U8NB 3D69B 1L9PA 1XGQB 5D7IE 3FFCB 4Y4FA 1XH0A 1O9ZA 4UBDC 4O02A 4JFFD 5CZRA 3ZX1A 4DGYL 2B16A 2L8AA 3EJJX 3JWNC 1UEYA 4UILL 4YXHH 4GG6E 2VISB 3BSZH 4UQ3A 2VSMB 1OWRM 1MQKH 2DD8L 2JSFA 1LYQA 2KZKA 4UNTA 3HVNA 4F1SA 1TMCB 4L9LC 3T6QC 1CDHA 3L3GB 3ZKXC 4LSQH 1PS3A 1XTMA 5B38A 2EIBA 2XIDA 3JVFC 5DQ9B 5DRZA 1UYWH 1RU9H 5DHVB 1DFBH 1CXFA 1VHPA 2BDNL 3RFZA 1TSRA 1ORQB 1RFDL 2VWEC 4IDLA 2YAQA 4FFWC 2IFFH 4L3FA 2LR4A 4RQQB 1JGVH 5CP7A 4AGNA 1JUFA 4AK1A 1NL0L 1HQRA 1V3LA 1CICC 3WEAA 1PSKL 2YGVA 4N2KA 1L0YA 3I9AA 5DFAA 4C57C 5EOCH 4JFHD 4LQFH 1K8IB 1LO0H 3II1A 3DV6B 2ZWKA 5GJTH 4MYWB 5F7NC 5F3FA 3TPUA 1PW3A 3D85B 3WV0A 5LG1A 1BAGA 4BDVB 3FJTA 4WY7H 1A6ZA 3V0WH 1Q9KA 3BUDA 4DVBB 3TH3T 2W0PA 3B2MA 3QDGA 4XCEA 4XAWH 1DQVA 3ASWA 3ALWA 4QNPF 3EBIA 4HCGA 5MP6H 1LEIA 4JFSA 4R5TA 3IKCB 2EUZA 3KPNA 5E6ZA 3ZE2B 5CR8A 1A4KB 3KJ6L 3OWEA 3U83A 3ULVC 1RAMA 1SXZA 4KHTL 4UTAH 25C8H 4YBQC 1DBJL 3THML 2O1AA 3BDXA 4UQCA 4ZDHA 1EJOL 4TVPD 3QPXL 4NDMB 1B90A 3FUJA 3QUMH 3TOPA 3LRKA 5IUSA 1LE9B 4GAFB 1QWHA 3BZEA 1E6OL 2Z3FA 3TESA 4N90D 2IAMC 4JJ5B 2X9WA 3DGCR 1BG9A 4NZDA 1ZLUK 2UWEE 2I5YH 4PFEA 5HBBA 4HGWA 2XT1B 4OLYH 4X4XA 4EI0A 4M62L 4GKNA 2RBLA 4NN5B 4KKAC 3FONA 2CD0A 4R7XA 2VDKH 5CSZA 5IK3A 2BNRD 5A43C 4AYID 2ED8A 3LN9A 4K55A 4OZ4B 5GS1B 4ERSH 3D51A 2IALA 5HYEA 3DV4B 3V4VL 2VMJA 3EFDH 4UT6H 4R8WH 1UJ3A 2VDNB 4YIQB 2XSKA 1DJYA 3S3CB 3O6FA 3S88H 4Y4FC 1WIUA 2FHCA 5D4HA 5GHWH 2DZEA 4EXKA 3PABB 5K39A 1PZ2A 2VRQA 2ITCB 4MASA 2VDPB 1RZJC 5E9DD 3RILA 3MBWA 3H9SA 5ADPH 4P4KD 3RY4A 4X99A 3TIDA 3MUHL 1SXNA 2HT4C 3LH8A 3G5ZA 2VLJD 5GGUA 3V7AG 1GOGA 2JB6B 3DURA 5AG9A 4BFIA 5JHBA 4QLWA 1P7HL 4W9KC 4QHKJ 4AM0Q 1GGCL 5F71A 5EIIA 1W72B 3LXUX 4KTDH 3NZHL 4PUBH 5K1JA 3HFML 4K3GA 1S5IH 4YHOH 3W9EA 3S36H 1AHMA 1SZNA 5T5FL 3WSQH 3GUTB 3WS3A 4PJ5D 5I76B 4OAWB 1DEDA 2J71A 1TG8A 4ZFOB 3WEOA 3IDNB 3IDGA 3QISA 1MRDH 3QFDB 1E4WL 2AJ3A 1KWKA 3ZUCA 5C2BL 4PMFA 3ARQA 3IGAB 4N26A 4X7CC 5GXBB 1HCFX 4U1HB 3SE4A 3VFNA 3VWJB 5DGRA 4X98A 3LJ3A 1HYRC 4CVUA 4L1LA 1FLTX 4LLVA 4P2OA 3DECA 4JPVH 4LLYA 3H3PL 3ULSB 1BBJA 2WOBA 3HZMB 1KXVA 3OC8A 2NW2B 2R2EB 5KW9L 1USQA 3RIKA 1OTSD 5AZ2L 4P2QE 3FU7A 3IK2A 4KDW