4JDEA

Crystal structure of pud-1/pud-2 heterodimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
144
structure length
144
Chain Sequence
SQLTRRTAKVSIDNQTGSHFKFQVTHKYTGWDADKSDVVMFQPDEVKEIFKSVAYNTGFLTTGVDNWLVDGTMVQERTEVDNKGHQIGKKSYIEHAKFISDSRSWKQHMLTAEDDGKTTTIRVFPTEIHFISPSGESTTTFTKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of PUD-1 and PUD-2, two proteins up-regulated in a long-lived daf-2 mutant.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Unknown function
molecule keywords Protein F15E11.13
total genus 32
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2013-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18457 PUD1_2 Up-Regulated in long-lived daf-2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3820 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jdeA01
4JDEA 4JDEB
chains in the Genus database with same CATH superfamily
2GJZB 3GXPA 1K2DB 3QXUA 1MQKL 3BN9D 2CALA 1O9VA 4PJEF 1MIEH 4BZ2H 1CDYA 1WFOA 1WFJA 2WQUA 4X9HA 1FP5A 4AYGA 1CDBA 4G8EA 5K9KA 3UJJH 3C87A 2W8CA 2YARA 2BSDA 3MV9D 4FGMA 2Q87A 1QW8A 3KPPA 2BO0A 4OF3A 4XVOA 4MJHA 2WLLA 2YC1B 3MGOA 2A4ZA 2VW6A 4J8QA 3HS0A 5LBGA 3BQUD 1F6AB 4L1SA 5B3JE 1X5GA 2YD6A 2CGYA 3G5XB 1SMOA 1NCJA 2QSCH 2KYIA 3CFBB 5GRJL 1IL1A 3OR6B 3NJIA 4U33A 1JV5B 2CIIB 1G94A 1UOWA 2VJXA 3U9UB 1QZNA 4TRPL 2D4FA 3X13B 2J6EA 5KWYC 1TITA 2WIMA 4MJJA 4E9QA 5I5RA 1XF4B 2PCXA 3PHOA 3VWJC 4CBPA 3GC3A 1RCYA 2NCEA 3UDWC 3GGWB 4Y2DA 3BZDA 1QMUA 3W3BA 5FO8A 3VA2C 4HMDA 2B0SH 4PJAA 4OT1H 5CFHA 1AKPA 3KGRA 1DCLA 4JM2B 1E50A 1FBIH 3GSNA 2PTUA 5AYTA 3SODB 2M1KA 3ZZ1A 2BCKB 3D2UA 1QVOB 1MVYA 3SDDC 3C5ZC 5EZOH 4NQSA 2X4RA 1MN4A 4IEFA 2IPKA 1YY9D 1WVZA 2CLVB 3A67H 3PYCA 2KLSA 2VSKB 1RJZB 1RHHB 3CFJA 3QZMA 1J0HA 3OKLA 2FSEB 4P46A 2FT7A 2Y6TE 1YYLL 5CJXA 4NQEA 4LU5H 5D6DC 1JI2A 3TEYA 4LSTL 1VFMA 1NC4B 4U1JB 4OF7A 4DTGH 1SY6A 4A2LA 3AAZA 2G0KA 5ILTH 4F3FA 2VO5A 4J23A 3KPPB 4K73A 3V7AE 4PN6A 1CBVL 1MJJA 4JZNA 3CN1A 4U6YB 1OP3K 4E42B 5HDLA 2JH2A 3QAQA 4KO5A 2AS5M 4F7TB 8PAZA 1LK3L 2BP8B 2F74A 1T20A 1SFDA 1IGIL 1W0VB 3QFDB 2VUOA 1BM7A 2CM5A 3AT9A 4JB9L 1ZE3H 1SLVA 2VZ3A 2EE9A 4MZIA 4OCWH 5CD3A 4M3KB 2XN1A 4OLYH 5TGBA 3HG1B 5HSFA 3HJEA 1S6NA 1D7CA 4WO4B 2C1OA 1V55B 2MKLC 3RWIB 4N24A 5D2NB 3BIKB 3CN0A 1TT6A 3BSHA 2HJLB 5CSZB 1YN6B 2CO3A 1KTDB 4X6FB 4RMBA 2ZPKL 3QSKB 3DETD 4LKCA 5AW5B 3TESA 4X80H 4GT7A 3CPLA 4L1BA 5T3XH 1SMAA 3Q44A 5I82A 4DP4X 1ZS2A 4WFHE 2V5YA 4A37A 3ZYJA 4YSPA 5B1AB 4LK4A 1W72A 4M1CD 1XSKA 3B56A 3I9GL 2DL2A 3ULVH 1MJ7H 1D5ZB 3FPXA 4HEME 3FQXB 2CCLA 2K70A 2NTFB 2XFXB 4S1DC 4ZFZB 3SJVA 1B0GB 3UO1L 2PKDA 4TQPA 1D5IL 2N7BA 2C3VA 3BE1L 5HY9A 3VWKD 1Q94B 3TV3L 2AVFA 3O9WC 5I9QB 5DHYA 1DN2A 4HUXB 4HJGA 5F0PB 4DKAA 1D5XB 3PE9A 3CSFA 4LHUA 1M6OB 3OR7A 1AD0B 1QR4A 5EIIA 3OKEB 2YA2A 4YDKL 1RUAH 2I07B 2VTFA 3VXSB 3QJTB 5LLIC 1OM3L 1U8QB 4MAUH 4QXGH 5IVOA 1A6WL 3DXAD 4NBXB 4AUJA 2B1AH 1JFQL 3B4NA 3L3OB 4KK5D 4N87A 3UROR 3RWJA 5F70A 2DI9A 2C9QA 1T7ZA 2G4GA 1YC8A 5AENA 3T2OA 3UMNA 4HUVB 2AJSL 4FX5A 3GI8H 5H94B 5H4YA 4I77H 3T6ZA 5KBDA 3QAZC 3CIQA 1CYWA 3LD8B 1J1OL 3TZVC 3WIHA 2YPVH 1HQ4A 3L1GA 4Y9FA 5DHEA 4ALAC 4WV1A 3VRJB 5DWPA 1CFTB 3T08A 1QO3A 4HS3B 4JCWA 1NANI 4K15A 3PDGA 4GB9A 4NC1E 4MQTB 3M45A 5SWSA 4JK0D 3QI9C 3VE0A 1OSZB 1UH4A 1LD9A 4MB1A 3N2JA 4YIQB 4FQQB 4AH2A 1SDDA 4O58H 2M83A 3NA4A 4UINH 1FL3B 3V0AC 3FTSA 2KERA 5I1CH 3OKKB 3HC0B 3MKKA 3CQPA 1AR1C 2EIZB 2IO5A 5IB5B 5LCVH 2R0ZL 4HAGA 5I17A 2B15A 3WY1A 3DI2B 3X12A 5TDNA 2E9BA 3QO1B 4PRPA 1LMKA 2DW5A 1RP9A 2YGQA 4PUBH 4NO2A 3DBSA 5KYYA 4JCMA 3G5VB 4HKBB 4AVIA 3EGSA 3QUZD 4PYHA 1MG2C 1CBVH 1LWJA 3GINA 4FEIA 1JZ6A 4H44C 1Q9WB 1ZVYA 4J8RB 1GZQA 3DX2A 5JIIA 3O4OC 2C3GA 2BZCA 2VISB 3DX7A 3VRIA 4YPJA 5TDOA 5D6CB 1TNNA 1A0QH 1I8AA 3KPRB 1CGUA 4M4RB 3ALWA 4ZXBB 4M03A 3VWKB 1A6ZA 4XNXL 5E6RB 1OPGH 5F72S 5CXPA 3NPSC 4Z0XB 3CHQA 5DD6B 3UGXA 5D7EA 1G7JB 5BZDA 4LCIL 2NW3A 1PSKL 1HAUA 4NNXA 3TTSA 3ZU8A 3BUTA 4LQ1A 5HDBB 5E2TH 2JB5H 1FAIL 1IFHL 2XDHA 3KLSA 1DCEA 1PDKB 1EMTH 1TQCB 2UY6B 3HUJB 3C5SB 3HVDA 5F6HJ 1GIGH 1UWXK 3FT3A 3K8KA 5ITBH 5C0FB 3QNFA 2VLMD 1NL0H 4L4TE 5DVLA 1QTSA 3NYKA 2DQGH 2Z9TA 1EGJH 1Z9SB 2B20A 4PWFA 4WY7L 3U9PH 1XGUA 1CXEA 3IDXH 4HPYH 4NPYB 2QHRH 2BY3A 2IDCA 2P5PA 3NA9L 1H6FA 2GABA 5F1OB 3VXOA 4XWGH 5IT2L 3L5XL 4WO4D 2DPKA 4ZJ9A 1LEKA 2B7DT 3D12B 3ASNB 3ARGB 3LNDA 4JFPA 4F7MA 1S9XB 5FECA 2PTTA 4PWHA 4TLSA 1W8OA 1KG0B 4CGTA 4N5UA 4Z0BL 2A4CA 5IGXL 2XN0A 2OR8A 5DC9B 1WFMA 4YDKH 3SDYL 3Q06A 3V6OC 5JOPE 3NIDE 5CR8A 3KPQB 4IOSA 5DJ6B 4NFBA 3UTSD 3P30L 1JFQH 1PY9A 4OF6A 3GMRA 5TE6L 1MFEL 2V17L 3GSNB 4YHYB 2AJSH 2JK5B 1QO3B 3C6LD 4GRWB 4HS3A 5CINH 1BZ7B 3C60C 5TH2B 4I77L 5DYOB 3QIBC 3VRJA 2XV6B 4HEMA 3RI5F 2D9QB 2ZJSL 3WFHA 3E6FB 3S4SA 2O93L 1MF2H 4XP1H 3DJSA 3WFBH 4LLVA 2RTTA 5K59F 3E8UL 4PW9A 2BH0A 3GKZA 3SPVA 3VGFA 4A7GA 4JUSA 2DMKA 4XPGL 4PRDB 3CFBA 3TC9A 2OM5A 4PRNB 2V4LA 4O58L 2WNXA 1P53A 5FKPB 1NIDA 5F0LB 1N3NB 4NQDE 2VXTL 4H20H 3D87B 5LCVL 1N10A 3HI1B 1I7ZB 5KJRL 1ZTXH 3SBQA 5IR1A 2GC4C 5EO9B 5DJ0A 3HR5B 1OP9A 2YXFA 1WT5A 4IHOA 3S36X 5I75B 1IM9B 2WYZA 2BSCA 2OV0A 4OGYL 1UXWB 3TCTA 4F9PC 4UQ2B 3HUJF 4P04A 5DMKB 3PJNA 4Z1PA 2ZG3A 1UWEL 2HTKD 4JO2L 2AHIA 3MCG1 3D1MC 3RWCA 1JZ4A 1HKLL 4KTEH 5IW6B 2FBJL 3VI3A 5INDA 5CU9A 3ZE0B 4RMUA 2RB8A 1OPGL 3ZT5A 3QYMA 5BV7C 1T0NA 5JHDA 4PLNC 5FGSA 4WJ5B 1CFQB 1QLRA 3O6KH 4HFUL 5DSCA 4YPGB 1BVLB 1G0DA 1HT6A 1TOXA 2JQAA 1JGUH 1NCCH 2QVTA 3TA3B 3FONA 4CVZA 3ZYIA 3GSWA 2LGNA 4BFEA 2VDNL 1ILSA 2XZAH 3EADA 4X5PA 3ZTJH 1Z9SA 1YN6A 4JNXA 3B43A 2NDFA 3NCFB 4XPBL 4Y4HB 1NGXA 1X9LA 1AMYA 4IRJA 5AOMA 4OGAC 3DHUA 2QHLA 1MWAA 5L0QC 5FAAA 4JVUA 2ZOKB 3A0OA 5ESQB 4C58B 1HNFA 1U8JA 3DIFB 4PJAE 4AXWA 4WLCA 5AAWA 4Z3EA 1KTRL 4I1NB 1JI1A 3D5OF 3MJ7A 4WHDA 2AJYH 4X6DF 4KJQC 4LSPL 5BO1L 1EUTA 1GTFA 3BPLC 2CXGA 3S34L 2X5PA 3VXUB 3ZE1E 5JNYB 3E1ZA 3OV6A 3UERA 1L9PA 2J1WA 1FSKC 2K78A 2BLFA 1R3HB 4G43A 1GHFH 2W9DH 1HNYA 1CXIA 4CADB 3BFOA 1PJWA 3T65B 2OSYA 5CCGE 3BP7B 4MRCA 2YWYA 5EEYA 1E6JH 1G9MC 3H0TB 5JXAH 4TNFA 4FHJA 4F7CB 3T0EA 1AQDA 4XN9A 3MUUA 5EO0A 43C9A 1CMOA 1RUPH 4J3OF 3BCDA 5CKGA 1AO7E 5E4EC 2O61A 1N5YL 1QRKA 3DX6A 5ACZA 2WINA 5C9JA 3FBKA 4NJAL 3FFCA 1R3KB 3RZCC 3VXMB 4F37F 4PYGA 1AR1B 5E2VH 2IALA 3N85H 3V4VA 1NGYB 4X7TA 4XMZA 3OKKA 2EO1A 1ECYA 1V5JA 2PYEB 3E8UH 3MJWA 2DWEA 4ZMZA 3BT2H 4WGKA 4N2CA 3AU1A 1IT9L 3O3UN 3QDMB 2V9QA 2VSMB 2QLYA 3PWUA 3OXRB 3MBWA 5HYQA 4PJ9A 4WWKA 5D1ZI 5EBMB 1NQBA 1DJHA 3KPRD 1UJ3B 4JPKH 4X6DA 5CWSB 3U7WH 1AO7A 1F56A 4FKKA 1G1YA 3L95A 5IQOA 4PJHF 1AS8A 4BA0A 2ZOTA 3DRTB 5T1KD 4HCIA 1F58L 2G5BA 4AQ8C 3W39B 1VA9A 3SD2A 5I8OH 1TU2A 3QPQD 4LB8A 3GXTA 4H8HA 1BYNA 3EJUA 2KMWA 1ZSDB 1ONQA 1BLNA 1FFNA 4MA1C 2CO6B 4PJIE 2ZOLB 1GPOL 3O6FD 3GIVA 3FCSA 4OT1L 3MLUL 4TMPA 4HSCX 4TL5A 2AW2A 3ELQA 1GOFA 2J73A 3PU7A 3HW7A 4I0PB 4JG0H 4OZFB 1KULA 2XTJD 3JWDC 4YPGA 4MDIA 3FB5B 4ACTA 3UTTD 1BG1A 2ALAA 1I7TA 3LS5L 4M61A 2JLLA 3ZE1B 1DQQA 4RGOL 3HHSB 3WKML 4D8PB 4GI8A 1EHAA 5HYJB 3KL0A 1DEEB 3V5HB 5EUOA 3P3SA 2ICWI 1I85C 1ZCRA 4UAHA 2UZXB 1YY8A 1CLZH 3SDXA 1EHLH 4LSRL 4R4FH 2R0KL 5J6HA 4JZJB 3AVEA 2NYZA 2WBJB 4IBZA 1BW8A 1OOAA 4WI0A 2WC7A 4B9JA 5ILTL 3LXCA 1BIIA 2QADC 4IBUA 1DBJH 3KW7A 5IVXF 3LMJL 1HQRA 3P9WB 3CPLB 1WICA 1FH5H 1JZ7A 1ZHBB 1G7IB 2DTML 5JHDE 5C0BD 3O0RH 4PJ8A 3ZL1A 2CNZA 4Z78B 4ZMWA 4MMZA 2ATPA 2BXZA 3SKMA 2XZQL 1ZVNA 5AW4B 2LU4A 3AZUA 3REWA 2XJKA 4IBLT 2WWMD 1IC7H 3MNMA 3O3DA 5DFVD 4HAKA 1HZHL 3AMLA 3BIBX 3MLYL 1SOSA 4KK9D 4HYTB 2XWEA 4Q8BA 2WGNB 2DQEL 2WXLA 5FGCE 2HMIC 4XWOC 4WCYH 2JIXB 3ABZA 3V8OA 5JXAL 2OKMA 3BVWA 2JI3A 2HAZA 2F58L 4RGNB 3SZ6A 1INDH 4N2IA 3O3AA 2BPBA 4M8UA 4OLEA 3WFHB 5JPMB 1JE6A 1IGCL 4N90E 1QFWL 5B38B 2UWEA 4QHLB 1ZPLA 1W0WA 3H2QA 3EBIA 4P5TA 1OE1A 4I3GA 1SLWA 4WW2F 2FX7H 3QDMA 4WU7B 3ARDD 4KVCL 1V7NL 2AK1L 1A1MA 3G04B 1RJZA 3OAYH 2DIBA 5JYLA 2AV1A 1OO2A 4JBSA 1JAEA 3RNKB 4F5CE 3UO1H 3S8WA 3D6GA 4OKDA 3VM7A 1E67A 1JG9A 4QRRE 2BK8A 4TULL 2QGDA 4QTFA 4NS0A 3TT1L 1JGEB 1CXKA 4K3JH 5ACZB 3HG1D 4MMXB 2LAAA 3NIGE 1UWYA 3AREC 1BD2E 2FE0A 1Y6KR 2QV2A 1XF2B 5KSAD 3BMVA 2YN5A 4PWKA 1PG7L 3WY3A 3MRRA 4UQDA 3Q2VA 5DO8A 1MNNA 1CLVA 2CZNA 2CCVA 3P3RA 3VGAC 4Z8FH 1XL4A 3WUZA 1YZZA 1N8ZB 4XT1C 5GGTA 3O9WA 5I73B 3QULA 1MFBL 1FE8L 4I18A 5D96C 2A5UA 4X4XA 4JGUA 3OGOE 3SDDA 4YC2C 4K5OA 1IKNC 2KPWA 3ZO0A 2F8XC 5ICXA 1K5NA 1AG0A 3F6JA 1SF5A 1BXXA 1CGTA 4L4TA 3MJ8B 5TQ2H 4PBDA 1XR9A 1GRWA 4QTIH 3F58H 1F0LA 4IU2A 1D9KC 2GJJA 1N0LB 2F1EA 1A6ZB 5IQLA 1PD0A 3MRJA 4OF5A 2X4RB 3FKUS 3MTRA 3MBXL 2BIQA 3FO1A 3WLWD 2BCKA 4WNJA 3SYPA 4YNYB 4ZTPH 2R2CA 2ZUQB 1IM3A 2RD0A 3KYKL 1ZA3A 3KYOB 2DICA 1PCSA 1QRNE 3QUZB 4RRPG 1IVTA 1QR1A 1IJ9A 1KCKA 1NDMB 1DJZA 3MACH 3NZUA 1KXQA 4ZW5A 1DEDA 4K23H 4AEFA 4CMMB 1FH5L 3DDGA 4OBSA 3O2DA 5IVXA 2DJUA 3CCHB 3T6VA 4PJEA 4YWGL 1LO0H 1CVSC 5BZWB 3X17A 3AITA 3IGLA 1SLXA 1FC1A 3K72B 5EBLA 4JREC 3SGKC 1SQ2N 2XTJB 5I1GH 5SWZE 3D39A 5HHOE 1HHHB 3BH4A 5LBSA 2HSIA 3K3QA 5KSUB 4FQJH 4EVNB 2GBAA 3H2WA 3N44F 5EZJA 2BJML 3MRCA 3PWNA 5J11C 3NABH 4Y4FD 3QHTC 5EEWA 4E0RA 4YDVA 4BKLB 4E41E 5C07A 5E00B 3TIEA 5I1EL 3ZSSA 4LASL 5HHNA 5KBLA 4JHBA 2HG5A 2I9LA 3RQ3A 3H9SB 2IFGA 4F8PA 1KB9J 5DJZA 3KPMB 3C9NB 1FN4A 3PL6D 3QCVL 3SOTA 4NZTH 4PJBE 1V7NH 2AK1H 3THML 4XX1E 1QZ1A 1N59B 4OD1H 1HCFX 5D1QB 3T4AC 1HFUA 5MEQA 2X2UA 1M56B 4WGVB 2AEWA 3NA9H 4LEXH 2LLNA 2F54A 1U4EA 4TVPL 1RZQA 4EZLA 2IALB 4OZHB 1K4CA 4ZQKB 3LZRA 4WW2C 5KAQF 3QE5A 1BV8A 5DK2B 1TXKA 3QS3A 3WXVL 1EEZB 1EJ8A 3NACH 1GSKA 4LF3B 1QFOA 4YSOA 4DK3A 1CD0A 1S7TA 2Q86A 1U2HA 1MCQA 1UZ8A 2R27A 5AAMC 3MAWA 3SDYH 1KB5H 1J5CA 1QD0A 2BSSA 5DK0A 1Z5HA 3GO1H 4XMLH 1I1RA 2MOVA 5A6LA 5C7ZA 5A2FA 4KKCD 5CLXA 1MFEH 2K9UA 3IAQA 3S3BB 2DLHA 5LXVA 4NGHL 4P05A 1M2VA 3G08B 5FUZL 3CBRA 1S8DB 3SGDI 1WPCA 4X5WB 4HU8A 2YEQA 1KT2B 4N6RB 2WQRA 2WXGA 4AMWA 1FE8H 3L4VA 3VSUA 1AYRA 2BSRA 3DBXA 3OSKA 4Y19E 2G3NA 4X2UA 2RACA 3P4MB 3RY6C 3UZEC 1R6VA 1U8KA 1XDTT 1UEMA 3O8XB 4AGNA 3CMOH 1QEWA 2ZWYA 3QCUL 1OALA 3H56A 4Y4FB 2A2QT 3T04D 3TBTA 4ELMB 2AEOA 1KTLA 3MLRL 3DHPA 5HHOB 4P5KA 1PDKA 1NCBH 2OL3H 3ROOA 3GMNA 4NNYB 1BJ8A 1TJIH 3TZVA 1KIQA 4GMTH 3HG5A 5EV7A 4NBYB 3DX1A 2CBPA 1JNLH 4RQQA 5C0AA 1MHCA 3TBWA 2QQQA 2BP8A 3PIQB 1ESOA 1WHPA 3X1FA 4TYUA 2CK2A 3NH7L 2C9PA 1MAKA 3N1GC 3W9DA 2JWYA 3SPIA 2Q8AL 2C4FU 3LB6D 5T8IA 3NAAH 3O0LA 2BNUA 4PRHA 3U6RA 1NPNA 4P9MH 1MFVA 1D2PA 2VXSH 2YLKA 4OQTA 3RURA 5GRYA 3WDIA 4DN3H 2Y3NA 3ECQA 3QHFH 3U4EA 3CC1A 2A1WH 1AJ7L 4GQ9H 1ZPUA 4F1ZA 5TDOB 3DGGB 2FBJH 4HF5H 1BMZA 2R2EB 3LKQA 4PB9L 5ALCL 3S8GB 1QLFA 3NZ8B 4NJ9H 1UC6A 3BGMB 1K3ZA 2XG4A 3HE7D 4G9FD 4FQXA 4HMCA 1G0XA 4TUOA 1XGYH 4ZUUB 1ZDSA 3KWUA 2XXGA 3BAEL 4QOKD 4S1QL 3IDJB 4PJ5A 4NZDA 4Z7VF 3MRNB 4XO5A 3CHPA 3T4YA 3EDEA 2X2IA 2JB6A 2AABH 5B22A 4JPIB 1A9BB 2ED8A 5FHBL 3CDGA 2W59A 2WLZA 4FHKA 4IU3A 5ETUA 5I15L 4FNTA 2NR6C 4JVPA 1B90A 2YXMA 5IB5A 4MCZA 4I48A 1KTLB 4Y5VC 5IB2A 1UOKA 4KH2A 4NM8H 2H2PC 3QPQC 4WGWB 1U8NA 1E9QA 4QI3A 2EEFA 1CTNA 4JKPH 5JORA 3ARUA 4F8OA 1NMAH 1S3RA 5C86A 1MPAL 3DX8A 1UHVA 1A8JH 3K2KA 2I27N 1URIA 1BVNT 3K6IA 4IRSD 2MSPA 1PYWA 1ZMYA 4K55A 3VXSD 1R46A 3IXAA 4UV7H 3BYYA 4NRXA 3L4TA 4JFUA 1RVFL 3CAFA 2J5WA 2FX8H 3TEWA 3TIEB 2GBVA 7PAZA 3LPFA 2YR3A 4KKRA 1IFRA 4JRXA 4Q74A 5I73C 3BP5A 1I4FA 4EE2A 3WS3B 3L4WA 4DEPC 3V0WL 1V8HA 2JELH 5D96B 1ZT4A 1DBAL 1TETL 1JNHA 3NQIA 1AANA 3CSTA 3ABGA 4WRLA 1AQHA 5KVGE 2O6DA 3QJUB 4KKAD 5SWSD 3OG4B 5I26A 3QYNA 3CGTA 3EF7A 2P42B 1CF8L 3G9AB 5A43C 3ARDA 3K6OA 4UQCA 4W9FC 3MOAH 4X5RA 5FR3A 4BFBD 1V3LA 4TVSa 2E46A 3GJFB 4FQ1L 2ZX8A 5JUEL 2WY3B 1ZVSA 5T1LB 1PZSA 1FFPB 1ADQA 3JT2A 3SQOL 3VSQA 1RK0A 3BPNC 1UM6L 3BKYL 1MCCA 3HPJA 2BMKA 4MQ7A 4FTDA 1WBZB 1FYTB 1IM3B 3TCLB 1ET8A 3BX7C 1QFWM 2ZWNA 2NXZD 3QNZA 3SDXE 3TGXA 2NX5B 4QRAA 4R96A 4P5RA 5JTWA 5L88L 1ECZA 5AFAA 4GP5B 1BPVA 3OF6D 2OL3L 3LNGA 4Z3HA 1E3ZA 2X7LB 4ODBD 3ZR5A 5JDSA 5HDQL 1O6VA 4XVJL 1QWHA 1MQKH 3ARVA 3HB3B 4IDLA 5LN4A 2V2TA 1SEBB 4N2LA 1VAHA 4LPCA 2ZXCA 3B6SA 1AXIB 5HVHC 4X6FA 3MLZH 3GZKA 1F58H 3IJEB 2VC2H 4M7LH 4DN4H 5LAXB 4AGPA 3FB7B 4TUUA 2ZCHL 4XCCL 4DF9A 5IJVB 5J11B 3B2UC 2VXSL 3MSPA 3MKGA 1UFUA 4U6XB 5T5NG 2EIJB 2V2XA 3B83A 4IGBB 2A6DB 2GIMA 3MGTB 1CJYA 4ZXBD 4ONGL 4IJ3B 1WSST 5D7JA 4QRTA 5E2UH 4QMEA 4HUWA 3S2CA 1WAAA 4X6DE 4DSYA 1PKOA 3U4KA 2IFFH 3EGSB 3FUKA 1KB5A 5B7EA 1EHLL 2HTKC 3H3KA 3ZDZB 5DUJA 2AAVA 2DQTL 3DRQB 4MBRA 2Y69B 1WGOA 4YDNA 4R7NA 3TJHD 1C5CH 3P3UA 1JNNH 1TZGL 4HV8B 1E3FA 3CX5K 3SYAA 1NFKA 3MZGB 5HI5D 2FO4B 2VZUA 3HFFA 4P2OD 2QSQA 2OMNA 3BXNA 5AOZA 2RAMA 1MFAL 3L45A 2FB4H 5BRPA 2F7RA 2PYEE 3L48A 4XHJD 2YHGA 4P5TB 3PLYA 3D33A 5CSBA 5F0JB 3RDTA 3DK2A 4DZBA 2E6QA 2G3ZA 3VVWA 1RUMH 2R0WL 2JXMA 1L9OA 4HUKB 1U8JB 2Z1PA 2EE0A 3NVQA 5DD6A 3B7YA 5DR5L 5AVVB 4HZAA 4AXWB 2Y7OA 1JVOA 1T89C 3M7OA 4J1UA 3WO3B 5GS1B 1UH3A 5DJDB 3DVNA 2VZ1A 2MPVA 3KPRA 5IEKB 2A9MH 5LO7A 2ZXWB 3TH3T 5ID0B 3K71A 3RVVC 1W16A 4LLWA 1NCAH 2J4WH 4GRWH 3H3PL 1T4KB 1KYFA 1VFAA 1BVLA 3WJLC 3MCLL 2DB8A 1VACB 2EYRA 3MGOB 1NBVL 1QFWH 4XBGA 3ULUH 5DZNA 3HLKA 1U93B 2YMXL 3LKOB 5D1QD 4UTAH 4G9DB 2E7LA 5IG7B 3AS2A 3FSVA 1SN0A 5F9AC 4FQ1H 3EH1A 2ZYSA 4R6UA 1Q1JL 2R69A 4ZI8A 4R0LA 4YXHL 1X6LA 4OVVA 2X4QA 3G6JF 3HKFA 3SQOH 2F0CA 5HY9B 3M17B 1WTLA 4IRZA 3STBA 4YHKL 4ZAKC 4AG4L 4PHXA 3I3EA 4MD5A 3MI6A 3QUML 4ZFQA 2HKFL 2HT3D 5C6PB 1WS7A 1KENL 1DVFC 4XBEL 2GT9B 1SHXA 1BXVA 2LFGA 3D9AH 1L9TA 3LTVA 1KLUB 3LD8C 3ULVL 2VR3A 2OI9B 1RD6A 2F1BA 4UT7H 4HKZA 4KTYA 3W0WE 4EI5C 3UIZA 1SVCP 3SE9L 2F8VA 4P2QA 1KV7A 3VU1A 2V5RA 4PREA 4G7QB 2FECL 1KYOJ 3AC0A 1D5IH 2ZT9C 3MGAA 3TVMA 4FA6A 3ETTA 5H4ZA 2YPLD 4PJ5E 3VJ6B 1ZSHA 5A7EA 3VXNB 4G8GB 5HGDA 2Q2LA 4OI9A 2YQ2A 3VI3B 3U48A 1BVZA 1U8NB 4F8QA 3B2XA 1C8PA 1KGUA 1OT4A 4BQ9A 3GLZA 2YGVA 4N6QA 4P5SA 2FX9L 2Z31C 3B9EA 4HJGB 5DZLA 4Z78A 5BUGA 4OB5L 5C8JB 3EJZD 2H5UA 2CO4A 3O4LD 4FFYL 1R4XA 3O45A 4KRPD 1P1VA 4XCYA 1EGJA 3GI8L 4PJCB 1T6BX 1F00I 4KI5F 3VXQA 5D1ZA 2W07B 3TBSB 1B0GA 2Z0UA 4Z7OF 5GRVL 3D06A 2ZXDA 4JKKA 3SB3A 1F3JB 2E7DA 2BVYA 2OK0H 3F05A 5GS0C 3UDWA 4LOFA 5HYIA 3RTQA 3FZUD 2EVGA 2DH2A 3D52A 1ICTA 3V5HA 4JRYA 1CIDA 2EDEA 1KYUA 2PYEA 5KVMC 1NCIA 1R47A 3PHAA 4JZOA 4OZIA 3MACL 1JZGA 3UYPA 4Y1AD 1HINL 4TSAH 2QGBA 5D70H 3RDTC 4XWOD 1NFIA 1U8HA 4WKXA 3N44B 4PVMA 4XVTL 3U46B 3OXSB 5IB2B 3KEHA 1OSPL 4Y1AA 2N7SA 2ZONA 1AKJD 4MAYA 4HG4K 3RAJH 3RB7A 5BVJB 1G9MH 3ZUNC 1MEXL 2H3NB 3WU1A 1ZSDA 4RFNB 1LO5A 4UWQB 3QRFM 3MVSA 1JHKL 3C12A 3ABKB 3FN0H 5F9OH 6PCYA 4FZ8H 4CC1A 5JOFA 3OF6A 1A7QH 4WJG3 5DA0B 4M8RA 3S37L 1A22B 2OJEB 4KHXL 2B4CL 5F9JB 3EGXA 1JV5A 1HCVA 1AO7D 1K4DB 2QADD 1XR9B 1G7JA 1A6UH 2XVGA 5CP3A 5DQDH 2LU7A 5F6IB 1QUNB 3DURA 4LASH 1AQKH 4NFCA 4DZBB 4M9PA 3DO7B 4AM0Q 5ALBL 3FSOA 4O02B 1EVTC 5L4MA 4OZHF 3MRPB 4QD2E 4JFDE 1B9ZA 1MVFA 2FQDA 4I3SL 1Q72L 4OZIB 1KJVA 4HW6A 3EBHA 4X8XA 4JHAH 5CZXD 4PAZA 1WAEA 1L6PA 4PBWD 3THMH 2A6JB 3VI3F 2CSPA 2Q8BL 4WNSA 1FZMA 3PUCA 4C4KO 4K94C 3WNJA 4IEFB 2X44D 3FQ2A 1G7HB 1GKEA 4U1GB 4AITA 3RJDA 1KENH 1N4XH 1PIFA 4EI5A 4H5SA 1KN2H 4I7ZC 3D3VD 4PRHD 3BRFA 1F4XH 1XF2A 1YEEL 2VLRE 3GRWL 5C08D 3LCYA 3U46A 1A6AB 2WLIB 3QIUD 3SE6A 3ATEA 12E8L 4NKMB 3SIKA 2G2NA 4QRTB 2WLHA 1IAKA 2NW3B 4MYPA 2H0JA 2Y7NA 4JY4A 3ZZSA 1KZYA 3CVIH 2HT4C 4MHHG 2VERN 1MI5A 1Q1PA 5JDSB 1U8OB 3KBPA 1JZDC 4WI5A 2CQVA 6FABL 2GSGB 5IMKA 4YVUA 5IHZB 2KQNA 5IW3A 2EACA 4A7QA 2R1YA 1J8HE 3DDFA 3AGWA 3ULUD 3BDYH 2EVIA 2HG5B 1NSNL 2VDRL 1W80A 1GZPB 3O41A 3IGUA 4BK8A 3IFLH 3TN0A 1FA4A 4PS3A 1EZLA 5TE6H 4KBPA 3MJ9A 4DP0X 2WBJD 2PW1A 2KI6A 4M5SA 2BW5A 2AJUL 1YYML 4PRPE 5CINL 3M8OH 5D2NC 3L9YA 2OXHA 1LP9A 2LQRA 2YQBA 3QUXC 3L3IA 5CHNB 4PB0L 5HGDB 1TTRA 1K4CB 4OCRL 1KLGA 3OB8A 3OWEA 3PDDA 4ORGB 5BRZD 1W8NA 4P2RD 4GPVA 3LN4B 3MUY1 4CUCA 1M7XA 4PEEA 1S7SA 5D1ZD 3ARXA 5E9NA 4XPGH 4HULB 5KUKA 3FAWA 3FU0A 1RQ5A 3GSXB 4P49A 3BVVA 5T1MA 1XSIA 4KTGA 2W38A 1AHKA 2OA9A 4XNYL 1ZHKB 4BM7A 5DFTA 1VADA 5HJ3A 5DFWH 3VJ6A 1ES0A 2WTRB 2YFOA 1UURA 3MPCA 2LABA 4RA3A 4K3EH 2Y7QB 1QR1B 3OKYA 4KUZH 5KSBB 1CT8A 2WZAA 3ZTNH 3ABLB 3OJ2C 1J05A 3SQBB 2QTVA 5E03A 1KB3A 4GW5B 5KW9L 3WLBA 3JYBA 5CM1A 2NT0A 4WEBH 5SWZB 1CG9B 2Y2WA 3NJKA 3WFDH 5KBKA 4Q6YA 3MYJB 1DUYA 1XH0A 2Z8RA 3FZUC 1IM9A 5KVDH 3NJHA 1A5FL 1FZJA 4ELDA 4FFWD 3BPLB 5LGHL 5I1IH 3KR3H 4K71B 5CZXC 5AW6B 2ICWA 3Q5OA 4KKBC 2NNCA 3FFDB 5I15H 4G83A 2HJLA 4GP4B 2A74C 5CSZA 1ASPA 4ODTH 5BZWA 3KAAA 2G75A 1T7VA 4QIRA 2NPLX 4IBVA 1JGDA 1RFDH 1TJGH 1ZEAH 2COVD 1PLAA 1YNTA 1HSBB 3UEZA 3QT2A 4MNGE 5DF0A 4MD0A 3V6FB 1JPTL 3LKNA 3O6LH 2VDNH 3CZJA 4LDCA 1WIPA 1VFBA 3R06A 1NCGA 4RMVA 1J9SA 4ELME 2V3DA 1PKQB 1YRKA 4NRZA 3QI9B 3RVWD 1RVFH 5INCA 4PJ7E 1KN2L 4Q0XL 5ICUA 3UG3A 3HG1E 1O5DT 1K8DB 4ZPTA 2CU9A 4APQA 1OLLA 1EHKB 3QJSB 2VRAA 5BS0A 5DO2C 1BXUA 4Q9RL 4U1KB 1LK2B 5BOZG 1HHIB 4YO0A 3DVGB 4J3BA 4EI5D 3OXRA 1OW0A 4LPVA 1A4JA 2GK0B 3FO0L 5DRXA 2IPUK 3A6CL 3TO4B 3PWJB 4XNZB 5JHLH 3QUGA 4G5AA 3QIUA 4HALA 4CW1A 2YEVB 2P5ED 3T0DA 3O2VH 4Z9KB 3VFMA 4RZCA 4WU5A 3HI6H 4HJ1A 1CF8H 1T04B 4WO4A 1DE4B 3SDCD 5D6CA 2VDOB 1FYHB 5AW0B 2Y3AA 5AW3B 3UPRA 1SXNA 1FLRL 3NJFA 3MNZA 1RUPL 4NZUH 5C0DB 4MXQD 2E59A 2N0KA 5C71A 1DBML 1GC1H 1YHPA 2VR6A 5DRNA 5I0ZA 1R1CA 4KK6C 3OAWA 4N22A 1NGQH 4WSGA 2UXVA 4QXUL 5D9SA 4IOSD 2AJUH 1ANUA 1MDAA 4U6XA 3HPLA 3UTSA 5LDSA 4NJAH 3RY6A 2DQMA 5G2NA 4XBPB 4B9FA 4OZFG 1IL1B 4PJ5D 4CMHB 4DQOH 3GFUA 1CCZA 2AZAA 2YZ8A 4HUMB 3NRPA 4P2CG 4PS4H 5E2VL 5E8EB 5KVFE 3RKDC 5FS5A 1HZKA 5B1KA 2HFFB 2YA1A 2B0SL 4KQ4L 1R3LB 3FH7A 1UVQB 1E2ZA 4Y4FA 4TL4A 2PO6D 3FT4B 4HIHA 2FHCA 5F9WB 4UILH 5LWYH 3RIKA 4YFLF 2VLRA 4Y9CA 1QYGH 1TQCC 5EZOL 2C4FT 2M8XA 1T21B 2R4RL 1SBSH 3F7YB 3MV7D 2NRDA 5D93B 3E38A 3SQBA 1KBWA 2FQGA 4NWUL 4DN4L 3KXFE 3HLAA 5DRZA 3P9LA 4YBHA 4YZFF 4BH7B 3ZE0F 4N86A 5DI8B 2K6ZA 3FRPB 2ZNWA 1U4FA 4DP7X 4JZJC 2FL5B 4EF3A 4M7JH 3EOBA 7CGTA 4YOKA 3ZO9A 4AK2A 3IMBA 3GEWB 4H2CA 1ZVHA 1ASOA 5I8OL 1DVFD 4ESKA 3VXRD 1UZGA 4PJGB 2WCGA 3KLAB 5E8PA 4DZ8B 3JWOL 1YECH 1IGIH 4CILA 1MCKA 1KEMH 1GMIA 4HX1A 2XA3A 5BCAA 4DGIH 3WNLA 4DP6X 1DFXA 5CHNA 4K8RL 4POYA 1SYSA 3QNXB 4HOWA 5AYQA 1FVDB 1J8RA 1OAKL 4KO9A 4U1GC 1GZHA 2BWIA 4YHML 5KS9E 2LU5A 4IKIA 4LBAA 3MRGB 3RLSA 1MUJA 5B3NA 2XFXA 1CK0L 4AW4A 3WHXB 1JN6A 2NY5H 3TN0B 1LLAA 3V6BR 4W93A 2HFTA 1TU2B 4NUGH 1KTBA 3NEEA 3O6LL 1A3LL 5F9DC 4X80L 1YNTF 1NCDL 1EAOA 2FUQA 3S97C 4H8WH 1UASA 3QIWD 2ZUWA 4TSBH 2CKBA 2P48B 3OPZL 3C08L 4AYDC 3UBHA 2X4QB 4DUVA 1LGVA 1S3KH 4OZIE 2C3WA 3AUWB 2XRAH 2WXQA 3QFJB 3ZTDC 4FYSA 3MBWB 1WAAE 5HHOD 5TDPA 1MCIA 1I9RL 3CNKA 4X99B 2ZUVA 4N8VA 4KZCA 2DMGA 4W9HC 3BO8B 1NCAL 2YO3A 2JJTA 1XIWD 2HWZH 1A6AA 5AL0A 3CZSA 5I75C 1OGTB 4APQD 4PMEA 3IDGA 4RGND 5ID0A 3WEAA 1IX2A 3K71B 1S9KC 3ULUL 2NW2A 5T3ZE 3CCHA 2DQEH 4IBTA 4P9HC 7FABH 5AALA 4UDUA 1NICA 3VD3A 1BYOA 1KGIA 2K9FB 4BWWA 5TJWK 4DOHE 5IY5B 1Q1JH 2X4TB 2XETA 4L4TB 4NC0B 1TZHA 1A6WH 3W39A 2YD3A 3ESOA 4QO1A 1X5MA 2RBLA 2PW2A 1G9EA 1NDMA 3I3BA 1ROWA 5DT1H 4JG9A 4UNVA 4APXB 4HJ0C 5EZLA 5HPMB 1X5KA 1FFQA 1OWWA 5DLMH 3GDBA 4H8PA 5D1XB 1MQ8A 1EJ6A 1T1YA 2VXVL 3P69A 2VSCA 3WFEH 3H9YA 3L9EA 1I8LC 3HC4H 2NX5E 3LRHA 3HAEH 3N43F 4WFED 4GAGL 4Y4KA 5CGYD 3V6ZA 3VAEA 1DANU 1MCOH 3DRQA 2BNRA 1AZBA 3EJZC 2XIBA 2GJRA 1CFSA 1UTDA 2Y22A 2IV8A 4MNQB 3P0YL 3EZJB 1G5AA 1PLGL 4GO8A 1RSYA 4LHUD 4M62H 1JP5A 1JTOA 4AYMC 3SO5A 2R4RH 3JV6B 3QYCA 1KYDA 3VYNA 2PPFA 4K3JL 3NRQA 3F7RA 2MOGA 4NWUH 4LCCB 4PW4A 5EIIG 2H32H 3IKCB 2EILB 2FJFA 1HXYB 4EKJA 5J6GA 3PL6B 4BZ1L 3X3FL 2P3YA 3O9WD 4YEFA 3IGAA 2QPEB 1NFIB 4U3HA 4MX7A 4Y2NA 5GRJH 1FNGB 3ZIMA 3NIDB 1YMMB 4YSUA 3TF7C 3VNZA 4K9EC 1QFWI 2DLGA 3O4LB 4TSCL 3DTUB 1EHNA 2IV9A 2BSTA 2OTUB 2V3FA 1YECL 3OAYK 4HIEA 2L7UA 5IVNA 1GZHC 1B4TA 3HKZA 4OTXH 4PIBA 4HIPA 5EFIA 3Q01A 4YFLI 4KO6A 4Q9BA 2CGRH 4H88L 3K46A 4RAVA 2VDKB 4WVRA 3V5KA 3WIFB 1IQDA 1OF2B 3VFTA 5D1ZB 2HJKB 2QQNL 3KJ6H 1YEIL 2IWKA 1W8EA 3VD1A 2VIRA 2C7FA 4HCRA 4Y2LA 5E0FA 1R5VB 5DD1H 2ZKMX 1N64H 4BQ8A 3O3BB 2EXYD 1FHGA 5EN3A 3L13A 1A3LH 4AEEA 4TN9A 1AGDB 1WTGT 1YYLH 2PABA 3KVPA 4BZYA 5BZXA 5GZOA 3PJSA 5HGBA 1NC2A 4M7LT 5DK3A 3DX9B 4GKSB 4Y2DB 2X1XR 2X6UA 1RUQL 3DOHA 1GIGL 2MQCA 3JVGA 3WSQL 9CGTA 4HXAH 1EFXA 2X2JA 8CGTA 4ACPA 2BINA 5C0IB 3HN3A 4D7PA 2XNAB 2VDMB 3ZE0E 4L9LC 3UJTL 1V10A 2DI8A 1JVKA 1DDHB 2JJTC 4HPYL 2R1WA 3V4UH 1FGVL 3MLVL 2B4CH 1PAZA 1X5ZA 1S7UB 2ADJB 1BWMA 4CVUA 3H9SA 4XWGL 2JKXA 2BX5A 3FH8A 4XN8A 4NZRL 4ZX5A 2EDHA 5CJBA 2R51A 3US0A 4G71B 2YAQA 3NJMA 4OKVA 3MLXH 4P4RA 3E6FA 3S4SB 3BKJH 3UTOA 3W1ZA 1G6RH 2ARWA 3OB0H 4RISL 1A2YB 1MCHA 2VRKA 3D85B 3CLFL 1M05B 2JK5A 4MJIE 3NABL 3QORA 4UBDD 5KTEH 1GYWA 3MX0A 1MWOA 3B2VH 1IFGA 4M48L 2WLYA 4WDIA 1AZVA 3NSCA 2A83B 4XMTA 5DTFB 3MRCB 2IAMB 3MUZ1 4AQOA 3K81A 1TTAA 3VACA 3NIDF 5D93C 1YY8B 4YSQA 2Z4QA 4L8CB 3PWLA 3VWJD 1OTUC 2IDQA 5HJDA 3VFOA 12E8H 3F7PC 3K72A 5EBLB 1M6OA 3MRFB 2ETWA 3ESVF 1T5WA 2W9EL 4JFVA 4Q4EA 4Y4HD 3TYFB 4ZXBC 4U6VH 5LVEA 1NBZA 2FVNA 1UXSB 4MSWB 3J7HA 3LB6C 3I75B 4NZ8A 4PJ5B 2XN9A 3TV3H 4DKFH 1XVSA 3WXVH 1AO7B 2D7QA 1CDCA 3BQUC 2G30A 3QWOB 4D0BA 3WEMA 4P4KA 3QUMB 2OMTA 4JDEA 3T8XB 4FA8A 1AC0A 4Z77A 5KJRH 3VI3E 3QEHA 1RZIA 4KJPC 4X6EB 4FTVA 3X11B 3ZN6A 1S78C 1DL7L 3K0WA 2UV3A 4HLZH 4P4KD 4CSTA 5IOKA 5HGHB 3MC0A 3CHSA 2NOYA 1SY6H 5HJBA 4MVBD 2EDWA 3FT2B 4UDTA 2V0AA 1TZIA 1SYSB 3QNXA 4NGHH 4RWYL 5BOPA 4JPVH 4FLSA 3QUKB 3TN0C 2NYYC 3QUYD 1UA6L 3D30A 4XAWH 1QSZA 4AYBA 4F92B 1VSCA 4BJLA 3D0LB 1HKLH 2PPEA 3N1QC 1NBCA 1KTDA 1ID5I 3KH4A 3HS0C 2P7TB 2WTPA 1MCJA 1KWGA 4WWKD 2Q6WA 1NCTA 4PJGA 2F19L 3E6HA 4X8GA 5FK9B 1XZ0B 1TVDA 3DXAE 4GRLB 4JN1H 3UBXA 2MEJB 1GY2A 4FEMA 3VG0H 5FM4A 1FZKB 2EP6A 4ZMXA 2V33A 1T1XB 5B1JA 3TP4A 3EOBB 5TGBB 2ZSWB 3UZQB 5D4QA 1GGIH 3WKNA 4BFGA 3MBEC 3KLHC 1RKRA 3EYVB 3N6YA 3BW9B 4LCUA 5I1CL 4J8RA 1ZANH 3CSGA 1G7LA 2A77H 1IEBA 2OPCA 3O8XA 3WHE0 1IGTB 1CFMA 3BJLA 3IN0A 4H25B 5MEPA 5EUOF 3GBNH 3ZQ9A 2ZKXA 4PG2C 4L4VD 4XO4A 3TO2B 4NERA 4AYSA 1L3WA 2ITFA 4O51B 4Y5VB 3NCMA 2ZYHA 1IM3D 3WO4C 4E41A 3BC9A 3QIBB 1V3KA 2OMVA 5JMRA 2OTWB 5AWNH 2V2TB 2OZ4H 3SDAC 4K2UH 1T5XA 1A5FH 2CLVA 1X7SA 2WXPA 1RULL 4JM0A 5B4MD 2OTPA 4UTBH 1TEFA 2BDNH 2NUPB 1S7WB 3C09B 5EEZA 2RFXA 1H3XA 2FT6A 1CN4A 1MREH 4MLSA 4NJ9L 3MLXL 3PAUA 2W9DL 4E9LA 3LQZB 4YAQB 1LILA 2A7BA 3IJ9A 3TXAA 4R4ND 5T1DH 2ZP8A 3HOGA 5ANHA 3PP4H 1IU1A 4ZMYA 4M5YL 1TCMA 3OKMB 4DVBA 1BF5A 5FEBA 5LGJA 1RZGB 1D5MA 1FJ1B 5AKTA 2BERA 2RHEA 3I6KB 3LHPL 1IAII 1JCKA 3F7KA 1U8QA 3A6BL 1AZRA 4PRID 3C8HA 3EOTL 5KVFL 3HA0A 4Z3FA 4Q0XH 4YE0A 2KBGA 2VDQB 4KMQA 5AD0B 1BFVH 4RX4D 1HE7A 5AB9A 1J86A 2O6EA 3BEVB 4LLQA 4E5XA 3CFEA 2Y23A 5I16A 4RMQA 2Z7UA 2EECA 1E28A 3CFIC 4E9XA 2ATPB 5CEZL 1KIUA 4OZGA 5IT2H 5F1IA 2DMHA 4BE6A 3A6CH 1ZHBA 1O9ZA 3LHAA 1AI1L 3TA3C 4BQCA 2BSED 4AYID 1MLCA 3PWPE 4KXAA 3ZKXB 4OIBA 3VFRB 1T03H 3BVNB 3FCBA 5T5FA 1DLFH 1TETH 1LMIA 3WLWC 5IMKB 4POZD 1DDTA 1I7TB 4LDOB 4AENA 3HNVH 1H19A 1FVEA 5TK2A 1DQLL 2CHNA 5HVHB 3N91A 2XYCA 5FOJA 4PGBB 1GTNA 4Z7WF 3CWGA 1J8KA 4ADIA 1MI5E 1J5IA 1BD2A 3WNPA 4GAAA 2O5XL 4KDWA 1LWRA 2D7PA 2DQCH 3FB5A 3NIGF 4DQOL 3COOA 3UZVA 4PS4L 4MXVE 1KIPA 1TZOA 5I18L 5DMIH 1TTBA 3CFDA 4NCC1 4PGCA 4Y16A 1DLHB 3FQNB 3NDYE 2WANA 1NUNB 3VFSA 4AIZB 3KHOA 5J0BA 2NQDA 1VEOA 2PPAA 1BLNB 1FFNB 1TLKA 1BEYL 5AG9A 4N20A 3QUYA 2X89D 3I02A 1FL6B 3E2HB 5CN2A 3WN5C 3VFGL 4JAMB 5CJXC 4LGSB 2E4TA 2WUCH 1PAMA 1SBSL 2ZOOA 3BUDA 4MCMA 4FABH 1EZSA 3MRGA 4U6YA 1P84K 3K80A 4F27A 1PLCA 3ARED 5K9JL 5BRQA 4WTZA 4RRPM 1J88A 5IHHA 2MCPH 4HWUA 1SDAB 1Z7JA 3P4OB 2ADJA 5I2IB 2KT6A 1YPZE 4I5BB 3U6XS 4KNUA 1X7QA 1KDIA 5G5DA 3S5LA 3MV8B 1XO8A 4DP9X 4YSAA 3ZYZA 1DSFL 3ETBF 5FFGA 3AU0A 5C1MB 1FGNL 4HWNA 2NMSA 5C08A 4N0CD 4AJ0A 5MP6H 4K2UL 3NIFE 4XNQA 3ML9A 3QDHA 2X1OA 2QKIC 3KM2A 3V4VB 4DGIL 3DVFA 5CD3B 1I75A 5HGBB 4NXKA 2CM6A 4J6RH 1NH6A 2PMZA 4OQ1A 5L2KB 1B4JH 3MCYA 2A6IA 4WEUD 2BS8A 3QEQE 3P4MA 1KY7A 4OD2B 3SKJL 4EIZC 1JRHL 4QY8B 4Y1AE 3SJVE 5IUCA 3V79C 4YDJA 3CVCA 4ELKB 3ETSA 1M53A 1CFBA 1IGCH 3IDMB 3QGVA 1R3JB 1UVQA 3NQKA 4NC1C 5HHMB 1MZYA 3AM8A 1IAKB 4JRYE 2FX7L 3ZGIA 4XOCA 1LEGA 2HFEB 4R4NC 2OP4H 4URKA 2V5SA 2AJYL 4FXLA 4XNMA 1IAMA 1YN7B 2VMJA 2QPFA 4CJ1A 3ZXAC 1JZ2A 4I0PC 3GWJA 4XCYB 1SHMA 5FM5M 2A6KB 2DLIA 1Q0YL 4ATWA 1EEZA 2UWEF 4DGUA 5A2JH 1IEBB 3IETA 2YPKA 2DQUH 4IIZA 3AJ7A 3HRZC 4IOIB 1S7VA 4M6NL 4OM1L 2MMXA 4PJIA 1NGXB 3BDBA 4IRJB 3VSTA 4RZCB 3OKNA 4JGJA 3AS1A 1KCVH 3JV6A 2J4WL 1PG7H 3C6LB 4I2XE 3KJ4C 3MRPA 5FC9A 1M7IB 4TUJA 3MCLH 4OJYA 4MHHI 4JO4H 3QDGB 4AEIL 4ES8A 3RZCD 3V6OA 4CGUB 2LAGB 3IMWA 2G3MA 5C0CE 1R5IB 2YMXH 4M4PA 4PY8I 1YCSA 4K7PY 2Z3FA 3H9SE 3ZHDA 2CO2A 5H94A 4ZT1A 5I18H 1NJ9A 3QI9A 1XF5A 3N85L 4P2RE 3FT1A 4FQQA 4PP1D 3MV8E 4JFYB 4JRWA 2ICCA 4P3DA 1I1YA 5SWQA 4FXKA 1T0MA 2DJMA 3APCA 4BEIA 4X42A 3MLSH 5FPIA 2WQSA 3A47A 3HCVB 4LVHC 2HLFD 3OHXB 4LPTA 3WAJA 2AXFA 2ITCA 4UOW1 1ORSA 3ZL2A 1P4IH 5DJ0B 4ZX3A 4AWJC 3MXVH 4TQHA 1BFTA 3UYOD 3NJGA 4FAAB 4YFEA 2P43B 3ZMNA 2IWEA 4KROD 1M9WA 3BP4B 1E90A 1YPZF 4PD4K 1R24B 4XPAH 4OFKA 3I6LE 3ECBB 5EOQH 2P8MB 1NANH 2KHAA 1SM3L 5K33A 1A1NA 3QXAA 3LRSB 4LOEA 4BBWA 3H7BA 3QFJE 3RWDB 1N2RB 4OGAD 1AG6A 2B5IB 2ZKWA 4ZZFA 4KRLB 3SPCA 4X4ME 3KYOA 1QFUL 4PJGE 1WFNA 4NN5B 4PJ9C 3IF1A 2X4SA 3P11L 1T4WA 4S0TD 2FX9H 4GS7B 3SE3A 4F2MA 2W07A 3W9EA 2CR3A 2B14A 2L0DA 3QARA 4YHIA 4M00A 3OZLA 4NLAA 3TA4D 2QQNH 4L4VE 4OCYH 4EN3A 3UH8A 1OGAB 3IDIB 2EDKA 4UIMB 4H40A 5CZRA 2JE8A 4U1SA 1HHJB 3VH8A 4CU8A 4OLWL 2I60L 4BGDA 5DUPL 3ISRA 4ODHL 5LQBH 1A4KB 4MQXC 4TM9A 2AJXH 3JVFC 4UF7C 1KCSL 2XN9E 4RAUA 3JZYA 4B41A 3I2CL 4C54A 3LMJH 2A6KA 1D5MB 1H3UA 3QXWA 1NGWB 5CZVL 3LQZA 1EFXB 5BQDA 1W6WA 4GNKB 4F7MB 3O0RL 2DDQL 1BIHA 5FYKH 3V0DA 1VF5C 1ZT1B 2ZXAA 4JHZA 4WUUA 3RWIA 3VFNA 2VDOH 4FERA 5IFJA 2DQFA 4NZRH 5JLZA 1S7VB 3MODH 2Y36H 5JO5B 3R7RA 3EDJA 3IFNL 4ALAH 4XOEA 4NQEB 5DUBA 2DQUL 4X5LA 3ARFA 5GJSL 3U25A 2FGWH 2P4AB 4OU3A 4NKOA 5T3ZH 2VXQH 4RMSA 1BOGA 5E5MA 1R3HA 1U8KB 4Q56A 1FG9C 5DHDA 4JKMA 5F0MB 1KCVL 1DJSA 4CVXB 5B38G 2F58H 2AQQA 1BBJB 1SXZA 3BKMH 1PZ3A 1ZIBA 4X50A 3MQIA 5CD5C 1IVLA 1FAKT 3UP6A 4YDZA 1BF2A 1KBGL 3L5JA 3T5WA 2PR4L 3NJLA 4LIQE 5J1AB 5I5IA 2G2RA 4L5FH 1F1AA 3T2NH 4EO5A 2FHBA 2EDRA 4B50A 5E8OA 5DYFA 4H5SB 1B2YA 4PJAF 4PR5A 3ROLA 3WL9A 5IF0B 3WNKA 1D5RA 3KPTA 3TURA 1Q9WA 1S2EA 1AXSB 5F1SA 3WEOA 2DEYX 5JIQA 3FUJA 1FVCA 5ESAB 4Z7VA 1MDTA 1QW9A 4XO8A 4AE0A 3GRWH 4GRLA 3UBXB 4W9DC 4QTHA 1KPUB 1B3JA 43CAB 1EBPA 3CLWA 1XGZA 2XWZA 3PHOB 4WK0B 3I9IA 3CG8A 1TCRA 4QYOB 4ZUTB 3ULVF 1OGAE 1I8MA 2W95A 5DS8A 3CSYB 4Z76A 1JUFB 2YA0A 4I0KA 4IMLB 1KGYE 4FTVB 4FA7B 1X4ZA 3BAYA 5HGGS 2LVEA 5D7KD 1HX0A 4Z7OB 2QQLL 2GJZA 2R29L 4B27A 5KVGH 2WO4A 4U1KA 4L1DA 1AVAA 5HGHA 4WV1B 1P1ZA 4RCAA 4AUUA 1V7MH 5EU7C 5GS1C 4XCFL 3HJ0A 1XCQA 2JQMA 4YHIB 5AOLA 5F7YC 4ABVA 2C7UB 5E8NA 1ODUA 5SWSB 3BDYL 3W9EB 4BFRA 3T0EE 5EH1A 4DN3L 4MB4A 1HYRC 1KACB 2CRIA 2NY5C 2CUMA 1X5IA 4JY6B 4NT6B 5IHUH 3P0VL 4NRZB 4CN4A 5FB8A 5I0VA 1VGEH 3GMLA 4NKDA 5F3HA 5EUOB 3QIBD 3L3JA 1G9NC 3IXTA 4NRYB 3Q7JA 1KCBA 1U8MB 3N50A 4LRIC 4R8WL 1MHEB 1HZLA 5ECGA 3M8OL 4X7FC 3S3PA 2X3CA 3BZ4A 4IKKA 4MA3A 4S1QH 5ICYB 1PYWB 1A1NB 4W70A 1PZ2A 6TAAA 3BI9X 1GGUA 1BZDA 2NZ9C 4X9BA 4PB0H 4KVPA 4PRDA 3BSZL 4L48A 1INQB 2I26N 5DTFA 2HN7B 3DX0A 3FQRA 4ZTPL 4C4UA 2CXKA 4HJ0D 1ONQB 3QHZH 1E0OB 3EFOA 5I74C 2OYKA 5DMGD 2F7OA 4K4KA 4EN3D 1T6VN 3OR7B 4N2BA 4AW7A 1GS6X 1U58B 2BFGA 3HS9A 5KG9B 1RIHL 3FULA 1JVLA 5ETUB 2H6UA 2P5EA 1RZKC 4HK0B 5B1JC 1TUPA 1OVZA 3PQYE 4WHTB 1UOLA 2O5ZH 1IE5A 1OTSC 1V05A 3Q8BA 4GG6B 3MNWB 2WZ6A 4J3SA 4Z7NF 1CG9A 4J3XA 4MJ6A 3TH2T 1T89A 1LO0L 1QRNB 2GSIA 5CWSA 4KFZC 3O8XC 3O81A 1CGXA 4WWNA 3SE8L 5A1AA 5AD0A 5C92A 2BVUA 1EPFA 1KPVA 5GZNA 1WYJA 4MMZC 3S35H 3T77A 3ZZLA 1EXHA 2Y36L 4L8DB 5D7LB 2NUTB 3QJHA 1RIVH 1RZ7H 4K7PX 1T7WA 1PPIA 5DD5L 2RQ8A 2XA8L 1FNFA 2XPGB 3N42B 3T0EC 2HCZX 1KIUB 3HHRB 3U7YL 3V0WH 2JELL 4Y1TA 2NY1B 4IRZL 3ARGA 5LGHH 1A3ZA 2YD7A 2DWDA 3W2DH 4I88A 5DVOA 2TSAA 5E1HB 5EN2B 5ECJE 5I1EH 5FV2A 3OLEA 1DBBL 4IIQB 5JW3L 2J2ZA 3MRBA 1KYAA 3C2SA 3CFKA 4B3VA 3DX6B 4LNVA 1UA3A 2FCBA 3WL9B 3FT3B 4FADA 2FO1A 4UT9A 1YEKL 1I4FB 2E7LC 2VSDA 1HL8A 1AZUA 4QUOA 3O3BA 4ZYKA 1QPKA 3UL4A 3PNWA 5AVUB 1Q0EA 3MRDB 3KCPA 2NY3B 1P7QB 3NOIA 2EC9U 3HR6A 4FFZH 3O6ML 2E6PA 1WFUA 3N40F 4GI6A 3NACL 1MCPH 3ZKQD 1A65A 2KDGA 3O8XD 5D4JA 1ED3B 3K74B 3T6XA 4TVPE 2DLFL 5KYUB 4YSRA 2UY7B 2K4AA 5E5MB 4MNGA 3F12A 4K07A 1EQWA 5LDUA 3OBAA 4WFGE 1G5GA 2OMVB 3ARRA 3TPUB 1UG9A 2F6AA 1OTTC 3MUGA 2P8PA 3QI9D 3ISYA 5JPNB 5EEXA 2IADA 4PJBF 3WY4A 3B34A 3E3QE 3WDHA 3C5XA 2EVFA 4PRAB 4JANB 2SEBB 4HPOH 4LF3A 2AEIT 4CJ0A 2HRGA 2AJZB 1NMBH 1CE6A 2P5WB 4PJHB 4CNIA 2EICA 4DFIA 3EFDH 1I7RB 4WSKA 5CCHE 4DEPB 5E24E 5AVQB 2F7IA 2KZWA 3RWFB 5C3IA 3DX4A 3MLWH 5FK9A 2ED9A 3Q3GB 3MLRH 4HV8A 2MRYA 2DD8H 2CIKA 3DUSA 3FHEA 5HPMA 2BVPA 4BQBA 2JCWA 4Y19D 3U4AA 3T2PA 3KXFA 2CLRB 4Q6IC 4ZUWA 1NGZB 3QBTB 1A7RL 3PGFL 5IMLA 1OAXL 1QABA 3DIVA 3APMA 4C4KT 2R2HB 1RIHH 1PD1A 1L0QA 3UTZB 4I13B 3OLGA 3FQWA 1EK3A 5F93C 3ECUA 2O5ZL 1G9NH 1MFAH 3IDGB 1T7YA 1DVQA 1OQOA 1E5CA 3MOQA 5JIPA 4LOUC 1QA9B 4R83A 4DP8X 2EADA 2NY2C 3QHFL 4UDUB 3U0PA 2J6EL 1SGKA 5IFHL 3S35L 5EWIL 3WV0A 3CMGA 3G5ZA 2JI1A 1LM8V 2K8QA 5LG6A 3ES6A 2BVOB 2UUDH 4X6CB 2EDJA 3OAUL 3C5ZD 1M1XA 1UUSA 4H26B 1XB3A 5DD5H 4L1LA 4KX8A 5EN2A 1F8TL 1HI6A 2QKIA 3BJ91 4DO5A 3NBNA 3T71A 4NM4L 5K39B 3HB3C 5AKVA 4NKIH 2C4XA 4BFJA 5HDBF 2D03H 2ZXBA 3SKJH 5DVPA 1F90L 4ANVA 3BLPX 4L0YA 1A25A 4JY5H 5C2BL 3RVTD 5H2BB 2IH3A 4QRUA 5FA4A 3U9WA 4NHUB 2H9GB 4NM8L 1NOFA 2ALWA 1F3JA 3HC3L 2J71A 3QUYB 4JKPL 4QOKE 4BE5A 2OBGA 5IVZB 4AIZA 2XHNA 2OP4L 3OB0K 4WHYG 1N0LA 2D2OA 4IGBC 3RE0A 4GRMB 3WEXA 4EJ1C 1NWOA 2YD5A 4WHTA 3TCXA 4R9HA 3FUHA 3WHXA 4JX0A 2E6JA 3S8FB 3QUMH 4B7LA 5AKRA 5CS7A 3IK2A 3QEUA 4QYOA 4FFWC 2XG5B 2IBBA 4R7DB 4YLQT 2BC4B 2XRAL 1U6AL 1Z6JT 4LPYA 3LZFH 4K5MA 4PTTA 2AANA 5FYKD 1WK0A 4J3TA 4UU9A 3SE9H 4Z7VB 5HP5A 3L17A 3TBCA 1B9KA 4YUEH 5E8DH 5E4OA 5E94B 3UABA 3MJ9L 4JFDA 1TG8A 5DEFA 3FRPA 4YSDA 2G5UA 5GS0H 2F74B 3TYGL 1ZS8B 5M95B 4PU2A 4H8WC 5C07B 3F7QA 1SVZA 1UD2A 3IJSB 4AGQA 5JW5A 4NHCL 5EOCJ 5F3FA 1MJJB 1X5FA 2YKLL 1BJMA 1BQHG 1LO4H 2EIMB 3ENEA 3QISA 5KSAB 4HHWA 4JDZA 3V0EA 2XN2A 2FDBP 3ZTEA 3ZKND 1OE3A 4EUPG 2CO7A 2OS7A 3OMIB 4X9YA 1J87A 3QH3A 1OL0A 2YOCA 3LDBB 2MCG1 4G6AD 3IDMA 1KELH 2EUWA 1FDLL 2AV1B 3CQQA 4MJ2A 5GIRB 1I7UB 4G1EA 2XIIA 4L23A 2BXYA 3FNKA 3TO2A 1FH2A 3IGAB 4GAGH 5E0QA 5I1DB 2Z31D 2EYSB 4ONHA 1BA9A 3HMXH 2ICES 5KAQG 1RK1A 4MCZB 3UX9B 3NRFA 3KS0H 1NIAA 4XVJH 4ZMPA 4JFTA 4CMMA 1EV2E 1E30A 1JHTB 3IGFA 3FQUB 3PGFH 4XCEA 4BFIB 1LJMA 4P0DA 4XPAL 1P5UC 1II4E 1T4KA 5SX5K 1H6TA 3V0GA 3UZEA 1J1XL 3PV7A 3WMSA 1OCZB 1ZA3B 2V8LA 4XNDA 1MRDH 1UCBH 4P2QD 4JL2A 5DJYB 1IGYA 3RVXC 4B5ZA 3VX1A 1CI3M 4G11A 1H9DA 3KPLB 4HGKC 4MNQA 2DMCA 1F13A 2ZCHH 4MTMA 4XCCH 5E9AA 5HPOA 2R7EB 1BZ9B 1L9RA 3TO4A 1QSFA 1IC0A 2ZX9A 4NX0A 3GSOA 4M8VA 1M3IA 5C0GB 2HLAA 3IDNA 3TO4C 1KCUL 1ROCA 2DWDB 1Y0LB 2Z92A 3OAUH 1W72H 4LVOB 4ONGH 2YUVA 4OF0A 2CLZA 5IM7A 2HXAA 4KHXH 1NLBH 3OGCB 4NHUA 2W1NA 4KXZH 4ZAKD 3W9DB 5HI4C 5M7QA 1GJIA 5GHWL 3MRLB 2AFNA 2IFFL 3FMGL 4MA7L 4NQXB 4OLYL 2WSKA 3PQYD 4WHYH 5D7IF 4N85A 3ZR6A 2VDQH 1BOGB 2H1PH 3CDZA 3BUIA 5FGBA 5ADOH 4L3ED 5DUPH 5FCUH 4ODXA 3SYOA 5F21B 1XWVA 3GMNB 5TK4A 2YRBA 1H8OA 4XMUA 2X6AA 3M1CA 4D9RE 1VFBB 3WKQA 2KPNA 5EUKA 1XZWA 4K9EH 3O2WH 4BZ2A 3LRSA 2Q8BH 1CLOH 1FC2D 1CFNA 2EE3A 2NYKA 4W81A 3DV6A 2AC0A 1FZOA 1IM9D 4CKVX 3S6CA 1HILA 4PP2A 3KBHE 1NWPA 1FNEB 1F4XL 2ERJB 4A2EA 2GKIA 1U6AH 2E5EA 3GIVB 2FGWL 2BOCB 1AQ8A 3QJRB 1FGVH 4WDIB 3HZ3A 3LXUX 3STLB 4OCSH 2WZPD 3MA7B 1OTTD 3VG9B 1J1PH 3ARFC 4YUEL 2YLHA 5E9DA 4BSVA 1RL1A 2D3VA 3WD5L 5DK0B 3OL2A 3TFBA 2BIMA 1A4CA 2HKHL 1AGCA 2PCPB 1NJ9B 4AY0A 3IN2A 4L29A 4FYRA 1G6RL 2X38A 1AHWB 5ACMA 1L9MA 2IGTA 5KOVC 2VL5B 3QIUC 3BWUC 4U0RC 5B39G 1PKQE 2AQ2A 4NHCH 1MY7A 1E5UI 1U36A 2LFEA 2VDRH 3CN2A 3KPNB 4HK0A 1K8IB 4YXHH 4ZMVA 3B2VL 1HL5A 2EEXA 4H26A 1IARB 4FQHA 3KLQA 4YHKH 5CJ8A 4CRPA 1WD9A 1KLFB 3GXUB 3F8UB 1N59A 1DN0B 3NJXA 1GGYA 3QS2A 1T1WA 4LCWA 1S7SB 4A6YA 1OF0A 5K1VA 3VXNA 2C8NA 3D9AL 3LSOA 3KHQA 4X0KB 4R5XA 1OSYA 3HMXL 3IETB 4LLYA 1T1ZB 5EDXA 3N1PC 5ESAA 4N0CC 1OGSA 3QORB 1R17A 4XP5L 3EUDA 3FO9B 1R5WB 4BCYA 2CHXA 3EYSL 3VXMD 4DKFL 2XWCA 1E7UA 4P2YA 3BVUA 5D5MF 2VABA 1S7WA 2ENSA 3DROB 1G1KA 3OG6B 4L37B 3V9CA 2VN4A 4JE0A 2V7NA 5L2KD 2ITDB 4JM2C 3SQRA 1P1ZB 2CHWA 4OBRA 4WUUD 4XX1G 4Z7WE 3LNHA 3GIZL 3HHSA 4JFWA 2YFNA 3C5ZB 1SHSA 1H0DA 2DQJH 4OJCA 5BZDB 1OB1B 3MRLA 1MCRA 2WNKA 3BN9C 4WFHD 5G4OA 2GW5A 3WO4B 1N70A 2BRQA 4JGMA 3HC2A 4PBVC 4CVXA 2C9XA 4ZTOL 3DKHA 4MBOA 2QZ5A 5KVDL 1HH9A 5AZEH 3CFCL 3S4SG 1HH6B 2GIXA 1X5JA 2EYRB 4LRIA 2YD2A 3KR3L 1NMCC 2JCCE 4EN3C 2WXIA 5CO1A 5I6LA 2IG2L 2FH8A 4XBPA 2IBZY 4IU3B 1CL7L 3PF2A 3NFNA 3G7TA 3OWRA 5DA4A 4AQEA 2QL1A 1MFUA 5BRZA 3BOVA 3BDXA 4LCIH 5IWLC 4XMKL 3T3PE 4TPRH 2ZKHH 1DVXA 4OGXH 1DQDH 2IH1A 4ICXA 3IMRA 4FQ2H 2I5YL 5DJCA 2ESVE 3EOAB 3LRKA 3QUKA 2DQIL 1I1FA 4AT6A 3ERXA 4BFFA 2W60A 1MY5A 2QVMA 4HK3J 1SJMA 1JWSB 3IMVA 1TF4A 4CN1A 1XEUA 3IMTA 4I18B 1E5AA 4ZYKB 2YD1A 5T5NF 4NO3B 4FZ8L 3LQMA 5FLVA 5KS9B 5A7BA 5T3XD 3HZYB 3JQOB 1CGSH 1UWXH 4ZO8A 1NIFA 2OMTB 4Z77B 2Z91B 4PCYA 5CIPH 1DQTA 5D7HA 4Q89A 3KH3A 2A6IB 1AS7A 4UQ2A 5IMOA 3ZK0A 1MREL 5LGYA 2EIDA 3O2VL 4Z7UB 3HEIB 2H2PD 4N68A 4XHJC 3WJJA 3ROOB 3M88A 4KTDL 5CEXB 1KDJA 3TBVA 5HYJE 3EO0B 43C9B 3WKPA 2NR6D 2YAFA 3B8YA 1LVEA 2GCYB 1Q72H 3ZOAA 4WNQB 4B3EA 1QSFE 1T1WB 4OSUL 5IQMA 3IAGC 2D7OA 4LSVL 2QVIA 3TJHC 3APDA 1RZJC 2HT3C 5FYJD 1DBMH 1GC1L 3UAJD 2WHVA 4G8FA 1TZ8A 1X7QB 5G5DB 3S5LB 4AVJA 7PCYA 4G6ML 2A9CA 2Y07H 4TNVK 1XX9C 4KXCA 3EOTH 4GBXA 3BP4A 1K6QH 4GW5A 3ATDA 3GHEH 2Z35A 4M8QA 5F44A 3ZQWA 1F4WL 1R0AL 4LLVB 4YHZH 1YEEH 2FWOB 5BQ7B 3QDGD 3GTVA 1JFHA 1GL4B 1NCWL 1C16A 4KQ3L 4BZ1A 4N5ED 5GPRA 4PV8B 1GAFH 4O02H 2P5EB 5DQJB 1YEGH 1VESA 2XI9A 3ZDYF 5MERA 1FO0B 1C5BH 4H7VA 5CEZH 1LQSR 5KSVB 4CDGC 3KMDA 4HWEL 4HG4J 1DP0A 3FRUA 4HSQA 3W5MA 1KBKA 5GGSY 1Z9OA 1BQKA 4MRBA 3DI3B 2QQKH 3ILDA 4GQPH 5HYSG 4LE8A 2BHZA 3GF8A 1MCSA 3LQAC 3TWYA 4LPWA 4MNHB 4MB5A 3FTXA 1TQSA 3EW3B 4AQAA 1R5IA 3GXIA 2J5LB 1NSNH 3G6DL 2F53D 1CFQA 2CBMA 1DFBL 1AGFB 2XWJA 3P3TA 3EH4B 4P23D 4OGYH 4HFWA 5IROA 2OLDA 3IFLL 3JSSA 5EF2A 1PZAA 1WFIA 5ID1B 3M07A 1OXYA 4OZIF 1NFDB 5F3HB 3OKDA 1NKRA 5GGVY 2Z31A 4OV6F 1KXTB 3FB8A 1RAMA 2I9TB 4JQVC 4AENB 2WZPA 5E23A 4FC3E 5I1AB 1JF1A 1FG2B 3ARGD 4L8DA 3WTXA 4XCNA 4NDMA 4DO6A 1F86A 2DD8L 3F6IA 3ZHNA 4D7BA 1HXMA 3BHBA 4OCRH 3FXIC 1FBIL 5I0XA 2CDEB 5HVGB 3RTLA 1RJCA 1BZEA 4ETQB 4QKXB 4PGDB 2P45B 4ODWA 1ORQB 5I76A 2XTSA 2FEEL 3BAIA 1OD9A 2E9WA 1YN7A 1Y1DA 2DYPD 3O4OB 4YDVB 5EU3B 4YFDB 1E5YA 3K6DA 5LBVA 3RKPA 4DKTA 5F2FA 1N0XL 3DA0A 4Z7UF 4XNYH 1XGTA 1U58A 5KG9A 5AVRB 2YEZA 3PQYB 3SDCA 1DSWA 2XZAL 5D2LB 5HVWA 4K3EL 5GS3A 2G9KA 1E3XA 4XO3A 3TBYB 4PJXF 4F33B 4PHZA 1OK8A 1QBAA 1INQA 3TT3L 1XR8A 4PJ8C 4NN7B 5ENWB 1XD0A 2BVPB 5IFHH 3AABA 3MRIA 4MX7B 1NGPL 1F4AA 1BQHB 3NFNB 5BO1H 3CZNA 3CHOA 3C8KA 1KIRA 4L2LA 3IXTB 1XGRB 3WY2A 4PJHA 1TTCA 2J8UB 3SKNB 5FF6A 3AB0B 5I1IL 2VUYA 2D03L 3ULVC 1NM9A 1WWWX 3GGWA 4JFFE 3NSYA 3FB6A 4IS6B 3L95B 3CVHB 2FJHB 4IRSC 3QR2A 2V8MA 3B3BA 1SDYA 4PJXA 3X13A 4AYFB 3VXSE 3S48A 1DJGA 4OH2A 3QQ3B 2CPUA 4KKPA 2OCFD 3UCQA 4R7NB 1BM3H 3U2IA 2XBDA 3DOSA 2HLFC 4XP9L 3KJ4B 5I2IA 5ICXB 3ARGC 5CJ5A 2DEWX 2FO4A 2B2XH 3RPKA 2NLJA 3QG6A 3QORC 4LLUA 5H37H 1ZHNB 4EOWL 3BESR 5EZPA 2XT1B 4LSUL 3CLEL 3RBSA 1D2OA 3B9DA 3WTUA 1I1FB 4AT6B 4WUUB 4QY8A 2Q7NA 3CXHK 5EOTA 4KZ0A 3DURB 4PJBA 5IOPB 2EDXA 1NCWH 2EDYA 3LZFL 3QWRD 2X1PA 3ISWA 3N9GH 4LMQE 2X40A 1ZT7A 2VW4A 2C1PA 2VN3A 3FTUA 2BNQE 2L7EA 1DJXA 4HUVA 1SOXA 2W9LA 1PLGH 3B9VA 5D7JB 1CDJA 1TZAA 3FYIB 3RNQB 3LZQA 4P5KB 3CPUA 5MEOB 3UO8B 4W9ZA 1XIWA 4ODSL 3LXAA 1IIIA 3TBTB 1N6QH 4NUQA 4AQZA 4G80A 1YNKL 3D69B 2BP5M 4R7DA 4W9LC 2H8PB 2FEDD 2YBRB 1MHHA 3LV3B 4N5EC 4BHUI 4I5BA 1VCBC 1FIEA 4UM9B 2EXYC 1DFBH 4C55A 3LS4L 4GYBA 5LAXA 2Y4SA 3N40P 2X70B 3VWJA 3F00A 1CLYL 1DUYB 5IIEB 1H8NA 3QP3A 1SUJA 3D39E 4PJHE 3VGAB 4IM8A 1HN1A 4K0OA 3BSGA 2ARJA 4JO1H 3SCMC 4O4YL 2WKOA 3LH9A 3T0AA 5DD0H 4BK4A 3CX5J 1MJUH 2X4OB 3MLUH 4GEIA 1TPXC 1W0WB 1JSYA 3KD4A 2VR4A 4AIXA 3CXDL 4MD0B 3V6FA 1DO5A 2NZ1A 4GSRA 5LWYL 1S7UA 3LS5H 3N1FC 3QQ4A 4UUJB 5L8JB 2B4CC 5L7XL 5BS0E 1QBLL 3M7FB 1UQSB 3WIAA 3AT0A 1YJDH 1I1AB 3QZBA 1TYEB 3LN4A 1AP2B 2MNUA 2BVOA 2OQJB 2ZICA 4ZQTA 3ZSTA 4XAKE 1Q4NX 5KANG 3JYCA 2PLTA 3EKCA 4LARL 5IW6A 2HX8A 4H0HB 2OL3B 3K1KC 1DBJL 1PZ5A 5D1XC 3WTWA 1T6WA 4N26A 4Y9EA 4PG2A 3SKMB 2DTMH 1Q38A 1W72L 4P2OB 5J1TC 3V4UL 3IMUA 5JHMA 1ETJA 5JOEA 5CFAA 2DBLL 4NZJA 3QG7L 5BQ7A 1RPUA 4IRSA 1YMMD 3FBQA 1MKFA 2BM3A 4FG0A 5GGUB 1JOIA 2MFNA 3ME0A 1K5WA 4PJFF 4QLRA 3RL2A 3LX9A 4JZJA 1OAKH 2W0LA 4FL4B 4AK1A 4KQ0A 1HK6A 3KPOA 1REIA 2YUZA 1T83C 4KHTH 3D18B 4MS8D 4RISH 3ZLQC 5HHXH 1DYZA 4HOMA 1QSEA 1NINA 1VFAB 1JHLH 3PL6C 5KTEL 3UTTA 3VGEA 5K9OA 3F01A 2XYBA 2JB5L 3D07A 4LHUB 2R1WB 3O2WL 1SQMA 4U7KA 5D72L 4F93B 5JZ7D 2I60H 1NCDH 2Z0BA 2WQ8A 3SN6N 3W0WA 1B0RA 3C5JB 1B0WA 1EMTL 4I4WA 5IEKA 1FCGA 4H4NA 3C08H 2RJMA 4KDTA 4FI6A 2JB6B 4G7RB 3KLKA 1BCIA 3LNIA 3TH4T 4DQAA 5FX3A 3FN9A 1NL0L 1H3TA 4XI5D 3C75A 3S36L 3DYOA 2WAHA 4PJGF 3ARFD 3HCVA 1PQZA 4F80A 4EDXB 2EDTA 4OCSL 3J8F7 4PTUB 1UZ6F 3OZ9H 2AEPL 3TEXA 2EYSA 2PXYC 4TULH 3JWNG 3E6HB 4JHWH 2DYPB 3JV4B 4WSJA 3RZCB 3TNNB 4ALAL 3O6FB 1VZHA 5E8OB 2HJKA 4JUTA 4Z0BH 5GS2H 4GW4B 1GGCL 2AITA 1CGVA 1QUNA 1UD3A 2DWYA 7FABL 3U4EB 3FTYA 1DZ0A 1B0IA 1YNKH 5GS2D 5E6IB 3PCYA 4W9CC 3RUGE 3GPEA 3QJFA 4APQB 2YEZB 3P30H 3SE4C 1UACL 4RX4A 5F6HI 4UQBA 2Y0SA 2I32A 5DT1L 1JTTA 1WCBB 3GTNA 2DOCA 1A6TA 2FLMA 3DO4A 1MZZA 5JHLA 1EHXA 2N4IA 2W91A 5DLML 1UENA 4WV1C 2OCCB 2A6DA 1Q9KB 1WAAF 1D9KD 1OHZA 5AZ2L 3WE6A 5DD0L 3D8MA 1OAYL 1ZLDA 2J72A 4IIQA 4JR9H 5JLZB 2EDQA 1ND0B 2DQHL 3UAAA 5F7UA 4JN1L 2WXOA 1D9KA 4R84A 2I9TA 5EZIH 2JIXD 1Z32X 4GKNB 4C83B 1AS6A 5D1XE 3M1BB 2OULB 3FQUA 4QTIL 4XCEB 4S1RH 4Y4FC 1EX0A 4JKWA 3UPAA 1M3JA 2H4EA 3MGTA 4MA1B 1RP8A 3F7VB 4IBYA 2NLJB 3QG6B 3KEDA 2Y1YA 3BH8B 1WRFA 2K8MA 3GLDA 4P23A 1FL5B 4F7EA 8FABA 3A22A 3PWPB 1Z5LA 1HSAB 4LDEB 1G1CA 2ZQKA 5I71B 2FR4A 3OAZH 2XVBA 3H42H 3FTGA 2EJ1A 4QAWA 4RSYA 5F7NC 2EZ0C 5C0BB 4XPHL 4JDTL 5DGQA 4FG4A 2XTJE 2WUBH 4NKQB 1V7ML 1J9QA 3PHQA 4J27A 4ZODA 3SGKA 1GZQB 2R8SL 2H3NA 3VXUE 4EN2A 2J20A 5AZEL 3W38A 1RULH 4POUB 3SYQA 3TFKC 4DIXA 3AROA 2G60H 3QO1A 5FOBB 1UXSA 2Y6SD 4JRFA 4PLJC 3GLEA 1XR8B 4ZS7H 1WGVA 1MW3A 4HHAB 4KUCD 3UTTB 5BS0D 3B3IA 3MBED 2NY1C 4PWGA 4B9PA 4LIQL 1IBZA 3IJ8A 5BNXD 4O2EB 3EO9H 1TR7A 5SX4I 5D1QE 1CFTA 4A68A 4JY6A 4BRVA 1LP9F 1Z0NA 5LBSH 4A7VA 5E8NB 3RHWK 1PL3A 2Z93A 1PW3A 2O1AA 2VDKH 3R7QA 3TJEH 5IK3B 3S36H 5IQ7H 5T1KB 4QHUA 4K3HA 1A2YA 3D85A 4KK9C 1IMHC 1BXAA 2VIRB 2BIPA 5A3ID 2FR4B 1QWUA 5AZUA 5BPPA 4LEXL 3GRBA 2GSGA 5KS9A 3QDME 4AZ8B 3RJOA 1I8MB 3FFCE 1EEYA 1A7OL 1ZDQA 4LGRB 4QR7A 3S35X 3UZVB 1JDDA 1S78D 2CJ3A 1MI5D 3C2AH 2B59B 2YGPA 2XX1A 3I3DA 1EXGA 2V7HB 3U7YH 1T03L 1T3FB 4BDVB 1QUPA 2CMRH 4N2EA 5JA8B 2DS4A 5FYJH 5ICZB 3EYFB 4HC1L 4QT5B 5FKPA 5D9SB 3BRGC 4ZO6A 2FYYB 4TVUA 2PO6A 3JTTA 3EO1B 5CLYA 2H0PA 4YK4C 3ZT6A 3B5TA 4M48H 2GPZA 1M6UA 4KOBA 2FNBA 3BVNA 3GTTA 3RX8A 1T2XA 4G6MH 1Q9KA 3FQXA 1YEWA 3QCTL 5TPWL 4NQCA 3IAPA 1HTYA 1KFAH 1J0KA 5MENB 2F53B 3X1GA 5TH2A 4EQ3A 4KQ3H 2OTWA 1R5VA 3INUL 3DRTA 4WW1A 3KW8A 5B39B 2W9EH 3UTZA 1DJYA 2MQ3A 1YEGL 1K85A 3BT2L 5E1AB 5EZIL 3CMOL 4GXFA 1ED3A 3JWOC 4P2QE 4HIXH 3UTPE 3NSJA 2E27L 3O2DH 1EVUA 2W80C 4G8FB 3PDOA 2QQKL 1LNUA 4W6XB 3MUJA 4JPKL 1WWBX 1FUNA 3JV4A 3V52H 3RZCA 1PZBA 4FQCL 4F7PB 5JHAA 3AU1B 5JQ6H 4NYLA 1KG0A 2RIKA 3II3A 2WKGA 1DL7H 1I7RA 4DO4A 1L6ZA 1NA8A 5CBAA 2P9RA 5K9QI 1QSEE 1NEZA 3S88H 3ALPA 1BX2A 1OM9A 5L0QB 5AW1B 4EI6B 1D9KB 3W82A 4M6AA 3EXJA 3GNMH 4B97A 3NAAL 4HH8A 1W6LA 3LXBA 5E6YA 1K72A 4D8OA 5K93A 4PLOB 2Y72A 4E42A 4U7MA 1HDMB 2UVFA 4N8VG 1JZIA 3F7LA 1ETZB 5GISH 4G1EB 1URZA 4N0UE 3WHE1 3IWVA 3O3EA 1AQDB 4JVWA 5EO0B 2J21A 5C6TH 2G60L 3T0XA 5B8CB 2MIZA 3U83A 2NSQA 3PABB 1JDAA 4XAKD 3E80A 3HZMB 2X53A 5CZKA 3T8MA 4X6BA 2NR6A 3CHRA 2CAKA 4S1SL 5KYUA 1ML0A 4GLRH 3DVGA 3MLWL 4G43B 1BGXL 1CICB 5HDWA 4OLZH 1DJIA 5FHBH 1X3DA 3B9KD 4QHNB 2XXMB 2HPTA 2P52A 2XTJC 2IPUG 4UT6H 2F1AA 5BRZB 3GXDA 3JT0A 4NNPL 3O6FC 1SXAA 4XGZA 4OFYA 5F71A 2FO8A 2OXGA 2P24A 3TIDB 4G8GE 4ZOBA 5IQ7L 4YSEA 4LGPB 2NY2D 2NY4B 2I7SA 1H15A 4R97C 3Q5YA 2LU3A 2OZ4L 3VTAA 2IC2A 3QZWB 4GUCA 3EG9B 3MRHB 3H9HB 3R18A 4U05A 1Q0YH 1VDGA 1JGDB 1EEUA 3RA7H 1TSRA 5IZ7A 2GJ6D 1KJ2L 4UB0L 4I9WE 3MLYH 3X12B 5DWUL 5E7FA 1IIKA 1THAA 3O3DB 5ICZA 4KJQD 2WP3O 3ABMB 3FFDA 4YHLL 4NUJA 3NGBC 2QSVA 2CMRL 2WYHA 3L5IA 4ZOCA 3KL5A 1FL3A 5DZVA 3PP4L 3OHXA 2KUTA 2X6BA 3GHPA 1CQKA 2VMDA 3QRBA 3CZFA 1T0PB 4WW2B 3VMPA 4AEIH 2VJ8A 3SBWA 4J3WA 5EMYA 3D08A 1Q0XL 2IBGA 1TVBB 2V6HA 2WAQA 4OZ4A 5FA3B 3L7FB 1ZJBA 3U4BL 2JKTM 5J8OA 2HRHA 4F24A 3DPDA 1S7QB 4ORZC 1KFAL 2F54E 4LLDA 5F1KC 5CBEA 3BPCB 3ZHLA 3QA3A 3F7YA 1A3RL 1HI6B 1SN5A 2QKIB 3LN5A 4N8UA 4EUPA 3L2MA 1HOEA 3MRFA 1RJYA 2YAOA 3VXME 3VUAA 5IM7B 3WNNA 3C6LA 4M93B 2KDYA 5GGRY 3ESNA 3EJYC 3H9ZA 3K6FA 3TT1H 4QGYA 1QNZH 1VEPA 2E27H 2PP7A 4OZFA 3KYNB 4FDWA 5C07D