3FQ2A

Azurin c112d/m121f
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALFKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Type Zero Copper Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fq2A00
3CVCA 2WO3B 1DYZA 2B08A 2QPDB 3SBPA 1JERA 3X1NA 1KDJA 1IBZA 2CAKA 2MTAA 3NJLA 2R7EB 3PLYA 2PPDA 1B3IA 1AR1B 4L0PB 3WI9A 1JXFA 4DP8X 4E9QA 1NZRA 2QDVA 3FSWA 3TASA 4KO7A 2YAMA 1MZYA 4K9JA 1GY2A 3FSZA 3UGEA 1J9QA 1AG6A 1NINA 5B7FA 3ABGA 3MX0B 1NIDA 3UACA 4G7RB 1GY1A 4AKPA 2CBPA 2HLEB 2AFNA 2BW4A 1AS7A 1ZIAA 1NDTA 3WIAA 3PCYA 5I6MA 4GYBA 1SJMA 2BHFA 3AG3B 3FSAA 3FT0A 4YSEA 1JZIA 1MZZA 1AG0A 2BP0B 1PLCA 3AY2A 1URIA 4QKTA 1V55B 3OMIB 3ZDWA 1IBYA 3CZUB 3ASNB 4A66A 3G5WA 3WG7B 3GYRA 3RYMA 3PXLA 1NIBA 3FU9A 4UAHA 1CUOA 1AOZA 1E67A 2Q5BA 2YXVA 2VN3A 3QPKA 3FSVA 1UATA 5D4IA 4YSDA 2OCCB 1KBWA 4A68A 1PCSA 2FNWA 1BXUA 1MG3C 2GC4C 2DYSB 4CSPA 4YSSA 4WTQA 5B1AB 1MG2C 2PP9A 1GS8A 1ASOA 4F2FA 5AZUA 5AKRA 2H47C 3T6XA 4KO6A 2JXMA 3BQVA 2R7EA 1T5KA 3ABLB 3EH4B 4JHUA 2PPEA 1KV7A 3TBBA 2AZUA 4KO5A 3TBCA 4A2GA 4Q89A 1ASQA 3IE9A 1NWOA 1JVOA 1JZGA 2YAOA 3UABA 1SDDB 2XWZA 4MFHA 2HX9A 2DWTA 1ET5A 3H4FA 2PP7A 3ZX1A 1HAUA 2DWSA 2GC7C 1L9RA 2J55A 3KW8A 4P5RA 2BWDA 2YAQA 4AKQA 1GS7A 1BXAA 2OV0A 4KNSA 2YAEA 3ZIYA 1E5YA 4YVUA 4G7SB 4NB7A 1SF3A 3FU7A 4AI7A 5B1JC 1E5ZA 3IEAA 1OE1A 1OE3A 2UXGA 2UX6A 2RACA 2ZOOA 2XV2A 2TSAA 2NRDA 2PPFA 1L9QA 2XXGA 1E65A 3IBOA 3AG2B 5PAZA 4GP8B 3NJIA 1TEFA 2EILB 5I5JA 1AZNA 1ZIBA 3C75A 3H56A 4HCGA 4FAAB 4RH4A 5LDUA 1GYCA 1EZLA 1WA0X 3QJSB 2UX7A 1ET8A 2XXFA 2VW6A 1V10A 2OJ1A 3CG8A 4AX3A 3OM3B 3T6WA 1NWPA 3QJQB 4FA7B 3X2QB 3V9EA 2EINB 4HHGA 3NJKA 1A65A 5I28A 2HX7A 1PZAA 2BO0A 1KCWA 5B3SB 2IAAC 2W8CA 1TU2A 2HRGA 4BWWA 3S3DB 3T6VA 1BYPA 2VMJA 2VM3A 1PF3A 4KNTA 4YSTA 4YSAA 3NT0A 3FYIB 2Y1AA 4E9YA 4KOBA 1M57B 5ANHA 4E9TA 5I5MA 2CUAA 5E9NA 3SQRA 3L45A 3AZUA 2AVFA 1GSKA 1GR7A 2XU9A 4E9RA 3D12B 4DPAX 3NJHA 3U25A 3S8GB 3AW5A 4BXVA 1J9RA 1PNDA 3IN0A 1L9PA 1NIAA 3FPXA 2HRHA 3DKHA 4G7QB 6PAZA 1HAWA 1JXDA 5I6KA 5B1KA 1CURA 1A8ZA 1OF0A 1QHQA 2X88A 4UANA 1BEXA 4HIPA 4F2EA 1PZCA 1RZQA 1EHKB 3S3CB 2BP0A 2I7OA 1ILUA 4A2DA 4F7KA 5F7BA 1W6WA 3CDZB 1KCBA 2UXTA 4DP4X 3T9WA 2YXWA 5I5IA 2YARA 1OV8A 2PPAA 7PCYA 3PAVA 4EF3A 1JOIA 1AZBA 3T6ZA 1RCYA 1I53A 4DPBX 1A4CA 2CALA 3WKQA 2FQDA 3NP3A 2XVBA 3NJNA 1AAJA 1AIZA 3NSYA 4DPCX 2EIKB 4A67A 1BQKA 4N8UA 3MBWB 3FS9A 4W9ZA 3TA4D 1JXGA 1ZDQA 1M9WA 2Y69B 2GB2A 4M4RB 1AS6A 4GP5B 4BXSV 1HFUA 3FQ1A 3ABKB 2PPCA 2H3XC 4ENZA 4NERA 2ZONA 2DYRB 2I85A 2GBAA 3HB3B 1SDDA 2FT8A 4Q8BA 2VSMB 5I6NA 2H5UA 3TU6A 3X1EA 4BWUA 1RKRA 2MRYA 2PLTA 1OCRB 2IH8A 1L9OA 1IUZA 1OCOB 5B1BB 2GSMB 3CVDA 2BWIA 2TSBA 3ERXA 4E9VA 1NICA 2WSDA 4BDVA 1JVLA 5FC9A 1NPNA 1OCZB 4G70B 2FWLB 1PAZA 1PZBA 1PMYA 2I7SA 3EF4A 3FPYA 1XB8A 3GDCA 3OQRA 2IWEA 4AKOA 4DP0X 2FT7A 2GIMA 1F56A 1ILSA 5D4JA 3X1FA 2DY2A 2JKWA 3OD3A 3V9CA 2HZHA 2ZWNA 3EH5B 1DZ0A 2IH9A 1L9TA 2XV3A 1MDAA 1FWXA 3NJMA 3ASOB 3PPSA 3ZBMA 1ZDSA 1W8EA 1PY0A 4BK5C 1BAWA 2FJSA 3CVBA 2W88A 5I26A 3QJTB 1JZJA 1SHWA 2IDQA 6PCYA 1V54B 2XV0A 1WA2X 2J57A 1XB6A 4A2FA 4DP2X 4E9WA 3IN2A 3QJRB 4ZK8A 1W6LA 3DTUB 3PAZA 1XMEB 3N2JA 4YSPA 2YAPA 3N55A 1TEGA 3QQXA 3ABMB 4G71B 1A4AA 5B7MA 5B7EA 1J5CA 1BQ5A 2FT6A 3NSCA 2IDTA 2CCWA 4N4YB 2EIMB 4YL4A 4GP4B 1A4BA 3GXUB 2PCFA 3OMAB 2YAFA 3NJGA 5F7AA 1ZPUA 2P80D 4YSUA 1ASPA 4GXFA 1X9UA 2VSKB 1GW0A 2CJ3A 3X1BA 1FA4A 2UXFA 2XYBA 1N70A 3UAEA 2J5WA 2B3IA 4YSCA 1ID2A 1NTDA 4AZUA 2HXAA 2XX1A 1E30A 2AZAA 2IWKA 7PAZA 3FQYA 5D4HA 1NIFA 3AG1B 3AG4B 3HEIB 2IWFA 4KO9A 1AS8A 2FQEA 4BDVB 2GI0A 3WNIA 1J5DA 1RZPA 1XB3A 1KDIA 1YLBB 1AQ8A 1A3ZA 4PCYA 1SF5A 1SFDA 2ZXWB 1SNRA 1SHXA 1AACA 3QJUB 1OCCB 1J9TA 1WS8A 2P80A 1IKOP 3EH3B 4JKNA 2LLNA 1X9RA 4HCIA 4WKXA 1J9SA 4QLWA 2VM4A 5I6PA 1AZCA 1TKWA 1NIEA 4E9SA 3FYEB 1ETJA 2EIJB 4HAKA 4X4KA 1JZFA 2PCYA 1CC3A 1ADWA 2FQFA 4TXVB 4DP5X 2FTAA 1KYAA 3EHBB 3NJFA 3H4HA 2BP8A 3CDZA 1AZRA 1KGYE 1M56B 4DP6X 1BYOA 4W1TA 8PAZA 2IDSA 1N68A 1CYXA 1R1CA 4PAZA 1PNCA 2J56A 3WNJA 4HALA 2UXVA 1FFTB 3FU8A 3NJJA 1BXVA 4HHWA 2XLLA 3S8FB 2QPEB 4NAJA 2YQBA 5TK2A 1KBVA 5TK4A 4CSZA 2VW4A 4DP1X 2QT6A 3NSFA 4UF7C 3NYKA 5B1JA 2IDUA 4YVNA 2XUWA 3OMNB 1QLEB 1AANA 3DIVA 1ET7A 4KNUA 1NPJA 3BVDB 3SBQA 3UADA 3JTBA 2PP8A 3S3BB 2GHZA 3FU7B 1BQRA 5EHFA 2IDFA 4DP9X 3QJVB 5A7EA 1JZEA 1PLAA 4HCFA 2AANA 5IY5B 1GS6X 1PLBA 2E86A 4A2EA 2QDWA 4DP7X 1CYWA 1SFHA 4YSOA 2VW7A 3WKPA 2DV6A 5I6LA 1ZV2A 3SBRA 1JZHA 2BP8B 1WS7A 4KOCA 4P5SA 2BW5A 4YSQA 2BZ7A 2X87A 4HZ1A 9PCYA 4JHVA 5PCYA 4E9XA 3T71A 3JT2A 3X1GA 2FQGA 2JFCA 1AZUA 3UAAA 2Q9OA 3NP4A 3NSDA 1QNIA 2A3TA 1IC0A 2WO2B 3FQ2A 2BZCA 5AFAA 4G72B 2XX0A 4YSRA 2YAHA 1OE2A 2N0MA 3PAUA 4M3HA 1L9SA 1WAEA 5I6OA 1OOWA 2HX8A 3KW7A 4BWTA 1WA1X 4A2HA 1VLXA 4GY4A
chains in the Genus database with same CATH superfamily
4IKNA 5GSVA 5KW9L 5JLZB 2FJHB 1RIHH 3PJSB 3V0HA 4PRPE 4LKXA 2AXFB 4ZW8A 3PLYA 4K9EC 2PPDA 3HTLX 1A9VA 1QYGH 4MLSA 1M9SA 1MIML 4Q0XH 3SDDC 4BIKA 1N19A 1D9KB 4E68A 3PV7A 3E8UL 2P5PA 1MZYA 1CU4L 3CXHK 4M00A 4BSWA 5IJVA 1NQBA 5DRNA 3CVHB 5L2JB 1G1CA 1CF8H 4M5TA 1WFUA 5CGTA 1IC4L 2WVUA 1DJWA 5GJTL 2OYLA 5EIIA 2H6UA 3ETSA 2BS71 3NCYP 3UZEC 2HLEB 5D1QA 2GJ6D 3HJ0A 5ITFA 1AS7A 3DPDA 4ELMA 1CT8B 4LLWB 1G6RH 5J7CC 3HG1A 4XPAL 5EPMA 5CJQH 3VYPA 5DJZA 2K6YA 1HILB 1ZLWK 2KL6A 1YPZA 3ZDWA 2G3NA 3GSNH 1C7TA 1IJ9A 2GHWB 3CLFH 2AV1A 3EDEA 5TFSH 3VGFA 1XDTT 1KJMA 3QNXA 2CJTA 1PD6A 2WC7A 1E67A 2MJWA 1QI4A 4CKQA 3FONA 4TQ8A 2Y2WA 4L0ZA 2RQEA 4XOAA 1EGJH 1HXYA 2XN2A 1ZKAA 3RTQD 3HCVA 4K9EH 4L3CB 1Z9LA 5J1AB 1ED3B 4HS3B 3BQVA 5C0GB 1DFXA 4N0UB 3E3QE 1LP9B 3BUQA 4I0PC 2LR4A 3TBBA 3QXAB 4G5AA 5T5FH 4I5BA 1NWOA 2QGBA 5CJBA 5JHLA 1IGIL 1ONQB 4WI5A 2WWNA 1WWBX 1ZT7A 4G8GA 4H44C 4K3DL 5DRXA 1GJIA 1HEHC 1SLXA 4AM0A 3GPEA 2W9DH 2YXMA 3F7YA 2FJFB 1GOHA 2D9CA 5ICYA 2DOCA 1HAUA 3BT0A 2H9GA 3MRRA 4U1KB 2AQ3A 1L9RA 5FFLA 4D94A 4P5RA 3JYBA 1K6QL 2A74B 2R4RL 6FABH 2WINA 5EOCJ 2X4OA 3MCLL 5KBLA 4Z8FL 1CL7L 1EFXB 3ARYA 1JHTA 2R0WL 3IEAA 1M1XB 4IRJA 4QHMB 1UC6A 1AVAA 3D39A 5MEQB 3G9AB 3OR7A 4G8IA 1YDPA 4G83A 1XCQA 4YHZL 2ZTBA 3WEMA 4TSBL 1IILE 4LEBA 2APBA 1TLMA 5ID1B 1IM3B 1AZNA 1E43A 5F7FA 3AB0C 3LKOA 2DQUL 2FIKB 2XNAA 4MJ4A 3GZQA 4IU2B 4K8RD 1CE1H 2XJKA 1NGZA 4TQPA 2DRUA 5I16A 4I87A 3CG8A 5EUKB 5GRVL 5IROA 4M5ZH 5EZPA 3GGWB 4ERSH 1BF8A 3PDOB 3EJYD 4WO4B 3HI5H 3HMXL 4NNYB 3BZEA 4MMXA 4XP9L 4D0CA 4OZGB 1I8AA 1FNHA 5DDHA 1IAII 1MIEL 3PIQB 4LLUA 3BMVA 3Q5YA 4NNPH 1BYPA 4KNTA 3UTPD 4Y19E 3FYIB 5FUZH 3MNVB 2DM7A 1XZ0A 4S1DC 5DEFB 4B0MM 1U41A 5JW3H 1MVFA 1RPKA 3BHBB 1GSKA 3OV6A 1DN2A 1KZQA 1NGWA 1Z0NA 3ZYJA 3X13B 5LJYH 4LCCA 4U05A 3L54A 5DC9B 2KLSA 2HFEA 2HRHA 5BS0B 4A6YH 3KPPA 5JHDB 5D2NA 5D4QA 3GUTA 3F7YB 5DVOA 2H8PA 2X88A 4UANA 1CQKA 2NQ3A 3D3VA 1FPTH 1ZEAH 1HWHB 4JFZL 1EEZB 1BXXA 2XFXA 2BP0A 4HLZH 4WW2F 1WBZA 3QFJD 5DD5L 4BK4A 5DO8A 5JXED 1OT2A 5I1GL 1HNGA 3S36L 3UO8B 4HU8A 1FJ1B 3GWJA 4APQD 4FL4C 3LH2H 1DQIA 2FZ3A 2BDNL 4UT9H 1L5GA 3HG5A 1MFCH 4WV1A 2FCBA 5D7IA 5BS0A 4EI0A 1INQA 4HUXA 4BH7A 2IVFC 5CU9A 4LCWA 3QQ4B 1TYJA 1W8OA 2F7RA 3KYAA 3MCKA 4JZNB 4OFYA 4PWFA 3RWIA 3IGAB 3JBG7 4L0YA 4HX1B 1V3KA 4IEFA 1N5AB 5J13B 4L18A 1SY6A 4UMSA 1A66A 1CICB 4MNQD 3O6FD 2EO1A 2WLYA 4NC0B 5IVXF 1MH5A 2I07A 4JGUA 2UUDH 2BSRA 4YHKH 3SDXA 2ZONA 4N0YH 3ML9A 3R7QA 4Z76B 4Q8BA 1ZV5A 1S5IL 3X3FH 1Z3GL 3JTSA 2Z4TA 3LRGA 3BZEB 5C6PB 1KYOK 2VRKA 4YBHA 3ARBC 3LS5H 3SKNB 1S9KC 3O45A 3QIWD 4NZTH 2GSMB 4B7LA 2HVKB 4QDGA 5HPOA 2CA4A 4FP8H 3T8VA 4E9VA 4BDVA 4A37A 4Y4HC 4QYAA 4OLYL 3U6XS 1BWWA 1XMWA 3VX0A 4LHUB 5K9OA 5DJ6A 1F56A 2FO4A 4QRUA 3O4OC 5CSGA 3X1FA 4AVIA 4WK4B 4OLZL 1LDPL 2H4EA 3HLKA 4Z7NF 2BSTB 1IT9H 2JV6A 4I0PA 4JRYA 4KTDL 4M9PA 4RRPA 4FFVC 3TBYB 4B7IA 3FQXB 2HZHA 4PRID 3GD1C 4JG1L 5ETUA 4LEEA 1AKJD 5EOQL 1G9NC 1MW2A 3II1A 3OX8B 3MLVH 5I1LA 3LKRA 1D5IH 1BW8A 3AQXA 1F4AA 2EEBA 1O6SA 2PO6C 1S8DB 2YGOA 4HUCA 3ESUF 3HC2A 1T1XA 4YR6B 2BRQA 4AM0Q 4ZMQA 4KK8C 3VXRB 1U2YA 1W8EA 5C0BA 3APFA 4X7DC 2PMZA 2OZNA 4RZKA 3QJTB 1LK2B 4LGRB 2DWEB 3QARA 4NKOB 1FNGB 2I32A 2LAAA 3RDTC 1FBIL 4I9WE 4PJ5A 1K2DA 1MJUH 1YYMH 2QLVB 2ENYA 4PLJC 5K59F 4OIIL 2YUXA 1MRFH 4JO8A 4WHYG 1HS6A 1ULVA 4AENB 5I1CL 2XN9B 5ISZD 3DTUB 3VRJB 2OXGB 3M07A 5E4IA 4XPBL 4KVNL 3VRLF 1TEGA 2NQCA 4XTRC 1FFPA 5JNYB 4OLWL 2R1WB 1OQXA 1J88A 1OO2A 3BAEH 4EJ1C 4F7CA 2Q6WB 4O5LL 2BIQA 3DX6B 2VR3A 5F6IB 1HOCB 5D1ZB 2CR6A 4F15C 5FWQA 1SBBA 2MEJB 1OVZA 4S1QL 4U1HA 2ID5A 4NKDB 5CMAB 5I0WA 3MRPB 2EDDA 4HUKB 3RDTB 2YD5A 5EU5B 2IO5A 4Z7UB 5CJQL 1YAIA 1MCWW 3QIUD 3F2LA 3VM7A 5AW2B 4UQBA 1EO7A 2XYBA 5IHZA 3KLKA 3V55A 3W38A 1A14H 2J1XA 2Z6FA 4XBPA 3V4VB 3ZW3A 1G7HA 1RERA 3R1GL 1EMTL 2D31A 4NRYB 2IWKA 3AWFA 3ZO0A 1KBGH 3MRLA 4B9YA 3AM8A 4JQIH 1RZPA 2F53E 2YD1A 4JFEE 2A6IA 3LDBC 3LKSA 5TQ2H 2WYZA 3VMPA 3ZKND 1YNLL 1WS8A 5CLYA 1MIMH 3FQNB 2VDKL 1TQBB 3PQYA 4BCXA 3TN0B 5HYQB 5I66B 4YDNA 3GRWL 3OB0H 5DC2A 2DLFL 4XO5A 2R0LL 5KYXA 5D1XB 3TN0D 3CSTA 4FYQA 2FJHA 4HMEA 4HLEA 3TBSA 1AP2B 5AOKA 2YSSA 3V5HB 4OLXL 3VFNA 2F8XC 5HHPB 1ZPLA 1NLBL 4Q52A 1DN0A 3MLSL 4TTDD 5EORH 3VWJB 4Z5RA 1K4DA 1N8ZA 3ECBA 3AACA 4X6BA 3QQ9D 1SZNA 1TMQA 4HGKC 1MUJA 3ARBB 1T83A 1DL7H 3BAKA 3NJFA 4KMTL 3VFTB 4RGNE 2IAMD 4AK2A 5EUOF 3FB6B 5I8OH 1WAAA 1R47A 2BCKB 3SE4C 2AK4A 5JR1H 2JKLA 2OL3L 1IAKB 1J1OH 8PAZA 3QPQD 4L1TA 3AB0B 4PVNA 2R2CA 2CWRA 1CYXA 4P2QE 2OYPA 4PAZA 5B38A 4JCWA 4ONHB 1RZ7H 3QI9B 3TBVA 4G9FD 3LOWA 4HALA 4Z95H 1DO5A 1FNEA 4NQCE 2A1WL 3ES6A 4X7FC 3W0WD 2E9WA 3K2IA 4F57L 4YS4A 1KTDB 3ME0A 3ZMEA 1NCWL 4M4RA 4NRZA 4U1LA 2W9EL 5AAMC 2IDUA 2V5RA 4AYFB 5GS0L 2YKLL 2CSPA 4G8FA 2Z31D 2VXVL 4BZ1H 1TJHH 2JI1A 3RP1A 3BUTA 3MO1B 1UT2A 3K3QA 2JMRA 3AQDA 3T77B 1A4JA 2AJXL 1WDAA 2BHYA 2UV3A 3DMMB 4PU2A 5DRZB 5DWUH 5EIIG 1CICC 1X9QA 3FOMA 4PLKD 2DMCA 2XWXA 4XI5C 5IY5B 5TD4A 4BA8A 3IFNH 1PZUB 3OL2A 4Y4KC 3MCG1 4C55A 5D70H 4OFIA 1PW3A 1KELH 1IC5L 2X4UA 3SKNA 1DBJL 3L5IA 3KWWB 1XAKA 3O2VL 2EEXA 4TPRL 4U33A 1QKZL 1WS7A 2NY2C 4DF9A 3Q2VA 5EOCL 5DF0A 2F54E 1JCVA 3AAZA 1B6DA 4WFHD 5EN3A 4IIQC 4A1RA 3SDXB 3HE7D 3VGEA 3OJDB 2APXA 4NQDD 1VJSA 1A5FL 3KEHA 4LSPH 4E9XA 4PJ8B 4LAQH 3TF7C 2AJUL 4KXAA 1RV6X 2DI9A 3TLRA 3GSVA 2OBGA 2OMUB 4AQ8A 1JAEA 3MRHB 3ARWA 4KUZL 4NFBA 1QBBA 5AFAA 1PX3A 3OWRA 3VXTB 5DA4A 3TNMA 4Y19A 1L9SA 3I6GB 5DQDH 2R56L 1OWRM 5BRZE 4EUPB 1U36A 4BWTA 3K5SA 3WFDL 1T3FA 4PW9A 3ZE2F 2MKLC 5KVMC 3D0VB 3WIIH 3DO7B 2ODIA 1T6WA 4DTGH 2ZSWB 3RX7A 3A5VA 1MNUH 1IBZA 1NC2A 5I6XB 5EEXA 4MB4A 1MJ8L 4YN3A 1MY7A 1JWUB 2PETA 4MD0B 5HGDB 2AEPH 3LN9A 1QEWA 1A7RL 2IIJA 4CSTA 4XPHH 3DRQA 3MRCA 2WXHA 3L3OB 4PYGA 3FSZA 4EUPA 3BD4A 4PVMA 5CD3A 1IGIH 1FL5B 2NY7L 4HF5L 3ABGA 4NKDA 3BAIA 3H7BB 1HKLH 1UWGL 4HKBB 3TO2B 2ALWA 4MZ3A 2BW4A 3MZTA 3N40P 1C08B 4MYWB 1MCJA 5I6MA 2HWZH 2MFNA 2BHFA 2EIDA 1Q94B 1MZZA 4PJXB 4Y1AB 4OZGA 4KAQL 2FO1A 1AI1L 2XY2A 3T65A 5GGSY 2OXGA 3ROLA 5DUBB 3V6FA 5E1AA 2K7PA 2BS9A 4R97C 3U7WL 4JLRB 1M6UA 3POCA 1KY6A 5J6SA 2F19L 3LEYL 3V10A 2AP2A 1J8SA 2BJML 1QSEB 1OAYL 1RQ5A 3ECVA 3DX0A 4U3XA 3IDYB 1JNNH 1X7QA 5EU3B 1MFNA 2G2PA 4ISVA 3EG9B 5C7XL 5EC2B 2C1PA 1ASOA 1MFAH 1WAAF 2OCJA 5GGVY 2X10A 5C0BE 3U4EA 4ZX4A 1NGQH 2R7EA 3Q13A 1TO5A 3ILDA 5FUOL 2YFOA 4N8VA 3GMMA 4XPFH 5KS9E 1JVOA 2VR8A 4YFLI 2WTRB 1IKNA 1TTAA 1ETZA 3MLUH 3VFNB 5AUMB 2CJUL 1GVIA 2R0KL 1E4XL 4NWTL 4FXGA 2WXOA 1CD1B 5ICUA 3NQKA 3U6RA 4JREB 2YWZA 4DAGL 2IGLA 4HPYH 4PJGF 3C5JB 3WO4B 3BEWB 3GSNB 4IGBD 5C0CA 4EI5A 1E5YA 3KNBB 1BVZA 4DGUA 3NFSH 5DJ2A 2B0SL 3L3OA 3IDMB 4BSJA 1DBKL 1GH7A 1OE1A 5J9PA 3FQUB 2X4RA 4ORZC 4PJDE 2UX6A 2JH2A 3K72A 4R0LB 4TRPH 2Y22A 3SE8H 2TSAA 1A4KB 3CMOH 4J3OD 1GSMA 3QUMB 1TCRB 2DL2A 5IJBC 1H5BB 3FO0L 1TYEB 2YPLD 1U8NB 1ZVSB 2ZOKB 2NQDA 3BSZH 3C75A 3UZVA 3JWOL 2CPUA 4HCGA 4HC1A 5LDUA 1KEML 3GEFA 2Y5TB 1WC7A 4XNQA 1A6VH 4G6JH 4NUGH 1XEDA 1VERA 1X3DA 4AX3A 1KMGA 3S8WA 3QIBD 4MHHG 1DBMH 1KXQE 2ENPA 4UINL 1C8PA 3MRJB 2ZE0A 4ZDHA 3NJKA 3GSQB 3CFNA 3M88A 5F21B 3BPLB 3K6DA 3ZMRA 3SO3C 1KGXA 1I7TB 1MJUL 1U4EA 4F27A 1OP3K 4WV1B 4TPRH 1E4KC 4Y4FD 4XMXA 4M8VA 4KDWA 3H2PA 3VXQB 4YSAA 4XMKH 1Q9KA 2K1MA 1J86A 5EIIB 1WEJH 4L48A 2IGFH 1ZT4A 4JG0H 5F96L 3JWOC 3FU0A 3NRPA 3CLEH 2DI8A 3RKPA 3GMPB 2R2BA 3D3VB 1L9PA 1DLHB 1HQ4B 3BQUC 4RBPK 4BFIB 4UWQB 3FTUA 1WZLA 1PG7H 3O6LL 2CKBA 4C56D 1PZCA 2VN7A 2ATPA 1F4HA 3JVGA 1HCYA 1UXMA 4L9DA 1R3JA 2HJLB 2O1AA 1MEXH 2R56H 3DV4A 5TF0A 5JHMA 3WTSA 5H4YA 2QGEA 1JGVL 2FECI 2WLJA 2XWJB 4N22A 4KZ0A 5CEZE 3E1ZA 3LZLA 2UYLB 5FHBL 4UOQA 4EF3A 4PW4A 3MGTB 5IB2A 2VDMB 2W0FA 4OLYH 1AZBA 1RP9A 1KXHA 2MCAA 1ZY9A 2EC8A 4U1LB 5LGKA 1NANH 3M1CA 3QHZH 1BVNT 2EE2A 3AWEA 4JZOA 4HW6A 5KW9H 4WCYH 4W9ZA 1E4XI 2LAGB 2IALA 3UBHA 1XR9A 3QSKB 4LASL 3WJMB 4JE4B 1CGYA 2V2XA 2BIPA 4I48B 4ENZA 5IB1A 4AVHA 4HOWA 2Q86B 1UWGH 4MJ5A 5CBAB 2FT8A 3FN3A 5ID1A 4Z7OB 4LFHD 1MXGA 2DTSA 3B9EA 4XCYA 4JDTL 2PLTA 4NZFA 4Z6AT 4HWBL 2XZCL 2W0LA 2NTFA 5G2NA 1GGUA 4GB9A 3H54A 1MRCL 4Y1SA 4EN3D 3EYOA 1U91B 1N8ZB 4GS7B 3SD2A 5ID0B 1UM4L 3ERXA 3OZ9L 4RAVA 3R4DA 5A1AA 2K8QA 3HMWL 2XG5A 1TKWB 3H3PL 1NSNL 4GAYB 3QQ4A 1DUYB 2ZJSH 4GFXA 3QZWG 4U1KA 3GK8L 1YY8B 1YVLA 1I1CA 4HHAB 1W2KT 5F6HI 1CLYH 3GSOA 3VFVB 1FE8L 2EEDA 2H7WA 3IAGC 2A1WH 4XBGB 5LBSA 1FI8C 4P3WA 2GJ6A 5AVYB 2C9PA 1DVZA 2E7LC 3OAUL 5E8EA 1L9TA 2E9GA 2W9LA 2XV3A 3IAQA 1JGUH 4A7QA 2YD0A 2PYED 1OPGL 5E9DA 3RWJB 4WGWB 3ZTCC 5ESVB 3IM1A 4S1QH 3WO3B 2F68X 2V5YA 4NZUH 3MSPA 1F13A 3LAFA 4P3CH 1P2CA 1UGNA 4G6ML 2DEXX 3AT8A 3IGKA 4KRPC 5SWZA 2OQJA 4FG6D 3TVMA 5GQBA 2DPKA 1M6OA 4HPOL 6PCYA 2XV0A 2A9ML 1DVFD 1AQKH 3RIKA 3HNTL 1FNFA 5DEFA 4DP2X 3QJRB 1IKFL 1T2JA 2AEQH 3FTSA 3CZGA 4HMDA 3QRGH 1TOXA 2H6PA 1YYLL 3DV6B 4OVUA 2CHDA 3UTZB 4GUOA 3MA7A 4MNGB 3A4DA 4FNUA 4X98B 1RFDL 1OAJA 2COVD 4ZFOB 4DH2A 2EC9U 4ZO8A 1JD7A 3MROA 3W9EA 1CBVH 2UZYB 3ILQD 2IH3A 3B6SB 4WLCA 4X9YA 3QCTH 5SWSB 5DGQA 2F8OA 3LIZA 4NOFA 5DZOA 3I02A 4LSVL 3VXRD 3VD2A 4XWOC 5IW3A 1KYOJ 1R6VA 2H0FA 3FQUA 4PGEB 3RVXD 4LAJH 3LIZL 1MCEA 3T1FB 5A43C 4QCIB 3ZJAA 3JSSA 4X5XB 3RG1C 2GY5A 4KKQA 1ZLVK 4PGJA 3WLBB 1G7MA 1CI3M 4ODXB 4NOBA 2W0KA 2FNBA 1AQDA 4OCYL 2XVLA 3QDMA 2OMUA 1NIFA 3QQ3B 3AG1B 2ADFH 3B7SA 3MNWB 4M5YH 3QS2A 2WUCL 1KPRB 1KDIA 2YD2A 1MCCA 5IEHA 2IGFL 1JDCA 5KS9A 2R0ZL 5HHME 4AEFA 4RRPG 5KSVB 2CDFB 2GSIA 3T8XA 3OC8A 4FTVD 2P80A 1I7UA 3ARDA 1PKOA 4UBDD 2BRRH 3CH1A 2GIXA 5J56B 3BDYL 4N2IA 4HXBH 2ZUQB 3O4OB 3FTXA 4QXTA 1UUSA 5JW3L 1PDKA 2WZAA 3D4GA 2DBLL 3TFBA 3V8CA 3VNZA 5L0QC 3LNIA 2WUBH 1U42A 2O72A 1TSRA 4UM9B 1JZFA 5EG6C 2BPBA 2VDLH 5FYKH 1KTLB 2VH5H 5E1AB 1QBMH 3EHBB 1P0SE 5DFVC 5BPPA 1UOKA 3QPXL 1I9JH 2BP8A 4QAMB 1NBZA 5GSRB 1ZANL 2IFFH 3CDZA 2C3XA 4I1RA 1D6VH 4DP6X 3OXSA 2HP4A 5HI3D 2HT4D 1IEAB 3SE8L 2XN1A 4PS4H 3CMOL 1IAOB 1J10A 2D3VA 4NJAH 2ZUUA 2E9BA 3DRTB 5DJDB 2VLLA 3FQNA 4YHML 5I19L 1FFTB 2X2UA 3RVVC 1TTRA 1I75A 4HHWA 5GHWL 1B0RB 1RZGA 4DFIA 4P2YA 5EF1A 1KCKA 1TTCA 1CXEA 2G4EA 4KKBD 2J4WH 3QI9A 1IGCL 1R34A 2O26U 1KN4H 3FK3A 1IRAY 4K94L 1MWAL 1OSPL 3DHPA 4R84A 4TNVK 2CU9A 5MENB 2HLFD 3BPNB 1OIOA 3QFJB 1F41A 1BIIB 2VC2B 4KNUA 4KMQA 4CGUB 3BIKB 3WXWH 5B8CA 1F3JA 2A6DA 4L3EB 5BZWB 2BOCA 1CGVA 2BWQA 1E4XH 2P8PA 5I74C 4MZRA 4DQOH 1KC5L 3HN3A 3RGBA 5BS0D 2DQTL 5GRUH 1UZGA 1CG9B 5I9QC 1J1PL 3IGLA 4NP9A 2NZ9D 1ED3A 1Y1DA 3VI3B 1PLBA 1JWSA 4Y9GA 3RY6C 4NKMB 3H9HB 5DQDL 2VW7A 2HFEB 4DKFH 7FABH 2DM4A 3RWGA 3K6NA 1U95B 1HH9B 4JJ5B 3VW3H 1A7QL 5FM5M 4K94C 3J2PA 4LVOC 4LCUA 3GZOA 5L6YH 3VO0A 4J3SA 1SY6H 5GXBB 3OQ3B 1U6AH 2AJYH 3EW3B 1CK0H 4YPJA 3RIFK 4IKJA 4D8OA 4ZI8A 1FL6B 2KLTA 5C86A 1JUFA 1DVFC 2B1AL 4V2BA 3VRJA 2BSDA 2Z7WA 1MCKA 5GS0C 5AB9A 4JK0D 2PXYC 2D7QA 1JWMA 1CMOA 2KZ1B 1X6LA 1CCZA 1UM6L 1YNKL 4HK0B 3ULVF 5EFIA 3V4VA 4ZW6A 4GPVA 1Q0YL 2N0MA 4QRPA 4UMGA 3FU5A 1JTOA 4KJPD 1C16B 2P5ED 1HKLL 3E3QC 4WENB 4J3VA 4KKRA 5AOIA 4PHZA 5L2JA 3APNA 1DFBL 1U8CB 3O9WA 4TVSa 2DQEH 4GG8B 3EO0A 4W4OC 3MKGA 5EZJB 5IQ7L 4GY4A 1IM3A 5AAMA 3ZGIA 1ECZA 2D03L 4WWKA 4PJIF 1N26A 3OKMB 4BFOA 1D7DA 1QA9A 4L1DA 2HJKB 3TBTB 2WD0A 1XXFC 4XX1E 2APSA 4Y8AA 1KJ3H 3AREA 4XMPL 2BOBB 4Y5VC 4WWOA 4CGTA 1JHTB 2XQBH 3CFMA 3WBDA 5GSRA 1A2YB 1MJ7L 2WY3B 4JDTH 4LLQA 4Z7VE 2WKOA 4WI3A 1AZVA 5EZJA 4YDIH 2WKGA 4C83B 3PF2A 2WLMA 3ATFA 1E5BA 4H1LA 4M1GL 3JWNC 5H35B 4LXFA 3O45B 3QAQA 4HC1H 4AZ8B 3QWRA 3VCLA 4ZSOA 1AFVL 4BSVB 4Z7UE 3MXVL 4OH2A 2Q8BL 1VADB 5IUCA 3QUXD 2V9TA 1URIA 2P26A 3DOSA 5I17A 1JYNA 3CH1B 2CLZB 3D2UA 2EE3A 3ASNB 3NG5A 5HVWA 1N7MH 1KTRL 3RWHB 1WIOA 1JUFB 2VN3A 3VWKB 1BZ9A 4GSDH 3O0RL 1U8QB 4KJQD 5DCCA 3MJ9H 4DZ8A 1PCSA 3QNZA 1QRKA 2DAVA 3MMEB 5KOMC 4ANKA 3TX4A 4Z7QF 3VQLA 1CFBA 2A4ZA 2QSCL 3L1OH 4ZQTA 5E4OA 3OKMA 1RIUH 1NH6A 1MCPH 2VUKA 1T2QL 3ABLB 2PTVA 1RI8A 4YC2B 2FLRT 4H40A 3QZWB 4JHBA 1ASQA 3IE9A 4WY7H 4HT1L 1ACCA 4N8VG 4YPGA 5IW6B 4ZUSA 4GG6E 3QAZB 2IADB 5L4MA 2OI9C 1WBXB 3Q3GA 4FMVA 2MPVA 4MCYA 4K71C 2R27A 4WTXA 2BM3A 3ZX1A 2V2TB 4PN6A 5INDB 2UZYA 2X6BA 1H19A 4N6RB 4AJVA 1K8DB 3WHE0 3FB7A 2DF3A 4XNMB 1EBAA 3UTZA 1VDGA 1CF1A 1VACA 5J0BA 3C2AH 5EU5A 5BV7H 3T4AB 3UTTD 5DYOA 1KPUB 1CFSA 5HJ3A 1KB9K 4YFLF 5KVGE 2I69A 3WKML 2X4QB 4LRIC 4H8VA 2NY3D 1FYTA 5LNDA 3UH8A 2VLJA 3ZE1B 3I6LD 2DQUH 2WXKA 5AW4B 5IQMA 5JO5B 4I3RL 3GS0A 2Z31B 3U0PA 1RLBA 4OGYH 4U0RB 4FAAB 3MRBB 2WTRA 1PBYA 1JWSB 3DGGB 4C4KT 3HS9A 2AAAA 2D73A 4ZSOE 4FQLL 5EDXA 3AT9A 5D5MB 2IMMA 3OWEA 4LMQI 4P2RB 3PWPB 3WGUB 1ZV9A 2R69A 4TUJB 3W37A 5B3SB 5E8PA 1U3YA 4HWZA 1JPFB 4OV5A 3SE9L 2CHZA 2WCGA 4PEEA 4X6DF 2PNDA 5D7EA 4NQSA 3CWGA 5C09D 4HHAA 2VNCA 4JFDE 4J4PC 1KUMA 5F9WB 2IANA 3TIDB 1A64A 1CE6B 4M7LH 2R29A 3B2UD 4B60A 2YK1L 3AZUA 2Z9TA 3KJ6H 3MBWA 1RAMA 1FZMA 1GR7A 1X5AA 1QR1A 5T1DH 3WNPA 4X4YB 5IB3B 1PNDA 5H8DA 1P4IH 4JO4H 4XVUC 1N6QL 4R4FL 3F6IA 2J1KA 1RZIA 4Y5YB 4BZ1A 3QG7L 5I6KA 5H4ZA 5AL0A 4U1SA 2ZXAA 1C5DB 1HL4A 4LLAA 4ODXA 5F0LB 4GLRH 2GYSA 3MRDB 3FUNA 4UUJB 3T8MA 3O6FA 2DQIH 4K3HA 3CC5A 4K5MA 3V5KB 5I1EL 4QEGA 1P1ZB 3F7PC 2H2SD 3MUHL 2DQEL 1FLTX 2ZOLA 5CGMA 4MDIB 1REIA 4Q6IA 1M7DB 3KPRA 5K5YA 1UUNA 2YMOA 1TVBB 4PVLA 4Y4FC 2WNGA 1RK7A 4XWGL 1PSKL 5CLZA 1PU0A 1RCYA 2A6JA 4OY9A 4L37B 1VZGA 2DWDB 2OI9B 4U0QB 2GTZB 2EIKB 4IRZL 3TWCH 4J3XA 4F91B 4LQFH 5TJWK 3FS9A 3VXUE 3N42F 2C9SA 4CVXA 5FW8A 2DQDL 2AK1H 3UG5A 2PCFB 4EAEA 1KIPB 4HIXL 3KPSE 4KI5C 4YHLH 4D9RE 4CNIA 1VFMA 3ARRA 1JHKH 5IROC 1FE8H 1QFWM 1G94A 2DN7A 3CFKB 1FGNH 2GIYA 2VSMB 2JJUA 3TCLB 1WIPA 3FT4A 2DQTH 2CR0A 1KCLA 4OM0H 3PL6D 2VMDA 1VPOL 4PJBB 2RJMA 2P5WA 2UWEE 3C8KA 1CFSB 1KPUA 3KBFA 4LVNB 3P02A 3BRFA 2R1XA 2O4EA 1KYUA 2E3VA 2BWIA 3FAWA 4GIAA 2AXJA 2PCPB 3OLEA 5KSBB 4PV8A 3SZKC 2Y7NA 4P4KC 4JY5H 4XMTA 2RAMA 5LBSH 2EDEA 1KJVB 3WS6A 4FXLA 4M1DH 5T3XE 1T5XB 4K7FA 3B2XA 1LP9A 1LVEA 4AG4L 4DCQA 3NZSA 3OQRA 3CSPA 1K9TA 4FEIA 1MFEL 1ILSA 3TYGL 3DPBA 3IMWA 4Q6KA 5E4EB 1FDLH 4Z3EA 2HFFA 3FTVA 3U9UA 3V9CA 1PIGA 3LY6A 2ODHA 4MXQC 4JHWH 4Y4FB 3IXTA 3CHRA 1RSYA 4OJFL 1QABA 4ZUVB 4FA8A 2EDNA 4WU7A 1OXYA 4NQCD 3L5WB 4H25B 2OQJB 1LO4H 1YO4A 2HTKD 4G6FD 3I3DA 2Q6WA 1BFOB 1XF4A 3P2DA 1CWVA 4L23A 2BFGA 3GIZH 3H42L 5M7QA 1GOFA 2DLGA 3CJJA 4R7DA 1NGPL 5D55A 2XZCH 3HI6L 1RJYA 3WJLC 5I8EA 1EJFA 5FGCE 1VIWA 4PJEF 4XPAH 4YHPA 4PGCB 1F4YL 3SY6A 4EOWH 4X8JB 4XPTH 4ZMPA 3GJEA 1N6VA 4A39A 4M3KB 2GG1A 3BISA 2FIKA 4C56E 2HT2D 1BQLH 3KL5A 3VCLB 2VZSA 4J3OC 3BEWA 4LSSL 5F9DC 1W72L 4EI6A 5FLVA 4W9EC 4YDJA 4JFYB 2XIDA 4AH2A 1XF1A 4JM4H 4ZFGH 1B0GA 2XZQL 3D39B 1OB0A 5MEQA 3D0LB 4JFXB 3VFSB 3U6XA 1X9UA 5K59E 2UZXB 2K0RA 3ENEA 3QO0B 2V7HB 1QX1A 5IBTL 3QDMB 5ADPH 1WZKA 4KJYA 5FYKU 2Z31C 3KPLA 1N5YH 1TVDA 2QZ5A 2E7DA 4AGNA 4LHJB 1SBSL 1ZLDA 4NJAL 1AS8A 1KCUL 2Q86A 4BA0A 3CX5J 2GEQA 4BRVA 5JPMB 3VGHA 1SFDA 5MERB 2VERN 1HHGB 1WWCA 3F5WB 3PWPA 3QH3B 1EX0A 4GRLB 4LEXL 2NX5D 3C6SA 3BVUA 4PRDB 4PGCA 2V3EA 2JXMB 1TR7A 2AGJH 2J20A 1S7UB 3H9SA 4WEBH 4BQ6A 1VKXB 4RFEB 4MMZC 3U82B 5I1HL 2VLKA 1QWUA 3QULA 3FO2A 1A1OB 4NM8L 4HEME 3VQ1C 3L4UA 2X6UA 3UTQA 4NCC2 4XN5A 3C6LC 1R5WA 5GRUL 2WYTA 2VDQB 4XPGL 1LE9A 1QR4A 3EJTA 1J1PH 4PWEA 3DV4B 3D18B 3Q2CA 1DDTA 1AXTH 1ORSB 3MC0A 5GZOD 2HFFB 3U9UB 4PG9A 1DJXA 4OSUL 2J8HA 3KE0A 3ESOA 1K8DA 5T3ZL 1JGVH 2ZKMX 2VLRB 2J88H 3SKOB 1M53A 1JPEA 3WMQA 5DQ9B 4BH8B 2DEWX 4QHNB 5KYWB 3NJJA 3B1TA 2XLLA 3OKLA 3BH8A 3BKYH 4S2SB 1U8KB 4FQIH 5KUMA 3V4PB 2J8UB 1L6ZA 3IF1A 5DLMH 4K23L 3GNML 1K5WA 1RJZA 4DP1X 3NSFA 3RFZC 3WNLA 1E2ZA 2PWHA 4YHIA 4J2XA 2X42A 4PGDA 4X8XA 3AREC 2XWCA 2BVOB 2AJXH 3C87A 4F9LA 1J9CT 1AIFA 2VN5A 4OB5L 2IGTA 1X5HA 2MCPL 3TJEL 3VFOA 4OIFA 3FT4B 4PSRA 2HN7B 4V2CB 1Y07A 4XAWH 1KGJA 3S3BB 1VZHA 3MRNA 5K9KB 4FYRA 3UTTB 1HXMB 4EDXB 3BHBA 1NCHA 3VGDA 4HUNB 5IT2H 2WXNA 1E8YA 1G7PB 4OU3A 3QEHA 2EXTA 4LSQL 1UOWA 2XQYG 1J5OL 4NUJB 3RAJH 5FK9B 5E2VL 4XCYB 4ZMTA 4HIIB 3ZIMA 4AQAA 2JIXA 2JK5B 4GSQA 3CDGA 1IZJA 3CFEA 4LPWA 2ZX8A 3UZQA 5EWIH 5HHQB 2VZ3A 1YNLH 3CZEA 1I1YA 4HZ1A 3V4UH 3AQZA 3CFCL 3FCBA 4NLAA 3ULUD 1IGFH 1JF1B 1F90H 4RMSA 4L9LA 4CU8A 2QQKH 5GZNC 3K8KA 5E8NA 4MDIA 3NZHL 4U3SB 5E2WH 4WWPA 1PZ3A 2IALB 3VXSE 4J4PA 2AXHA 3KPRE 2M83A 4WI0B 1IGTA 1P7HL 5CLTA 5EEVA 3IRCA 1MAML 4I0CC 3RE0A 1P9MC 5IBLD 5EBMA 4DGVH 3MU3A 5F3FA 1ZVNA 1YEIL 1OD7A 3SE4A 3ZL1A 3QWOA 2EDWA 3ULVL 2KPNA 5GGUB 4G8EA 1LD9A 5GGSA 1IO4C 5J6HA 3RWDA 3RY6A 3GT6A 3X12A 4NENA 1X6NA 4X8CA 5AUMA 3RL1A 4ZUVA 2DM2A 4X4XB 1CGSH 1I3GL 3L7FB 3LIUA 5DD3L 3VFWA 1QSZA 5E5MA 2ZYIA 2XWBA 5KTEH 2FIRT 5T8IA 4LCWB 3FUDA 1S7QA 2L7JA 1U8CA 4G59C 4MXVF 2R7EB 4WGVB 4HJ0C 4X9HA 3DDGA 2MMXA 3Q44A 3U46B 3L3DB 4DP8X 2W80C 2YK1H 1UADC 3O2DL 4RZCA 5BQ7B 3WTWA 3QEQA 3KYOB 3PPEA 1KJ2L 2F1AA 1NC2D 4NSKA 3DIFA 3ZGHA 2EVJA 2JCCF 4L4TD 3APMA 1LEIA 4NN6C 5LCVH 3U79A 1QI5A 4JR9H 4CADB 3I02B 4XN4A 1HE8A 2KYIA 3V0WL 4PJXF 4BZ1L 2NY0C 1I8KA 3SKOA 1KXQA 1Y0LA 4NQEB 1TXKA 2XZAH 1MCPL 1M7XA 4WDIB 5DZPA 4TF4A 5F7EL 1IEBB 1MQ8A 4AT6A 2J71A 2Y1ZA 4FKEA 4ZFOA 3SOBL 4F92B 5ERWB 1I9RH 1OALA 1PY9A 4Z7NE 2QR0A 1GGBH 1TZGH 2EUWA 1FO0L 4OJEH 1S7RA 2HFGH 1E4JA 3KYMA 1RHHA 1MFCL 2OYMA 3HZMB 3GTNA 3U9WA 3LRHA 5EZOH 4DNLA 3FU9A 1CUOA 3C09C 5DYFA 3LQAC 5HDRA 4PWIA 1UATA 2FR4B 3VXNB 4CBZA 3HRPA 4JHWL 3ZRSA 2IQ9L 1B4TA 2MHAA 2BOCB 2BNQB 2CIKB 4XBEH 2QMKA 5KJRH 4M6ML 5C0RH 3M45A 3T6XA 2JXMA 5LO7A 5CZXD 4AQ1A 1KTBA 3QFGA 2AZUA 2Y5EA 2NOYA 3TZVB 1JSYA 1WE5A 3CMGA 3ZR6A 2E9JA 3NA9L 5KSBA 2G5BA 3VE0B 1ZJBA 3WEXB 1P1ZA 4XC1H 3VFWB 2HX9A 4GJTB 1XH3B 3Q5OA 2Y3AA 3V0IA 3SDYL 1H8SA 3ZTNL 2J55A 2G2RA 2VSDA 1AGFA 3FZUD 1HOCA 5D1ZA 3AY4A 3D6GA 5G5DA 2ZIDA 3OR7B 2ZUQC 3G6DH 4TUKH 2HT4C 2O93L 2Y6SD 2ZOWA 5E03A 5EZLB 4R5XA 4L8CA 3KPQA 2O61A 3D0LA 1E5ZA 4JFXA 2QELA 1OM3L 1H9VA 5L9DL 4N2NA 1HDMB 4YE4L 4GQZA 4GRMA 2Q3XA 5FV2A 5CM1A 3G5ZB 3O0RH 1QZ1A 2V5MA 4CADA 3MJ9L 2FX9L 4Y4HA 1BOYA 2XZQH 4EI6B 4ZTPL 4TLTA 3JV6B 3AG2B 1D5XA 5T1KD 4JFEA 3V2AR 1T0OA 1ZIBA 2F74B 4PBWD 5BZZA 3QCVL 4PJHB 3X14A 3W2DL 4C47A 1XTMA 3S5ZA 1A7PL 4B9ZA 3HG3A 3BKML 2HJFB 4LKCB 4NO5A 4PFEA 2R9HC 2XXFA 5CAYB 1BDYA 1PD0A 5KVFL 2WLLA 3OM3B 1MFUA 3QJQB 3QZMA 5KBKA 4AL8H 1HWWA 3CFJB 4KK9D 4HKXB 4KAQH 4XVTH 4PP2B 4R2GD 2KERA 1KELL 4PJCB 1A1NB 1DBJH 3MJGX 1S4IA 1TU2A 3EO9H 1JXKA 2AJSH 5I1CH 1KWKA 3L5WA 3QO1A 2WWKO 4H25A 4ZMVA 2J8UF 3V4PL 5I5MA 3H8NA 1I4FA 4MMYA 5E9NA 1E2WA 1J11A 3L45A 2AVFA 4ZUTB 1ADQL 1DLFH 3QC5X 3AQYA 2HRPH 1UG9A 4GH7B 1BFTA 3RIAK 5DT1L 5EPMB 3MN8A 1A47A 1NGXB 3DLQR 3DTXA 2PABA 4M62H 2BP5M 4P46C 1U8IA 4ELMB 1YEWA 2E75C 2GITB 1VPOH 2PO6D 3IAPA 1MEXL 3L5XH 3A22A 3RGVD 3J8F7 1EHKB 3TEXA 1XGRA 4X98A 3CZLA 4Y2DC 2JVUA 1R3KA 4N0FB 2H1LM 3QEHB 4QRTA 3UBFA 4GKZA 3VXRE 1Q72H 3I6GA 4B9KC 4IRSB 4DOHB 4PJAF 1YECH 5IM7A 4KV5E 1SOKA 2IF7A 1KGWA 1UM5H 4NPKA 3TEZA 4LKXB 2G0KA 1RZFL 1C5BH 4XO9A 5KYXB 4U31A 4UAOB 4HEPG 1AIFB 1BQKA 1YHPA 4N8UA 1J18A 1FDLL 1S3RA 4FG6C 2F54D 2MQ3A 2FBJH 4WDIA 1BPVA 1HC1A 1EJOL 2WXPA 2DQJL 2Y5TA 3SGDH 3T04D 4F3FA 4H8PA 4ADGA 4F8TA 5DHVB 2YMTA 4F7PB 2OTWB 4HIHB 3OKDB 2DJUA 3QG7H 4FKHA 5I6NA 4B5EA 4BWUA 1QOKA 2C1OB 1X5FA 2MRYA 4NUGL 1U8OB 2OS7A 1RUPL 4L8SA 5IGXH 4J3OG 4BD4A 3C5ZC 4KX9A 2IPUG 2ADYA 5F88A 2AXWA 3I75B 1Z9SA 2WSDA 3OG6B 4HOXA 1JVLA 5EO9A 3RQ3A 4ZUTA 3LKPA 4PJ7E 1QHPA 2R59A 1VCAA 3QDJB 5FO9A 3A4EA 2FGWH 4MQTB 3SKMA 3MRMB 1UWXH 4BZ2H 2H32B 2IWEA 2GSGB 1TCMA 2MKWA 1VGKB 3BGFC 4FFZL 5GGRY 5B3JF 5J6GA 3QUYD 4G8FB 1BSIA 4I77H 2ZICA 1M2VB 1MFAL 4F7CB 2WW8A 3CFDA 1NBZB 1JNLL 1N0XH 3BVNB 3NGBC 1HIMH 1IARB 3EAKA 3MBXH 1IGTB 1RK0A 5GGVL 4QHLA 3EO0B 2VCOA 5EBGA 4ENED 4ONHA 5I24A 2BNUB 2XA8L 4XMLH 2DWEA 5KZCD 2JJSA 3BGAA 4KRLB 1C8QA 4PJ5D 1ZE3H 4XOEA 2ZUTA 3S35H 1HH6A 5HI4D 3T3PF 4BFJA 1DBAL 1VFAB 1PY0A 1F4XH 4TLUA 3MGOA 4AZ8A 4EUPG 4YO0B 3VXME 4WFFE 5FHBH 3K1KC 1INEH 2OMTB 1BFOA 4DN3H 4KXZI 1XB6A 2V33A 2WMPB 4LSQH 1A25A 1E40A 3VDBA 1UCBL 2XT1B 4JFOB 4N2GA 4J12A 3QJOA 1KJ2H 3HPLB 2P7TB 1OSYA 3N55A 4MJHA 5E9DE 5AQ0A 3VXSA 5EZLA 3UBXI 5LBGA 1A4AA 4HKZA 1NBVL 4OF3A 5A2FA 2Z3FA 3P0VL 2Z0BA 3NSCA 4GBXC 3B9KD 3DWTA 4MJJA 1NAKL 4N20A 3MI6A 4LEXH 3WFZA 3O6ML 3LH8A 1NKGA 1R3IH 1V7MH 1ASPA 3S9DB 3OSKA 1JDAA 2QQLL 2AEWA 2GJPA 2NZIA 3QXAA 3L3KA 3UO1L 3SGDI 4KWUA 4MD5B 2RMNA 1FQ9C 4D8PA 2HXAA 5I8EB 4BKTC 1IVLA 2XX1A 1I1RA 1SDAB 1A1MB 1ZSHA 1K3ZA 5AW5B 1KZYA 3HFFA 2EYTB 3W11D 3WFEL 1VZIA 2R0WH 4DAGH 3DMMC 2QZQA 4XCEB 2J88L 5KVEE 1KLFB 3RB7A 4EIGB 4RIRA 5C97A 3Q43A 4G6AD 4LRIA 2ZXWB 1E8WA 1O0VA 3SOTA 1WTLA 3OLDA 2NYKA 3QJUB 1OCCB 3BCFA 3D4CA 4PV1C 4RGOH 3NCJL 1WG3A 1EVUA 4N86A 1JGIA 2Q87A 1UWEL 5J06A 1CFQB 3BX7C 5FB8B 2HAZA 3KR3H 2WVSA 3LH9A 3UIZA 4C56B 2YUWA 3SODB 1JHLL 2VM4A 3KWUA 4AIXA 2QSTA 2BXZA 3CX5K 5I0VA 1JYXA 1YEGL 5BNXD 2EIJB 2VDLL 3AMKA 4JKLA 5FYKL 5BZDB 3QI9C 1OKEA 4IRSA 1JZDC 1S7UA 3H9SB 4OCRL 5A2JH 4XN2A 5JHLL 3EJQA 3QUXB 4C4UA 5KYNA 5C6TH 5T3XD 3HC3H 1BJ1H 4IU3A 4KJWD 5DTFA 1I7ZB 1Q0XH 1MAJA 3TCXA 3IWVA 1DVUA 3COOA 1VEMA 1BQUA 2AQSA 2ZYRA 4NLHA 1AOHA 3RJDA 4M48L 3QFJA 1BYOA 3DUSB 3HKFA 3RZWA 4AYDC 5LGHL 2EH8L 3BPOB 3C8KB 4HIEA 5C71A 2X1XR 2VC2L 3K0WA 1FF5A 5IFAL 5IJKA 3WXVH 2I26N 1EAQA 1LP9E 3CQPA 4XVSH 2XWTA 4HFWA 4GUQA 2VDRH 5JLZA 4EBQL 2MTPA 1T0PB 1XZ0B 1LWRA 1ZOXA 2I5YH 3DXAA 1FUNA 1KIPA 3VXOB 4WW2B 4JKMA 1U91A 1BX2B 3C60D 2WMPA 4QRUB 1ACYH 4LDLB 5GJTH 4ABWA 2BY3A 4DK6A 4S1DD 3BRGC 1NPJA 5LG6A 3R06A 1MRCH 4XC1L 4M5SA 4N9GB 1WF5A 4WO4A 2ZKHL 3N6YA 5K39A 5I0YA 2IDFA 3VE0A 3WEXA 2AJVH 3FTWA 4FJ6A 4PB9L 4OM0L 4ZUWA 4WVRA 5IQLA 3UZEA 4UM8B 2WHVA 1IKNC 1BM7A 3L08A 5CEZD 2ZOLB 1IAKA 1PQZB 2JI3A 3U7YH 4WJG3 1LWHA 4HK0A 5DR5H 2B1OA 2C3WA 5I6LA 3REWB 4I77L 4N68A 4EZLA 5JIPA 2BNQA 2Z0UA 3O9WD 4JPVL 2BW5A 4N3UA 5L4JA 1OTSC 3B5TA 3DARA 2VJ0A 4ZMYA 1D5ZB 1E90A 1OAUL 3QYCA 4KV5F 1QUNB 2OX5B 4LE8A 4HX1A 1MHEA 5C07D 2WQXA 1J48A 3WFCH 3O2DH 1AZUA 1PG7W 3IXTB 2WINB 1A7RH 4OQTL 3D33A 4XNMA 3S6CA 1D2PA 4NC2B 5FA3B 4U1IA 5E6IC 1UZ8A 2XX0A 4HUXB 2YQGA 1Y6NR 3P11H 2IV9A 4QXWA 5L4IA 3U9PL 3B7TA 3KGRA 2WXLA 3DUSA 3N9GL 4FFYA 4V1DD 3SCMA 3WS6C 2YD7A 4YHOL 3NPSC 4XP6H 3FXIC 4P46A 1BECA 1IGJB 4ZYKB 1D7FA 1AD0A 3FQTA 5HBBA 5LLIC 2D7TH 3K71B 3RY4A 1RU9L 3HPJB 1NFIB 5DHVA 5M95B 2OYKA 4LLYA 2PCPA 2Z1KA 5CUSL 5DZLA 3LRMA 2VXSL 3QUXA 4XCFH 1F2QA 3WLWD 4I1PA 3L95A 1JXFA 3LRSA 4GW5A 1E28B 5CD5C 1F3DH 1G9MH 2EDJA 1ZMYA 3FSWA 4ZMOA 3MJ8A 1UACL 5K33A 3NEEA 1YUHB 3IDGA 4Q0XL 1FRGH 1O9ZA 4X4MA 4XO3A 4G1MB 1F90L 1NEPA 3IJSA 4XMZA 1KN4L 3LZFH 4XC3H 1CXFA 1E4HA 1BQLL 3NFNA 4DKEL 3UPRB 2XXCB 4Y89A 5EIQA 3T3PB 3VWKA 5CJXA 1D7BA 3QUZD 4PB0L 5DMKA 5ABAA 2JCCB 1D5ZA 4AW7A 2X7LA 3QA3B 4Q9QL 1RPUA 4ZO7A 1IAMA 1SJEA 5L2KD 3ULVC 1LD9B 5GGSB 3B34A 4GYBA 1SJMA 3AG3B 1YEIH 3TT3H 1JZIA 4AVJA 2N59A 2P48B 4X7SL 4DW2L 3KPOB 1XGRB 2G75A 4NZUL 4PTUA 1QD0A 4TUKL 1QHOA 2C7UB 2NNCA 4FQ1L 2E7MA 3MBEA 1O7DC 1YECL 5FF6A 4XRCA 1FL3B 4RGOL 2IADA 4IBWA 4TNWF 5D7JB 5F1NB 2LQRA 3V0EA 4LOUC 4CC4A 1SBSH 5D6DA 3N1FC 3L5JA 4WO0A 3CFDB 1F1DA 2ZXQA 2NXZC 2H47C 4LESA 4WK0B 2AXFA 4W9DC 4KITB 2EAEA 3A67L 5I1LB 2CMRH 3NK4A 3TBTA 4HFUL 5MHSD 4JHAL 3MV9D 5KSVA 4XXDA 2KHAA 2ICWI 4FNSA 1YY9C 4MJIE 5BZXA 3RNQB 4RAVB 4LOEA 5LQBL 4XR8C 2BSTA 2JWYA 1UJTA 3FCSA 3FQWB 4OCSL 2DWTA 3BZFB 4UILH 1K6QH 1AQDB 4K3GA 4N2CA 2V7NB 1BF5A 3TIDA 4R2GB 4M48H 2WIIA 2EXYC 4KK5D 3KW8A 3PAYA 2BWDA 2YAQA 3Q8EA 4DOHE 5ILTH 1BXAA 4GG6B 2HFGL 5K1VA 3P0VH 1TJXA 2CJSA 3K8LA 1YPZF 2P44B 1ZWIB 4XN9A 3RL2B 3JV6A 1EJ8A 3V6OC 3Q8FA 3CLWA 1OE3A 3LHPL 4GFTB 4L9LB 2UXGA 5B39A 4CDGC 4F8OA 3Q0HA 1HINH 3G5VA 4GIPD 3R19A 3PUUA 5KJRL 5BVPL 1HESA 4AQAB 2IPKA 4I9XA 5FM5O 4JDVA 1X5KA 3L4CA 4WFEE 1YQVL 1JGUL 4OGXH 2Z91A 3GSQA 3KLHC 4QTFA 1C12A 2DQMA 2VW6A 3LS5L 4B9GA 2XA8H 4XMLL 3HG2A 4FXKA 2WKLA 4DEPC 5EF2A 5ENWB 4V33A 3EADA 1M4KA 2VIRB 1F6LL 3UDWA 4G7YH 5EC1B 3S4SG 1YG9A 4ZUUB 3P4OB 2NY1C 2HG0A 3Q2WA 5B8CB 1VKXA 1QLEH 2NZ1A 2VMJA 5ESVA 3ARSA 4G80B 1UA6H 2V2TA 2CGRL 2R2BB 4PRDA 3P4NA 2XG4A 4A7GF 1A9BB 4N90D 4YOKA 2OMVA 5E6YA 1J9RA 3VX1A 3ZHKA 3GBLA 1NAKH 1PGRB 3JT0A 2FYYB 4R83A 1IM9A 1T2QH 2QTEA 3O11B 1ID5I 5IW1B 1CURA 5CCHE 2AVGA 3II3A 4JPSA 3NCCB 1RZQA 1PS3A 3G6JE 4QRAA 1F58H 1EO8H 4AJYV 4Y9BA 4UZGA 3BT2H 3C6EA 3C60B 1MHCA 1DEDA 4HKXA 3K2UL 2V5TA 7PCYA 3NVQA 4R4NC 2IBZY 3EZ8A 3ZUCA 4H20H 1J8KA 2FUQA 4A7TA 4DO6A 4K4KA 1BEYL 4LQFL 3NP3A 2F54A 4GS7C 3QHFH 5B22A 4WJ5B 4DPCX 4XHJD 1X7QB 1QBLH 3P54A 1N59A 4KVCH 2K7QA 2X4UB 2QQQA 4AMKH 1JI1A 1NL0L 1BREA 3RVWD 1IQDB 5TE6L 4L8DA 1M9WA 3MBXL 5E23A 3A6OA 1NGXA 1HFUA 1NGZB 3GK8H 1K5NB 4JLRA 4Y4HB 4XP1H 2PWGA 3PFQA 4YDIL 5IMMB 1MPAH 4PJ9C 3QEQE 2P45B 3LN5B 4P5KB 5C0DA 3INUL 4Y7MA 2MQCA 3TTYA 5FYLE 3EFDL 2HLAA 2EH7L 3I6KA 4ODSH 4TYUA 5EN2A 4F58H 5IVXB 2BOBA 2EACA 3VI3E 4PJ6A 3UC2A 3HBQA 1DQJA 2IG2H 2EJ1A 1AY1L 4CA4A 2X4NB 5LBSL 3KWVA 5IB5B 1A9EB 5JXAL 3BWSA 3GO1L 1DANU 1I8MA 2ADIB 3L3GA 1JFQL 1ORQA 3D25B 3L9RB 4TLSA 3TYFA 2LFGA 3SGKC 4FG2A 4JQIL 2F6AA 2WNKA 2R29H 1PAZA 2C5DC 5J13C 2G3XA 3GDCA 5HHOE 2VN4A 4YDJB 3VD5A 3F7KA 3T0ED 4JFFE 1D5BA 1E5UI 4PRPA 2NY0B 5KG9A 1PTZA 3FBKA 5FYLL 2GBUA 5GISH 5C08D 4KKCC 2DY2A 4JVWA 1RIUL 1PDKB 5CCGE 1FHGA 5IBUB 2L8AA 4JRFA 5HHVL 3EUDA 4OGAC 1EV2E 5D1QC 4QRPD 2DQJH 2MH4A 4TQEH 2NCEA 3ZZQA 2WWMD 3G5ZA 1MI5E 5GGQL 2QVFB 1ZK9A 4PUBL 1FAKT 3ARGC 2QPFA 3PPSA 1JPGB 3LV3A 1OAQH 3IU3A 5FO7B 2X3AA 2NNAA 4KC3B 1AP2A 4GRWH 5D9SA 1UD6A 4AQEA 2FJSA 1T7ZA 4NCC1 1P7QA 1HH9A 4JJ5A 1C08A 4XPTL 3TCLA 5E0QA 2G2RB 3MOAL 1ADQA 1NCBH 3LCYA 5L2KA 1WYJA 3MXVH 4AYID 3QC6X 1EQWA 1KBPA 1WA2X 3D52A 3BPLC 3LNFA 5IW1A 1NMCB 2EXYD 4KK5C 3IN2A 3RPIB 5HYEA 5JDSB 3MLWH 5BV7L 1XMEB 1YYML 3LX9A 1FRGL 1EHAA 4ZS6D 3AS3A 1E3ZA 1K72A 2P8PB 2XIBA 3QIWB 4GKLA 3RI5K 3IDXH 4EIZC 5C3LD 4YL4A 3MYZA 4ZFGL 4ESKA 1CDUA 5GJSL 4ZPVB 1AHWC 1HIML 2DKMA 4ES9A 3MJ6A 4Y1AE 2QFPA 4OBRA 4PJXE 1B90A 5KYUA 2VLME 5DD6B 1IZKA 1UXSB 3EYSL 2RBLA 1A14L 4POYA 1DVFA 5E6SB 4R0LC 1W72A 4NO0B 1IJNA 1ORQB 2D3NA 1LQSR 1VB9A 3JWDL 3RTLA 4YSCA 5T3ZE 1QSVA 1YA5A 5DUMH 4OCRH 4XE5B 1S7TB 3BP5B 1OAZH 3FT9A 1XH1A 5JOFA 4XZUB 5D4HA 3PRZA 3PHQB 4AL8L 3CFKA 2WTPA 3ARDD 4Y5XA 4EKJA 5LDSA 4LSTH 5E2JA 2C9VA 4FS0A 1YLBB 1ZANH 3FTYA 4RMWA 3F83A 3MZGB 1FYHB 1Z9PA 1G0YR 1MCNA 4MJ6A 1IKOP 3R18A 4NN7C 4YNYB 4E41E 3O6FC 4K8RH 4DN4H 3TT1L 5LXGL 3RTQC 4X6FA 1IE4A 3MV8E 1UYWH 1NCTA 1ZHNA 4UNUA 4Q56A 3SJVA 1JK8A 4IIZA 1JYWA 5I6PA 4CMHB 4OZ4A 4S1SH 3I6LE 3MJ7A 3WFHB 2DLFH 4DKEH 1EJ6A 1DBML 1ZSDB 3EJJX 4G6KH 5F1IA 2PCYA 4M1GH 3IDUA 2AJVL 4PB9H 3TO4C 4DP5X 2FTAA 2K6ZA 5A3IC 4LDCA 3U7AA 4OBSA 4NZJA 4NS0A 1QRNB 2Z64C 1OWWA 3AT0A 4AQZA 2Z35B 1IIKA 2ZKHH 3K4AA 4DQOL 4PJGE 5J6HB 4DTGL 4NO0D 2NTFB 4HCRH 4KMLB 3UAJC 43C9B 4QRFA 3QIBC 1NDMB 5HXMA 3H2QA 3QW9A 1WCQA 1NJ9B 4FLQA 2H6OA 4NNPL 5C0FB 1FIGL 2G9KA 4HIJB 1IM9B 5EO9B 2JQMA 1KBBA 2I24N 2W9EH 1FO0A 2QPEB 4M8QB 1FCCA 5T3XH 1ZT7B 4OLVH 5I15L 2NSQA 2XTSA 3EBGA 2WTOA 4OD3H 4PR5B 4S0HA 2WCPA 1MN4A 4YVNA 5IB4A 3OMNB 5SWSA 3UBXA 4XBPB 4JZOB 4X8GA 4ZD3H 3MODH 3QJZA 1T22B 4OF5A 4DEUA 2V5SA 3D0VA 3NCEB 2OSLB 3PWVB 1R5IA 5K1NA 3LVEA 2LU5A 2BSRB 3WO4C 2O6FA 2F58H 3G5XB 4PTTA 3GMOA 4YGVB 2EDHA 1GS6X 1T21B 1XGYH 3CFIC 3I2CH 1BVKA 4XN8A 3O2VH 1F4WL 5AYUL 3UIYA 5MEOA 4OFYD 3ARGD 1XTLA 4QOKA 1K85A 5EWIL 4TL5A 5JIKA 5JO5A 1J8HE 1H8OA 1W0YT 2CRZA 4RIRB 5IOKA 4G2AA 4NKMA 1KGCD 2D4FA 3ATDA 2V3FA 3D39E 1RPQA 2NNRA 1HQ4A 4BFIA 2W92A 1EEYA 5CKAA 3LZFL 2FZ3B 2WBJC 1T5XA 2CUMA 3T71A 4JM2F 3FB7B 3F01A 3KPSD 4D9RD 3MRLB 3DVGB 3T0XA 1I3VA 2NY0D 4NKOA 3IDJA 2PTTB 1BMZA 5MEPA 3QIUC 5HVHB 4WUKH 3K2UH 5DHVH 5EDSA 1QPXA 3LB6D 5C9JA 4KFZC 3RTQB 4GEIA 1YJDC 2H41A 1CR9L 4RZCB 3WY2A 4U6HB 5A6MA 5CCKH 4MZ2A 3PABA 3G6JF 5DEGB 1CGSL 3DIDA 4AGMA 4KUCF 1WAEA 2X2IA 4Z7OF 5E08H 2GABA 3V52L 4E5XA 5F7LB 1IGML 4JN1H 4NKIL 3VH8A 4H8WC 1UD8A 2MNWA 4QTHA 2P5WE 2AEPL 2MTAA 4U1HB 5GRJH 4JE0A 4XH2A 2W81C 1OB1A 3G5XA 1J7VR 3QJHA 4U2ZA 3OMZA 1UD2A 3SYAA 2H2SC 1AMYA 1KGUA 4AYFA 1P5VB 3FTZA 3O6KH 2P46B 5GJSH 2KT6A 4LPCA 1MQKL 4GW4A 3BLPX 1U8JB 5INCB 3RHWF 1NINA 2PWDA 2JLLA 4Z7VA 5KYYB 4YBQD 2CUHA 3CHPA 2AFNA 3ISYA 2NPLX 4A7GA 4X5PA 5F9JA 3VGGA 3P9LB 3T1WA 4W6YB 3FSAA 4F1SA 1IAIM 4JY6A 2A9MH 3DGCR 4K2UL 3ULUC 2AKRB 4DVRH 3AY2A 5H94B 5IT2L 1F18A 4W6XB 3QR0A 4M93B 1KCUH 4WTZG 1UKSA 3LEYH 1P84J 4Z3IA 1XF2A 1G84A 5DFAA 2Q5BA 3APCA 1YC7A 1BV8A 3K0YA 1XL6A 1QKZH 3V5HA 1WGVA 1MHCB 1BVOA 2ESVB 5K9KA 2HJLA 1BBDH 5AENA 4C8XA 4EEEA 4MAYD 2XN9E 1KTCA 1AGEA 1R33A 2J21A 4LP5A 2X89D 4JM0A 1LHZA 4MB3A 1E6OH 2BINA 2PPEA 3W5MA 1MFDL 2QADC 4UNTA 1JWUA 1MPAL 4GSXA 2QGCA 2X53A 1BAFL 3N5AA 3IU4L 4OZ4B 2YBRA 3GBNH 3FF8A 4GXUM 4QY8A 1U2HA 5AW1B 3SPGA 2OMYA 3EGSA 5DJ0A 5IREA 1HI6A 1U3NA 3KXFD 5BXFA 1R75A 2JKRM 3ETBF 4DT2A 5KBMA 3BUDA 2Y5QA 4RFNB 4OSUH 4A63A 1E9PB 3HRZA 5CIPH 5LWYH 1BIIA 4JO1H 3JVGC 2PR4L 1BIHA 2YQ2A 3RDTD 2QMJA 4MDRA 3KJ4C 3MOQA 4C4KO 2WSKA 5C07E 3MRHA 3KLDA 2APVA 3NGBB 4EIUA 1HSAB 4K9EL 1CDCA 3DHUA 3JZ7A 5D1ZD 1N2RA 4JFWA 3L3JB 1ZT1A 1SXCA 4PJDF 3UAJD 3CCHB 2Z8WC 1FL5A 4GMSL 1TZIA 2BXYA 2YS4A 1F11B 2NRDA 2XXGA 4GQ9H 2NX5E 5K9JL 2C34A 2NY3B 4V1DE 5CGYD 3P1VA 3OXSB 1FYTE 4HUUA 3NQIA 4JQXC 3H56A 4OB5H 2BIIA 2EYTA 3QJSB 5GGQH 1L9NA 4MA3A 5IFJB 4HV8A 4QRSA 1XZWA 1OAZL 5F7EH 4FA7B 1G9NL 3O3EA 5GRZA 5IHHA 4GRLA 2EDOA 3SY0B 2Y0SA 3V9EA 4UQ2B 2HUEA 4Z8FH 1QTPA 1BF2A 2IV8A 1EO8L 1J5OH 1AXSA 4HWBA 3STZA 4F37K 2XICA 3F00A 3K1DA 4GW1A 4O2EA 3T3PE 2EEFA 2MWCA 3NT0A 4RWYH 4LCCB 1U8MA 1NL0H 2O5YH 4JPQA 4WUUB 5AW8B 4E36A 1KENH 1HCFX 4LBEA 3WHXA 4AQEB 2VDNH 4BCZA 3ARGB 5LHDA 3HZ3A 3PJNA 3AS2A 1YNTA 3QNZB 4QRQB 3U83A 5DJDA 3VSQA 3QZNA 3MNWA 5D2LF 1R5VA 4CDHA 3RWDB 2ZXCA 1LILA 2EH7H 4ODSL 2OL3A 3GNMH 3K7UA 3UBXG 1QHQA 4XPFL 2HTKC 3QUML 2NY4B 5F1IB 4YHLL 4G11A 4GW1B 1A7OH 4O2EB 1JN6A 3MFFB 1E8XA 2RIKA 2RB8A 1OGAE 3D85B 4J8QA 2VZTA 4PJ9B 3WDJA 5I2IA 4YXLH 2OPCA 4Y88A 1I8LC 3PXJA 1FGNL 2A9NH 2BVYA 4JFHD 4M43L 1AGBA 4NI3A 2BP3A 3NN8B 1OV8A 3PAVA 1U92B 3NJVA 1JXJA 4DPBX 4N0UA 1RY7B 4J3WA 4ODVH 4X80H 5A2AA 3UZQB 5HHQA 1RXLA 4M9OA 1T66D 4A6YB 3BVNA 3ATEA 4WFHE 2H0JA 2MPAH 2VDOL 4NQDA 2D7TL 2VLRD 4Y5XB 4Z7WB 4Z76A 4A38A 1G7IB 5KJ4A 1DQDH 1T6BX 2W07A 2ZKYA 1QRND 1DZBA 4C59B 2WCSA 1MCOH 4NAMA 5JW4N 3FTGB 3C8DA 5L8KB 5KBDA 3T2QA 3IGAA 1LMKA 5HYSA 2DDQL 3VMOA 2WBKA 2XWTB 3H7LA 1V3JA 2FEEI 1MCHA 3D1MC 3KS0H 3FHAA 4FQXA 4PJDA 3X1EA 2F7IA 4F1ZA 1QEWB 2AJZB 4APQB 3MRRB 3MR9A 1G0XA 1UM4H 2GUOB 3CXDH 4ZMAT 3HMWH 2ZOUA 5BJTA 5EFIB 4AUJA 2CLRA 4I1NB 4QCIA 4PBVC 4OCYH 4Z78B 2NY5L 3TC9A 3UCRA 3S98A 3VFTA 2E46A 3EO9L 2NX5B 4DK5A 4G70B 3KM2A 4H8QA 4XWOD 4UQAA 5E94A 2A7BA 3IDXL 1NCBL 3ZLQC 4WFED 1S7VA 5IFJA 4ELDA 4HWUA 5FKAB 5LGYA 4FQ2L 5SV3A 2AS5M 2GFBA 3ZTEA 1M71B 1T2XA 1KEGL 1HXYB 3UBGA 1UZ8B 1ODUA 3NIGE 4UQEA 4WUKL 2GPZA 3CU1A 3EYQC 1AJ7H 3CZJA 3EH5B 1MKFA 3BCDA 4FL4B 4XP4H 3CIQA 4AT6B 1FFNA 5SWQB 3FQRA 3HPLA 1OT1A 4GUPB 3S35L 3OAUH 3QUYC 1IAIH 3H6AA 2VABA 1K2DB 5ICXB 4HUMB 1T7VA 1U93A 2YR3A 5JYMA 5DDHB 4BK5C 5JQ6L 2IBBA 3BUYB 5ANMA 4CU6A 5IR1A 3KYOA 3ARTA 2OSWA 1SHWA 1I9RL 1E9PA 3E0GA 3HRZB 5E2TH 5GGTH 3QIUA 4PRNB 4RGMC 3FJTA 1LEKA 2GUOA 2B5IC 1BGXH 4L3ED 3HRZC 5TQ0L 5EULV 2AI0L 5ILTL 3ZZ1A 5I19H 5DJ2B 5D1XE 4MKMA 1QPPA 3VJ6B 5HDBF 2RA1A 5K39B 2E7LA 3BH9B 1TJGL 4KHTH 1F42A 3BN3B 4ABUA 2M26A 2Y7MA 4GW4B 5D1QD 5TE4H 5TH2B 1EFXD 1TF4A 3GXUB 2IFGA 5DQJA 5I1AA 2VDMH 3PNWB 1URLA 2A9AA 4HWNA 4NGHH 2EDRA 5E8DL 5FYJL 1NFDE 1QA9B 3L4ZA 2VZVA 3MRQB 1NKRA 4LU5L 4OV6F 3KLHD 4X4YA 3B3IA 4KRPB 1GW0A 5FHAH 3X1BA 1GMIA 4FCHA 2UXFA 4FQCL 1KJ2B 2L0DA 5J89A 2J5WA 1P7BA 4ZFZA 1B2YA 1FNGA 1P9MA 2ITCB 3KBHE 4NT6A 4PP1D 4WHCA 4AEIL 4MZIA 5DEGA 5AB2A 1HK6A 1OAXL 4HCRL 3ZT5A 2DYPA 4FLOA 4FI7A 5CBAA 2F08A 1C9SA 2D7MA 1ZVHA 4AYSA 2V8MA 2QQNL 1OEZW 4ZTOL 1SF5A 5BMFH 3SGEI 1MCSA 1I1AC 1J05B 1SHXA 4RMRA 1L0QA 5CZVL 4OZIE 1BAGA 1SY6L 5KSAB 2AK4D 5T5NF 2ZX7A 4HS3A 4XVJH 3BEVA 4YX2L 1QFWL 4OGYL 4YE4H 5TE7H 4ZX6A 1GL4B 1CGTA 1TQCB 3GBNL 2VGLM 2DQGL 4N9OB 1WWAX 2NY4D 4QWWD 3VWJA 4ATTA 4WFGE 4I0PB 4QLWA 3QUMH 4PCSA 4JZNA 4P2AA 3QISA 1TTFA 1MCFA 3WUZA 1KOAA 3O2WH 4YFEA 4FQIL 2LU3A 4M5ZL 2H3NB 1OB1B 1WZMA 2D7PA 1QEXA 4KVPA 5IJDC 3U1PA 2PR4H 3EYSH 3HB3D 1XH3A 4XB7A 1E42A 5TF1L 4M6OH 6CGTA 1XD0A 1NOAA 1WIUA 2CHWA 3A6BH 1R3JB 4ZD3L 1SEQH 3LYRA 5CZXC 2LGNA 3WNOA 4XAWL 1M7IB 5A7EA 1FG2A 1OTTC 2L7EA 3EOTL 3ESVF 1XGQB 4ONFH 3MUGA 5KYWA 2ZOKA 1RIHL 3TV8A 4ABVA 2Q1EA 1OQOA 4JPKH 2J56A 2IH3B 3NIFE 1TQTA 3GMPA 5C3TA 3K72B 1AZZC 1IGCH 2ZWKA 3BQUA 1BXVA 4IDJH 1KV3A 3S8FB 1IT9L 4LNRA 5SWSD 4XNDA 1FC2D 2VQ1A 5D71L 2ZQKA 4P59L 2F5AH 3RGVA 2IOIA 3Q6GH 3KAAA 4AK1A 5B1JA 3AABA 3QG6B 3C12A 3N40F 3MUUA 5E4EC 5JW4R 5AW3B 1ZLWH 1MHPH 1IEAA 3BVDB 1P7QB 1NM4A 3PWNB 1YEHH 3GIVA 3UG3A 1G6RL 4GSRA 2R1WA 1JVKA 2IPKB 4MMXB 3EBAA 4UZSA 4IHOA 4HCFA 3HAEA 3U1SH 4JS7A 4OZHB 5EUOA 3GMQB 2AQRA 2GQHA 2WZ6A 5BVJA 3PHSA 1CYWA 2WN2A 3VFUB 5HGHA 4V1DA 3WLWC 3KBPA 1IX2A 5EBWA 3P3TA 4FQ2H 3T0BA 4MNHA 4PS3A 4J39A 1KEGH 2MNUA 3IPFA 4P5SA 1UZ6E 1OM3H 43CAB 7FABL 1BG1A 1CVSC 5ACZA 2J1WA 4JDEB 3SE3C 4Y8DC 1RZKH 3BLKA 2FGZA 4W9JC 4FXKC 5PCYA 5T3ZD 1KIUB 4MJIA 1B2WH 3CHOA 5ETUB 1O6TA 4C57C 2Q9OA 3NSDA 5DWUL 1NAMA 3KPQB 2O61B 2AABH 3BE1H 5T33L 3MO1A 3L6FB 4IBVA 2X70B 2Z92A 1T89C 1TZ8A 3DJTA 3F7RA 5EUOE 4AH2B 4L4VD 4ANXA 4A55A 1GTNA 3N1MC 1BWMA 1OGPA 4FTVE 3R1GH 4ETQA 2LTQC 5F9AC 1SRDA 3ETTA 3UC0H 3SCMD 3VH8G 1KTKE 2EIZB 3MTRA 3ZKXC 1UJ3C 1DQDL 5A40E 2AJ3A 3BAJA 5FFOA 2P8MB 2XKNA 4R7VA 5J11C 2H1XA 1NSNH 3US0A 4UM8A 1ZSDA 3OKOA 3WI9A 3VTAA 4R4BA 4RAUB 3WIHL 4G5ZH 3D2UD 4E9QA 2VDPB 3QR1A 1RJYB 1OLZA 4FERA 2NZ9C 4MX7B 3S5LG 3WYRA 2DICA 5EIVA 5BRPA 3BXNB 2F54B 4F7PA 1TEYA 2DQHL 3MA7B 4IJ3B 4Z23A 3APDA 4ABQA 2DLIA 3TT3L 1FVEA 2VE6B 5CD5D 3SE6A 2G2NA 1QUPA 4KQ3L 1YJDL 3X11A 3VXTA 1HQRB 4LOFA 4OCNC 3KYMB 1YNTB 5F9WC 3D9AL 2C3HA 2K3TA 3NFPB 4MCZA 5BUGA 4XCNA 1YSOA 1WP6A 3EDDA 2E59A 4P3CL 3UPCA 3VD4A 1AO7E 3NIDE 4AEEA 1A02N 1F4XL 5E1QA 4A66A 5JW5B 3O11A 3GHBH 3CN0A 4YHIB 4I0PD 4P57B 1NIBA 1ECYA 3ULVD 2W91A 2OSYA 2OCCB 5TFSL 2WLKA 1U8KA 5ISZE 4LPXA 1R3KB 1HHIB 3OG4B 1UD4A 4KKNA 3QYNA 4OJAA 4H13C 4NWUL 3SDDD 1AGCA 4PI0A 4POZD 2GC4C 5FAAA 3QGVA 1VGEH 2OKMA 3DIFB 2K4WA 1PEZA 2HVJB 5AKRA 1V7NL 2BNRB 2X1OA 4CVWA 3QWRD 4NZDA 1EVTC 4FJYA 3AWGA 4JRXA 5L7XH 4JHUA 3X17A 5EEUA 2CIKA 4A2GA 2D7OA 2YKKA 5HGAA 1FG2B 4KI5F 3PUCA 3S7GA 3O6MH 3EO1B 5SX5K 3EKCA 3DV6A 2YAOA 4XO4A 2EICA 5JDSA 1AYOA 3QDGD 4K3JH 4UV7L 2G5RA 5IEKB 5MEOB 5FGBC 1PZ2A 2N7SA 1DSFH 3VI4E 5HYIA 2JQAA 3EOTH 4PG2A 3SHSA 2CDGB 1CFTA 4XWGH 3DX6A 3BP7A 4YMPA 1QFOA 5C0IA 3PWVA 4H88L 9CGTA 4LLWA 5TPWL 3FMGL 1QSFE 1KBKA 4BRJA 3F7VB 1MRFL 4M6NL 4HG4J 3TJPA 5IK3A 1L7IL 4R7XA 1G9EA 5DI8B 4KZEL 4EI5D 3UYRL 1JPTL 2WXFA 3PP3K 2RACA 2DQDH 4U3SA 5TDOB 2EVGA 3ZK0A 2JCWA 3IPBA 3EYVA 1BFVL 4P8QA 3F5WA 1SMAA 1WICA 1FZJB 1E65A 3GKZA 5C09A 2HJFA 4LKCA 4XGZB 2P5EE 3IGFA 4PW3A 2WIMA 2BRRL 4OI7A 2KQNA 5DK2B 1X5IA 1RURL 4MCMA 4JFFD 4I85A 4JNXA 5ANME 3RA7L 1GYCA 4ZX3A 2YHGA 1E27B 5DT1H 2C4XA 1A0QH 4R9HA 4OLUL 3BN9D 2MOVA 3CBJB 3RGVC 1WAPA 3QVAA 5GS3A 4ETYA 3GXTA 2IPTH 1OAXH 1CD1A 1EZVY 3QJHB 1R46A 3X2QB 2GSIB 3SPHA 2CE6A 4WW2A 4Z5RB 5CIPB 4JB9H 1AXIB 1EHLH 4LCIL 4QD2E 2B0SH 1KCWA 4OFPA 3O8XC 4ZX5A 2ZAIA 1S9VA 1GJUA 3QQDA 1S5HB 3WHXB 2JJSC 3S3DB 3VI4F 3IDYC 4QXGH 3QJFA 3FQ4A 5DSCB 3WSQH 3RJQB 4KU1A 5I74B 4KJPC 4ELKB 3K4ZA 3DX7B 5J4MA 1DVSA 4Z7VF 25C8H 1RJCA 3W81A 4WGKA 3KPMA 2BNQD 6PAZA 4LGPB 1Z32X 2YZ1A 3V7MA 4X8JA 5IJCC 1OL0A 3T0EC 4LCWE 5CEXB 1QSED 1T89A 3N91A 4B53A 4YLBA 3CDGB 1N67A 2DI7A 4OGZA 5A6LA 2VKWA 4PWHA 3DDFA 4ODWA 3WSQL 3RRQA 4B41A 4F7KA 3E6FA 3VI4A 2W95A 3OHXB 5EU4B 2UXTA 4IOIB 2XPYA 5EF3A 3FFCB 4PMEA 4Y1AD 1NUNB 2Y7QA 1CDIA 4NN7B 1QBLL 2M1KA 3T4AA 2P9RA 3QZOA 1PLGH 1CTNA 2WXRA 1KPVA 2VXSH 3GMOB 4YGVA 3IJSB 5KVGL 4HXAL 1XVSA 1UXSA 4IBZA 5IESH 2WXIA 5D72H 1SXNA 1KLFA 4PJFF 3D5OF 1Q0EA 1QATA 4KXZH 4AW4A 3AU1B