3FQ2A

Azurin c112d/m121f
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALFKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin
publication title Type Zero Copper Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fq2A00
1AZUA 3EHBB 3ZBMA 3EH4B 4KO6A 2WSDA 1L9QA 3OM3B 3X1BA 1JXGA 2B08A 2IWEA 3IN2A 3NSDA 2PCFA 3T6ZA 4NERA 4ZK8A 3PAUA 1FWXA 1L9TA 3QPKA 5I6NA 1SHWA 1NDTA 2GC7C 1SFDA 4BK5C 3RYMA 3AG2B 1ASQA 1ZDSA 1ZDQA 5B1AB 4A2HA 5I6KA 1JZHA 1E5YA 2FTAA 3NP4A 3AG3B 3X2QB 1TEGA 2VSMB 4YVNA 1J9TA 3NP3A 4M4RB 1UATA 1IUZA 1EHKB 1X9UA 5ANHA 1M9WA 3QJRB 3D12B 1HFUA 1ADWA 4DP5X 1OOWA 3OMNB 3FU7A 4DPCX 1ZPUA 2XV2A 3PPSA 4BDVA 1OCOB 2EINB 1NPJA 1MG2C 3SBPA 1NTDA 2BP8B 1GYCA 1I53A 1IBYA 2J57A 2P80D 5I6PA 5IY5B 2XU9A 4E9TA 3FU8A 5D4HA 1SDDA 4E9RA 3PLYA 3OD3A 2EIKB 2GB2A 4DP9X 4DP6X 1J9QA 3WIAA 4BDVB 4UF7C 4HHGA 3EH5B 1CYXA 4HCFA 5B1JA 3KW8A 3FU9A 2ZONA 1AG6A 1IBZA 1RZPA 2YXWA 4W9ZA 1SDDB 3V9EA 1GR7A 2BZ7A 2CJ3A 2IWFA 1RZQA 2FJSA 3T9WA 3WKQA 2B3IA 3GDCA 3HEIB 1BXVA 4KO7A 1MZZA 1FFTB 1A4CA 1KBWA 4EF3A 4PCYA 4AKOA 4A2DA 3OMIB 2OV0A 2FT8A 2XVBA 3ZDWA 2H3XC 3S3BB 4E9WA 1NICA 1NPNA 3NJHA 5B7FA 4GY4A 1JXDA 3FYIB 4E9YA 2PPDA 2XLLA 2H47C 3FPXA 3NJGA 1PLBA 1B3IA 2YAFA 2CAKA 4G71B 3FT0A 3G5WA 1PZCA 2MTAA 1ILSA 6PCYA 3NSCA 4AX3A 3WKPA 2UXVA 4A2GA 1GW0A 2YAPA 2OJ1A 2YARA 9PCYA 1JZJA 1HAUA 2X88A 4HIPA 4K9JA 1NIBA 3T6VA 1J5DA 1XB6A 3UGEA 4A68A 4AKPA 1GY2A 2ZWNA 2XWZA 2W8CA 4ENZA 4E9XA 2FT7A 2HRGA 4N8UA 5PCYA 1XMEB 2IDUA 1PNDA 1PZAA 3UAEA 3ZIYA 1AANA 1KDJA 2VSKB 2GBAA 1SF5A 1OCRB 1R1CA 3DTUB 4G7QB 1PNCA 3AG4B 2Y1AA 4F2FA 4UAHA 3FQ1A 4CSPA 3NJFA 1ZIBA 3ASNB 2W88A 3NJLA 1SNRA 2XXGA 4F2EA 2NRDA 1TEFA 4YL4A 1E30A 2QT6A 4PAZA 4HHWA 4A66A 1NIAA 3IN0A 3FSAA 3NJIA 2XV0A 2FWLB 1ID2A 4HCIA 1KYAA 3V9CA 3PAVA 1GS6X 4RH4A 1N70A 3U25A 2IAAC 1A65A 1BQ5A 1E5ZA 3H4HA 3PCYA 5TK2A 5B7EA 4DPAX 3GXUB 1TU2A 2UXGA 1AOZA 1HAWA 2HZHA 3T71A 1XB3A 2WO3B 1SHXA 2HXAA 4DP4X 4WTQA 3H56A 1V55B 4KNTA 4YSEA 1AS6A 5I6OA 1EZLA 2YQBA 3FSWA 1NWPA 2UX6A 3FSZA 4TXVB 1JVLA 2JFCA 2OCCB 2EIJB 2MRYA 2ZOOA 4YSRA 2EIMB 3IBOA 5E9NA 3X1GA 3S8GB 4YSAA 4YVUA 3ABKB 1AZBA 3X1EA 4BWWA 3ABGA 1JXFA 1AR1B 2AFNA 1W6WA 1JVOA 2AZAA 4KOBA 2XV3A 2UXTA 1DYZA 4QLWA 1PAZA 4DP7X 1AIZA 1JZFA 1KCWA 1RKRA 2VN3A 1W6LA 4G70B 3BQVA 1JOIA 5PAZA 2XX0A 4WKXA 1WA2X 1AZCA 1AZRA 3AG1B 4GYBA 3FU7B 4YSSA 1OE1A 3ASOB 5B1BB 3CVBA 1F56A 1PMYA 1URIA 3JTBA 2FNWA 3CVDA 2CBPA 2TSAA 1QHQA 4HAKA 1L9RA 1MG3C 1NINA 4Q8BA 2PP9A 2VW6A 5AFAA 1BQKA 2QPDB 3TASA 1ILUA 1SJMA 1ET8A 1CURA 1BEXA 2GHZA 2P80A 3DKHA 3QJVB 3S3DB 5B7MA 1ET7A 2DY2A 1XB8A 3L45A 1OF0A 2Q9OA 1V54B 2GSMB 1MDAA 4L0PB 1NWOA 2XXFA 2PP7A 4Q89A 2VW7A 1NIEA 1VLXA 3N55A 2I85A 2R7EA 1BXUA 3SBRA 2GIMA 4UANA 1IKOP 3NYKA 4G72B 5TK4A 3T6WA 3SQRA 2DV6A 3ABLB 3WG7B 4GXFA 4AZUA 3GYRA 2CALA 3FYEB 2BWIA 4KO5A 1J9RA 3CZUB 2H5UA 3C75A 2IWKA 1PF3A 4GP4B 1T5KA 3IE9A 4YSPA 1CYWA 1PCSA 2JXMA 1AS8A 2FQFA 2I7SA 1YLBB 1N68A 1BYPA 3OMAB 2XUWA 2X87A 4JKNA 2PLTA 2IDSA 4DP8X 4KOCA 1OCZB 1NIFA 2YAOA 4YSUA 2YAQA 3TBCA 3CDZA 4FA7B 3MX0B 3NJNA 1ETJA 2FQGA 2PPEA 4A2EA 4A2FA 1M56B 2FQDA 5F7AA 3UAAA 1OCCB 2UXFA 2BP0A 2VMJA 3UACA 5B1KA 1AAJA 2GC4C 5B1JC 2Q5BA 4YSDA 7PAZA 3CDZB 2LLNA 2TSBA 1ZV2A 4E9SA 3WNIA 1A4BA 2HRHA 1BQRA 3EF4A 1KDIA 1L9PA 2AZUA 4AKQA 5FC9A 2HX9A 3FQ2A 1GY1A 3QQXA 1E67A 2A3TA 4M3HA 2BP0B 1IC0A 2BHFA 5I6MA 2HX8A 4HCGA 2PPCA 1E65A 3PAZA 4N4YB 1WS8A 3DIVA 1L9SA 3CG8A 5I5IA 1NZRA 4YSQA 1CC3A 8PAZA 4G7SB 2QDWA 5A7EA 5AKRA 3T6XA 4BXSV 2IDTA 3S3CB 3NSFA 1AZNA 4GP5B 2FQEA 1WA0X 1PY0A 3TA4D 3UABA 1A8ZA 1PZBA 4YSOA 1WAEA 1WA1X 2BO0A 1GS8A 1RCYA 2E86A 3PXLA 2YXVA 3QJQB 2BP8A 3H4FA 4GP8B 4HALA 1QLEB 2BWDA 1PLAA 5D4JA 3ABMB 1AG0A 1V10A 4NAJA 4DPBX 3QJTB 1KBVA 1JERA 3QJUB 2EILB 2IDFA 4YSCA 3NT0A 4MFHA 4W1TA 2RACA 5I28A 3X1NA 2YAEA 4HZ1A 2QPEB 2BZCA 2J55A 5D4IA 1KV7A 2IDQA 5I5JA 4BXVA 4E9QA 1AACA 1M57B 2BW4A 2DYSB 1DZ0A 3SBQA 2FT6A 3FSVA 3JT2A 1J9SA 2YAMA 3ERXA 2QDVA 2UX7A 2VM3A 2DWSA 2BW5A 1OE3A 2PPFA 2VW4A 4KNUA 2N0MA 1CUOA 3ZX1A 3QJSB 5AZUA 1J5CA 1QNIA 3NJKA 2HLEB 1MZYA 3KW7A 1A3ZA 2JKWA 1JZIA 2J56A 3UADA 1NIDA 2CCWA 2GI0A 1L9OA 5F7BA 4F7KA 1ZIAA 2R7EB 1AQ8A 3NJJA 2PCYA 3TU6A 4JHUA 1FA4A 6PAZA 1SFHA 2VM4A 1OV8A 4BWTA 2DWTA 1KGYE 2I7OA 3OQRA 4G7RB 2ZXWB 3AZUA 3BVDB 3NJMA 3S8FB 1KCBA 3WNJA 4NB7A 5I5MA 1GS7A 1X9RA 2DYRB 5I26A 3N2JA 4KNSA 2HX7A 2WO2B 2IH9A 2PPAA 1ET5A 4P5SA 3AW5A 1BXAA 3FS9A 3HB3B 1ASOA 1BYOA 4YSTA 4E9VA 2J5WA 5I6LA 1GSKA 1OE2A 2IH8A 4KO9A 4X4KA 1BAWA 1PLCA 4A67A 2AANA 2YAHA 4JHVA 4CSZA 2Y69B 1AS7A 2XX1A 2XYBA 1JZEA 3X1FA 4BWUA 4DP0X 3EH3B 1SF3A 3TBBA 4DP2X 4P5RA 3MBWB 2PP8A 3NSYA 1JZGA 2AVFA 5EHFA 5B3SB 4QKTA 5LDUA 1A4AA 1WS7A 3FPYA 4AI7A 3IEAA 2CUAA 1ASPA 3WI9A 1TKWA 3AY2A 3FQYA 4FAAB 7PCYA 1W8EA 4DP1X 3CVCA
chains in the Genus database with same CATH superfamily
1WGVA 3VXSB 1L5GB 3AREB 1A7OL 2HKHH 4FFZL 2BK8A 4HKXA 4NSKB 2WYIA 1YEEL 1YN6B 1E42A 3I3DA 5F9WB 1JHLH 2FJGA 2PYED 5KBNC 2X1QA 3QNXA 1OSEA 3EJZD 3X13B 5D7LE 5I8CA 1A1MA 1OQOA 4Y2LA 4R7DB 5HDBB 4FERA 1U8PB 3V6OE 5FA4A 3RYMA 1IJ9A 5ID1A 3F7QA 4ODHL 2EVFA 3UIYA 4XP9H 3DX1A 5L0QC 5EUKB 3CC5A 3HNTH 5A6MA 2WKGA 1NCHA 5HDLA 4RGNB 3O6FB 4GRWF 1FL3A 4WO0A 4I0CC 2JTDA 4M5YH 1I1RA 4WFEE 3ZTEA 4L4VE 4LCIH 4WU5B 4NKMA 4LLYB 1Q1PA 5DZOA 4P23A 5GS1B 2GJ6B 4ZNEE 4L8DA 3SKJL 3QR0A 1KCRL 4ONFL 4AUYA 1OAKH 2BSRB 1HI6A 3BVXA 2C1PB 5FW6A 2J21A 1GGTA 3SE4A 3CIQA 1HZHL 4MBRA 3PF2A 1O7DC 4JHZA 4PY8J 1Z66A 1HJBC 4NN5C 5AVWB 2DW5A 3NFNA 2EDMA 4BDVB 2R1WB 4WW2F 3OXRB 1M3JA 2R0WL 1R5IB 4DWHA 3GFUA 1H3GA 4KKBD 3E8UH 5TE6L 4LKXA 4LESA 3VACA 2AF2A 4ZBJA 3C5ZD 5C0EA 5CP3H 2CHWA 4C47A 2VE6A 5E1QA 5IJKC 5M95B 1FPTL 1GR7A 3WN5B 2VDNH 3ULUD 3GS0A 2P24B 3I74A 4JFHD 1RZQA 1I1AC 2OL3L 5JIPA 1RK0B 3QNYB 3T77A 4KO7A 2EYSA 4KPHH 1L3WA 3GZQA 1GOFA 4BFKA 5I23A 4GUOA 3QIBD 2ENSA 5CSGA 5I18H 3CHXA 4MWFA 1XSOA 4Z23A 1LYQA 2EEXA 2G3XA 4OIIL 5EZOH 5G5DA 5D1QD 2DJUA 3PWPB 4M8QB 4Q52A 4LASL 1JGEB 4WI9A 3SJVE 1XZWA 4LPYA 5KVEL 5E9DB 1X5GA 3QDGD 5K1VA 3CH1B 3QUML 1S7TB 3ULAB 1DQKA 4ZFOL 6PCYA 2QKIB 2NZ1A 2LU3A 3GUFA 3JV6B 2EDYA 1QNZH 1NC2D 2E9JA 2R29L 4K9JA 1LO2H 1FL5A 1Z9PA 4U1NB 1JMZA 1PZ5A 3TBSB 3JVGA 4ODTH 3ECUA 4JDTH 4YIQA 2ZWNA 2R59A 5FUZH 3HN5A 4K3HA 5GZOD 3H9SD 1SYSB 4A7GF 4HISA 3KCWA 1PZAA 5D7LD 3UAEA 1JNNL 2WQSA 5DMGC 1YY9C 1MH5A 3AG4B 2ESVB 4RX4A 3TS8A 1NFDE 3ARBB 3IDMA 3SPIA 1R9FA 3LZQA 1UYWL 2NZ9D 1G7JB 2HPOA 4PIRF 4XNAA 1WWBX 5IVXF 3AJ7A 4F2EA 3T0WA 2EVHA 3L3KB 2CIKB 4KY1L 4WFED 4P4KB 1X5IA 3A3YB 5KS9A 4GT7A 1JGVH 2PR9A 2QVIA 2ADGB 4L4VD 5EBMB 3SZ6A 1WAAE 2WHVA 1YN7A 4O2CA 1X5FA 3LKPA 5E03A 4KTEL 1HAWA 1JZ8A 4NN7B 3R06A 1NMCB 1TQWA 1YC7A 2D7TL 3J27A 3N42F 4OZFG 5CJBA 5F9OH 1CCZA 2VLKE 3DGDA 5GGRA 2PW2A 3V5HA 2EVGA 5B8CC 1GOHA 4BQ9A 2XVLA 4UTAH 4KX8A 4YSEA 5I6OA 1I9RH 1NCWH 2B1HH 1MREH 1NWPA 1P4BL 4CW1A 2UX6A 3FSZA 3K1DA 3EYSH 1W16A 2C3XA 4I5BA 4PJGB 3TCTA 2VZSA 1ZLVH 3CH8A 3O45A 4WHYG 1X9QA 4XVSH 3VFNA 2DYPD 1T6BX 2BIOA 2W0PA 2ZX9A 4OY9A 3MFGB 3QK0A 2DL2A 1OP9A 3VGBA 4X4MA 5F7EH 1S8DA 4HEPA 1I1FB 4MA7H 4K7FB 2H7WA 2F6AA 4UT7H 3CVHL 1JRHI 1YNLL 3X1EA 3SJVD 3UJJL 4X7EC 1TQUA 3KWTA 2AZAA 2HFFB 4JE4B 4BFEA 5T1KB 2JI2A 4N2NA 3SGEI 1IQWH 4P2RA 3GSQA 4JZNB 2WKLA 1BX2B 4YHIA 1N5AB 2VM9A 2UWEE 2E59A 3FHEA 4FQ1H 4G82A 3OAUL 3BKYH 3V4UH 5AKSA 3FU7B 4ZX6A 2B77A 2QR0B 2QVMA 2YEVB 2CXKA 2XWEA 4FI7A 2FBRA 1FFOB 4PLJC 5C07B 4LP5A 4OCSH 3LZFL 4JKPL 4PRNB 3ZDYF 5IW6B 4Z7QF 4BH7B 4WTZG 1P69B 3KGRA 3K6OA 4H13C 5F9JA 3WO3B 2VO5A 4HLZG 2N7BA 2OI9B 4LPCA 3ZDZF 2Z65C 3QJVB 4N2AA 4AYSA 2UZXA 5T1JA 4I48B 5EF2A 3U9PH 5BV7H 4N0UB 4MA8H 1XZ0A 1CE1L 3GI8L 4P4RA 4XCCH 5AW2B 5AW3B 1I8LA 4F8PA 2XYCA 1OPGH 4LAQH 1UWEH 3LH9A 5FOBA 1TR7A 3DYPA 3B37A 3ZO0A 5CJXC 4PJEB 5D2LF 1AJ7L 1MQKL 2YWZA 1IGCH 1U8JA 1CBVL 3FRUB 3GPEA 5ESAB 4YJZL 1XIWD 4ETQA 1EO7A 2OSLB 1YO4A 4KK6C 3D3VE 2VLKD 5TTRA 3PP3H 3GSUA 3H6AA 1AC6A 4GI8A 5B4MC 1LQBC 1CD0A 3BGMB 1EBAA 4EIBA 5CD3B 1AD9B 3H85A 2BSBA 2ODIA 2HG5A 1NDGA 5D96B 3WTYA 1BYPA 3BAKA 4Z7VE 3ML9A 2KQNA 4BYHA 1W0YT 3H9YA 1WUNT 3DVGB 4S0SD 4P23C 3OKDA 4K9EL 3NQIA 2RIKA 4QRSA 3KPRE 3N91A 4HKZB 4KXBA 3GUTA 5IJVA 5CFHA 3CX5K 4JDEA 5TDPA 3BW9B 1USZA 3SE4C 3M07A 5CLZA 1H9VA 2EP6A 1SVZA 3VE0A 4FLSA 4RBPK 4X2UA 4M7JL 2B7DT 2EDRA 4GS7B 1XTMA 4QHNA 1I7UB 3B7SA 3AY4A 4LL1A 4QRRE 2H3KA 4XPAH 4JPQA 4OZHA 3DGGA 3F7PC 5ICXB 2XZAH 3AQDA 3BO8A 4E9SA 2CDFA 3KWVA 2WQRA 3UDWA 2Y0SA 3QC6X 4OJEH 5DD6A 5FECA 4W93A 3EH1A 3MRLA 1HEZA 4FNPA 2AERT 3SBWA 3D85D 4P57B 1S9VA 5CN1A 1JV5A 5TF1H 5EF1A 3CFKA 5EU7C 5GIRB 4HHAA 3C5JB 1L9SA 3D69B 2NUTA 4KZEL 3PQYB 4J3OH 2JKXA 5MEPA 5T5FH 4MSWA 4Q9QL 1M1XA 3GHEH 5FO8A 2FIRT 1U3HB 2IH1B 4YHPA 1NAMA 4QXUH 4QXGH 4BZ2A 2IDTA 1JPFB 3ISWA 3DHJA 3KPMB 3DHMA 1AZNA 5M94B 5CEZE 1D7DA 4HJJL 1JGLL 1WA0X 1KTJA 5J3HC 2JCCE 4U1LA 2EXTA 1AZVA 1X5KA 1EJOL 2LR4A 3JVGC 3W39A 2O5ZL 1CYGA 2FLRT 4ZMLA 4JFOA 1HT6A 3RJOA 1KCKA 1QAWA 1UM5H 3D3VD 4G11A 1FN4B 4HCRA 4RMRA 5MI0B 5GJSH 4YBLB 4H8HA 2FJFB 2VXVH 2W07B 3AUVA 4XGZB 2X41A 1N7ML 5C0CA 4P48A 5CU5A 1RI8A 3LS4L 2AQ3A 4W1TA 4RLDA 1KY6A 3EFOA 1N5YL 1RUAH 1YRKA 1VCAA 1NC4D 4DTGL 3LS5L 1T7WA 1FVCB 5F7NC 3EGDA 3UO1H 3O2WL 2R23A 4LLVA 4EZJA 3P77B 3EBIA 4PJBE 1AACA 2DYSB 2LLLA 5D7IB 4BUGA 4CMMB 1GGIH 2R0LL 4NQSA 3QORB 3D34A 4PJCF 5KOMC 5CFAA 4L3FA 1TTGA 2WXGA 3NZ8A 3KM1A 1A7NH 4GW1A 2LV4A 4X6CE 3KPRD 1AGBA 2OMYB 1FQ9C 2WWMC 3DARA 3L81A 3MODL 4HIHA 4UZUA 1TCRB 3MXWH 4BFNA 1XBRA 3TWCH 2F2HA 1QNIA 5TDNA 3MLUL 2JKWA 3TCLA 4HJ0C 4KH9A 2XRAL 1TJGH 2YD3A 3BPCB 3DO3A 3LRSB 3LQZB 5DZNA 5BXFA 4IW4C 3Q7JA 4NO3A 4QLRA 4L4TB 4X6DE 4QRRD 5KSVB 4P8QA 3VI4F 5EO1A 1DSWA 3VFVA 1FA4A 3CQPA 5GGUA 3KNBB 3RUGA 1U58A 4NHUB 1NSNH 5JOFA 4CMHC 1WGOA 1KGYE 3BWUC 5DJYB 2UVFA 4G7RB 1ML0A 2P49B 3VU1A 2E74C 4PJFE 4B9IA 3MUGA 3EYFA 4S1QH 4XMPL 2V9TA 3C8KB 3HG5A 3MXVH 3HMXL 1CXFA 2ENPA 1BOYA 1JRHH 2A73B 3MRGB 2NNCA 3HMWL 5B39G 1LP9B 4PMEA 4Y2NA 4YHKH 4WENB 4F1ZA 1S46A 3Q2VA 3SGEH 3GGWB 3O0RH 4AVIA 1CFSB 2FE0A 2DM7A 4S2SB 2O1AA 5HHNB 3SE8L 5CEZD 4FTVA 5JORA 2ZPKL 5IM7A 2ZSWA 2XYBA 4F20A 3MJ8B 1F4XH 4B3EA 4ZZFA 1UT2A 5J6SA 5AOLA 1KLUB 3BEVA 4NJ9H 1GC1H 3JBG7 4RMQA 2J43A 1VFUA 3BZEA 4FDWA 1CTNA 2OMZB 2VAAA 1A9EA 4G9FE 1FV1B 5D7HA 3REWB 4F7TB 2ORBL 4BFIA 2JJTA 1KB9J 1WK0A 3DOSB 1JYNA 1HCYA 3TO2A 5T3ZE 5FFLA 3GMPA 3CSYA 1KEGL 4YWGL 1KJ2A 3AY2A 4ZPTB 2Y1YA 1MW2A 4PS8A 1GTFA 2Z31A 2V8LA 4CDHA 3OR6B 4H8QA 4Y4FD 4PLNC 1MCPL 1A14L 1I8LC 2AI0H 5TGBA 4OD1L 3M7FB 4PS4H 2ZCKH 4JB9H 4RZCA 3C60C 3O3EA 2QZ5A 1SEBB 3ALXA 3VWKD 3PFUA 5DJ0A 1AKPA 1NEPA 2ALWA 3RTLA 3U7YH 3V10A 1YAZA 4JG1H 1KGXA 3IDIB 5EIIG 2WNGA 2VC2B 4N2KA 5LB1A 4EDXA 1ZDQA 3L5JA 5IESL 2K0RA 4KXAA 5GS0C 3F7VB 2VH5H 1FYTB 1JUFB 3CDFA 5E94A 1A5FH 1TTUA 2AJXH 1FORL 2R0ZH 5JHAA 2XPGA 1MCWW 1BVKB 2Y24A 2Z8SA 4JJOA 4ZFZA 4QRQB 2VXUH 1AHMA 2NYZA 4QRPE 3FTXA 4UTBL 1YMMD 2LE9A 4FQLL 2RCSL 1A4KB 4HWEL 1KV3A 4LF3A 2HTKC 3AMLA 1R3JA 4M6NL 5IY5B 3ZHDA 1DFBH 2XKSA 1NAKL 4QHKI 3RE0A 4XCFL 2EXWC 5ITFB 1BFTA 2YUWA 4PPTA 3UL4A 2CDGB 5CUSL 1TT6A 2NQ3A 2AKRB 4QT5B 4JMNA 5H94A 1G0DA 3CCHB 4PJIE 1XF5A 1MJUH 3DGCR 2VMCA 4GAJL 5DT1H 4QTIL 4AGLA 5LXGH 4E41B 1HKFA 2B8OT 2YXWA 1SN0A 2X1WL 4OU3A 3RKPA 1S2EA 3BXNB 4JRXE 2CJ3A 3AY4C 3ZQ9A 4JUSA 1XDTT 2P5EB 4H5SB 1JPEA 4DOHB 3MNWB 1OL0A 2MSPA 3CFUA 5CD5D 3UDWC 4NO2B 1FE8L 2JK5B 1BLNA 4AEIL 4GG6E 3NJHA 3V5DA 2EZ0C 5IJDC 1ZHNA 1WUZA 3JV0A 3F64A 5T3ZD 1B3IA 1C5CL 2CM5A 2X70B 1QLRB 3OKKB 4AYMC 2A6DB 3U0PA 2MTAA 2WM0A 1ILSA 1DN0B 3HRPA 4OLEA 3SEPA 1QG3A 3PHQB 4HF5L 3VXUB 2NNAB 4HOZA 3G6JA 4OZGE 1J5DA 4PJ9A 4KMLB 3UGEA 4NRYB 4E9XA 2PKDA 3MLXL 1JPST 1HIMH 1HE7A 2MQ0A 2GTWB 1QLFB 3VXQB 2RR3A 3KLAA 4NO0A 5GQBA 3NRQA 3QAZB 1JZ3A 3T0AA 1XCQB 4IDLA 4IRSA 2XZCL 1LNUA 1IEBA 1A6TA 3HC4L 3NJLA 4X80H 4DGYH 1GJIA 3GKWL 2BMKB 4QRPD 1MCIA 2CLVB 2LVEA 5FO9A 2FWLB 4WTZA 3OVUB 4HCIA 1NUNB 4UDUB 1B6UA 1DQDL 4ORGB 3VXOB 3QIUD 2MQCA 2BNQA 1M42A 3FMGH 3K7UA 2VDOB 2CK0H 3VVWA 1TO4A 2W5PA 5K33A 5LCVH 3ML8A 3RIFF 4OD2B 1G6RA 1T2XA 4MJID 1AHWA 5C0FA 4HJEA 3F8UB 2Z91B 5F3HA 1AS6A 1CVSC 1FAKT 2WXIA 4L5FH 2CGRL 2DIJA 4NKDA 3CZJA 3SDXE 3K46A 1HWHB 3GMNA 4G6KL 1R6VA 1TZ8A 2NDFA 2DH3A 4WI6A 1JVLA 3CN3A 1RUPL 4JRXD 2VN5A 1P7BA 4NQQA 4OQTL 4R26H 3B2VL 4ODHH 4PJAE 4UYPA 4HMEA 3ARDD 5GS2D 5I0WA 1HYSC 3DBSA 1CPUA 4KJYA 4PTTA 1X7TA 2MCAA 4LSDA 2W94A 5LBSL 4K3EL 4JY6A 4ZQKA 3REVA 2NW2A 3WUWG 5C0GB 1OSPH 1KN2L 4JO2L 4LQ1A 1N6QH 2EYTA 3UXFA 3OPZL 2WMPB 4GRMA 1BD2A 5DS8A 3MV9B 3QZPA 5IV2B 2YRPA 4JVWA 2AXFB 3W9EA 4NCC1 5JIQA 1YEFH 3VFRA 4QGYA 3SKJH 2WTRB 3O8XA 1KCRH 3GO1H 4GPVA 4ONFH 4WEEA 1IGJB 3CZGA 1JOIA 4FZEL 4PB9L 4I8DA 2GITA 3Q0HA 2G30A 2CKBA 3CPUA 1G4RA 3ASOB 3RWDA 3RDTD 5DMKB 3ZYZA 1BQHB 2VR3A 3VM7A 1VACB 3PGDA 4P5TC 2OPCA 2IAMB 5DC4B 2Y36L 3RG1C 1GYVA 5TE6H 5F7DA 3TA3A 5F3BB 3GJEB 3R4RA 4LOFA 1R24B 2VW6A 1NBZA 4WNSA 2XFGB 3NCXA 2VOTA 3V7AE 3MV01 1ET8A 3RVXD 1UH3A 4ANWA 5GXBB 3MRDA 2OL3H 4UQBA 1HHJA 3FNKA 5KSAB 2CO6A 2JJTC 2GSMB 1MFBL 1T80A 1NWOA 5E5LA 2JI1A 1RZ8A 4QO1B 3N55A 4K8RD 1T03H 4FE9A 1XF2B 1K5NB 1OGPA 3IMVA 1ETZA 1WCQA 1UQSB 2VDKB 2G75A 3CPLB 1E28A 4LASH 1QSEA 2BM3A 1JDDA 2Z31C 3NYKA 4G6AC 4HJTA 1AP2B 4PRID 4TUKL 3VDAA 3W82A 1CD9B 4N22A 4UQIM 2X3CA 4DGWC 3ROLB 4MA3B 2Q10A 5D1XB 5T1LB 3QC5X 5MENE 1J11A 3TONA 3BDXA 1CLYL 4Z7UE 3VFOB 3VNZA 3FYEB 3KLDA 9CGTA 4ZUWB 4AW4A 2CKNA 4HGWB 3CDGA 3U4EA 2ZD0A 5C97A 1L3NA 4NUPA 1PSKL 2MNUA 5ICZB 1OHZA 1S9WA 4X4YA 1MCCA 4J3OF 1DZBA 1KFAH 4GG8B 1JNNH 3CFDA 3CDYA 5EEZA 1Q94A 3QFDA 3P2DA 3QGVA 4OFVA 1PZSA 2ZIDA 2EE3A 1U8HA 4YHZH 5FYKL 3NIDB 4F27A 5HYFA 1D9KB 3BD4A 2R8SL 4WWNA 4QHLB 1QSFE 4FP8H 1PGRB 1UYWH 1ZT1A 1JYXA 5ANMB 1E8YA 5KSBF 2JXMB 1TVHA 5DJAB 3FTSA 5CJ5A 5HPOA 4AMKL 2YGPA 2UYLA 3TBCA 4PHXA 4X6FA 1QR1B 4HZLB 2NYKA 3ZZLA 1T7VA 3MX0B 3PV6A 1JWSB 4JL2A 3SD5A 1H9DA 2PR4H 5ACMA 1G7LB 3Q6GH 4KTEH 3DX0A 1QX1A 2UXFA 3NCJL 3BDYL 4MNQE 4OUOA 5D1ZA 2D7TH 4QR7A 1AGFB 3BIKA 3VMOA 3CDZB 2LLNA 5DUBB 1UTDA 5C0BB 5AAMC 3RNKA 1A4BA 4PMFA 5AAPA 3DO7A 3EFFA 5D2NE 4J8RA 4MXWL 4DESA 4PSRA 1IGYB 3VFTA 5K5YA 1P4BH 3D06A 2Z4TA 3BE1L 1SYVA 5I0YA 5AVZB 2WBXA 4JGJA 2ED7A 1AXTH 3ISYA 4ES9A 1WFTA 4TSAH 3WNMA 1BJ8A 4M4PA 2ZOKB 3BAWA 2EDLA 4X0NA 5EU3A 1NCBH 1XF4A 1T1ZA 2VC2L 4OFKA 4HLEA 3PWNA 1JHTB 1TDQA 1JI2A 2X2IA 4YE4L 3QS3A 4YXLL 2EE2A 4NKIL 3X14B 3UAFA 2MJWA 1G9HA 1T4KA 4GAGL 4Z77A 1CDJA 5I75B 1VKXA 3MRKA 5E4EC 4PJ5A 3LKSB 3WLBA 1E7UA 1ZPLA 1YYLL 1A7PH 2VMFA 4PJ9C 4R4FL 3OAUH 3ILPA 3CZFA 2EEBA 4GQ9L 5HVHC 3BN9C 3L9BA 2DLEA 4V1DA 3NCYS 2KI6A 43C9B 4DN3H 1NEZB 2BC4A 4U3XA 3UYRH 1INDL 1W15A 5EO1B 2J72A 2BVTA 1YUHB 4JFQB 2DMBA 1NCGA 3LZFH 2R1YB 4H8WL 3WJMB 1RK1B 3ZKXC 1ZHLA 4IRSC 4PBDA 1P7KB 5H35B 1TTFA 2ZG1A 2D3JA 4R5XA 5EEWA 2J6EA 1BQLL 3KL0A 5KANI 5E8OA 3AXHA 1OAJA 3LV3B 3I9GL 1QSFD 3BSGA 1DZ0A 2VLJB 3FSVA 3GI8H 3LKNB 3ERXA 3ULSA 3D87B 2W91A 4X8JA 5FWRA 4U7MA 4EN3A 4A2LA 4AM0A 3RJDA 5F9DC 4X6BA 3VQ2C 1Q90A 4FYTA 3MRRB 2V2TB 1NCOA 1H5BA 3G6DH 5DDHB 2W65B 1U8IB 3KW7A 1T66C 5E70A 1S78D 3VWJB 1MLCB 2F74A 4QAWA 5MEOB 2GJ6E 1AHWC 3GMQA 2CCWA 4F7KA 5FHBH 4MNQD 2HMID 2WKOA 4UILL 1K4CB 1U2CA 5HD8C 5I76A 1GW6A 5I8KL 4LVOC 3DRQB 4X5QA 3V7MA 1KEML 5HGAA 1NCAH 3VJ6B 5EIIA 5FUOH 1EFXB 4M6OL 4OF7A 2P46B 1ROWA 5LWYH 1DE4A 2DWDB 2P52A 4HAGA 1CS6A 4N3UA 2WZPA 3EYVB 2IV9A 4MX7A 3BCFA 3X11A 4IKNA 5HJ3A 3PAYA 2HX7A 3I9PA 2E4FA 4LSVL 1PZ2A 4O2EA 5HDOA 3CE1A 4FFTA 1BXAA 3FS9A 2EH8L 3BPOC 3F62A 1G1OA 5I6LA 4LLWA 1OE2A 1QFUH 2J5WA 1RU9L 2IH8A 2H3NA 3G5VA 2ITDB 2N01B 3P9WB 3PWPE 2HT2D 3O8XC 4I0PD 4DQOL 5T5NF 3C5SB 5E9DE 1UJ3B 1I3RB 4DETA 5D4QA 2FX8H 4MAZA 1BBJA 3BPLC 5DYOB 2VDQB 1IB5A 2HT3C 4GEIA 5CJQH 4M7JH 4WFFE 3DK2A 2DBLL 5INCB 1I8KB 2HJKA 2XBTA 1WFOA 5L2JB 5CILL 2RALA 5A2CA 1KPVB 4YLQT 3CSBA 5F72S 3TA3C 4AH2B 5LDUA 3NESA 2N59A 4GO6B 4Z7QE 3KGUA 3BZ4A 2VDOL 4PEEA 5IOKA 3OZKA 1HXMA 1QYGL 2X10A 1I7RA 2DQJH 2ZUQC 5DSCA 2EH7L 4F80A 4HKBB 2I60L 1HHIA 4GBXD 5IB5B 2OMWA 4FXTA 4I7ZC 4PY8I 2HJFA 4I3SL 5DTFA 1YJDL 4QPEA 1N26A 3ZBMA 2JVUA 4PCTA 3FT3B 2MCMA 4GW4B 5EUOA 3NSDA 4ZQTA 5IB1A 2C9RA 4HSQA 4PREA 2V3DA 5F6IB 1IM9A 3BAXA 5KJ4A 4NERA 4MJ5A 4XAKE 5JQ6L 4PJ8D 4J12A 5D7SL 4ZFGL 4LPXA 3NAAL 5F7MC 1SFDA 3QO0B 1XGUB 3IJHB 4PRHA 3DNKA 5KYUB 4HJJH 1JGLH 2X4TB 3H9HB 1IC7H 3QUXA 5J9PB 2N56A 3FQXA 4NLAA 4G8FB 1T89A 3CZKA 5E8NB 3UTZA 3IGUA 4QJ3B 5L88L 3VD1A 3IFOA 4ETYA 5GS3A 5BQ7B 3T3ME 4EDWL 2JLLA 5IEHB 4AYFB 3MCKA 5SWZE 1KYFA 1DVFC 5JIDA 4UV4H 1F11A 2EO9A 3IJEA 1N7MH 1UENA 4AYID 4JRYE 3EAKA 3O6KL 4HWUA 1N5YH 4PRPA 1MHHB 4R84A 5FKPB 3MRJA 3VQMA 4LLDB 3LS5H 5DD1L 1CGVA 4GQQA 4PJ7F 5F7YC 3FK3A 2VISA 2X9YA 4H1LB 3O2WH 4M1GL 1IZKA 3FCUB 4DEPC 1F4YH 3IXTA 5DC0A 1PL3A 4R97B 1P6WA 1QWNA 4DO5A 1Q72L 3OJDB 5IB3B 1INQA 4ZPVA 5HBBA 4U7SA 1BGXL 3SDDB 3FB5B 3CFTA 3ULVE 2QBWA 3FB8A 4HK3J 1IM3B 1YECL 3GDCA 4QRTB 3P0VL 4RFOL 3V4VB 4WFFD 5E8EB 4RFEB 2VDKL 3B9KA 4YNYB 4YFLI 4NIYE 3D4ZA 1TFHA 1NPNA 1MRCL 1U8NB 1S9YA 1H6EA 1FGVL 3T4YB 3ZE2B 2HKAA 2HB0A 4WZ9A 4V33A 1TJHH 2CXGA 4ECNA 5AOZA 1H6TA 4HWBL 1S5HA 5C2BL 5JW4N 3HKFA 1F1DA 3OV6A 5KZCB 3D0VB 4A2GA 3G6AB 4XMPH 4FULA 2OJ1A 4NKQB 5ITBL 3G08A 3QNFA 3L3IB 1J1XL 1JZJA 2X88A 3RWCA 1U6AL 3HMXH 4C55A 4OZ4B 2UZIL 2VL5A 3HE7A 1X7SA 1U8MB 4S0TD 5DURD 3WLWC 2ERJB 5GRJL 2X89D 1FLRL 3KYMB 4PS7A 4XAKD 4N0RA 3LRLA 1FO0B 1KDJA 4UBDC 3JTTA 2F7IA 4F3FA 4LIQL 4LCYB 1PNCA 3PIQA 2XQYA 2Y07L 4G1MA 4PJEE 1A6PA 3ASNB 4M29A 1R34A 1HCZA 1QATA 1ZTMA 1WIOA 4UT6A 3L17A 3NDZE 4YL4A 1N3NA 3DUSB 4JFWA 2AAVA 4RWYL 3KGTA 5SWZD 1KWGA 3MU3A 5L2KE 3P1VA 2PCPA 4WNQB 5IJCC 3G04A 5T1DL 4X4XA 5H2BB 4IRJB 4JRYD 2BHUA 3HCVB 2K7PA 2V17L 4BEIA 1KEGH 1HXYB 4NO5B 4KRPD 3GXIA 5HYQB 3L2LA 4PR5A 4L9LB 2WAHA 4NRXA 4OD1H 1NLDL 1L0PA 4Y1AA 5ADPL 1CT8B 3DJSA 1T0MB 2X3AA 4OV5B 2F19L 1EO5A 2IPTH 4ODXB 4ZSOB 3H0TB 4ZW6A 2E27L 1PAMA 1H8LA 4NP9A 4HKXB 3ULVD 4I18B 5IESH 3BUTA 2YXMA 3IDGA 4TULL 2FJGB 2NSQA 3GLZA 1QABA 1FORH 1A1MB 4JFFA 1AMYA 1YPZF 4Y4HB 3ZYJA 2HN7B 3HE6D 4ZUTB 3GQFA 2PYEA 1W6WA 3CZNA 2CNYA 4UTBH 3WEAA 2P8PA 5ID1B 5KW9L 1PDKB 3W56A 1WRFA 2NCMA 3PDGA 2QHRL 3ZHKA 4HWEH 2W60A 1M2VA 2ZOLA 2ZXDA 5CHNA 2HYMA 2A9CA 2VN3A 4M6NH 4C8XA 3RIAF 1FL3B 1NAMH 1YEKL 2NXZB 3E6HA 2L7QA 3SPVA 4BZ2H 4G7YL 5JHMA 3PJNA 1WA2X 2CCLA 1AZRA 1Q0EA 5T3XD 2K9FB 3ZHNA 2XTJB 5CUSH 1NCCL 5DVOA 5AKVA 3SYOA 4NUMA 5I1HL 4P23B 1UKTA 3FUMA 4Q9RH 3GJFA 1BM3H 1AY1L 3TVMD 3RVVC 1HI6B 2UUDH 5KJRH 4JCMA 1U8CA 4QTIH 2G5UA 3G9VA 4KDTA 1I4FA 2YD6A 4RDBA 4L18A 4DKTA 2WC7A 2YQ3A 4OGZA 3D39A 1JV2A 2DICA 1MDAA 1BZOA 5HI4D 5C0EB 3LPOA 4E9LA 1VLXA 5D7JD 1FE8H 2C4XA 2V2WB 3SBRA 5L2KD 1UXSB 5LNEA 3C5ZA 2BNUA 2WLNA 4NBZB 3WBDA 1K8DB 1XGRB 1C5CH 2QHLA 3QRFM 2LLGA 3AU0A 3MYJA 3T6WA 5ICYB 4M5ZL 4MWFB 5JIKA 5IT2L 1JWUA 3INUL 3MMEA 5C09A 3CFCL 5FGCE 1EHXA 3AU1B 3RVWC 2DJMA 4OKVA 3HAEB 4HF5H 4EBQL 3IDNA 3C75A 5D1QA 2A83B 1WAPA 1P6AB 3M1BB 3QDGA 2FNBA 3G3LA 3IE9A 3MLXH 2EADA 1VRSA 3QUXC 4JDZB 4AGNA 2D2OA 3SDAD 2HT4D 4MAYA 2V5RA 5IMOA 3BLKA 3HR5A 4DO6A 3B1TA 1J0IA 3DPBB 3FRPG 3TIEB 4HFWB 4KX7A 3BAEL 1NC2A 1Z6JT 2XZCH 3N1PC 5FO2A 3ZJAA 2CIIA 4KI5C 4YC2B 2D9CA 3HC4H 4EOWL 3S88L 3KJ4C 2W0FA 1KPRA 3GKWH 2Y7QB 3ZKMC 1QBBA 3VQ1C 2H32A 1MH5B 3EJJX 3H9SA 1CGUA 5D7LA 3RL2A 2DD8L 3IDMB 2WQXA 1T21A 1AIFB 1DQDH 3DX7B 4KNQA 4C4KO 4F2ME 1GCFA 4KDVA 2Y1ZA 1ACZA 3AM8A 1B88A 1UOKA 4ZO9A 3BFOA 1XSJA 3IMTA 2V9UA 4PY7B 4Z18A 4F15C 3BJ91 4Y9FA 5KS9B 5C0NC 3TZVA 5HYEA 1ZANL 3ES6B 4OJAA 4B5EA 1HNFA 1ZV2A 4R90L 3WIHA 1A1OB 1TYJA 1BQRA 4UAOC 4WK0B 5JPMB 4FHBD 3LKPB 3SKOB 3P3TA 3UJTL 3R06B 4R2GD 3ZE1B 1IAMA 4R5VA 1P5UC 1RH8A 1X5LA 3U9UA 4OQTH 3B2VH 1W0WA 4W6WB 3IETA 3C6LD 3BGFB 5IVNA 2WVVA 7CGTA 3QDMA 3RX7A 1KJ2H 1OGAE 3P54A 5LBSH 4D0CA 1RZGA 1XFPA 4K3EH 4JM2D 3L1EA 3WMPA 3OF6D 3U6XA 2EUXA 4JO2H 4UIKH 3F01A 3TA4D 4WU7A 4Y2OA 1M6OA 5AENA 3QWOA 1E9OA 3B7TA 1EVUA 3HE7C 2X7LA 5C8JA 2DYPA 1SVBA 3QJQB 7TAAA 4FZEH 4JHWL 2XZQH 2FWUA 4IBLT 4PB9H 2MCG1 5CN2A 2BWDA 2JJUA 4OI8A 4OB5H 1AZZC 4WVRA 5DQDL 5TFSL 4P2RB 1JERA 3GSQB 1TENA 1EGJL 3QJUB 4Y7MA 1ND0A 2MNWA 4JS7A 4LLAA 3S5YA 2F0CA 3O2DA 2Y36H 4Q7DA 2AEOA 2LVCA 1ZLVK 4KVPA 3T8MA 5JXAL 1J18A 4LNRB 4XAWL 4F7MB 4N68A 2BNRE 2R2EA 4Y16B 1KV7A 3E3QE 4HP5A 4RNRA 4RRPG 1RHHA 2NX5E 3QH3B 1FYTE 3WTVA 4AJWA 1B3JA 1J9SA 3VXME 2F7RA 1T5XA 3DVNA 4W6XB 4HC1A 5ESVB 5F0LB 3SHSA 3TPUB 2IMMA 1TZOA 2BW5A 4KI1A 4JFXB 5F9JB 5JPNB 1UB6A 4ELMA 1TMQA 1EPFA 1LD9B 4LEOB 2UZXB 1SN5A 3NZUA 4L8SA 3ZTDC 2HVBA 4U1KA 1XGTA 3V4VL 2XKNA 5IMLB 4MMZB 3ILDA 5FGSA 3D30A 4M48H 4X83A 5DFAA 1BPLB 5HDRA 1CLYH 4NZRL 3MV7E 4GSXA 5KVFH 3MUHL 3P9MA 1MW0A 2GQHA 3QCUL 1AR1C 1V3MA 4PLKD 2KDGA 3IPFA 3OQRA 1PSKH 4ICWA 5F9AC 1MFAL 1ZSHA 4L4JA 3LD8B 4QRUA 2JKSA 1HC1A 5HHVL 1WAAA 2VZTA 5KN5B 5HDBF 2VWEC 4ZUSA 3VH8B 1E40A 5E6RB 3GSUB 4K3JL 4JVUA 2ZCHL 1QEWA 3FHQA 4HUWB 3S4SG 4BZ1L 1MWAA 2BFVL 4FA6A 5IW1A 1Q8MA 4R8WL 4CJ1A 1XIWA 4LCUA 2HPTA 2IH9A 1A1NB 3WNPA 4JNXA 3AW5A 1OGAD 4MRBA 4YSTA 4DOHE 4IOIB 4KZDL 1FO0L 5DVKA 2JJSC 1RK7A 2GEQA 3TFKD 1TG8A 3VNYA 2BRRH 1H15B 4AMKH 4KUZL 3BWUF 5AZEL 4QXWA 3PGCA 2XX1A 4KJQD 2A9BA 3OKDB 2A6JB 2WTPA 4QRSB 5F93C 4AENA 2PP8A 4QWWC 3BPNB 3KAAA 1YSOA 3NCJH 2AXWA 2XWJA 5IJVB 5ELIA 5C3TA 2Q7AA 2IGLA 3QFJB 4B7IA 1J86A 4KDTC 3UTPE 3VE0B 1ETA1 4ZODA 5GPRA 3OJMB 4D0BA 1QZ1A 4K7PY 3FQYA 2VJ0A 4NENB 5FF6B 5HHOA 4OZHB 2BNRD 1M05B 3AWEA 3DGGB 1W91A 4PWHA 7FABL 3GC3A 3KEHA 4GXVL 2BSDA 4KO6A 2NX5D 4K2UH 3L9RA 4UU9A 4KJPD 3JWOL 4X7TB 3KGSA 3VXMD 3C5ZC 4LNVA 3BT2L 1DBML 4XN7A 3PXJA 1HEZB 1TKWB 2VC2H 2CUHA 1JFQL 1EXHA 4XCYB 2J7LA 3CXDL 2FEJA 4MD4A 1G6RH 1JV5B 4RMWA 4YE4H 4YXLH 1KWKA 2OK0L 1ASQA 4NKIH 5LGHH 2NUTB 5CGYD 4GAGH 1NGYA 2AEQH 4DN4L 3P4MB 3IRZA 4HGKC 1YYLH 4KUCD 5K9KB 4R4FH 4XZ4A 2J8UE 4HS3B 4H25A 3MV7D 4GQ9H 5HGHA 3R1GH 3CWGA 5GGQL 1F2QA 3FDWA 4IBUA 5DEZA 4EI5B 1BMWA 1UEYA 3CZEA 2OR9H 3BP4B 1QHPA 1Z0MA 2F1AA 4MAYC 3DA0A 3Q01A 1J7VR 1UM6L 3KPQA 3W0WB 1HQ4A 3N5AA 3WY4A 2Q1EA 4LQFL 1MHEB 4H8WH 3QUKA 3WTWA 4JFOB 2X05A 2YC1A 2NY3C 2ZXAA 2Y7MA 5AYUL 1F4HA 5BS0D 3IAPA 1F4AA 1BQLH 2FJUB 2BJML 2QADC 1I9IL 2DH2A 3CVIH 3D3VA 3FUKA 3I9GH 3ETBF 3O4LE 5DD0L 1T1YB 4B9CA 1CXLA 3DIDA 4H88H 3QB7C 3BKCL 4JFDB 4I2XB 3VI3B 3OC8A 2CKBH 2PO6D 4W9ZA 1WFMA 3LXCA 3EGDB 1USQA 2CLZA 2H0PA 4LLVB 1Q0XL 2KH2B 1KGWA 1JGIA 3WKQA 1NBVL 3MV9E 3R0NA 4H40A 4N2MA 3TZVC 1KBWA 3K0YA 1HH9A 1GJUA 4A2DA 3ROOB 3EJSA 1OEZW 4NWTH 2E47A 1AD0A 4NQTA 3BYTA 3KPOB 4HUXA 1M9SA 5TDNB 3DV6B 1KEMH 3UTPD 3PREA 3HB3D 5EZLA 5BXFB 4X8CA 2ZX8A 1UCBL 3BEWA 4Q58C 1D5XA 3FT0A 3NOIA 3PWLB 4GSUA 3QZLA 2FD6L 3V7AG 2YAPA 4X98A 3GBNL 1J0KA 4ZMWA 3GB7A 4PJGF 5GGUB 2C9VA 4ZG1A 4YHOL 5JLZA 3M1OA 4LSVH 1GYUA 5KUMA 5KVGL 4W9DC 1Y7VA 1EAOA 5BQDA 3AQZA 3IS0X 5PCYA 4CNIB 1OGSA 5I17A 2B1OA 1RURL 4DQOH 1MJJB 4Y9EA 3L3DA 3KEDA 5HPMA 1CGTA 1FNSL 2WLKA 4MA1B 3STLB 3DV4A 1A9BA 5AZ2L 4XC3H 3BRDA 2EACA 2NRDA 1TEFA 1YEGL 4PWJA 5IB2A 2DBLH 4TTGA 1LE5A 1V3KA 5EBLA 2EJ1A 4KKNA 4FTVB 1ERNA 4AJ0A 5CILH 3IN0A 1R5VA 5IFJB 5E6IA 1UFUA 2YGNA 4WHCA 5EOCL 3MTRA 5ENWB 3HPLA 3PCYA 4UIMA 3BEVB 3BVNA 2F7PA 3FOMB 5EIQA 2Y06H 2Z6FA 4XPTL 5HGDB 5T33L 3BZEB 1KMGA 1FHNA 2I60H 1A9EB 3NA9L 2MEJB 2UY6A 4WJ5A 2WLLA 3EJYD 5EC2A 3TO2B 2A9ML 3CXFA 1YJDH 1SHXA 3GMPB 4IU2A 3CSYB 3H42H 3NCMA 2OMVB 3O4LD 4OFQA 4L8SC 3ELAT 4WWKB 5FYJE 4XPBH 4KGJA 3MBED 5JQ6H 4ELKA 1TU2B 4IKKA 5D7SH 4MJHA 2GJZB 2DTML 2H6OA 3QA3A 4N2FA 3QHZL 4UT9L 1TETH 4Z7OE 1MCSA 2P42B 1VZIA 3O3EB 4K7PL 4W4OA 1JWMB 2ARJB 2VL4A 2QPUA 5E9NA 3SGDH 4Y4FA 4JO4L 3G5YA 4JJ5A 1RUKL 2R2CA 5AW1B 1F6LL 1OTUC 5L88H 2YMOA 4UMSA 2F54B 5BVJA 2X6VA 4JGNA 5LKNA 1MIEH 4XMXA 3VWKA 4EDWH 4AUUA 5FIEA 5IUCA 1CWVA 4FHKA 4X9GA 1RIVL 1N64L 2B14A 4UOZA 3D08A 1GZPB 2A77L 1JS4A 4J28A 1EEYA 3O6KH 1QR4A 4WUUA 5ILTL 4C58B 3FRPA 1XIWC 2XPGB 4KK8C 2GEEA 3N9GL 4G70B 4EMZA 2Q3ZA 2F58L 5DD1H 5FEBA 3UJIL 5DLML 4XCEB 3LAFA 1PMYA 4XNXL 2JB6A 1I85A 3DMMD 1YMMA 1R3JB 1UB5B 3TT1L 1WITA 4JX0A 1RZFL 3T8VA 4NYLB 2OZ4A 2J44A 1KTCA 4UDTA 1K72A 5DJ8A 4IBWA 1CB4A 3QXDA 2OJEA 3BUYA 5D6DA 2J8HA 1U8QA 2GHZA 3S3DB 5EEVA 1YECH 2IOOA 5EA0L 2CBTA 4ZXBD 5FLVA 1VSCA 3I84A 3EHBC 4WLCA 3GTTA 1MJ7L 3CFIC 4KKPA 3DSNA 3FQWB 4OFIA 5ACZA 3POCA 3OWRA 3IU3B 3N50A 3Q8CA 2VLME 8CGTA 4MHHG 4OZFB 3VM5A 1CFNA 1AE6L 5GJTL 4HPHA 5DJCB 3PFQA 5C2BH 4MBOA 4HK3N 3CFJA 4XCNB 1JZ5A 2Y6SD 2E9BA 3V5DB 5GSRA 1JZ6A 4LHUD 1J1XH 2FLMA 3UZVA 1QD0A 3TWYA 5ECGA 1U6AH 5I74C 1TPXC 2UZIH 3DYMA 1FP5A 4M6ML 3U0PB 5GRJH 4J3WA 4YFLF 1FLRH 3APDA 3SGKA 1UVQA 2ZKHH 4ODSH 4U6YA 5DGRA 2PWGA 4MDJA 3IJSA 3G6JB 1SEQL 3OSVA 4XHJD 2Y72A 2P26A 5EEXA 2PTUA 2WCGA 3PWUA 5AW8B 1RP8A 2CO3A 1DQJA 2I26N 4P46D 5SX5H 4E42A 2A74B 1EX0A 1A6UH 1RJYA 2CHDA 5LBGA 4GEJA 2C9QA 3S37L 1BFOB 1PJWA 2NY6D 2GPZA 3RGVD 2YPLA 2FEDD 2VR9A 3I6KB 5AVXB 4JKMA 2Z0BA 3U2SA 4PBXA 1U8OA 4M8VA 4JG9A 3RTQD 4W68A 1ETJA 4N0YH 4ODUA 3VTAA 1M56B 3BH8A 4AIOA 2V17H 1RJLB 1IILE 2FQDA 4ZAKD 4RRPA 3UAAA 4A37A 4YDIL 1OCCB 2PXYB 4MNGA 5DEGB 1XEUA 1FH5L 4FHJA 5INDA 5DRXB 3Q2WA 4QHUA 2JF1A 3S5LG 3B8YA 4HOWA 7PAZA 3UBXG 4EE2A 3Q06A 5ADPH 2HVKA 5D7IF 3OKNB 3WNIA 3CN4A 1SUHA 1WWCA 1QI4A 2DQHH 2QZQA 2GUOA 2F19H 1XH3A 5CSZA 3LEVL 1HINH 3IMWA 3V8OA 5KYXB 1CL7I 1F2XK 2E27H 4KTDL 2BP0B 3RGBA 2UY7B 2OLDA 3IDYB 2YMXH 3TNMB 5GGVY 3OZ9H 2EYRB 5J6HA 1BMZA 1I8MA 2W9EL 5HJGA 1IGTB 4TULH 1JD9A 1NZRA 3RWGB 5CEYB 4N2EA 1MAML 4H20L 1O7DE 4M43L 4MJIA 4NKDB 4BBWA 4OR1A 1L6PA 3F6IA 1COBA 4HYTB 2A4CA 3NSFA 1M1SA 4NIKB 4F33A 5FCUL 4G1EA 4NM4H 2XHNA 4PI0A 4UYQA 5KW9H 4Z95L 2WUCL 5DO2D 2G3MA 3QO1A 2E6QA 3A5VA 4PTTB 3PXLA 2E86A 1RZ7H 3DJZA 4L5FE 4O9HH 3K71A 2YXVA 2ETWA 4ZQKB 4JN2B 3JZ7A 4QDGA 2MMXA 2NW2B 3PJSA 4NQDD 1PLAA 1HX0A 4P2OD 2VJXA 1Q4NX 2Z8RA 3KDMA 3L54A 4GRMB 5TPWL 2WXJA 5I1HH 1LP9F 3W9EB 3FQRB 2NY4B 1FYHB 4ONGL 3ESVF 4PYGA 3VRJB 3ATBA 3CMOL 1CN4A 1IAKA 3BPLB 2WQAA 2CR3A 5HHMD 4E2OA 3D09A 1X44A 4E5XG 2DLHA 1L0XA 3VD4A 2ZF8A 5J12C 4RSVA 5E6IC 1FNEB 3EJUA 5BPPA 4OZGA 3TNNA 4W70A 4NZTL 1F0LA 3L5WB 2VR8A 5I1GH 3RFZB 1QI5A 2APBA 2BPBA 2AJVH 4YPGA 4BV1A 1VESA 3FFCE 2JTYA 1ZXQA 2OTPA 1TQCB 2ZKWA 4M5ZH 5DK0A 1RZ8B 3F84A 5IT2H 1N2RB 3INUH 1A64A 1OVZA 3QQ4B 5TJWK 3OHXB 1J9CT 3MRHA 4U1GB 1LVEA 4TNGA 3QARA 2HTLC 3K6IA 3W57A 4EBQH 3VU2A 4GSDL 2NY0C 5HHQA 3VD7A 4LK4A 4MXVF 1OT1A 2VERN 5ALCL 2ZP9A 1QHOA 4GAFB 4W4OC 4RA0C 4PRIA 2YIHA 3O4OB 4U6XA 1UJTA 2NXYB 2V6HA 1ZGLB 1WTLA 4GO8A 2PN5A 3NEOA 3ZU8A 4ISVA 5C0JA 2DYRB 5KVEE 3A21A 1LLAA 2ZCLL 3U4EB 4O5LL 3UERA 3AGVA 4MMYB 4N5EC 5DRZB 1CTOA 2Q8BL 3PRZA 3BAEH 4NUGL 3TX4A 5MERA 1DBBL 1JYWA 1K6QL 4G6FB 2A2QT 4LGSB 5CWSB 3V6FB 2BOBA 4F7EA 3UH8A 1Q94B 3QFDB 3H9ZA 5E2VL 1WG3A 2EDDA 3EW3B 4FG6C 4WI3A 3GTVA 3OJ2C 4M7LH 1JXJA 4FKHA 4JHBA 1O9VA 4MTMA 4LOUC 3O3AB 1ZT1B 2B9AA 1X3DA 1IFHL 3TBBA 4GFXA 1CMOA 2CO2A 4IIQA 1I1AD 3ECQA 1TVHB 3HOGA 4JFTA 4KY2A 1A02N 2UYLB 5D7KE 3MBXL 1BVNT 5AEAA 5DZAA 1O6SA 5ID0A 3PV6B 1FZKA 4LLMA 5GSVA 3W1ZA 2ZZUT 1VADA 3FO2A 3UYOD 2QSTA 3UJTH 5D1ZB 4Z5RA 1DCEA 3QXUA 5I9QB 1RMFL 3LB6C 1YQVL 3MREA 2XCMC 3FH7A 5I19L 4PV9B 3RNKB 4I87A 4U1JA 3DVFA 4MQ7B 4KAQL 3S5ZA 1OWWA 3VFTB 4GJTB 1KB5A 4JR9H 1QBLL 3WO4B 4P2QA 3H53A 3I02B 2GC7C 4GAAA 3AG2B 2PMZA 3S2CA 5B1AB 5CR8A 1GH7A 1TTCA 3FFCD 3NP4A 3DX3A 1XF4B 3GHPA 5DMGD 3H7BA 3WAKA 5CD5C 1YY9D 1J9TA 1T1ZB 4AQEB 1MVUA 5GGVL 1Q9OA 4OLUH 2BIPA 3I2CL 2EECA 4XVUC 1E6OL 1VGKB 3FQ4A 3GRWA 4RMVA 4CN6A 4M93B 3SGKC 4DHLA 2VDRB 2D8KA 2FSEB 3B5HA 3NVQA 5DQDH 3IWUA 2JIXD 3KPSE 1EGJH 5FK9A 4XOCA 4FN0A 1ZVYA 1CIUA 5FX3A 3DC0A 5IMKA 5B39B 3UPRB 3GBDA 4ADJA 2XG5A 3ZDXB 4FLRA 3KYOA 4H1LH 5JXAH 4B7LA 3MROA 1RD6A 4RAHA 3OD3A 4FADA 2ZAHA 1ADQH 2HG0A 3H2QA 5A3IC 1L9NA 1MVFA 2N1KA 3K1KC 3KYAA 4UF7C 3T2PA 4NQCB 4EKXA 2E4TA 4HHGA 5BJTA 4JY4B 2I24N 5F1KC 4UOW1 4PGDB 1ZWIA 1T04B 1AG6A 2WIIB 3RQ3A 3V9EA 2PW1B 3TEYA 3QVAA 3V0VB 4N6RB 4U4IA 1CZ8H 3VD3A 4P2AA 4NPYA 3FT2B 4X5LA 1RY7B 4HIXL 4PG2C 4G8GE 4EN3B 3D0AA 4AM0B 5JYMA 5CAYB 3BUDA 4NZRH 4Y88A 4V2CB 3SO3C 3KLHC 2CBQA 3V0WH 1H5BB 3HRZA 3QCUH 1CL7H 1S4IA 2HP4A 4LL9A 2EVJA 2AK4B 5SWSE 3D18B 1ETB1 3EDDA 4NHCH 3G5WA 4OAWB 5DU7A 1MFAH 3UTOA 4AGMA 4Q97A 2OTUA 3S6CA 4AX3A 3WKPA 1U91B 4U1HB 2EDFA 4PJHB 4UOW0 2P5WD 4HMDA 2GT9A 4K3JH 2ZCHH 5HGAB 2AJZA 1BW8A 2BFVH 5EIIB 4BZ1H 1HS6A 4NPKA 1XB6A 2G2PA 3N3EA 1QRNB 1GY2A 1S7WA 3HUJF 2YD8A 3BP6A 2OMBA 3NG5A 4WW2A 1DE4B 4AXWB 3F2LA 3RRQA 1XGYL 4LDEB 3V4PL 1YMHB 4PLJD 2Q0ZX 2XFXB 4FXKA 1E3FA 1RUQL 3ATEA 1Z9LA 1XBDA 3MRQA 5D5MF 5HJ3B 3HR6A 1RAMA 1WTGT 4KUZH 3S96A 3VD2A 3RWEA 5K39A 5AZEH 1HNYA 1F42A 3MJ7B 4PWKA 3WKML 4X9IA 4KFZC 2XG4B 1CI5A 4MCZB 4NNXA 4JM4L 2XXGA 5EU7E 2H3NB 3G5VB 5L4FA 2OMXB 2QT6A 3B3IA 4CU7A 2I5YL 2NY1B 1NEUA 2XV0A 5J1TC 3MLWL 3KPSD 3EJQA 1N70A 5E5MA 1XR9B 2DLTA 3II1A 2F1BA 1E7VA 2OXGA 3FF8A 1QO3A 5F7KC 4WFHE 4OVUA 3QQ9C 3CBJB 1WE5A 2HJKB 3CLEL 5GRVK 4KC3B 2GKIA 1GRWA 3GKZA 1CLZH 4XP6L 4GXVH 2GTZA 3NGBC 4Y8AA 5C08B 3BZ4B 3H56A 4KK6D 1CICA 4A1RA 2E46A 1DBMH 3BT2H 4D0DB 1HXKA 1EHNA 5B4MD 4JGUA 4A7GA 4Z7NE 1JFQH 2NY5C 3WIIL 3CXDH 1E4WL 1INEL 3P2BA 4FL4C 2P9RA 4LOEA 1J8HA 1Y1DA 2JFCA 2OCCB 1U3NA 5KYYA 2E75C 3LKRB 2XTLA 3HC0B 4GBXA 3WIHH 4PREB 1S5IH 5DA0B 1IM9B 3FB6A 4G8GD 4MJ5B 1AZBA 2PTVA 5IVXA 1HN1A 3AITA 1WCBB 2OKMA 3FO9A 5KS9E 5GGQH 3WFZA 1DJHA 3T0EA 4G5ZL 1J8SA 4PJ8A 3QUXB 1NGZB 5SWSD 1LEKA 2DWXA 1UM6H 3LEYL 1P84K 5EFIA 3S35X 4DIXA 4U6HB 4IGBB 2P45B 5HGBB 2HUEA 2ADIA 4WKXA 1HILB 1Z0NA 5F1SA 1TIUA 3QDJA 5AYUH 5E6ZA 2DM3A 4MZIA 1F11B 3LRGA 5B38G 1V8HA 3WS3A 1MCFA 4JAMA 4DZ8A 2BJMH 3CVDA 4LRNL 5DD0H 3ZE0E 2BS9A 2R1XB 1M2OA 2HRLA 3BKCH 3GSXA 4Q8BA 4ZW8A 5I30L 3KLKA 5AFAA 1H19A 1XCWA 4JPWL 3CHSA 2VISB 4UNVA 4IIQC 3LQAL 2ZKMX 5JXEA 3HN3A 1UKSA 3IXTB 3QQDA 1T83A 3PP4L 3WY2A 1NBVH 4X4ME 3O2DH 1OF0A 4NWUL 3LCYA 1INQB 2QGEA 4JRLA 3ZPDA 1KIRB 3UBXA 2NY2B 5MHSE 2WXNA 3KPPB 3QRLA 1XWVA 2X4SA 5CXPA 1PVHA 3FT1A 1R5WB 4NQEA 4UANA 1SJHA 5DJZB 5HXMA 1F18A 1G1KA 4P2RE 3X3GL 1B4JH 3Q2NA 4L3EA 3W38A 4WFHD 5HY9A 3VXRB 4HX1A 1G7PA 3B9KB 3SDYL 3VFMB 3ME0A 5J3HD 2WBWB 4JZOA 1U95B 4LSRL 4QJ5B 3NIFB 4NQVA 1S9YB 1P9MC 3GBNH 2YPVL 2CJTA 3CZUB 1D5IH 4YHYB 3VFGH 2IPKA 4YHOH 5EDXA 3WY1A 1KYOJ 4LCWE 5KVGH 1GIGH 5FW8A 1T5KA 3MLRH 3ZMRA 1KT2B 4KFMA 3AGWA 1ACYH 2VABB 1T2QL 2BXYA 3G08B 2FWOB 1YLBB 4HSCX 1Z3GH 5E6YA 3VFPA 3VDCA 2Z7YA 1RURH 1SXNA 2YHGA 2A4EA 3SODB 3WUWB 3KL5A 1FNSH 3OGCA 3P73B 4XO5A 1DJGA 2RH0A 3RFRA 1JP5A 3LQAC 1IO4C 1OCZB 5AZ2H 2F1EA 1D3CA 1YEGH 3AS0A 2FO4A 2H0JA 4XMVA 2X89A 3TBWB 1EAPA 3HG3A 4OLVL 4PJDB 1U42A 5EOCH 4BFFA 3OL2A 2WWMD 4J6RL 2VRKA 4GRLA 4HJUA 4ODBD 5D2LA 4YDJA 4CAGA 4E5XA 1LK2B 5M7QA 1N3NB 2WOYA 4RVBA 3MKKA 2TRHA 4HJ0D 1TQBC 1KBGH 3S98A 2G60H 3NA9H 3IB4A 2ZTBA 3WUZA 2A9MH 3G04B 3VW3L 4L3CA 2YJLA 5TE7L 4NQXA 4KI5F 3QAQA 4UOQA 3WN6A 4YQXL 3FQNA 3LKOA 1TITA 3KLQA 1NH6A 2DQTL 2OSWA 1C5BL 2GIXA 4Z7WA 3QQXA 2YUVA 4M3HA 4UNUA 2DTMH 2JLPA 4NRXB 2VKWA 5TQ0H 3QHZH 4JQIL 4UT9H 4Y1AB 4S1SH 4JO4H 1RUKH 2ICCA 3HRZC 5E23A 3JWDL 5MHSD 1BDYA 4XNQB 3T6XA 3JTSA 1FVDB 2AEWA 4RIRB 5I8OH 3S3CB 4DH2A 2FYYB 3FO1A 2XIIA 4K3DL 2C8NA 1RIVH 1N64H 2C9PA 2CRIA 4MDRA 2VDPL 2A77H 1MLBA 3GSRB 4HULB 5ILTH 1DJWA 1CLOL 1EK3A 1FCGA 3N9GH 3ZT6A 2PYEB 3HHRB 3H7LA 4WW2C 3RL1A 1QLEB 2F58H 1N10A 4MYWB 5KTEL 2OSYA 4BM7A 2ZJSL 5TH2A 1Z9OA 4FI6A 4PWGA 1ZMYA 4FXKC 2IDFA 1AXSA 1ZEAL 4LCWD 5CHNB 2AMGA 3HG1A 3I50L 4OJFH 3TT1H 1RZFH 3FTYA 3K2KA 3VUAA 3C08H 1NGWA 2QQKL 4LDCA 4JZJB 3LN9A 1U8LA 3QHTC 4YLCA 2E7LA 3PV7A 2XICA 4M9PA 3LNIA 3GJFB 2JV6A 3N1GC 1CFTA 4XBGB 5EA0H 2APSA 1MF2L 1XF3A 2Y5QA 2UX7A 4TOYL 4UZSA 3GMLA 3C60D 1BREA 1G9ML 2KHAA 4WO4A 2DQGL 2R56H 3FUEA 3OAYK 4J1UB 1WFNA 4LSUL 4PU2A 1WC7A 4OLYH 4FQHA 1JV2B 2BOCA 4J3OG 4ZDHB 1Z5YD 2VXQL 2P44B 5F8QC 1NIDA 4JPVH 5IKCB 1LEIA 1CICC 3C5ZB 2HFTA 1LM8V 3ESOA 3O3BA 5IMMB 2Q76B 3NDYE 1ES0A 5D7JA 4ZUUA 5C0CE 2UUDK 3MYJB 1R3LA 3U4KA 1XT5A 4NDMB 1IL1A 2HFEB 2Y2TA 1W72L 3SPHA 4HS8L 1KCVL 3RI5K 1R75A 3QIBB 5I5MA 3HBZA 4NN6C 4APQA 5K1NA 1LO4H 1X9RA 2HTKD 1ULVA 3IDNB 2XETA 3A6BL 4O2FA 3CFNA 5D1QB 3QUYA 5EWIL 5JDSA 8FABA 3WL9B 5EU6A 2QEJA 3QDGB 2EXWD 3T0EC 4XX5A 3WD5L 1ASOA 1CF8L 1ZA6A 4OD3H 4PJCA 3E6FB 3U48A 1MY7A 4HPYL 1BF5A 2H2SC 4JHAL 3HR5B 2Z1PA 3MVSA 2AANA 1OAZL 3R8QA 5E51A 5SWQA 1NC2B 4JHVA 3T8XA 3GI9H 1PLGL 3OGOE 3NN8B 5K9OB 2J88L 3EH3B 1QSZA 2XWTA 4YDIH 2H32B 3G7TA 3H9SB 5HHXL 1FH5H 3DROB 3FZUC 4GMSH 4ODWB 5D7LB 4BRJA 3VI4A 2VNCA 3RUGE 1KJMA 2XZZA 1XH0A 1K85A 4J3XA 3DXAA 5JXEC 1PIFA 4J23A 2EZ0D 1T83C 3DX2A 5C0RL 2F5AH 3LEVH 4LDOB 3ARPA 4ZZKA 1E6JL 2H0FA 4KTDH 1I31A 3IKCA 3ARGC 5AAWA 3D51A 5DZPA 1TJXA 3TO4A 4U6VH 1AKJA 2FECL 2W9EH 1KBKA 3STZA 3X1BA 1DHKA 3K8KA 4L4VB 2LTQB 4HXAL 4QI3A 5JA8B 2VMEA 4M43H 4OM0L 5MP6L 3MRPA 2K6YA 3I85A 1KIPB 4RDQF 5I73C 4BK5C 4OCLC 3F65A 3IETB 4Z95H 5CCGE 1NBYB 3ZE2F 2WUCH 4MLIA 5JW3L 3AG3B 1P1ZB 5MEQB 2VSMB 4UQEA 5D93B 5FKAA 1UD4A 1UATA 2ZP8A 1EHKB 4FLOA 5ANHA 3LPGA 3DX8A 2CZNA 1ADWA 4FQXA 4MLSA 3QULB 3Q5OA 3TH2T 1KACB 4DVRH 5I6XB 3UTSA 1M6OB 4DPCX 5C0CD 3H8NA 2E7BA 1E9OB 1OCOB 4JGMA 3MLSL 1MG2C 2OX5A 1DBJL 2J2ZA 2K8QA 1FH2A 2DYPB 4UUJA 4WI2A 5DVNA 3P0GB 1T0NA 2FL5A 2P80D 2BY0A 2NQDA 5D4HA 4AJVA 2VTFA 4ICXA 2VUKA 2ZE0A 4TVUA 4LBEA 5CP3A 3SJVB 1ZHKA 3MJ6A 4OF0A 5EO9B 1XL4A 3VGGA 3BRGC 1J9QA 5GRZA 4LSQH 1QTSA 3ESNA 1X7QA 2DKUA 1KCUH 3GSNB 1G7QA 5DA4A 3QQNA 2Y3NA 4GRLC 5B1JA 2A7BA 1K4DB 3AROA 3VYNA 2H6UA 3DWTA 4U1MA 3A47A 2DQUL 5BZWA 3MLVL 1T5XB 2DRUA 3N04A 4XE5B 1UB6B 3ZMEA 2UZYA 3S7GA 1HYSD 4I4WA 5B7FA 4S1RL 4U1KB 4QEGA 2G5RA 4GSDH 3CV5A 2XV6B 2BVPA 1UT9A 3Q8BA 4A6YA 4AVHA 2FBJH 2K4WA 2EDEA 1QPPA 2AABH 5ALCH 3KBPA 1C16A 2NT0A 5FFGA 5I0VA 4ZTPH 5T5NG 1S7QA 2UXVA 1DQML 1B9ZA 1ZLWH 2NSXA 3S2AA 4K5LA 2WZ6A 3BFQG 3P9MB 1IC5H 1OXYA 3SB3A 4PVLA 2AHIA 2ZCLH 1QKZL 5DUML 4L05A 4N9GA 5BO1H 1HSBA 1A3LH 2Q8BH 4K23L 4NUGH 3RWHB 4QRUB 4XNZC 1K6QH 3NK4A 3ARRA 2DIBA 1PNDA 1VAHA 4ZUSB 2PYFA 1AANA 3TC9A 4P5TD 3WXWH 1Z7JA 1QEWB 5KVFE 4KH2A 1FNGB 3K5RA 2WINA 1P7QA 4RMTA 1XIWB 4LCUB 2XVKA 4B6ZA 5F7UA 5I1LA 2DQDL 5F97E 3TIDB 4ONHB 1BYNA 2VLKB 1OP3H 4TNVK 2UVEA 3A23A 2OM5A 4EI6B 5B38A 1IFHH 5IGXH 4LPTA 1SNRA 1HL9A 3RX9A 2IC2A 2X4UA 3UROR 3FFDA 1WZ1L 4I9XA 3SKNB 5L9DL 3AUWB 3MBXH 4DPRA 4PW9A 4KVCL 4N2LA 4AIXA 4X7SL 2AV1A 3A0OA 1MNNA 4IBTA 5KUKA 1U0QA 2BOLA 2E7LC 4G8AC 2DQFA 2Z31D 5L4JA 3EDFA 4G6AD 4UWQB 3CK0L 5JHBA 3MUY1 1RMFH 3G6JE 3L9EA 1YQVH 4WO4C 2Z92A 5JUEH 5I19H 1JK9A 3APCA 5IR1A 4H8PA 3AWFA 1EV2E 1A2YB 1TVBA 3F5WA 3V6BR 1OALA 1QBLH 4P3DB 32C2A 4BQCA 2UWEB 2OYLA 1MCRA 1IIIA 1LDPH 3Q9QA 5ERWA 4UU9B 4YSRA 1MCOH 5HI4C 4PP2A 3K6SB 2EEDA 2CK2A 3HS0B 3UEZA 3O2VH 1RULL 2VN4A 1WZLA 5D7JC 5GGVH 2WZ5A 3I2CH 3MNMA 4FYSA 3HZ3A 1VDGA 4MD4B 4EUPH 4XI5C 1MWOA 3SQBA 3O3DB 2NYYC 2AVGA 1PTZA 4Q74A 3O41A 4MRCA 4A7QA 3VXTA 4MXVE 3D85B 1X5ZA 4APQC 5EPMA 3D8MA 1T1XB 4XWOC 4XN4A 2BNQE 2X4RA 2XDHA 3QUYC 43CAA 2F7QA 3HBQA 1TFPA 2BSTB 4GW5A 3NABL 5JHDA 3MAWA 1KIQA 1UC6A 3HZMB 2E8ZA 4NXSA 2F68X 2F18A 3KBHE 4U1IA 1H0DB 5I0DA 3CVBA 3PDOA 3Q2CA 2CPCA 2G9KA 3JTBA 3N41F 1NDMA 3L7EA 5FM4A 3WFDL 1VPOH 4BJLA 4YXHL 2OQJA 3LN4A 3T4AC 1BQKA 3PYCA 4K94L 5F88A 1AO7A 3FUNA 1SJMA 2X4NA 1QBML 4BRVA 2Y5TA 2CU9A 1N59B 3D3VB 4FQCL 4HIXH 5BS0A 1SN2A 3R0MA 3T2NH 1YEIL 3ECWA 1SBBA 5FV2A 4R7XA 1FZMA 1NLBL 2VW7A 5LAPA 1BZ9A 3BGAA 5I2IA 3EADA 4Z8FL 3FCSA 3SY6A 4OZFH 2GIMA 2EKJA 1NC4B 2E3VA 3L4XA 4QXTA 1BD2E 5AAWC 1HH9B 4Z7VB 1D5MA 4JKWA 3QJOA 1A7QL 1R3HA 3TO4C 3SQRA 5CEXA 3GF8A 3QCVL 4H0GA 5CMAA 4CVZA 2FX7L 5DJXA 1AD0B 4MDIB 3GYRA 3BRFA 3IGAB 3ZE1F 3BUBA 5DRWB 5B3JE 4PJ9D 3L3GA 3SE9L 3KPRB 3QJZA 3VSVA 2NY5H 3BN9D 1F90L 3FCTB 2GAZB 1AYOA 3OKLA 4M7ZC 5DMIH 3UP1A 4YHML 2NT1A 2FIKA 3K4AA 4J3VA 1R3IL 2K1MA 1K2DA 3LEXA 3WGVB 3WHXB 3JV4B 3V4PH 1XQ4A 4NO0D 3GB7B 5E4AA 1B0GB 1RUQH 4FCAA 3FCBA 4QRRB 4IRSD 3VX0A 5CINH 3N0AA 2W80C 3BP7B 3BMVA 1VEMA 3PXHA 4FQXC 4WWOA 3WKMH 5LAXB 1Q1JL 3UFIA 2ZX7A 1MJ8H 2BIIA 4X5PA 3BZDA 4L2LA 4HU2A 4MD0A 1RPQA 2I5YH 4M62H 3MTXA 1QSEE 4WTXA 2B4CL 2MKWA 1UCTA 5IEKA 1KBBA 2CR0A 3MR9B 3MGOA 4FA7B 1LEGA 2BNQD 2GJJA 3A6CH 1PZDA 4A2EA 1AC0A 5FXCH 4GKZA 5EC1B 5KYWA 3CLEH 1LE5B 1IKNA 2DZEA 4XTRC 3SZKC 5B1KA 3FU3A 1R19A 1ZJAA 2GBUA 2GC4C 4JLRA 4XP6H 5CP7B 5B1JC 1SOQA 2CPUA 3B6SA 5HD8D 4UIMB 5CZVL 4KHTL 3BVNB 2PABA 1KDIA 2DL9A 2JCCB 1OAQH 3M6DA 2H26A 4FQIH 3IVKA 3D0LA 5CIPH 2CJUL 4I0KA 3WIIH 3HI1A 1E4WH 1E2VA 1INEH 1E67A 2UY6B 2WLLB 3TJHC 4HUVA 1FC2D 4NNPL 2OJZL 4Z3TA 2JKRM 5F1NA 3ZUCA 1QA9A 3RPIA 1WD8A 3MNZB 1KC5L 4ZMZA 4URKA 3AB0B 5KSBA 4BXSV 1PJ9A 3BP5B 3BD3A 2FQEA 1BD2D 3MBEA 5DQJB 1AGEA 4KU1A 3UABA 4EIUA 4Y4FB 1N8ZA 3JUYA 1PZBA 2CMRL 1QMUA 3WIFA 3CUPA 1BQSA 3O8XD 1R3KA 5I66A 2B4CC 3LEYH 3QJHA 1KJ3L 3TP4A 3VWKB 1FG2A 2QQNH 3ETSA 5E99L 4YR6A 3WV0A 3KWXA 2QFPA 3ABMB 1YQ2A 2HT3D 2QSCH 1VFBA 3HUJE 3P9LA 3BZFB 3IJ7A 1TVDA 3V6OC 1NCJA 3FN0L 4LB8A 4MZRA 1UWGL 4LRNH 3MOAL 1YC8A 3B34A 5IK3A 3TA3D 3VFUA 5E7BA 1RZKC 1VHPA 5D5ME 3JYCA 3VCLA 4FXGB 3UAJA 2RMNA 4YFDB 3DOIA 1SOXA 4JPWH 2BZCA 4JFYA 1DJXA 3TJPA 1D2PA 3LQAH 5TQ2L 4C4UA 5J11C 3JT0A 1KB9K 3PP4H 4OT1L 5FA3A 1YMMB 3GSNL 4Q0XL 1Y0LB 2H8PB 2VQUA 3EO1A 2A38A 3JQOB 1LWHA 4UDTB 3NCWA 3VSTA 3QXDB 1IT9H 1QSED 2ZXCA 3GBML 3OMZA 5LNGA 3GSVB 1DQVA 3B43A 4PJ5E 4KJQC 5E1GA 2X0UA 3VTTA 3QSKB 3PE9A 5EO0A 3SQOL 2OYMA 4B9KC 3ZDXE 4OSUL 4ZXBA 2WWNA 1EXUA 1MCJA 3DSNB 3QE5A 4LSRH 4V1DE 4XO8A 2ED6A 3QYCA 2L4OA 2YPVH 3K91A 4X99A 3L3OA 1I1YA 2O93L 1FBIL 3PHOA 3RNQB 5L4IA 3QNZB 1TEYA 2P5PA 4PN6A 4F91B 1DVFD 3NJMA 4KKCC 2E6PA 3EOBA 4Y19A 1HCFX 3KR3H 4BSVA 2AQQA 5DUPL 3UZVB 5FDWA 1JHKL 4QHKJ 3SGJA 4BK8A 5IVZA 4JN1H 1HTYA 4KNSA 3BVVA 4Q2ZA 4WSKA 4HIJA 4G8EB 3LMJL 4R96A 1XGPB 2V8MA 3D48R 2DB8A 4U6YB 4IBQA 3L5IA 4MDJB 1J5OL 5HDQH 4POUB 3GMMA 5CGYC 5FO7A 3VGFA 3NACH 4LLQA 2EDOA 4H26A 2Q8AH 3OPUA 4CSZA 1DFXA 3E38A 3M1CA 3PWUB 3N06B 3CFBA 4J6RH 1DQJB 1JZEA 1CD1A 1MEXL 2BSSB 2JB5H 4JKKA 4WWID 5DO8A 2D4FA 4RISL 5E00A 2P43B 1JZGA 4PV8B 1PQZB 3VW3H 3WEBA 1U8OB 5TE7H 3EIFA 2Z35A 4WV1A 3WS6A 5DWUH 4YQXH 4BIKA 4JDVB 2DQTH 5ETUB 4P9ML 3HVDA 1C5BH 7PCYA 3VI3F 3WNOA 1F3DH 1WF5A 4R6UA 2RD0A 3L95A 1JPGA 1CR9H 2EKSA 4ATWA 3BZ5A 2MCPH 4ZAKA 4QRPB 5CCJA 1FI8C 4B95C 2HVKB 3A22A 1WZAA 3RILA 3KJ6L 4EO5A 5HTSA 4QD2E 3GLEA 1NUDA 5CSZB 1BXXA 1F13A 3DK0A 4B0MB 1OSYA 2PCFA 3QIUB 4XNUL 2X0WA 3JWDH 4CDGC 5AVRB 3ARWA 3WCYA 3WLWD 3VXNA 4PJXF 2Z1KA 3MLPA 1I8MB 4U2ZA 1N4XH 1RLBA 3QEQA 3G5ZA 4PTUB 2VMDA 4PJ5D 4YBQC 3L5XL 3IGLA 1IU1A 3OB0H 1HESA 4MJIB 3MFFB 2VDPH 3MJWA 4G7VL 4UBDD 4XC1H 2F08A 4OCWH 3WHE0 4PJIB 5TD4A 1NCIA 5J13C 3C6SA 2F15A 2ID5A 1EZVX 2H2PC 4V1DD 4F33B 4QY8A 2P8MA 2DBJA 5DF0A 3ZGIA 2R0KH 3VGEA 2ZJSH 1PY4A 1OOWA 2L7UA 4GI9A 3CLFL 3QO1B 3Q5TA 1ZLEA 4IJ3C 5BRZA 4JRXB 5HYSB 2YKLL 2NUPA 3S4SB 3GHBL 4YAQA 1CFBA 1B0WA 5T1MB 3WXVH 3ARDB 2Z93B 5DFVC 1WPCA 2RB8A 5I6PA 2QQKH 5DGQA 1BIIA 5EU5A 3GSWB 2YSSA 3SCMC 4TNFA 1A3RL 1WZMA 4GG6B 1C12B 3RZCA 4HEMA 5EUOE 4NQDA 3T65A 2HWZL 4P2OA 2FH8A 2WBKA 4ZMXA 1MF2H 4UM9A 5IF0A 3KPLA 1SZNA 3T3PE 4TOYH 1GZQB 2JQZA 4YDLC 1G9MH 3IPEA 3S48A 3QQ3B 4Y5VA 2WQWA 4PRHE 4PSPA 1JDCA 1T7XA 3GINA 3NJVA 5CM1A 5SX4I 4CKVX 2XXMB 1IKNC 4P99A 4D9QE 4IMKC 1QUNA 4DGUA 5I1IL 2VXQH 2W1NA 3F7LA 3H55A 3RDTB 1OWRM 2XBDA 4OZGB 4P5KB 4AUJA 4KK5C 4JPIA 1HSAA 4X7CC 2HKFL 3NCFB 4HUCA 1Y18A 1QWUA 1UZ8A 2ICWJ 3KE0A 4YPGB 4J3OC 4KI5E 4WI8A 1PEZA 4GY4A 3N6YA 3VGAC 2O6FA 1EFQA 2EC8A 4Y5XA 5DK0B 1SDAB 3RPBA 1FHGA 2MTPA 4PRPE 1W72H 4LVNB 4LKCB 4HS8H 1KCVH 2WZPD 5GRWA 1MHCB 1O5DT 3Q43A 5I1AA 3MGAA 3BOVA 4ALAL 3BSHA 3WFBL 4PJ7A 3THML 2P4AB 3A6BH 5BVPH 5HHQB 4AYBA 2Q7NA 2VQ4A 5EWIH 1G0YR 4IHOB 1JE6A 1YNTB 2XWZA 3MBEC 4PRIB 5IBTH 2AXHA 3ZL1A 3WD5H 4F9LC 1XL6A 2GFBB 4OCRL 4ISVB 2BP3A 4Z3JA 5C0JB 2WWOA 3SYPA 3BMWA 3RVVD 2YR3A 2DMHA 5CZXC 4JFZL 2HLAA 5MERB 2K8MA 3F00A 2OMUA 1QW9A 1PLGH 1ZIBA 1TLMA 2DLFL 2VN6A 3BH4A 5IVOA 2D31A 4XN8A 1FZJB 3EG9A 3NIFE 2V7HA 5HHXH 3SDXB 3L2NA 3FSAA 1MN4A 3ZKQD 1GGCL 1ID2A 1WEJL 4MQSB 4RH4A 2JKNA 1J05A 2X44D 4PJAB 3IF1B 4HIEB 1BBDH 5E1AB 4XVTL 1BZ7B 5EBGA 4YDMA 5I1DA 1S9XB 4APXB 5F96H 4QF1A 5CEZL 1BMGA 4V2BA 1O6SB 5AD0B 1B0RB 4JPKL 2X1XR 1BZQK 1QQDA 3RVWD 5CZKA 1M7IA 1U3YA 1VADB 2BXZA 1WFUA 2CDEA 4G42A 3IU4L 3TEUA 2KQMA 5MP6H 3RVUC 3OKOB 4Z5RB 5FYLH 4KQ0A 3ZTNL 4MASA 4PRHD 4TXVB 4P5MA 1OSZA 3MREB 4IIZA 4J3UA 5D72L 4WKZA 3LRMA 3IDJA 3PWJA 1SJEA 3OLIA 1CDCA 3IBOA 4WK2B 5JW3H 4LDLB 4IK6A 2OW7A 4FEIA 1A4JB 4NPJA 1HHGA 1UXWA 2WXOA 3IMRA 2XQYK 3ABGA 3D25A 4MCMA 2WLJA 4KI5D 4GIAA 4G8IB 4KVNL 5AW0B 5J1AA 2D7MA 3PG2A 3H7BB 4KBPA 3SGJC 1MXGA 4U3SB 3MLSH 4PRPD 1Q9OB 4DP7X 1MXDA 4PHZA 5ECJE 3FFCA 3ECBA 3A67H 1W6LA 4M61B 2LAGB 3B7UX 1CLCA 4HT1L 4FQ2L 3S3PA 2BVQA 4LEXL 4Y1AE 5FK9B 2X53A 4NJAL 5JQHC 2P8LA 3KYNA 1WBYA 2XWRA