3FQ2A

Azurin c112d/m121f
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALFKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Type Zero Copper Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fq2A00
1NPJA 1OCOB 2NRDA 1NWOA 3NJIA 3NYKA 1RCYA 3C75A 4TXVB 3NSFA 2WSDA 1M56B 3SBRA 3MBWB 3ABKB 4E9SA 2UX7A 1M57B 2FWLB 1OV8A 2GB2A 3PAZA 2IWFA 1ADWA 1WA0X 2MTAA 4WKXA 2FQFA 4JHUA 2YAQA 1J9QA 2YQBA 1WS8A 2CUAA 4E9YA 1OCZB 4WTQA 2A3TA 4HHWA 3EF4A 2IDFA 5TK2A 3CDZA 3AG1B 4DP5X 1AR1B 2BP8A 1BEXA 2FT8A 2P80D 1NIAA 4ZK8A 3EH3B 3SBQA 2AVFA 1X9UA 4AKPA 3QJTB 4DP7X 2PPEA 3FPYA 4DPCX 2IWKA 2N0MA 3PAVA 1ET8A 2XVBA 4HIPA 1W8EA 1HAUA 3DKHA 3ZBMA 2PPAA 2J55A 4E9VA 4G7SB 3S8GB 1WA1X 3FU9A 3NSYA 1BXAA 1R1CA 2PPDA 1BAWA 3NT0A 1URIA 2YAOA 3UADA 1ASQA 1ASOA 2JKWA 7PCYA 2CCWA 2YARA 2CJ3A 3OMAB 3FSAA 1HAWA 4G70B 1V54B 2E86A 3SBPA 3T9WA 1L9SA 3NJLA 1E5ZA 2BWDA 2FQGA 3NSCA 4HALA 3NJNA 4F7KA 4HCFA 1MDAA 2PP7A 4AKQA 1L9TA 1JZHA 2HRHA 1VLXA 2BP0B 4HCGA 1GSKA 2VSKB 5ANHA 2H3XC 2VMJA 1W6WA 2XV0A 1PZCA 1RZQA 1E5YA 3WKPA 3CVBA 4DP8X 2UXGA 2P80A 1BQ5A 1NIDA 2DWSA 3JTBA 3FS9A 4YVUA 1JERA 2H47C 2EIKB 2JFCA 1PF3A 2AZUA 4A2EA 2HZHA 1XB3A 3OQRA 4Q8BA 3WKQA 2VM4A 2RACA 3S3DB 2Q9OA 1CYXA 4DP6X 1AZRA 4P5RA 2IAAC 3GYRA 2XX1A 5B1JC 3FT0A 1ILUA 3T71A 1ASPA 1JZEA 3T6WA 4E9TA 3EH4B 2GBAA 2BHFA 3DTUB 2EINB 2Y69B 3SQRA 1UATA 4BK5C 1PNDA 1JZIA 2YAEA 1JXFA 3QQXA 2GHZA 1V55B 1GW0A 1WAEA 3FSVA 1L9RA 1ZIAA 4A2HA 3MX0B 1TEFA 2OJ1A 3DIVA 1EZLA 3NJHA 3TA4D 3IN2A 3TU6A 2FQEA 2FT7A 1KGYE 2GSMB 1AS7A 1KV7A 3GDCA 1AS6A 2VW7A 2PCFA 3AG2B 2YXVA 3CG8A 3FQYA 1ZPUA 4A67A 4A2GA 1JZFA 4K9JA 1NZRA 4RH4A 1GY1A 3CDZB 3X1NA 2BP8B 3N2JA 4DP9X 1TKWA 5B7FA 3ZIYA 2FNWA 2HXAA 1KCWA 4PCYA 4DP0X 1A8ZA 2J57A 3IN0A 3N55A 1PY0A 2VSMB 4BXVA 2VM3A 4UANA 5D4JA 2XU9A 3S3BB 1NIEA 2PCYA 1N68A 1A3ZA 5TK4A 2PP9A 4W9ZA 1J9RA 1AOZA 1JZGA 5D4IA 1KDJA 1NICA 1AZNA 5AKRA 4G72B 4L0PB 3UAAA 3WIAA 2HLEB 2XWZA 2HRGA 2QPEB 2YAFA 3AW5A 1AG0A 3X2QB 4YSEA 2WO3B 1ILSA 4QKTA 1GY2A 3ZX1A 4M3HA 4DPAX 2HX7A 3FU7A 4YSDA 3FU8A 3RYMA 1SHWA 1WA2X 2HX9A 2ZOOA 4DPBX 4G7RB 1IC0A 2FTAA 2UX6A 4DP1X 1XB8A 2I7SA 1YLBB 2Q5BA 2W8CA 2PPFA 3IEAA 2BZCA 2BWIA 4YL4A 1CUOA 3WNJA 3AG3B 4GY4A 3H56A 1ET7A 1OF0A 1PAZA 3WNIA 4A66A 2XV3A 1CC3A 3QJSB 1J9SA 1AZBA 3PPSA 3FYEB 8PAZA 2YAHA 5PCYA 3NJMA 4CSZA 4UF7C 4KO5A 1AG6A 2XV2A 4P5SA 1FFTB 4KOCA 1GS8A 4FA7B 2IDSA 4YSRA 4NAJA 2EIMB 3UAEA 3H4FA 1RKRA 2PP8A 7PAZA 3T6XA 4AKOA 3NP3A 1AZCA 2XXGA 1ETJA 3GXUB 1IKOP 2X88A 1OE1A 1BXUA 4KNUA 1A4AA 4JHVA 3X1GA 1IBZA 1M9WA 1ZDSA 2BO0A 4YSSA 1L9QA 1XMEB 2UXTA 2XLLA 2FJSA 4QLWA 3ZDWA 3WG7B 5A7EA 1AIZA 2MRYA 2H5UA 1E67A 1JVLA 2BW5A 2DWTA 4GP4B 3V9EA 3AG4B 2CAKA 5F7BA 4JKNA 1J5DA 1QLEB 5I26A 2IDQA 2LLNA 3WI9A 2EILB 3G5WA 3X1FA 1A65A 5I6KA 2XYBA 1V10A 1L9PA 3X1EA 5B7MA 5EHFA 4KNTA 1PLCA 4F2FA 4YSCA 1MG2C 1ID2A 1JVOA 1SHXA 2XX0A 4YSUA 2BP0A 1N70A 1NWPA 1AS8A 2DV6A 1SJMA 1IUZA 2QT6A 5E9NA 4A2FA 1GR7A 3V9CA 1CYWA 2QPDB 4BDVA 2UXFA 2HX8A 4KO6A 1QHQA 1SF5A 2CBPA 1F56A 1DYZA 1NDTA 1ET5A 1ZDQA 3NJJA 3FYIB 4AZUA 3NJGA 3UABA 1PNCA 1A4BA 2JXMA 1SDDA 3TBCA 1PLBA 3L45A 5FC9A 1A4CA 3JT2A 1RZPA 4BXSV 1L9OA 1XB6A 2I85A 2B3IA 3QJRB 2R7EA 2FT6A 2Y1AA 3QJVB 3EHBB 4HCIA 2WO2B 1I53A 3FU7B 4A2DA 3PAUA 1SFHA 3FSZA 4Q89A 3ABGA 2J5WA 1NPNA 5B1BB 1NIBA 4GP5B 1FWXA 3KW7A 1JOIA 5B1KA 3U25A 3AZUA 3HEIB 3TBBA 2GC7C 4DP4X 3OMIB 4PAZA 5I6OA 2PPCA 2GI0A 3BQVA 4G7QB 4HHGA 1KDIA 4AX3A 3AY2A 3OMNB 3FPXA 1OCCB 3ASNB 4E9QA 3D12B 4YSPA 3HB3B 1E65A 2EIJB 1FA4A 1T5KA 5I6MA 4AI7A 2IWEA 1OE2A 3FQ1A 5LDUA 2AFNA 1WS7A 3CVDA 1MG3C 3QPKA 3UGEA 2ZONA 1KBWA 2VW4A 3NJFA 2YXWA 2DYSB 1KYAA 1MZYA 1OE3A 1JXGA 3IBOA 5PAZA 2GIMA 5B1AB 1E30A 6PCYA 5IY5B 4E9WA 3TASA 2AANA 3CZUB 2I7OA 5B1JA 2PLTA 5I5MA 4G71B 3FQ2A 5I28A 2TSBA 1BQKA 1ZV2A 2J56A 1BXVA 1OOWA 4ENZA 4YSQA 5B3SB 1SNRA 6PAZA 1OCRB 4KO7A 1TU2A 1W6LA 1AANA 2X87A 4YSAA 5I5JA 3X1BA 4KNSA 1JXDA 1J9TA 1NTDA 2ZWNA 1B3IA 1DZ0A 2W88A 2QDVA 5AFAA 4E9XA 2GC4C 5AZUA 3NP4A 4KOBA 2AZAA 3NJKA 3T6ZA 5I6NA 2XXFA 2OCCB 4MFHA 3ABLB 4M4RB 1TEGA 2B08A 4BWWA 1JZJA 1BYOA 4A68A 2ZXWB 1CURA 1X9RA 4BWTA 1GS6X 1GYCA 1J5CA 4YSTA 2QDWA 4X4KA 4BDVB 1SFDA 3S8FB 2IDTA 4UAHA 3NSDA 2BW4A 2VW6A 4YSOA 2FQDA 1HFUA 1GS7A 3IE9A 4N8UA 3UACA 3OM3B 1BQRA 1NIFA 1NINA 2IDUA 3CVCA 1PZAA 1MZZA 4GYBA 4NB7A 1AACA 4GP8B 2DY2A 3T6VA 1SDDB 3ERXA 2YAPA 3S3CB 2CALA 9PCYA 4YVNA 1QNIA 3KW8A 4NERA 1PMYA 4F2EA 3FSWA 2R7EB 5I6PA 2VN3A 1ZIBA 2UXVA 3OD3A 1PCSA 1AAJA 1KBVA 1EHKB 4BWUA 1AZUA 1IBYA 4HZ1A 2YAMA 3PCYA 2OV0A 4FAAB 1AQ8A 1SF3A 4W1TA 3ASOB 3QJUB 5D4HA 2BZ7A 1PLAA 3PXLA 4HAKA 3PLYA 2XUWA 5I6LA 4GXFA 3EH5B 3BVDB 2TSAA 5I5IA 2IH9A 3ABMB 1BYPA 1KCBA 4EF3A 2DYRB 1PZBA 4DP2X 5F7AA 4N4YB 4E9RA 2IH8A 3QJQB 4CSPA 3H4HA 4KO9A 5B7EA
chains in the Genus database with same CATH superfamily
2CDEB 4OGAC 1MCKA 4PJAB 5IUCA 3D25A 3OKDA 5E00A 2YC1A 3WHE1 2BNQE 4ILDA 5E6IA 4RFOL 5AL8A 1VDGA 3ZDXE 1BIIA 2DLGA 4P3CL 1M7DB 4QJ3B 4ZMAT 1R5WB 1GL4B 2Q8AL 2GK2A 5CJ5A 2IWFA 5IOKA 3ZDXF 3K2IA 3P30L 1JK9A 3JV5A 2YD7A 1DUZB 4X6DF 3EF4A 5E9DD 4GJTB 1MW0A 3AG1B 4PMFA 4NENA 4DP5X 2WVTA 3GHBH 1ULVA 2X9WA 5E1AA 3VXPB 2AQ3A 4XE5B 3B2PA 2VZTA 3M86A 4JHBA 2VZUA 4L0YA 3BAKA 4KXDA 3OKNB 3L7FA 5HYIA 2BIQA 2CR6A 4D0BB 3OKLB 5EU4B 5AW9B 2OBGA 2FO4A 3ZBMA 4PJXB 4JKMA 3SKJL 2HLAA 4PLNC 1FZJB 3VSVA 1BXAA 1CLOL 1R1CA 4WW2F 1BAWA 1U8LA 2ZUTA 2OP4H 1P7KA 3CSYB 5IJKC 4PLOB 3P0YH 1QVOB 4ODTH 3MLWL 1JS4A 2D0HA 3I6KA 3D0VB 4U1MA 2GFBA 4XP5H 4H26A 4QRFA 5C0GB 5CGMA 1NDGB 4OD3L 5KANI 3MTXA 2X42A 4WGWB 5LBSH 2CRZA 2BIPA 3VE0B 1XF4B 1ZTMA 2ZPKL 5CSBA 2ITDA 3UTZB 3RB7A 4JQIL 4BRVA 1IL1A 1UD6A 2FNBA 4HCFA 4F15B 1RPUA 3O8XC 4FNLL 4MRCA 3HUJA 2PP7A 3P54A 2BNQB 3ARGC 4JVWA 3P2DA 3ZDXB 1JZHA 1WK0A 2VH5H 1KN4L 4PWHA 1EH9A 4N0UE 3WN5C 3ARBA 2H3XC 4Y2OA 1AGEB 1CZ8H 5AVYB 3BAXA 5DRNB 1GTNA 1G7PB 3VYPA 4PJCE 3BZ4B 3H2WA 2Z7YA 1BWWA 1KG0B 3MLRH 2IQAA 4JZNB 1T1ZA 3RI5K 4PJCF 1FVEA 2I24N 2ZX9A 3CN3A 1JGEB 4HJIA 4FLQA 1IGML 5FGRA 3GHEH 4EDXB 4ECNA 4F7TB 3VFPB 1HEHC 2DAVA 3HG5A 3RVTC 4Q8BA 2CKNA 1AGDB 4WDIA 4CN4A 5D2LE 5C6PB 4P5RA 4WW2B 1ZJBA 1BZ7B 3SPHA 1LGVA 2F1AA 1GOGA 4F58L 1HILB 3B4NA 5I1DA 4XOCA 5BRZE 3GSNH 2AI0H 4AIZB 2AQRA 3HW7A 3PPEA 1JXFA 5ENWB 5IVXA 2AV1A 2GHZA 4R4FH 4MMZB 3AU0A 5DTFB 2C1PB 3FQTA 3DOSB 1Z9MA 3MRHB 3QUYD 1OSZA 5HGGS 1WV7T 3UAJA 3F6LA 4DGWC 4H44C 2BK8A 5HHOE 4BEIA 4Q9RH 1M2VA 2OMVA 4ANVA 3N85L 5I0XA 3GDCA 4OT1L 4BFRA 1KB9J 4XVJH 2GSGA 3CN1A 3PJSB 4ES9A 3ZHDA 1G9MH 1NGPL 5J4MA 4HUCA 1BFVH 4N0UB 4ACPA 1YEIL 1QACA 2EVJA 3BUBA 3OG6B 1DBKL 2H0FA 3M46A 1NCOA 1FYHB 3IWUA 4UOJA 5TQ0L 4PCYA 4EBQL 3AWEA 4PJCB 2V3DA 1XEDA 2R29H 5IB1A 5FO2A 3NEOA 5FYLH 3MRDB 1TNMA 1MIEH 3KWXA 2MNJB 4FLHA 4UILL 1A3ZA 4ELDA 5FEBA 4LLWA 1OGTA 3MR9B 4Q74A 5ICUA 2N56A 5DUBA 4K3DL 1FNAA 5D2LB 1MCJA 4GQZA 4OLEA 1HE7A 2D3VA 5K9KB 4NAMA 4L2YA 1ZANH 2H9GA 1Z9PA 1DQTA 2VDMB 3K8KA 2OMWA 2X40A 2E7DA 3BCFA 3IAQA 2IALB 4WUUE 3ELAT 5C0CE 2XWTB 2XWZA 4RFNC 1H9DA 1WC7B 2AEQL 2F53D 4WNQB 5GQBA 1CE6A 5BRZB 2YSSA 1LEGB 5KSBA 1NLBL 1P7QD 2CHWA 1WHPA 2WO3B 3DX9A 5LGYA 3HC4L 4I0PD 5IR1B 4NZRL 4HGKC 3T04D 4CSSA 2E9JA 4GUQA 3QUYA 4JN1L 1YEEL 1LTXA 2VZ1A 3QUZD 4PREA 3HHSB 4FCAA 3BWSA 4OKVA 4X4YB 4F2ME 5HHOB 1XB8A 4CC1A 3O3AB 3QFJD 2I7SA 2W8CA 3IEAA 3JYBA 2BLFA 5LLIC 1QWNA 3UTPD 4N85A 4PTUA 4M93C 1ZLWK 2JJTA 3V7AE 3MSPA 3U9PL 1MFDH 3OR7B 5H94A 3WNIA 2C9AA 1CC3A 3OZ9H 2WN3A 4U31A 3V10A 2HKHH 2QBWA 1MCEA 3L13A 5FXCH 5L7XH 1XAKA 2PTUA 3V0VB 1TZIA 4I18B 4HIHA 4IBQA 4HT1L 4FX5A 1GS8A 4S1DC 1OF2B 3PREA 4TN9A 1NDMA 2QEJA 2JI2A 1NC2B 5FO7A 4ODSH 1OB1A 4A6YH 3U79A 1LO3H 4LLQA 3VW3H 1ZD6A 1HHJB 5F72S 2GBUA 3Q1EA 1BXUA 3FCGA 3MREB 4AUJA 5ESVB 2ZWZA 5F1KC 4R0LA 3L9RB 3WCYA 2QELA 4XPHH 2UXTA 2WJ7A 4O2FA 4F24A 3AITA 4WUUB 1V7ML 4KAQH 4BH7B 5C0CB 4AYBA 2F53A 3LV3A 3T1FB 2DQJL 2Q3ZA 5DVNA 1MHCA 2FD6H 2IPTL 2WGXA 3UYPA 3DX6A 2WHVA 4H0HB 4I0PA 4RWYL 1RSYA 2E47A 1S9WB 4P8QA 3VD5A 3VD1A 4JFZH 2BVTA 3AB0C 2Y6SD 4OM0L 1JYVA 5DQ9A 4R4NC 3OQ3B 2IDQA 3BPLC 3QUZA 3TBVA 5M95B 1E6OL 1AE6H 2P28B 2XQYG 2PCFB 1M9SA 2XWRA 2V8LA 1L9PA 4MVBD 4ACTA 4F2MB 1FL3B 2CDFB 3CFEA 3QFJA 4NZDA 5HHVL 5C3LD 3BWUC 5DJCB 2GQHA 1R3IL 4HIEA 3G9AB 3P4MA 2JK5B 1OZTG 4LSQL 2OLDA 1KC5H 5M7QA 3D3VE 2H0JA 4A7GA 3ARDB 1QFPA 2B8OT 4JCMA 4A2FA 4QJ4B 3WHXB 3RFZB 2CXKA 3K74B 3V9CA 5IKCB 1E4XH 4O4YH 1QHOA 1B4JL 2NZIA 3C6LC 3VGEA 4I0KA 1R75A 1OAYL 1XCTB 3FYIB 4LVHB 1KXHA 5DQJB 4FDWA 5EH1A 1KGXA 4H8WH 4OJEH 4JM2F 1H9VA 1MWAL 2JH2A 3GJEA 1QBAA 1X5HA 1ZA3B 3BZFB 2MHAB 2XVGA 3NA4A 1HHIA 2V9TA 3WIHL 2EXWD 1MFAL 3I3DA 4BXSV 2Y7QA 1T66C 4NP4H 3O9WD 2H3NB 3RILA 2WBKA 3MCYA 4JFPA 3ZYIA 4IMKC 5JUEH 3WNOA 3LMJH 4N8VG 1OAUL 2NNCA 3T0XA 1CXEA 4U6VL 3II3A 4NQTA 4HWBL 5L6YL 3NUKA 1KCLA 3SZKC 1R5VB 4W4OA 3GLAA 4DN4L 2A73B 2WY3B 4FLRA 3WXVL 5F6HJ 5GISL 4HJTA 3OF6D 3SE4C 4DPRA 3EO9H 4WO4B 3BKYL 1OTUD 3U7YH 2XZQL 2DQDH 3AY2A 4JFXB 1Z5HA 5T1MB 3QUXD 3S34L 3PY9A 4CC0A 3D3VB 1J0ZA 1E65A 5D1ZB 4BCZA 4G1EB 4MASA 2C3XA 4XODA 1OE2A 1W15A 4JO4L 3DRTA 4X6EB 5D7SH 3TNMA 3WSQH 2Z31A 3CXDH 4XMLH 1SN2A 3V6ZA 2CDGA 3EJTA 1BZQK 3BN9C 5DFAA 3GSQA 2F74B 4NUPA 3CSTA 4JO1L 1F97A 1B3JA 4JM2B 1YQVH 1BIHA 3P9LB 3TASA 1SHMA 4A7VA 3OKOB 2EAEA 1ZHKA 1RY7B 1XR9A 3HVNA 3K91A 4KZEL 1QTYT 4UQ9A 4U1HA 2WNGA 4X0KB 5J9PA 5HDRA 4NQDE 1JFQH 2YPLD 3QUGA 2DWDA 4XXDB 3KR3L 4P5TA 3V0JA 4Z78B 4Y5VB 3T0EC 3UYRL 1MY5A 1UCBL 2YWYA 1FFOB 4UI2A 1TO5A 2WSKA 2AZAA 1N59A 4CVXA 2NXZC 2VDOH 2X4RB 2H8PA 2Q2EB 4I2XE 1X7QA 3QXWA 3FOLB 5HDBE 4Q6IB 4A68A 2BVPB 1UCTA 1RURH 1QQDB 2FX7H 4KKLC 5HDBF 2EDFA 4CVUA 3FTZA 1X5JA 4WJ5B 1KN2H 3NCBB 1U21A 1MCBA 1WZLA 4IIZA 4PV9B 4TUKL 3HC3H 4XMVA 3D52A 2FEDC 3KDMA 2HVBA 4JE4B 1UXWA 3CK0L 3IE9A 3FB8B 2JKXA 4W93A 1HSBB 4TNVF 1NOAA 4GP8B 1QPKA 3A23A 1WFJA 4LMQE 5ESAB 4X7FC 5FHAL 3S3CB 1TQCC 3RA7L 5DGRA 1XH2A 1AHWC 1HHHB 5HTSA 4GS7C 3ULUF 3LB6C 1NAKL 4LO9A 5IQ9B 1QUPA 2WLIB 4NRXB 4OUUA 1DVFC 3L3HB 3MV9E 4ZS7H 4NQDB 2YPLA 2NW2A 1ZLVK 1KXTB 3EFFA 2YAMA 1S5HB 3PCYA 5AKTA 1LO2H 2DQFB 4XNYL 3BGFC 3L3JA 1CK0H 4L8BA 1FG9C 1HQ4B 2D2OA 4JFQA 1P7BA 1SM3H 5EA0H 1UG9A 3QEQE 3VFSB 1BQLL 4I2XB 4GKZB 3BKCL 2EJ1A 4G80A 1NMAL 2RQEA 5HDBB 1QOKA 1S7SB 3NMEA 4C4KO 5D7KD 4MNQE 5BXFB 3ROOA 4ZFZA 1G6RA 3MJWA 3C75A 2VDNB 5CD3A 1ZGLB 4LPXA 1DBMH 3ZKNC 3L3IA 1UH2A 2XSKA 2EO9A 2V6HA 2R2EA 3WNKA 1UGNA 3SY0A 4UT9L 3MLSH 1OP9A 3NZHH 1MY7A 4LSVH 3F65A 4Z3HA 3EBHA 1HYSD 2DQEH 4D9RE 2OQJA 3PHOB 4GXUN 4DEUA 3GXDA 5CZVH 1BEXA 4PWKA 4HU8A 2ENPA 1D5XA 5ID0A 4GH7B 4IIQB 4XPTL 2AJZB 4YN3A 3GMOB 2VQUA 5ES4B 3AM8A 2EIZA 2N0MA 3BHBA 2NY0D 3ETSA 5LO7A 2XQBH 3MV9B 3CZJA 3VGAB 4NKIH 3P0VH 4UU9A 3I9IA 2X4OB 3TJHD 2ZCLL 2BXYA 2WOBA 3AU1A 2FUTA 1FZOB 3SDAD 2BC4A 2IFGA 4Y7OC 2AK1L 1S7VA 1OKEA 2QV2A 1BJ1H 3DVNA 3NSYA 3O81A 3BDYL 4JLRB 3ECQA 4ZUUB 1KYDA 4OZGE 3TCXA 2ID5A 2EVHA 4K3HA 2ZWKA 4NKOB 3U0PB 3JYCA 3QEQB 4OZGF 5B39B 2CCWA 5I8EA 4YMPA 5EMYA 1ETB1 3LNFA 1HKFA 2G60L 3RX7A 5EFIB 2ZAHA 4UZUA 1R3KA 5BV7C 2Z4QB 2APWA 3Q2LA 2X7LA 3T9WA 2BWDA 3ECUA 4KKCD 4MNQB 1F41A 1R3HB 2AJXL 2BSTA 2UVFA 2IOIA 3L1OH 3QC6X 2CBOA 2B16A 1M1XA 1NKRA 4M5ZH 1OPGH 1AP2B 5FDWB 2HRHA 2VLLB 2GK0A 2HKFL 4HCGA 4DOHE 5B3JE 3FCSB 5ANHA 3O6ML 4DAGL 3UTSE 5GZND 4Z7QE 2OTUA 3C12A 3HR5B 1N64L 3TN0C 2BP5M 2C9QA 3Q2NA 4JQXA 4Z7QF 4ZFOB 1YZZA 3QZWA 3MA7A 3SKOA 3L9YA 2V3EA 1B4TA 3FS9A 4PB0L 1XF5B 1I1AC 3N9GH 2G2RA 3GWJA 4YR6A 3RRQA 1U3HC 3BPNC 5CJBA 1DEEA 5HYSG 2GJ6A 2NZ1A 1CYXA 2W92A 4QOKD 5C08D 1R5IA 1ZSHA 4P06A 5FYKE 1PCXA 3RGVD 3G6JE 4OZGB 5LHDA 3DTUB 1JBJA 2CXGA 3BH8B 5BOZG 4HPYL 1BVOA 3OHXA 5FGSA 1TLKA 1NOFA 1ZHNB 5BV7L 3F12B 4FABL 5DSCB 2F58H 4QRRD 3KBFA 3FUMA 2OJ1A 3UGXA 2ENSA 4PJGE 4KC3B 3RWFB 1KGYE 4PJGF 1KV7A 1K4CB 2YUWA 4PMEA 5F8RC 1AS6A 1JGVL 3PWLB 1T5XA 5BZXA 3HNSH 3S48A 4MAYC 1SXNA 4PB9H 4DOHB 2VDLB 1JPFB 2ADYA 1WBZB 4PRDB 3UTSB 3CZLA 4Z7QB 3MUZ1 2EC9U 3MRFA 5C86A 1SVZA 2AKRA 3MKKA 2Q8BL 4Z76A 4FC3E 4XVTH 1U91B 4FTDA 4B96A 1KEGL 1J7VR 3VRIB 3LH2H 3D06A 3DK0A 1FRGL 1PDKA 3EOAB 5CJXC 5D2NE 3ABZA 3IM1A 4W9EC 5GS0D 2Z91A 5BZWB 3CC1A 3ELQA 2CO7B 1VSCA 3QZBA 4FQIH 4QOKA 4X5LA 5C08A 5FA4A 3IAGC 2OI9C 2VDQB 3APDA 4BFIB 1I9RH 1L0XA 2FIKA 2GCYA 3L95B 4KROD 3G6JB 2OX5A 4N90E 4X4XB 4CU6A 3VXUE 4GB9A 4M7JH 1UWEH 3PV7A 5AUMA 3JTSB 4OLUL 5D7LE 3V7MA 2IANE 3QUMA 5EU7E 2VJXA 2Z92A 1EXHA 2WTRB 3L08A 4PRBB 4NXSA 1SHWA 2ADGB 3TJEL 1EHLL 1OO2A 3BXNB 3IDGA 5E8DH 3UG5A 4MQXD 4PJGB 1K3ZA 4Z3TA 3HZMB 1J8RA 1M2OA 2B1OA 3R1GH 4N0YH 4G6FB 1XDTT 2Q5BA 4FKKA 2SEBA 3CH1B 4HS8H 2IDCA 5AYUH 5I82A 1IGYB 4PLJD 1F11B 4XXWA 1IAMA 3NSJA 4MGXA 2OSWA 4M6NH 4AZ8A 2ADFL 3ARTA 4ZMTA 1NGWA 2RB8A 4U1JB 4AEFA 1KBGH 3NBNA 1T1XA 4RZKA 3QC5X 2QHRH 4UQ2B 3K2UH 5E23A 5EBMA 4X2UA 2EADA 4LVOB 3VFTB 4KO5A 1MJ7H 4L3CB 1B0RA 4I3RH 5IUSA 5JPMC 3MLXL 3RPIB 4NNXB 5DJ2B 3AMLA 4LSDA 1KT2A 4KTEL 2IADB 3BAEL 3BVNB 5D2NB 4JZOB 3CZFA 3NP3A 1WRFA 1CD1A 4PG9A 1JL8A 2BDNH 5HHME 3WJMA 5FYJE 5CWSA 4YHPB 4H13C 2EYTB 2V9UA 4FLSA 2PWDA 1I1YB 5GXBB 5F9OL 4NXKA 4XCEB 5AAPA 3VXUB 3NFNB 4S2SB 2UY6B 5F7FA 2C9PA 2PW1B 4M43H 1E2VA 2IBBA 3QWRA 5EU3B 4ETQA 5D7LB 1OAKL 3L2NA 1N67A 3P1VA 1X6NA 1P5UC 1C5BL 3FQUA 3TBWB 1DBAL 3OTTA 4XHJD 4NCC2 1SDYA 1T2JA 5I6XC 5CLXA 4LLYB 3K4AA 1FV1B 2B3RA 3A47A 3FQNB 2J1ZA 4BFEA 3MGTA 4I4WB 1MUJA 2WWOA 4K94C 4D0DB 1AZVA 4M9OA 1XBDA 4LE8A 1HZHH 2H2PC 1N26A 4HXAL 1JVOA 4NYLB 4DN3L 1I1FB 1EANA 5HI3C 5HHXH 5DD0H 1MIMH 1N70A 3GLDA 1IUZA 4MBOA 3ARXA 1GGIL 4KQ4L 4AQOA 1JNHA 2B1AL 3EOTL 1BOGB 1P84J 1QRNE 1PG7X 1F56A 1DYZA 1JGUL 1U3YA 4OCYL 1DBJH 3QNYB 4PGEB 2PR9A 4XMTA 3CX5K 5KVGE 3MRIB 4OFDA 4XXCC 3DXAA 3EFDH 1BQHG 4WENB 5HHMB 4JKLA 4BSVB 1BVNP 4AXWA 4CDHA 3MROA 4OFYD 1IBDA 4EZKA 1OCWL 2YRPA 2CUHA 4JVUA 5D6CA 1UHVA 1OSPL 3W37A 2XWEA 4PY7A 1FVCA 3PRZA 4ZQTA 1MLCA 2VERN 4E42A 4HUUA 3U7WH 4IBSA 3D87B 5HVWA 1UT1A 5CKGA 5GRUH 3GSOA 5CGYC 5IFAH 3K2KA 4ERSH 4WVRA 3FNKA 4PAZA 3VWKD 5FFLA 2GI0A 2R1WB 3EUDA 3WOVA 1RUPL 5B8CB 3HZKB 3ULVH 1KYFA 2YOAA 3EG9A 4TLSA 4K94L 1VIWA 3QAZB 1E40A 2AHIA 1T7XA 4YXLL 4XNUH 4XMXA 2YRLA 4FXKA 4HDIA 3WS6C 3F01A 3PWVB 2NY2D 4OR1A 4FTVD 3LZOA 2OSLA 2QGCA 4PS4L 1HXYA 2EDWA 2NSMA 4R7XA 5EN2B 1IKFH 3O0RL 1MG3C 2BFGA 3OWEA 3L5XH 2WMPB 4NN7B 1QRNB 3HG4A 5I15L 4PP2A 3BVXA 4RWHA 4KJPC 3DVIA 3NJFA 4IGBD 2DYSB 1MCOH 4NNPH 5H8DA 2B20A 5E0QA 5EIVA 2DEXX 1KXVA 3CVIL 3DJSA 4H8UA 1UA6H 3H53A 1ZWIA 4N8CH 2I7OA 3FTWA 2PLTA 5I28A 3NPSC 1D9KD 3QE5A 3QNXB 2LHAA 4OFYA 5LXGH 2O4EA 2VQ1A 3PNWA 6PAZA 4O51A 2EYSB 1E9PB 1TU2A 4WWPA 1DL7H 3CC5A 5F0MB 3E1ZA 5EZJA 3UZVB 1TVBB 4JJ5A 4U3HA 5CF3A 5C1MB 4GRWH 5T3XD 4X0NA 4M48L 5AZUA 2EH8H 3MJ9L 1F2XK 3DSFH 3NJKA 3HNVL 3ASWA 2JTDA 4NHUB 1LEKB 1IGJB 3MV7A 3AY4A 5F9WC 4AQ8C 2OSYA 4WFHD 4M4RB 4U2ZA 5SWZE 3FN9A 2YD0A 1JZJA 2EDYA 3I2CL 1RUAH 3QULA 4LQ1A 4UUJA 4N8VA 3LZPA 5HGBB 1BVZA 3V0WL 1J5CA 5FWQA 4A37A 5HDQL 4FTVA 3VI4F 4FNPA 5FYLE 1ZEAL 3Q2CA 3RWDB 1J8HE 3PV6B 4TPRH 1VGKA 4G6AC 1YY9C 3LNIA 4M9PA 2L7EA 1A7RH 2YKLL 5T5FA 3MFGB 2CKBH 2FSDA 4IGBA 2G5RA 4KTDL 3VFOB 3CN2A 4N0FB 3TVMB 2QQQA 2CALA 9PCYA 4BUQA 4FHJA 4H8QA 5F7EH 3IJEB 5KYWB 2EE3A 1A7BA 2Q1EA 5CNHA 3GS0A 1D9KA 4ZJ9A 5F1OB 1ZIBA 3GSNB 3S5LA 1F6LL 5I1HH 3JUZA 3CD4A 3CFDA 2JLPA 4FN0A 1ES0B 5JW3H 1RIHH 1IBYA 1H8LA 1Z9NA 4KRPB 4RRPG 1KCSH 5I1AB 4N22A 3ML8A 2V5RA 2K8MA 4GXUM 4P2CG 3ZL4H 5ALCH 3CQFA 4PY8I 4KK9D 3AAZA 3OAZK 3WKYA 1H5BA 5CXPA 2X4SB 5C71A 5J06A 5BZDA 4XO5A 3GIZL 5L88H 4BZ1A 3W0WD 4AYDC 3CMGA 1MF2L 1RZFL 2PYED 4EI5C 3BPCB 3IJ7A 2DWEA 1JNNH 2J73A 1T21B 1UB5A 5SWZB 3DO4A 2EDEA 1AYOA 4BE5A 1N7ML 4N4YB 1PY4A 3EYQC 1WIPA 4LLAA 3VXTA 5J11B 1OWRM 2XNAB 4EOWL 3HE6D 4Y4HB 1RCYA 1CXKA 1AQHA 4M7KL 1YPZE 2R0ZL 3CHQA 3V0AC 4BQ9A 1J8HB 2JJUA 4IRSC 4L29B 2WLLA 5AW6B 2ICWB 3II2A 2GVYA 1P4IH 1YPZF 4PRHA 2F19L 1H6TA 5G2NA 1QMUA 2GABA 1RIUH 3KEHA 4R3SA 4U0RB 2F5AL 3TZVC 2J3SA 5KW9L 4F9LC 3WD5H 1J11A 1H15A 1V3JA 3MO1A 4BSWB 3JZ7A 3BPOC 3C60C 3OC5A 1QTSA 3S4SG 1YNKH 1MDTA 5CCGE 3PE9A 5JORB 2WCSA 1E2ZA 5KBDA 1KZQA 2KKQA 3MJ8A 4JZJA 1CLZL 3RY5A 4XB3A 5D7JD 3E6FB 3NFSH 5EIQA 4UB0H 1SEQH 1T0PB 1OD7A 2CA3A 1K5NB 2Y36L 1CU4H 3S8GB 1VENA 3HS0A 1KPUB 5AVXB 2BCKB 3VXNB 3ZYZA 3EJCA 3LIZA 4JHAH 3B7UX 4OLZL 2F54E 1T20A 2O6DA 4D8OA 4AUUA 2WXIA 3W0WA 2MJWA 4OBRA 2W59A 2VC2H 1IGCL 2QR0A 1SZNA 1JRHH 4Y16C 4LLVA 3WFZA 3R0NA 4R2GB 2PTTB 2EDMA 1WWWX 2QADD 3ETBF 1I3RA 4YHML 4U7SA 2HG5A 5KTEH 4GAYB 5IB2B 3RIAF 5J3HC 3HE6A 2HJKA 3PGFL 4RAVA 4UTCA 3TIDB 3PHSA 1YPZB 2XTJD 3FQRB 3Q13A 1R46A 4OLWH 3NEEA 3V6OA 5ACZA 4M5YL 3L48A 4EUPA 3BVWA 2I5YH 2HPOA 4JRWA 1DCLA 1EJFA 2EDLA 1F6AA 4GLRH 4QTFA 2H2SC 5CEZL 3NGBB 5MEND 4XCYB 4Z7VE 3U82B 5EO0A 3WUZA 3Q1SL 4AIXA 4Z7VF 4QKXB 3LEXA 3D09A 3TBTB 5JXED 4DFHA 4KXBA 2ZCKL 1F3JB 2WP3O 4QGTA 3GM8A 2QHLA 1H3GA 3U4BL 1ZE3H 3RX9A 1Q8MA 2EDXA 2JFCA 2VE6A 2AEPH 3EYSL 5D7JA 4BGDA 2ITCB 4YH6A 1BZOA 2VM4A 4DWHA 3BH9B 4JFFD 4DP6X 5EBLB 5MP6L 3O6FC 2IAAC 5JPNB 1AQKL 1JUFA 1X6LA 2ZOWA 3S35X 2X2UA 3FT0A 3IDIB 3HTLX 1QHPA 4X80L 1ASPA 4M5TA 5DLLA 5KSVA 1DQQA 2F54B 3EH4B 3N43B 1J48A 2O26U 4YDVA 4U1GC 1EFXD 1PZSA 2B9AA 1YG9A 4QD2E 2EYRB 2ZUQC 3GTTA 4L4VA 4OQTL 4XPGL 4HEME 2C3VA 4N68A 2CSPA 4MJ4A 5D71L 4ORZC 2WYZA 3BIKA 4AEHL 3VNYA 1MXDA 2WXHA 4G9DB 3I75A 3V4UH 4PJ6A 1TZAA 3DYPA 3HFML 2PETA 3QEGL 4JG1H 1U9KA 1MFBL 4MHHG 4KJYA 2D7TH 1VZGA 3HCVB 4H2AA 4FQLH 1CE1H 3LKNB 1BLNA 2B4CH 5DHDA 3WNMA 2HUHA 1ECZA 2PKDA 2HT3D 4OY9A 3ZKSD 1L0YA 3SKNA 3QSKB 5BVJA 4Q0XH 5MENA 4ZDHB 1P6AB 5I5RA 4Z7VB 1U8NA 3CBKB 1UH4A 2FYYB 3S3SA 4W70A 4UTBA 3TV3L 4HHAA 4L18A 2UY7A 3QG6B 3EYOA 4ODWB 1PYWB 4HZLB 2FHCA 8CGTA 4Z18A 2GITA 2X2IA 5FKAB 2GT9B 2OMTA 3CXHK 3B1UA 5FW7A 4CN1A 4F15C 2JE8A 4AGNA 1QR1A 4QMEA 1E5AA 5JIPA 4PQXA 1NCBH 4X9GA 3TYGH 2BS9A 2E27H 3D2TA 4MHHI 4JFFA 1Z3GL 3HG0A 3MRRB 5DHVA 2YEVB 1AOZA 3F00A 3NN8B 4ZMOA 2ZXCA 3BOVA 3M1BB 7FABH 3UAAA 4G72B 1B2WH 3VFWA 2BFVL 2UZYA 5AVWB 1EFXA 3GSRB 3X2QB 3PU7A 4LFHG 2YD5A 1XIWD 4GBXD 4HS6B 1GIGL 3G5YB 3MBEA 4LK4A 4XGZA 4KUCF 1RP9A 3RYMA 4WI5A 6FABL 3HNTH 3KH3A 2W0KA 3OG4B 1D5IL 1IFGA 1CGUA 1LD9A 3K6IA 4C55A 2DD8L 2OTPA 4E5XB 1N10A 3C5ZD 3ZT6A 2EIDA 1I4FA 2Y4SA 3AG3B 1QBMH 3K81A 2B2XL 3RAJL 4S0SD 4MMZC 4URTB 3GHPA 4GQQA 1FBIH 4ZO9A 3UH8A 5C0NC 3FYEB 3O2WH 2YMOA 5PCYA 4DERA 5ICZA 4PWFA 4WEBH 1HS6A 1Q94B 3HG1E 1AG6A 1RFDL 2WLZA 1F4YL 1KJ3L 3JVGA 3JWNC 3UAEA 2IQ9L 3VDBA 4R7DB 5DHYB 3VXOA 4CMHB 1MCWM 2BOLA 1P9MC 2PP8A 4R97B 1A4JB 2R69L 1AKJB 3A67H 1SLUA 4NO3A 5FUZL 5LWYH 3GXUB 5ID1B 1H6FA 1KIPA 2D7QA 5EZIL 2F7QA 4ZFQA 5CR1A 1MHEB 5CR8A 2FJFA 2KI6A 2ZXQA 1ZLEA 1IGIL 4U1NB 2A9NH 3KJ4B 1A7OL 2IFFH 4B27A 2OMBA 2Z9TA 2ZKYA 3HFFA 3GXFA 4GP4B 4OD1L 4YPGA 3UCQA 2AXFB 5KN5A 1XIWA 2NY7H 3GEFA 4GBXA 5KS9E 1J5DA 2VXTL 1KB5H 2IMMA 2Y5EA 1E50A 2OXHA 3LD8C 3U2IA 2V5YA 5IJCC 2LR4A 2K6ZA 3O3EA 4N3UA 4NUMA 1QLEL 1VEMA 4HSAC 1OAQL 3LSOA 2CLRB 4FFYH 1BP3B 3U0WL 3PABB 3C5ZA 4P07A 5DVPA 1BBDH 5E08L 3K8LA 2O61A 2C8NA 3UP1A 2NY3B 1VGEH 4LSSL 2HVKB 2FBJH 1SJMA 4WAFA 3W39A 1GR7A 4BCYA 1G6RH 1YECH 1XL6A 5SV3A 4YDLB 2KUTA 2WWKT 2BOBB 3R8QA 4M29A 3VRJB 3HZVA 3PWJB 3HG1B 5JNYA 2UZIL 3HI1A 1VPOH 3X11B 2CO6B 3BSGA 4LBEA 4IRJD 1J8KA 3UABA 5C07D 2X6VA 3L3OB 4TNVK 4M8VA 4E41D 5IMLA 1U8OB 4OCWL 4UM8B 1BEYH 4I5BB 1YEDA 3JT2A 4G43B 43CAB 4CKQA 5GRWA 1H8OA 4FF9A 5KG9B 4TRPH 5GJSH 5DEZA 1JPST 3QJVB 2WO2B 3DOHA 3C5XA 4JDEA 4OZIE 3QDMD 5CS7A 4HKJB 4POYA 2XN9D 5EF2A 5J89A 4OZIF 1TVHB 1FWXA 1EZSA 1WD9A 2BNUB 2VN4A 1Y1UA 3N5AA 3R06A 4H1LA 5F3HB 3RWIB 5FOBB 5KS9B 4DP4X 2J1XA 1WCBA 2G2PA 3CV5A 2EDJA 3U83A 4ORGB 4DVRH 4LLMB 3KPQB 3SYCA 5EOTA 4HOMA 1A8JH 1IM3B 1MEXH 2ZOLB 2BM3A 3QQ3B 4LPCA 3THMH 2C9SA 3FPXA 3M07A 4EZMA 1G7LA 3VAEA 4W9FC 1N19A 1ZPLA 1YYCA 2CRYA 2EIJB 2WWNA 5I66A 5H37A 5H35B 3GK8L 2KLRA 2NT1A 3FN3A 4KJQC 3VXQA 1LK3L 4RAUB 5T5NF 1WVZA 3SDDD 2QKIB 2O6FA 3ILPB 4YC2B 3ZO9A 3REVA 4O2CA 3SYOA 4KJWD 2APXA 3FRPB 4K7PY 5C07A 2WZ6A 3GBNH 4Y5YB 4E41A 1ZK9A 2JI1A 5L9DL 3G08A 35C8L 1T4WA 4C83A 2F15A 4U33A 4XTRD 3KWTA 2ADIA 1U8HB 2AMGA 1SNRA 2Y5TA 5KYNA 2FH6A 1THAA 5EZOH 3UBXI 3UIYA 3QDMA 4OZIB 4LVHC 3MNZB 4J3OC 3V7AG 2XI9A 3VCLB 3OKMB 1E3FA 5EF1A 1DZ0A 4H8HA 1VCAA 1MNNA 5CEYB 1LO0H 4WHTB 4Y19E 5AFAA 4NQXA 2X6UA 5F89B 2FH8A 2FWUA 4HLEA 1BQHA 1AH1A 1JTOA 2NQCA 1QBLL 5IBLC 4JB9H 1ADQA 2R9HD 4JQVC 4QUOA 4AMKH 3NCWA 3IDNA 3K6SA 4KVPA 4JDTH 5DMGD 1DE4A 4XB8A 2CIKB 3L4YA 4TM9A 1K9TA 2EE2A 1FIGL 4GRMB 3KPNA 2C7FA 1URLA 4AM0B 4BDVB 4BKLA 4NN5B 1TTUA 3X14A 4CVZA 5DFWH 3X17A 2XQ0A 5CSZB 2Y07L 3A4AA 3SDDA 4WO4C 4JPKH 3GSXA 2BSRB 1H3PL 1NIFA 1EEYA 4HXBL 2JXMB 3VQLA 4KDWA 3B3IB 1NBZB 1QASA 2XWJA 2ARWA 5D1ZC 8FABA 2A74C 1GZHA 4YVNA 4MA7H 1ED3A 1U8JA 5DFVD 2OJEB 3IKCA 2CO2A 4JPIA 4XH2A 4QXUH 2DQIL 1E27A 4R4BB 3P9WB 4X7SH 4WI2A 5D7EA 4DGIL 3W9DA 3D6GA 3TV8A 4QNPE 1MJJA 4P57B 3ZKXB 5HI5D 2DMHA 4MXWH 3SGDI 4QNPF 3T2QA 4FLOA 3ILDA 5E1HB 1JZ5A 4Y19B 1NKGA 2KS0A 2L7QA 2EECA 3QXDA 4ZPTA 3VFGL 3HI6L 3RIKA 1NBVL 1TTCA 2AXWA 2V5SA 3U0TB 3VACA 2ZUUA 3QUMH 3GRWL 1HCZA 2MPAL 4E9RA 4XX5A 1XEUA 1CLCA 1OW0C 3NIGE 3QIUC 4ZUTB 3BISA 1WUNT 1INEH 5DQDH 2G5BA 1T0MB 3MXWH 2KMWA 1NWOA 2NRDA 3MX0A 3NYKA 4FQCL 4K23H 4L0ZA 1NEUA 2A9DA 1XSJA 2ENQA 2ICEB 4QHKJ 3QRFM 3MBWB 4JFOB 5D1ZI 3EZ8A 1P2CA 3O45A 5I8OL 4LSRL 2GB2A 1I85C 2OL3L 3N04A 5EZLA 2ISDA 3ZKQD 4KDTA 4TOYH 2EUVA 1FNSL 5DR5H 4MLSA 4Q6IC 1I7RA 1W0VA 1I8KA 4OW6A 4F8OA 5AENA 1KLUA 1YAIA 1OSYA 1KGCD 3P73A 5E6YA 4RVBA 1WSST 4PHZA 3K6DA 4L1HA 4ZK8A 4FQHB 3EH3B 2Y6TE 3Q8BA 2W9DH 1FORL 2AVFA 1AGCB 5D1XC 4RZCB 1Y18B 4N2KA 4B97A 3AXIA 3HE7D 5GGTL 1A3LL 1GVIA 1VJSA 2AW2A 2HH0L 5GS0H 1YNLL 3S6CA 4E9VA 4NX0A 2QPUA 2V0AA 1F8TH 4P59H 5IB3A 2F0CA 5ETUB 1N3NB 4RSVA 1OTSC 1MCWW 1HIML 1UGKA 1E6JL 2YAOA 5CSGA 5AVUB 3VUAA 5ANMA 2AQNA 2EDRA 5CFHA 5JR1L 25C8H 3V4VL 5IMOB 3CDGB 3CIAA 2J43A 1GGTA 2MOQA 4RRPA 3E38A 2C7UB 1LM8V 5GZOC 3MFFB 5T3ZE 4YO0A 2MIZA 2DLEA 1IQDA 3NIGB 1HHKA 2CHNA 4HGWA 3MXVH 3BUQA 4XMKH 3WMPA 1GKOA 4BZ2A 1A6ZB 3NJNA 3K1DA 1R34A 1QBBA 4U6YB 3RWEB 1MLBB 4ZAKD 2YZ1A 1TQBC 2XG4A 5EEXA 3HAEB 1AD0A 4LZKA 2X6BA 5DJYA 3AWFA 1Z5LB 4DW2L 4K7PL 2CGYA 4WU7A 2JELL 5DJAA 4LHQB 3RNQA 1IAIM 4KHTL 3B9KD 3IK2A 5EU6D 4N9OB 3KPLB 4KI5E 4BZYA 3P2TA 4YFDB 2ZKWA 2H47C 1BMWA 2EIKB 2HT2D 3TWCL 4D9QD 2ADJA 3RWCB 2CK0H 3RDTB 4HIIB 3WKQA 2DBLH 3HE7A 1D6VH 3EDJA 4YHOL 3EDDA 1HH6B 1JWUB 4AIOA 2ED7A 1YYLL 4ZTPH 5B1JC 4EDWL 1Q1JL 1YQ2A 3WY1A 1KIQA 1T5WA 5KSAB 2ZUXA 3L2MA 3WTUA 2HMIC 3ULVE 4OJFL 4XO4A 1F45A 3KS0H 4IIQC 4JPWL 2EINB 2Y7LA 1YN7A 2WXFA 4F9PA 3ULVF 5DZ9A 1Q0YH 1NOLA 4HWEH 3BO8A 4GKNB 1QO3B 3QQXA 3TF7C 1UENA 1Y1DA 2I25N 1L9RA 4MJ5B 1ZIAA 3PF2A 2VUKA 1JG9A 2H1LM 4POZD 3D25B 3M1OA 3OKDB 1TETH 5E00B 1LEIA 2YC1B 2C26A 4MYWB 3HUJE 4IHBA 2VLMD 1G7MA 3AS1A 5E6IB 1BIIB 5BPPA 3MV11 2FZ3A 4XO9A 4TVSa 3NCYS 4ZMWA 2CWRA 3E2HB 2YXVA 1VEOA 4M3JA 4Q2ZA 1JK9B 4YDJB 3G6DL 4ZAKA 2B0SL 3AS3A 4KZ0A 4L1SA 3ZZQA 4KVNH 5EOCL 4NENB 3N2JA 1TYRA 4AGPA 1FHGA 2HXAA 1UQSA 1TTGA 3P11L 4WO0A 3QG7H 2A9MH 1N6UA 1AKPA 3BN3B 3PGDA 3L7FB 1PY0A 3B9KA 5HJ3A 2FHFA 5EU6A 3OLDA 4PGBA 2DKMA 4YDKL 4CVWA 4LMQI 2FGZA 4L3EA 4UANA 2D3JA 5B39G 2VDNL 4MKTA 3RVWC 2FO4B 2ALWA 1MELA 2DJ4A 3GSWA 5IOPA 2J6EA 4NC2B 2MH4A 2HLAB 4NCDA 1T1WA 4GRWE 5IW1A 3QYMA 2OXGB 1I8LA 3ARFC 5F7DA 3TESA 1AI1L 1P7KB 2YMTA 4GRWF 2O5ZH 2RIKA 1NFIA 3FFDB 4JDZA 1Q0XL 4HC1A 4WI8A 5AZ2L 5C09D 3WIAA 1MRFL 4QAWA 2Y25A 1U58A 3MJGX 4FXLA 4I77H 3RL1A 3I6KB 5IVXE 2ZXEB 1YMHB 4JR9L 4U1MB 3QQDA 3QXVA 2BCMA 3AT8A 4FZEH 4H26B 3DGDA 1UVQA 5JIQA 3GEWB 3FJTA 2GG1A 3RDJA 5DVKA 4NRZA 1ZHLA 1TSHA 4RFEB 4XHQA 3SE9L 2ITDB 3RY6A 2A4CA 4IJTA 2FB4L 1WA2X 1IL1B 2VXQH 4G7RB 3HUJB 5DZOA 3FU5A 4M7LT 4WZ9A 1A2YA 1KBKA 2OZNA 1T1YA 1YLBB 1JWMA 3W2DL 1WZAA 3ARBB 4Y2OB 1C5CH 2BNQD 4OI8A 2OS7A 3W11C 4HOZA 3CFTA 5E8EA 3SGKC 5LN8A 3S2AA 2ZG2A 5FV2A 4LFHD 4MZ3A 1S3RA 4NM8H 5JOEA 2X1PA 1T1ZB 1OHQA 1FVEB 2YAHA 3T2PA 1JNLH 3NJMA 1G94A 2CRMA 4YJZL 2YXFA 4WEMB 2HTLD 2YA1A 3IVKB 3AJ7A 5T5FH 2EIMB 2WB7A 2ZKHL 4NM4L 1T2XA 3OKNA 4DZ8B 7PAZA 2G75A 2WKGA 4IRZA 3NESA 4NO0D 5T33H 3T6XA 4CA4A 5EBGA 4D0BA 4MXQC 5EU4A 3K4DA 4NT6A 4GRWB 3UJIL 3X1GA 3DYMA 5I1DB 1JNJA 3RBSA 4TL4A 1KJVB 2FJUB 4KXZH 5C09A 3A6CH 3RWGB 5KSBE 4LP5A 4YHKL 4XB7A 4MKMA 1MCPH 1VHPA 4XVUC 5KSBF 5IVXB 2AV1B 2DQGL 1JVLA 2ZP0T 3FQTB 2XOTA 3ESUF 1QVOA 2RTTA 1OSZB 3AG4B 1UM4H 3BP7B 2N4IA 1AGFA 2ZIDA 2RFXA 1AMXA 3DIFA 4XC3L 5C0GA 1M2VB 2OMVB 5T3XH 1MQ8A 4AENA 4IBYA 1JWSB 1IT9L 1MVFA 1L0QA 2V2WA 3VE0A 4BZ1H 2ZX5A 1I9JL 1A02N 3IFPA 4WUKL 4WV1B 3IMWA 3K5RA 4H40A 1EO8H 3ARVA 1RLWA 2BNQA 3MUJA 2XWBA 2XX0A 3P4LA 1ZCRA 2K78A 4YXKH 4D94A 4JO5A 1AS8A 2CD0A 4KGJA 3SDCC 4X6DA 5DRNA 1ZT4A 3ZSSA 4KXAA 4NBZB 4NQED 3SE6A 1K3IA 5AG8A 3AFLA 2YUXA 4KO6A 4FQ1H 2CBPA 1KG0A 4JGUA 1NDTA 1OGTB 3O6KL 4ATTA 5BQ7A 5ILTH 4ADIA 1ET5A 4Z3EA 3DBXA 2R23A 2WIMA 5DUBB 2YWZA 4FQXB 3ORJA 4LASL 5EWIL 3NJJA 5D1QC 5IHBA 1L3WA 4NO0A 5KVDH 3NAAL 4FNRA 4G42A 3R18A 2H9GB 2ATKA 1OM9A 3Q43A 4G8IA 4RESB 5DJZA 5CBAA 5IWLA 1TITA 2F53E 4WW2A 4O5LH 4KY2A 1CE6B 1BZ7A 2OJZH 2QMJA 2OYMA 2XCMC 5KBPA 2YSSB 5KSBB 2B3IA 3DX9B 4OZFA 5EOQL 4M8UA 2NR6D 1BMZA 5BRZD 3QUYB 5FIEA 4KKPA 2X41A 3H7BA 2I27N 4PREB 5ENWA 3KW7A 1JOIA 4OKVB 4B60A 3U25A 2YD2A 2NXYB 3LIZH 3OPZL 3QFJE 5D6DC 5L4MA 3D4CA 2D0FA 3UTPE 1P53A 2IV8A 4G6JH 4PTUB 5HHOD 4ZSOE 4IDJL 4AX3A 1DDHB 4UIMA 1J10A 3N1PC 2PXYD 3MJ7A 4AEIH 3F83A 3S36X 1UKTA 5EU7C 3D18A 4GW1A 4N0UA 1TZIB 2XZZA 4NQEA 3I6LE 2LTQC 4PJCA 1G7QA 2E6QA 3BWZA 1SUJA 1KCRH 3NACH 1NDMB 1GCFA 1KULA 1SLWA 2E56A 1TIUA 3SE8L 3QDAA 4Z0XB 1UEYA 2ZONA 1OB1B 3KDPB 3MRDA 2KZBA 4LLQB 4ZRGA 5IIEB 1UYWL 4LVNC 3PWUB 5CJOL 3NH7H 2AANA 1MWOA 3I9GH 4ZZKA 5F7HA 5A43C 1JYNA 4O2FB 3S35H 1G1KA 4OJYA 3RZCA 3DTXB 2F53B 3LV3B 3BP6A 3PUCA 5KBLA 4ENZA 3WFDL 3D0AA 1MHCB 1PG7W 2VC2B 2IALA 3UYPB 1NMBH 4PJ8D 4WUUD 4I0PB 4KKNA 5BRZA 1LEGA 1SXZA 4WJKB 5DQ9B 3T2LA 2FVNA 2K9FB 3TBVB 1F58H 5LAPA 3T1WA 1RZIA 4HKBA 3CFEB 3QFJB 1SMAA 2XN2A 3T2NH 4HIEB 3P4MB 2I26N 1MREH 1ZLWH 5G5DA 3UZEC 3ML9A 2DH2A 4ZSOB 2B08A 1EHAA 5DCCA 4ZW6A 1ZVNA 1BWMA 1A14H 2PXYA 1OL0A 4N2MA 5DEJA 1GYCA 3MYJA 1R3JA 4KPHL 4HFUL 5EEWA 3H2QA 3EZJB 3OR7A 1AXTH 4P0DA 3V4LA 4APQD 3ARDD 4UT7H 4KKBC 4AL8H 1TQVA 1YEFL 3RIAK 4YSOA 3NPZB 2YN5A 3IWVA 1XGZA 3RLSA 5F7NC 1BQRA 3N0PB 3BWAA 3GJEB 3NVQA 4Y2DD 1XTMA 1DVYA 3A4EA 4X7TB 2I60L 4UTBH 4C47A 2VXUH 1Y6NR 3SJVD 2EXYD 4BQ8A 1XF2A 1PMYA 3ILQC 1MHHB 1UWYA 4M3KB 4JFPB 5DVMA 5MEOB 1H8NA 5E4EB 1AAJA 4LSUL 4WU5A 3O2DL 4NN7C 4PJ8A 4OI9A 1C7SA 3WHE0 5HVHB 1M3JA 4FEIA 1I8MB 4TSBL 1LQBC 4Q9QH 1I9EA 3QIBD 5DHVH 2V9RA 3F05A 5AAMA 3P0GB 4BQ6A 2GIYA 2KZKA 2VJ0A 3QJUB 5DD5H 1RZ7L 2APTA 4A7TA 1PQZA 2BZ7A 3BSZH 5ALBH 2QLVB 3F7KA 3UAFA 2WZ5A 3PGCA 3IPBA 3MOAL 3VO0A 3S9DB 5FYJL 3Q2WA 4U6TA 2P1YA 4N5EC 3WN6A 5EEVA 1KCBA 1RJZA 1FL3A 2KHAA 1CFTA 2PYFA 3MUHL 4NJ9L 1KENH 4AOFA 2CR3A 1X5LA 3MLZL 5E8PB 1USQA 3E8UH 3DRTB 2VN7A 2YUVA 3TNMB 2HFEA 3D3VD 1RPKA 4LCIH 4APQA 2Z31B 1CPUA 3ARDA 4UQDA 3V6ZB 3RFZA 1JF1A 3SB3A 1S7WA 4ABQA 4PGCB 2QGDA 5ECGA 2QL1A 4HH9A 4MCYA 3ARGA 5GJTL 1HK6A 1MFMA 4NAQA 2Y9RT 5CCJA 1HOCB 3L2LA 3WN5A 4E9YA 1J9QA 5E7FA 5IQMA 5AW2B 4Y2DA 2QQLH 1LQSR 2A2QT 4JM2D 1ZHKB 2EABA 4PR5A 2VLJD 1XR9B 3CDZA 3ATEA 2QTEA 1KNOB 5DQJA 3SJVA 4Y5XB 1FE8H 3UTTD 4CJ1A 1SYVA 1U30A 4U1HB 2HWZL 4KNQA 1NH6A 3GHBL 4MXVE 4B9KC 2QLYA 5J9PB 2NY1C 2YPLE 3VQ1C 3PP3K 4P5TB 2IWKA 4MXVF 3C09B 1EEZA 5HGHA 2E4TA 3QIBA 1GSMA 4ZMVA 5ITBH 4MDJA 4XCFH 2YK1H 2CJUH 3L5IA 1N59B 4CVXB 1FZKA 3IXAB 2H8PB 2OZ4A 3V0HA 1X7QB 5DMYA 2OP4L 1C12A 4OIBA 3KYKH 2WXRA 1TZHA 3OMAB 4R9HA 3P0YL 1X5MA 1NGZA 2ZUWA 4ODTL 5IV2A 4FZ8H 4G5AA 4JFXA 4AG4H 5BRPA 1KBPA 4MDIA 2XWDA 4XP5L 1FFQA 1EPFA 5T1MA 3N50A 1MCFA 1EERB 1NCJA 5LBSL 5HYQA 3KDMB 4LAQH 3O4LD 2DEYX 1UXWB 4XI5C 4UDTA 4AKQA 4B50A 3K3QA 3VRLE 5C0DA 4PIBA 4B0MM 1G9MC 4GG8B 3VRLF 1G87A 3O3UN 1QFWH 2P5PA 2F74A 3GI8H 1CZ8L 2VLJA 3NCCB 2MCMA 1ZOXA 3HZYA 4R5XA 2PMZA 3UTTA 5DO2C 1QFWM 4OUUB 4KFMA 4WQOA 1SXBA 3MLRL 4HW6A 3HN5A 2YPLB 3ZKMD 3GHEL 3T0AA 1OOAA 3H9SA 4Y1SA 2DBJA 3SD5A 3D69A 3L3JB 4U0RC 4AV0A 4L8BB 1AZRA 3DJ9A 4LDOB 4XXDA 1YY8A 2WCPA 3P77B 5I1EH 2XX1A 4JFQB 4H88H 3ZDYF 1TT6A 2CG9X 5IW3A 2BHFA 4NPYA 4G80B 3PL6B 1PZ3A 1UATA 5IVZB 5AB2A 4BK5C 2DKSA 3GSNL 2AI0L 2X4RA 5D7KE 4KU1A 2K6WA 1CS6A 1VFMA 1WJ3A 1MAMH 3TLRA 2Z34A 4H1LH 4R4FL 4ZFZB 2MNWA 1G6RB 4KGLA 2BVPA 2F8OA 3DIVA 4X9YA 5CD3B 3MRJA 3EYUH 1EZLA 2G5UA 3ATDA 1FN4A 2WV3A 3PJNA 3S98A 3L3IB 3O4LA 4K4KA 1A21A 3OR6B 4Q9RL 4FFWD 3D7PA 3GBEA 5EC1A 3SY0B 5FO9A 5K1NA 3T0DA 4XVJL 5F9AC 3CFCH 2XY2A 3FB8A 5C97A 1G9ML 3WY3A 3BVVA 1BFVL 3WJLA 5H37H 4R2GC 1D5XB 5ID0B 3QNFA 3BDXA 5BOJA 4XBGB 4BA8A 3ULUD 4GUOA 2EIZB 2R29L 3O6LH 1ZLVH 3CLEL 5FYLL 2OM5A 1WFTA 1OD9A 2GJ6E 5IQ9A 1QATA 4UU9B 4YUEH 1MIEL 1P1ZA 1CGSH 4N0CC 3NGBC 2IOOA 3MV9D 1S7VB 3DVNB 4PY8J 1KXTA 2DI8A 5D4IA 1S5HA 3SKMA 3AGVA 2DQFA 4PP1C 4TQEL 5I8EB 1KUMA 4X9FA 3CXFA 3FTVA 1BVLA 1R3KB 2WKOA 4RCAA 3ZTEA 3QA3A 3QEQD 2X7LB 3ZR5A 1O6TA 2VL5A 1ILSA 4KKQA 4OGQC 4GKZA 1B4RA 1NCHA 2BSTB 2V17L 2EEDA 2O5NA 1S7SA 3IDJB 4OLYH 3CPUA 1M1XB 3HG2A 4UYPA 3MHZA 2OK0H 1IE5A 3HPJA 3TWYA 3UO8B 1OWWA 1AY1H 4NZFA 4NSKA 1ADQH 4LQFH 1KGWA 2GK0B 5C7XH 3QO0A 1ZGLA 3QFDB 2OYLA 1O0VA 3F58H 4AIEA 3QH3A 2OTUB 3F84A 1CDGA 4I9XA 4UIKL 4AUYA 1MFDL 5D70H 1BPVA 3MCG1 3MA7B 3SKOB 1OLZA 3UBFA 3OZ9L 2AEOA 2HKHL 5E4OA 4F93B 3FT9A 3PHOA 1XH0A 1AGBB 5FYJU 4ANUA 2G2RB 5L7XL 2N7BA 4YR6B 2NY0B 3U9WA 2J25A 3D48R 4FA7B 1DEEB 3GMOA 5LGHH 2ALAA 2ESVE 2GJ6B 4NPKA 3REWB 4QOKE 4GIAA 5BZZA 1B90A 5HY9B 3X13A 1R5IB 4H8WC 2AQ2A 1AZCA 2F1EA 1ETJA 4ODSL 4QO1B 4A6YL 3VW3L 1GYAA 3L7EA 3EOYG 4ENED 4JLRA 3RPBA 2GTZA 4XPHL 1I1RA 4PI2A 3OHXB 2H5UA 4KAQL 1T83C 4TTDC 2K45A 3WDHA 4KRMB 5BMFL 4P4RB 2FD6L 2NX5E 4Y4KB 2YA2A 4LKXA 4TVPE 3WXWH 4PEEA 4JFZL 1NCCH 3BUIA 2ZX8A 4K3JH 3RVXC 1X9LA 4M1GH 1M71B 1CL7H 3G5WA 5I6KA 1K2DA 1T5XB 2WPGA 4O02A 2O30A 2DMKA 1AE6L 1E28A 2ZOUA 3IJYB 3UPRA 4S1QH 3WELA 3KLAB 2LABA 3TTYA 4HUXA 1S7XA 1UJ3C 1X5ZA 1ONQA 4YSCA 3MA9H 4H20H 3WIIH 1NBYA 1XBRA 1KC5L 1ZTXH 2AKRB 1CIDA 3LCYA 2E7MA 4EN3C 4DESA 4O4YL 4ZFOA 4PRID 3VA6A 1PDKB 2D3NA 1JSYA 1XF5A 2ESVB 4QOKB 5FA4B 2P52A 2JMRA 3LQZA 1D6EA 4H8WL 4YDNA 3EJYC 2FIKB 2GCYB 4XRCB 1MNUH 4F7PA 2GJPA 2OX5B 1AR1D 1JGDA 1XB6A 3QQNA 5AUMB 4OFVA 5HHPA 1NL0H 3P4OA 4NP4L 3FAXA 3NQKA 3LOWA 3EHBB 4OZGA 5F7WC 3CAFA 5FYKD 4E5XG 2XIDA 1J0JA 4ZMLA 5JUEL 3LMJL 2Z92B 4R97C 1EZVY 2NX5B 2AXHA 1WAAE 4OCMC 5CZKA 3IDGB 2OR9H 5MEPB 4GP5B 2LAAA 1ZHNA 5DSCA 2F61A 1WAAF 2CJSA 3N44F 3CZGA 1V27A 3EYVB 1J88A 3ATAA 4N2DA 1ZVHA 2SEBB 3KLHC 5GRXG 2EUWA 5HDWA 1II4E 4HHGA 3AADB 2VWEE 2F2HA 3RWFA 1X5KA 3EO9L 4G6FD 1K4CA 2DQDL 1S9YB 3MDJA 4M6OH 4K0OA 4AZ8B 1PD1A 1YA5A 4HBCH 4HUNB 1NGWB 3VFUB 2HFGH 1FP5A 1WYJA 4GAJH 1T1XB 3CX5J 3A5VA 1T5KA 3Q7JA 5EBMB 1IFHH 2X9XA 4A7UA 1QI5A 2WXMA 4PRDA 3WEMA 4BZ2H 5FX3A 5FOJA 4N6RA 4FQ2H 4JRLA 5D7SL 2J1WA 4PRIA 1MVYA 1KT2B 3CXDL 5HGDA 1FH5H 4XMLL 5KVEH 2A0LD 3X3FH 3UBHA 1KBWA 3CZFB 3DXAE 4YE4H 2G30A 3SDXE 1CD1B 1KYOK 4J27A 1CGXA 3ARUA 4PG9B 3VRIA 3WJMB 3TM6A 1E30A 1N6QL 1YQVL 1IGFH 5CWSB 3QHFL 3SDXF 5FLUA 1HJCA 2XIIA 1AHWA 3JWDC 3KL3A 3MI6A 1E9OB 2HTKD 2WXKA 1BQKA 4YDLC 1N0XH 1EQWA 3RY4A 1RQ5A 3FC8A 4I3GA 5ADPH 2WCGA 4ETQB 1L6PA 2X87A 4X4XA 4N90D 1AOHA 4YSAA 1BDYA 1JFQL 3OKKB 1FLRH 3D1MC 1BF5A 3L3OC 2QSVA 4FMKA 4M7ZC 1OALA 1L7TH 1L9MA 5D7LD 1EVUA 2W88A 3ES6A 3MGTB 1HEZA 1MUJB 5I6NA 2XXFA 3BXNA 4PJGA 2VDOL 2WN2A 5IESH 1TEGA 5C0BA 2N1TE 1NCDH 1SEBA 1JFHA 1CURA 4QPEA 2WVSA 1IGYA 4PRNB 1JNHB 1RURL 2FX7L 5IHHA 3HN8A 1O9ZA 5AYQA 1PJWA 2GUYA 1KN2L 1FLTX 4OD2A 5T8IA 4UAHA 4WIQA 2L8AA 4UQ2A 5TF1H 4MS8D 3CPLB 3STBA 1NCAL 3U6XS 1NINA 3RKDC 3UL4A 2YEZA 3FOMA 2OSXA 2ZP8A 1IEHA 1LP9F 2WYIA 3AMKA 3DXAB 4HEPA 3F6IA 3FH8A 1G7JA 3RPIA 3SDXB 2IADA 1B2YA 3FTYA 5D2NA 2E7BA 5ITFA 3EGDA 4AXWB 1NMCC 1CBJA 4G8EB 1AFVL 3JWDL 1FNEA 4PY7B 1CFSA 4FYTA 1MLCB 2WAQA 1C8PA 3IMUA 1SYSA 4E42B 4HUUB 4HWZA 1AZUA 4OF0A 1I1YA 2J6EH 3JT0A 4NN6C 4EO5A 3HLAA 1BVKB 2COQA 4ZS7L 2D4DA 1E4HA 3GSOB 1AQ8A 3GNML 2PW1A 1AVAA 2VABB 1M53A 4RMRA 5D7LA 1CGTA 2FR4B 1LO2L 2NNAA 3D5OF 3MV7E 4HC1H 4DEWA 1CK0L 4HAKA 3EG9B 4GXFA 5F6HI 3A6BH 3BVDB 3I3BA 1KFAH 4QY8B 1SM3L 5EA0L 2ROYA 3B7RL 3FQNA 3ABMB 5TGBA 1PZBA 4FXKB 4HDIB 2QVFB 5TFSH 2W81C 3FRPG 3LHPH 1IKNA 2OSLB 4NYLA 5DZJA 1X9QA 4UINH 4LLUB 3NSFA 2WSDA 3KCPA 3IGAA 1KBBA 1LO4L 4PP2B 1O9VA 2XZCH 1DBML 1XGUB 4UOZA 2FWLB 2VLKE 4QF1A 2G4GA 4CU7A 2NLJA 4LESA 1ADWA 4WHYH 2HT4D 5A40E 2YAQA 1E3ZA 1ZWIB 3BFQG 3MLSL 3NZHL 4L48A 4PW9A 4LSVL 3QNYA 3ZRFC 1F2QA 2DQEL 2BP8A 1V05A 3MRIA 3TN0A 4YQXH 4NN5C 5CZVL 1GGCH 2VQ1B 5AVQB 1I7UA 4B53A 3PNWB 4LAJH 2CQVA 3EFOA 1XSIA 1TU2B 1FCGA 4O51B 1MRDH 3FPYA 2WUCH 4BSVA 3CC5B 2YQ2A 3SY6A 4Z7OE 2A6IA 1RK0A 4K15A 3VSTA 5KYXA 4IRZH 1OM3H 2XQBL 1J12A 4JJ5B 1MVUA 4OGYH 4NKIL 2IAMD 3P0VL 5DLMH 3V5KA 3FU9A 2R4RH 2XFGB 3ECWA 3MV7B 3TPUA 3B2VL 1NM4A 1RUQH 5T5NG 2Y06H 3TJPA 2MCAA 1P7HL 2AJVH 3FB7A 3QULB 4UUJB 2PW2A 3LN5A 3QXTA 2DZEA 1FFPA 1CVRA 3KHOA 4N26A 1HL4A 2X1WL 1MW2A 1L9SA 1CD0A 2DRUA 5F6IC 2DIJA 2XA8H 3BUYB 1VGKB 4PRHE 3L1OL 3KGTA 3LVTA 4J3SA 1L9TA 1OPGL 2BP0B 4TULH 2VLKB 3LZFH 3V2AR 1P4BH 2VMJA 1QNZH 2WSPA 3GZQA 2H6OA 2X1QA 3IF1B 3SPVA 1FPTH 2EDQA 2M83A 4ANKA 5IFJA 2Q2LA 1WGOA 2X53A 1D9KB 2E3VA 3S5LB 1AMYA 3TVMD 1TVDA 3CFDB 2ARJQ 3HHMA 5A2JH 4M1CD 3JTBA 1Z5YD 1VZIA 4Q7DA 5CLZA 3GO1H 1MHPL 3VMPA 5DU7A 1EUTA 4U1LA 5E5RB 1KGJA 2JQAA 3N9GL 5TPWH 4Z7OB 1J1OH 2CLZA 2FE0A 4KRPD 4XNBA 4D9LH 3QI9C 5F93C 1MJ8H 3CNKA 3NABL 2H6PB 2IAMA 5JW4M 2NDFA 4GI6A 1H5BB 5HI4D 4UQIM 2MKWA 3UZVA 3W0WE 5EV7A 1M05A 5DK2B 3DGGA 1JZEA 3QIWD 3Q6GH 3GB7B 3SZ6A 2DWEB 2MQCA 4YNYA 3BLBA 4OZFH 4AYGA 1UB5B 3ISWA 2ZTBA 5TTRA 4DK3A 3VXTB 4AYSA 4NS0A 3AC0A 4ZMQA 5JDSB 3TA3C 1HESA 1WAEA 5SWZD 5DUPH 4A2HA 3S36H 3Q5YA 2F58L 2X0VA 3C6EA 3DRQA 1A0QH 4OSUH 5E9AA 1UFGA 2W0LA 5EORH 2ENJA 5E4IA 4Y4HD 5M94B 2W0PA 4PRHB 2I9TA 4LOUC 5EUKA 3W57A 4F7CA 2AEWA 3UDWC 4XWOD 1J8HD 3HNSL 2BY3A 4OCNC 2J8UA 2PWHA 3MO1B 5AVSB 5C2BH 4K9JA 4PB9L 1GY1A 3OSKA 3QEUA 4A55A 2JLLA 3GC3A 3E80A 1NCUA 2DLFH 4WHDA 5HVFB 3CLFH 4JZJB 5I16A 2CBTA 4N0FA 4RFOH 2R0LH 4JY6A 1A9BA 2NNFA 3W56A 1WAPA 4HBQA 1FAIH 4XVTL 4LNVA 1RULH 4ZTOH 5JPMA 2PABA 3BH4A 1JHLH 3LH2L 3WGVB 1MFEH 3HS0B 1SJHB 1U8MA 3OAZH 3DJTA 3P4NB 3OZLA 4N25A 2VR9A 4F33A 3OL2A 4ZNCD 4LKCA 3PHQA 4LSPH 3BJLA 1KDJA 2QQNH 4FQIL 4ZMNA 4R5TA 5GGRA 3W0WB 2VDMH 3QIWA 1EDHA 4P23C 1I9RL 1DQLH 3QDGA 4M8QB 2QR0B 3QS3A 4L4VE 2X4SA 4KVCH 4V2CB 5GRVL 1PGRB 4B41A 4LLVB 4M7JL 1UWEL 2CM6A 3TEXA 4QKTA 3HAEG 4J4PC 4QRTA 1T21A 1I3RB 5SWZA 2EIEA 4YSDA 5DUMH 1GC1H 3HE6B 2HJKB 4LCYA 3VI4A 2R83A 2FTAA 5E8DL 4DP1X 2G9KA 5ACZB 4NBYB 4X5PA 4EUPB 5JMOC 2W65A 4QXTB 1HL8A 4Y4HA 3R1GL 1F6AB 4HS8L 3RGBA 3CFQA 2B15A 5AYUL 4FG2A 3GGWB 2ICWA 1CDYA 1HOEA 3LEXB 3MOBH 4XVOA 1I8IA 4XN5A 4W6WB 3WDIA 2E4FA 4M6NL 1KBGL 1ZVSA 1RP8A 4FNLH 1TUPA 2KYIA 4XP9H 3K2UL 3WS3A 4ODUA 2VE6B 5D7JB 1LMKA 5AB1A 1ETZA 2BSSA 1MJ7L 4J8QA 4NC1E 4JFFE 5IW6A 4I3RL 5I71B 2K8QA 1FQ9C 1JUFB 1S5IH 3E6FA 4N20A 4JG9A 3UMTA 2V5MA 1FFNA 2AP2A 5FUOH 3VWJB 5KSVB 1DQQB 2BDNL 1ZDSA 2D9CA 5CFAA 2VRAA 2H1XA 2TRHA 2WQSA 4L8CA 1F1AA 3VXSA 4D8PB 2F54D 1WT5A 4KI5C 4L4VB 2C3VB 4NEHB 3GSUB 4NHCH 2DWTA 1UD2A 3BIKB 2E9IA 2QADB 5EO9A 4MCNA 4RBPH 4FA8A 3G3LA 5I26A 4XMZA 3MJ9A 4PJ9B 3WI9A 3ZTNH 3ESPA 3WEAA 1FFRA 1MAJA 3IDUA 3ULVC 3FO2A 2C9UA 3SKNB 5BVJB 1ZA6A 5FDYA 4LBAA 3MNMA 1U8NB 4XBEH 4P46B 2MCPH 3DURA 4B5EA 3FUNA 1DJWA 4P2OB 3GF8A 4RSYA 4YSUA 4HHAB 4P2RD 2UY7B 3WS6A 5HHXL 5DD0L 1MIML 3BUDA 5IGXH 4E0RA 3DPBB 2X6MA 1OP5H 3D30A 1KCUH 4Y1AA 2YPKA 4OBSA 1QR1B 4NI3A 4UV7H 1F3JA 1NGPH 2VISA 3VX1A 2JJSC 3HHRB 4ZOCA 5GGUA 2NZ9D 2QQKH 3KVDD 4ZXBD 4JFFB 1DBKH 5DHVB 2Z7UA 4MTMA 4FGMA 3D51A 1DBJL 2NYYD 4B7LA 3PP4H 5DRXB 1X44A 2CH8A 5J13B 5EBLA 3EFDL 1BOYA 5JPNA 3VFWB 4RMWA 3F5WA 3HPLB 2M8XA 2R7EA 2JCCA 4P4KD 4JJHA 1WIOA 3VFMB 3D4YA 3MBEB 4K3DH 1EHXA 1XV8A 1NPUA 5BUGA 4FHKA 3FSZA 3Q9PA 4J6IA 3U7WL 5D8JH 3TIEA 1QWHA 2HAZA 5GRUL 3AXHA 3BUTA 2JJWA 4PIRF 5IFAL 1WLHA 1GGBH 2GC7C 2OZ4H 4JRXD 5DD1L 1LD9B 4ERSL 4ZD3H 2AEQH 4KK6D 1HNGA 3UC0H 4AQ8A 4AT6B 4M03A 2XBDA 3ULVL 4WTWA 1FDLH 2FCBA 1LJMA 4BK8A 1RSFA 4YSPA 2A77H 4ONGH 2GIXA 1J5HA 3WDJA 5ICZB 4P2RA 1DVUA 5CINH 4MDRA 4XNUL 3IGLA 1EBAA 1VKXA 2IPKA 5LBGA 5I1LA 1H19A 4HCRA 2JKRM 3QG6A 4ODWA 2VOTA 2YPVH 3TBYA 3VXOB 4N2FA 2GHWB 1F3DJ 3L5XL 3U9PH 2GT9A 3WJJC 3WTYA 4FI6A 4NFBA 3IU4H 4NO3B 4ZXBA 1TYEB 2YXWA 1MZYA 1OE3A 1KIPB 3KM1A 3FCTA 5IY5B 6PCYA 3DLQR 1MCOL 4NNPL 1OARH 3T77A 2Q3AA 4IOIB 1UA6L 3MRRA 4N8CL 4WK2B 1CDUA 3ZHFA 4P2YA 5DS1A 3H85A 3NN8A 5KJ4A 3D05A 5LXGL 4P4KA 4QGYA 1W6LA 4YPGB 3WEXB 1DVSA 3MLTB 3PG2A 5KN5B 4PJ7A 5KSUB 4OFPA 2O72A 5E70A 2N01B 5I73C 1K72A 5JHAA 2Z1PA 2X3CA 4XNZB 4KUCD 1BYNA 4FNTA 4UNUA 4YDMA 4ZW8A 3LPPA 3O3EB 4B0MB 3LEVH 4OZ4A 4BFKA 3CFNA 4JRXA 5DVLA 3LSOB 1S46A 2EH8L 2P48B 3ALWA 2DQJH 3C5ZB 3DSFL 4I8DA 4ZOBA 3WLWD 2IH3B 1QSVA 4CUCA 4FYRA 4EI5A 2YLHA 3E3QC 3HS8A 2XC8A 4JFDD 2EUZA 4V33A 4LEBA 3W39B 1GS6X 3MRLB 2X6CA 5L4FA 1RUAL 3QUYC 5CEXB 2QDWA 1KEMH 4LOFA 2LQRA 2NY3D 3DC0A 2DJSA 5DJDB 4AWJC 3HZVB 1KJ2B 2IDTA 3QPQC 3TYFB 5JNYB 4H5SA 1L0PA 3HI1B 2VW6A 3RPKA 4KK8D 1OAZH 4KK5D 4TPRL 4LSQH 5BUPA 4LBEB 5E99H 5C07E 2JJTC 3CVCA 4GYBA 4WFGE 5EIIA 4KZDH 1A7RL 2H2SD 4CN6A 3IU3A 4FNSA 2CKBL 2CIIA 3B2XA 4R7DA 3ZZ1A 3INUL 32C2A 2CBQA 4Z77B 1YEDB 3MGOB 2X4PA 4HETA 4RX4D 3KW8A 4NERA 4KUZL 2D73A 2VN3A 3IE4A 1MHEA 3ECBA 4CW1A 1AXSA 1KBVA 2OFQA 3QDME 4JDEB 4N28A 2X05A 5I1HL 5JW3L 1RIHL 2YBRB 1KCSL 2NY6B 1Q9WB 1YC8A 4H1LB 3R06B 3WY2A 4P5MA 2E7CA 1WCBB 4HLZH 3ASOB 3ZL4L 2H0EA 4Y8AA 5ALCL 4R0LC 1INDH 1ORQB 4JFYB 3NA9H 4MJJA 4YHZH 4JJOA 5EOTB 4S1RH 3BW9A 1BAFH 5CO1A 5L88L 1G7LB 2E75C 4RDQF 1EMTH 3ARSA 3APCA 1JNNL 3CDCA 1IM3D 4JFDA 4I0PC 5I66B 1LDPH 2J4WH 5DF0A 5T1KB 3M45A 1G1YA 2XIBA 3QUZC 1NEZA 4KO9A 5C7ZA 4H8PA 3WXVH 3NJIA 3VXQB 1MCCA 1DQJA 3LKPA 4R6UA 5CP7A 3BKYH 3UP6A 3F7QA 5MI0B 3REVB 2DLIA 2ED9A 2UX7A 3H3PH 1KPVA 2BOBA 3PWJA 5C07B 2GTWA 1P4IL 1WA0X 1XFPA 3MLVH 1ZXQA 4ABUA 1U95A 3ZHNA 5L0QB 4I3SH 1S7TA 1RIUL 5HXMA 2WXQA 1ROWA 1BFSA 3TT3H 3G08B 3PQYA 3QORB 4HP5A 5DJ0B 3WD5L 4C83B 2ADIB 2EDHA 1NIAA 3PHAA 4RX4A 1YNKL 2Y5TB 1KXQE 4UM8A 3ULUH 4S0TD 5FK9A 4UT6A 3L5WA 4AKPA 1NGQH 1ZE3C 3QJTB 1PZ2A 5IHZB 5JLZA 3QDMB 4XBPA 5KG9A 2Q7NA 3NFSL 3FF8A 2X0WA 3EO1B 4LOEA 2J72A 4UB0L 1SEQL 5DT1H 3BSHA 4NQXB 2CGRH 1WA1X 5HJGA 5D93B 1CU4L 3RP1A 1KJMA 4ETYA 2XDHA 3NIFE 4FQPA 1JRHI 4B7IA 1TVHA 2BNUA 4FP8H 2JV6A 2DI7A 1EDQA 2LT9A 2D0GA 3IDNB 2RMNA 3KPOA 3LNDA 5E4EC 3K6SB 4ORGA 1DE4B 1U3ZA 2CJ3A 3KR3H 4YBLC 2E6JA 3KPQA 4QEGA 4JHWH 2VC2L 1MPAL 1S9VB 3KPNB 2WXOA 1OQXA 4BKLB 1JRHL 5JZ7D 2VZOA 2Y6SC 4YAQA 4CVZB 3V8CA 4GLRI 2VMFA 1H3XA 1JPTL 2NYKA 4MVBC 3W9EA 3ISYA 4HALA 5KTEL 4O02H 3SDDB 3T08A 5JHLH 4UM9A 1QW9A 2Y22A 1EEYB 1I1CA 2B4CC 1DVTA 2Y1VA 2NY5H 4OLWL 4CDGC 2MSPA 4R96A 4FA6A 2I5YL 2QKIA 4QIRA 2XWJB 4DO6A 3ILPA 5D9SA 4A7QA 8FABB 4P2AA 4X5RA 2VZSA 1ED3B 3U6RA 1BQUA 4MD0A 2VM9A 1U8JB 2PO6B 3FRPA 4TUKH 4PJ5A 4JPIB 3KYAA 4HF5H 3N6YA 4MQTB 2HP4A 3CK0H 3I50H 4XH2B 2QVMA 4GAFB 1EEQA 3KGUA 1MI5D 5DJXA 5EF0A 3L17A 1MJJB 2R69A 1XB3A 5DYFA 5FCUH 4YBQD 2AEPL 4W6YB 2DQCH 5A2AA 2VDPB 5GGQH 2X12A 3PXJA 4OZIA 2EXWC 3G5ZA 4ONFH 3QNZB 1NAKH 1HINH 1QEXA 5ANME 5D7HA 3OKMA 3NIFB 4H4NA 2VT0A 3O9WC 4WRLA 5KEZA 5DZNA 4U2YA 2DQHH 5CEYA 3QDJE 5IQLA 1IAOB 3V0EA 5JA9A 1BD2A 4GRLB 4Z9KB 3C09C 3BLPX 3H9YA 3POCA 5JIKA 4MMXC 3M17A 2EXSA 2V2XA 2G5BB 2YMXH 1B88A 1DSFH 3MX0B 2CR0A 3QJFA 2Y2YA 5DZLA 4C56A 3BFWA 4C8XA 1F02I 4L9DA 1G1OA 3TU6A 4U3CA 4UBDD 1VADB 4X7EC 3MUUA 3V4UL 4AM0A 2QSCH 3O45B 2ZYIA 5F0PB 2DM4A 5KVEE 4JG1L 1OTUC 3BKCH 3FBKA 4OU3A 5EZLB 2D7TL 4FG6D 1KLGA 4I1PA 4FQLL 3SYQA 2Q7YB 2B4CL 3QUXC 1I7RB 4GI9A 1W0VB 3K7UA 4PGZA 1I8KB 4OV6F 4TF4A 3VU1A 12E8L 4Q0XL 3UJJH 1KLUB 1A5FH 2VDLH 3IMRA 1ND0A 1XZWA 3PDOA 3HB3D 4KI1A 2H32A 2FNWA 3A6OA 5J1AB 1ZLSH 1A3RH 4MJ2A 4IOSD 1X5IA 2K9UA 2FWSA 1FGNH 1MI5A 4LSTH 3RTQD 1IIIA 2OJEA 4Z23A 3AQZA 4U1KA 4R4BA 4UOQA 2ZSWA 3G6AA 4OIAA 3KL5A 1CDHA 3TYGL 3MRBA 5IB3B 1J9RA 3PIQB 2E27L 1K6QH 2P42B 3V0IA 1NICA 5ANMB 1W2KT 4R83A 3II1A 3DMMD 5J1SC 2VDQH 2HLEB 3LZQA 4FL4B 7FABL 3QDJB 1Q9KA 5FYKH 1B2WL 3OBAA 3T5WA 1AG0A 1EGJA 3DUHA 4LHUD 5CUSH 3UFIA 2JB5H 3QHTC 4FNUA 4YO0B 5HJBA 1IQDB 1HHKB 4HGWB 4WW1A 3U0TA 4MA1B 3T6QC 5IBUB 4XNMB 2FEEI 1G9NH 2Y1ZA 3HNTL 2ODIA 2UX6A 3PAYA 4QRPD 1T89A 4W6XB 5DA0B 4EOWH 2OCFD 4N24A 4KQ0A 2X70B 2PPFA 2XG4B 5G4MA 3SGJC 1JZDC 4RMTA 4JFOA 5DJYB 1QBML 2FEEL 3NTCH 3DROB 3VNZA 2ZOKB 4HUWB 4LP4A 4WU7B 5DJAB 5IBTL 3T4AA 5EU6E 1P6WA 4L3EE 3O2WL 2QMKA 4D9QE 4TSCH 4IOSA 4WEBL