3FQ2A

Azurin c112d/m121f
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALFKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Type Zero Copper Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fq2A00
1MZZA 1BXAA 3GDCA 4BDVB 1NZRA 4DPAX 2EIMB 2UXVA 5F7AA 3NJMA 4YSQA 3ASNB 1GW0A 2B08A 4AKQA 2BWDA 1V10A 1F56A 1AZNA 1FWXA 1GY1A 2DYSB 4JHVA 3QJUB 4YSRA 9PCYA 3S3BB 5I6NA 3ERXA 2EINB 5B7EA 1SDDA 5LDUA 4G71B 2XWZA 1E65A 1J5CA 2J55A 3ASOB 2FT8A 2EILB 2XYBA 3NP4A 4NB7A 2FWLB 1JVLA 4DP1X 3FS9A 2CBPA 3PAZA 4HHGA 5I6PA 2VSMB 1HAWA 2VMJA 2HLEB 3GXUB 1CYXA 1J5DA 3SBPA 1ZDQA 1AR1B 1ZV2A 4YSPA 1ETJA 1NPJA 1RCYA 1JZHA 1NINA 2Q9OA 4YSOA 5F7BA 4W9ZA 2P80A 4HHWA 2E86A 4QKTA 5TK4A 1DYZA 4KNTA 1E5YA 3U25A 4KOCA 1GR7A 1AZUA 3NJHA 2FQFA 1B3IA 1GS6X 2YXVA 1J9RA 3PAVA 3N2JA 2Y1AA 2IDUA 2PPAA 2UX7A 3C75A 5E9NA 1KYAA 1JXFA 3IE9A 1AG6A 3HB3B 3V9CA 4KO7A 1MG2C 2GIMA 3N55A 1NIDA 1PMYA 2ZXWB 3DTUB 4YSSA 3WNIA 3ZIYA 2CCWA 2HZHA 3QJVB 1J9TA 4A67A 3UAAA 3KW7A 1XB8A 2H5UA 1X9RA 2JKWA 2QDWA 4A2EA 1CYWA 3GYRA 1JVOA 2YAOA 1BQRA 5I5JA 4AKPA 4N4YB 3ZDWA 3CG8A 8PAZA 1JZIA 2MRYA 1TEFA 2BZCA 2XX1A 4KO9A 3WKPA 3S8GB 1CURA 3FU8A 1ZIAA 1XMEB 2VW4A 2BP8B 2LLNA 1KV7A 3PAUA 1ZIBA 1CUOA 3ABKB 1A4AA 1A8ZA 4E9SA 2UXTA 3UABA 1GYCA 1IC0A 4DP8X 5I5IA 1PZBA 4M4RB 4AI7A 3ABMB 1KBWA 3BQVA 1BXUA 4ENZA 1TU2A 1AZRA 2OCCB 4A2GA 2HRHA 1NTDA 1ADWA 2I7OA 3OMNB 2J56A 3QJRB 1AS6A 2QPDB 2HX8A 1BEXA 3FU7A 3UACA 1J9SA 1ASPA 5I26A 1KCWA 4DPCX 1AOZA 3EH5B 3CDZA 3NJJA 3PPSA 4TXVB 5B3SB 2XX0A 1SHXA 4KOBA 1PZCA 3FU9A 4GYBA 1CC3A 1E5ZA 2EIJB 3TBCA 3FPXA 2YXWA 2XXGA 3FSAA 3JTBA 2IH9A 4W1TA 3WIAA 5IY5B 3D12B 3NJFA 5D4JA 2BO0A 2X88A 1A3ZA 1NPNA 1JZFA 1KGYE 1AS7A 4PCYA 1WA1X 2FQEA 4JHUA 1TEGA 1KBVA 1BXVA 1L9RA 1SF3A 2XLLA 2XV2A 3UAEA 4UAHA 3WNJA 2XV3A 1SNRA 1RKRA 3UADA 5D4IA 2TSBA 3PLYA 1PLAA 2H3XC 4X4KA 2CUAA 4BWUA 3X1BA 1PAZA 1DZ0A 3HEIB 2IWFA 1E67A 1NIAA 3T6XA 3CVBA 2AZUA 3PXLA 3QJSB 2BP0B 1L9OA 1OCOB 1AG0A 1ASQA 3FT0A 2J57A 2YQBA 2ZWNA 3FYEB 1GY2A 2XVBA 2PPFA 3EF4A 2DV6A 3H56A 2IH8A 2IDFA 4A68A 1JZGA 4YL4A 1NDTA 4YVUA 4YVNA 3IN2A 1PF3A 4KO5A 2Q5BA 4GXFA 3AG1B 1QLEB 4CSPA 1ID2A 3TASA 2PP8A 1ILSA 1AIZA 5AFAA 2VN3A 4FA7B 3MBWB 7PCYA 4HIPA 4N8UA 3OQRA 4YSAA 2DWTA 4G72B 2I7SA 5I6KA 3NJNA 4G70B 2IDTA 1SFDA 1WS8A 4HCFA 2A3TA 4G7QB 4DP0X 4EF3A 1ZDSA 4P5RA 1AANA 2W8CA 2Y69B 1L9SA 1V55B 1KDIA 1XB6A 3CVDA 2DYRB 1BAWA 2HXAA 2YAQA 3NP3A 2OJ1A 1J9QA 4CSZA 1SDDB 1WA2X 2ZONA 4L0PB 2CALA 3IBOA 2R7EA 2BW5A 1ET7A 4DP7X 3UGEA 4GY4A 2WSDA 4M3HA 4UF7C 5AZUA 2HRGA 3FSVA 3NSDA 1M9WA 4GP5B 4PAZA 4KNSA 2IWKA 4P5SA 5I6MA 1JZJA 2X87A 2W88A 2FNWA 3OM3B 3S8FB 1E30A 1NIEA 1X9UA 1WA0X 2VSKB 5B1JA 1JXDA 1WS7A 2UXGA 3T6WA 1KDJA 4QLWA 2YAHA 4JKNA 4F2EA 1EHKB 4YSEA 4GP4B 3MX0B 3NJIA 2XXFA 4K9JA 4FAAB 4E9YA 2YAFA 2AZAA 1OF0A 2XUWA 3S3DB 3FPYA 1IUZA 1FFTB 1M57B 2XU9A 3V9EA 1V54B 2PP9A 1VLXA 4HAKA 2GBAA 3ZX1A 1EZLA 2FT7A 3FQYA 1OCZB 2GC4C 1NWPA 3TBBA 2GI0A 1IBYA 4DP4X 4ZK8A 2RACA 4WKXA 4BXVA 2YAEA 2JFCA 4BDVA 2GB2A 3EH4B 1R1CA 3TA4D 2PPEA 4YSDA 1PCSA 2R7EB 3NYKA 1PLCA 3AG4B 2QPEB 2UX6A 4DPBX 1N70A 4A2HA 3X2QB 4NAJA 3FQ1A 3T71A 1A4CA 2I85A 4RH4A 1L9TA 1AACA 2FQDA 4UANA 1JXGA 1AQ8A 2EIKB 4Q89A 2BW4A 4E9VA 3X1FA 2OV0A 3AG2B 2H47C 3FSWA 1OOWA 4HALA 4AKOA 1ZPUA 1PZAA 1TKWA 1W6LA 2FJSA 3IN0A 1UATA 4AZUA 4DP6X 2IDQA 3CVCA 2GHZA 1I53A 1RZPA 3NJLA 5I6OA 1QHQA 3AY2A 2UXFA 3RYMA 4DP2X 1A4BA 3EH3B 3FU7B 4A2FA 2VM3A 2AVFA 1W6WA 4HCIA 1NIFA 4WTQA 5ANHA 3CDZB 4G7RB 1L9QA 4E9RA 3SBQA 4HCGA 4E9WA 2IWEA 1PNDA 3IEAA 5I5MA 1ASOA 3AZUA 4KNUA 3G5WA 2WO3B 2DWSA 5A7EA 3NJKA 5D4HA 3FSZA 3L45A 5B7FA 1IBZA 6PCYA 1HFUA 4YSCA 2JXMA 4A66A 2AFNA 5EHFA 3ABLB 3T6VA 1JOIA 2QDVA 3DKHA 2TSAA 1XB3A 5AKRA 2QT6A 3DIVA 3JT2A 3QJQB 2ZOOA 3FYIB 3WG7B 2BP8A 3H4HA 3FQ2A 5B1AB 4BWTA 1GS8A 5I6LA 1W8EA 4DP9X 3S3CB 1A65A 1PY0A 4GP8B 1BYPA 5I28A 3OD3A 1OE2A 1ET8A 1AZBA 3SQRA 2N0MA 1BQKA 1PLBA 2BZ7A 3KW8A 3NSCA 4E9QA 3EHBB 4YSTA 5B1BB 1AZCA 1M56B 3WKQA 3NJGA 3AG3B 1OCRB 5B7MA 1FA4A 2BWIA 2DY2A 1SF5A 1MDAA 4BXSV 2IDSA 3NSFA 2AANA 2FTAA 3T9WA 1RZQA 4Q8BA 2VM4A 1JERA 3ABGA 2PP7A 4E9XA 2HX7A 3WI9A 2GC7C 4BWWA 2IAAC 4A2DA 4F7KA 2YARA 1MZYA 2PCFA 4NERA 1SJMA 2PPDA 4HZ1A 1N68A 1PNCA 2VW6A 1BQ5A 1BYOA 2FQGA 3CZUB 3X1NA 3PCYA 1OCCB 1QNIA 3NT0A 2P80D 4F2FA 5TK2A 2YAPA 3AW5A 3X1EA 1OE3A 1T5KA 3H4FA 2FT6A 1SHWA 1URIA 1KCBA 1YLBB 2VW7A 2NRDA 2YAMA 3BVDB 3QPKA 2PLTA 1ET5A 2B3IA 2WO2B 1AAJA 3SBRA 3T6ZA 1NWOA 3OMIB 3QJTB 5FC9A 3X1GA 1SFHA 4BK5C 2HX9A 1OV8A 1GSKA 1OE1A 3OMAB 5B1KA 4MFHA 2J5WA 4YSUA 2BHFA 4G7SB 1IKOP 2GSMB 2BP0A 1GS7A 2CAKA 4DP5X 1AS8A 3NSYA 6PAZA 2PPCA 7PAZA 1ILUA 1HAUA 1MG3C 1JZEA 3ZBMA 2XV0A 4E9TA 4AX3A 3TU6A 1NIBA 1WAEA 5B1JC 1L9PA 1NICA 4KO6A 5PAZA 2MTAA 2CJ3A 2PCYA 5PCYA 3QQXA
chains in the Genus database with same CATH superfamily
4MDJA 2CRYA 1MZZA 2P5WD 5DLML 5I2IB 5HHMD 1C5BL 2YGVA 1IC5L 4TQHA 4ZPTA 4ELMA 2YSSA 3NA4A 4ZD3L 1QSFB 2R2CA 2OMUB 3WSQH 3SYAA 4N68A 3U36B 1USQA 3QJUB 5IIEA 5LGHL 1GKEA 5I6NA 5J13C 3UZVA 2VT0A 1SOSA 2DBJA 2VRKA 4UTAL 2QZ5A 2ODIA 3N44B 5HGAA 3MN8A 4B3VA 3O0RH 2CK0H 4HWEL 5KBLA 4DP1X 1GGUA 1XH2A 2GTZA 4HS8H 1BZ8A 4NQED 2GSGA 3B9AA 3B9EA 3OAYH 2K4AA 5I6PA 4L0YA 5CMAA 1YECH 3KLLA 1NOFA 1W15A 4G9FA 1NPJA 1OIOA 4JPVL 3PGFH 3PP3H 1UD8A 4MNHB 4LOUC 1HNFA 2V5YA 1SOQA 1DBBH 5E2TH 3FTZA 5LLIC 4Q9QH 4LARL 3A47A 1RIVL 3BDYL 3MBEB 5BVPL 1HE7A 4BZ2A 1JPSL 1AD9A 3NJHA 4J2QA 4J5VA 4W6XB 1BREA 3KAAA 4PD4J 2Q6WA 3B8YA 2CKBL 2UX7A 3B1UA 3C75A 3KPOB 3U2IA 3UCRA 5BZDB 4MYWB 5BVJB 4KO7A 3ECWA 3HBZA 3WLBA 3ARYA 2O4EA 2WQVA 5KUKA 4LMQI 3AABA 4GRMB 4RAUB 3BHBA 4HAGA 5DEGB 3TZVB 4WDIA 1ZA6B 2XZQH 4NXSA 5F6HJ 3QC5X 1Q9KA 3WSQL 3O4LD 5I1DB 3G9AB 3AACA 3MLZH 3P9MA 2GK2A 3PJLA 3QR2A 5TPWL 5J6HB 1HNGA 4PB9L 1ZS8A 1RPQA 4MA1B 1JVOA 2CBQA 2FLMA 3HPJA 1NFIA 4PM1A 4ONGH 4LP5A 4J3BA 4CC1A 3ZDWA 3CVHB 5DRWB 3SPIA 4JHWH 3O0RL 1L0XA 2HP4A 3DLQR 3VRIA 4HS8L 3KYNA 2NSQA 5GGSA 5T5FH 3EGSA 4JFXB 1YECL 2VISA 2YXFA 4OJYA 3VVVA 4TL5A 2N4IA 3PGFL 3B3IA 3O81A 5IUSA 2HVKA 2QKIC 3QISA 1DBBL 2ZUSA 4N0CD 5E2TL 4S0HA 4PV9A 4Q9QL 1TZIA 2BIQA 1KENH 2HH0H 1FNHA 1U3HC 2EIZB 2JJUA 1BZ7B 5K9QI 2NLJB 1RD6A 2NY3B 4N28A 1RHHA 2DF3A 1UUSA 1Z6JT 1QLFB 5SV4A 3BP7A 1O7DE 4A37A 5EU6B 3VCLB 1KCWA 1LNUB 2GKIA 4LK4A 4X5QA 5CNHA 3IMWA 4KDTA 1SXBA 5CILH 5DSCA 3QNYB 4RMQA 4HLEA 3V4LA 1UURA 4WKZA 4LPVA 4AWJC 2VZ1A 3MLZL 4HZAA 5DJAB 4IKKA 3WIHH 3U6XS 3C8KB 3FN3A 4LKXA 2E8YA 1TVHA 3BYTA 4UQBA 1P2CA 4G8IA 3FQRA 4ONGL 1I1AC 2LU3A 4U6TA 1VHPA 4DNLA 4JHWL 5DZVA 3HC3H 5F1IB 5AG8A 4J23A 1MLBB 5IQ9A 2KDGA 4ADGA 3WLWD 2XXMB 5J3HD 3MA9L 5KJRH 3DX8A 4M5YL 3WTTA 5T5FL 1AO7B 2TSBA 3VSVA 5CXPA 1N12A 4TNEA 3ELQA 3FCTA 4HG4J 4OJCA 4XX1G 4P3CH 5F6HI 2DIJA 4OFDA 4V1DB 1RJCA 3EUDA 4PJBB 5DU7A 3QH3B 1TF4A 4HOMA 2IWGA 1KENL 2VXUH 1E5AA 1FVCA 2WP3T 4NZRH 4FFWC 1IAMA 1OB1A 2PPFA 3MXWH 2CBOA 3BPLB 2K3HA 4H8PA 3RA7H 4JLRB 2W65A 1QSFD 3JTSA 3LCYA 4I2XB 4LF3A 3OKKB 4XOAA 4ALAH 3E2HC 1I85A 4I7ZC 5ISZE 4OFVA 4Q6IB 4GXFA 1XIWC 3T3MF 1ITCA 1TQBB 2ITEA 2XVGA 4P48A 5C0DA 3HHRB 3IDUA 4P99A 4M7KL 3L4CA 1UEMA 3QUYB 2VDQB 4MVBC 1BP3B 4KKLC 2J1YA 3TONA 4FXKC 1KJ2B 1YC8A 4XBGB 2VL4A 4EIGB 3ZT5A 2V2XA 4HQQH 5KYXA 3PP4H 4AL8L 4OD2A 3S9DB 4MCZB 2A3TA 2ED6A 3C5XA 1XSKA 4KJPD 5J1TC 1HH6B 5E8NB 5CD5D 12E8H 2C3VB 3HC3L 2ZONA 4AV4A 4P49A 2CALA 2EO7A 2GHWB 5KJRL 4P59H 3MBED 2Y23A 2NR6D 2GCYA 4PLJC 1LXMA 5D2LF 1DO5A 3CU1A 4ODVH 1OGAA 3NSDA 5DF0A 3CUPB 5E6ZA 4P3CL 3F6JA 1M6OA 1T21B 4M93C 4QYOA 3M7FB 2BHYA 1E6JH 1EAQA 3KPRA 1UWYA 4IK7A 5SX5K 1CD0A 1B0GA 2VXUL 4U0QB 3T65A 3NZ8B 3BRGC 4CMMB 4NZRL 3TWYA 2A74A 2Q20A 4F2EA 3HZYB 3MXWL 4LVNC 3TZVD 3RA7L 4E9YA 2YAFA 1LO5A 4IBSA 4ALAL 3QHFH 1OF0A 2XUWA 4DWHA 2VMDA 1TJHH 1CXLA 4LLUB 5LBSH 2GQHA 4L8SC 2CLVB 3A23A 3QEGH 5C09B 3D18A 5EC2A 2ICCA 1CXEA 2Y5TB 1HC1A 2HUHA 3GHBH 2VE6B 1GVIA 5FO8B 2GI0A 2PXYC 3QIWC 4FS0A 4R4FH 3UBXI 4JG1H 3DETD 5KAQF 1EGJH 1K5WA 5H94A 5ISZA 4R5XA 5GPRA 4GRWF 3BT2H 5C08A 1JWMB 1QUNB 1U4FA 5FKAB 4HQQL 4X4ZA 3SGDH 3PP4L 4NN7B 5JQIB 2WZAA 3DVGA 2Z4QB 4P8QA 4HETA 4E42A 2WB1A 4JN2B 4PJAF 4S0SD 2G2RA 4IKLA 2FZ3A 3EJSA 4UAOB 12E8L 4YXHH 1INQA 2G9HB 2LLGA 4A39A 4P4KB 1HQRA 3VGDA 3SE3A 2I85A 2IBBA 4P59L 4P5MB 2R15A 4XH2A 3GZOA 1AQHA 4FXGA 1H9VA 3SKOA 2NY3D 4ODVL 2XWBA 1S3KH 3GZKA 3MCLH 1MJJB 2OMZA 2BW4A 5JOFA 1C9SA 3B9VA 4OZGE 5EU6D 2BSSB 3OTTA 4DAGL 3RP1A 3VD5A 3MVSA 1U92B 4DGUA 3CFDA 3FC8A 5A43C 1A8JH 1OB0A 2DB8A 3TJEL 3CIQA 3ARGC 5E1HB 2WLHA 4WF7A 3T3PB 4HIEB 2D7QA 1WD9A 1SJHA 4NQSA 3QHFL 1D9KA 1TJHL 3QUXB 5DJ6A 2DJUA 4HCIA 2DQTH 1NIFA 1JZDC 3GHBL 4UU9B 3TXAA 4D0BA 4FNQA 3I2CH 3IJ9A 1MAJA 2MQ0A 1S7RB 2QGDA 4JG1L 1C08B 1IL1B 5KYYB 1EGJL 4NLHA 3BT2L 4PREA 1EAOA 4EI6B 1DSFH 2R0WL 5ID1B 2EACA 1AO7D 3KBPA 3CSFA 1U42A 3CVHH 1XGUA 4RMBA 2CE6A 4P23D 2WXHA 1LEIB 2K4WA 1JFHA 3GFUA 1QLRB 3FT1A 3T0WA 4YXHL 5T1LB 1WAPA 4ETQA 1URLA 4Y89A 5M94B 2YOCA 5BOPA 4LCYA 1R5VA 5A6LA 2HVBA 3B43A 5IKCA 2Z8RA 3DIVA 4U1HA 1S3KL 4JFDB 1WD8A 2ATAA 3QIUB 1M7IA 5E0QA 1KJ3H 3RJQB 2O6EA 2UZXA 2A38A 3WJJA 3OF6D 2C7FA 2EE6A 4AXWA 3TURA 2RH0A 1YN7A 4I18A 2BS9A 4PVMA 5I28A 1PY9A 4LXFA 2J5LB 4LNRB 3V95A 3D85B 3QUYD 4BQ9A 1KV3A 4OZGA 4XOBA 5KSUA 2R9HD 4B60A 4F1SA 3A22A 4YSTA 4Z95H 1B4JH 5CP7A 3ZIMA 3MUJA 4Q6KA 3V5HA 2DQTL 4OV5A 1BCIA 3VFTA 3IFPA 1SF5A 5HDQH 2EXWC 2AQ2A 2KL6A 1CFVH 3I2CL 1KLFA 1ZGLP 1M3IA 4ZYKA 1FZMB 5AW9B 1XGYL 4GRLA 3VXPB 4B5EA 4ATTA 4EUPG 2LABA 2A6IB 1DSFL 4QRQB 4PRBB 3H1ZA 5HHOA 3RWJB 4ESKA 2PP7A 4ODWB 1QTSA 3CVHL 5HPMA 2NNAB 2OXGA 3AWFA 3EJRA 5GGQH 1JFQH 1W91A 4Z7NF 7CGTA 2PPDA 4HJGB 1EX0A 2KPNA 3DI3B 4RAHA 2JKLA 3OKEA 5GRXG 2VW6A 3X1NA 4XBEH 4LCVA 4DKAA 1EO7A 4AOFA 1IM9B 3LPFA 2YAPA 3AW5A 3X1EA 1CO1A 3GTTA 3LTVA 4GFXA 4PBVC 4U1IB 3OJVC 1XX9C 1A4KA 1ZT1A 5F1NA 4OCLC 1KJ3L 4Q97A 1Y18A 3GS0A 3OV6A 2D7TH 2G3ZA 3RWGB 3KWVA 4F37F 5C09D 3QUKA 3U82B 1I8IA 1OOAA 4OW6A 2KH2B 5FGSA 1PQZA 4X98B 1IKOP 1CVSC 4CVWA 2OW7A 2OQJB 5KOMC 3L3IA 1ZJAA 4HUWA 4QRUB 1MFVA 1O7SA 4FQIH 4Z95L 3GO1H 5EWIH 3WTWA 4OKVB 1ZAGA 3BP6A 3RUGB 2WYTA 5HDQL 4TF4A 3N5AA 1CFVL 1KJ2H 1S9XA 4FMKA 1KPVB 3ZTEA 1RK7A 4NPYB 5GZOD 4NO5A 3QHZH 4EN3B 4JEGB 4P4KD 4WUUD 2FIKB 3APNA 1U2CA 4BDVB 5AL8A 1NCCH 4JKMA 1Z5HA 4Y2DA 5BW7C 1HCFX 3IJEB 3L3JB 4OJFH 2Z93B 5GGQL 1JFQL 4TVSa 3T77B 3GD1C 2DQFA 1W72A 2G0LA 2JNZA 3BAIA 3V4PH 1GPOH 4XBEL 1X5JA 1QTYT 4WCYH 3EJYD 3WNKA 5LDUA 4DOHE 2FATL 4CU6A 2D31B 2X4PA 4WTZG 2HLAB 2ENQA 1OAXH 3IDMB 4FQXC 5AWNH 3TC9A 3H9SE 4KMTH 2FWLB 1JVLA 4H88H 4HAFA 4U3HA 3RVUD 2CR6A 1ES0A 5ESQB 2D7TL 3QUXD 4W4OC 3T4AB 3T5WA 4N26A 3MNZA 1F58H 4GKLA 1J5DA 4Z7VB 4KV5E 1R5IA 1ESOA 1ZV2A 4JZNA 5EA0H 4XZUB 3S5LB 4ZOBA 1LILA 2DEWX 3V4VA 4OFQA 1F0LA 3QDGE 5KSBE 3US0A 4F7PB 1TCRB 1IGJB 4FQIL 4ZS6C 3GO1L 1DEEA 5EWIL 1D5ZA 2VR4A 3SJVE 3BWAB 1F41A 1XD1A 4PJIA 1BIHA 4YAQB 5C92A 1XEDA 1NGXA 4LCCC 2BOBA 4J39A 1T0MA 1T1XA 3QC6X 1URZA 5DI8A 2P8MB 1JXFA 4XP6H 2MFNA 1ZLUK 4YJZL 4QRRE 3QHZL 3CZEA 5T1LD 3HB3B 2PTUA 3CMGA 2Y0SA 1WFOA 2EDEA 1MIML 3QJXA 1R17A 4R7VA 3ESPA 1PZSA 1FZOB 4JFDD 3QIUD 1KGWA 5I73B 3K74B 3FRPA 5T5NG 1UM6H 3L95B 3V4PL 1GPOL 2YEQA 4U2YA 4RRPM 4B50A 3ZL1A 4WCYL 1G43A 1INDH 4WI9A 1YN6A 1VACA 4PCTA 3Q0HA 2X1XR 4PIRF 3L5XH 1OAXL 3P0YH 2DLFL 5TE4L 3GPEA 3D85D 5AWNL 3VFPB 4KMTL 4H88L 2KERA 3DX6B 1ZIAA 4QHMB 4LMQE 1DE4A 4NZUL 4IRSA 1YAZA 1KZQA 1NMAH 4OV6F 1KTLA 4P4RA 2ETWA 1THCA 3BZEB 3BVUA 3ABKB 1F58L 5E9DB 3WTSA 3HKZA 4B9GA 2C9SA 2HVJB 2AJUH 2A9NH 3FB8B 5EA0L 1FFRA 4M02A 5C0EB 3H9SA 4JKLA 4MCNA 1VEMA 3AT8A 4LLQB 1IC0A 2AQ3A 3GGWB 3GRGA 1JTTA 5IJKA 1S9KC 2QQQA 5INDA 1JZ3A 1N59A 1ZXQA 1PZUB 2B0SH 3GPSA 1A6AB 3QJRB 3L3HB 2HX8A 1NCTA 3CN4A 3QDGA 5KSBA 1UD2A 5A2KH 4XP6L 4GSRA 5IJVA 3N40F 3NJJA 1SGKA 1KCKA 4F91B 4Z77B 1SHXA 1G1CA 1QO3B 5EDXA 4N0YH 5JOPE 1IM9D 1B0IA 3GT6A 4JFFB 1WFUA 5IF0A 1N5AB 1CC3A 2FUQA 5AOMA 2VZ3A 3FTUA 2C7UA 3TBCA 2BNRB 2QLVB 5E00A 4QRRA 3NCJH 4I48A 2IH9A 5FM4A 4Y9EA 4G1EA 4RFEB 3KDMB 1UM6L 2PCFB 2YD0A 5GS1B 1YA5A 5DHEA 1INDL 3BXNA 3UGUA 3T1WA 5IWLA 3L5XL 4LBEA 3OL2A 3P0YL 5F7WC 3UTTB 2WXRA 2I07A 1UA3A 2VR7A 4M8QA 2RMNA 3U2JA 3WNJA 1NMAL 4Z3TA 2BIPA 4PSPA 5J12B 4GUPA 1M3JA 3RGVC 5E2JA 2CUAA 1FN4A 4OZHF 3ZUNC 2AJUL 2A9NL 4ZFOB 2F58L 3D0LA 3OKDA 3MO1A 4OCMC 4DKEH 4HUVB 1KG0A 1G7HB 2BIMA 3QJSB 4YDVA 5IV2A 4EN3D 3V0VA 1DDHA 4BFNA 4L37B 4XI5D 3JQOB 4ZUWB 2B0SL 1U91A 3MUZ1 1F6FB 2OX5A 3KYKH 1KBPA 2IH8A 5I0ZA 5EFIB 2A99A 3KPQA 3V7AE 3RLSA 1JZ7A 1DLHB 1IIKA 3K71B 2X9WA 3NUKA 1CLZH 2HLFD 1JPST 1Q9OB 2UVEA 2VLKB 2ATPB 1ZXKA 3WEOA 1OP3K 2WMPA 1WTLA 3WO4C 4MNGE 1AR1C 3W57A 1I8MA 4LLWA 4N8UA 3NCJL 1BOGB 3BP4B 1GGBH 2MNJB 4NT6A 4TUKH 4WV1A 3P4NA 2IDTA 2VXTH 2BFGA 4JPIB 3SGEI 1KEML 2ZX8A 4P5RA 1AANA 2X40A 1KIPB 1J05B 4PHZA 4OD1L 4WI6A 1PG7H 2QVFB 3FQXA 3IBOA 1NLBH 3O3EA 4WJ5B 5IREA 4HFWA 4U1JB 3ZE1E 1ET7A 1NUGA 3CZGA 1JPGA 1FL3A 1GL4B 1ZGLB 1E9QB 4FQQA 4J3TA 1LK3H 2IPUK 2OYKA 3SQBA 1M9WA 3STZA 4PAZA 4DKEL 2WCPA 4NRXB 1K8DA 5HDBE 4GXVH 2LV4A 2ODHA 3D4GA 4JUSA 3HB3D 3RIFF 3HFMH 4GI9A 3MV7B 2K8QA 5B1JA 3CN2A 1RVFH 2BRRH 2OSXA 5CJXA 3UO8B 3LPPA 3U9UA 3MCG1 4ABVA 5BRZE 3KYKL 4N6RB 1A6ZB 1U4EA 2OMVB 4Y16A 3WN5C 4FLQA 1D2PA 2WYZA 4HLZH 2EDLA 5E2UL 1D5RA 4RGMC 5HYJB 3U0WH 2VWEC 3STLB 3V9EA 1V3MA 3G6JE 3KD4A 3RL2B 4XGZB 3CFJA 4YE4H 1DBAH 2F5AH 1JXJA 3MLXL 4X9BA 4F3FA 3DVFA 1MOEA 2EYTA 3WJJC 2H7WA 3NDYE 2VDOB 3D7PA 1JNNH 1GGBL 3HKFA 4KK8C 4TUKL 3SCMA 2YUVA 3CC5B 2XBDA 5BRQA 3ZDXB 4HMEA 5AZ2H 2VXTL 4FCHA 3AG4B 1TYRA 5CWSA 5E9DD 1JUFB 2XN1A 3MJ8B 4MNGA 5E4EB 2E75C 3F62A 2X9YA 3NGBB 5LGJA 1BJ8A 1PG7L 4HS3B 3WUWB 1NLBL 1UKTA 4JCWA 1FNSL 4BFGA 5C9JA 4S0TD 3EJTA 5B38G 3L7FB 1IQWH 4PWEA 5L4JA 1LK3L 4L1HA 1M05B 1QVOA 4TNWF 3DV4B 3QA3B 3CFUA 4GXVL 4P0DA 4PWJA 4RLDA 3K3QA 3HFML 1ZPUA 4OUUB 4UZUA 1RVFL 2BRRL 3QIBC 3GSOA 3N9GH 3BJLA 4HGKC 4BEIA 4O2EA 1KBGH 3O4OC 2Z6FA 1TU2B 1XL6A 2BNRD 4XPAH 5IVOA 4OM0L 3RYMA 1EJ8A 1HQ4A 1A4BA 2F8IA 4LSTH 3U0WL 1FZJB 1E4XI 1TG8A 4JMXA 3AQZA 2NY0B 3QGVA 2D8KA 5BRZA 4YE4L 4D8PA 1DBAL 1KWGA 2F5AL 2F53A 2J8UF 2WKLA 1I7RB 4H8VA 1FFNA 2NXZB 2GSIA 3MQIA 3UTTD 3IXAA 4UILH 3KVDD 3RURA 1JNNL 5CEXA 5IHZA 4DCQA 5DJCA 5E23A 1MVFA 2UZYB 3VRJB 2LTQB 3AREC 5AZ2L 5KVFH 5A7EA 1X3DA 3TEYA 5B7FA 2XHNA 3RWCA 4IRZH 1E8ZA 4JO8A 2FJUB 4MQXD 4PGDB 2IH3A 2W91A 3ZDZE 4RIRB 3ROOA 2NTFA 4GKNA 1T5XB 5T1KA 1AGBA 4R4BA 5JPMA 4M3KB 1CG9A 2F74A 4FX5A 4JFOB 4QXTA 3U4BH 5T3ZE 4K4KA 4AEHH 3WEBA 1IQWL 4QF1B 4XRCB 4IS6B 4Z0XB 1CIUA 3HUJB 1D5XA 2OMTB 3QARA 1K9TA 5EUOF 5F0LB 3S2AA 2BSTA 1XF2A 4RMSA 5E8EA 2BNQB 1ZKAA 5F1KC 2AJ3B 3UBXA 2VLLB 5AVQB 5IBUB 1K4DB 1JDCA 5LHDA 4WFGE 5CN1A 3VG9B 3I75B 1QAWA 3N9GL 3HPLB 1KBGL 1R4XA 2CIKA 1J5OH 4YNYA 2GJ6B 1FAIH 4LGPB 3NSCA 5FGCB 3ARQA 5GISH 1EHXA 3EOYG 1DJWA 3LQZA 1KN4H 2KI6A 4N2HA 3ZTJH 1JWUB 1VF5C 4I77H 3PIQB 1H3GA 4A04A 3VXRD 3UERA 2IDSA 2WAQA 1TCMA 1V3JA 2AANA 2XVLA 5H35A 2PWDA 3DUSB 1QP1A 4FG2A 4IGBA 3T9WA 4DZ8B 4UILL 4HDIB 4F8TA 2EYSB 4L4VA 5K69A 2Y4SA 4B9PA 3UJJH 3CQFA 5GJTH 5KVFL 3G6AA 2HSIA 4LLYA 1TJXA 4IRZL 2HFEA 1IJNA 4N1CA 2DRUA 4PH8A 4ZNEE 1MZYA 5JW5B 25C8H 5TJWK 2K1MA 5DS2A 4HIIA 3O3DA 4C56E 4C54A 5IZ7A 3U4BL 3MV7D 1A14H 1OE3A 4AEHL 4MD0A 3K6OA 2GEEA 3OQ3B 3FRUA 3GRBA 5LB1A 2FEDC 4F15C 3US9A 2DPKA 2XTJC 4HEME 4PJ8A 2DMCA 3QDJA 3LB6D 5GGTH 1U2YA 1RP8A 5J11C 3PABB 5LGYA 5E6IA 5HYJD 4F7CB 3QNZB 4G8EB 1JCVA 1IBBA 4OLVH 1MVYA 2OCJA 4KXZH 2H32A 2E46A 4IHOB 1J8RA 1YUHB 1CCZA 2B3RA 2J3SA 5DT1H 3VVWA 4GIPD 3PWPA 3GMQA 4JJHA 4EOWH 1J5OL 1FAIL 2WTOA 5GISL 1GZPB 4Y4FC 1KN4L 5TD4A 5DFAA 3SPCA 5CBEB 4ZFZB 1Y0LB 4HS6A 4I77L 3VD1A 4KTGA 2FIRT 1EEQA 3HI6H 1NIBA 5FDYA 4UM9B 3W11D 4U1GB 2ZF9A 1IAOB 5LBVA 2PCYA 4BFOA 1WWWX 3DOIA 5PCYA 1DJGA 1AKJB 5HJDA 3NQKA 1I3RA 3UJJL 3GDCA 5GJTL 1H3TA 3PWVA 3ENEA 5I8EB 4F2ME 3MGAA 2YO3A 3D25A 3WJMB 5DJZA 5KBKA 4X7CC 1FVDB 1OT4A 2GITA 3B9KC 25C8L 4N2GA 5L6YH 2NW2A 5HHME 3CBJB 1JF6A 1LL1A 3VMNA 2F7QA 3KDPB 3CZFA 4D9LL 4ELMF 2TRHA 43C9B 3R4DA 2DMKA 3EJQA 4PTUB 3S3BB 4EPSA 2IAMA 1Z9OA 4ZFOL 1A14L 2X89D 1SDDA 3B5HA 2FWOB 4GG8A 4ERSH 2WTRA 2WXKA 5D2NC 1QSEB 1CFTB 4PRNB 1NA8A 4NN6C 4MD4B 3NEXA 5GGTL 1FC2D 3SPGA 4C56A 4D3CH 4FADA 3TVMA 6TAAA 3QQDB 3UAFA 2Y2WA 3H3BC 3SY6A 3WUZA 1PYWB 5HHQB 1XSIA 4OLVL 1IGYA 1U6AH 2HLEB 2JV6A 1W8OA 2NY0D 4HFUH 1ZDQA 3KL0A 3T2OA 2O6CA 1GYAA 4HEMA 5DT1L 4P2RE 2NXZD 2FB4H 4GG6E 5CP3A 4QKTA 3C8HA 4KNTA 1UQSB 3APCA 3I3BA 1CFNB 5F7EL 1ZV9A 1ZLEA 1BVLB 1BPVA 1MFBL 2XFXB 4YR6B 4DSYA 1OSZA 5BRPA 5JORA 3BWSA 2VDOH 3HI6L 5E1AB 2C9UA 4WO4A 4PV1C 3ZE2E 2IC2A 3QQNA 1AZZC 2AXJA 2DD8H 4DN3H 1Q0EA 3VA2C 3DNKA 5IHUL 1H3VA 1OPGH 1ZT7A 2AJXH 2OMBA 2Q76A 4FYTA 3QNFA 1UT9A 3A5VA 4OGQC 3OKMA 4CN6A 3Q5OA 1MHPH 1DVFA 4H4NA 1BQHG 3V0AC 3UX9B 5F3BA 3O3AB 1U8NB 4OIFA 2CG9X 3VI4B 5EU4B 2BNQD 5L6YL 2C9AA 4HV8B 2JXMB 5HDOA 2WWKO 4H5SA 1OWWA 3ATDA 3GXIA 1MY7A 1G5AA 5B39A 3NFPB 3RWHA 3H54A 1P7QB 4ERSL 4JNXA 1JZIA 3KBFA 4AE0A 1X5GA 3HZVA 4D3CL 1ZS2A 3GLDA 5GGRB 2GJ6D 4N0RA 4WWKB 3X13A 3LKSA 2BP8B 3RTQC 3PDOA 3C5SA 1ZIBA 1ED3A 1U6AL 4JGJA 4HFUL 4DVRH 2CLZB 4KVNH 1BLNB 2EVGA 2FB4L 2HG0A 4A7UA 1ZT4B 3CX2A 4AI7A 3ZR6A 4ZQKB 3CH1B 3IDIA 4M61B 3WMQA 5HI5C 2Z91B 4NQEA 5K39B 3OMNB 2E9GA 4P2RA 1RZJC 2OL3A 2L8AA 2VDOL 3ECVA 1SZNA 4A55A 1UXLA 3IVKB 1OAKH 4X9FA 5I26A 3MU3A 4DN3L 2FBOJ 4DPCX 3L6FB 2FR4A 3B7UX 2W81C 1L3WA 3GI9L 1CTOA 2AJXL 4U0RC 5KSAC 1OEZW 1XAKA 3QO0A 4HKXA 4R26H 1MHPL 3N0AA 2BVQB 4DUXA 2DQHH 1N26A 4FG6D 1M7DA 2RFXB 1HJBC 3A3YB 4DK5A 3GRWH 5DYFA 3VM7A 3NJFA 1U8CB 2YUZA 2YBGA 1H0DB 1DUZA 1PVHA 2F7RA 2NYKA 2W95A 1FFOA 4YHIB 4G7YH 5LAXB 5JZ7D 2QGCA 1KCVH 3VQ1C 3VFMA 4GH7B 1H6EA 2AVGA 3WIHA 3MV9E 1F11A 4X80H 4J1UA 2Y7NA 4ISVB 1P53A 1G7MB 4R3SA 4Y9BA 1X6LA 3MCYA 3QZLA 2H3XC 5F44A 4DVRL 2BIOA 5D6DA 1B6UA 4KVNL 1P84K 2V5SA 4HGWB 4K3GA 4UM9D 1E27A 3PXLA 1F1GA 1P4BH 4HKBB 4YFDB 1YEDB 4NKDA 3MRDA 4NQVA 1AKJD 1G7LB 4FNUA 2H1XA 3VG0L 4YO0A 1MH5A 1MHEA 1JMZA 1RULH 1JK9B 4CA4A 3MR9B 2CGZA 3MRRA 4AT6A 1OAKL 4BFIB 1NCJA 1A0QH 4KQ0A 3HCVB 3CFMA 3IDXH 1CXFA 3Q44A 3EO9H 5CR8A 5DHVA 1TTGA 3VFGH 1FNGB 4PW4A 5D1ZD 4CC4A 2Q7NA 4XCEA 3PHAA 3ALPA 4R26L 3SE8H 1NAMH 2DQHL 3PPEA 4HIPA 2CO3A 1I1YB 1QSED 3OQRA 2OJZH 3CCHA 3GRWL 3DK0A 3Q7JA 4MHHG 4O9HH 1SVCP 4K7PH 3PHOA 2JSFA 2C9VA 2WBWB 5GRJH 5CHNA 4J3SA 1F18A 4MMYA 5FX3A 3ZYOA 1D7FA 1S7WA 4G7YL 1U3NA 4B9YA 1W0VB 2M83A 1KCVL 1S9YA 1HN1A 3RQ3A 4N2CA 5A16B 1BQUA 1P4LB 2ZJSH 4X80L 4PP1C 3HRZB 1ACZA 2D3JA 4FEMA 4KTYA 3UGEA 2NPLX 2WSDA 2VDPH 5AZUA 1BZOA 4Z7UE 3S3JA 5LKNA 4N2LA 5GGUB 1FRGH 1IAIM 3MNVA 4KKAC 4N2BA 3RVXC 2Z31A 3ISRA 4JFUA 3DXAB 5HVFB 2GUOB 4PN6A 1IM3A 3T3MB 2W88A 4XN4A 1P4BL 4YHYB 3LKQB 4PYHA 2BWQA 2FECL 4PJDE 4WFEE 3INOA 1XF5A 3PGCA 4YFLF 3SBWA 5A2FA 3R18A 4M29A 5KEZA 4JKPH 2I27N 1RULL 4FAAB 4NJ9H 3E1ZA 2J8OA 1A0QL 1U8IA 1USZA 3IDXL 1LO0H 1RIHH 3EO9L 2QPFA 3VFGL 3LH9A 3QZMA 4J3VA 1SUHA 1VLXA 3Q2WA 4HHAA 1G94A 4TSCH 3SE8L 1P7QD 1QFWI 1NAML 1PAMA 4DP4X 1IQDB 1LO3H 1G0DA 4JPQA 4L0ZA 5I2IA 5DMGD 2HT2D 2OJZL 5LBSA 3RX5A 4WWKD 1UGNA 4O9HL 3TCXA 1DLFL 3WAKA 4K94H 1QSFA 5GRJL 2OMUA 2WZPD 5C0BE 3KLQA 5LO7A 3U36A 1V05A 1EGJA 4UYPA 3HNVH 2X6VA 4LLMB 4G1MB 4APQD 4I13B 4S1QH 2ZJSL 3EYUH 2UWEB 4HK0B 2IBGA 4HCRA 2EE2A 2VDPL 2IDCA 4QD2E 4CJ0A 5SWZB 1FRGL 3ZKND 3X1FA 3T2NH 3AG2B 4DVBB 1U8OB 2Y36H 3RBGA 3FSWA 1YJDL 3DI2B 4CVXB 2IIJA 1TTCA 4MNHA 3L4VA 1RIUH 2V37A 1M9SA 3KH4A 3KPLB 4JKPL 4HPYH 1Y1DA 3MBEA 4GRWB 4KRPB 2NR6A 4PIBA 4FTVB 4LIQH 4XBPA 1LO0L 1RIHL 3TOPA 1C5CH 4YHPB 4PJDA 4AYID 2MQGA 2MHAB 3AQXA 4F93B 3S37H 3TT1H 3ZL4L 3KPOA 4PJAB 5I16B 4FDWA 4TSCL 5BZDA 1KXQE 2BLFA 2GTQA 5E6IC 2VCOA 3ZZQA 4AGPA 3IEAA 5J89A 4J28A 4XWOC 1DQMH 3N40P 1ASOA 4GRMA 4AQ8C 2FHCA 4KNUA 3LIZH 2ROYA 5DEGA 3TZVA 3V52H 1G7QB 1ZA6A 4K94L 1LE9A 3PDDA 1FG9C 3ISWA 4OF7A 5I1DA 4ZOAA 4R7XA 3TO4B 3CU7A 5ANME 3HNVL 2QGBA 3V6BR 4U6VH 4HOZA 2WV3A 1AO7E 3SKNB 5I0VA 4S1QL 3UTZB 3EYUL 3Q2NA 3CVHA 5DRWA 1OTUC 1EFQA 1XB3A 1QI5A 1J8SA 1B0RB 1Z66A 4V1DE 4QTFA 5HVWA 5EUKA 3MRCA 4PJBE 2IBZY 4N90E 3DROB 3ZO9A 4JFXA 3T2NL 2J2ZA 2Y36L 2V3FA 2XQYG 5IR1B 3JV5A 3PUUA 5AOJA 4UQCA 3WNMA 4B6ZA 5G5DB 2XY2A 1RUMH 2EICA 1OQXA 1RIUL 4RGNE 1Z0MA 4I2XE 5AZEH 1ET8A 3ZT6A 3IT8D 1DJZA 4NQDE 1W2KT 4QNPE 1UOVA 1D3CA 4HPYL 2ADGB 1MFAH 4WHYH 2EIZA 3QAQA 1BZ7A 3E1F1 2ICWB 2NLJA 3B83A 4LIQL 4G11A 4OKDA 1AZCA 4CW1B 1C5CL 2CSPA 3NJGA 4OZGF 1QLFA 3SDCC 3F7PC 3TT1L 1M1XB 4IIQC 4MNQB 5EU6A 3VCLA 5F6IB 1LO4H 1LNUA 4UTCA 4Y4KC 2DAVA 1RK0B 1D5IL 2M2DA 2W0LA 4B9CA 3V6FB 4YDLC 1DQML 2VM4A 2PWHA 5A3IC 1XXFC 3LIZL 3V52L 1A2YB 1V5JA 3CBKB 4ETYA 2IOMA 1KXQA 2JLLA 4PPTA 4NO0B 5DJAA 2GY7B 3BC9A 4B9IA 3JVGC 3C8KA 4JDEB 4BSWA 4RFNB 3DXAD 4U6VL 1HZLA 3LQAH 1BGXH 3GBNL 1U8HB 1EXHA 3CZUB 2P80D 3RDTB 5F1IA 4P04A 1MLBA 3QPKA 1MW2A 2G3XA 1JGIA 3AT0A 3L9YA 1AO7A 4KH9A 1TMQA 1NWOA 1X6NA 4LDEB 4H1LH 5MI0B 2Y6SC 1U58B 4V1DA 1XGZA 3HN8A 1RUML 2YRBA 4PJBA 2AXWA 5GZND 1LJMA 2W0PA 3NEEA 3QH3A 1EFXB 4I0PC 1QBMH 5BQ7B 3CDYA 3KGTA 1MFAL 4KVPA 4EQ3A 1GCYA 4JM2F 3GMRB 1ILUA 2NZ9C 3VMPA 5T3XE 3QUZC 2B16A 4JLRA 2IQAB 4I2XA 4YLQT 4Z7NB 3OF6A 2NX5E 4Q6IA 1NGWB 4L5FE 4KJWC 1N5YH 4K7PY 2C9PA 4R4NC 4WEEA 5EMYA 5IP4A 4ZPVB 5E94B 3X12B 2O72A 3QUYA 4L05A 3RWIB 1JV2B 2IOOA 3M1CA 5DEZA 4LOEA 1TLKA 1KJ2A 4LP4A 3H53A 4K2UH 5SWZD 2VUKA 4UQ3B 1NCDH 1WISA 3LEYH 2BWDA 4U4BA 4YWGH 2LLLA 4MCZA 3LQAL 4FQHA 2JQZA 3Q2CA 4GKSB 2RHEA 1HH6A 5E8NA 5D7LB 2BY0A 1ICTA 2C3VA 5KYWB 4Y5YB 1RU9H 3VX0A 1XGQB 1Y6NR 2QADC 5HGGS 2WQXA 4L3EB 2P5EB 4HWZB 4KRPD 3RFZB 2R59A 1QI4A 4FTVD 3C60C 4G6JH 3GXNA 5F2FA 3CUPA 1CI3M 2LHAA 4X7SH 3T3PE 2VH5H 1O6TA 2Y7SA 5E70A 4G42A 3QZNA 3U7WH 1HHJB 2DLEA 1QBML 4HHWA 1SDYA 4CMMA 1GGTA 1JGDB 3PP3K 4NDMB 5C9KA 1MCBA 3HZYA 3L4XA 1T2QH 5SWSB 2X4TB 3K0WA 5IBLD 3P9LA 1UADC 4NPJA 3PJSB 1NCAH 1IO4C 3IWVA 4H2CA 4R7NB 2WIIB 4LLUA 4QAMB 5C0GA 4AL8C 3FTGB 3WELA 3TO4D 3LDBB 1N5YL 2CLVA 5C09A 2F68X 2MTPA 2Y5TA 4QY8B 2VE6A 4OSUH 2XWDA 4U1LB 4DUWA 5FO8A 4L9LA 2DM7A 2QEJA 5CSBA 4XO9A 3VGGA 3D8MA 3ZIYA 1AZVA 3DMMB 3HG1B 5AVRB 4FC3E 5L2JA 1UZ6E 4K2UL 1JWMA 1QUNA 3UAJD 5FKAA 1NCDL 4A67A 4YWGL 1I8LA 1XB8A 2QDWA 5C2UB 2Z4QA 2A6KB 5C0CE 4UQAA 3VXUE 2NNXA 2NW3B 4JN2A 1A6UH 4N9GB 3OSKA 3EJCA 4EUPB 5EF0A 1RU9L 2G9HA 5I5JA 3MLSH 1C5DB 4ZW8A 2EC9U 4P4KA 4WENB 1TEFA 5IEHA 3WKPA 3SO5A 4PI0A 4CC4C 1NBZB 5AB0A 3HZMB 4P5MA 1U2HA 3VE0B 4G6JL 3D9AH 1I3UA 2LLNA 1KV7A 3ECQA 2ZQKA 4NKOB 2P49B 1HWWA 1MJJA 1JHLH 4ALAC 2J6EA 4X7SL 3GXMA 4MNQD 4GRWH 2PR9A 2BSSA 3DHPA 3QZBA 4Y1TA 3U7WL 3KGRA 4HIQA 3T0DA 1U92A 4DP8X 2AV7B 4PI2A 2XWTB 1T2QL 4G6KH 1BBDH 3P4OB 4HIEA 4AYDC 4JFSA 4NKIH 1NCAL 3QUXA 4NO0D 5ITFB 3UEZA 1AGDB 2ICEA 4KV5F 5IMKB 3VM5A 4LHUG 3ROLB 1NBCA 1EHNA 1OARH 4OSUL 5LWYH 4ZMYA 4ACTA 5KSBF 5GGRY 1S7RA 4FI7A 4W68A 1C08A 1IL1A 3N85H 3RDTD 3UIZA 4DIXA 3CX5J 2A77H 2H6UA 4EI6A 5ID1A 4MA7H 5AOIA 1S3RA 4TV3A 5AW1B 3MRKA 1UENA 3D12B 5D4JA 4UM8B 2WLIB 2H26B 1LEIA 3GLEA 1A6UL 1QLRA 2WBJC 2WLMA 3KM1A 5T1LA 2UV3A 1EFXD 2UZIH 4OLXH 2BFVH 4AEFA 2PTTB 4LZKA 2D7PA 3D9AL 4JFDA 4KX9A 1DQKA 4OJAA 2XQBH 3QIUA 3VMOA 1JHLL 3PL6C 3MXVH 3WS3B 2HFFB 1SQ2N 5AOKA 1DZ0A 4LPCA 3GSVB 3MUUA 3V7AG 3CHXA 3FBKA 4HUUB 5C6TH 2RQ8A 3BVXA 3I6GB 2BP0B 4G6KL 4LNRA 5IHLB 1DSWA 3BJ91 3N41F 1CYGA 2X1OA 3MJGX 2FX9H 4NKIL 5I0WA 1ZLWH 4A68A 1CVRA 1UJ3A 4KROC 4IMLB 2BJMH 4YVNA 2MCAA 4D7BA 5EIIG 1OARL 5LWYL 1U3JA 1SRDA 3DIFA 1QLEB 4PR5B 1FZMA 1HSAB 2OFQA 5D7LD 4IJ3C 3N85L 3VXPA 1ILSA 1BIIA 2A77L 4HSQA 5EEWA 4L3ED 2P5ED 1HL9A 1OVZA 2A6IA 3MRBB 4N8PA 4MA7L 4QRQA 2B14A 2Y72A 2DWTA 4C4KO 3LRSA 4Z6AT 2NNAA 3BD3A 5HYSG 3WS6C 3S35H 4JG0H 3ZHDA 4OZHB 4HCFA 4G7QB 4DP0X 4HJGA 5D7EA 3ZOAA 1T2XA 3I02A 4HUMB 5A6IA 3KNBB 5IQOA 4OLXL 2UZIL 3DJZA 4YC2C 3JWNH 1IM9A 2BFVL 4X6BB 5GRVL 5KYNA 3IMBA 4RNRB 3BEWB 4Y4HB 3WFEH 4LSVH 5SWSD 5FF6B 3N0PB 4AJYV 4WK0B 5K9KB 3MXVL 2VQ4A 2CNZA 4UIMB 5FYKH 3GS4A 1E5UI 3KS0J 3RWGA 3EDDA 2CRZA 2JI1A 2DQEH 3VX1A 5C6TL 4JFWA 3H7BB 1A4JB 1AY1H 1NIEA 3S8FB 4X98A 3GMLB 5DQJB 2OQJA 1OAQL 4QRUA 2FX9L 4GP4B 4PJ9B 3DMMD 3HG1D 3T0EC 4L9DA 3UZEA 3TBSB 2FNBA 3BEVB 3NCEB 2BJML 3DETC 4Y5VA 3RUGA 4WVRA 5BJTB 1MLCB 3DTXB 1BM3H 5CEZE 3A67L 2PP9A 3T8VA 1KPVA 4X4YB 1EZLA 4NPYA 4LKCB 5GRZA 4JQIA 5IMLB 4FKHA 5KVGH 4GUOA 2D7MA 4EN3A 2YC1B 4FA6A 5JXEC 2FIKA 3FULA 4E41E 4BDVA 4FTDA 4GEIA 1OLZA 3SYOA 1VADB 4HJ0D 2YGNA 5B8CC 3NZUA 3S35L 3GMNB 4JG0L 3IJEA 4MLIA 4K71B 4URKA 5ITBH 1BQLH 3GUTA 3T77A 1T66D 5EU5B 1GC1H 2XTJE 3AS1A 4ZUSB 1GRWA 3KL3A 3QCTH 5JPNB 5AAWC 1W80A 2ESVB 3QDME 5I30H 3UBGA 3KBHE 5KTEH 2XIBA 2D31A 2HLAA 3IDMA 4LSVL 3WFEL 4MJ6B 1AACA 4LSUH 2EIDA 1GOGA 4QO1A 3FL7A 1QSVA 1WBZA 4W9JC 3L4YA 5FYKL 5ESQA 1JF5A 1HJCA 3T4AA 1VFAA 2HTLC 3II1A 2DQEL 5F7NC 1AC0A 2H47C 3AB0B 1H3XA 1OOWA 3MRFB 1EMTH 3OZKA 5EB9A 3UYOD 4Z7VA 3ESUF 1AY1L 3MKKA 1QKZH 4XZUA 2DKSA 3DTDA 4AZUA 4S10A 3UG5A 2EKJA 5HYQB 3HS8A 3ZE1F 5C3LD 4H8WH 1MHCB 2AK1H 1TCRA 1IGJA 3Q1EA 3D39B 3CDGB 2UXFA 3I6SA 3K2IA 3BWAA 4C4BA 4YAQA 5EEUA 3CZNA 3IDNA 3FU7B 5GRUH 4JFFE 2GJRA 5HDBF 4MX7B 3MRLA 4XCYB 3WFHB 2NZIA 2P8MA 2QJDA 3HI5H 3VTAA 3TNMB 5KVGL 4P23C 2RTTA 4NRYB 4QCIB 1D2OA 2OZ4H 4MAYB 2QPSA 2CA3A 5ITBL 5F9AC 1TSHA 2VN4A 1GC1L 4Y0GA 5D2NE 3RX8A 3G6JF 3X14B 1RSFA 3L95A 3OHMB 3QCTL 5EHFA 3BPLC 4EZKA 5D93B 5I30L 3RWEB 1EZUA 5KTEL 1ZY9A 1II4E 3LPWA 4NUGH 4LSUL 3VFPA 4ZMPA 3DX6A 4QHMA 3SO3B 4LAQH 3F84A 3QR0A 2UY7B 1H5BC 4K55A 3BZEA 3QUYC 1QHOA 4WEMB 4PRIB 1HEHC 5E9DA 1EMTL 3ALWA 2HVJA 1XF1A 3FB8A 5C0EA 4X99B 2J8UB 4LLQA 5DFVD 3P3TA 4H8WL 3F6LA 1ZTMA 4X4ME 2AK1L 3GXFA 1T7XA 3GGWA 2C8NA 4HVBA 4OY9A 3HZKB 1A6AA 5GRUL 3L3HA 2EE0A 2VLKE 2GJZA 4N8VG 3IPEA 4HLJA 2KLRA 2XG4A 3HI5L 2XN9B 3UP6A 1BFSA 4XO5A 3LZFH 4XTRD 4ZZKA 2OZ4L 3QFJB 1MRCH 4JFFA 1N5AA 4Q8BA 4Y2OB 4WAFA 1RZIB 5JHBA 4Y4HD 2AEIT 2BNRA 2AQRA 2Q2EB 5B21A 4RA3A 5D9SB 5EUOB 4UCFA 4BFJA 2GC7C 3RIAK 3KDMA 1BSIA 2PCFA 5GS1A 4PRPB 2I25N 5I71B 1UD3A 3W5NA 3AY4C 4FABH 2MIZA 4AYGA 5DXWA 4OVUA 5IGXL 4DK3A 3I74A 5DC4B 3UTTA 3E80A 2H9GA 2JJSC 1OAYH 1UWEH 3VGFA 1KGCE 2VW7A 4LAQL 1JGUH 4PJ9D 5DQ9B 4ANKA 3TN0A 3MV7E 4NYLB 3ZDZF 4N85A 5D7JB 4ZMZA 2B5IB 3CAFA 3MOQA 4DGVH 4ZFOA 1BQSA 1SEBB 2ATKB 4HUVA 2VN5A 1G7HA 3F8UB 2Z1PA 3VQLA 5GGTA 5B38B 5DGRA 1PSKH 3FCGA 4GINA 4L37A 4XT1C 4ZUWA 5GZOC 1QLEH 1FSKB 3J07A 3EDJA 4AYMC 3L2NA 3VRLE 2ICWJ 5FM5O 4AMKH 1HEZB 4E9TA 2R1XB 1C16A 5EFIA 3TO2B 2ZYRA 2X4QB 1DLHA 1L9PA 4LBAA 3K71A 3MUY1 3EO0A 2ESVD 3P9WB 5J5EA 1J1OH 1EH9A 1Q9OA 1MRCL 2VLKA 2ATPA 2YA0A 5C0DB 2X05A 2VR8A 4F7MB 4UDTB 1OSEA 1RZFH 2R8SH 3O6FB 1BOGA 1QBLH 3BP4A 1F45A 2R56H 3BZFB 3LIUA 3BVNB 1B9ZA 1GW0A 1W8NA 1BW8A 2CJUH 1KTCA 1AZNA 1CL7I 3VFVB 4FABL 5IB4B 4GKZB 3VXMB 1KIPA 3RVUC 1J05A 3D4CA 1GGIH 1U33A 2CUHA 2YJQA 4LDLB 1OAYL 3FU6A 1YHPA 4D0CB 1E65A 2OSLA 1JGUL 4WJ5A 1RZ7H 4OD3H 1IGMH 5CR1A 5AVVB 4U1JA 3D39D 4NB7A 5CSZB 1S7VA 3NRPA 4CGTA 1ZGLA 2PW2B 1KIQB 3SZKC 5F96H 1E9QA 3D09A 4HHGA 4M6NH 4DGVL 1LHZA 1EEUA 4NRXA 1SLUA 4W9FC 1OHZA 4YSPA 4OIBA 3QEQB 1SY6H 2ZICA 3SD5A 3K8KA 3MV7A 1OAJA 3EDEA 1PSKL 2EVFA 4LSSH 1QLEL 3FXIC 4RDBA 4U3CA 3U25A 4MAYD 1EZSA 2X6AA 4MMXB 1A6ZA 4B9JA 4AMKL 1GS6X 2YXVA 2FJHB 1RI8A 3VFUB 5HYJA 5CU5A 3G9VA 1KYAA 4ELMB 1AG6A 3QQ9D 3RL2A 3V9CA 1AGFB 1GMEA 4WWOA 4B9FA 4A6YA 2YKLH 3FZUD 2R8SL 3RI5K 2R56L 3HAEG 4FKKA 2O6DA 3CC5A 5LAPA 3ESOA 2CJUL 3FUEA 4CU7A 3ILQD 4PRID 2QSCH 5C71A 1JUFA 3WIFA 3MJ8A 3ZDYE 4BUQA 4A2EA 3L3OB 4UINH 2GSGB 1GGIL 2HT4C 3HUJE 5C70A 4OCXL 5CMAB 2WVUA 4P9ML 3V7MA 4N4YB 5AW6B 4HS3A 3WUWA 1RZ7L 4OD3L 2HG5B 1FNFA 4P05A 2WXFA 3QP3A 3L7FA 5F96L 1M05A 4M6NL 3GI8H 4HH9B 3IGAB 1BZ9B 1MCKA 5BOJA 4HOWA 2N56A 4D9QD 2ZUQC 3DV4A 3QA3A 5FIEA 5DK0B 1AD9B 1SY6L 4FD0A 1QFHA 4CRPA 2XN9D 3DIDA 4OUUA 2X89A 3D30A 1NDGB 3EF7A 4DETA 4LSSL 3QFJD 4HIJB 1DSYA 2BOCB 2HJFB 2V9RA 1TU2A 4R2GC 3MRIB 2APSA 3WLBB 3LKOB 1ADWA 1JI2A 2V9UA 3VU2A 1HX0A 4Q52A 4NAQA 3LNGA 4ZRGA 3JWOH 4CN4A 5FOBB 3NIGE 1FZJA 2VJXA 4BE6A 5JR1H 5LQBH 3FFOA 3AROA 4FZEH 5B3SB 1J87A 4GG6F 1Z9NA 3VWJA 1I7RA 2XACC 2XX0A 1GGCH 1HHKB 1CD8A 1FYTB 1GOHA 1DTUA 3WTXA 2YKLL 1YEGL 2J73A 2H1PH 3HPJB 2UZYA 4M1CC 3FPXA 3VRJA 5I75C 1L4IA 1IFRA 1I1CA 3JTBA 4W1TA 4ZX3A 1XBDA 2QSCL 1NKGA 2PUQT 3ZE2F 4ANUA 1N4XL 5D7JD 1GMIA 1OW0A 5C0AB 2R27A 5EOTB 4PGDA 5DURB 5DZOA 1PBYA 4RIRA 3ETTA 4Q9CA 5GGVY 3EGSB 1EXGA 4Y9FA 4YIQB 5C1MB 3E9UA 4JFOA 4OH2A 3TJHD 5AD0B 4TQPA 2IG2H 2CLRB 1JF1B 4MMZC 4NRZB 3K6IA 2ARJB 3BCDA 2HVKB 4QF1A 1UXWB 4IS6A 4XRCA 1SNRA 5AW2B 3HUJA 1NL0H 4Z0XA 2OMTA 2Y25A 4EN3C 3IRCA 1TZIB 1PLAA 4YBLB 4NC2B 3Q8AA 2BNQA 4TQ8A 1EUUA 1G6RA 3C6LC 2AJ3A 1T4KB 4XI5C 2VLLA 4ZW6A 3R7QA 1K4DA 3PGDB 1E67A 1P9MA 1RHHB 4QR7A 1XMWA 3EYQC 2MCG1 1MVUA 5EEXA 1U8QB 3I75A 4G80B 3IDYB 3MHZA 3HPLA 4Y2LA 5FO9B 2J57A 3VYNA 4ZAKC 2WLJA 2DWDB 2GJ6A 3O6FD 3ZUCA 2HLFC 4ICXA 3JWOL 1JZGA 4PYGA 5DSCB 5JR1L 5LQBL 1JWUA 2B2XH 3PIQA 4X7TB 2WP3O 4FZEL 5DEFB 3VXMD 1GGCL 2FRGP 4XMZA 4DZ8A 1WP6A 3WKMH 2PP8A 1TVHB 3LRGA 4HXBL 2H1PL 4HDIA 5KVMC 2N7SA 2EYSA 2ED7A 4UNIA 2X53A 3ATFA 1BFTA 3VO0A 3QAZB 4MB5A 2EABA 3CSGA 5L8KB 4XZ4A 3GIVB 3SB3A 4LFHG 2GJJA 5FHBH 3DX8B 4RFOH 1PJWA 5JW5A 2V9QA 1ITBB 1HSBA 3CHOA 1A3RH 1SXCA 4Z1PA 3VJ6B 1NQBA 1QSEE 1TO5A 3QFDA 4BA8A 3QEQD 1UWXH 1JNHA 1V55B 1KDIA 3CVDA 5DZAA 2OJ1A 3O6MH 1JPTH 1XH3A 1SBSH 2IG2L 3TEXA 1BQHB 3EYFB 2VB5A 3L3KB 4MJIE 5IOPB 5E6SB 3EG9B 4N24A 4L3FA 1NL0L 3HB3C 1L6PA 3K6NA 1LTXA 2XZZA 4M62H 4U6XB 3T6QC 2N1KA 4F1ZA 3FOMB 3PABA 3ZR5A 3BUPA 3QWRA 4E5XB 4PW9A 4F7CA 3QNZA 4M7ZC 5I6MA 4MS8D 1OGPA 4IHOA 5I73C 1YUHA 1E30A 3C9NB 1MW1A 2VSKB 3FT3B 5MHSD 1NFKA 1PJ9A 1KTKE 3BH4A 4AIXA 1MJUL 3NJIA 3EOAB 1GZPA 3ZVVA 3IS1X 5CBEA 1I8UA 1Y0LA 4ZFZA 1WWAX 1ZANL 1YNTF 2B2XL 5K1JA 3RZCC 3TLRA 2EZ0C 3L9EA 2WNWA 2YKKA 2VDLB 5I0DA 3ZTDC 5LG6A 4HAKA 4UM9A 5FV2A 4F8NA 5IROD 3WKML 4AITA 1IAOA 3QWQB 1ORSB 2GC4C 5BZWB 3VI4E 2WLYA 1AKJA 2K8MA 4WGWB 3A0OA 2XXCB 2GB2A 2YQ3A 1JJUA 2Z7WA 1WTGT 3BGFB 32C2A 3WJMA 2FVNA 3AS2A 4PWIA 5FHBL 3VAEA 3H6AA 4UQDA 5ID0A 3GLAA 1A3RL 3B37A 3I6LE 5F8QC 4A7VA 3GTVA 43C9A 4PTUA 1JPTL 4BGDA 1SBSL 1YAIA 3TBYB 2FWOA 1CT8B 4QYOB 4XXWA 3REWB 4TVPE 1UZ8B 2QHRL 4IU3B 1DVZA 4M62L 4X5PA 1QSEA 1CFTA 4PRNA 3ZZ1A 4MD4A 2Q7AA 4PWKA 3SDAB 2A74B 1NKRA 2OV0A 1PYWA 2VDNH 4B9KC 4GKOA 1LO5B 4JHBA 3BQUB 4DF9A 3COOA 2ZCKH 1UATA 2FYYA 4Z18A 1JRHL 1VPOH 4RETB 1DVQA 1X5HA 4LLAA 1UQSA 2FHFA 1BOYA 4Z7UF 3CHSA 2QV2A 3B2VH 4LEOB 2X6UA 2XFXA 4MSWB 4YR6A 1GYWA 3WHXB 4DZBB 1HESA 1IZKA 2TAAA 1X9LA 5ISZB 4OI8A 5C0AD 5DURD 3CLEH 4HPOH 4HU2A 5ES4B 5J12C 5G4NA 4PJDF 3V0GA 1CTNA 1QD0A 4MQXC 4B7IA 1MAML 1T7WA 3LMJH 1TTUA 2GIXA 4UB0H 4OCRH 4AG4H 4GO9A 1SYSA 1U8NA 1IBGH 3O3AA 3VI4A 5EU4A 1E8YA 3MJ9H 5IHHA 4HV8A 2JXMA 2Z8VC 3L5IA 3FO1B 1B3JA 1NC4A 2APWA 2Q3XA 2OMZB 3NFPA 4AVKA 3LIZA 2TSAA 3JSSA 3MKGA 3U9WA 3FUIA 3RWFA 3GMOB 1OT2A 1THAA 2Z7YA 4BINA 2K7PA 5IB3B 5G2NA 5GGRA 1F02I 1X4ZA 1GTFA 3EYVB 3CFDB 4WWKA 5A1AA 2BP8A 3NCYP 2RJMA 4AC4A 2Q86B 2VDNL 2OXHB 5HSFA 3KXFE 4LQFH 2WZPA 4DHLA 4N3UA 5I6LA 4NQSB 2CLZA 5EU7C 3DDFA 2ZCKL 1P7HL 1NCIA 1VPOL 5C0NC 2RQEA 4QT5A 4N1EA 1JPFB 2J21A 3H7LA 3UDWC 4HULB 2VXVH 1CF8H 4ZQKA 4B41A 3CH1A 4D0BB 4M61A 2ZUWA 3L4ZA 1OGTB 3ZKMD 4YHNB 1Q9WB 2Z91A 4ODSH 4KUZH 5K39A 5I1IH 2DQJH 3D05A 3IVKA 4FN0A 2MEJB 1NEZB 3CLEL 4HPOL 3GEWB 1ZJBA 3FSOA 2KZKA 4YHOL 3L6FA 3EO1A 3PFQA 3B7YA 5SX4I 1YDPB 4AQZA 1DJXA 5I19H 2H0FA 3LMJL 4AVJA 2BVQA 1JERA 4RAVB 1CU4H 4XPFH 4ETQB 4OCRL 4AG4L 4JFZH 3BIBX 1OALA 4TUUA 1IBGL 1R5VB 1LWJA 3MJ9L 4JQXA 5IKCB 4FCAA 3CZKA 4GSDH 1U8CA 2NQDA 1H0DA 2CJSA 1N68A 3POHA 1WAAE 3LB6C 2X2JA 2F18A 3MV8E 4JANB 4YHIA 2DLGA 5LAXA 1E8XA 4FQJH 5BPPA 2OI9B 1SVZA 2H6PA 4ZW5A 2X2IA 2NRDA 3DXAE 4QHLB 5L8LB 1ET5A 1N8ZB 1G7MA 3OB0H 1F4WH 5HD8D 1NH6A 1QA9A 4LQFL 1FNAA 5HDRA 5CZKA 4BK5C 2J25A 1E90A 1IKNA 2IPUG 4HGWA 3HS0C 3O8XB 4KJQD 2FAUA 5CP7B 2J5WA 3QPQD 1N67A 4YSUA 4HKBA 4JAMB 2VXVL 2ZXGA 1CF8L 1I7TB 3IFPB 2GSMB 1YEDA 4CMHB 1VENA 2CHNA 4LPXA 5TDPB 1G7LA 1KLFB 1L7TH 1MNNA 5IW3A 4PJBF 4ZJ9A 1LMKA 4ODSL 8CGTA 4GRLB 1MFUA 4KUZL 4I88A 1OP9A 3K80A 4ZFGH 5I1IL 2DQJL 1JK9A 3MR9A 1RUQH 2XV0A 5JIDA 5AVUB 4BFIA 4OBRA 1SLVA 3HCVA 3KH3A 3X3FL 1JI1A 5F71A 5HXMA 3EH1A 1UD6A 4L1LA 3N1FC 4M9OA 4QNPF 3O9WC 2A9MH 5I19L 4OZIE 1FFPB 5TQ2H 1J0HA 5HY9B 1CU4L 4JFZL 3FTYA 2AI0H 1KFAH 3LVEA 3SDAD 3DYOA 3OC5A 4WW2B 4GSDL 4AKQA 5EF1A 1TZ8A 1V10A 3IFLH 3RPKA 3K2MC 4UZSA 2UWEE 2JVUA 1ZT1B 3TEZA 3GBLA 1MCNA 5EBWB 4AH2B 1OCWH 2LU7A 1G4MA 3U7YH 3WCYA 1W0VA 1PZ2A 3DX7B 3FB6B 3PWLB 4FQJL 1ODAA 4G71B 5A16A 1I8IB 1P4LA 2EJ1A 3HFFA 2EILB 4DERA 5D1QB 3HRZA 4JM2B 5F88B 4UOZA 1WAAA 4UDUB 1AYOA 1F4WL 2NXZC 5HJ3B 1KN2H 1DP0A 3MV8A 1SQMA 2TRYA 4P5TB 3JBG7 1A7RH 3AMKA 4WK2B 5GGUA 4KGJA 3WO3B 5ISZD 3I50H 4I3GA 3BISA 3UXFA 1CICA 2LTQC 3DXAA 2GUOA 1OK0A 3WMSA 4YSOA 3SPJA 4JM0A 2AMGA 3LKQA 1D5BB 2P80A 4D9RD 3C6SB 5D5MB 5ICZB 1JYNA 2VDLH 3L4TA 2DEYX 4DO4A 1U8MB 4ZFGL 1HI6B 4NO5B 2OS7A 2EUXA 1I4FB 1RUQL 5JNYB 2A9AA 3Q13A 1Z3GH 3LD8B 1J9RA 3F05A 5DCCA 5I1KH 3UYRH 2Y1AA 3K5RA 3ARFC 2VJ8A 5AAMC 5E9NA 1NOLA 2E7BA 2JB5H 4OVVA 4XE5B 5TQ2L 5GZNA 2DQFB 4X4XB 1IQDA 1NGQH 5F7HA 2P42B 4PV8B 2AI0L 3HZ3A 2EEBA 2IXQB 1KFAL 4TLTA 4N8CH 4TTDD 3WTVA 3EFDH 2BNUB 4PY7B 1BG9A 2X4PB 2WXNA 3S5ZA 3IFLL 2VR5A 2JKWA 1BVKB 1X7QB 4GAFB 4ZO7A 2ZSWB 1OCWL 3U7YL 1C8QA 1IARB 4LLMA 4XN8A 3AMLA 5KZCB 2PO6B 2J43A 1R5IB 3W9DB 4JZNB 4KK6C 2UWEA 4KZDL 4HK0A 4JY4A 5EULV 4YN3A 2ORBH 2E9WA 3UPRB 3HHSA 1A7RL 5SWZA 2APVA 3I50L 2O6PA 4JCLA 4F9LA 1EDYA 3A6OA 3AM8C 2ROXA 3T0EE 2D9CA 4DVBA 1U8OA 3BLPX 3NIFE 4CVXA 4ADIA 3DARA 2HPOA 2BY1A 1PEZA 3MJ6A 4NHUA 2Q8BH 4NUMA 3KPLA 1NBYB 4UNUA 1AZRA 1NBVH 3GJFB 1XHHA 2HRHA 2P8PB 4F5CE 1Z3GL 2X0WA 4FTVA 2J56A 5I1KL 2E7DA 4X9GA 3UYRL 3M1BB 4YHPA 4ODTH 3T3PF 1ASPA 2MHAA 5E99H 5E0FA 3LQMA 4DPRA 5I16A 4JG9A 3ORJA 3ARBA 4HJIA 4F58H 6CGTA 4Z3FA 5EEZA 4GPVA 5TGBB 1CZ8H 1NGQL 3FFDB 5HDLA 5I17B 2FH8A 3FCSA 4MAUH 1YN6B 4N8CL 5K33A 4AM0Q 4YZFE 3EFDL 3GLZA 4G2AA 2JI3A 1CLVA 3FSAA 1G7QA 4A2MA 5IY5B 1TQCB 1OK8A 3ES6B 4GAJH 4BFBD 1NFDE 2ZXEB 4HJJH 3NN8B 3TO4A 2VAAB 1YJDC 4HC1H 5I1LB 2VLMD 3WTUA 4RESB 3SKNA 4DOHB 3FBQA 2MPAH 3UTZA 2CHXA 4U7KA 2W0KA 2E7MA 3WEMA 3H9SB 5HYIA 1B0RA 1UZ6F 2ORBL 4P2QB 4YXLH 4GRLD 1VFUA 5D4IA 3UAJA 3IMSA 3THMH 3DROA 2ADJB 3DA0A 2LR4A 2EDXA 4AVHA 3J2PA 1AXSB 4ICWA 3SE6A 5IR1A 3S4SG 4J4PD 1I82A 5DD3H 4XO3A 4KK5D 5G5DA 1ND0B 2Q8BL 3QDGB 1IEHA 2OR9H 5ICXB 3EKCA 1NBVL 1F4XH 2YQBA 3MMEB 5D1ZC 5L2KE 1KLGB 2ADGA 3SJVB 1A7QL 2NNFA 2Y06H 2ICWA 1KXTB 3GB7B 5DHYB 4P46C 4CW1A 2LVEA 4ODTL 4YMPA 4K94C 3LPGA 5I6XB 5E99L 3RKDD 4AQ1C 1M1XA 5E00B 4QRRB 5J6SA 2XOTA 1RK0A 4F58L 2X1PA 2YQGA 4F5CA 3D48R 4JFPB 3MX0A 1LQSR 1IBFA 3V6FA 4MAUL 2LOEA 2ID5A 4FFYH 3K6FA 1HHIB 3CFKB 5D1QD 3EAKA 1A2YA 3QVAA 4JM2D 4G43B 4G72B 2A1WH 2XWCA 3O2VH 4NO0A 4GAJL 5SV3A 4HJJL 1SFDA 4JRLA 4Q6YA 5DZJA 4JDEA 4P2OB 3I9AA 4HC1L 1XB6A 1CJYA 2MPAL 1ML0A 5KVEE 1J9QA 2YZ1A 3Q06A 2L7QA 3RDTA 3CDCA 1KG0B 1RK1B 2BW5A 2R7EA 2VKXA 3N41B 4P07A 1YYMH 4YXLL 3WYRA 5GSRB 5FHAH 3THML 1LK2B 3FSVA 1GW6A 1P7KB 4XOCA 3BUQA 4JRYE 4KNSA 1D7CA 5KWYC 5DD3L 5I1JL 4XNYH 5LN8A 3K8MA 2FNWA 4IRJB 4LU5H 3ZN6A 3MNMA 2YD8A 2B39A 1S7TB 3G7TA 3PE9A 1F4XL 5BQ7A 4Z7OB 1HE8A 3QXAB 2Y06L 4BZ1A 3MLWH 3LEXB 3TV3H 1T20B 2QVTA 4JO2H 4JFYB 1LO2H 2QQLH 1JHKH 5D71H 1R19A 3S3DB 5GRYA 2IQAA 1IUZA 4LLWB 4MYPA 5DMGC 2VERN 3S7GA 2VQTA 1QPKA 4WV1B 4WWKC 1NGWA 1NANI 2O93L 1Q0YH 3KLHC 2ZAIA 5KZCD 2PO6D 4ZPVA 5E94A 2H2SD 4ZK8A 1MCEA 3X12A 4FFYL 1JV2A 2R0LH 2A1WL 4QRPB 4ZX5A 4APQC 3TA4D 3FF7A 3FRPG 2FSDA 2OCFD 2VDKB 3QI9B 4XB3A 3QZOA 3EBHA 3IK2A 3FNKA 3MI6A 3DRTB 1M71B 2EDWA 2EVJA 4A2HA 4GKSA 5K93A 3ZKNC 1EJOH 5TF1H 5D7LA 5CZXD 4Y5YA 1K8DB 1U3ZA 1G9NH 1G7PB 2AJYH 3F3HA 1YYML 3KWTA 1XGQA 3TYGL 4ZMVA 4L3EA 5F0MB 2P5EA 1P4UA 5C0IB 2IV8A 5FHAL 4HWZA 1ZA3B 1JXGA 3I3EA 3RFZA 1RJLB 3BGMB 4K5MA 5HHPB 2DI7A 3T0VA 2XWXA 3R8BB 5JDSB 1YZZA 4OF3A 1QR1B 4XNYL 1LEGB 4H7VA 4LU5L 3DX2A 4AKOA 1AGCB 1PZAA 4JQXC 1HU8A 2L7UA 1FP5A 4NDMA 1JGDA 4JRYA 5I6OA 3TV3L 2ZUYA 1G1OA 1R3KB 3BD4A 4JO2L 2X4TA 2QQLL 3HC2A 1UTDA 4BIKA 1JHKL 5D71L 3ZTCC 1O9WA 4W9KC 1F3JA 3PJSA 4PG2A 4A2FA 2OPCA 2VM3A 3MTRA 1X5IA 1FO0B 2WIIA 2BSEA 3FTGA 3SCMB 4QJ4B 3LQAC 4G7RB 1O5DT 2FJGB 5CGBA 4QY8A 4U1LA 3QORA 4NIYE 1P5UB 3L9RA 4ZW7A 4U1NA 4U1SB 1N0XH 4FXTA 3H9SD 2R0LL 3QFGA 5F72S 2A6JB 3WJLC 3HG1A 4POUB 4PWHA 3AT9A 1VERA 1HHGB 3OLDA 5D4HA 3FSZA 1X5KA 1GA2A 3PQYB 2A6KA 2NW3A 3RY6A 1EJOL 5TF1L 4AJ0A 1LEKB 4EUPA 1N18A 3QDGD 1C5DA 2AJYL 1U8LB 2BVTA 4CGUB 3ZE1B 2WQAA 1NBZA 2L04A 1VCBC 2Y6TE 3HZMA 3SJVD 1NCHA 5HYSB 1J1XH 5F7UA 2XA8H 4HYTB 3VE0A 4QOKE 3WG7B 1M7XA 1Z32X 2ZXDA 3VFOB 2WQWA 4LLDB 1F4AA 5GXBB 3CC1A 4QRRD 1HYSD 4MXWH 4FXLA 1OAUH 5GIRB 1AI1L 4Z7WE 2AV7A 5TE7H 4CNIB 4NUQA 4XPHH 2BZ7A 4FNLH 5IEKB 3JWDH 3P4OA 4NFBA 4E9QA 1W72L 3IXAB 2VL5B 5CEXB 3FMGH 1X4YA 3VD3A 5CGYC 5ITFA 1AGDA 3G6JB 5IMKA 2D7NA 3IMTA 5JIKA 4AYSA 4BXSV 3DX3A 4PS7A 1RJYB 2ADYA 1WFJA 1BEYH 1Q4NX 2CXGA 1N0XL 4XXDB 4XVOA 1JD7A 2NTFB 2APXA 5T1KB 3SPVB 3BPNB 1AGBB 1KTDB 3ABGA 2PW1B 4QXTB 1EERB 2E5EA 3FO9B 4A2LA 5BS0B 3F64A 4R0LC 3ME0B 5AVSB 2WLIA 1L9NA 4IMKC 1XF2B 2BSTB 1HHHB 3OG6B 1PNCA 4WSJA 4IRJD 3UBXB 2QLYA 2X10A 3M07A 3EFOA 4YBQD 5MEPB 2PNDA 3NVQA 2EP6A 1J1XL 2PTTA 2XA8L 4NZ8A 4XMKL 3QCVH 3DURA 4BKSC 1AAJA 2W07B 3DV6B 5JA9A 1TYEB 3WDHA 1XGRB 4YNYB 3WS3A 2HFFA 4MXWL 1OAUL 1NUDA 4BH7B 1ZSHA 3F7KA 3GSVA 3LQZB 4CSTA 2YZ8A 1IFHH 5B1CA 3IJHB 2WIMA 5B1KA 4XPBH 2Q0ZX 4KKQA 4WTZA 1AR2A 3D50A 3DYMA 5D55A 5TE7L 2BP0A 2B1HH 3GNMH 5IVXE 1IGCH 1ZD6A 2NDFA 1AS8A 2NQCA 3JWDL 4FNLL 5H35B 2IF7A 1AVAA 4QIRA 3S97C 4F20A 1KYOK 3FMGL 4E0RB 3QI9D 5IMMB 1Z0NA 3PG2A 3CPLB 2PYEB 1GXEA 4IMLA 1WPCA 2R0ZL 3L7EB 3BKJH 3LH2H 3FN0H 4NP9A 2H0EA 2P3YA 5IFJB 1BEYL 1Q90A 1HSAA 1T83A 2X4NB 3DO4A 4I3RL 5KN5B 2G0KA 1ZE3H 1WRFA 3FQWB 3UC2A 4J6IA 3GQFA 3MRBA 1DQVA 2DM2A 4OZHA 2Q7YB 2CDGA 3LVTA 5DYOB 2DYSB 4PJ8B 4I0CC 4W9CC 4KHTH 4XN2A 4N5ED 1QFOA 1M2OA 4ZUTB 1E4WH 3KNBA 1VZIA 2WN3A 3SGJC 4X6BA 3PV7A 3KR3H 3BPOC 3DGCR 3BEWA 4Y4HA 3QCVL 5FF6A 4XHQA 2EDHA 4M7JH 4ZMNA 5K9KA 3I85A 1GCFA 4UIMA 3WNPA 4Z78B 2XC8A 1IFHL 2P48B 4LT7A 3SCMD 4DGYH 4XPBL 1RCYA 5IBLC 3U30C 3A4EA 3H7BA 1A4JA 4K0OA 4W9ZA 4C57C 2B1HL 3GNML 3GMLA 1IGCL 4N1HB 4YQXH 5DQJA 3VFRB 4C4KT 5DRZB 1RH8A 3EYSH 4PJ9A 4IDJH 4JHAL 1WBXB 3H85A 3TBSA 2J8HA 3PAVA 1A1MB 1I3RB 3BEVA 3W9EB 3WENA 5FECA 1VESA 1UA6H 4J2XA 3BKJL 4MHHI 3LH2L 3VSQA 5BJTA 1MLCA 3DTXA 2CO6B 5DJZB 5KBMA 2BMKB 2VDKH 5C07E 4X4YA 5IMLA 4LKCA 1ZLSH 2GY5A 5E6RB 5KUMA 1AYRA 4WTXA 3GXPA 3CZFB 4TVUA 1YMHB 4Y2NA 3VRLF 4N8VB 1JE6A 1VADA 1JBJA 4EI5A 1W9XA 2F6AA 3GMNA 2WTRB 4ZTOH 2CO7B 2CPUA 4UNVA 4Z5RA 3F5WB 5D6CB 2X4OB 3OR7B 5EU5A 4KHTL 4C56B 3TVMB 1E4WL 1TZGH 5JPNA 2AEPH 4DQOH 4K3JH 3L16A 5EO9B 2ESVA 2FO8A 1OTSD 3KR3L 1MHHA 3U0TB 4KO9A 4GS7C 3MREB 2BZCA 4FHKA 1VGKB 2WKOA 1KBBA 2QKIB 3S8GB 3FU8A 2XYCA 4M7JL 1QYGL 1GAFH 1YPZB 1U3HB 1DJSA 1IBHA 3G08B 3WAJA 4P3DB 4KC3B 2NUPB 1BJ1J 4DGYL 3REVB 1B4TA 2YPLB 4OZFG 4YQXL 2SODB 5HYQA 3SSGA 1XWVA 4RFNC 1MHCA 1QEXA 5T1KD 3EYSL 1CE6B 4IDJL 4WEBH 5DS8A 3RIKA 3KCPB 1IAII 3CDGA 3FN9A 1ZT7B 3DVNB 4DTGH 1JZ4A 4OF8A 1EEYB 4BUGA 1G87A 1QZNA 3HHMA 3GEFA 4X8JA 5BS0D 1TJGH 1UA6L 3OKMB 2I5YH 3CFCH 1TNNA 3FU7A 2KQMA 3QFJE 4UOQA 4XCYA 3UTSE 3E6FB 3WFHA 5F3BB 1AOZA 3T1FB 4PBWD 2VDRB 1WEJH 1LDPH 1ZLSL 1CBVH 1U95B 4X6FB 1PZCA 3FU9A 3JWNC 4QCIA 4NRYA 1BMGA 1I1AB 1N64H 4FFVD 4AK1A 4PRPE 4F2MB 2EIJB 1BPLB 4GW1B 4L1DA 4PQXA 2JK5B 2WOBA 4MD5A 5JHDE 4HEPA 4K9EH 4N22A 4ZTOL 3FHQA 2PWGA 2NSXA 1A6WH 2BO0A 3X14A 1TZGL 3POCA 1EPFA 2AEPL 4DQOL 3L5HA 1KB5A 3IRPX 4K3JL 1CDJA 1UH3A 3LAFA 3RWEA 3DJTA 3CHPA 3GJEB 4B0MB 4B5ZA 2EDKA 3DBSA 2Y7QA 1L9RA 4PU2A 3RZWA 5C2BH 1P4IH 1CGSH 3BDXA 1GAFL 1A9EB 1DVSA 5GRVK 1WT5C 4PGBB 2UY7A 1MQ8A 2FGWH 3E6HA 3NPSC 5B3NA 3ZDYF 2PYED 4XP9H 4PRIA 3HEIB 3LXAA 2GPZA 2OR8A 3HUJF 4X9YA 5DGQA 1IILE 1M7UA 1VAHA 4P2RB 2W60B 1NAKH 4WLCA 4X99A 4GG6B 1ZHKA 2J8UA 3ZHLA 1J0KA 4XR8C 1XIWB 2F61A 4FG0A 3WMPA 4WEBL 1AQKH 2ZWNA 1YMME 5IFHH 4DTGL 2ZUTA 3MRMB 5EOQH 2FYVA 3FAWA 2BSDA 3C12A 3HZKA 5BMFH 1TJGL 1T1ZB 1WUZA 2I5YL 2IDFA 3H56A 1VGEH 1ZLWK 1GC1C 1M7DB 4PJ8D 1WEJL 1LDPL 2XKNB 2ZKMX 5L8JB 5T3ZD 1RLBA 2XN9A 1DQDH 1F90L 1N64L 3A4AA 2N7AA 3B4NA 2WLLB 1BDYA 2M8XA 3QFJA 3IKCB 4Y2OA 1LD9B 5F7YC 4LOUD 5DJ2B 2HMID 1RZIA 1Z9MA 5AB1A 3UTSA 4K9EL 3BPCB 4BFRA 3I6KA 4TTGA 1K85A 2FWSA 2WVSA 1CF1A 3ALXA 5D9SA 5EUOA 1TO4A 1OL0A 3NIGF 4EBQH 3NJNA 4G70B 1A6WL 1F11B 4KU1A 5EH1A 4PRPA 3P3UA 4WFGD 4BKTC 3C5ZB 5KVDE 3PV6B 3RL1B 4M93B 3BLKA 5JW3H 4L1TA 2F0CA 3HAEB 5LVEA 2XA3A 5C2BL 3NRFA 1E27B 1P4IL 3L1OH 4NPKA 4TMPA 3IAPA 3L3DB 3QEQE 5DQ9A 1YC7A 4NKDB 4NQVB 4XHJC 4XP9L 3Q48A 4ZSOE 1KJVB