3FQ2A

Azurin c112d/m121f
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALFKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Type Zero Copper Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fq2A00
3WKPA 2HZHA 1AZUA 4AZUA 2EINB 4P5RA 1M56B 1PLCA 2YXWA 3T6VA 4DP2X 3S3BB 2BP8A 3CDZB 5F7BA 2I85A 3FSAA 1AS6A 3UADA 1A4CA 1RKRA 1UATA 2OV0A 2ZWNA 3MBWB 4E9YA 1AS7A 2OCCB 1ID2A 1J9RA 2CBPA 1PAZA 3NSCA 5I5MA 4A66A 4MFHA 3T6XA 2HX8A 1NTDA 2TSBA 4HCFA 3KW7A 3QQXA 4L0PB 1WA2X 4G70B 5B1JC 3X1GA 1KDIA 1XMEB 2AVFA 2PPCA 4UF7C 4E9VA 2YAOA 2IWFA 1NIFA 3NJGA 2TSAA 2CCWA 4YVNA 3IBOA 1W6LA 3AZUA 2ZOOA 1MZYA 4HHWA 4G7RB 4BDVA 1E30A 1SNRA 4A2GA 1AOZA 3FQYA 2BWIA 1V54B 3PCYA 3ABGA 1HAUA 4AKQA 1R1CA 1L9OA 1PMYA 1KDJA 2BP0B 2QPDB 1I53A 2HLEB 3FSWA 4JHVA 2FT7A 1BQKA 4DP8X 3DKHA 3QJQB 1OF0A 2QPEB 1TKWA 3T9WA 2IWEA 2EIKB 1N70A 2VW7A 1ET8A 1FWXA 2W88A 1F56A 1FFTB 4G7QB 3OD3A 2XV0A 1W6WA 3NJJA 2WSDA 2MRYA 2FWLB 2BW5A 1AR1B 1JXGA 3T6ZA 2VM3A 1OOWA 1JZEA 1FA4A 3N2JA 2ZONA 1JOIA 1V10A 4YSCA 1JZHA 5PCYA 4P5SA 1GY2A 3FU8A 4ZK8A 1PZBA 1OCZB 1GW0A 1L9QA 2BP8B 3UABA 1IKOP 4A2EA 4YSQA 3NSDA 2IDTA 1J9TA 4YVUA 3UAAA 1IC0A 3CVDA 3AY2A 1ET7A 4YSTA 3SBPA 1ZPUA 1NWOA 3CG8A 4BWUA 1GYCA 4F2EA 4BXSV 1BYOA 3AG1B 4G7SB 9PCYA 2PPFA 5I28A 3NT0A 4KO9A 3FYEB 1ASPA 2QDVA 8PAZA 2QT6A 2GC4C 5B1AB 2IDQA 3TASA 2CALA 4DP9X 2EILB 1ADWA 1CC3A 2VMJA 4NB7A 4KOBA 1AZBA 4K9JA 2HRHA 1PZCA 1CYXA 2HXAA 3NJNA 3FQ1A 1WA1X 3OMNB 1PCSA 3FS9A 4E9TA 2ZXWB 4BDVB 5I6OA 2PPEA 1OV8A 1OCRB 2XWZA 5D4HA 4BXVA 3ZBMA 1OE3A 3NJLA 3WIAA 4DPAX 3UACA 1OE2A 2XYBA 2XU9A 1URIA 3OM3B 3NSYA 3HEIB 2YXVA 4YSOA 2FQGA 1ILSA 1QLEB 3ASNB 4KNUA 1BAWA 4M3HA 3H4HA 5B1KA 1WAEA 1JZJA 4YSDA 3DTUB 3L45A 5D4IA 4DP7X 3EH5B 4QKTA 1AAJA 4YSUA 5PAZA 6PAZA 1HFUA 1MDAA 5I5IA 1NIAA 2XXFA 3PAUA 4RH4A 2XLLA 3T71A 4A67A 2W8CA 4HALA 1GR7A 3D12B 3ZIYA 4BWWA 1J5DA 2FJSA 1BQRA 3FU7A 2XX0A 2BZ7A 5AZUA 1KBVA 1SDDA 1CURA 2DY2A 2GHZA 1ASOA 1PNCA 2PP9A 3ABKB 3S8GB 1BXUA 2GIMA 1GS7A 1JVOA 5TK4A 1JZGA 2PCFA 4E9RA 4NERA 1ZV2A 2AANA 3TBCA 1AZRA 3BVDB 3PXLA 3QJTB 3PAZA 4Q8BA 3SBQA 2R7EA 1CYWA 4G71B 2VW6A 1TEGA 2UXTA 1AG0A 1ET5A 3G5WA 3PPSA 3SQRA 5I5JA 3IN0A 1MZZA 1IUZA 2VSMB 5D4JA 1A3ZA 3FU9A 2P80A 4CSZA 2MTAA 4AKPA 3MX0B 5TK2A 3AG4B 1NIBA 2AZUA 4HZ1A 1VLXA 2Q5BA 1RZPA 2BWDA 2GB2A 3TBBA 1AZCA 4PAZA 2BW4A 1SHWA 1OCOB 1WA0X 3QJRB 3N55A 4AX3A 1A4AA 2PP8A 4DP1X 3PLYA 1PLAA 4Q89A 2XUWA 1EHKB 2QDWA 3AW5A 2IAAC 1AANA 3EH3B 2DWTA 4HHGA 5AFAA 1KCWA 2VN3A 2IH9A 2RACA 2GSMB 2XXGA 4HAKA 4W9ZA 2CUAA 5AKRA 1BQ5A 4UANA 2H5UA 1GSKA 1IBZA 1X9UA 1ZDSA 2YQBA 2B08A 4PCYA 1JZIA 2BZCA 2VW4A 3GYRA 2Y69B 4F7KA 2VM4A 3CZUB 4A2HA 1PZAA 4A68A 3FSZA 3U25A 4DP6X 1KCBA 2FNWA 3FU7B 3OMAB 1NICA 2DWSA 4EF3A 2PCYA 2EIJB 2PLTA 2CAKA 1SDDB 4FAAB 3HB3B 1GS8A 1PLBA 1NWPA 2J5WA 4DP0X 3PAVA 4GP8B 1ZIAA 4YSSA 3FPYA 3JT2A 1NZRA 1RZQA 1MG3C 3FQ2A 3IN2A 2WO3B 2YAPA 2R7EB 2GBAA 4X4KA 2FT6A 4KO5A 2FT8A 2FTAA 3AG2B 3ZX1A 1NDTA 4YSRA 4UAHA 1MG2C 4KNSA 2UXGA 3IE9A 5B7FA 1SFHA 3EH4B 1N68A 4KO6A 1E5ZA 1PY0A 5B1JA 3TA4D 5I6NA 5F7AA 4GP5B 1RCYA 2XX1A 1KGYE 2YAEA 2FQEA 2X88A 3NJIA 3RYMA 4FA7B 5I6KA 2JKWA 2Q9OA 3ERXA 1GY1A 1NPNA 2X87A 1AG6A 2YAMA 1NIDA 5A7EA 4BWTA 3FSVA 1ZIBA 2J55A 1DZ0A 3WNIA 3BQVA 3NJHA 3WI9A 5EHFA 1BXVA 1AACA 2UXVA 1AIZA 1JZFA 1QNIA 2IDUA 4KO7A 2YAQA 1XB6A 2I7OA 3QJUB 1A8ZA 4W1TA 1JERA 2HX9A 2NRDA 5B7EA 4AI7A 1QHQA 3TU6A 1L9RA 3OMIB 1J9QA 4HIPA 4KNTA 4E9WA 3IEAA 1ZDQA 2BHFA 2H47C 2PPDA 4GP4B 4TXVB 4A2DA 3ABLB 4N4YB 3AG3B 4DP5X 1SF3A 3ASOB 1NIEA 5E9NA 1E67A 4GXFA 2P80D 2WO2B 3EHBB 3C75A 3S8FB 2IDSA 3UAEA 3SBRA 3NJFA 1TEFA 1BXAA 1SFDA 1L9TA 1HAWA 2JFCA 4KOCA 2IH8A 3UGEA 3CVCA 2IDFA 5IY5B 2FQDA 4HCIA 2J56A 1OCCB 3S3CB 4N8UA 4E9QA 4GYBA 4YL4A 5I6MA 3X1BA 4JHUA 4YSAA 2BO0A 3GDCA 2PP7A 1AZNA 1WS7A 3EF4A 4QLWA 3KW8A 1ASQA 1KBWA 4E9XA 3ZDWA 1JXFA 2PPAA 2J57A 4CSPA 1SHXA 3X2QB 4F2FA 5I6LA 1JXDA 2XV2A 3FPXA 2N0MA 1GS6X 1PF3A 1L9SA 5I26A 1ETJA 1A4BA 1NPJA 4DP4X 2I7SA 1YLBB 2LLNA 2OJ1A 2UXFA 1XB8A 3WNJA 4DPCX 1A65A 3NP4A 2GC7C 1IBYA 4M4RB 1SF5A 1BYPA 3H4FA 4E9SA 2H3XC 3FT0A 2AZAA 3NP3A 1J5CA 3H56A 1M9WA 2FQFA 4YSEA 3CVBA 3CDZA 3GXUB 5B1BB 3QPKA 1CUOA 4HCGA 3V9EA 4WTQA 3S3DB 3NJKA 2GI0A 3NSFA 2IWKA 2YAHA 1PNDA 1T5KA 2E86A 4AKOA 3QJSB 4JKNA 3T6WA 1SJMA 3WKQA 2A3TA 7PAZA 4G72B 6PCYA 4DPBX 5LDUA 3X1NA 1XB3A 1DYZA 2B3IA 2XVBA 1AS8A 4GY4A 1B3IA 3QJVB 3NYKA 4YSPA 1JVLA 2Y1AA 1X9RA 1BEXA 1KYAA 2EIMB 3ABMB 5FC9A 3FYIB 3OQRA 2BP0A 2JXMA 4BK5C 3JTBA 5ANHA 4NAJA 1WS8A 2YARA 1OE1A 3DIVA 2YAFA 1V55B 3V9CA 3NJMA 4WKXA 4A2FA 1W8EA 2DYSB 3WG7B 2VSKB 3X1EA 1EZLA 1KV7A 1NINA 1M57B 1ILUA 2CJ3A 7PCYA 2DYRB 5B7MA 2UX7A 2UX6A 2AFNA 4ENZA 5I6PA 2DV6A 1TU2A 1J9SA 2HRGA 3X1FA 1E65A 1E5YA 2HX7A 5B3SB 1AQ8A 1L9PA 2XV3A
chains in the Genus database with same CATH superfamily
3QZLA 3QCVL 1QLFB 2GSIB 4WF7A 3HS0A 5EORH 4Z7WE 2J7LA 2YHGA 5EZLB 2V7HB 1AXSA 3CDZB 2G2PA 3P73B 5K1VA 4F2MA 3FSAA 5I18L 1IT9L 1NBVL 5F0JB 1VFOA 1YEFH 2AV1B 3BH4A 5BV7B 4AL8L 3CLFL 4MGXA 4ZMZA 1HINH 5ICYB 2ENSA 1NTDA 1ZWIB 1ZGLB 1D7BA 2X2JA 3H7BA 2D31A 4C58B 3OJ2C 4ZFGH 2EE3A 2Q76B 4XXWA 2EUVA 3QR0A 4RAUA 1XCQB 4JHAH 3HC3H 4GBXB 5GS0D 4APXB 3JV6A 3VXNB 3WIHH 2IPTH 1FNGA 4ZNEA 4PJ8B 4Q58C 2QVTA 3UBXG 1C08A 2EYRA 3EJJX 2CO6B 4ZS7L 5C2UB 3VXTB 2Q3ZA 3FU5A 1DBJH 3RUGE 4URTB 2G3XA 3FTUA 4BH8B 5JORB 4YHLH 4LP8A 1JAEA 1BFSA 4QOKB 4DP8X 2BSRB 3DETD 1LD9B 4NRYB 3QH3B 5C9KA 3B7YA 2NT0A 5KBDA 1E3FA 1SN5A 1WT5C 5ID1B 3ROLA 4FLHA 1QW9A 3DMMC 1V7NL 2I5YL 1K8IA 3HBZA 1IM9D 3UZQA 4KVNL 2BW5A 3OKEB 4LU5L 3GSQA 4S1DC 4QNPF 4QXTA 2IADA 3QUYC 2FWOA 1V3JA 4L18A 2HSIA 2GJZA 2XACC 3CHRA 3TH4T 4XBGA 2IJ0C 1CD8A 2OR9L 5HD8C 2XV6B 4IIQA 5D71L 1BCIA 1S7XA 3GRGA 3TCLA 4G8GB 3AREB 2XKSA 1JPEA 1DQDL 2X2IA 4FHJA 4QYAA 2DRUA 3HRZC 2KZ1B 4Z7QB 4GMTH 2CRIA 1EVTC 3EYSL 1HZLA 4JFHE 1TTBA 4QJ4B 2GTZA 2PNDA 3RBGA 4RDQG 4N1EA 2YLHA 2JIXB 1C8QA 1NFAA 4I0CC 4IU2A 2Z0UA 1KYDA 3INUH 3MZGB 1QSEE 3D0VB 1S7QB 2J3SA 1IAKB 3TJHC 4PN6A 5ERWB 4GSRA 1Q9KB 3CH8A 1FH5H 2CALA 5EIQA 1VACB 4BCXA 4TSCH 2A6KB 4PJEF 4H26B 2ILLA 4PVBA 2IPKA 4MNQB 4MXQC 1MOEA 2X3CA 2YJQA 1ACCA 3A0OA 4GLRH 1DN0A 2CUHA 4HU8A 5IMKA 3H9SB 4DPRA 5DD1L 2VXVH 3P9MA 1L5GA 4BXVA 1QKZL 1E9PA 3TBTB 1UA3A 3UACA 3DURB 3ARDD 2R27A 4LNVA 5I76B 2HN7A 3L4UA 1RH8A 1ADQA 1YNTA 4G6KH 1A64A 3EYUH 5FB8A 1U3JA 2WNKA 4AXWB 3TWYA 1LE9B 4RWYL 2C3GA 4MB3A 1MVYA 2YSSB 4BFGA 1RUAH 2Z31D 3V9FA 4XHQA 1OP3K 1DQKA 4APQB 3EADA 2I9TB 3A67L 1JZJA 4PJ9B 4NLAA 3K46A 5JHDA 1JGLH 2CJUH 4G43B 2R4SH 2VDRB 1QYGL 3LZFH 5EBMB 2NQCA 1KB5H 2AK4E 4OCSL 2CIKB 4U6XB 2C4FT 3H85A 5E6IB 4FYRA 5EDSA 4U1JA 1P0SE 5IR1B 1G7JA 4RH4A 4GAYB 5KVEH 4LVNB 4NUQA 3HUJB 4M9OA 4W93A 2FIRT 3IM1A 3QIWD 3L17A 3CUPA 3QNYB 1UYWL 2UWEF 1OSEA 5GJSL 2H6PA 2HKAA 4J8RB 3BIKB 3NIGB 3ZE1E 2DIBA 2PR4H 5DVKA 1EBPA 2JKLA 5HPMA 3MRQB 4WVRA 1FCCA 4NAMA 3TFBA 5KVDE 4EQ3A 1XZWA 2PWFA 4Y4KC 4C55A 2AEQH 4TNGA 1XVSA 3DJTA 3K74B 1IEHA 4R4BA 3A4AA 1MCEA 1HXKA 1NSNL 1UXMA 4Z7AA 1KB9J 1OF2B 2X1XR 4K7FB 3WKNA 2DN7A 3J2PA 1RZFL 5IMOB 3TFKD 4M8VA 3DI2B 1A3ZA 2FSEA 4GG6B 1AQMA 3KLQA 3SY0A 1JF1B 1VFBB 3TO4D 1SPDA 3RDTA 4AQ8A 1CGSL 5I17A 4OCYH 5DJAA 4BFRA 1NBQA 1RZIB 3V7AG 2LFGA 4XN2A 3QEQE 1A3LL 1P5VB 4GFXA 2ZJSL 4MJID 3I84A 3RI5F 3T2OA 2JQAA 4AX3A 1RERA 5CXPA 2PP8A 3FQRA 3NACH 4NP4H 1ZV9A 2YPLB 3BP6A 4R4FL 3M8OH 4Z5RB 5IHUH 3BUDA 1DBBH 3SODB 5DWUH 1OSZB 3CX2A 4HWNA 2HT4D 2JJUA 4MZ3A 1F58L 1YNKH 2G2RA 1N3NA 3ARBB 5D2NE 3RE0A 2F54E 3R7QA 3UGXA 3GHPA 2NUPB 1CLYH 2OX5A 4HAKA 4X8GA 2CK0H 1XIWA 2R15A 3O8XD 4JFQB 4AE0A 1WZMA 3TJEL 2ZAHA 3BVNA 3RZCD 1R3LB 3HE6B 2CPCA 1TO5A 4FI6A 1YEGH 4ZSOE 1IBZA 3KXFE 4HKXB 2YQBA 1AD9A 5HI5D 3RUGF 4L8CB 1E4WL 5E2UH 3KJ6L 3OVUB 2FLBT 3Q1SH 1P7KB 4RFNC 3OPZH 1B9ZA 4G3YH 2WXMA 4FL4C 4YBLC 1LEIA 5C0AE 5DF0A 4WWKD 4XPAH 5F88A 3MLSL 5EC2B 1DBMH 4E42B 4DVRH 1F6AB 3HB3B 1BREA 3ARYA 3CPUA 4QRPD 3UBXA 3P4LA 4DSYA 1J1XH 1MLCB 4YSSA 1RL1A 2Z3FA 4OM0L 4AIZB 4IK7A 2VMEA 4YXHH 1AR2A 4TS6A 2FTAA 4ILDA 4V2BA 5TE7H 1FZMB 5AVYB 3TNNB 1CCZA 4XNQB 3MXWL 3IFPB 3IU4H 4JB9L 4KNSA 4YE4H 5BRZE 2ZWKA 5T1KB 1O75A 1J1OH 1AGBA 1XGPA 1NEUA 4GRWH 1K5NB 5IJCC 2IQAB 2G9HA 4N2BA 1SLUA 5F9JA 4QRTA 3LRSB 4FNPA 4UDTB 2O5ZH 2EABA 1PY0A 3FQNA 3OR6B 3T65B 4U1GB 2COQA 2ZP0T 1OAQL 1N26A 2C9PA 1N2RA 4HXAH 5D1XA 4YPGB 4PREB 2A99A 4AGPA 2YPKA 2KT6A 1DUZA 3KGUA 3SYPA 3DRQB 4BBWA 1DCLA 3VGEA 3MLTA 5HI3D 5MEPB 1NPNA 4G2AA 1ZS2A 4PJDA 3TIEA 3PWNA 2C9VA 1HWWA 3RNQB 3IDIA 3DX7A 2VLRB 4ZFOL 5EIIB 3ZKNC 2CKBA 3PWPB 5FOBB 5IROC 2X6VA 1TSRA 2HLFD 2FIKB 3R4DA 4WV1C 1FJ1A 5F3HB 3OR7B 1WDAA 1LO4L 1M6UA 3L9YA 4P23B 4Y9BA 3KPLA 5LGJB 2JB6A 5B7EA 2WIIA 4XN5A 4PRPB 4XOAA 5BMFL 4GAGH 2FLRT 2K70A 3NFSL 5GIRB 1W72A 5C0NC 3QQNA 1A6UL 3HPLA 3ISRA 2AXGB 2KDGA 5MP6H 3VRJA 5DD5H 4P3DB 2Q2EB 4ALAL 3K71A 4HUNB 4IOSA 5JOPE 2VDPL 1X5ZA 5TDOB 4DP5X 3UMTA 2O5YL 2BWQA 1UXSB 4NJ9H 5CJOL 1ACXA 4MASA 2ATKA 1A2YA 8FABA 3Q5TA 3D25B 3S8FB 1ZHBA 4MS6A 2VRQA 3PL6B 4RFEB 2JKSA 1J0IA 3NA9L 1P5UB 4I0PB 4HLZH 4L9LB 3GLZA 3QRGL 2VL5A 4LVEA 3SGKA 1PZDA 5DWPA 4Z3EA 2V2WA 1HHHA 1HL8A 4JFZH 2ISDA 4B9PA 4JFED 1OCCB 2ODIA 1UWXK 3STZA 2F08A 3NCYS 5I6MA 4ZUUB 4DEUA 2PP7A 3K6DA 3O4LB 4LPUA 3VXRB 4AYFA 1K85A 4YL9A 4ONHB 5DJXA 1WF5A 1G9HA 5FV2A 1X5YA 3RX8A 5FF6B 3MGTA 4E9XA 5SWZB 4M5TA 2IGFH 4N3TA 4QHLA 4J3OD 3FFDB 4YGVB 1W16A 3TA3A 3ALWA 1RZKL 3TT1H 1JXDA 2OJZL 2XV2A 35C8H 4MMXA 4O02A 4QUOA 3HLKA 3HFML 4R7NB 4LRIA 2WKGA 1PFCA 4AYBA 4BH7A 1E2WA 4K3EL 4LLMB 2DQJH 3FULA 2P52A 1YMME 2AJYL 1YN6B 1MPAL 1XX9C 2AXFB 4IMLA 2R56L 1OCWL 5CSZA 4P2RA 4OZGE 3A6CL 4OI7A 4FI7A 1SF5A 3H4FA 3LZPA 5GS1C 4NX0A 5DTFB 5M7QA 2H3XC 4PP2A 2PW1A 2UZPA 3BPLC 2VSDA 3W1ZA 1R5IB 1JSYA 2WVUA 4DN3H 3CVBA 5D70L 5CGMA 4YGAB 4CU6A 2OW6A 1Q72H 4KMLB 5IQLA 3U2SB 1ZVSA 2IWKA 1AFVL 1AQDB 1FV1B 4NQTA 4RGNB 4B9IA 1I85A 1SGKA 1B4LA 1B2WH 5DURD 3S35X 1J8SA 4AKOA 2NY6D 4HIXL 3BN3B 3GB7A 2YJLA 4MZIA 4M6NH 4QWWD 3K6SA 3FCGA 4YBQC 3FO0L 3AS1A 5AVTB 4QRQB 1E4KC 3FB5A 1Q9OA 4FNLH 1ETB1 3I74A 1CGYA 4U3SB 1NCDH 3VO0A 1KZQA 1XB3A 3C5XA 5CO1A 3UC2A 2X4UB 3M88A 3D4ZA 1UB6B 4NNXA 3BAKA 1W15A 5IVXB 2WOYA 4YX2L 2B2XH 3QVAA 3ABMB 3LEYH 3HG1D 4PGBA 3N1PC 2CRMA 3O9WB 1UZ8B 1OTTD 2NNFA 4IRZA 4H40A 3BAEH 3BOVA 3CSBA 3UYPA 2WVVB 4O58L 4OLZH 4ERSL 5C0BE 4R7DA 3ZDZE 2IANA 4XAKD 2F9BT 5LN4A 2DEWX 1ES0B 2FO8A 2R2BB 4NNYB 5CIPA 5B7MA 2UX6A 4G7YL 4YO0B 3I6GB 1CZ8H 1NEPA 3AACA 1RUPL 5LAXB 4R5XA 4JRFA 3SEPA 2HVJA 4EVNB 1U8OB 2I25N 3HMWL 2Q7YA 1NAML 5I8CB 2JKTM 3N9GH 3U82B 4PRDA 4X8XA 4ESKA 2GT9A 4Z78B 5BUPA 1NAKL 1CDJA 3P2TA 1M56B 3FB8A 3BDBA 4WNQB 1WRFA 1YECH 4F7TB 3BW9A 2ZWNA 3EH1A 5T3XL 4Z7OF 3NIDF 4OY9A 2PO6A 2O4EA 3OKKB 1ZT4A 3EIFA 4R4NC 5MHSE 5HDRA 2EDRA 3KR3L 2W95A 5K9OA 5DVMA 2FBJH 2AEOA 2JTDA 4NZTL 4MAYC 2WAQA 2YKKA 1OZTG 1SY6L 4KK8C 4NQCA 3ISWA 3KW7A 3EXJA 3CFKA 2XZCL 4WFGD 2APWA 3QCTH 2Z92B 5HY9A 5AVWB 5CKAA 2D73A 1TEYA 4LSTH 1IM3B 5HGAA 5FM4A 1FF5A 3VRLF 5DEFA 3CCHB 2XTSA 3CSPA 1KY6A 4OTXL 2QTVA 4A63A 1CFTA 2ZOOA 2YPVA 4Z7VF 2YD4A 5F7FA 4MHHI 1G1YA 4P5MB 1SNRA 3TZVA 4OI9A 1AOZA 2D7TH 3MODH 3NJXA 3ZYJA 1FORH 2MHAB 2HWZL 2Y06L 3NPSC 4PJGF 1I53A 1BVLA 1D5ZA 2FYVA 2WIMA 4K9EC 3OB8A 1S9XA 1TKWA 5JXED 1Z66A 3CDYA 1MRDL 2KZKA 3KH3A 1ZTXL 4CKVX 5EORL 5C08B 3N40P 3APMA 3ULVH 4PTUB 4YXKL 1E5CA 1BQHB 4JUSA 1MFEL 2MRYA 5CBEB 5J56B 5GQBA 4MCYB 3IJ8A 3A6OA 3L7FA 3DMMB 1T1XB 4U3HA 4ZQKA 1QRNA 2YUWA 1JK8A 1HINL 2MNJB 1ZK5A 3PJNA 2WGXA 4M02A 3EGDB 4R96B 4QMEA 4N8PA 5I8OH 3RWJA 5D1QC 4HH9A 2C3HA 4HUXB 1PZBA 2CE6A 4DO4A 3RURA 3NQKA 4ZTPL 1MVUB 2AC0A 1LE5B 1SEQH 4ZFGL 1GIGH 5JUEH 1S78D 1U42A 3EYOA 4JHAL 2E6JA 4HWBA 1XGYH 2J4WH 1J8HB 1NMAL 4U6YB 3ZN6A 4C4UA 1VB9A 4D0DA 4KUZL 3TPUB 1DUYB 4UQEA 3EDEA 3T1WA 4F2EA 1GYCA 1T7VA 5CJQL 5JHBA 1INQA 1JE6A 1EZVX 3C8HA 3CSYA 3TVMA 3F84A 4OZGF 3HRZB 3AITA 5K9KA 1FFNB 4I88A 1ASPA 2CJTA 2BIPA 2PYEE 3VUAA 3L2MA 4YHLL 1DHKA 2NY2D 5IB5A 3WMPA 3PWVB 1NCIA 3OKMA 4U1LB 3MX0A 3PUCA 3GKWH 3H7LA 2HXAA 3RJDA 5TGBB 1FCGA 3GFUA 4RSYA 1X5FA 4M3JA 1U3HA 3FN0L 1NCUA 1MUJB 3B7SA 4HHAB 3DA0A 3QIBA 4KZ0A 1IC7L 3BZDA 2XIIA 3CPLA 4Z77A 4IYKA 3BISA 3F7PC 4LGPB 2ZP9A 3ETSA 3KL3A 5D4QA 1V3LA 3N40F 1DE4B 5IWLA 4M8RA 1OT2A 3H4HA 4L05A 3HAEH 1WAEA 1D9KC 3CZEA 2NTSP 1GW6A 2VLJE 5ESVB 3FTZA 1NGZB 3QFJE 3GKZA 1CVSC 1EXUB 5HHMD 5E99H 1MI5E 3IETB 4GMTL 2BNUB 3KH4A 2XXFA 1SXBA 4HH8A 5DJCB 3OKNB 3T8XB 3UIZA 5EFIA 1VFUA 4H88L 4JY4B 4AT6B 4PJEB 3HN3A 3IMBA 1VESA 3INUL 3TBSA 1GSMA 1M71B 5T3XD 3RGHA 4ENED 5JW4M 2FR4B 2CWRA 5AVRB 1O6VA 3ZDZF 1FVCB 3VMNA 1JPTH 1A7RH 3RWHB 4EO5A 3BRFA 1SXAA 5E6YA 1AXTH 2YMXH 3QK0A 1C12B 2YPVL 3BFOA 1LP9A 1AZRA 1BFVL 3LKNB 4Y9CA 3QZNA 2GJ6B 5KYWB 5GSVB 4FXTA 3WDHA 5I66A 5JW4R 1ETA1 3O2DA 4UQCA 2VN5A 3HHSA 2HH0H 3SDCD 3KYKH 4KHTH 5DD3H 3I3BA 1R33A 2P80A 2ZUQC 3EYUL 1H0DA 4PW9A 3BGFB 4EN3D 5GSRB 2CBOA 3WO3B 2EDYA 5B21A 1IGFH 3QZWG 4FULA 4MA3A 4GJTB 5HHPB 4CVZB 5EU4B 4IMKC 4X7SH 1XT5A 5C0FB 3EUDA 3TBBA 3IF1A 2CJUL 3WNKA 2R4SL 3BQUA 3MNMA 3EFFB 4JKWA 2W59A 1E9QB 1D3CA 3F12A 3QJRB 5I71C 4JREC 5LG6A 2UWEB 4X7DC 4F3FA 1RZJC 2WUBL 4YHKH 2XUWA 3RVTC 3SHSA 2JB5H 3O6FD 4F8LA 1YPZF 2WVTA 2EDFA 1AANA 4N0UA 3VXPA 5IUSA 5KVEL 5MEOB 1RUQH 3QULA 5DZAA 4JNXA 4JKKA 2APSA 1TITA 1IFGA 3IU3A 1KCWA 3A23A 1YC7A 3SKOB 4XB3A 3PY9A 4IS6A 3PDOA 1KPUA 4BFFA 5C0EA 4OQTL 2H2PC 3O3BB 4A2MA 4BIKA 4HWBL 5EU5B 4ZO8A 3V5DB 5E5MB 3R1GL 3ZO0A 4W9LC 4NAQA 1EXGA 2VO8A 1MCWM 4P49A 4LCUB 2EEBA 4UZUA 3H3PH 4LRNH 4ZO6A 4F58H 1RZ7L 3DYOA 4ODUA 3ME0A 2VXUL 3VRIB 3DJZA 4RFNB 1PLBA 1KG0B 4FL4B 5EZJB 4YBLB 1KJ2B 2VLLB 1MG3C 4O51A 4WHYH 3IN2A 1OGAE 2WO3B 3N0AA 5LCVH 3DGDA 4UIMB 3CXDH 4X4KA 4ZBJA 2A9NH 1EJ6A 2Y24A 3AG2B 3IMVA 4MCNA 3ZE2E 3UL4A 1ZLDA 4UTBL 1ODAA 2AJUH 1G0DA 2O6DA 2NUTB 3PABB 3B2UD 4G6MH 5AB2A 2O5NA 4HZLB 4PRIE 4ABWA 3MV7A 4HMCA 5HYJB 4DZBA 3JV5A 5IHUL 3RL2B 1DBBL 1C5CH 1CXKA 2DTMH 3AADB 3FN3A 3EOTH 3MO1B 5E7FA 4ZPVB 2X05A 4QKXB 3CDGB 3LD8C 1YNKL 2G0LA 5FK9A 5I6NA 3BRGC 1CLYL 3MRRB 2CK0L 4HK0A 4J6RH 3KPRB 2Y1ZA 2YAEA 3KPQB 3NJIA 1UJ3C 1E50A 2NY0B 2WQVA 4X5RA 3CSGA 1IE4A 4BK8A 4XP6H 4Y2DB 1YEGL 1JNHA 2Z4TA 3U7YH 4GQQA 3D18B 2EEXA 3U4EA 4BWTA 3Q1SL 4P5TC 3ZE0E 3OPZL 4CVWA 3P3UA 4WJKB 4G3YL 3KWWB 3EDFA 4XPAL 3ELQA 4E5XB 1EUUA 1JZFA 2GCYA 2AQSA 2YAQA 1XB6A 3BVWA 1OVZA 1J1XL 5LBVA 1MQ8A 3QFGA 3QG6B 1RZ8B 2C3VA 1H3PL 4H8WH 2F8IA 5JHLH 3PP3H 2DIAA 3BP4B 4JRXB 4J27A 4HIEA 3ZYIA 2EDOA 3EHBC 4WV1B 1IGMH 3KGSA 2NY3D 4TNVF 5HGBB 1MDTA 3QORA 1F3JB 2B0SH 5BJTA 2DMKA 4HOXA 3AG3B 4J2XA 3N6YA 1SF3A 2E4TA 3BKYH 1KXTA 2QADC 2WLLB 3ML9A 4PS4H 4WUUA 1UEMA 1WTGT 3IU4L 4YE4L 5IQ9B 2H3KA 3FCBA 1KFGA 5IB2B 1KWGA 1HIMH 4PVLA 1J1OL 5IOPA 1TTCA 3Q5OA 2LAGB 1S5HB 2NY5H 3WELA 1QSEB 2O5ZL 3ARSA 2ALWA 4HLEA 3J8F7 1G5AA 3GMQB 3L3GB 4D0CB 5EPMB 4F20A 3L4WA 2E9BA 4O2FA 4PJCA 5D7KD 4P46C 1F11B 4BUHA 1MAML 4AG4L 1BZ9A 4A2LA 1FDLH 4JHUA 1XZ0B 3BIAX 1G9NC 5ABDE 4ZMXA 1KBWA 2R0LH 1D5XB 1H15B 2ICWB 1AKPA 3RVUD 2Z1KA 5FECA 4CRPA 5J1SC 3AB0C 3U36B 4BM7A 3MLUL 7FABL 3MUGA 4K3GA 3BPCA 1PDKB 4F2FA 4ICWA 1IL1B 3RTQC 5I30H 4TNEA 3CMGA 2X0WA 5DJ2A 4GAGL 4ZFZB 5TDNB 4OCWH 5IJKA 1JYNA 3Q3GA 4R2GD 3DECA 5MP6L 1RFDH 3CZNA 5DD5L 2DKMA 2V37A 3VB8A 5BS0D 3U1SH 2A6JB 1EMTL 1WWWX 4M4RB 2N1TE 1GOFA 1HC1A 3F7VB 4ZMNA 4G9DB 4OGAC 2VDQB 3B9KC 3GTNA 3E2HB 2WQWA 4UM9B 2LQRA 4G8FB 3SCMC 5C0JA 4LL9A 2YD9A 1UOKA 2XWDA 1LEKA 4E0RA 1T22B 2QV4A 3V4VH 5GS1B 5ID0B 1EEYB 5AVZB 3V9EA 2ADIB 1UT1A 2CMRH 2JI1A 3AU1B 3BPLB 1G0XA 3CTTA 3NJKA 3B7UX 3QZWA 4FQXB 4J3SA 2P5WA 4E9LA 5I0ZA 1T5XB 2FECL 4JAMB 1SOSA 1TQCC 4JKNA 5KANG 3UG4A 5JMOC 2SEBA 1UOVA 2AABH 1TZGH 3KHQA 1QAWA 1GL4B 4MRCA 2E8ZA 4YLBA 4FG2A 1NEZG 5T8IA 2I69A 2PYFA 3DARA 3D3VA 4NQXA 4OZIE 4FJ6A 3P4OA 2OMWB 3M1BB 4AM0A 2QGDA 3TH3T 1M7IB 2OL3B 4M6OH 3MRJA 3O3AB 5SWSB 3TBYA 1DJWA 3TT1L 2W5PA 1V7ML 5IM7B 4JJHA 4MQTB 3LZLA 4LHJB 3SIKA 1ZLVH 2DQJL 4KZEL 3M7OA 3AS3A 1D6VL 2R9HC 3CIQA 3UXFA 1UC6A 5EU7E 4JY5H 4HD9A 1CICC 3PWLB 1MRCH 5AZ2L 3T0DA 4NI6A 1PKQE 1IV8A 3AGWA 5EEWA 5J12C 4X80H 3ZE2F 3LDBC 1EV2E 3NCBB 5KSAD 1M57B 5D2NB 4LBEA 4DN3L 4OM1L 5DJDB 1LEGA 2I24N 4YN3A 3GJFB 2AK1H 4P4RA 4RLDA 1Q72L 3C12A 1E65A 3HR5A 4MNGE 3RY6A 4JFWA 5B3SB 1I3RA 4ZUSA 4ZSOB 2XC8A 3KXFB 1W0VB 2VDRH 1E4JA 1NBYB 4M6NL 3PQYD 1FC1A 5C0AB 2YN3A 5C0CE 3D2UA 4XNAA 3UADA 3SQBB 4X7FC 4FNLL 2OV0A 3L9RA 5IK3A 1KBGH 3ZE0F 1NCDL 3V6FB 4PYGA 4XWOC 3CC1A 2I60L 3V4PB 1AIFA 1TQBC 3O3DA 2ZXBA 1Y7VA 3L3KB 5ESAA 3QQXA 3ILQC 3UP1A 2B2XL 3BWAA 3L08A 5GRXG 4AM0Q 3D69B 4QRSA 3VFPB 3FZUC 2YAOA 5E1QA 2IWFA 4CGUB 3UYRH 2VITB 1CFNB 4J3VA 4MAYB 4DKAA 3BAEL 5D7JC 3MRKB 3WFBL 1Z9PA 4OLZL 5E8OA 3VXMB 3FT2B 4G7RB 4ATTA 3APDA 3UOAB 3S8WA 4KKZA 4JGNA 4V11A 3D0LA 4PUBH 5ANMB 5DZPA 4XP5L 2OMYB 4W9IC 3VYOA 2VKXA 4MSWB 2IALA 4UMGA 2NPLX 4MA1B 2E6PA 4K5OA 2FT7A 4K8RC 1WBYB 1T1WA 4L3CA 1S7WA 2NCMA 4U31A 1ZLSH 3MC0A 4X0KA 1FZOA 1N70A 3NIDB 4Z7OB 5F9AC 2DMHA 4WTWA 5DSCB 1SQ2N 3W9DA 1AE6L 1BLNA 5GS3A 4J3WA 1UADC 4AY0A 4QHUA 2WBJD 3D39A 5E03A 1YECL 3G5ZB 5GGSB 2NMSA 1TQWA 4G9FD 1M7DA 1XF5B 3ZZ1A 5GGUA 5DEGA 1JOIA 2IWGA 2VYRE 5I23A 2FH8A 1V10A 3QYNA 1AHWC 2FBJL 4FFTA 4FQQB 4ONGL 4HMDA 3QCTL 4Z7VB 1FE8L 1URZA 4PW4A 1C7SA 1P4BH 4XCFH 3LKQA 2QVKA 4WI0A 1NLBH 3SOBH 4P3CH 4YVUA 2F15A 3AY2A 5D1QB 4PJGB 2E27H 2KLRA 3KNBA 3CG8A 2Q8AH 1FFQA 1DANU 1MAKA 2C3WA 2D7TL 4OKDA 2NSMA 3AXLB 5HYQA 5IIEA 2G4GA 3VFVB 5EBLA 4HCRA 4FQHA 3MA9H 2OTWB 2AXJA 3VWJA 3QWOB 4MJ5B 3VM5A 2EVIA 3BZEB 4DP9X 32C2B 4Q0XH 1CC3A 2YGNA 1LDPH 3JTSA 3PU7A 4FXGB 4XPGH 3WLBB 5ADOH 1SZNA 4NN5B 4NQDD 3L1EA 3REVB 3GSRB 3IJSA 4Y2LA 4H4NA 2K0RA 5FYLE 5HHOA 3ULVL 3T4AA 4L4VA 4FYSA 5TE6L 1WFJA 1I8IA 4Q74A 3NJLA 3WIAA 3JWNG 4J2QA 4YHML 2WWMC 3L4ZA 4W9FC 2EDXA 3BN9D 1GJIA 4QT5A 2YXVA 4MDRA 2Y72A 4Y4HA 1D2OA 3T5WA 1DJXA 1R24B 1NCNA 4A7UA 1BAWA 4IBZA 5I8OL 2FD6H 5B1KA 3ESUF 1NGXB 3DYMA 1YMMB 4JRYD 1X4YA 3EH5B 2CLZB 4BFEA 3CXHK 3OXRA 1INEH 3ARGC 1Q0XH 4OZGB 3NK3A 1AAJA 1UB5A 4S2SB 4WUUD 4EBQL 1WH0A 1XGYL 2J4WL 1NIAA 2H1LM 2HG5A 1DBAH 3CLWA 2D2CC 4XCCL 3MA7B 4K7PX 2PETA 1NEZA 5DMGD 1CF8H 3OV6A 4N2KA 1Y18B 3PWUA 5DEZA 2F19H 1RSFA 4P2QB 5IHZA 4JDTH 4U6VH 3LRHA 2XJKA 4BRJA 1MCPH 1WWCA 4DEWA 4HUVB 4U7SA 1PNCA 5C70A 1J9CT 1T1YA 5EU3A 5K39A 5AVXB 2F5AL 2MCAA 3GKWL 4UINL 2AQTA 2O26U 4PV9B 3CFJA 3DXAD 1KIPA 1I8MB 2X0UA 4LCIL 3F62A 3OF6D 1TEGA 4OR1A 2XN9D 3NSJA 1OY3B 1R0AL 3KPNA 4KNQA 2AMGA 1RVFH 2GHWB 3G6JB 4OFIA 3RHWK 2NOYA 1FNAA 5F1SA 4FYQA 2BY0A 4RMTA 4R9HA 4IGBC 1HCZA 4U3CA 1H6FA 1I1FA 1HHIB 3VB9A 1H3XA 2BX5A 3RLSA 5IZ7A 3WO4B 3MN8A 3MCYA 3UTSB 1FIEA 1OK0A 2R1WA 1HOCB 3OZLA 2JTYA 5E99L 4KWUA 1WA0X 2EDLA 2QQLH 5DS8A 1AD0A 4JGUA 4ZAKA 3GSVB 3HC4L 4JG1H 3OBAA 3ZDZB 5I0YA 2GBUA 3MJ6A 3FU3A 3H55A 2V33A 4KY1L 5I73C 4MXVE 4NKIH 5KW9H 4JREB 2NXYC 1ZE3C 4MD0B 4KJWC 5J1AB 3BRDA 2WNXA 1NCCL 4QHNA 1BQ5A 4LQ1A 1N5AA 1CGVA 1CR9H 1JPTL 2BOCB 2EXYD 3D87B 5JMRA 3L95B 4Z0XA 3VD2A 1LWRA 5MEQA 1AXTL 2YMXL 4L3EA 5EN2A 2VZ3A 1SBBA 1NA8A 4IEFA 2BZCA 1NGYB 5T1LD 2OKMA 1J1PL 3AJ7A 8CGTA 1P4IL 3JWDC 2WLMA 4WEBH 4KZCA 2X70B 3FJTA 2HH0L 3TBWA 5CILH 3KYKL 4DHLA 4PJXA 3S5LG 4NQEB 4KHTL 1MIMH 5DD3L 3WN5A 4EUPA 1DJSA 5B22A 2EZ0C 4JQIH 3V10A 2J5WA 2NZ9D 3KBPA 1CGTA 4JM2A 1DQQA 1IGFL 1NZRA 1YEJH 2YD7A 3M17A 3HJ0A 5D6DA 4X7SL 1U8PB 1NCWH 1YPZB 1DVFC 1L0PA 1AO7A 3QPQD 3SE4C 3V0IA 3ZX1A 1HJCA 2EDHA 4RZCA 3L2LA 1R3IL 1XF4B 3NFPB 2GK0A 3MGOB 3ULVD 3MJ8B 1BZQK 2JB5L 5FOJA 1QG3A 2ADJB 4L2LA 1A6TA 4LKXA 4X98B 4B7IA 4IOIA 2DQUL 2J12B 2ZPKL 1PG7X 2AQNA 1L7IL 4Q14A 5E8NA 4ZPTB 3HMXH 4NSKA 2LGNA 3FCTA 2Q9OA 3K72B 2VR4A 1GY1A 4G42A 5A16A 2F53B 1M53A 4HUWB 3FSVA 1ZIBA 4HJTA 5DRXA 4HIJA 2OZ4L 1UJ3B 1MLBA 1FYTD 3GMMA 3H3PL 4LCWE 4LRNL 3VFNB 2MIZA 3GMLB 1GRWA 4F58L 4FMKA 4KBPA 2AEWA 4IW4C 1R3KB 2FEDC 2ZOUA 2XNAA 4P5TB 3K6IA 1MCLA 3ABZA 4NDMB 2Z93B 4NUPA 4DCQA 3II3A 4RNRA 4AV4A 3RAJH 3V6OC 1KEGH 3MI6A 5F7NC 5EU6A 1EHLL 5LCVL 3H8NA 5C3LD 5F1NA 4U6HA 5LKNA 2E9IA 4JO2H 1ZHLB 2FNBA 3E3QE 3ILDA 4TYUA 4A2DA 5I16B 4CDHA 4YK4C 2VDOH 3CLEL 5L2KD 3ABLB 4N4YB 3U0TB 5LNDA 4KROC 2CD0A 1NIEA 2EDEA 5E9NA 3QI9A 2ICWI 4J12A 2CM5A 2D0FA 3MJWA 2DTML 3EHBB 4UB0L 4M4PA 3SDDB 3PGCA 1K8DB 4XO4A 1SJEB 3C6LC 2QADB 3KWUA 4F8QA 3QEHA 3L16A 2IH8A 4K5PA 5HGHA 3GBLA 3ATEA 3QAZB 2E7DA 5GGVY 4UTAA 4XP6L 3V0HA 1N0LA 3Q9QA 4GYBA 1QSFB 4NQVB 2LU4A 3IPFA 5H94A 3UZVB 4XRCB 4HIHA 1BM7A 5G4OA 3X1BA 5FGRA 4D9LH 4F37F 4YDIL 5GGVH 4CNIA 2ZD0A 4ISVA 2CNYA 4HFUH 2X4RB 5FPIA 3BUPA 1DANT 4P46B 4P04A 1U58A 4UCFA 4F7PA 3C5JA 5CWSA 2J57A 4LEBA 5GZNA 4LSSH 2AW2A 5TFSL 3VJ6B 1ZJAA 1KN2H 3L3HA 3K81A 1OOAA 5FHBH 1HHJB 3BKMH 5KSVA 1PF3A 2LU3A 4C56B 5JHLL 4NN6C 6FABH 5AYQA 1A4BA 4LHUG 3AB0B 5E94A 2ZUUA 1MI5B 2UXFA 1RJZB 3FT4B 4PJFF 3RTQB 3T0XA 2B0SL 2L7QA 2XETA 4YH6A 3LPOA 5DZNA 4NXKA 3SN6N 3BKYL 2KI6A 4PS4L 3SKNA 4UT7H 3GWJA 4TOYH 4EZLA 3PDDA 5AL8A 3LKRA 2DMBA 2NY5L 1FFPB 4W6WB 5BV7L 2OXGB 4DT2A 3ZMRA 1NBZB 3UJTL 2J1WA 4F80A 4S0SD 1DVZA 4NUMA 3DTXB 4NKMA 4F5CE 4PLKD 3DIFB 4PGJA 2P24A 4WNJA 4MXVF 3MBXH 4MS8D 2WPGA 3EAKA 2XZZA 1T5KA 3DVNB 1YY8A 3F7YA 4AZ8B 1HI6A 4IOFC 1FBIH 3F65A 3KPSA 2YUZA 5C86A 3BMVA 1UM5H 3FQUB 6PCYA 3MLXH 4BHUA 4QI3A 1JHKH 1MJJB 4OD2A 5JDSB 2P7TB 1TQCB 2C7UA 4HETA 3NAAH 5EIVA 5H2BA 1CBVL 3QQ9D 2VXTH 3ZGHA 5I30L 2M2DA 1RMFH 2JKJA 2Z4QA 3QJVB 1TYEB 3K80A 4M29A 3C8DA 4FTVB 3FB6A 3HE7D 4XNUH 1IAII 5E5LA 3UPAA 1T7YA 4WI2A 1IIKA 2JXMA 3U1SL 4EN2A 4PRAB 1A4JA 3O4OC 1W80A 3RGVA 3VW3H 2WXGA 5BZWB 3X1EA 1Z3GH 4QCIB 3G04B 4PVNA 2RCSH 5F93C 3T0EC 3VNZA 4TV3A 4UOQA 2B9AA 1CICB 4NO0B 4E68A 3G5VB 3CNKA 5A6IA 1Z6JT 2HRGA 1EEUA 4GO8A 3HG1E 3LDBB 1F5WA 5CJXC 1MCNA 3SDAD 2FBRA 1A1OA 1T4KA 5T1MA 1R5VA 3OAWA 3QDJA 2P5EA 1WE5A 3C60C 1TZGL 3A24A 1CJYA 3BAXA 4XBEL 3IGFA 5F7BA 4MJ6B 4XAKE 2WMPA 1ZLEA 3CMOH 2XTJC 4UT6A 1VGKA 4E41D 3W0WA 4JR9L 5I5MA 1GTFA 1EEQA 1FAIH 1DDHB 2Y3NA 4GXUN 3DJ9A 4XVTL 3T6XA 1H6EA 4L4TD 2EC8A 1DEEA 5JLZA 4G70B 3JVGA 2V17H 2F7RA 4ZOBA 4E9VA 4L1HA 5FM5O 2XG5B 2P8PA 3NJGA 4XC1L 1TQBB 4JY6A 4LSVL 4AK1A 3H42H 3P02A 3BH8B 1MRCL 3CFEB 1UQSA 3D85D 4MD5A 4IRSC 1D7CA 4FFYH 4ODVH 5DZOA 3S48A 4AEEA 1MHPH 3NVQA 2TRHA 4JE4B 3BXNA 1T89A 4AKQA 5IW1A 4HWEL 4ADGA 2I9LA 4WFGE 4LO9A 1WBXA 4N0FA 5JOFA 5DJ6B 1BQKA 3UO8B 3IAGC 3K0WA 4I9WD 2CDEA 5AKVA 4WW1A 3MZTA 3MCG1 5F0LB 1FVDA 4HX1A 2ZCZA 2VDRL 1YEEH 2VWEC 5CGYD 2W88A 4AGMA 2AI0H 4IBSA 2HUHA 2I32A 2PCPA 2VAAA 4LAQL 4PV8A 1K2DA 5E0FA 4FRWA 3BVUA 4L1BA 1HWHB 4GRLA 3F83A 2X2UA 1P4LA 4MB4A 1TU2B 3L6FB 5CHNB 2OCFD 1BOYA 4JFYB 5AW5B 5T3ZL 2XOTA 5CU5A 1TMCB 4BQCA 1ETZB 4NZJA 4PRHA 4V1DA 5IF0B 1I1AA 1A0QH 3IT8D 4A2EA 3HG0A 3RWEB 1T04B 1G7IA 1GJWA 4BA0A 3UYRL 1AHWB 1SHMA 2CHWA 1GTNA 2WQ8A 3PV6B 3DV4A 3VSUA 3QEUA 3NCWA 1OHZA 3L3OA 4XXWC 4GBXD 4AIOA 4HEPG 3VFUB 3PFUA 4AQ1A 3DX9B 4BWUA 1LNUA 5FO9B 4UOW1 1OZUA 2WC7A 3CFUA 4G7SB 9PCYA 4PJ8D 2XPZA 5JO5A 4JLRA 1CE1H 1U93B 3LPFA 4K71C 3OKDA 2KYIA 1KJ2H 2GC4C 1QEWA 3KM1A 4J3OF 3G7TA 3CFNA 4XN9A 4UAOC 3B5GA 1Z2KA 2D2OA 2N7AA 2HRHA 4QOKD 4UYQA 4YDJA 3T1FB 4LHUA 1EZUA 4F7EB 2VISA 4BDVB 2DQMA 3C2AL 4KQ3L 1T6VN 2Q7AA 4PFEA 3UTTA 2YKLL 2WLHA 2XWZA 2VTFA 3NOIA 1H19A 1ZT7A 5KYUB 4YIQA 3TF4A 4S1QH 1HDMA 3VD1A 3OM3B 3T3PE 1CWVA 1HILB 1U8JB 2IV9A 3IJEA 5DHYA 5LG1A 1VHPA 5DUBA 4NKQB 3KYMB 5E8PA 4URKA 2CU9A 3VNYA 1Z3RA 3QJFA 5KSUB 1MAJA 3PGFL 2OTPA 3AFLA 3BUTA 5J89A 5F1KC 4AUYA 1YN7B 2VR7A 2XQ0A 4PJDE 1OLLA 1NC2A 3X12B 4YSDA 4I3GA 1TQUA 4JFDA 2G75B 4G8GD 2NR6D 1H3WM 4HD5A 4IIQC 3ARED 4XCFL 1G7QB 3SOBL 3HG2A 4JL1A 4P3CL 1HFUA 3IDXH 2DZEA 2G60H 2E27L 2DH2A 1MHHB 2XICA 1GZQA 2IAMD 1JUFA 4U4BA 5LGYA 5EEVA 5CP7A 2Q8AL 5JW4Q 4A67A 3F3HA 3F04A 1E5AA 3EYFB 2HJLA 3ARGB 2JIXD 4XPFL 3H1ZA 1DSFH 1YNTF 3LPWA 3C09C 1BZ8A 1U8LB 5DD0L 1AZVA 2GHZA 4XPGL 5JPNB 3WFCL 1BD2A 3Q9PA 4X50A 1MJUH 1R3HA 4Q9QH 3P77B 3MBED 4WKZB 5HHME 3U2IA 3PYCA 4MNQD 5DJZB 1ZV2A 3TBCA 4MMYB 1KB9K 1NCAH 1MNUH 4I3SL 3L1OL 3SBQA 2R7EA 2A9MH 4RMWA 1BPLB 2UXTA 4P07A 3I02A 1DVQA 1V3KA 4XHJD 1EERB 2D7PA 2XWTA 1RQ5A 3QNZB 4TPRH 5DQJA 2NW2A 2XWRA 1QUPA 4AVIA 1JDAA 5DRNA 4R8WL 3FU9A 2GW5A 4OLVH 3AM8A 5AOLA 2H8PB 2P42B 3TBVA 3QHFH 3WEOA 3KJ4C 1QLEL 1GC1C 4HZ1A 3C5ZB 3WL9B 2FD6L 5I75B 1T2QL 3JTTB 3QNFA 5FKPA 1Y6NR 3DX4A 2JCWA 3UBHA 4APQD 5AW0B 1FL5B 4PJ9D 1QWHA 5EF2A 2IGLA 1G9MH 1Q0XL 3MR9B 1HCFX 1PTZA 4IGBB 4N20A 4FLOA 4XMKL 5E5UB 3PLYA 1PKQB 2ICWJ 4BYHA 1DBAL 3P4NA 5E6ID 3VFMA 1JWMB 1N5YH 4QDGA 2A74A 2WLIA 3KDMA 5INCB 1XR8B 1XF3A 2F19L 2ZXQA 1BIIA 2DWTA 4HHGA 1OSYA 2H0EA 6CGTA 4U6VL 4LNRB 4X6BB 4G82A 5T3ZD 2XN0A 1WC7B 5EBWB 5CLYA 2APVA 4A7VA 1QWUA 4N8CH 4BSVB 2LABA 5LLIC 2OS7A 2BSBA 4KDVA 4P2RE 1JZ3A 1XF1A 4EQ2A 4I18A 2EH8H 5ENWB 5I73B 1NCOA 3QFDB 1D5MB 3DYPA 3PIQB 1ZTXE 3HI6L 4PJBB 5FUCE 1JIBA 2Y69B 3S5ZA 5HYSA 2VXQA 2FJHA 3DOSA 3IXTB 5KBMA 4Z6AT 4A68A 1ULVA 2NYYD 5C0CB 3HHMA 2HMID 3EJZC 4B0MM 3N44F 1BHGA 3GC3A 1MJ7H 4EF3A 1K3ZA 5LQBL 4JFOB 4F1SA 3QJZA 2VDQH 1HH6A 3UBGA 3V95A 4UIKL 5DI8A 4HGWA 3HZYB 1MJ8H 1I4FA 3GPEA 1ZANH 4BZ1A 5KVDH 1GYAA 2HTLC 5EWIH 5DVPA 3CV5A 5BXFB 4KKBC 3RDTC 4AQ8C 2C1PB 3L4TA 4GAAA 3SBWC 2EVGA 5J6HA 5AD0A 4YHIB 4ZMYA 4JG1L 4FYTA 4QO1B 1OTUD 4UQ2B 1SXNA 4JPVH 3RVXC 1DVFB 4LQFH 2O6FA 2YPLD 4TULH 3TEXA 5C6PB 3U1QA 5KZCB 3MRBA 5EO1A 5KW9L 2K78A 2JLPA 1WISA 2OL3H 4XGZB 3HLAB 2WZPD 2FB4L 3ARBD 3WN6A 1KYOK 2X6UA 4U2YA 3F6IA 1KGYE 1A7NH 3FFOA 1CR9L 3FO1A 4PD4J 2W65B 1R4XA 1MF2L 1QPXA 2DB8A 1XIWC 2EE2A 1PSKH 3HE6D 1CE6B 1TZAA 1WG3A 3MRGA 1JDDA 1H3VA 3AUVA 2IANE 3U4KA 3ETBF 1RLBA 4ZDHA 2FGWL 1RZGB 4WEBL 3EGSA 3IDGA 3PAYA 5ACZA 5CILL 1CK0L 4PJAA 4EI5B 4AK2A 4DKDC 2BCMA 4OCLC 2X4TA 3D51A 4JQIL 2NSQA 1KNOB 2E47A 5C0DA 1A8ZA 4OGXH 3HB3D 4UOW0 5T33H 4W9GC 4WY7L 3GJFH 2Y9RT 4HUKB 4WTZG 3RVVD 4GO6B 3TYGH 1WT5A 1YEJL 1PX8A 4XXDB 5J9PA 3OJDB 3WD5H 4DQAA 5AZEH 1IAIH 2ZNXA 3GRWA 4FQCH 4UILL 3W39A 2XWJA 2MKLC 4DWHA 3QUYA 1FAKT 2Q8BH 4PJDF 4OH2A 1EIBA 4L8BA 1U9KA 4M6MH 4ANUA 4I48A 3Q2CA 4JVUA 2R1YB 4JO4H 5T1KD 3UAEA 3QIUB 4YDKH 1Q0YH 3ETTA 4RMQA 4KK9D 4YK4B 1C9SA 3V4PH 4PEEA 3L5WA 4KROB 1QFOA 4Q6IA 3QZMA 1L9TA 3DOIA 1SOQA 4AITA 1A9BA 3O11A 4DGYL 1U3ZA 3SQOL 5FKAB 1C5DA 3LS5H 3Q2WA 4GS7B 1Z5YD 3FF8A 2L4OA 4F93B 2OSLA 4Z1PA 1AZNA 3EF4A 1BQSA 2DWDA 1F4XH 2DI8A 4WHTA 4X7TA 2X4QB 3PUUA 4L9DA 5L8LB 2EE9A 5DGRA 3MYZA 2XFXB 3VCLA 2VLRD 3VGDA 1JDCA 3PWPD 2D8KA 4HS3A 1FNSH 3RAJL 1OAUH 2FEEI 3DVIA 4IDJH 4P23D 4G6AC 1KEGL 3UCRA 2VR5A 5D7KE 4R97C 3HVNA 3QJHB 4PRPD 2BIHA 3EYQC 3QUHA 4KI1A 4OSUH 4K55A 4P9HL 2I7SA 4XZUB 1YLBB 5GGSY 1PD0A 1JTTA 4IRJC 3WCYA 1G9EA 2WN3A 3IDJA 4GINA 3BP7B 4U1NB 1ZLUH 2X89A 3NDYE 3BP5A 2LW3A 1JK9A 2GAZB 5E24E 1KGXA 2ZCHL 4HJIA 1BJMA 5K9QI 2C8NA 4Y19A 3F64A 3E6HA 1W9XA 1EAJA 2BM3A 1JI1A 3PL6D 4N3UA 3ULSA 5LVEA 4I0PD 3GZOA 1OM3H 1SJXA 4IKLA 5E00B 4DUWA 2F1EA 4I3RH 2VN6A 5DUML 5BS0E 2YAHA 5EO9B 3VXOB 1F6LL 1A9VA 2R29A 1PNDA 3EJYD 4FZEH 2XG4A 5IHLB 1JNLL 4ZX4A 1CGWA 3W9EA 4BQ6A 4D9LL 5CCKL 3NZ8A 2EXWD 4N9OB 3U48A 2CDGA 5GGVL 2ICEC 3WFDH 5T5NF 1LJMA 5F96H 3TC9A 4HFUL 3VXRD 1HKFA 1UXWA 2BC4B 3DV6B 1U8MA 3CFMA 2HT2C 5SWZD 1DQMH 4POZC 2XVBA 4G1EA 4PJFB 3MV01 2DQGH 3S4SB 1KN2L 3FB7A 2X4NB 3I6KA 3TO2A 4Y4KA 4ZUTA 4AW7A 3D2TA 1R5WA 4ZXBB 3IJHB 3PJLA 1TUPA 2DD8H 4MMXC 4XI5D 1BZDA 3P9WB 1MHCA 2BP0A 2PWEA 5GGTL 4LRIC 4DTGH 2BK8A 2NTFB 5F9OL 4RBPH 3RPIB 2HLAA 1OE1A 4H20H 4H25B 2DYPA 3V9CA 1QFHA 1L9NA 2BVPA 2LFEA 2FO1A 1BQUA 3IWUA 2H3NB 4FFVC 4KK5D 3W5NA 1K4CA 4PWIA 3O4OB 4P2OA 3L1GA 2G5UA 4MKMA 4HKBA 4UV7H 1DVSA 3MNWB 4PS7A 1FVEB 3BUYA 2ZICA 1ITBB 2J88H 2DTSA 1JS4A 3MBXL 4N2NA 1BBJA 4HUCA 3SKMB 5EOTB 4Z0BH 1J05A 1FBIL 2QPFA 4K4KA 1I85C 3DLQR 1UM5L 4J4PA 4XMWA 1TCRA 3MLXL 1H3UA 4MA8L 3SE6A 3FN9A 4JKPH 2RFXA 2ITCA 1KTLB 3DGGB 2ZNWA 4XO5A 3BE1H 2A73B 3QS3A 4AH2B 3BFQG 3LV3B 3NAAL 2W07B 4NZRH 2TSBA 1SXCA 3FFCA 2CG9X 3SJVB 2XTJB 3QO0A 5ISZA 4XNUL 1XSJA 4NN7B 4NZDA 3VFWB 3PQYE 4X4XB 2VCOA 1AKJB 2FJGB 3VXSA 1IKFH 2MCPH 4HDIA 4ORGA 3KLHC 3O9WD 5A2KH 1YSOA 3RJQB 3VW3L 4H5SB 3SPCA 2C4XA 3ARFA 4HQQL 2JVUA 2MH4A 3PF2A 3VQ1C 4PHXA 4KUCD 4N87A 1IAOA 1LO2L 1Z3GL 3VFOB 4FXLA 4OFYD 3CFCH 1FP5A 12E8H 1R1CA 4G7VH 4NLHA 1DVYA 1JL8A 1NDGB 1XR9B 4BQBA 1CVRA 3IMRA 4OUOA 2JJTC 4OBRA 1BQLL 1EGJH 1VKXB 2BNRB 2WXKA 3FQWA 4JHWL 4A1RA 1X9LA 4MQXC 4M1DL 4LCWB 1JXGA 3CDFA 3CMOL 3LIZH 2A4EA 4HG4J 1OAYH 43CAB 4HSCX 3L8QA 1QRKA 4LCYA 4DZ8A 2W0PA 4NBZB 2VJ0A 5IG7A 2G5BA 1RZJH 3HS0B 3REWA 3O0RH 3IRZA 1OCZB 4OF8A 2V17L 3RRQA 1AXSB 4F2MB 1Q94A 3IPEA 2JJWA 1IM3D 4BK4A 3MRFA 4PCKA 1AQHA 4EOWH 4G9FE 4FFYL 4N0YL 1T0NA 4ODVL 5T5FA 3NPZB 1FL6A 4FQJH 1UWEL 2OTUA 3H7BB 4KI5F 2D31B 3NT0A 5FFLA 5DK2A 4LLAA 1Y0LA 3TZVC 5F7YC 3VGFA 4RAUB 4E2OA 2A83A 1FQ9C 1PZCA 3TF7C 3JV6B 1YEEL 1FNGB 4K71B 5LNGA 2AI0L 5FW7A 4KMTH 2O5XH 4AYSA 4XH2A 1C08B 1PIGA 2EYRB 3NTCH 5C08D 1DFBH 1KGCE 4NC2B 3TT3H 3WS6A 4UAOB 4B9FA 2DI7A 4JRWA 1T03H 2BS8A 5IQNA 2BDNH 2B14A 3MOAH 5IJVA 5I1GH 2BOLA 4HU2A 3GPSA 4HJUA 3HJEA 2QPUA 4LSPH 3WYRA 4KI5C 1N6QH 2GTQA 3DMMD 5JR1H 3ECBA 3ROLB 2DQIH 1OQXA 2EAEA 2ZXDA 4NQDE 4S1DD 1K8IB 3DTUB 3QO1A 3UZQB 1MW1A 3GSQB 5D93C 5KG9B 2QMJA 4QXTB 4N2LA 2IADB 3MRMA 1FNHA 2VSCA 2A38A 6PAZA 2UVFA 4DO5A 1MDAA 3KWTA 2GJZB 1E8XA 1HQRA 1IEAA 1Z9OA 1J8HD 4JKLA 3FQXA 4JZJB 4XBGB 4C8XA 5HP5A 5C2BH 4WK2B 2DEYX 1CLVA 4IIQB 5DT1H 1D5BA 5B39G 1S7XB 2EACA 2J21A 3TCLB 1J5DA 1CE1L 3WEBA 2VQUA 3FU7A 2HAZA 5DQ9A 1XL6A 1KJ2L 1J5OH 1U41A 3TVMC 3ATDA 2V5MA 4JRYE 1KIRA 5CD5C 3IDNA 2GTZB 4WUUE 1JVOA 2P8LA 2PCFA 2AANA 3C09B 4XPBH 3MLPA 4IU2B 1ZPLA 1GHFH 4GEJA 1I3UA 4M62H 2VXSL 4WU7A 4G71B 2Z91A 3GSNA 3IDUA 1RURH 3L4VA 5HGGS 3QUZC 4MAZA 1KYUA 4S1QL 4KTGA 3FH5A 1U3HC 4HWUA 4MXQD 3DSFH 4ACTA 4CSZA 3ZOAA 3EXLA 2IPKB 3FRUA 4GQRA 3QIBC 1MFAL 4PG9A 2IH1A 3TOPA 4HLJA 4NT6A 1DN0B 1LWHA 2EDQA 5IMKB 4JCMA 3P9MB 5AOKA 1L5GB 5IWLC 5H37A 1E9PB 3DXAE 3ENEA 2FJFA 3VI3E 1S2EA 2ZSWA 3LCYA 3QWQB 4ZOCA 2X4OA 2HN7B 3OAUH 5MI0C 1BMZA 1YNTB 1LP9F 1G6VK 2EICA 1SUJA 2ESVA 5FB8B 2CNZA 1KXVA 3GIZH 5D5MA 4DEPC 1DO6A 3FUHA 5JHDB 2IH9A 4HS6A 1DTUA 3R18A 4BE5A 3DVGA 4DGUA 2DQHH 1Y07A 1MFUA 3B83A 5ICXA 3HG1B 5FYKU 3O45A 2H5UA 1MJUL 1G7JB 4R7VA 1N67A 2B08A 3ULUF 1DVUA 5ACLA 4F7KA 3BGMA 4GW1A 3BVVA 1KENH 5HVHC 2YIHA 1KELL 2A9ML 5FV1L 5HHVL 2GJ6D 3CUPB 3OMAB 2N4IA 3QDMA 4TPRL 1B0RA 2H6PB 3QISA 3ZZLA 5HPMB 2P5WE 4Y4KD 2X1QA 4FFZA 3VVVA 2R2EA 4I1PA 2QFRA 1WAAA 4Y0GA 3KL5A 4OZHA 2AEPL 4R4BB 4ZS6C 1SXZA 4RETB 1NOFA 4N6RA 4OW6A 3U9PH 1TTFA 1UACH 3MUJA 4NBXB 2A4CA 2DYPD 2GSGA 3D3VE 4NOBA 4QTFA 1IILE 3ULUC 1TZHA 4U1KA 1AMYA 2FSEB 1OT1A 3BQUC 2AJVH 3L1FA 3AMKA 1HSAA 4X6DA 5C3IA 3SY0B 1CGUA 3RDTB 1N68A 2A6DA 5I17B 5JW5A 5DJAB 2V7NA 5F7AA 1NANI 4XMLL 1XBRA 1T7ZA 1NL0L 5DC0A 2BNQA 4LOVA 3TEYA 1KT2A 4N8CL 4D9RE 2DWEA 3RYMA 5I6KA 3FQRB 3ERXA 1CXEA 2EH8L 1P4UA 3BP6B 3QCUH 1NCBL 3LMJH 5I8EA 3UAFA 3ZR6A 3ULVE 3NZHL 4KU1A 3JXAA 2G2RB 2AGJL 4W68A 1N3NB 2WQXA 3UGUA 4HOWA 1XBDA 5CR1A 1RJLA 1PEWA 2OX5B 3O2WH 3K2UH 1XIWB 2WCSA 4LLDA 4NQSA 2VDQL 1ZEAH 3U9UA 3LN5A 4WW2A 3IFNH 3BVNB 3PP3K 3VXUA 1QA9A 1NFKA 1I7UA 5C1MB 3SZ6A 4ELMA 1AD9B 5ISZD 3MU3A 2C9XA 1MJ8L 1OIOA 1ZANL 3X3GL 1MIEH 3QXTA 1LEIB 3MMEA 5F88B 4HBCL 1MW2A 2X12A 5KS9E 3GSNL 3KVPA 1SLXA 2BOBA 4YWGL 3GZKA 5A40E 2WTOA 1FYTE 5DA0B 5EOCJ 3UBXB 5AW3B 1ZK9A 5F1IA 4JFXA 5LHDA 3LVTA 2OR7A 4LQFL 2VLKA 4PHZA 3ALXA 4OLWL 4TULL 4XOBA 1KBBA 5C7XH 5HYJD 3OJVC 3SBRA 3LSOA 3DX8A 2OL3L 1F45A 1TEFA 3HZMA 3CN3A 4TQEH 3U6RB 3UGEA 2QSCL 3SB3A 3K2MC 4MMZA 1MSPA 3KPRD 1YNLH 5CAYB 3BSZA 5CSBA 4HK3N 1AGBB 1XGPB 3AAZA 4Y5YA 2G9HB 2IFGA 5DHVA 5F9JB 5JZ7D 4QRTB 2H0JA 2XFGB 1JPFA 3FQNB 3N1GC 5D1XB 4XVSH 1N2RB 1SOKA 4H1LA 4PRBA 2YPKB 3VA6A 1DUZB 2EQDA 4M8QA 3X2QB 3OX8A 3MLTB 3K4ZA 5T33L 1LXMA 2UUDH 4Q9CA 2KL6A 2AQ3A 4JGJA 3HNSL 3QR1A 2HRLA 4PJDB 5I15H 1RI8A 3CQQA 3DHMA 4MTMA 5F97E 3TIEB 2WUCH 3PWNB 3QDGA 1CI3M 1IAIL 4TLUA 2BJMH 4QRRA 4KKAD 3IDIB 5IROD 2Z65C 4JRXD 1YZZA 3DX7B 3MCLH 4PSPA 2CKBB 4AEIH 3HZKA 1Q9WA 1FJ1B 1TF4A 4JFHD 4JANA 3QORC 3KPLB 3L5XL 2AZAA 2JE8A 4DW2H 2YS4A 2WIIB 1JG9A 1FNFA 2OMZA 1OTSC 4JO4L 4YDKL 1D9KA 1W72B 3HPLB 3V4PL 3VRJB 1QSED 2WTRA 3ZDXE 4GUPA 3HBGA 4YDZA 2D0HA 3K71B 4CW1A 1XHHA 1T80A 2HG0A 1DR9A 1EXHA 5SWQA 3LS5L 5C0GA 5A3ID 2VB5A 4R90H 2ATKB 2BVEA 1A2YB 5IBUG 8FABB 2BIOA 4M7LH 1ZHBB 4QAMB 4H8QA 1HOEA 3ZU8A 4DPBX 3Q43A 4U05A 3U9UB 2VL5B 4NGHH 3V6BR 2V2WB 1HHHB 5J0BA 1MREH 1E8YA 1WTLA 2NYKA 1ZLVK 1UA7A 3RGBA 2XRAL 5F0MB 1KCUH 2N59A 4G6JH 3TV3L 1FNSL 4O4YH 3STZB 3SDXA 5L2JA 3NCYP 4IDJL 4FOMA 4YSPA 3UTPD 2X7LA 4KRPC 4AYFB 4LLYA 4M5YH 4OSUL 3JUYA 4ANXA 5DJXB 3CVIH 1AGDA 1RXLA 5KSBE 5CM1A 3MGTB 4PJ5A 2FZ3A 5IJKC 3GMRA 4YQXH 4QHLB 3QXUA 4DOHB 4X5PA 3BT2H 3F7QA 2F8VA 4K9EL 1MWOA 3TA3B 4F9PA 4MMXB 2XIDA 4B5EA 4RGOH 4O02B 2R8SH 1HS6A 1EZLA 5M94B 4BH7B 4ZX6A 1SVBA 1A6WL 1YEWA 3CN2A 4UM9D 2AFNA 5JIKA 2DQFA 4IMLB 3LQAC 5CSZB 4P2RB 4XNMA 1M2VA 4GW5A 3B6SA 4I3RL 2WLKA 5GISH 1RHHA 4FQXD 4FZEL 3COOA 3NMEA 2PW1B 1HNFA 1HNGA 3EBGA 4PH8A 4PP2B 1Z9NA 5DO2C 1D5IH 2QQNL 3D7PA 5J06A 4XP4L 2I85A 3WFDL 4GKLA 5C0RH 5F96L 5I1CH 3FKUS 5DZ9A 4YJZL 2EYSB 1ZVSB 3PFQA 1KTJA 5AL0A 4RA0C 2CBPA 1BG9A 1PAZA 1DQML 3E7JA 5D96B 4KVCH 5ALBH 5J13C 2DQGL 3FTSA 4AQAA 2GBVA 2AQ2A 4YBQD 3GB7B 5SWSD 3OGCA 4KXCA 3B5TA 3K6SB 2DD8L 3OSKA 4J3BA 4OFPA 5B1JC 3ZYZA 1SYVA 3V0GA 2BPBA 3FB5B 5IQ7L 1Q9OB 3IXAA 1Z5HA 5AVVB 5MENA 5FEBA 1OW0A 4H20L 2AKRA 4P8QA 4E41E 1YVLA 1L3WA 4NNXB 1UM6H 1JGIA 3PCYA 1Z9SA 5HJBA 4GG8A 4PGBB 1ANUA 1GPOH 3GGWA 2IIJA 3LAFA 4UV7L 1A14H 2HLEB 4N2GA 5CCGE 3MFFA 1J8RA 1QTSA 2J72A 1RU9H 2WXOA 2XWXA 3S35H 3UYPB 2FYYA 4R7DB 4FKKA 3KXFD 4Z0BL 5C0IA 2IANB 2EDWA 3RY6C 4CVUA 2VRAA 2ADGA 1KTRL 2QVMA 5CIPB 7CGTA 4PBVC 4B3EA 3OPUA 3BLPX 3K0YA 3SPGA 1EO7A 1FA4A 1KCVH 5F7LB 2HVJB 3UZEA 4HKZA 3KBHE 4MBOA 3RB5A 2X1PA 3DX1A 2Q7YB 1OP4A 5HDQL 4L3EE 4PRDB 2NX5A 2GT9B 2EDDA 2Z7ZA 3U7WH 2JF1A 5JTWA 3FB8B 2QV2A 2B9BA 4N2MA 5T1DH 4S1RL 4Q97A 5AB0A 3BW9B 1VF5C 4R4ND 1IKFL 2MCPL 2PO6B 4PJXE 1ZT4B 5EH1A 2R69H 4YXLH 4MAYD 4KK8D 5K9OB 2W9LA 4OFVA 1J5HA 1QSZA 4N90D 5JXAH 3VXMD 4NQCB 2PPFA 3CFKB 3H9HA 4ZG1A 3FT1A 5A2AA 1SRDA 5HY9B 4KO9A 3PS6A 12E8L 4D3CL 3FYEB 5HGAB 4LLQA 4G7VL 5E08H 2QT6A 1ORQA 5DEFB 3CGTA 4HT1H 3TASA 2DQ6A 1AO7E 2E4FA 1ITCA 2FX8H 5F3BA 1RK1A 4JPWH 3BHBA 4CBZA 1TETH 3CVHA 1EGJL 1H3GA 2O61A 1XGQA 2ZOKA 1TQSA 3ZDXF 3TZVB 3E8VA 1BVNT 3ZHNA 3OZ9L 4PJIA 4JFUA 4K3JH 3SZKC 3Q0HA 4XMZA 5HXMA 4DQOL 3PNWA 1DBKL 3M07A 3FBKA 3LIZL 4BFNA 3KLDA 4LLUA 3ZTEA 1GAFL 1D5ZB 1KF9B 4BCZA 5CFHA 1S9XB 1PZ5A 1TKWB 2ZUXA 2FQGA 1RZJL 3LEXA 2RMNA 3O0RL 1IQDA 2BLFA 4H8HA 3GSUA 3NSXA 3SPHA 4JK0D 3AWFA 3EFOA 3AC0A 3V4VA 3TWCH 1B3JA 3VX1A 5KBPA 5JOPD 3GIVA 3L7FB 2NY4B 1G94A 1QRNB 4ZQKB 1JK8B 5F7WC 5D1QD 1N8OE 5L4IA 5D93B 3RWJB 4FQJL 4HH9B 3WMSA 2FJSA 5FM8A 1F86A 1KCLA 3OHMB 1NANH 4ZMVA 1MCRA 3U0WH 1RPQA 3EYOB 4D0DB 2GUOA 1I8UA 4WSJA 1ZLWK 1SM3H 1KGUA 2BMKA 4PB9L 1UEYA 2EO9A 3PP4H 3EG9A 3K8LA 5CCKH 4E9RA 3FQTA 2DLGA 2RQ8A 4A7QA 4M7LT 2C9SA 4KMTL 2O5XL 3B9KA 1INQB 3BVDB 2B3RA 2Z8SA 1TJGL 3CSYB 2R0ZH 3K91A 1LMKA 5E8EA 5F70A 3TVMB 3SCMA 3ZRSA 1P84J 4ODHL 4AJWA 5K9KB 3TT3L 3U7AA 4P5KA 4WSKA 2X42A 1AC0A 3T4AC 3BKJH 1IJNA 3V0AC 3WNMA 1UZ6E 5IB5B 3MOAL 5I1GL 3OKMB 3MX0B 1F13A 1N6QL 4KXZI 4WK0B 2AZUA 2QHLA 1E0OB 3OJMB 1E9OB 1MCOH 1OGPA 2DQIL 1S9YA 5E4OA 4Y8DC 1U3HB 3RIAK 4EKJA 4MNQE 3O6LH 1HEZA 1EZVY 1PX4A 1YMMD 5FYLH 3QIBB 4Z77B 2YSSA 3CPLB 3EDDA 2QSTA 3QJOA 5I2IA 1EAQA 1ZTMA 3VGGA 1P9MA 1HZHL 2Z31C 2QDWA 4NRXA 5ETUA 3MRCA 2O1AA 3N04A 4U33A 5I0VA 3SKJL 5I0DA 1S7UA 1RJYA 4P2QD 4AIEA 5GRUL 5I1IL 1A3RH 1OK8A 3FUFA 1J5OL 2GY7B 4NNPL 3U2JA 4DEPB 1A21A 2RD0A 5EFIB 1WFUA 3MLRH 3P9LA 4XPBL 3TN0A 4U0RC 4QGYA 3TBSB 3U25A 4M62L 5A2LH 2J44A 2DWSA 3UAJA 1KGIA 4J6IA 3HUJE 1MHEA 2CAKA 2RB8A 2Z8VC 3DSFL 5T3ZE 5HVHB 3V52L 2HJFA 5KYNA 3INOA 1G6RA 4ANWA 2NLJA 1GOGA 1LP9B 4GB9A 3NIGE 3FQ2A 2A6IA 3SD2A 4A55A 3CHPA 3VE0A 5I66B 1J12A 2GBAA 4P0DA 3TFKC 3HHSB 4YBHA 2XDHA 5KWYC 3UTSD 3KPTA 4GT0A 3OAUL 1NDTA 2J2ZA 1BBDH 3I3DA 2Y5EA 1J5IA 5I18H 1H0DB 1E27A 1JMXA 1JV2A 3VQMA 1HX0A 1NBVH 1PW3A 1CLCA 1PZUB 2VGLM 4MA3B 4ZAKC 2IPUK 4AL8H 3CLFH 3MLYL 4GFTB 2CLRA 4PJXF 5TPWH 3FT3A 4GG6E 1RCYA 2WYHA 3BQUB 3DRTA 1G9NL 3BUQA 1EEZA 2DQHL 3FHQA 3QS2A 4JM2F 5AYUL 2FQEA 2ZOTA 3F12B 4LXFA 3RVTD 2JKWA 4F3FB 5D7JA 4N0UB 3VXPB 5A7EA 1FO0A 2IPUG 5CN2A 1N59A 2J55A 3QULB 3VSQA 4YMPA 4IBVA 3UBXI 3IU3B 1R3LA 3RWGA 3VGAB 1QI4A 2E5EA 2H2PD 2ORBH 1QTYT 4IS6B 4OVUA 3PDOB 2WB1A 1KPUB 5C0EB 2UVEA 5HI5C 2DM2A 4BE6A 2GUYA 4NQED 5MHSD 4EIUA 3O6MH 1WQVT 5E2WL 1KXQE 4AI7A 5KVFE 3QP3A 5FYKL 4IQHA 3TU6A 4ZMTA 3ORJA 3V2AR 3U4BL 4UQBA 3GI8L 1LM8V 2KLTA 3LH8A 1M05A 1ZDQA 2OSYA 1RIUH 5D6DC 3U9PL 1V7NH 1UACL 4ODUB 4TL4A 2X9XA 3ME0B 4KVNH 3WFEL 4LU5H 3W0WE 2AJVL 1PG7W 4MJ2A 2QPSA 5C6TL 3LKOA 4ZMWA 4O51B 3ASWA 1PZ2A 1J87A 3NH7H 1WLHA 3QWRD 2ED6A 1BXAA 4RX4A 1X5GA 2K6WA 4KOCA 3UTQA 5E7BA 1UWGH 3BLBA 1I3VA 2MPAL 2QSQA 1FZKA 4RZKA 1DQDH 3S3CB 2JJSA 3LJ3A 3MV7B 3QCUL 3WY4A 4YL4A 4DZBB 3LMJL 5KN5A 5ABAA 3DUSB 2F53D 1WFMA 3H0TA 4ONFH 4PCSA 2NSXA 1IRAY 4QLWA 5FK9B 1EUTA 5DZVA 1XEUA 5FO7A 2VMFA 4DAGH 3O2WL 4X9IA 3K2UL 2FWSA 3HKZA 5HI3C 4F7MA 4HK0B 3Q8AA 4BFIA 4LBAA 3IFNL 4X4MA 1HEJC 4B9ZA 4N8VA 3LZNA 4JO8A 1JNHB 4P5TD 1JWSA 2MWCA 5KVGH 1Z0NA 5DHEA 1I1YA 4I8DA 3U4EB 3VX0A 1JF6A 4AC4A 4BK5A 3CWGA 1XGUA 1BF8A 1MIEL 1U8HA 3MJ9H 3HS8A 3WLWC 1XH3A 4ZUWA 1XO8A 3RWDA 1Q1JH 2GCYB 2IFFH 4JDZA 4KQ4L 2J6EH 4L4JA 4OGYH 1G0YR 5EOCL 1G6RL 2VLRE 5IFHL 1GVIA 2C3VB 4NP9A 3PWPE 2FQFA 3ZDYB 5C7XL 4YSEA 2AS5M 4JG9A 1P1VA 3EHBD 3QI9C 2EEDA 3N06B 3SDDD 4HIEB 4RWYH 4HEME 4XWGH 4AQOA 3JWNC 3KEHA 3QORB 5BJTB 4IBQA 2QADD 3ZL1A 3WAJA 3A67H 4CN4A 3WIFA 4XNYH 2OW7A 3QNXA 1KXTB 3P4MA 1YNLL 4WUUB 5A2FA 2F18A 2WZAA 3NEXA 5IOPB 7PAZA 1F4WH 1G7HA 1QSFD 3KGTA 2F7IA 3CDCA 1LVEA 5DZJA 4XVSL 4YS4A 1IO4C 1J0YA 4WAFA 1UJTA 1EHNA 1BMWA 4P46D 1UYWH 2D7OA 4O2FB 4PJCB 3VFSA 1AS8A 4GXUM 3MTXA 5I15L 1BZ9B 1QI5A 5GZNC 1JNNH 2DLTA 4AQEA 1XMWA 4FCHA 4MQSB 4OF7A 2WUCL 1KYAA 4C56D 2RA1A 3P54A 2DLIA 1QPKA 3GXPA 2YZ1A 3L3JA 3CZSA 4ZX5A 3L3DB 3OB0H 4Y2OA 5FECB 4Z18A 3NIGF 3RTQD 1NSNH 3VXRE 4AEIL 3MUGB 3TCXA 1UUNA 1V55B 3BPCB 4K8RL 4NENA 5EB9A 3LNGA 2CBMA 5CGTA 5SWZE 5DJ2B 1F1AA 5IVZA 2P9RA 2DH3A 3KLAA 3Q3GB 4CMHC 1SDYA 1O7DC 2WD0A 2XY1A 2BVQA 3VDBA 2FL5A 4HK3J 4JFSA 5I1LA 1KTKE 5FYKD 2F8XC 1A3LH 1KTDA 5E4AA 1IX2A 2ZJSH 4ES9A 1AZUA 3FXIC 1PJ9A 4XP1H 4AW4A 2EINB 5HDBF 1K5WA 4M7LL 5IB1A 3ULAB 1TJHL 3ZKMC 2BP8A 4H0IA 5C0JB 3BKCH 1LEKB 2G3ZA 4J3OH 1NGPL 4E0RB 4YFEA 1UD4A 1GXEA 1WFNA 1U92A 2OCCB 3QZWB 1F58H 1FG9C 1H6TA 4PJ7A 4M7ZC 1J9RA 2P5WB 5AW9B 2VN7A 3NSCA 1VCAA 3LB6C 5DMKA 1IBHA 4HS8H 5BQ7A 5KYYA 2WAHA 2HX8A 2CLVA 2ZKHH 3II2A 1F02I 3TJEH 1JGVL 2SEBB 4HCFA 4KV5E 5BO0D 1I7ZA 2WQAA 1QO3A 2AJSH 4FTVD 4IHBA 1E4WH 2PYFB 3KJ6H 4FG4A 5J13B 3D3VB 4NQXB 2JCCA 3B43A 3LH9A 4YQXL 1GMEA 3P4OB 4YVNA 3SO3C 1DVTA 4AM0B 3HMXA 1F18A 3NCFB 5CINL 4YLQT 4WO4A 1OXYA 3MRJB 3TBYB 1U8QA 4F9LA 4X5WA 2R8SL 1NUFA 4N2IA 3RGVC 2R9HD 3CAFA 3O2VH 3CN1A 3SE4A 1CN4A 5IVXE 1A6PA 2BIMA 3B4NA 4LHQB 4H2CA 1CICD 4NO0D 3A3YB 4I5BB 3DKHA 3UG3A 3DK0A 5GISL 2QHRL 1MCDA 4PWKA 3T9WA 2IWEA 4H2AA 1RK7A 1F56A 1D5IL 4G7QB 2JH2A 1ADQH 1UD2A 4LBEB 2DLHA 3KLSA 1LEGB 4P57A 5CNHA 5EF0A 5AW6B 5F9WB 1O9WA 1IC4L 4P4RB 3T6ZA 3IMUA 4CMMA 1YO4A 2DM4A 2WZ5A 4NJAH 3HR5B 4Q56A 5K59E 4XMXA 2V2TA 1I3RB 5ALBL 4ZUSB 2IEPA 1CI5A 4KVCL 5AW1B 4XMVA 3TL5A 4KXZH 2OAAA 5K69A 3BAYA 4EAEA 1PY4A 3FU8A 4GOSA 3WNLA 4Z3JA 2R39A 3D2UB 4L8SC 3ARWA 3JVGC 3L9RB 4XWOD 1JMZA 5IK3B 4K15A 3CN0A 4QRFA 5TQ0H 5TJWK 2ATPA 4OZFG 4X9BA 1AIFB 3O3DB 3K4DA 3ILQD 3RI5K 1FFRA 1O9ZA 2LU5A 1J0HA 5ESAB 1LGVA 4A38A 3BWAB 3FUJA 4F8TA 3ZL2A 3FZUD 1E6JH 1EVUA 1QR1A 4QRSB 8PAZA 2YGVA 3HZ3A 4P5MA 1A14L 5KJ7E 1A6UH 2ZKXA 3CHQA 2CA4A 3S35L 4K9JA 2E6QA 4ALAH 1LK3H 5E8OB 1KJVB 4Z9KB 3X13A 5D2LA 4KDWA 5AW4B 3D0LB 5CJOH 1H5BC 4AQZA 5C8JA 5BUAA 3C6LA 1OE2A 2IALB 3QQDA 1XDTT 1URIA 1T21A 2B16A 3NA9H 4OBSA 1EDQA 1KCVL 1HXMA 1T1WB 4L3CB 3QRGH 4GRLC 1X6NA 2PTTA 4X0KB 1FZOB 5L8JB 1SHSA 5KYXA 1CG9A 3W9DB 1OD9A 3U7WL 4HJ1A 1BLNB 4QLRA 1QPPA 4JMXA 4DP7X 4RFOH 2ED9A 1I1AC 4QHUB 3D39B 2WYZA 1ZT1A 4LPWA 4F57L 3HN5A 5C08E 3S37X 3K1DA 3MJ7A 1WP6A 4PJAE 5D7LA 1M7DB 3PRZA 5GGUB 1CFBA 5DEGB 4YXLL 4WI9A 2BHUA 3V5HA 2XKUA 5E1IA 2OR8A 1ZHNA 5JXAL 1JD9A 1Q8MA 4ADJA 4F8PA 1RZKH 3K4AA 1BQRA 1THAA 1TYJA 2V2XA 3AY4A 5E08L 3ZDXB 4AQ1C 3JWDL 2QKSA 2MEJB 3EJPA 3HFMH 3LKQB 1HCVA 4HT1L 4WI0B 4UZSA 3RU8L 2FX8L 4U1MA 4UMSA 4JPWL 2WP3T 4Y1AA 4R0LC 1TETL 4LFHD 2OJEA 4HULB 2R56H 3CSFA 3KNBB 3B5HA 2XQBH 3A6CH 1EZSA 1J8HE 3EO1A 3FL7A 3OLDA 4K3JL 5HYQB 5IIEB 5EBLB 4FQHB 4R6UA 2NT1A 3PPSA 1FLTX 2NY2C 5LDSA 3VWJB 1WYJA