4N8CH

Three-dimensional structure of the extracellular domain of matrix protein 2 of influenza a virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
b'QVQLQQSGPEVVRPGVSVRISCKGSGYTFTDYAMHWVKQSHAKSLDWIGVIGTDNGNTNYNQKFKGKATMTVDKSSNTAYMELGRLTSEDSAIYYCARRDRDDVWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of monoclonal antibody
publication title Structure of the extracellular domain of matrix protein 2 of influenza A virus in complex with a protective monoclonal antibody
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 220
sequence length 220
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n8cH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n8cH02
3IJHB 3KPNA 2ERJB 2WQRA 5C0CE 2Y5TB 3T4YB 3WKNA 3HG1E 1UA6L 3TPUB 2XWTA 5LKNA 3Q3GB 3C8DA 3VXSE 1K4DB 1GGYA 4PUBL 1R5VB 2CDEA 5GGUA 3WEXA 3C60B 3FB5B 1FBIH 4KJQC 5JO5A 5F1NA 4ZAKB 4CUCA 2MMXA 2OTPA 4P59L 1OP5K 2V5MA 2YUXA 1BOYA 3H9HA 1CE1H 4HKZA 4LLWA 2V5SA 3HAEA 3LHPL 3BP6B 4R26H 1YQVL 3ZKND 4QGTA 2WAHA 4NC1C 1KTLB 1BFVL 1HOCA 1V7NH 2ARJQ 3QG6B 4V1DA 4JGUA 3UX9B 2OX5A 3ULUE 4OD3H 3QEQA 1CF8H 1WCBB 3TIEA 2CKNA 2APVA 4MQTB 4DN3L 2Q3ZA 1OP3H 4YBHA 1MQKL 5GZNC 1B2WH 1NCCL 2FX9L 2AJYH 3MYZA 4CADB 2Q1EA 2V7HA 2JLLA 3KYKL 4NQDB 4L9LA 4DKFL 2P24A 3BXNA 3DI3B 4JO2H 1KV3A 2ZUVA 1HKLL 2ENSA 5AUMA 5EOCJ 2CLRB 4B50A 5C07D 3I6LD 5D7KD 2YD3A 1T22A 3HMWH 1EEUA 1S7XA 4HS8H 1JUFA 5KVGL 4ZSOA 3QEQD 4MQXC 3RY6A 3L6FB 3IKCA 1ZT4A 1DQML 1WK0A 1GSMA 4KGJA 4AIZA 3QEHB 4HUNB 5I18L 3KWWB 2I24N 2V9TA 1E6JL 3JVGA 5I1EL 5ICZB 2BDNL 4WFEE 4EDXA 4YHZL 1EXUA 3Q6GH 4DN4L 5ACLA 4H26B 4CU8A 1I7UB 3F58L 2NR6C 1MHPL 4PJDE 1EGJA 1HCFX 2Y72A 2VZSA 1OP5H 1P69B 5ENWA 4UILH 3BIBX 2E7HA 3DX9B 1IGML 5FCUL 3MRFB 2IANB 1PSKH 4NKDA 2CLZA 3VFGL 2CIKA 4OIAA 1HXMA 1K3IA 1ZVSA 2ZNXA 4WFGD 1I9JH 1D6VL 3ARVA 4MLSA 3WS6A 4YK4C 4DJMA 1QA9B 2Q20A 4OGYL 4L3EA 3ARBC 1NAMH 5E08L 3LDBC 5E6ZA 2VLJE 4PLKD 2GAZA 1TQBB 3LEYL 4E41E 1AGFA 1U9KA 1FO0B 1F11A 4AH2A 2X4QA 3SGDI 2KZ1B 5TDOB 3ZT6A 2O26U 1O7VA 1DE4B 2VWEC 1NFIA 1WWWX 4UINH 2W65A 3VI4F 1QACA 4KVCL 4G6MH 4RMVA 4CKVX 2OJZL 2MSPA 1DQLH 5J1TC 5FAAA 3RGHA 1KLFA 3UYRL 4WENB 3LZFL 3VFMA 2DQEH 4LHUG 2VAAA 4KZEL 5GIRA 3RHWF 3ARBB 3NA9H 1X5JA 3LDBB 4QRQB 2P5EB 4OKDA 4QF1A 2N1KA 5F70A 1A64A 3MO1A 1QTYT 5DEFA 5I8OH 3BAEL 4Y16B 1I8LA 3LS4H 4LIQE 4PJHF 5MERB 1PQZB 5K9QI 3MJ7A 4L4TE 1MREH 5JW4N 5F7HA 1ZEAL 2I26N 2XQBL 3UAJC 2NY6D 1A14L 2G5BB 1N0XH 2V2TB 3C6SA 1KB9K 1J0KA 3SE8H 2XI9A 3S6CA 1M1SA 4PRDB 1QSFB 5HSFA 2NY0B 3LKOA 2MHAA 4K3EH 5CINH 4L1HA 5J1AA 2G2RB 3PJSA 1WVZA 4M5ZL 2F8XC 4MXWL 1WFNA 4IOFC 5DD1H 4UOW1 5DA4A 5DR5H 4UV4H 5FM4A 3VE0A 4PP1C 1RMFH 1I1YB 4HK0B 2BHZA 4OUUB 1OAKH 3TCLB 2ZWLT 1G0XA 1T1ZB 3MV01 1I7ZB 4YO0A 4PJAB 3GMPA 3AXLB 2WBKA 4U6YB 3QNXB 3FT2A 3JV4A 3IF1B 5EU6A 4WV1A 5JR1H 3LQAH 3ZL4L 4NHUB 5HDBF 5DJCA 1WISA 3BRGC 5JPMB 4WUUA 3SGKA 2VZUA 5JLZA 1LMKA 4U33A 1JNHB 1QLFA 3QFJB 2CGRL 5FDWB 3T2OA 5FB8B 2JJSC 2GSGB 3GHEH 1ZGLP 2EDFA 5DHXB 2YD6A 1MCPH 4Y4HC 5I1DA 1R6VA 3VWKC 3TO4C 2F74B 3BWAB 3BIKB 1DL7L 4JO4H 2ICEB 3NFPB 5EG6C 4X9FA 5HVWA 4G9FE 1TJGH 3CFKA 1LNUA 4TQEL 4XCYB 1K4CA 3A0OA 4OD1H 4HC1L 3GK8L 3QDJA 4XVSL 3CFCH 4OZGA 3X3FH 5J3HD 3RWEB 4YHYC 3MRRA 3EDDA 4NO3B 3MLWH 1LE9A 3PABB 2R1XA 2Q76A 1XGTB 1OGAE 4F15B 2R4SH 3RZWA 3OZ9L 2QTEA 4Y4HB 1JGVL 2VABA 5MENB 4LHQB 5HTSA 2JKXA 1U8KA 4MQ7A 3GM0A 4WJ5B 2AV1B 2VH5H 3P9LB 4OZHE 3STLA 1G9NH 1T5XB 2LAAA 2PYEA 5FO9A 5LGHH 3VG9C 3QDJD 1VENA 5GJTH 1KNOB 3RWGB 3VMOA 1N6VA 4YHYB 3VJ6A 3FO1A 4CRPA 4M7LL 4FQLL 3EYSH 5KSUA 5E0QA 5HBBA 3LV3A 1F90L 3D2UB 1U6AL 3DARA 4I3SH 3JWDC 5JORB 1KEGL 3MLTB 2ZSVB 2VL5A 1P84J 4WHTB 2ENYA 3V0WH 4Y89A 5EO9B 4LEOA 4Z7WF 1Y18A 2AAVA 5E70A 2EO9A 4IJ3B 5ITFB 2WINB 4OFDA 3VG9B 4FXKA 2GJZA 2N4IA 2BY2A 1NUDA 1VACA 3AY4A 1GZQB 4NN7B 3EAKA 5BXFB 1IKFL 4HG4J 1KJ2A 4F7MB 3BEWB 3UPCA 3VD5A 4D0CA 1O0VA 1UA6H 2HLAA 1FZKB 1GGBL 4NSKA 4M03A 4LGRB 2MKLC 3ZKMD 2I9LB 3CSGA 4PUBH 1ZS8A 3S4SB 3NIDF 3OTTA 1EHXA 1M7IB 4GRLA 4C83B 4F37F 3DRTB 3EO1A 5F93C 1H8SA 2C9AA 4M93B 3L3DA 5DMIL 5IJKA 3QQ4B 2YRLA 2AXGB 4PJ9A 3LHPH 3D39A 4NO0A 1NAKL 2HTLD 2GUOA 1YQVH 2CR6A 1BX2A 2KQNA 2QHLA 4GRWB 3T4AA 3ARUA 5MEQB 2QHRH 3MMEB 4Y19E 5IMMB 3DBXB 1TCRA 1OWWA 4FS0A 2R1WB 1QRNE 3T2PA 1YZZA 2BSTB 4XP4L 5JNYB 1N59B 4ODVL 1QLEL 4DN3H 2X09A 1TNMA 2GK0B 2HKFL 5E24E 1H5BC 1MQKH 1KLUA 1CTOA 4R97B 4HKXB 4KTYA 2YZ1A 3KYKH 1WT5C 5IB4A 2DICA 4DKFH 1OW0A 4NO0D 4L3CA 4PGCB 5DDHB 1A3QA 4MHHG 5KW9H 5HI5D 1HKLH 1WUNT 3VH8A 2F8VA 3OHXB 5IWLA 3MLSL 4F8QA 3CH1A 2HN7B 5K9KA 5EIVA 1DQMH 1T66C 2OR8A 3MGOB 4ODTL 1BQHA 1BOGB 1N2RB 5I18H 4P46A 1E6JH 1DN2A 4H20L 2BDNH 1ND0B 2WIMA 2R0KL 4YHZH 3V6OA 5I1EH 4OCSL 4DN4H 4MB5A 3TBSB 3WUWA 1U42A 5FCSH 1H5BB 3F58H 4PY7A 4BKLB 4OFYA 3GMNA 3VFSA 4MX7B 1JZ4A 4HZLB 1AP2B 1UJ3B 2KBGA 3S5LG 43C9B 4I18B 4I5BA 2H26A 1IGMH 2A6JA 5FCUH 5IB1A 3VFGH 2C1OA 5D1ZC 1D6VH 1HQ4B 1I1RA 2J8OA 4WRLA 3K8KA 3MRPA 3KYNB 2C7UA 5I8KL 2Y4SA 4HH8A 4LP5A 2IPUK 5FO7B 4XTRD 1FFNB 1FSKC 1SJHA 1AC0A 3LEYH 3KDMA 3GGWA 2A0LC 3PXHA 4OFYD 4B7IA 1LILA 1JFQL 1YECL 4N5ED 1JPSL 2QLVB 2AEIT 2DQJL 2DQFA 1KXVC 1F6LL 4RZCB 5ANME 2IBZY 4JZNA 4DUVA 3DJ9A 1A1OA 1FLRL 3ULUL 3MNZA 1U8LA 5EZJB 3WFBL 4K8RH 3RI5K 2PCPB 4KVCH 1F3JB 4G8IB 3DHMA 1UENA 2BNQE 3IVKB 5D1ZB 2J8UE 2EXYD 3QHZL 3UYRH 1T6VN 3CH8A 4JANB 1ZA6A 3SDXE 5CWSA 1S3KL 2YMXL 3H2WA 4PP2B 3GB7A 4U1HA 4UTBL 3OL2A 3MLVL 2HVJB 3NH7L 3O4OB 5FYLL 2VQTA 1YQ2A 5DMGC 2YA0A 3WLBA 5IKCA 5HHPA 1TZGL 5D93B 4EVNB 3WS6C 3BAEH 3L3OB 5EUOB 4Q58C 5AZEL 3O45B 2VXQL 4LCYA 3H9YA 4TPRL 4JHWL 4G6FD 1A7QL 3P4LA 1PLGL 3G08B 4U1JA 1RJYB 4ZFZA 5KJRL 1A6PA 1XAUA 2J5LB 1ZEAH 5DUML 4U1SA 5IESL 1CS6A 4N8CH 5JPNA 5JDSB 1CFTA 4Z76A 5E8NA 4RA3A 5E7FA 4TTDD 3FQWA 4EUPG 4MXWH 4XP6L 4ZPTA 5L2KA 3MFFB 1RSFA 2X2YA 4N1HB 4PV9A 4FQPA 3V6FB 1R24A 1EHAA 4P5MB 1NUFA 3G5ZA 5C0DA 1TPXC 1KGCD 1TCMA 2E6QA 5EBMB 5GGVY 1WEJL 2AK4A 3ELAT 4M9PA 4OLWL 1ZHKA 1HWHB 3C8KB 3MV8B 4FQXA 2F53B 3K4ZA 3ZL4H 4D94A 1I8IB 1CR9L 4LSSL 4HUMB 4D3CH 1HH9A 5F9JA 5IT2L 1J10A 5L2KD 4Z8FL 5L6YL 4PG9A 2CGRH 3T3ME 4HWUA 1E4KA 3VFPA 5SWSA 2C3VA 4XHQA 2GITA 4TOYH 5L7XL 4MJIA 4LPWA 4OGXL 5T1MB 1TPXB 3OF6A 4Y5XA 3ZKXC 1FN4A 4KHTH 3HUJE 1DL7H 2AK4D 1LE5A 1ZLWK 3UTTB 2PKDA 4WO4B 5FOJA 5GSVB 3CSPA 3O6FC 4TQEH 2FSEA 3GK8H 2CLVA 4XVSH 4TVSa 4KTEL 4UAOC 1D9KA 3MXVL 2W0FA 2X1OA 1EHLL 1UYWL 2A83A 4GAGH 2YBRB 3LPGA 5IV2B 4LIQL 5HJ3B 1YY9D 4GH7B 1FVDB 1WAAE 2OTWA 4M61A 3U7AA 1KACB 4LKXA 1ZLUK 1JPGB 3L5WA 3BEVA 4MJID 3BVNB 5ACZA 3DPBA 5E5UB 8CGTA 3OF6D 2YPVL 1PKQB 3DVIA 4PRID 3WD5H 1JGVH 1TTFA 5DK2A 3LPFA 3EOBB 3DX8A 4NCDA 2AXFB 2VMFA 5DC9B 3DROB 2Z92A 5KZCB 1EH9A 4TUJA 3RUGF 5GZOC 4OCYL 3P9WB 5BS0E 1D9KD 2A1WH 4JKKA 5E2WL 4P2RB 4UAOB 3U7YL 5CP3H 3VFRB 4M7LH 3WIFA 1M05B 2BOCB 2EDDA 5EU5B 2DLFL 1F90H 4KKNA 5E1HB 1U6AH 2A9ML 3G6DL 5I1AB 2A6DA 4FMKA 1S78D 1KEGH 3VA2C 4IIQC 5AD0B 1EFXB 3QG7H 3FZUD 1D5XB 5JHLL 2XY2A 4PGJA 3UBXG 3QFDB 2YS4A 1MCCA 2XN9E 3RWFB 3T2NL 1K4DA 1ZGLB 1AO7A 3HN3A 2Y07L 3O41A 4M1DL 4NQCB 1A1MB 5HHOE 4HIIA 4N0CC 2E7MA 4NN6C 5EZIL 5LCVL 5IHUL 3ARZA 3T04D 1XGYL 5E7BA 4F2MB 3EYQD 1GGBH 2VLRE 3LY6A 1BGXH 5FYJE 1C5DA 1PEZA 2QADD 4FFWD 1KTLA 5IK3A 4OSUL 1U3JA 5GGQH 4PLOB 5GGRA 1WCBA 5DMIH 5HGAB 4PB0H 2A2QT 5TH2A 1AO7D 2P43B 2GTZA 3SKOB 3LIZL 4ZTOL 2EYTA 3RI5F 1DQQA 3FQXB 1NAKH 2VXUL 4MD4A 1TDQA 5D2NE 5KVMC 1CICA 4NN6B 3N1PC 1QR1B 3M17B 1A4JB 4RMTA 1Z6JT 4X6CB 1GOGA 4K71C 5HDLA 4TUKH 4CDGC 5E6IC 5ITBH 1E28A 2CLRA 5D7LE 5AEAA 5KSAC 4XP4H 1ZE3C 4PJ7B 3OKMA 3GRWH 3FFDA 1QLEH 5BV7L 5T1KA 3UZEA 2FLBT 2HKFH 5C0GB 3HAEG 3CX2A 3L6FA 4MHHI 5B39G 4KI5C 3I85A 3KWWA 3WNLA 5ICZA 2XOTA 3MRBB 3SDCC 4LLYA 2Y36L 1A3RL 1IEBA 1FQ9C 4ZUSB 4XNZC 1CICD 4LDEB 5F9OL 1KT2A 2R2BB 1PYWB 3MLSH 3CXHJ 1LP9E 4LCWB 1UVQA 3B3IA 4GRLC 3IS0X 4K71B 4ODTH 1A6AB 5C9KA 3MJ6A 4U6HA 2R0KH 1J8HA 4DUXA 4OCSH 4GAYA 5CKAA 4FA8A 3RKPA 4BZ1H 3V2AR 3UROR 3QJHB 5FYKD 1NGQL 2VO5A 1BBJA 3SDCB 5DRWA 3UTPD 2PNDA 1T21B 1REIA 4LPUA 1G6RH 1QQDB 3CZFB 4JHBA 3SGDH 2YHGA 4Z7OF 4NKIL 5TDOA 3MNWB 3D3VE 1I8MA 5I8KH 3C6LC 3SOBL 2EYRB 3KPOB 2IAND 4DZBB 1T7YA 3S7GA 1TQCC 4LARL 3RVVC 4POZD 4E9LA 4EJ1C 4XVJH 1DSFL 1JFQH 1YECH 4PGBB 4A6YB 1GGIL 3QPQD 1JPSH 1LK2B 1TNNA 2DQJH 1XGRB 1ZT1B 4HPYL 1ACZA 2VDPH 3LN9A 3ULUH 3WFBH 1MY7A 3HI5L 1NDMB 4LSRH 1I8KB 2E7BA 2V17L 3ARYA 1C16B 1LGVA 1ZMYA 1F4WL 3EO0A 3RL2A 4QRUB 3QHZH 1T3FB 4Y16A 3ZDYF 1PQZA 2YMXH 2D7PA 4KDTA 3V5KB 2HRLA 3OJ2C 4UTBH 5DHVB 3MLVH 4M6ML 3NH7H 5FYLH 3BPCA 3BQUC 4PBXA 5BOPA 3HZVB 5BRZB 3ARBD 2G5BA 4JFDB 1TVHB 1MFDL 3EDKA 5T3XD 1MCOH 5D6CA 5AZ2L 1TZGH 4PY8J 5AZEH 5EZOL 1AGDA 3M8OL 4XPTL 1YNKL 4TPRH 3MRNB 3P11L 4GXUM 4C56E 1PLGH 5KJRH 15C8L 2XACC 4OCLC 4TYUA 4Y16D 2F58L 2P5WB 5DUMH 4D0DB 4RBPK 1RAMA 2ESVA 2OSLA 3S35X 5IESH 3SCMB 4P5KB 3BZ4B 4W68A 2ORBL 1ZT7B 2APXA 5J9PA 1CIUA 1I1YA 1XF3B 3AS3A 3EOYG 3ALWA 1HHKB 1T1ZA 3BQUB 1INEL 2LU4A 4PJCF 4PJAA 1H8OA 1J87A 2AW2A 3AXLA 1K8IB 3OJDB 1J5OL 5JIIA 4LPTA 5ILTL 3BYTA 3KPMA 5J89A 4XP6H 1QSFD 2NY0D 4PRPE 1F3RB 3CPLB 4KAQL 4EI6B 3O3BB 2GYSA 5IGXL 3HNTL 3CU7A 1JNHA 3OR7B 3U2SA 4JFHE 4U6VL 3RWJA 3S37X 1WEJH 5IHZB 3HC4L 4I48A 2PR4L 3O3EB 2E9BA 4QTHA 2IBBA 3CK0H 3P4OB 4KMQA 1CR9H 2X9YA 4JKWA 2RAMA 2ICEA 1QP1A 2PO6C 4NNYA 1H15B 3FO2B 1HCVA 4Z8FH 3WL9A 5L6YH 4XCYA 3LS5L 4EQ3A 4IRSA 3NTCL 5JQ6L 2ICWB 4L29A 2CO7B 4GLRI 4X0KB 3NFNA 5EO1B 5L7XH 3QFJD 5IJVB 1EJOL 3GSRB 2EIZB 3ZTJG 1AGCA 5HYIA 3SGJC 5KSVB 1IGFL 1KB9J 4F7PB 3PIQB 5CILL 4NBZB 3IU4H 4ZFGL 4MDJB 4RNRB 1ZVHA 3O4LB 1JHKL 1U92A 4CN6A 3LH2L 2A6KB 2AV1A 3MXVH 4OZFH 4LP4A 1EHLH 1U8MA 5E2JA 5C07E 3I6LE 2E9WA 4JPIB 4ODWA 4PJGB 5IOPB 4XVUC 4IRSD 4AEIL 4LIQH 4S10A 3RWGA 5IHBA 3ARGA 3F6IA 2YPVH 4FQXC 1IT9L 3ALXA 3S3PA 5JHDE 2HP4A 4OCNC 4P4KC 3ULUF 4LSQL 3PWPA 5E9DB 2X05A 2BVEA 1SVCP 4PRAA 5MEND 2R23B 4HWBA 4OCYH 3TJEL 1CFNA 1PD6A 2W91A 3F7RA 4KQ3L 4BSVB 5E2WH 3UO1L 1JNJA 1OCWH 2BJML 4MZ2A 43CAA 1UB5A 1FGVL 3OPZL 4L8CB 3ME0A 3DSFL 1U8QA 1KPRB 2DLFH 4PJFB 3HMXH 2NX5B 3ARGD 4FZ8L 3G6DH 5KSBB 1Z3GH 1UWXH 3UBXI 3OKLB 4PJXE 1C5CL 3D2UD 3BEWA 3PWPD 4YDJB 1VKXB 2H45A 4JCMA 5CBAB 1FZKA 2ILLA 3T2NH 5ISZE 2RIKA 1JHLL 1XR9B 3LD8B 4XCFL 3L3HA 2Y07H 3THML 3VFVB 4ETYA 4M1DH 4N9GB 1BD2B 2H9GA 4PJDF 5EZIH 3D0LA 4RGOL 3QHTC 2AXGA 3S97C 1IQDA 1XGYH 1RZKL 3K74B 3U0WH 3WO3B 3ULSB 5MEQA 4FFYL 3QRFM 2H6PB 4FQCL 3UP1A 4CMMB 1N0LA 4OSUH 2R1WA 4YNYB 3DVGA 3DRQB 4X7EC 3O9WA 1K9TA 2CUMA 4M1CC 4OCWL 4ZODA 2V6HA 3VXMB 5HYJE 5JNYA 3OB8A 2A73B 3LIZH 4ZTOH 3K2UL 4WHCA 2ED9A 1YY8B 4X8JB 2VXUH 3WXWL 3U30B 1MWAL 4HKXA 2FBOJ 4Y2DC 1UCBL 1QEWA 4MDIB 5JW4Q 2WNGA 3A67H 5DJ6B 2GKIA 3VFNA 5ABDE 5IW1B 2E8ZA 1G7JA 1X5GA 3M1BB 1X5KA 3OHXA 4JFEB 2X4NA 4F8TA 1ZGLM 5BV7H 2D31B 3F7QA 1CFVL 4OZ4B 1JGDB 3DVFA 4V2BA 2HT2D 3Q5TA 3RVWC 1H3GA 4JEGB 1FE8L 4PJEE 3EW3B 3OX8B 1NSNL 1QBML 4NM8L 2Y36H 1A3RH 4AMKL 3CDGB 4Q74A 4PRBB 5F9OH 4F7EA 5DRNB 4JAMA 5FOBA 4MX7A 5EUKA 4Y2DB 1NGWA 3PWNA 1AP2A 3Q48A 1UJ3A 4OZIA 4I18A 3VRJB 2D7TL 1YA5A 3BD4A 5EPMB 3CFEB 3Q0HA 1JNLL 4PJHA 4KV5E 4HXBH 4AIXA 2BVQB 2GIYA 3NMEA 1NGYB 3VWJA 2VAJA 4R7DA 1T0MB 2YA1A 3WE6B 3TFKD 3U0TB 2HJFB 3VH8G 1FFNA 1NGQH 3VFWA 2XY1A 5FIEA 3BO8B 3RWHA 5CJQL 4RMRA 3IJYB 4DEPB 4C58B 1BQHG 4JDTL 4YXHL 3H7BB 4NKIH 1DUZA 1MRCL 2NZ9C 1RK0A 5FYJL 1JP5A 3SKNB 1XIWC 1OOAA 3B43A 4S1DD 5CSBA 3VD3A 3MCG1 1OF2B 2NY1B 4TNWK 1F3JA 4LARH 3VWJD 3GSNA 2X4OB 5E95B 2A38A 1GGIH 4XPBL 3QUZC 1W72L 2EYSB 3QQNA 5I74C 1S7QA 4HPYH 5TE4L 4KUCD 2ZUSA 4JFYA 1KENL 1T1XA 2DD8L 2X4SA 4N90E 5D2LB 3HI5H 3RA7L 2BSSB 2FATL 2V17H 1NCDL 1E6OL 5KAQG 1G7LB 2X9WA 4IOIA 4JFOA 4O2CB 4TUOA 1F4WH 1GOFA 4ZOCA 4QT5A 1ZHNB 4EVNA 2FBJL 4QRTA 4UDUB 1JZ2A 1N5YL 5D1ZD 3PQYA 1GRWA 3KS0H 4P3DA 4AL8L 5FO8B 4TSBH 1BM3L 1XF1A 3R8QA 4A2MA 2P8LB 4X98B 5JDSA 1MFDH 2H2PC 5AZ2H 3QUXA 3QUZB 4JR9L 1OPGH 4PPTA 4MS8C 5EZOH 1RFDH 4XPTH 5E99H 3P11H 1GVIA 4DKAA 15C8H 1IMHC 1EEYA 2EE6A 2F58H 2DYPB 4QOKA 3HFMH 4U31A 2ORBH 3HPLA 4QY8A 1FG9C 4P5MA 3PQYD 4H0IA 5HYEA 4FFZL 2WIIA 1Q72L 2AI0H 3O2DA 1INEH 2MQ3A 3QO0A 4N1EA 4OZHF 1OHQA 1J5OH 1H3PH 5ILTH 1P9MA 2BXZA 4PJ5E 4GXUN 3MLXH 2IH1A 5DMGD 1CLZH 1VHPA 2EDQA 2CUHA 5IGXH 3HNTH 3PWUA 1D6EA 2CDGB 1OAUL 3QAZC 3HC4H 3GDBA 2PR4H 5GRJL 4ZOBA 4OD2A 3DIFA 4R4BA 3FONB 2LTQC 3DV6A 4GG6E 4IOSD 3H3BC 4WO4A 1IGIH 5DFVC 2F53D 1XH3A 4Z7WA 3IXTB 3JSSA 3LS5H 3GSUA 1OM3H 1CYGA 4LRIA 4KJWD 5DHYA 4ZUWB 4Y1AA 4R0LC 1GYAA 3OGCB 4K55A 4BSJA 4JDVB 5E03A 1B88A 4BH7A 1IGTB 1JF1A 1I3GH 2YBRA 3R1GL 5HJ3A 4GBXB 4AEFA 4RAUB 3ILPA 1ED3B 3QAZB 5F3BB 1GPOL 1IGFH 1FJ1B 5IEHA 4ZFGH 2KL6A 4WI6A 1JHKH 4ISVB 2DJSA 3BH8A 3EOBA 2LTQB 5HDQH 4WO4D 4M6NL 3EJJX 4JFFE 2QSCH 3BN9D 3ZKQD 4KROB 1FNGB 5CIPH 4AT6A 1WITA 5HGBB 3C5JA 3V5HB 1A7OL 5IB2B 3VGDA 3QDAA 4R0LB 2V7NB 1IT9H 2YD5A 5FGBA 1BZ7A 1M05A 5GS0C 1G9MC 3ULVE 5BW7C 1HEZB 1R0AL 1ZHLA 5F1SA 3TF7C 4CDHA 2IWGA 4FFVD 1EFXA 1TZHA 1RUMH 1HXYB 4KQ3H 4ODHH 1D5XA 4JDZB 3QWOB 3UO1H 3QFDA 2BJMH 1NBYA 5KZCD 2EE9A 3OPZH 3C5SA 4XGZB 4J3UA 3VXRE 4DKDC 2ZUQC 1P5UA 2DKUA 5BZDA 4H1LB 5EH1A 2BSED 3MRJB 4L8DB 4M62L 4HEME 4NCC1 2DWDA 1C5CH 1OLZA 2XYCA 3LRHA 5EC1A 1I1FA 5ID0B 1EFXD 3MR9A 4XX1G 4OF8A 1JHLH 4XCFH 4PJBB 3G6AA 2Y23A 3THMH 2GI7A 4R2GC 3V5DB 3C5ZC 2AXJA 3WDIA 4JRYA 5IM7A 4B53A 2OM5A 4G8FB 3HE7C 4U1LA 5HGAA 2X7LB 4RGOH 3CC5A 1E27A 4HUKB 4TNWF 1RZKH 3FQXA 2XNAB 4DWHA 3F7PC 3VDBA 3Q6FA 3DXAE 4FFYH 2BSRB 1OY3B 4FQCH 4RX4D 2ED7A 5I76B 4YFEA 5F1IA 4ZS6D 3D48R 3IFOA 4OCWH 4L4TB 4PJ7A 4YQXL 1SY6A 5FHBH 5BJTB 4JRYD 3DV4B 2NY5L 3EOAA 3GMRA 4R2GB 4XP1L 3C5ZB 4YGVB 5KS9B 1ZA3A 1MWAH 1WBYB 3HE7B 4B7LA 2PXYB 3I6GA 4XWOD 1EMTL 4BFIA 2ZUYA 3CVIL 1U8HB 1AJ7L 5HVFB 1UXSA 1RJLB 1H3TA 5I15L 1R5WA 1UZ6F 3FHAA 3GSXB 1KIQA 1CFVH 3WS3B 5MEPA 4KUZH 3KPQB 4LCWA 4X5XB 2EEDA 5KBNC 4RGMC 1FE8H 3T08A 3SDXF 1NSNH 4FQHA 5KOVC 4NM8H 2W0PA 3P2TA 4YBQC 4AMKH 4BFGA 2CIIA 3QJHA 1F3DH 2X4UA 3KXFE 4YHIB 3GIVA 2EDTA 3JWNC 3ROLA 1NCAL 4JO1H 4M6OL 5I6XC 3VFTB 4KKLD 4JY6A 1KGCE 3T77B 1T21A 1G7HB 2D7TH 2GJ6E 1YPZB 1FYHB 4NNPL 2NXZD 3FFCB 1YN6B 4LCWD 1JNLH 3QIUC 4LSUL 4HGWA 1EO7A 1C5BH 1EGJL 1IL1A 2C3WA 2VDOL 3NCMA 3AM8A 2EYRA 4OV6F 4RGMB 3QYCA 1NCBL 4PB9L 3CAFA 4N0YL 3RTQA 5FUCE 2AKRB 1UH2A 3UJJL 1MJUH 1S7VB 5CJQH 3BISA 5CEXA 4X80L 2RGSA 1MRFH 4PGBA 2P48B 4XZUB 4QXUH 1S8DB 4JDTH 3UTSB 1UWGL 3SDCD 3QWRA 1MAML 1MRCH 5FYJH 2JTDA 4QWWD 4HGKC 2OP4L 4XNMB 3CFDB 4PG2A 1P7KB 5IG7A 5IROA 5J11B 1LEGA 2FZ3B 4DW2L 5L0QC 5J6GB 4QRUA 1NEUA 1T3FA 1NMAH 2VXSL 4ZXBA 3RTQD 4X6EB 3WJLA 4JZOB 3V5KA 1D5BA 4O9HL 4XPBH 1W72H 3EBAA 2XZAH 5DHVA 1FL6A 5DO2D 1B4JL 4M3JA 5TE4H 1WGOA 5C0JB 5JXAL 1AXSB 2DD8H 2RCSL 3ECBB 5GGVL 2FATH 2ZSWA 1NCDH 1E6OH 4D0BB 1G7PA 1KJMB 1TVHA 4PRIE 3PHOB 3T3MF 4XPHL 5E00B 2FBJH 4P5TC 5ADOL 1T7WA 4G6AD 2HA1A 4KDVA 3T2QA 5MI0C 1N5YH 4L4VE 4JY4B 4LSPL 3IYLW 4NKOA 1V8HA 5L0QB 4ZXBD 5IIEA 3HUJF 3MA7A 2CXGA 3SCMA 4P0DA 1U8JA 2R15A 4EUPH 4Y5YC 2ZG1A 2RFXA 2R4RL 1FC2D 4I77L 3IETA 3T0EE 4JR9H 1S7UB 5GS1C 1DQJB 1HHKA 1WQVT 4M8QB 2WV3A 1ZVYA 4JFDD 3ZDXF 3OJDA 4N0RA 2C4FT 3BRFA 4Y5VA 2ADJB 1WAAF 1KOAA 2QQNL 4B0MM 4OFKA 5HGGS 2YN5A 5B8CB 1A6ZB 3KLAB 4YFLI 5D6DA 4CU6A 4P5TB 1JHTA 2C3GA 4K3JH 5MI0B 4FFZH 1Q72H 3SCMD 3QIWA 2NY4C 2WWMD 3TZVC 5J57B 4XX1E 4W6XB 3QUML 3FB6B 4RRPG 4OLVL 4Y5YB 1UEYA 2ZCKL 3P4OA 4OBSA 1OTUD 2VR9A 4G3YL 5GS1B 3RKDD 4OLXH 2O5YL 2E7LA 5DQJB 2AS5M 3FO2A 4Y2OA 1IGJA 2DTSA 2AQ1A 4J3SA 5D5ME 1OAUH 3PGDB 1JL8A 4LVHB 4OQ1A 4APQA 3C2SA 3P40A 4HQQH 1WBZB 1QRNB 3PV6B 3UC0L 3ARWA 5EO1A 3NOIA 1G0DA 3QIWD 4I2XA 2R2EB 4MD5A 2O93L 3EHBC 2NY4B 4XAWH 2ATKB 3TZVB 2X4TB 5TGBA 2R9HC 2DI8A 4NRXA 3GBLA 4MDJA 4RNRA 3FMGH 4K7PH 1M4KA 4I4WA 1WC7A 1NEZB 4JPIA 5EN2A 2B0SL 3G5XB 4YIQA 5IOPA 3F7YB 3R1GH 1MJ8L 3VGHA 3N85L 1GPOH 2F8OA 5I1HL 2WLYA 4IEFB 1H0DB 1INQB 2FX8H 3QDGA 4MNHB 3PP3K 3CNKA 3IAGC 3EYFA 4U7SA 1FG2A 2FJHB 4XCNA 5I73B 5E9DA 4M6NH 1U3YA 2CK0L 3IGAB 5HHXL 1NBVH 4U3HA 4NQDE 1MHCA 2FO1A 1IC7H 2R23A 1NAMB 3KHOA 1UZ8B 2LU3A 1Z9LA 1A7OH 2D7OA 2PYFB 2IALB 4NZTL 2XICA 3L5XL 1FAKT 1A02N 4NC1E 4L8CA 3N9GL 4J6RH 1IKNC 5KSBA 3QDGD 1R0AH 2UV3A 2FEEI 3QIBA 3OKLA 5ETUB 1N64L 3L95A 4K2UL 5E9DD 1VKXA 1YJDL 2AVGA 1WWCA 4LLVB 3DI2B 3GJFB 4JZJA 1FZMB 3CGTA 3VFOB 5DURB 1XR9A 3SKMA 4WY7L 4ODXA 4PJIA 4G8EA 5ANMB 4RGNC 5CGYC 5IVZB 4M62H 2IANE 4XVUD 4Z78A 1XF5B 4GG8B 5DZLA 4N0UB 2BMKB 4X6DF 4HC1A 5GPRA 1VADA 4YDIL 1IEAB 3LKNB 2WBJC 4B5EA 4BUGA 2YSSB 2KUTA 3MFGB 4CMMA 3KYAA 2FHCA 4JG1L 3PP3H 1KIPA 1F2XK 4XC3L 2PW2B 3MV11 3TYFA 2VKXA 2XWJB 1EAPB 2A73A 4EI5C 3FO9A 4PRHA 4X8JA 4OGAD 5GRXG 4XCEA 4ZOAA 5H94B 4UB0L 1FNAA 2C4FU 3WIIL 4RGNB 5CZVH 5IB5B 5HHMD 5E2TL 3HAEH 5DJ6A 2V5YA 1Q9LA 3S4SG 3GNML 1MQ8A 5IW1A 5DSCB 1E4WL 2WBJB 2PW1B 2QEJA 3BSZL 2D31A 5CP3A 1I75A 4WUKL 4IRJB 1DBKH 4KQ4L 5FKPB 1A4KA 3WHXB 4P48A 4LQ1A 4XP1H 2JIXA 4L5FL 1JZ3A 2P5EE 3BPLC 3OX8A 4ZFFB 5CGTA 5DJAB 2FD6L 1EMTH 5EOQL 3RPKA 5C09B 1WZMA 4NZRL 4EI5B 3CVIH 3U48A 3SBWA 1OGTB 5I15H 2VWEE 5CD5C 1RIVL 2YRZA 4BZYA 4ETQB 3P30L 4DQOL 3IDNB 4NQVB 5DI8A 4UBDC 4OLZL 3EYOA 5DUBB 5IW6B 3PL6C 3MNVB 1SYSA 3D25A 2BHYA 1SJEB 4KK6D 2JIXD 1QSFE 1J88A 4U6TA 1N3NB 2FX7L 3BE1L 2XTJC 4M1CD 5DJZB 1T0MA 2KPNA 2Z31A 1G9NC 2HJFA 3BPLB 5F44A 1NCAH 4M6OH 2CDFA 2IMNA 4I3GA 5BVPL 3CVHB 4UIMB 4O4YH 1IEHA 3MX0A 4NNPH 4U1NB 4AY0A 1LHZA 4LSUH 4BQBA 5A3ID 1EGJH 2VDOH 3FAWA 3SKNA 4DGVH 3U4EA 2VNCA 4PB9H 3PL6B 4N0YH 1J18A 2Z35B 3F12B 3CU1A 3MUJA 2P49B 3FTGA 2Z31D 3GMOB 4X80H 2O5XL 3TT1L 3TBWB 3T1FB 4HK3J 1UWGH 2FJGA 1KIRB 2EYSA 1MAMH 5DC4B 5D7IF 1MHEB 1Z0NA 2Z4QB 4OLEA 5IEKA 5ICYB 2OP4H 3RIAK 2H2SC 3NCJL 4YX2L 5KVFL 4DW2H 2GTWA 4O2CA 4HZAA 3RZCC 5I1IL 3RIFK 4M43L 4ONHA 1ZHNA 1FNFA 2VXSH 1PAMA 5EOCL 5IVOA 2ARJA 2HG5B 2NY1D 1DLHB 4O51B 1WLHA 4P3CL 3T3PE 2IGFH 4HX1A 3E1F1 1B4JH 4EBQL 1XGUA 2XXMB 4UNTA 5FO8A 4X9IA 5JXAH 1CD1B 5BS0B 3RWIB 2RCSH 3ET9F 5K9JL 4UT6L 5FV1L 2P8LA 4CU7A 3QNZB 2B4CL 5AWNL 5DK0A 3KPLA 4MCYA 5ADOH 3DUHA 4P2QA 1JYXA 4P23C 3KS0J 3PDDA 4M5YL 1N6QL 1EO8L 2AV7B 2GSIA 1K2DA 3ARDC 4G8GB 2MJWA 4LSPH 1A7RL 2W60B 3VXPB 1VGEL 3RZCB 3OAUL 3MOAL 5EOTA 1KEML 5DS8A 5C0CA 2YA2A 4I77H 2F5AH 3HG1A 4P2OB 3VXSA 4KZDL 3D85A 3WXVL 4X83A 3FAXA 3SQBA 4PLNC 5HHOB 2VLMD 4HHAA 1YUHA 1V3LA 2QQNH 2YUZA 3QDHA 4YWGL 2EDHA 2VKWA 4F7CB 1LO2L 3ARDB 2CPCA 1LEIA 3SE4C 3U79A 4M48H 1HSAA 2DM4A 4GQPH 3QUMH 5FV2A 3EFFB 4OLVH 4C4KT 1F4XH 1I1AA 2ZCKH 3L7EA 4G3YH 3VXSD 2Z8RA 3FONA 3U1SH 1ONQB 5A2KH 35C8L 5DJDB 3KNBA 4S1RL 3UTOA 3IXTA 4YGAB 3VXOB 5B38B 4LDLB 2DTML 4WFHE 3I9GL 3WFCL 1AIFA 4H25B 1XGPA 3ZTJH 4ZUWA 1T4KA 1PKOA 1WIOA 5GRVL 3VXUE 1EEZA 3MGTB 4JDVA 4GW4A 8FABB 3HRZB 5D7LB 4GBXA 4P57A 4LMQI 2D03H 2DWEB 3BW9B 5F3BA 4Z95L 2F5BH 5IF0B 1I1AD 4HIJA 4HMDA 4NRYA 1KXTB 3VFUB 5DMKB 4XHJD 3QI9A 3VGEA 3G5VA 1B4RA 2I9TA 4ISVA 3DUUA 3S8WA 5D6DC 2R8SL 2B0SH 1AGEB 4PJDA 4R4FH 3G6JE 3MRDB 3BI9X 1MJ8H 4JVPA 4HUVB 2VXTL 3V5HA 5I1HH 1OAQL 3TBVB 3DTXA 3T1WA 4GBXD 4K8RC 3U9UB 2VDNL 4JM4H 1WTGT 4YHPB 4W70A 1HEZA 2CK0H 5HHXH 2FEEL 4U3CA 4IHOB 3U0PB 2X42A 1AR1C 3BD3A 3CDYA 1U8NA 3QI9D 3W5MA 1GGUA 4I9WE 4WFED 4HUUA 1CGSL 3B9KB 1Q9WB 2D9QB 3DO3A 5C0EB 1FPTH 2VLJA 2BY0A 3FOMB 2O5ZL 3JBG7 2P4AB 4L3AA 5DFVD 4KROD 4E41A 4YXLL 3L5XH 5I75B 3N9GH 4XGZA 3FN9A 4H1LA 1OTTD 3MRJA 3TVMC 4QRSA 1P7HL 5I19L 1N64H 2Y25A 3QCTL 4K2UH 1S7TB 2J3SA 3HNSL 1YJDH 5L8JB 1B0GA 5CD3B 4PJEF 1MEXH 2D7NA 5F6HI 5IQ7L 3DYOA 4WY7H 5J1SC 3R0NA 2VLJD 3QUYB 3B2UD 3W9EB 4GW5B 2A77L 1IQWL 2G9HB 2X7LA 4S1SL 5B4MD 3QDMB 5EWIL 4HIXL 4X6BB 3TBYA 2XNAA 3QJFA 4WW1B 4CN4A 3SY0B 4HD9A 3TVMB 3BYYA 1IE5A 5GHWH 2HWZH 5INCB 4KV5F 4Q9CA 4JG1H 4U1MB 4Q6IC 2R0WL 3KPSE 3ZE0E 1KJ2H 4XC3H 1E4JA 2AERT 3ES6A 3T8XB 4XPGL 5DQ9B 4LKCB 5JOFB 1OP9A 3PP4L 4LCUA 3RIFF 3PGCB 2PUQT 4H5SB 3WIIH 3QIBC 1MCFA 1P4IH 5ESAB 5IBUB 2PXYA 1G1CA 4EDWL 3IDMB 4O58H 1XCTB 1CE6A 1OD9A 2HLFD 4WHDA 3GNMH 4C56B 4YZFE 4GAJL 1E4WH 5F7FA 4RQQB 3BSZH 2FYYB 3MRQB 3WS3A 4WUKH 4KQ4H 3FRPG 3MQIA 3KPQA 5DZOA 4YEEA 1BVLA 4L5FH 4L4TD 2FR4A 5C8JA 1PFCA 1XEDA 5ECJE 3JUZA 2XTLA 2FD6H 5EOQH 1A7BA 4BH8B 4RDQF 5K33A 5E6YA 3S35L 4I0PC 4NO5A 4O2EA 4R2GD 2D0FA 5EUOE 5C6TL 2VUYA 4DGYH 2PXYD 3OV6A 1RIVH 4YHIA 1F58L 1KTKE 3HPJB 3G04A 1ZANL 1BAFL 4XMPL 4KFZC 4NO2B 5FYKL 4OLZH 1RZIB 3RX8A 3HCVA 3VXNB 1IGCL 1G7HA 3ZYIA 5CP7B 4N9OB 3MCKB 1F3DJ 2EDRA 2VUOA 4AENB 1OB1A 1MCBA 4G9DB 5DFTA 2PTTB 1JGEB 3B6SA 2FX7H 3QA3A 2YPKB 1BF2A 3BE1H 3MTRA 3FQUA 1T7ZA 5J8OA 1XF4A 3GKZA 2GCYB 1L6XA 3S37L 2AJXL 5KN5B 1LD9A 4G43B 2KQMA 4G9FA 1X6NA 1W0WA 1SBSH 4XZUA 1EUTA 4XPAL 5TDPA 1SM3L 3D0VB 3WCYA 5K59E 4MXQC 3K8LA 3OXRA 5E2VL 4KMTL 9CGTA 4XNMA 1Y0LA 1AGBB 3MV8E 1FO0L 1OGAA 3VD9A 1VEPA 2O5XH 3TT1H 4HUWB 3H3PL 4HCRL 1URLA 3U83A 3MA9H 4RIRB 4OZHA 1EK3A 3IS1X 4R3SA 4G9FD 4LRNL 1GIGL 5T5FL 3FQNB 3L5IA 4DUWA 3OQ3B 4EN3A 3HLAB 3UPRB 4L8BB 5HHVL 2EZ0C 5C0JA 5ID1B 3O6LL 4XP9L 1WFOA 3AREA 4YE4L 3UTSD 1VA9A 4YX2H 4UQ2A 4D0BA 4ENEC 4OFPA 4GKZB 1KJMA 5I1IH 1DBJH 3PHOA 4M43H 4IMLB 2HTKC 1C8PA 1YMMB 5E00A 5EOCH 1AHWC 1JIBA 3IDJA 3TA3B 3UTTE 3MOQA 5JHDB 1NDGB 5T3XL 5CUSL 4P3CH 1NFDE 2E3VA 2Y6SC 4G6JH 2JELL 2G75B 1LEKB 5K9JH 5C92A 4UT6H 4CNIB 4EN3D 1MHHB 2B4CH 5GRVK 4LLMA 4M4RA 3PWLB 1EZVY 5F8RC 1R3IL 4M5YH 1N6QH 1EO8H 1NMCC 2X70B 1PKQE 4GW1B 4MJ6B 1P5VA 1A7RH 1YMHA 3DURA 4X4ZA 3RWDB 1DR9A 3OAUH 3BGFC 3MOAH 4KK5C 3E8UL 4PJXB 1SMOA 5B8CA 3KLAA 1KPUB 3KLHC 1LK3L 5DTFA 3QB7C 3DX6B 1OAYH 1EHNA 3MODL 4HWZA 3VRLE 4MWFA 4P2YA 4KZDH 5DT1L 2XT1B 3WXVH 3GUTB 4P2RE 2RR3A 1X6LA 3J8F7 3UMTA 2XWBB 4LHUA 3UDWA 2HAZA 3REWB 3STZA 5GGSA 5GJSL 3ZO0A 1Q9OA 2G5RA 3X3GL 3SDDC 3DMMC 1A9BB 4F3FA 4YWGH 1W8NA 2Z93B 2X9XA 3BMWA 1MAJA 1LO2H 1NMCB 4HUXB 2Q6WB 5DJ2A 1CFSA 4Y19A 1UFUA 3WLWC 4LLQB 4J2XA 4JKMA 4P5TD 3BGFB 1QRNA 4N0FB 1HHHB 4X4ME 1ZLVK 1UKSA 3GIZL 1MI5B 1F4AA 5A40E 35C8H 3WO4C 4NQCE 4GMSL 1K5NA 4W4OA 2UUDH 2X4TA 4S11A 3H42L 2J88L 4JY5L 2DL2A 3LN4B 3I9GH 3WFCH 2AQ2A 5C9JB 1T80A 3SDDB 2ITCA 4F9PA 1FFOA 1NEZA 2JJTA 4DCQB 3F7YA 1J1XL 1T89A 4HGMA 4Y19D 5HI3C 1S7SA 1S9WB 5TDNA 1C12A 1QRND 2BVPB 4Z95H 1MFAH 5HD8D 3GHBL 1FFPA 3KPPB 1JCKA 1P7QA 2WBWB 2XA3A 3SJVB 3P4NA 4NUGL 3U4AA 2OYPA 5CEZE 1PG7L 4XRCA 3WO4B 4BELD 1BPVA 3P77B 3IKKA 3LRSA 2NY3B 1OSPL 5HVHB 2E9IA 4X6CE 2VXTH 1PW3A 5C2UB 4F58L 2NLJB 1ORQB 3GZKA 1Z5LB 5KAQF 4ZQKA 5CMAB 2B2XL 1AQKL 1ORSB 1G6RB 2VDNH 5JZ7C 1FZJA 1A6WL 1KB5B 3U9PL 3GSWA 5C70A 1BFOB 1P7QD 5TQ0L 1XF2A 2VLKB 1J05B 4LK4A 5ETUA 4Z0BL 3OKYA 4HK3N 4HFWB 1CGSH 1ZLVH 3W2DL 4HWNA 3EHBD 3ESVF 4YXLH 2WK2A 1KJVB 4JQXA 5DD6B 3FCTA 3W9DB 1FZMA 5E1AA 2NYYD 1I9EA 1BZ9B 5ERWA 4HWBL 1OTSC 5ANMA 1X5YA 2OTUB 1PZ5B 2JB6B 1L7TL 4N1CA 1XF5A 2DM2A 5I19H 3O11A 3QCTH 5D70H 2PF6A 4O02L 1AI1L 2BNQA 4KI5E 3KJ6L 2J8UA 2YSSA 3GSQB 4MA8L 5IQ7H 4L8SA 3T09A 3SDXA 4DK6A 4YFLF 1LO0H 3X13B 4XBPB 1EVTC 1QSVA 1YNLL 4YHKL 3O3AB 4RAVA 1IQWH 4R6UA 4S1SH 3T65A 1U2HA 2XWJA 1U41A 2CD0A 1TTUA 4A2LA 3WV0A 3FN0L 3ZKSD 1MUJB 4HG4K 1BWWA 3GM8A 4NQSB 3NIFF 2I5YH 3BZFA 5H35A 1MY5A 4NQXB 1NJ9B 5CIPA 5EFIA 2Q86B 3RVUC 4LBEB 2R0WH 1FIEA 1NGXB 4XPGH 2X4RB 3CLEL 5CJXA 4GMTL 4IRJA 5FKPA 1BVKA 3PP4H 3FT4B 1Z9MA 3H0TA 3RVTC 4P99A 1CLCA 3NZ8A 4Z9KB 2DQIL 1P2CA 3FT3A 5DJAA 4I8DA 2WWKT 4HDIB 1L6ZA 4EDWH 3VCLB 1ZXQA 3W0WB 2F54B 1RI8A 2WUBH 3C2AL 4GAJH 5CGYD 2VE6B 2JCCB 5FDYA 1UXWB 4ETQA 4KPHH 5DYOA 1ES0B 5HHQB 1AQDB 5FF6A 1IAIH 3QEUA 3LN5B 5D7JA 1ULVA 5DUBA 5L9DL 5IW6A 5FHAH 5BRZE 5IR1A 1A5FL 4IRJD 4JFDE 5D72L 2P1YA 2FEDC 3RX5A 3TN0C 5LGKA 1NGZA 3N1MC 2VITB 4PJ5B 1N3NA 2DJUA 1N5AA 5C6TH 1F58H 1AD0A 2YD1A 3CIQA 1ZANH 5C08B 4XMPH 5IQ9A 4YDVA 3I6KA 5FYKH 2P5WE 1IGCH 3IRZA 1P53A 2IEPA 3E6HB 2EC8A 2NXYB 2Z91A 3MROB 1YNTB 2VZTA 4XB8A 2XKUA 1HHGB 5BVJA 2EDWA 4WWKC 4JO3L 4GG6B 3HUJA 3S37H 2FIKA 2AJXH 3PWVB 2L7UA 3MYJB 1SBBA 2XA8H 3ARFC 4N8VB 4U7MA 3RVXC 3TN0B 3SDAA 4OCRL 3GSVA 1T04B 3LQMA 3TIDA 4XPAH 3BJLA 2DBJA 3MJ9L 4ZO8A 1G0YR 4MGXA 3WNKA 3LB6C 1MH5B 4M7KL 1DVFA 4MVBD 1MHEA 4WDIA 1ADQL 2ZG2A 4HS3B 1N8ZB 2V5TA 4H8WC 5E2VH 4LCCC 1MWAA 1WAAA 2XZQL 1FO0H 2NTFA 4UBDD 5AG9A 1NUNB 5GRZA 3PL6D 2VISB 4HCRH 2VSDA 1S9VB 3HS0B 4KKCC 4WWKB 1D5MB 5T5FH 4LRNH 1GIGH 4JFFB 4LGSB 1QUNA 4JREC 2ZNWA 5HHVH 3O6LH 3ARFB 1OAXL 4XP9H 4JFQA 1CD1A 5HY9B 4YE4H 3S96A 5BS0A 2ZOKB 3GSNL 5J6HB 5MEOA 4JB9L 1DVFD 2EH7L 3NCYS 3RGVC 3BGMB 5D5MF 5D71L 5T33H 1F6AB 1A0QH 3S5LA 5T3XH 4LCCB 2AV7A 1FRGL 1JV5B 2MPAL 4G5ZL 5I17A 3A6CL 4EIGB 3LMJL 2W60A 3VXPA 2JELH 3O4LE 1CDCA 4HH9B 3RL1A 5IMOB 1YYLL 1Q1JH 4PJGE 1EBAA 1ZSDB 2IFGA 2XN9A 4ESKA 1UM5H 4AJ0A 5CSZB 5BS0D 4JREB 4P2OA 4POUB 1HWGB 3VXRB 5DC0A 2VL4A 1WFTA 1UT9A 4Y4KC 1A7PL 2HT3D 5HHOA 1EDQA 3RGVB 1QVOA 4YPGA 1UB6B 4YR6B 5KG9B 4G8GD 5E5MA 1AKJA 5HGHB 1LK3H 4G7VL 5HDOA 5BV7C 4CGTA 4F7CA 1E4XI 2BVOA 3MODH 4KTDL 3MJ8B 2VLRA 5TFSL 5DT1H 3N1QC 4LSTL 2ATPA 5GRUL 3AREC 5D9SB 2XN9D 3WFHB 4U3XA 1QG3A 4QRPB 5GJSH 4P2OD 3X3GH 4PJFE 1Q8MA 1ONQA 2IAMC 2NX5E 4U1KB 1NC4B 1HILB 1JWSA 2F15A 5HHOD 3RBSA 5F7UA 3BMVA 1MPAH 2CMRL 4AG4L 1W72A 4Y4KB 5B38A 3DXAB 5D2NA 2NCMA 1WBXB 4Z7UB 3LKSB 3UTZA 1JZ6A 3L3KA 1P4LA 3GIZH 1OQXA 4NDMB 1R5IB 2VLRD 5D7LA 4V2CB 5FYJD 4YHNB 4FQ1L 1VFAB 2YWYA 3PGFL 3BKML 2YEZB 3JZ7A 2DWEA 3HHRB 3QXTA 4GMSH 3QULB 1BD2E 3F5WB 3G9AB 3H42H 1R3HB 4JY5H 3D18B 5DMKA 5I1LA 1KN4L 2KZWA 4BFBD 1I85A 4GKSB 1A7NL 2ZOLB 1F8TL 4J3WA 3VGGA 1EUUA 4EUPA 3ROOB 1FV1B 1J1XH 4F9LA 2NW2A 4FXGA 3MRDA 3QZWA 3MRMA 2CRMA 2OQJA 3L1OL 1LP9A 3GHBH 1U8IB 5HPMB 3VXME 5D7LD 1ZWIB 5JA8B 3BPOC 2ICWI 3QH3A 1FL5A 4YHPA 1PG7H 3U46A 2C1PA 3K4AA 5DJ0A 1LDPL 1XR8B 2X10A 4L1DA 3DO7B 5FUZH 3U0PA 4LNRB 4MLIA 2Z8WC 1FYTB 3QHFL 4BK5A 2EKSB 3B9KA 4HPOL 5C0EA 2QV2A 1Z9SA 4JFEE 1UQSB 1SQ2N 3WN5A 1JK8A 3EYVB 1A6WH 3U9PH 5HYQB 5GS2D 4Y8DC 2ADIA 4WEBL 4HIEB 4W4OC 1U36A 4UNVA 5TQ0H 5CS7A 3D3VA 3DECA 4E0RA 1A2YB 4PRNB 3GBNH 3BPOB 4Z0BH 4MQSB 4TRPL 4XNQA 3H3KA 5DJXA 1KG0B 4ONFL 3DX7A 25C8L 5CD3A 5EIIA 4IMKC 4MZ3A 1GC1C 3B9KD 2HFFB 2OL3B 3GMLB 2HT4D 2VLLB 2P8PA 3O3DB 4HWBH 2DI9A 4MA3A 3QUYA 2RHEA 4XXDA 3FQRB 4AK1A 3KJ4B 1D5ZA 2G9HA 1L7TH 2IQAA 2HH0L 4LPCA 5CBEA 2M2DA 3DETD 3PHQA 4AYFA 2IFFL 4O02H 1AI1H 2NY2D 4X6BA 2N56A 4JM2C 3D3VD 3WDJA 1KXQE 4D8PB 4OT1L 3RWCB 4MA8H 3SY0A 1CL7I 5F7DB 1UKTA 1S7WB 5IVXB 4ORGA 3UEZA 4K7FA 1CU4L 1YNLH 4YHKH 3W11C 2MTPA 2F19L 2V2WA 3OAZK 5JXEC 3BDBA 3EGSB 5GRYA 1YC7A 2KH2B 4H1LG 2CKBB 5EZLB 4JJ5B 1GZPB 2BOBB 1IM3B 5DF0A 5DQ9A 2SEBB 3QUYD 1S7RB 3FN0H 3IDGA 2H32B 2K7PA 4O5LH 2MQCA 4H5SA 3K4DA 4LU5H 4F7TA 1DANT 3C9NB 1QPPA 4R4NC 4PGDA 3IDMA 1HQRA 4C56A 4JM2B 3TVMD 4PJAF 1HYSD 4GRWH 4GMTH 4JKPL 3I2CL 3HE6A 4NBYB 1DBML 4JPVL 5D2LE 4N8PA 5A16A 2DQIH 4S0TD 4ELKB 4Y7MA 5F97E 4BSWB 1MLCA 3OXSB 4FTVE 4ZO7A 3C2AH 2BVTA 4PRPA 3MBEC 3HPJA 2NZIA 3QT2A 3FHQA 3SPVA 4C56D 2JE8A 4KVNL 1A6TA 2AQ3A 5L9DH 3JWOL 1M6OA 3VGFA 5F7YC 1A5FH 1Y6KR 4IS6B 5D72H 3HE6D 3T3PF 4G9DA 4ELME 1YEDB 1J8KA 2PTTA 1JTPA 1U3HA 4TNVF 2QQKL 5TQ2L 1DQTA 2Z8VC 4BA8A 5SWZB 3V4VL 2VDQL 1A9EA 5CJ8A 3WFEH 3QXAA 2P8MA 3V52L 3QP3A 1TMCB 3BP7B 1Z2KA 1CI5A 3CXHK 4JFXB 4WVRA 4K94C 4X99B 4M7ZC 1T2JA 4PREB 4Y4FA 5EB9A 1KCRL 4LSVL 3MBEB 4ZPVA 3N50A 4GJTB 5LAXB 3OKDB 1IILE 5K93A 5TE6H 4JFHD 1G7IA 3MACH 4JO3H 1AGBA 32C2B 1T5WA 4KGLA 4XPFL 3OAYK 1U3HD 5CJOL 3MRGA 5B39A 3K7UA 4PFEA 4OCRH 2DQGL 4CJ1A 2AJ3B 3MJ9H 2EIDA 4RIRA 4M7KH 4R8WL 4QHKJ 3FQNA 3V4PL 1FL3B 5C07A 3HLAA 1QYGL 4L8BA 1ADQH 4ZD3L 1E0OB 4Y4FD 3G5YA 4M7ZB 1TENA 4A6YL 3V4UL 2PTUA 1RZGA 3TA3A 5JHDA 4HLZG 5D1QC 4NPYB 3MOBL 1YEGL 3MRCB 2ED8A 4XWGL 2G75A 3GSNH 3QCUL 1S5HB 2P7TA 1ZHBB 2LVCA 1R3KB 2ZCLL 4JB9H 2EH7H 4QHNA 1MHHA 1QFUL 5D71H 3LEVH 4I13B 4LAQL 4JJHA 4Z0XB 1IGYA 1BLNB 4YHOL 1VFMA 1FRGH 4G5ZH 2V2XB 3A6CH 4OCXL 3LMJH 2QSQA 1YMMD 3RWDA 5I8EA 3TA3D 5FECB 5JHDD 4PJXA 2ARWA 5IMLB 5D1QB 5EU3A 5H2BB 3ZSSA 1E4XL 3MRLB 3DX6A 5ISZA 1F6FB 3IXAB 4ZTPL 1WJ3A 3OAYH 4GRWF 5I66A 1PVHA 3WNNA 2Q8BH 2BVUA 1IAKA 1NBZA 4U6XA 2ADFL 2UWEB 1DANU 5KTEL 1HINL 4UDTB 3H8NA 4G7VH 4JFPB 4OV5B 1RVFL 3INUL 4TVPD 5K9OB 4KTDH 5TFSH 2H3NA 4CW1A 5CCKL 4LLQA 5GRUH 5IVNA 5FYKU 5HHNB 2FJFA 1BEYL 1EBPA 4NNXA 3PNWB 3LPWA 1X5ZA 3PUCA 5ISZD 5HYJA 4MCZB 1Y6NR 4KK9D 1ETZA 1RV6X 4NKMB 4Z7VB 5ICXA 3O2DH 2CMRH 4P4RA 2O61A 5EBWA 3HZMB 1UC6A 4LDOB 2DM7A 3BDYH 1QBLL 4Z7NE 4UIKL 2X89A 4PJBE 3BX7C 4YK4B 3PGFH 4MYWB 4ZYKB 4AEHL 3ETBF 3KPPA 1MI5D 4Q7DA 1TITA 5HYJD 1KN4H 4PJEA 1GJIA 2W0KA 1I4FB 1KTDB 3FO0L 3OKOB 4OZIF 1A7NH 1JPTL 1VFBB 2GFBA 3HR5B 3LKQB 4MAYA 2HYMA 3SDDD 1J0IA 3L1OH 4Q0XL 1N4XL 4NQEB 4DVRL 2NLJA 2X89D 1QSEB 3IJSB 4J4PC 3GJEA 3TESA 1ORSA 2XKNB 1QR4A 1YEJH 2LVEA 3OKNA 3NN8B 5KS9E 4XB7A 3ZE0F 3L3IB 1G7QB 1BFOA 4KUCF 5FA3B 4NUJA 1J05A 1NEZG 3LQZB 2BY3A 4RFEA 4F33A 4HPOH 4FMFA 3UZVB 2AEQL 4FG6C 2NY3D 1KPVB 3QUMA 5E8EA 4ZUUA 4MAYD 3W9DA 3WMSA 1VFOA 1IRAY 4WEBH 3X11A 1BZ9A 4LEXH 1UM6H 1OD7A 4YZFF 1QLRA 2VN7A 4FP8L 4QLRA 4WFFE 2X40A 4OLYL 4TRPH 5HI3D 3OB0K 4WU5B 5ALCL 25C8H 2HVKA 5D1XC 3F7VA 2DF3A 1CL7L 4Z77A 2K1MA 2YPLB 2VYRE 4XBPA 1SYVA 3QISA 1KFAH 5ACMA 5EUOF 4HXAL 4N68A 4FABH 1YPZE 2BRQA 4JLRA 3QQ9C 3TO2B 1R3LB 3RNKB 3FFCE 3P0VL 4LF3B 3VD4A 2I07A 3TJHD 3RU8L 2DM3A 1R3JA 2IFFH 4O00A 5C0FB 2W92A 4Q2ZB 3O8XC 4PGEA 4OT1H 4BQ6A 5I16A 3MUGB 1U8PB 4X4XB 1TZIB 3MLYL 4MB3A 5C0IB 3MV9B 4J8RA 2Q86A 2F19H 5FK9B 3P73B 3DVNA 2CQVA 4NJAL 3UTSE 1HHIB 5D1XB 3OKKB 2AEWA 4DTGL 1CCZA 1T83C 2QKIA 5M94B 2HFTA 5AYQA 4CVWA 5INDB 4XNUH 1CK0H 4BFEA 3RPIB 5D7SH 1YEEL 4N90D 2AJUH 3CUPB 4CMHC 2OJEB 1HDMA 4XXCA 5F96L 3PWJA 4DVBB 2UYLB 1OTSD 2Y1VA 5JUEL 4P9HL 3VWKB 4FXLA 3O8XB 1KYOJ 5HI4D 3TO4B 4J3OC 4JKPH 1FHGA 5HHQA 1AQDA 3I2CH 4JPVH 1JN6B 1IFHH 4UUJB 1Q94A 3T0DA 3KPRE 1JPFA 5F3HB 3IFNL 3OB0H 2KDGA 4J3TA 2BNRB 2H8PA 3D69A 4KRPD 5C0RL 3L9RA 2D4FA 3REVA 1SY6H 4PJ5A 1MCIA 2Y7QB 2XG4A 3CFBA 3GKWH 4XAKD 2Z9TA 1ZLSL 4ZFOB 4CMHB 1S9KC 4QHUB 3JWOH 5B22A 4LNVA 2EH8L 4LVNC 1X4ZA 1YNTA 3ABZA 3I3EA 4ZDHB 3TP4A 1OSZA 2EIEA 2QQKH 1JYWA 1HHGA 5TQ2H 5C0BE 3V4VH 5CZXD 4GG6A 1NBQA 4EXPX 2ADGA 1IJ9A 4PJ5D 3AU1A 2JK5B 3RVTD 2I60L 3TBTB 2FWOA 1U93B 1F13A 2HFEB 3MSPA 4NP4L 1HI6B 5DWUL 4HBQA 4PTTA 3EUUA 1XGQB 2VDLL 1KCRH 4LSVH 3I3DA 1MCQA 1NFKA 3QXDB 4OF7A 4JQVA 3VXUB 3QQ3B 2OLDA 4HS3A 1N8ZA 5F7KC 2NXYD 3ZLQC 5JW4R 2DQDL 4AIOA 5DD5L 1I3VA 1RULL 1RK1B 3E6FA 4RFOL 4P59H 4XPFH 3RX7A 1CT8A 4LVNB 5E94B 5CJOH 3T0WA 3VRLF 2BNUB 4Z5RB 2DQGH 4KMLB 1I9IL 2W9LA 4QYOB 3BUYB 1QKZL 3HS0A 2FEDD 3X12B 1CGUA 4MJ2A 4R8WH 3V4PH 4JFFA 4MSWB 5A1AA 4LASL 1BFVH 1QHPA 2A6IB 3G6JB 5HY9A 5JW3L 3MREB 3OGOE 2F9BT 3AVEA 3WFDL 1I3RA 4WU7B 4O2FA 4PTUA 3BGMA 2XPGB 1T20B 2YC1A 1AD9A 1F6AA 1MRDL 1JVKA 1LO5B 1DEDA 4ZUVA 1NCCH 3MOBH 1JV5A 2FX9H 4YJZL 1S9YA 3ZKNC 4OAWB 1QO3B 1YEGH 4Q9RL 1J12A 1DUYA 1FZOB 4XWGH 4MAUL 4EZMA 1K3ZA 3QCUH 5IMOA 1WF5A 4JFFD 1S9XB 1GCFA 3M45A 1QFUH 1U95A 5BQ7B 4DAGL 3ARFD 4KK8C 5KVGH 1O5DT 5DHVH 3VXRA 5JDJA 5I1CL 4MXVE 4YHOH 5IBLD 3GMMB 4OKVB 4OCXH 2IADA 3PDOA 4NYLA 1HHJB 2WP3T 1UB6A 4K9EL 3QUKA 4YR6A 3ULVD 5CEYA 2DLEA 4QCIA 3VDCA 1MHPH 1E4XH 1V3JA 2XFXB 4CVXA 3D5OF 4ZTPH 1RUAL 4KJYB 5DJ8A 3KPNB 4EOWL 1KBGL 3QCVL 4X6CF 3VXRD 2XWTB 5LGJA 1NC4A 5L2JA 2ADFH 4MNGA 1HINH 1X7QB 5F72S 4PJ7F 3WEXB 1RPQA 5JO5B 1RVFH 3INUH 5F1NB 3AFLA 4QO1A 3DXAA 4OGYH 4L9LC 5CCKH 4HKZB 5E08H 1WBXA 4ODBD 4HS6A 4ZOEA 3ZDZF 1BEYH 5I1GL 3KPSB 4U1GC 4NFDA 2CUIA 4BZ2L 1UACL 1HOCB 3QULA 4V1DB 3RY6C 2H41A 4WW2A 3QEQB 1R3HA 3D18A 4N0UE 1NC4D 5IB3B 3TIEB 3JVGC 5L8LB 4UIKH 2ZOLA 4PLKC 2OJZH 4J12A 3JTSA 3DXAD 4WHYG 3AAZA 3LZFH 2JB5L 4AEHH 4KZEH 2V7HB 4U1IA 4FQ2L 4L9LB 1FSKB 4Y1AE 3BXNB 3KGRA 5AUMB 1ZWIA 1HN1A 4U1GB 3FO0H 5B38G 1IBGL 1S7XB 3ZE1F 1JUFB 1JPTH 4ZSOB 4RGNE 1KCLA 3IKCB 3MCLL 1ZT4B 4LNRA 4AIZB 3KXFA 2EKSA 4JN1L 1N4XH 4Q0XH 4DVRH 3OBAA 1EXUB 1MVUA 4QXWA 2XQBH 1ROWA 2GJ6A 5F71A 3T0XA 3V7AE 5HYQA 1A14H 3G9VA 5DEGB 4DGIL 2EECA 3R8BB 1OAZL 1NKRA 1CVRA 2N7AA 4G42B 4PJ8A 1AE6L 4NT6A 5C09E 2WWKO 4M5ZH 4NKDB 2BVYA 2AEQH 3QZWG 2CIKB 1KCSL 1HXMB 3EJYC 1B3JA 3IAPA 3VA6A 3AROA 3FQTA 1FYTD 3KXFD 5I9QC 2IH3B 3HI6L 2HFFA 5B3JE 4LLDA 5SWQB 3GMLA 1G7MB 4HKJB 4L3EB 2NY6C 4XH2A 1SHMA 4UQ3A 3HZYA 3GSOA 2GJ6D 2DBLL 2GK2A 5F88B 1F11B 5IMKB 2YD8A 1BECA 4S2SA 4AH2B 5F6HJ 2X4QB 2DJ4A 3HB3D 4PJ8D 3T0BA 1IC4L 2VRAA 5F7DA 1I8LC 1NFIB 3TGXA 4DZ8B 2W65B 4HXAH 1AXTL 5CHNA 4OJFL 2ICES 2CKBA 5E4EC 5EZLA 3RDTA 3UTQA 5GS0L 3RU8H 3VI3F 1MJJA 3RNQA 3WDHA 2SEBA 3S36L 3VFMB 1DDHA 2VAAB 5GIRB 2NY6B 4PRIA 2OZ4A 5T1DL 4QF1B 1NFDB 4L4VA 4HC1H 4CN1A 2XTJE 4NJAH 4TSCL 5DEFB 5IHLB 4DTGH 1MF2L 1QFHA 5FA4B 4UV7L 3T0EA 3MJ7B 3RDTD 1YEEH 4IM8A 3GBML 5E4EB 4BSWA 2XZCL 4QXTA 5IFHL 1CFQA 1YN7A 3R06A 3PF2A 3CFJA 3OZ9H 5C0AE 2D4DA 1F00I 4WV1C 3C6SB 3K8MA 1V5JA 4P9HH 3ZKXB 4P2CG 5J06A 1BQLL 1U3ZA 5J3HC 3SGKC 3LKOB 5EDXA 2MHAB 5J1AB 1I7TB 3PJSB 4L4VD 4XI5D 3CCHA 4GKNA 1HIML 4JM2D 3P4MB 4P9ML 4XBGA 5EC2A 3O6FB 2P42B 3IFNH 5C0RH 3DYPA 3VE0B 1BJMA 5IBUG 3T0ED 1L0XA 4YAQA 3L7FA 4FQLH 1ZLSH 3U7WL 4G8GE 4PR5A 1MAKA 3GMPB 3BP7A 1S5IL 2ICCA 2BRRL 3JV4B 1J0ZA 4WV1B 5D5MA 5EU6B 5A2JH 3IJHA 4X99A 1CGTA 1CGVA 2Y5TA 3T4YA 2RQ8A 3BD5A 3TPUA 4WUUB 1C1EL 1W0YT 5JLZB 3Q3GA 3FKUS 5F1OB 1ZLWH 3QEGL 1R5VA 4YXKL 2UZYB 1JRHL 3C60A 3FB5A 3CDCA 4PJGF 4ZAKA 4MMXC 1L9NA 2QR0B 1OLLA 2I60H 2MWCA 1IKFH 5DWUH 5I1DB 3MUHL 4NP4H 3BP6A 2VDLH 5JMOC 2GJJA 1IVLA 3I84A 1CDUA 4XNXL 5JIPA 5A2LH 4IIQB 3CFKB 3QG6A 1ZLUH 1LNUB 1K4CB 5DD5H 3TC9A 1RULH 3QDJB 4OZGB 4RFOH 1CQKA 3WKML 3MRRB 1MCKA 3EJZD 3SO3C 5TJWK 1A47A 1YJDC 3PE9A 1LE9B 3C60D 1I9IH 4ZAKD 1QKZH 2R1XB 3BZDA 4NPYA 2Q76B 1TJHL 3MLZL 2GQHA 4CADA 4NQDA 3MRCA 4HJ0D 4PJFF 5KSBF 3ZKMC 5JW3H 3K80A 2VABB 3WFDH 3TH4T 1R3KA 4MQ7B 4LFHG 4AZ8A 1JYNA 4ODVH 2PYEB 4Z0XA 5FO9B 3TPKA 1DJSA 3WIHL 2HTLC 3AY4C 3QEHA 4Q9RH 4PJIF 1HNFA 3SO3B 3FO1B 5KSUB 4H26A 4KJQD 3TCXA 3LV3B 4X5LA 4XMKL 1I7UA 2ZPKL 5H2BA 4D9RE 4NQDD 4U2YA 4DAGH 4BYHA 4LLAA 2VL5B 5FGRA 1PY4A 3ZTNL 3DX9A 3IDIB 5T5NG 4LEOB 5E6IB 1Y18B 5MHSE 4LVOC 3NPZB 5IJKC 5KSAB 3MRFA 2IANA 1RZ8B 4H20H 5GSRB 4PJ9C 1KLGB 4K9EH 5D96C 2FH6A 3E3QC 4UDTA 5HI5C 4FXKB 2GJZB 4OV5A 3R0MA 1QA9A 1WWAX 1IM9B 4EOWH 1KJ2B 1KBGH 5GZND 1II4E 4D0CB 3QCVH 4X9GA 1FO0A 2B1AL 4XNZB 2HLAB 4NSKB 3H9SE 1V7NL 4HCRA 1ZS8B 1DE4A 5A43C 4GRLB 2AJZB 2EICA 3L3DB 4F80A 4LVEA 4W81A 4LVOB 1OW0C 3RUGE 4MQXD 4PJ9B 2VDKL 4YFDB 3D39B 2V5RA 5LQBL 2GUOB 1NLBL 1B2WL 1BX2B 3MLPA 5IWLC 3T4AB 4WI9A 2IQ9L 4ZYKA 4JN2B 1TCRB 3ARBA 4M4PA 2AK1L 1FLRH 2KKQA 2LQRA 4QRQA 2NR6D 2P5EA 3QDME 4P46C 3V95A 3V6OC 3HMWL 4XTRC 1L9MA 1LQSR 1KLUB 3EKCA 3C6LB 2CRYA 2JB5H 5MERA 1S3KH 4N5EC 1T7VA 4OF3A 5IB4B 4WCYL 1TQCB 3GO1L 1MCEA 4S0SD 4ZNCD 2Q7YB 3DSNA 2V2TA 1IBGH 2YUWA 3CH1B 3VGAC 3IU3B 4PRDA 1QSFA 2P5ED 3MCLH 4RRPA 1JF5A 2EXYC 2WSKA 2G2RA 2VXQH 3LQZA 4P46B 4JHWH 4JN1H 1A7QH 2DS4A 4OF0A 4JRXE 5LJYH 3MV7E 3WUWB 1Y6MR 4PY7B 3VG0L 3VFSB 1QSED 4HK0A 1NAML 1OAZH 4OUUA 1NCWL 4LSDA 3TCLA 2RB8A 1AE6H 1I7ZA 1H3UA 4I5BB 4U6YA 3QNXA 4WU5A 5IB1B 3IF1A 3ARPA 1KCSH 5MP6L 5D2LF 3MLRL 3VGAB 4NHUA 1T0NB 1WWBX 3HI6H 3MRPB 4NGHL 2C7UB 5JPMA 3IFPB 1MIEL 2CSPA 4UINL 3NVQA 4L4JA 2XQYK 3QFJA 1SJHB 4G6ML 3KDMB 5FB8A 3TO2A 5FDWA 2CH8A 2GSGA 1MCNA 2DBLH 4TTDC 3AS0A 4POYA 4OLWH 2DQFB 4Q2ZA 2C3HA 4JZNB 5JW4M 1FVCB 1IC4H 4U7KA 2F74A 3BWAA 3UCRA 4H1LH 4LSSH 1U8PA 3BIKA 4CBPA 1TZIA 3UAJD 3ZYJA 3NFPA 4MA1C 3TYGL 5C0IA 5IT2H 1X5LA 4JRWA 4OJFH 4G6FB 3V79C 1KCVL 1HHIA 5GS0H 4JE4B 3RWEA 2APBA 3OKKA 1ZA6B 3S36H 2APWA 5CWSB 4NO3A 2E9JA 1F45A 1JMXA 3GB7B 4IOFD 4OGXH 1HH6B 3PABA 3VRIB 1X9QA 2ZJSL 4U1HB 4NZDA 1QSZA 3RPIA 2DKMA 4C57C 1CVSC 1XGTA 2JJSA 4PP1D 4Q97A 1EERB 5T1DH 2UYLA 4M7LT 3QR2A 2EDJA 1N0XL 4RBPH 1DCLA 4Y4HA 5MENA 5IKCB 3VWKA 5HHPB 4RDQG 4TSCH 3TO4A 4KTEH 4WJ5A 3P9LA 1T5XA 3B5HA 1MF2H 2ZUUA 1UYWH 2PO6B 4K3EL 4LCYB 3DYMA 4UV7H 6FABL 1JN6A 4DKEL 4DFHA 4RISL 4Z7OE 5DD1L 1KNOA 5LBSL 2XZCH 5IFHH 5C3TA 4U1SB 5JPNB 1YMME 1CFTB 4Z76B 1GL4B 3QQ9D 4GRMB 1CXIA 1YC8A 5T3ZE 3D2UA 3ARXA 3FQWB 5JORA 2EDLA 3MLTA 2ZSVA 4Y4HD 3VWKD 3O8XD 4WHTA 2X1QA 3TO4D 4QRRE 5JR1L 4ZPTB 5L2KB 1E4KC 5EO9A 4GXVL 4PV9B 4ZDHA 3U7YH 1R24B 2M26A 5C0DB 5ITFA 4GO6B 2WINA 1JJUA 4Y5XC 3BRDA 3U7WH 2A9MH 2A9NL 3F62A 1GZQA 3ZDYE 4AQOA 2AK4B 4TVPE 1RZJL 1S5IH 5BXFA 2MKWA 4EXKA 1ZHKB 4FQXB 3C09C 4F7MA 5JHLH 4NM4L 4P4KB 1D9KC 1Q0YL 3WSQL 3IB4A 1UM4L 1TVBB 1C1EH 3VXUA 5F9JB 2EE3A 2I9LA 3ISWA 3S4SA 3JV5A 4YXKH 1NGPL 1M7IA 1VDGA 5F6IC 4C83A 1RUQL 3DRTA 2J1KA 1QNZL 3CVHL 3VFPB 5SWSB 1O7SA 4HJJL 2C3VB 3BESR 5LCVH 2GITB 3QQ4A 5IHUH 3BJ91 4MJIB 2BNUA 4YBLC 3NGBC 3SQOL 3FZUC 3OR6B 1LE5B 4XNXH 5EIQA 2W38A 3MMEA 4X4YB 5IMMA 3DBXA 1YEKL 2A6IA 4WFHD 3G6JA 4HLZH 2CLVB 5A2FA 1U0QA 2BSTA 1MI5E 3IAQA 3VXUD 1UGNA 4PJCE 3RBGA 2W0FB 3WKMH 1BQUA 1G9NL 1J0HA 1N59A 2NNAB 2A83B 1LO5A 5LGHL 2GK0A 3NBNA 4M61B 4N8VG 5GJTL 1TJHH 3MLZH 5F6IB 4LKXB 3EYQC 5CLTA 4OAWA 3E2HC 5FEBA 5ACZB 1QFWM 5DDHA 4PGCA 4FFWC 2W1NA 2ERJC 3NGBB 1N26A 5DK2B 4MNQE 3W82A 1FGNL 5BQ7A 2Z92B 4D2NA 4TUJB 2HN7A 5ESQB 5DRXB 5DVKA 5EU4B 3WIHH 2VC2L 3MGOA 3SJVE 1N2RA 1BOGA 4HULB 4PJBF 2ZG3A 4PV8B 1ND0A 3WIFB 3KHQA 1BFSA 3TBSA 1PBYA 4XMKH 2ZPKH 1H5BA 2A6DB 4QKXB 3L5HA 4BKLA 4X9HA 4XBEL 4I9WD 1WT5A 3ZTNH 4Q9QL 4KJYA 1T7XA 4HZLA 3L3JB 4J23A 1JPST 43C9A 1UH4A 3AUVA 1YDPB 1VSCA 1AO7B 3W39B 1CLYL 1HQ4A 1X7QA 3ZHLA 2VLKE 5DMJB 2FNBA 3O41B 3KYNA 3MJ9A 4HIIB 1CICC 5FO7A 2APFA 3DUSB 3CX5K 1ADQA 5KS9F 2HJLB 3KPSA 2B1AH 1G84A 1U58B 2XXCB 2QHRL 1C5DB 5IK3B 4RZCA 4J7RA 4U0QB 3SOBH 5GGRB 5HPOA 2R2HB 5EZJA 5IB3A 4KK8D 5TH2B 2GTZB 2PCPA 4D9LL 1U8OB 4G8IA 2VDKH 1BVZA 4K7PX 2EYTB 1DQQB 3IVKA 5D1ZA 5LQBH 1T66D 4MD4B 1DSFH 1NLBH 4R96B 4JANA 2Q3AA 2IQ9H 4OCMC 4PP2A 1CICB 1CG9B 4JPWL 5FYLE 2AK1H 3IDYC 2HVJA 3KPSD 5KW9L 1E28B 3B4NA 3HNVL 4V1DD 3OKMB 2CXKA 3FFDB 3NCFB 3V7MA 5T1KB 4K3GA 3GJFK 4FTVB 1YPZF 4DOHB 2QQQA 5EUOA 3L3OA 4POZC 1XIWB 3O45A 2E6JA 5KANG 1MFBL 2P46B 2ICWJ 3QPQC 2OK0L 1FCCA 4WCYH 1TQBC 3GO1H 4M6MH 2MNUA 3G08A 1RJYA 4LLYB 1WTLA 2FRGP 5EORL 1IEBB 1KT2B 5HVGB 5DEGA 4ELMB 3IDYB 3QPXL 3RY5A 1UVQB 5I74B 2A0LD 3B3IB 4XAKE 4G42A 3M8OH 1YNKH 1C7SA 3CSYB 4M02A 4U6HB 1QBBA 3W0WE 2F54E 3QBTB 3N06B 1J8HB 2JCCE 4GAYB 3MFFA 4ZS7L 1TVDA 2IH3A 3VG0H 3V6FA 5SWQA 1G7MA 4HKJA 3TNMB 1BBJB 1NCWH 3EDEA 5EBMA 3UJTL 5DRWB 1N7ML 5F88A 5IMKA 3C8KA 3MV8A 5MP6H 2F53A 3MLRH 4U4BA 3AGVA 2C5DC 1I8IA 4F37K 4D9QE 1I8MB 4KAQH 4NGHH 4Y16C 5DZNA 5C08E 5ADPL 1RD6A 3BZEB 4KDTC 1MIEH 4DZ8A 4S1QL 4K8RL 4U6VH 1GHFL 1OL0A 3QWQB 4L3ED 1WIPA 3GJFH 2MFNA 2BCKB 3HTLX 5T1MA 2NY0C 4ZUTB 3UTTA 4MD0B 3TYGH 3MV8D 1A8JH 3O2VL 1NFDA 5GSVA 1X44A 4HSQA 1BJ1H 1KCVH 3NTCH 5JQ6H 3EO0B 2YUVA 3RL2B 5I0ZA 2EDEA 4LOUC 3V0VB 3AMLA 5FA4A 5IV2A 2ZJSH 3EJYD 1EJOH 2P45B 1FVDA 4KY1L 3BPCB 1JPGA 2VR4A 4GT7A 3BVNA 1NMBL 4N8CL 4MMZC 1PKQA 5CILH 2DKSA 5D6CB 4NN5C 3UTTD 3LH2H 1P4BL 1CIDA 2AP2A 2AXFA 1AGDB 1I7TA 3DROA 1CGYA 6FABH 3SKUD 4AEIH 4DKEH 2IBZX 4RISH 1Z0MA 3P4MA 5JW5B 3O6FA 5LBSH 4PBVC 1IC5L 1ZOXA 2DOCA 2ESVB 2OSLB 4ODUB 4P2RA 5F9DC 5J9PB 2OR9L 3VFRA 2J8HA 2BOCA 5EU5A 4PS4L 4LSQH 5IFAL 3S3SA 5I1AA 5J56B 3VW3L 2K7QA 4ONOA 5AD0A 3KPMB 4UU9B 3TJEH 4IRSC 4NN5B 1GAFL 4GXVH 1M71B 3RWFA 1FGVH 4D3CL 4X4MA 2WW8A 4BQCA 4HBCL 3O6FD 3PG2A 3DSFH 1ZGLA 4FQQB 3U2SB 4FZ8H 4P2RD 2A9NH 4NQCA 3RWJB 1A1MA 4I48B 4F15C 3HA0A 1RZJH 4QTHB 2QR0A 2WP3O 4TOYL 4RX4A 4NM4H 4MXVF 1XFPA 4F2MA 1Q0YH 4KHTL 3WSQH 4KRMB 4MJ5B 1UM4H 3OWEA 4NNYB 5EU6D 4IIQA 3WL9B 4XC1L 1NGPH 4IRSB 1QRKA 1RUQH 1QNZH 4WUUD 3ARGC 3CVHH 4Z6AT 4QRPE 4HJJH 3FRPA 4L29B 3NFNB 3SKOA 5GZOD 4PGZA 2BHUA 4GAGL 1X5AA 4NQCD 3SQOH 2ZUQB 4TTGA 1AGCB 1QR1A 3M17A 1YEKH 1A4JA 4Z7UE 4OF5A 4X6CA 1V3MA 3WD5L 3U4BL 1U92B 4E5XB 2FB4L 4HT1L 1U8MB 4IJ3C 4ODWB 3K2UH 4ZNEE 2OMBA 5C0GA 3CXDL 3WXWH 5J12C 2A1WL 2R0LL 5CLWA 3ARGB 4NN7C 2NQCA 1UCBH 3MRBA 5CEZD 2IG2L 1HKFA 1UH3A 1VFUA 4ZUSA 1FNLA 3FB8B 3PWPB 1PG7W 1DEEB 1FGNH 3CD4A 4HFUL 4N0CD 2R2BA 4PRAB 1PYWA 1RY7B 5T3ZL 4Q9BA 3QG7L 1CFNB 4K7PY 2VC2H 2J8UF 1A6AA 3IDIA 4M93C 5E6IA 2PYED 43CAB 1UB5B 1VB9A 5KSAA 1QBMH 1RZ8A 2FCBA 4WI4A 5GSRA 4KWUA 1KLGA 1SEQL 1U8QB 4GS7C 5J12B 1FYTE 1CXKA 5JMRA 4XBEH 4PBWD 4Q9QH 1IM9A 4TVPL 3SDCA 1K85A 3O9WC 2HT2C 2PETA 1QQDA 3CZFA 1BGXL 3KR3L 3EO9L 3MNWA 1CLYH 3L3HB 4DFIA 5E6ID 5EBGA 5GGQL 3KPOA 4R97C 5KSAD 4YPJA 2AJZA 1A6UL 2H9GB 3D0LB 4DZBA 4PB0L 3HC0B 1DBBL 4DK3A 2J7LA 1IQDB 4FNLL 3MGAA 4GS7B 4KI5D 4FN0A 4A6YA 3E0GA 1LK2A 1IM9D 4JN2A 4YXHH 5SV4A 2K9UA 3OJVC 3WUZA 1XGRA 5I6XB 1ZT1A 3DVGB 2QJDA 4TUKL 3ZT5A 4ALAL 3O9WB 4WHYH 5ITBL 1NDMA 4KXZI 3TFKC 5B3JF 4QHKI 1I8KA 5F7EL 3GRWL 4D9LH 1P1ZB 5I1KL 1C16A 3QIUB 4GRLD 3TWCL 3C6LA 1KF9B 5IVXE 4WI3A 4JPWH 4PJ9D 2DN7A 3KLSA 3D39D 4JQIL 1QEWB 3P3YA 1UJ3C 2Q7NA 4I18C 2Q7YA 3RA7H 1KENH 1CBVL 3O3UN 3VFNB 3ZZ1A 3HZVA 3KPRB 1G7JB 3HNVH 4S1DC 5KANI 5BRZA 2LAGB 2X4NB 4JFDA 1EEQA 3IU3A 2IPKB 4JG0L 4HV8B 3VWJC 2IBGA 1MFBH 2OK0H 3MRNA 3U36B 1KUMA 1MCSA 3WNOA 5EORH 3C6LD 4AL8H 2P5WA 4BZ1L 1BM3H 4D0DA 1UCTA 1WIUA 4P5KA 3BZ4A 4M6AA 4F7EB 3EOTL 1CDJA 2ZP0T 1ZT7A 4JAMB 1OARL 5FOBB 1XF3A 5IP4A 5EUKB 2DLIA 2GEEA 1NGWB 3QPXH 1JMZA 3NFSL 3PWNB 4LQFL 3RVVD 3WHE1 5GS2H 3LCYA 4G7YL 4OZIB 3BQUA 5BRZD 5C0BB 5H37G 5BZWB 1K8IA 1G6RL 1KTRL 1MNUL 1KB5L 4PJHB 4ZS7H 3CPLA 1T0NA 4IRZL 5GS3A 5CJ5A 5IFJB 3BP5B 4EI6A