4N8CH

Three-dimensional structure of the extracellular domain of matrix protein 2 of influenza a virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
QVQLQQSGPEVVRPGVSVRISCKGSGYTFTDYAMHWVKQSHAKSLDWIGVIGTDNGNTNYNQKFKGKATMTVDKSSNTAYMELGRLTSEDSAIYYCARRDRDDVWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of monoclonal antibody
publication title Structure of the extracellular domain of matrix protein 2 of influenza A virus in complex with a protective monoclonal antibody
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 220
sequence length 220
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n8cH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n8cH02
5HYSG 1TCRB 1J1PL 4U49A 5FUZH 3P30L 4FQIL 2WWMD 4UMGA 2RR3A 3DV6B 4HPYL 5JPNB 1CU4L 3VH8B 2HT4C 3KDMB 1ZT7A 3TZVC 3QUZB 1OP9A 3P0YL 2D7TL 2YZ1A 1DLHA 4N0UE 3LPGA 2E6JA 3PWPB 3LN5B 5T3XD 3Q1SH 4OT1H 3VFVA 4KJWC 3RL1B 1HNFA 1A7PH 2V2WA 3OQ3B 3QQ4B 1NDGA 5K9QG 3O3DA 4Y5VC 5CJQH 3RA7H 1NC4B 4B0MM 1QVOB 4RQQB 1FRGL 4M6ML 3U9PH 5MENA 3B5TA 3H9SD 5GGRY 3GJFB 2J88L 1SMAA 4JCMA 2YR3A 5GHWL 1OGAD 3LIZH 3O9WD 1QSEB 3X3FH 1XR8A 3H9SA 3GMLB 3QUXC 4GS7C 4EOWL 1QYGH 3V2AR 3NH7H 1NGQH 1BQHA 5E08H 2YD8A 3FQXB 2GI7A 3BQUB 3RY6A 1QR4A 4CN4A 1NBQA 3ZMRA 1MCPH 1KTDA 2YPVL 4YXLH 3EJYC 3O4LB 3Q5OA 4UV7L 4QNPE 1GZQA 4D0CB 2R9HD 1BIHA 4RIRA 1J0KA 3C09C 4OQ1A 5I8EA 2EIZB 3MRBB 3MV9D 4GKSA 4ENED 2JE8A 4WI9A 4K9EC 3EYOA 1HDMA 2ICWI 4QEGA 1AE6L 3LN4B 3MV9A 5JW4M 1ZXQA 4LOUD 5FM5O 3BD4A 3ILQD 1GC1H 3FCTA 4Y4KC 3VWJD 2ZUQB 4NO2B 1T1WB 2NW2A 4C4KT 3X11A 3V9FA 5IJVA 5D6DC 1PSKH 4U1NB 3V6OC 2I9LB 3F12A 2Z35A 4I0PA 4LSQH 5ALCL 5EO9A 3EJZC 1XIWC 5DRNA 2UUDH 4BH7B 3GHEH 3LS5H 3LRSB 5DK0A 3QFDA 2VLME 3L3OA 3ULVF 5KANG 1UACL 3DBXB 4UV4L 1OSPH 4BFEA 5BS0B 4ELMA 3HI1B 4N1HB 4PD4K 2C3HA 4AEIH 4YHKL 1J18A 1IGFL 1MRCH 3I02A 5ALBL 3QDJE 2AQ1A 2A6IB 3IDXH 1ZHKA 1N3NA 2XRAL 3MJ7A 1U3JA 4E42B 4JM2B 1GYAA 4U1SB 5CSBA 4XP1H 4OCSH 4PJDA 2QQNH 4LF3B 3QEQD 2G2RA 5HD8C 4FQQA 4HJ0C 3EFDL 3MV11 5IJKC 5IR1B 1FL3B 3QEQA 4YPGB 3DIFB 4PP1D 1PDKA 1N8ZB 4MJ6A 1EDQA 2I25N 1MQ8A 5F1SA 1HHIB 1ZVSA 4HKXA 3VXTB 3VDCA 1S78C 5CZXD 3O3UN 4S1RL 4YQXL 3WXVL 4FFWD 1RZFH 3KPRD 1ZLVK 3VE0A 5IHUL 2AP2A 2EYSB 4MDIA 4U3CA 4M00A 2D0HA 3KPRA 3A67H 5L8KB 1IGCH 4E9LA 3ALWA 4EZMA 3VFNB 2FGWH 5CD5C 2NZ9C 3OKEB 1T1YB 4NKIH 2W9LA 3SPVA 4KHXH 5DURB 5IB3A 3G6DH 4CU8A 1N4XL 3EOBB 4Z8FL 4DN3H 1EZVX 3WHE1 4FXGB 1FNFA 1P2CB 1SEQL 3DUUB 3LEYL 4U3HA 4H0GA 1LVEA 1A7QH 1B4JL 1QEWB 1KXVC 4QWWD 1OTSC 4KK8C 2XN9E 4M4PA 3VRJA 3BXNA 4I8DA 4PJDF 5E2UH 1EX0A 5T1KD 2ARJQ 1MPAL 3GB7B 3F58L 3AROA 1Z0MA 3BSZL 3H0TB 2RFXA 1YN6B 5DQDL 5T1KA 2X2YA 3QISA 3UBXA 3KYAA 1TVBA 3QZWA 5I2IB 1EEYB 4HJGB 4XNZB 4K3DH 3RBGA 1AGCB 2FBJH 3B8YA 3VWKB 1F4AA 4PRHB 1Q72H 1WVZA 1XR9A 3GHBL 3K81A 3I6GB 3V79C 3MUJA 5J57B 3QUMH 2QSQA 1JCKA 4HMEA 4M48H 3MGOA 3UTQA 3MO1A 3RWIB 3LQAH 4L29A 2FECI 2HJFA 3MRKB 5JTWA 1IE5A 4D2NA 1V7NH 3QI9A 4M7LL 4F7PB 2Z4QA 1D6VH 5KG9B 2GUOB 5ILTH 3NPZB 1XGPA 3MJ9H 5FV1L 5TDNA 2H3NA 1NCNA 2VRAA 4ZDHA 4PRAA 5FO7A 1MQKL 1ORSB 1R3JA 5EOQH 1J8HD 3AM8C 3VXSE 5HGBB 4OKVB 2X1PA 2CGRL 4RWYL 1A6WH 3RZWA 4QRSB 1OP3H 3U36A 5L6YL 1J8HA 4HUUB 2GTZB 4YGAB 3BIAX 4NO5A 1QRKA 5E94A 3L7FB 4Y4HD 3GZKA 3QIBA 1MJJA 4PJ8D 3F7PC 2DS4A 2B20A 1CFTB 2CKBB 4Y4HA 4XB7A 3RVXD 3D25A 1CGVA 3GSXB 4LU5L 1SBBA 2I26N 3DTXB 3BP6A 3DVGB 4TUJB 5JXED 3BMVA 6FABH 2O93L 3A6CH 2VXSL 3QEGL 3MBEC 4CW1B 3T3ME 1U0QA 4JRYD 4M5ZL 5MEQB 4JKPL 2Q8AH 5HYFA 1A6ZB 4JRYA 5AD0A 2H45A 3IFOA 1JK8A 1PZ5B 1FYTB 2X41A 4IRJD 1UKQA 4W6YB 4RMWA 1KIUA 3N1QC 3IDYC 4I2XA 4IRJA 4RFOL 3D39D 2Z92B 3C8DA 4X5WA 1S5IH 2EE3A 1ZKAA 1RHFA 3AAZB 1YYML 1HIML 1WFUA 3D39A 2QADD 5D7JD 1U95A 3W5MA 1QPPA 4GXUN 4UT7H 4DAGL 3JZ7A 4UDTB 3TNMA 5D7JA 2APVA 4JFFB 4HWUA 4D9QD 5D2LB 1VFUA 5C3LD 4X6DA 5EU6E 1EGJA 1Q94A 2A77L 4OZGA 5L8JB 5KS9B 1T4KB 4CNIA 2R4RH 1NMCC 2AI0L 2BZDA 5I1HH 2ICEB 4UAOC 1P69B 2VMFA 3OXRB 2YD1A 2K7PA 5C0CD 1TXKA 4BZ1H 4OM0H 3GMQA 3WEXB 4G8GE 1LQSR 4IMLB 5C0CA 4JJHA 1AP2B 5J11C 2F8XC 5F96L 1DQJB 2Z93B 1LILA 2E3VA 3PWUB 4JY6B 2X4PA 3KPQA 4AM0A 4KKNA 1SBSH 3JWOL 3BEVA 4R96B 4PJGA 4JFYA 1XF4A 2FEEL 5DZOA 4OZ4A 3GK8H 3S3SA 1D5IL 1QTYT 4KPHH 3P9WB 2FX9L 4NZTL 1LDSA 4G8IA 2N1KA 6CGTA 1XF1A 1GGBL 4G5ZL 2IH3B 2QR0A 2VKXA 4MYWB 1FHGA 3ZDYE 1LEIB 1U8JB 4BSVA 3QG6A 2DQEL 2DI8A 2C3XA 3MRGB 5I1EH 1KYOK 4R26H 3TT3H 2OXHA 2PO6D 5BRZB 4OZGF 5F7LB 1DLFH 4OGAC 1M6OA 2NLJB 3CH1A 2WINA 5DLML 4WFHE 4HIXL 5CEXA 4Y16D 2EZ0D 4Y2OA 5LXGL 5GIRA 5TPWL 1C08B 4HUVB 5DA0B 3ABZA 4LHUD 3S4SB 4Y16A 1FFNA 3IGAB 4HT1H 4LEXL 5D1QB 1YDPA 4EQ2A 1AGEA 5LWYL 1I9IH 2CDEA 1CFVH 1OQOA 4ACPA 4W68A 3TVMC 1Q9WB 4WWKC 4TTDD 5TE6H 4U1GC 1HHKB 1HEZA 1T2JA 3AGVA 4GUPA 1CICD 3WIHH 1A6VL 3RWGB 2V2TB 4P3CL 1JZ6A 4NRYB 1CICA 3C9NB 5DI8B 3BHBB 2R23A 3L95B 3VI3F 2F53B 4NNXA 3UTTE 4HUMB 5FHBL 1BQHG 4CMMB 3U6RA 2BVQA 1CQYA 3SKJL 4HUWB 1AD9B 4K3GA 3B6SA 3GSOA 2J8HA 3NCBB 3O8XB 3PABB 4O58H 4V2BA 4ZFZB 4Z77B 2CLVA 3BYTA 4NNYA 5DS8B 3G5YA 4O51B 43C9B 1YEGH 5I1AB 2AV7A 3A6BL 4LASL 3TO2B 5IW6B 5EFIB 4X6EA 1M4KA 1A1NA 3D69B 1YEDA 3CFJA 4MQTB 4S10A 3QAZB 4OLZH 2KPNA 3LEVL 1TZHA 5GS0H 1HHHA 4L4VE 1HINH 2B1AL 4OD2A 3T0EE 2E9IA 1CLYH 1NCDL 4JZJC 3ULUE 3T77B 3SGDH 4K3JH 5BZWB 4TVSa 5HDBE 2YUWA 3SDDB 4U1HA 4PV9B 4FQLH 3EZJB 5FV2A 3MNZB 4Y4FC 3VD7A 4NP4H 5DZLA 5KVFL 1AGBB 3B2VL 3LQZB 5E8EB 3TEUA 2VLJB 3CVIL 3QUYC 5HY9B 3DRQA 3BPLB 1OL0A 2BERA 4ZSOA 2NY3C 1AQDA 5ETUA 1C5BL 4NQVA 4AH2A 3GSVB 3BISA 1DP0A 5A3IC 1WBZB 2HJKA 4GXVL 5GGTL 5DUMH 1FNHA 3EBAA 1EEZB 1UM5L 4IMKA 4PG9B 1DSFL 2FYYB 2NXYB 3MRCB 2PW2B 4TSAH 1IEAA 1ADQA 4O2EB 1UJ3C 4BQCA 5HJ3B 2YK1H 4XHJC 1S5HA 2Q76B 4ZFGL 2DF3A 1IAKA 4N0CC 4EVNA 1QLRA 2I5YL 5T3ZE 1Y0LB 4WV1A 3QHZL 4QO1A 1DL7L 2JCCA 3IFLH 5DYOA 3FMGH 4WY7H 5SWZE 5INCB 2OR7A 3SCMD 2W9DH 4H0HB 3QUMB 4KQ4L 2FD6L 1SHMA 1TPXB 1MAJA 3VG0L 3VXRB 4LVOB 4J1UB 3SCMA 3SQOH 2GSGA 1M7DA 4HPOH 2N7AA 4MXVF 2Z91A 1AO7D 3UEZA 3ZL4L 2PYFB 4ZNEA 3ARYA 1U8IB 3L3JB 1AO7A 1EBAA 2LQRA 1ZANH 3T09A 2QQQA 4TVPL 3BZEB 4XZUB 1ZSDA 1N6UA 5HVGB 1G7QA 1T3FB 2GYSA 5JR1L 2V7NA 3KJ4C 4IOSD 4NO3A 1TIUA 3UTPD 3UCRA 2ARJA 3JV0A 5D2NB 3UMTA 1AI1L 4NT6B 4FABH 3MRPB 3F8UB 3L1OH 1AJ7L 5F7DA 1H3WM 2Q86B 3MOBL 1RIUL 3MZGB 2L7JA 4LIQL 5DJ6B 1OAZH 3DVIA 2OTWA 2OJZH 4PB9H 5B22A 4OIBA 1YNLH 5TE4L 3QWOA 3B5GA 3O45A 3QFJE 4G7YH 4X6CB 4XCYB 2Z31D 3FFDB 4QRUB 5HI3D 3UBXG 5MI0C 3ULUH 3QZWG 5EUOB 4PJHA 2GY7B 2Z31A 1TETL 2AEQL 1RJYA 1GGCH 4TSCH 5BOZG 5ICZB 2OI9C 4NC1E 4AJ0A 4DVBB 1O5DT 3U0TB 3RX7A 4WFEE 5ECJE 5IHBA 2LTQB 2Q3AA 4EQ3A 2ZSVB 4XNMA 1FORL 3LOWA 1F8TH 4KZDH 1I1AD 3LS4L 3QDGE 4WU5B 2HKFL 1S7UB 4LSUH 1I1AA 4DZBA 4MHHG 3UAJC 1TVHA 1YUHB 1FGNL 4K3EL 2A9ML 5CD3B 2O5YH 5IW1B 4YIQA 2FHCA 2IGFL 3V5HA 4PY7A 4OFVA 3EYFA 5IKCB 2F15A 1A8JH 4NC0B 1FL5A 3VFOB 5BJTB 4YHMH 4M7KL 3QDAA 4X83A 2JELL 1WEJL 4KDTA 3GMMB 3IU4L 2YRPA 3EOTL 5KANI 1HYSD 1VKXA 2EIDA 2HFGH 4IRSD 5EZIH 3V52L 5T3ZH 1JTOA 1OTTC 4BKLB 3WIFB 4IRSA 3IRPX 1JN6B 3X17A 3NA9L 3BH9B 4PJHF 1MEXL 2DQTL 2O5XH 3R8BB 1V3KA 1FLTX 4NYLA 4GT7A 1MHCA 1G6RA 2YBRA 3RFZC 4AIZB 2R0WL 3HKFA 3TBWA 1WAAE 1UJTA 1MCDA 3PL6C 3PQYE 4V1DE 5M94B 3RVWC 1VACB 4XHQA 4P2YA 4JY5L 5CBAB 4RISH 5I74C 3BT2H 4JVUA 2VLKD 2HP4A 4OFYA 1SY6L 1PEWA 2YPLD 3WO4B 3V95A 4UIMA 2VLKA 5AYQA 2JJTA 1I1YB 5D7LE 2CMRL 4WNQA 1TTGA 2YPLA 1T83C 4DJMA 4DOHE 4N0RA 3TJHC 4JFED 4NOFA 3VXSB 3PXJA 4YDLB 3MZTA 2HFEB 8CGTA 2B1HH 4JFEA 2Q3ZA 2VQ1B 1I7ZB 2YMXH 5FDWA 5D1XA 5GSVA 5D6CB 1N26A 4K71C 1LE5A 1UKSA 1EAJA 3QUZD 2V6HA 3QXDA 5JPNA 4DW2H 3VXQB 1FO0H 3ARWA 1ZLVH 2WBJB 3VH8A 3PWPD 3QUZA 4HLZG 5EC2B 3RTQC 3SN6N 3W81A 4UOW1 4Z7UB 3NAAH 1U91B 1KLUA 5BV7C 4YXKL 5GGSA 4YPJA 1PAMA 2V17H 3QPXL 1WWWX 2F54E 2R1WB 1NC4D 3BYYA 2MPAH 1GSMA 4JDVA 2AABL 4OCNC 3BIKB 3RL1A 4BYHA 3QQ4A 4NNPH 3QCUH 1QVOA 3GBNL 3MGTB 1HCFX 3NFSL 4XAKD 4NM8L 4JPWL 2AJVH 4G6FB 3FRUB 3GKWL 1QSED 3G6JB 1KENL 3GJFA 4PD4J 3CXHK 3T0AA 3WO3B 5FYLE 3DVNA 3LKQB 4JHAH 2EYRB 4EN3B 4R4BA 3HE6C 4XPBH 5IMOA 3BQUD 3I85A 3MA7B 5KVGH 2YKLH 3N85H 3QCTL 3O4LD 4XX1E 5GZNC 4JHBA 4JPKH 1U8KB 5LCVL 4S1QH 3MNVB 1Q38A 3O4LA 1Q9KA 4K7PY 5EU6B 3NACH 3P4MB 5IB2B 3HNTH 1LDPH 1XF2A 2FEDC 2EIZA 3MRBA 1KJ2L 4K2UH 2X4UB 4ZFOB 5LGKA 1U3HB 2JB5L 4LSTH 1X5HA 1T22A 2YWYA 4NUJB 4PREA 3LN4A 3V4VL 2LABA 2AS5M 1INDH 1D6EB 4G8GB 4NO2A 1T1WA 5DEZA 1T1ZB 3IDIA 2XQBL 3QPQC 4PRNB 3KGRA 1QQDB 4U1NA 4HWBH 1J1XH 3MRMB 2NY0C 2CJUL 4NSKB 4LPCA 3SKMB 4M3KB 1Z9OA 4BH7A 4HSQA 2IF7A 3EOYG 3HI5L 3KYNA 1F6LL 2HTKD 5BS0D 2YXFA 3C08H 1M05B 1UH3A 3DBXA 3QIUC 4FFYH 3U7YL 2XFXB 3SDYL 5BS0A 2YEZA 1FCGA 3HI1A 4PJXE 4NRXA 1CLZL 5CCKH 3O2WH 2DQGL 1IEBB 3Q5YA 4P5TA 5C0FB 1KGCE 3GDBA 4P2RB 4UT9L 4DKEL 3MFFB 1R5WB 2A6IA 4JM2D 3HG1B 4PJ9C 4D3CH 1MCJA 3SOBH 2AK4B 4K94L 4Z78B 3Q6FB 4L8SB 4E41B 3GIVB 3W0WB 4Q6YA 1R3IH 2ADFH 3KLAB 4MVBD 4U1SA 2D03L 4PG2A 4MLSA 1QNZL 4ZOCA 4JY4A 3LH2L 4LF3A 3GBML 4UOW0 5DRXB 2LAGB 1FL3A 1EK3A 2E27L 4NKDB 4YPGA 3DIFA 4KKCD 3FB5B 3ARDB 1HHIA 4XAWL 4WU7B 3BGMA 2WAHA 1NGXB 2GK0B 1LNUA 3WFCH 4R97B 5IVOA 4OUOA 1JFQL 4JN1H 5BCAA 5T1MB 5IBUB 1BHGA 1A9BA 1A7NH 3CSGA 1JHKL 3UTTB 4LAQH 2AGJH 3HUJB 5DURD 1RUMH 1YJDH 4P3DB 1IAMA 1F58H 3OKEA 1T1YA 1FNSL 2OBGA 2BSRA 1BFSA 4LVHB 2H2PD 3ZSTA 4ZPTA 5TH2B 4FXGA 2M8XA 5D7KD 1VDGA 4JFXA 3QP3A 5T3XL 3HR5B 2ZKHL 2BVTA 4F57H 1YYLL 2V2XA 3MYZA 3AREC 4M7ZC 1BPVA 5DT1H 3MLWH 25C8H 2VB5A 3GB7A 2VXQL 5I30H 3BP5B 3T0EB 4GG8B 1YN6A 2XV6B 2VDML 5DRWA 2B5IB 4ZYKA 2MHAA 5LQBH 3FT4A 3VWKD 5I2IA 2K9UA 4PRHD 4OV6F 3CFCH 4H20H 1EEYA 4HJGA 4U6VL 3KPLA 1AGCA 2PYEB 1F90L 2ADIB 1U8LB 4X4ZA 2FHFA 4Q9RH 1CFNB 1X7QB 2BFVH 3ZHDA 3I6GA 3PUCA 3SGJA 4MWFA 1KIRB 3K7UA 1F4XL 3IU3A 2O5ZH 5EO1B 1FIGL 5FGCE 1JGUH 2Y07L 3ZZ1A 2BXZA 2X70B 5GPRA 5F9WB 4YDKL 3N9GH 1IGYB 1RAMA 3QCVH 3MRKA 3U30B 2Y25A 4F7PA 5KG9A 4J3SA 3DO3A 1N7ML 3OMZA 2QKIB 4K3HA 4P2QB 5FCSH 4Z95H 1BIIB 4DKDC 2CIKB 4WENB 4I13B 1KG0B 1ORSA 4XPFL 5HGBA 4PJEF 2WWMC 1JWMB 3Q48A 4QRSA 1A3RH 1RUKL 2GTZA 4G3YL 1TTFA 5FHAH 1W0WB 1Q0YH 15C8H 4PTTB 2P42B 1KB9K 3HMXA 2P1YA 3C5ZB 4R2GB 1VPOH 43CAA 5F88A 4WO4B 3WIIH 3DVGA 3DTXA 4QCIA 4TUJA 4AIOA 3V5DA 1I7RA 2P43B 3FRPA 2BVOA 1LO0L 3CH8A 4FMFA 1TJIL 4QHNB 1F4YH 3VFSB 5MEQA 1FYTD 5BVPH 5JHLL 1CI5A 4NQSB 1A6ZA 1LHZA 2EICA 3RNQB 3CDFA 3EDDA 1PZ5A 4KI5E 3BKMH 3LDBB 3O9WC 5C7XL 4NBZB 4GG6E 5KSUA 3MSPA 4PJAE 1CDJA 5EORH 3RY6C 4X9GA 2VDOH 5CP3A 3WLWD 3IETA 4Q9QH 2GITB 4PRDA 1L7IH 5IB5A 2IWGA 2ZCKL 1JZ3A 5FGSA 2BNQB 4Y5VB 1IGMH 3WSQH 1XGRB 2I07B 3CUPB 2DOCA 4CADB 1KYOJ 4C55A 3SDAB 4JFFD 1FO0B 5JIIA 4JR9L 3HNVH 4R8WL 4ORGB 2R9HC 4UDTA 1QSZA 4M1DL 2AJYL 2WLZA 5GRVL 5D2LA 1C5CH 2OL3H 2HMIC 3HZMB 4ENEC 4RFEA 4JVPA 1RV6X 1WV7T 5ICXB 1BWMA 3EFFB 4LOUC 1T4KA 3ILQC 4BJLA 2QQKL 3ARFB 3VWJC 2ICEA 2A1WL 1MFAH 4X8JB 1HHJA 3MYJB 4LSPL 3N1PC 1QD0A 4LP5A 3WEXA 3MC0A 3BVNB 3KWWB 3FOLA 4IMLA 1HXYA 5HHVH 3MOAH 1AP2A 1MI5B 5I15L 2J7LA 2OYPA 3S36X 3L5JA 1ZT4B 3PWUA 5E8DH 3UTOA 1NCUA 3TCLA 4XPTL 4JKMA 4KJPD 4R96A 2EDQA 1DANT 3CFEB 1QR1B 3MLYL 1P5UA 1RZ7H 3X12B 4JZOB 4RGMC 4OZIE 4FQCH 2ENYA 1DFBL 2IH3A 4GAGL 4XP9H 2F5AH 3FB8A 3T1FB 5DD1L 3VGHA 5BRZD 5EU4A 3CLEH 3IVKB 1KF9B 2R2EB 4PGDB 5BRZA 1BQLL 2VDRH 4W70A 3MRQB 4HG4K 1BZ9B 1HXMB 2NLJA 3NCYP 4ODSH 3CMOH 2XPGB 1AQKL 2G5BB 1IM3B 5TFSL 1XH3B 4PP1C 2VN4A 1J9CT 5D1QD 2RQ8A 5DGQA 3S4SA 5KSAA 5GRZA 3V4UH 5CZXC 5D1QA 2ESVA 3DGGB 1Q9WA 4FFWC 5EBLB 1HHKA 5IVZA 4UBDC 3EYQD 3TCXA 3MNWA 1W8NA 3OBAA 4OCMC 3PDOB 3VXOA 4DOHB 4WFFE 5HHPA 2F53D 2ZSWB 1MHPL 5DI8A 4H1LB 3L95A 1ERNA 3NGBC 5A16A 5C2BH 1IGIL 1H5BA 1UFUA 4Z0XB 1HN1A 2F53A 2LFGA 2A6DB 2ZOKB 4YBLC 4ODXA 1RZ8B 1OP5H 4OLYH 3WFDL 3O8XD 2PR4L 1N6QL 1OAUH 1AD9A 1G7JB 1KPRB 4A6YH 5JW4N 3TBYB 2LU7A 4JRWA 3PABA 4U0RB 5ITFB 5DS8A 4O51A 4OQTH 43C9A 3R1GH 4WHTB 3RUGE 5IFAH 1BVZA 4N0UA 5I1AA 4MHHI 1X5JA 5I66B 4C59B 4LDLB 3MLXL 1RUPL 2H26A 3LAFA 1N6VA 3D69A 4JFOB 5F97E 2YRLA 3G9VA 4JFDB 5GZOD 3UJTH 4KUZH 1G9ML 3SDDD 4JGJA 2ZG2A 1UADC 2NX5E 4PS4H 3T77A 3T08A 3WNLA 5BZWA 3PXHA 3LB6D 4PRBA 4P5KB 1BP3B 2VLJD 1UM6H 4FG6C 3SE8H 1DBAL 2B4CL 3JSSA 1AGBA 3LQZA 1NGPH 5E8EA 4LCCA 2VLJA 2R15A 5HY9A 3RWHA 1F11B 4Z7VB 4OM1L 4P46B 2IBZY 2P8MA 3LVEA 4X80H 2HN7B 4NUGH 4XVUD 4Y89A 4OF0A 3CFKA 1MCIA 3GSVA 3OJVC 4XVJH 4RRPA 4WEBH 3VGAC 2P48B 4PPTA 3BUYA 2JB6B 1T80A 1A64A 1OWRM 5ESAB 1G7MB 2NXYD 3H9ZA 3PGDA 5JIKA 2X4QB 5FOBB 3REVB 2FYYA 1NBVL 2PW2A 2JJWA 1EJOH 2YN5A 4XMPL 4O2EA 1KJMA 1RJLA 5GJTH 1T21A 1JNHB 1N64H 1LP9E 2VZSA 1UWEL 3BDYL 2OR9H 3AS0A 3INUL 3BKCH 4N0YL 3B83A 1OAXL 4Y4HC 2P24A 1GGIH 2DTML 4MSWA 2V5YA 3VCLB 3GMPB 3TIEB 5INCA 1C12B 1ZAGA 3VXRD 4RMUA 3RVXC 2FO1A 1EVTC 1OM3L 3QUMA 3I50L 5JXEC 3VXRA 4J1UA 2HJLB 1LO3L 4Z18A 4EEEA 4B53A 4R3SA 4FOMA 4IOIB 4XMLL 1GIGL 2GAZB 3RWCB 4PJXB 3NMEA 3GSWB 1U8IA 1G9MC 2F58H 3WNPA 2VXVH 5AZEL 3MJ9A 1UWGL 4PJFE 4IRJC 1AGFB 3QDJA 3BZEA 2W0LA 1PKQE 4XZUA 4ZOEA 3VXUE 3D18A 4OLUL 4QNPF 2B4CC 1T3FA 1MCWW 1NLBL 3PF2A 4XVTH 1YEKH 3MBEB 5D2NA 4YWGL 1FAIH 4NT6A 5JW5B 3HMWL 2QADC 3O81A 5D7JC 3MRIA 3ZDXE 5I75C 4JQXA 2Q86A 4X0KB 3N06B 2WIIA 4HCRL 4IJ3C 5JW3L 3UC0H 1ACYH 5GGUA 4AENB 1IT9L 5I1GL 3THML 4M43H 5ADPH 5HHNB 5I1DB 2HVJB 1FN4A 2DBLH 4BZ2H 2VDKL 1KJ3L 4WHYG 5HXMA 4QRUA 3MRRA 1MCQA 2H9GB 4FZEH 1HSBA 1CFSB 1PQZB 5JOPE 3C6LA 5C6TL 4KTDL 1UWXK 1F45A 4AL8L 3ROLA 5JQHC 1BOYA 1MREH 4XBGB 4ZD3L 5I18L 3QRFM 5AZ2L 4JG0H 4DVBA 3U0TA 3ZYOA 1NANI 1U8NB 4K7FB 4P2CG 1BJ1H 4ZUTB 4F58H 3DGCR 3Q6GH 1P9MA 1F4HA 3KNBB 4MGXA 3NABH 2ZSVA 5J13C 1OAKH 3W9EA 2WM0A 3NOIA 1F02I 4WW1B 4WU5A 2P8LA 2F9BT 3GRWH 3IJSA 1A0QL 1I85C 1PVHA 1YUHA 4L5FL 4WUKH 3S88H 4IDJH 3DI3B 5IW1A 1DBBH 5D70L 2XN9A 4Y5XB 3JWDL 1JRHL 1CDYA 2AJXH 4ONFL 5IKCA 3MJGX 5C0RL 4F9LA 2IBGA 3VFOA 3ZTJG 5BJTA 2MKLC 1WCBB 1UH4A 3PHQA 2OL3B 5D8JH 2KBGA 1QBMH 4OLVH 3NN8A 2YA0A 1UCBL 1XCTA 2PO6C 3RIFF 2G75B 1R0AL 1DCLA 5BMFH 1JN6A 1FZMB 5D72L 3HI6H 2C3WA 5EIQA 3OJDB 3RI5F 3P4LA 1EXUB 4EXKA 5TE7L 4Y16C 1XZ0A 2EZ0C 5SWQA 4U33A 2EDJA 5CILL 3VFUB 1GH7A 5EBMA 5FGCB 4K8RD 4AIZA 3HAEB 4P48A 2VDPL 2OTPA 1RIHH 1T2QH 2HAZA 1A1MB 3AU1B 5AYUH 3CXHJ 1LO5A 3QJFB 4TTDC 3SE4C 1I1CA 3DROA 7FABH 1A7RH 1WZ1L 2WUCH 5E5RB 1CICC 5ACZB 35C8H 4ZXBB 4OLXH 2L0DA 3KXFE 1K4CB 3R06B 4BSJA 2C1OB 1BJ1J 5FGBA 2CLRA 3RZCB 2UZIH 1CL7L 3VXSD 3BWAB 2R0KL 3MJ8A 5DUPL 1NCWH 3C2AH 3VXSA 1LK3L 3BPOC 3MXVL 2EDNA 1P1ZB 4JO4L 4GFTB 4XVSL 2PW1B 3MOQA 3MRLB 2OCFD 5IB1B 2WBJD 5KVDL 2QHLA 4X9IA 5F7MC 1VFMA 5MEOB 4MJ4A 2X44D 4JZNB 2WBJA 2WMPA 3WN5A 1K8IB 3FO9A 3CMGA 1U8PA 3LKNA 3P9LB 4Z7UA 1MAML 4CMHC 3QNYB 2R1WA 2WIMA 3MUHL 2MCPL 5CWSB 3BIKA 2D9QB 1H3PL 4G6FD 4DEPC 4W4OA 3UJIL 3WIHA 2EDHA 5I16B 1I8LA 5D9SB 4U2ZA 1JF5A 4ONHB 4TSBL 5T33H 1CE1L 4OV5B 1JGEB 2ED9A 1F42A 4PJAB 4X8XA 4ODBD 4EN3D 4J4PD 3LKQA 1FG9C 2J8UE 2EYRA 4JREB 4OF6A 4J4PA 4MCYA 2P5WE 4X7FC 4BSWA 4JG1H 4IMKC 1D5XB 4A6YB 1FFQA 3MA7A 1JZ8A 2FEEI 5E9DE 5EU6D 5BZDB 1U8KA 3JTTB 3MNVA 4UZGA 3TYGL 4J6RH 1QFHA 5GS0D 4WHCA 2ID5A 4IRZH 4RGNE 5EU6A 3PWNA 3P4MA 1KCKA 3HZYA 2EDXA 1U3HD 5IB2A 4NQXA 5EUKB 2O61B 3U46A 2XTJB 4ZFOA 1NCCL 1U3HA 3KPOA 4I3SL 4G8GD 4NUJA 4LPUA 3T3MF 5K9KA 3H7BB 1D6EA 5HHME 5HDLA 4NKMA 5EZLA 2UWEE 1TLKA 5C09E 4G8GA 2NY6B 3SCMC 4QHLB 1T1ZA 5MHSD 3P3YA 4ZOBA 3OKOB 2E5EA 4MX7A 4QRPB 4XB8A 5FA3A 5DSCB 3MRMA 1T7VA 4DWHA 4F7MB 5CLWA 3SKMA 2AQ3A 3QNZB 4FP8L 2GHWB 3I75B 1GAFH 2VZVA 3FB6A 5IVNA 3GIZL 4QKXB 1AGDA 1FVDB 1M05A 1MCHA 3ULSB 1FE8L 4APQB 2XFXA 4ONGH 4OZIB 1C5DB 3O6ML 4LCWE 1P84J 5I9QC 1JJUA 1IEBA 4HK3N 4LLDB 5DK3A 4ZPVA 3TH3T 2NW3A 2VABB 4ERSH 1R3HB 1IMHC 2A74B 3HG1D 5DVKA 1RUAL 1KIPB 1PZUB 2AK4D 3SE9L 4DGYL 3BZFB 2HWZH 2X9YA 4E41D 3MFFA 3W0WD 1G6RL 4XC1L 4I4WA 2AK4A 4F9PA 4Z78A 1A4JB 5F71A 4L8SA 3CX5K 4E41A 3GIVA 4FXKA 3KLAA 1T03H 3U1SH 3FZUD 1L7TL 4IHOB 4XCNA 5E4EC 2Z31C 4KUCF 3ARDD 5HI3C 1YPZB 4YDVB 5HYSB 3W9DB 2VUYA 4XMKL 3ARDA 3L3DB 4WU7A 5GGQH 1MHEB 1IC7H 1NFDB 4ZFFB 2APXA 1BBDL 5F6IB 5ACMA 4WI7A 3UTTD 5T1MA 5IT2L 2AAVA 3NCCB 1I1AC 3UTTA 4MAUH 3WE6B 4X6FB 1X5YA 3HUJA 3H3BC 1H15B 1L0QA 4WVRA 1X3DA 3MUZ1 3S98A 5I8KH 1YEFL 2COQA 3ZDYF 4GAFB 2HFFB 2R8SL 2IAMB 3SKUD 3DYPA 5SWSB 4QLRA 4ZS7L 3ESVF 3OHXA 5TH2A 2ZZUT 3RUGB 4PJ7B 3U4BH 3PE9A 2AK1L 2HKHL 3S37X 4TRPH 3T0ED 3V7MA 1HYSC 1C7SA 2C4XA 4G6ML 1AR2A 4IRSC 5E2WL 3ES6B 4LCIL 3BP5A 3T0EA 1DQTA 3SDXE 5DJAB 5FYJU 1E4JA 3A0OA 1OY3B 3QQ9D 5HI4D 4XI5D 1U8MB 1P4LB 3OGCB 5JNYA 4XCCL 3DETD 2PYED 1QFPA 3K4DA 3M8OH 3UDWC 1OAQH 3FJTA 3O6LL 5I71B 1BLNB 1X5AA 2PYEA 2FX8L 4RZCB 4I18B 1YNKL 2ADIA 1RIVL 1CFNA 1A47A 2KUTA 1RZKL 1KCVL 1NSNL 1S7VA 1KIRA 3ZKSD 2EDWA 2HVKB 1ZVYA 5EO1A 1WGOA 5F9DC 1RZJH 3BN9D 4NN5C 2J8OA 2J5LC 4UB0H 2JLLA 2JJTC 3K3QA 3MLRL 4XCFL 1IGYA 3EOAB 1JPFA 2IJ0C 2QHRH 4UTBL 2EH8L 4XWOD 1U8HB 5CJ8A 3V7AE 3IXAB 1NMAL 4MJ5B 4P2QD 4M5YL 3L6FB 1MFEL 4JFZL 1MRDH 1U93B 5EOTA 5AG8A 1RI8A 1EMTH 3K0WA 2CIKA 3QO1A 5EZOH 2DWEB 1E6OH 1LP9B 2GQHA 3LKRB 3HC0A 4R9HA 3OG6B 5F21B 3DURA 1KG0A 4K7PX 4NWUL 2HG5B 3FTGA 1YY8B 4XT1C 4MQXD 3HCVA 5D4QA 1JWMA 3T65B 3QUZC 3CVHA 4PRIE 3ULUF 4Z7NE 1ZMYA 5SWZA 3C5ZD 4R2GD 5HDBF 4TUKH 1FH5H 2DLFL 4JM4L 1A22B 5KJRH 5CIPH 3C5ZA 4WO4D 3IDUA 1IL1A 4G9DB 5KVEH 2W91A 4ESKA 4WO4A 4M6AA 5FIEA 5IMLA 3QULB 1P4BL 4AIXA 1NQBA 1P53A 1J05B 4PB0H 4AG4L 4G9FE 3M1BB 4NZDA 3DX9B 5TF1H 1RUQH 1GGUA 4N0FA 2BVPA 1PKQB 4NQSA 2BMKB 3RNQA 1IKFL 2EH7L 2F19L 4JFQA 2A38A 3O11B 2BNQD 5IGXL 3BQUC 4LK4A 2HH0L 4OJFL 1REIA 5L8LB 3SDAD 4YXHH 3FT2B 3MACL 4KTEL 1XGRA 4ZTPL 2I07A 2DQCL 3LHPL 3CUPA 1CWVA 4CADA 3Q0HA 3SDAA 1FO0A 3KYKL 4HG4J 5E6YA 3EYSH 5CEYB 5IK3A 2VXTH 5TJWK 4UOJA 4FMKA 5K9JH 5J1AB 4G6KH 4LMQI 1UEYA 4X4YA 3GI8L 4QHMB 4WFED 1CF8L 5C0BE 3ARFD 4HXBH 4Q9CA 2ZUQC 5ICXA 4ZTOL 3IDMB 1M7XA 3ESUF 1KB5B 5TQ2L 5F9OL 1S7TA 1DE4B 1K2DA 4U1KA 5E00B 3HLAB 4X8JA 3MYJA 3I6KB 3T0XA 3BVNA 3KWWA 1MI5D 1W0YT 3QDGA 5B38G 1IBGH 4QY8A 2ICES 4JQIL 4KJQD 4LGSB 4HC1H 3W11D 3L3GA 2HTKC 2X6MA 4O4YL 1ZT4A 2BC4B 1MNUH 4L9LA 5B8CB 5GRUH 4UINH 4YBHA 5HHXH 3CFEA 4O2FB 5E8OA 1KJVB 1UYWL 1QR1A 1VGKB 2MTPA 1A3LH 5E8NB 4JPVH 3DV4B 1QKZH 1GPOH 2H1PH 4S2SA 2ORBH 3QXWA 4HAFA 5LGJB 4DUVA 4JM2C 1D9KA 3U7AA 1N5AB 4UILL 2EO9A 3T1FA 1ZGLA 2P4AB 4K9EH 4MVBC 4ZUWB 3IVKA 5BVJB 1DBKH 2BNRB 2XWBB 1XGTA 4YEEA 1J1PH 3GFUA 3MRQA 1BZ9A 1HXMA 2ICWA 3P30H 4D0BA 2X4OB 2XPGA 4OFDA 2G5BA 1IM3A 1RQ5A 2RB8A 4FQIH 4KGLA 5I1JL 3BGFB 4PLOB 3O2DH 1WAAA 4B41A 4HWBA 4KKCC 1JZ7A 1CU4H 3PQYA 1OOAA 5DJZA 3SGEI 4ETQB 2XY1A 5DJ0B 4BK4A 4DGVL 3TNNA 4HFWB 9CGTA 3DGGA 4HJ0D 4M1GL 1LO4L 5EBLA 2NY2B 2NCMA 5D7LA 4D0DB 1F6AB 5AEAA 1PG7W 3MPCA 1EFXB 4P49A 5J89A 2A6KB 1FRGH 3VG9B 3PNWB 1Z9MA 4M6MH 1IFHL 3O3BB 4Z0XA 5CJXA 2ZOKA 3OKMB 2C26A 2J88H 2OX5A 5GHWH 2H2PC 1VFOA 2CKBL 2CLZA 1PG7L 1KEGL 4EOWH 1KPRA 4FQPA 4PGEB 4OF3A 1UWXH 3MGAA 2CO7B 4LFHD 5ITFA 5CFHA 3E6FB 3HRZB 4WHTA 2GY5A 4JFDD 5I66A 2YPVH 1HYRC 3TIDB 1T0NB 2F54A 4X98B 3CIQA 1MJ7L 4XNZC 1H3VA 4NQUA 4CU6A 2FSEB 2HTLD 3X14A 3VWKC 5KSBB 5C0AB 4DTGH 1RURH 5GGVL 1CFQA 2YD7A 4P5KA 1AE6H 2GCYB 4P46D 1IGJB 1W72L 1JGLH 2I9TB 2Y1VA 1XF5A 4R0LB 3DSFL 1F11A 1HHGB 2J8UB 3HNSH 1TITA 4QXUH 3LSOA 1B2WL 1PG7X 1I8KB 5ALCH 3MV8B 3VFRA 3HZKB 3Q1SL 2JB6A 1UVQA 5F7EL 4OT1L 3G04B 4MD0B 1UACH 3X13A 3O6FB 4LCUB 4RGNB 4UV4H 5CJQL 3RA7L 5LG1A 2VXUL 5GS1B 1CCZA 1SYSA 4NQEE 4YHKH 1IGFH 3T0VA 5JQ6H 2GSIB 1JNHA 4XC3L 1XCQB 1L4IA 1XMWA 1XGYL 5HHMB 3ARGB 3GO1L 3LIZL 4WCYL 1KELL 1FC2D 1QYGL 1EZVY 1R3KB 4IIQB 4LDOB 3FT3B 5FF6B 3GMPA 1VEMA 1FV1B 4JB9L 5F9AC 3EFDH 1MCSA 2JIXB 3RNKA 3S3JA 1IQDA 3AMLA 4DUWA 2H8PA 3OKLA 2YC1A 3CCHA 2JKXA 4PJIE 4D9LH 4MNQE 4ODVH 1I8IA 4MD5B 2GAZA 3H3PL 3JV6B 1SYVB 4PJXA 4S1RH 4YHPA 1DZBA 3WUZA 4HLZH 4YQXH 1V3JA 3WXVH 4CUCA 3VFVB 2FBOJ 1CE6B 1GC1L 2V2WB 2PCPB 1JNNH 3O3DB 2KKQA 3MBED 3WLWC 3S35X 1PSKL 1RULH 3O0RL 5IQ9B 5JW5A 3L5XL 4K23L 5MENB 2OR8A 1Q1JH 4Z8FH 1XR8B 3BKJL 3WLBA 3LEYH 4U05A 3P40A 4GKNB 4N8VA 1O7SA 1BQHB 2VWEC 2P5EE 5C07B 2H9GA 3BE1L 1MPAH 3F58H 1BFOA 1MRCL 3BSZH 1CN4A 1PQZA 2VKWA 2ZUXA 3JVGA 5DQDH 3MLUL 2XT1B 3LRHA 4XBGA 5I8EB 3WD5L 4RX4D 2ILLA 4K7FA 4MXWL 4ZUTA 4GKSB 5IFHL 3KNBA 4XP1L 1NANH 1HDMB 2QQNL 3QQ3B 3TV3L 5F3BA 4PGBB 3PGFL 3GHBH 3FCTB 4WW1A 4NGHL 1CLOL 5IJVB 2IFFL 1KC5L 3FO1B 4KJPC 2EXWD 5FM5M 2R2HB 4GRWF 3C87A 2RIKA 4I0PB 3WNMA 4OFPA 4DFIA 1ODAA 4Y5XA 5F7YC 4M7LH 4F3FA 3AS3A 5DC4B 3MCG1 2FJGA 3L3OB 1WCBA 1OCWL 3UTSB 1HH9B 2OL3A 3ZKND 2ZNWA 1Z5LB 4WW2A 1GC1C 1IGCL 5JIPA 2G75A 5A2JH 1NGYB 1MQKH 2FGWL 2ATPB 5KTEH 2CGRH 4RWYH 4R4FL 4UIKH 3OJDA 3G6DL 3FHAA 3KJ6L 3HN3A 5L6YH 1Y6KR 4AMKL 1EAPA 4KVNL 5D1QC 1BQUA 1N3NB 3MJ7B 5HBBA 3BX7C 5D7SL 3ZKXB 3ARVA 1HOCB 1JF6A 4L3AA 5EOCL 1QZ1A 1A1MA 5DR5L 1ZOXA 2G2RB 5JA9A 3BH8A 3PHSA 4FQQB 1VESA 3MV7B 3UJJH 2DQUH 4LU5H 1JTPA 2XG5A 3AVEA 3QH3B 4ZXBD 1CIDA 3EYQC 3F7YB 2VXSH 1H3TA 3QEGH 2IBZX 3IJYB 3RZCD 4MJ6B 4XH2A 1V7MH 1ZVSB 1K4CA 3R06A 5DD0H 2C1OA 3WS3A 3RZCA 4M5ZH 3BWAA 1WF5A 4K3DL 2FBJL 1WZKA 3BEWA 4MB4A 4M9PA 3VE0B 4PJBF 3O8XC 2PTTB 3TA3A 4PRIB 4Y19E 3NFPA 1E27A 1AHWB 4GJTB 4MAYB 5F1IB 2PW1A 1J8KA 3MRLA 4M48L 4WW2F 3FO0L 5IB1A 4XGZA 4L1HA 2X1XR 4NZUH 4WIQA 3MX0A 1U8OB 3SPVB 3SEPA 1NCBL 3QAZC 4KRLB 4JZNA 2NYYD 1V7NL 4HIIB 4DAGH 1K8IA 5GZOC 1D6VL 2IALB 4HGKC 3P9LA 5GXBB 5ILTL 4G9FB 1AR1D 2E7CA 1TJGL 3QNYA 3SDDC 1WWAX 1LD9B 3E3QC 4G42B 3PV6B 5AAWA 2A77H 1FC1A 5CWSA 3ET9F 3LB6C 4UNUA 4UUJA 4KI5D 5EOQL 5L88L 3BPLC 2NZIA 4LDEB 5FDYA 2AI0H 1CZ8L 2V7HA 1QRNE 4LARL 2RFXB 5I16A 5D9SA 3MLTA 5E95B 4OV5A 4GG6A 2DM3A 1JGEA 4PJAA 2ZUTA 3QZWB 1JHLL 4XVUC 4I48A 3GSNA 4HFUL 1VERA 1X9QA 2W0KA 3PP4L 3RVTD 2EE2A 3QXTA 4HUXB 1MCBA 3KAAA 1U9KA 3K2MC 2JJUA 1D5XA 4A6YA 2NXYC 3F7VB 2VZUA 2OK0L 1NL0H 3ARBB 1H3UA 4P23B 3JWOH 5BZDA 4HX1A 4OQTA 4ZUSA 3MO1B 1FGVL 4GOSA 3U79A 5GISH 5ANME 1WTLA 2HJFB 2FX9H 2XTJD 2W38A 5F7WC 3I3EA 3QI9B 2PKDA 5C0BB 2YA1A 5IMKA 2DKSA 2Z4QB 4ZUUB 1GGBH 4M03A 5EUKA 4G5ZH 2O61A 3KPSE 4POYA 1XGPB 1T7YA 1EA9C 1ZLUK 2Q6WB 3FOMA 5GRWA 3VGAB 3KYOA 4QHKJ 4PRAB 2NY6D 5FM8A 2AEIT 1KACB 3P9MB 1TPXC 4PUBL 3WNNA 4QRPD 1B3JA 4MA8L 4LVOC 4MJIE 5HI5D 3LQAC 5DLMH 3B9KB 4QRPA 1NEZA 4HIXH 3U36B 1BOGB 1UB5B 3EYVA 5FYKU 3C5JA 4KI5F 5TPWH 3QNZA 3K8KA 1OGTB 5E94B 4GG6F 3QIBB 4PJAF 1PKOA 3I75A 4APQD 1MJJB 4X7SH 4LEXH 5F72S 2DAVA 3AXLB 3ULSA 4APQA 2HLAB 3VU2A 4L3EE 4B7IA 4OZIA 3BP6B 2D7NA 1C5DA 2R4RL 4XRCA 4LLDA 1A6VH 2WW8A 5D2NC 4FN0A 4P3CH 5TQ0L 2A74A 1KIPA 1DEEA 4JFHE 2DL2A 3BZFA 3CGTA 4N8CL 3IS0X 3U4EA 4TVPE 5FHBH 3UPCA 4M6NL 3IFOB 4X6BB 1JK8B 4Y1AE 5IVXE 3QQNA 4K8RL 2J4WL 4OBRA 2AKRA 2VZ3A 2X09A 1WQVT 2RJMA 1SBSL 5C0DB 1EFQA 4LIQE 4ZAKA 1I9RL 2MKWA 3PWLB 1YC7A 3GK8L 3RWFA 4YDVA 3WFHB 5HYSA 4LASH 5E7BA 3TPUA 5IROC 3L3DA 1WTGT 1MHEA 4WFFD 1G9NH 2BP3A 3UO1H 2LTQC 4LBEA 1NCDH 1L0XA 2D4DA 4NQDE 4PGZA 4IEFB 4HMDA 4DK3A 4OZGB 2O26U 3L5WB 3D2UB 5DC0A 5FAAA 2IANE 4YFDB 3SJVE 3WE6A 4X6FA 2VE6B 3B2VH 1H15A 5HPOA 2IAMD 5SWSD 1S9YA 3F65A 3TO4A 2HFFA 4QRRE 1ZHLA 3NCEB 1C7TA 2IAMA 2DYPB 3GMQB 3C60B 1XGQA 5AUMB 2EE6A 5EA0H 5E2VH 3V0VA 3RUGA 4WJ5A 1CFVL 3OAUL 1T0MB 3QSKB 1AXSB 2X4PB 3E1F1 3KPQB 3V4PH 3I6LD 1UM5H 3BRDA 1DSFH 3BEVB 3ES6A 4YHYB 2XWTB 4JFYB 1XF4B 4Z5RB 2NX5A 1KCUH 2VO5A 2NPLX 5DVLA 2BY2A 1NAKH 1S9WB 3OKDA 4LVNB 4ZFGH 2XA8L 3RPIA 3OGCA 4G8IB 5C92A 1IARB 4LMQE 32C2A 1URLA 2I5YH 3GM8A 3V6ZB 2QR0B 5HGHA 3QHZH 1WC7A 2VSDA 3QG6B 4I18A 4K8RC 5JHDB 5C0EB 4O58L 4YEFA 2EDBA 1F6FB 2RAMA 2HVKA 3CH1B 4KQ4H 1I75A 3WO4C 2MQ0A 3EIFA 3U0WL 3VG0H 2ENSA 3JV5A 5DRZB 2V5MA 4OLZL 5GIRB 1UH2A 2R0ZL 5GS0L 2XZCH 1IRAY 1BX2B 1U8HA 3IXAA 4M3JA 1FFNB 2M1KA 1CLYL 3DPBA 4ODTH 3ZL4H 4YDLC 1AGEB 1U93A 2EDLA 3OV6A 4K3JL 3FQNA 2CDEB 4NQEB 5H37G 3RUGF 1FLRH 4TVPH 1BGXH 2DWEA 4FQLL 2DMKA 1LP9A 3ZDZE 3LKRA 4KRPB 5JR1H 1JL8A 4YO0B 2HG5A 2Q1EA 3RIFK 1YY8A 2WBJC 3EYUL 3WFEL 3T65A 1AI1H 5FGRA 4C58B 4NNXB 1AJ7H 3TJHD 3CX2A 4N8VG 1IC4L 5JLZA 5IFJB 3RI5K 3MOBH 3SDCB 3U6RB 1DEDA 1NGZB 3LN9A 4LNRA 5FYKH 3MA9H 1BZ7A 1HWHB 4QYOB 5CEZL 4PJIB 5TE4H 2J2ZA 3DRTA 3QULA 4W4OC 4CAGA 3G5YB 5DZNA 5ISZE 1I8LC 1J05A 2IQAB 2AV7B 3NFNB 3N1MC 1TETH 2VIRB 1UA6L 2AEQH 2WQ8A 1YEDB 1RMFL 5EG6C 4OCXL 1TZHB 1PKQA 3VXUA 5ERWB 4OD2B 1ES0A 2BMKA 4D9RE 4J4PC 1JGVH 2J6EL 4BQ8A 2CK0L 1WZLA 4DCQA 3IFNL 4HIEA 1FORH 5HYJE 4U1HB 4N68A 4WY7L 3IFPA 4Z9KB 5JZ7D 2B0SL 1M1SA 2W9DL 3CK0H 2HKFH 3O4OB 1LP9F 2C3GA 4LLVB 3DRQB 3BW9B 3SQOL 2AVGA 4ZSOB 1FGNH 4RA3A 4K3EH 2A9MH 4FTVE 1AQDB 1OF2A 1HI6A 2IGFH 1I9JH 5GS0C 5I1LA 3O2VL 5JOPD 2YPKB 5CEYA 4M6OH 1U3HC 5FXCH 2HJKB 1VSCA 3VA2C 2JELH 1WEJH 5J1AA 2XNAA 4XP5H 4KKAD 3IU4H 3EOTH 2XACC 1LEKB 3V52H 3FN0L 3U2SB 2E9JA 3DX8B 3LCYA 2L4OA 2VISB 1DE4A 3NA9H 1IAKB 4Q0XL 1MIEL 4EVNB 3I6KA 2DQTH 2YUVA 2FX7L 4PJFF 1NC2B 1ZE3C 4WV1B 1OAZL 1HNGA 2G5RA 2R0WH 5CHNB 4U6HA 2VZ1A 4XPGL 1YEHL 5B8CA 3J8F7 3ZDXF 1FBIL 3Q2CA 2N7BA 4O2FA 1SY6H 3SHSA 1GGCL 2GSGB 1VGKA 4OTXH 2Z91B 4F9PC 4L8SC 4M61B 5LGJA 1TZIB 4MJ2A 1N5AA 1ND0A 1JYNA 4WUUE 2BNRD 5DF0A 4ZUWA 1ZSDB 2XWBA 3HC3H 1CR9L 1G7QB 4CRPA 4LSUL 3FZUC 2PF6A 2V7NB 1ZGLP 4NO3B 2X4OA 4QXTA 3ARDC 3AC0A 1UT9A 2DTSA 2IADB 4ETQA 4R97C 2IC2A 5D71H 3SGEH 2NY2D 1UB6A 2NY5H 4YXKH 1UXWA 3QPXH 2VERN 1CBVH 4P5MB 3QWOB 1EFXD 5C9JB 2A2QT 3O45B 2EC8A 4X9FA 5F70A 2Q7YA 1F6AA 1OHQA 4Z76A 2DMCA 4XXCA 1JPSL 4PJHB 3GBNH 2A6KA 4FNLL 4MNGE 4LKXA 4WHYH 3NFSH 1RJYB 5MP6H 3LMJL 3GI9L 4NM8H 1B0WA 3PNWA 1ITCA 4OZFH 5K93A 4LVHC 3VD9A 3GKWH 3OKMA 3L3KA 1CXEA 4G8FA 4U0QB 1UXSA 4EUPA 3FO2A 5FO8A 1JI1A 2FR4A 3SY0B 3W82A 1KTRL 1CXFA 2Y5EA 1MIMH 3TN0B 1FNLA 4RISL 5EU5A 3T0EC 4ZO8A 4KC3B 2X5PA 3HRZA 4P4KA 3M07A 4DZBB 4GW1A 5LCVH 3D48R 2P8PB 2B5IC 3V5HB 1T0NA 5T3XE 1RJCA 5C0AD 3QQ9C 5HI4C 4XI5C 5FCUL 4YDIL 2FCBA 5C0ND 3DETC 3ZT6A 4B5EA 2GTWB 1KJ2H 2B1HL 4JO1L 2JB5H 2XA3A 2YMXL 1VKXB 1QSFB 3ZTJH 1F4WL 3V4VH 2NQCA 4KQ3H 1NEZG 1QO3A 4KMLB 4QHUA 4KDVA 4UQ3A 1IGJA 2DKMA 3GJEA 2I9TA 1IQWL 5CMAB 4R0LA 5F9WC 3MV8D 2J8UA 3VFPA 3BN9C 3VD4A 3P0VL 1FO0L 1OGAE 2P5WA 1MY7A 1YMHA 3U30C 5DMJB 1N59B 1DR9A 4G80B 2WWKO 1MHCB 4XWOC 3NAAL 3HMXH 3HI5H 5CUSL 1PX4A 3O6FD 3ZE0E 4PIRF 4RGND 5T1DL 3TBWB 1KPUB 1KEMH 4JO3L 4MD0A 1UG9A 1D5MB 3O6FA 3U7YH 1GGYA 1R5IA 3QCUL 2DN7A 2DQGH 4PTUA 3KPSB 2PTVA 4N5ED 5HHMD 3ARGD 2NTSP 4UT9H 4MQXC 1A6PA 4DKEH 4WNQB 5L0QB 4P9HL 4LP4A 4K94H 3C5ZC 5K9OB 2UWEA 4R2GC 5C09A 2EDOA 5LBSL 4XPBL 4IIQA 4FZ8H 4FS0A 2BXYA 4WO4C 2D03H 5CP3H 1QNZH 2JIXD 1KBGL 3LH2H 4NQCB 5DO2D 2YKLL 4TYUA 5D1XB 1UKTA 5GSVB 1FV1A 5LAXB 2JIXA 1LE5B 4AQOA 2E27H 3QXDB 1OAYL 4HAGA 1DQLL 2J8UF 1ZHNB 5IUSA 1UZ6E 4L3EB 4MD5A 4ELME 3MUGB 3JV6A 1SYVA 4LCWA 1KLUB 4HKZA 3LDBC 5GGSB 3ARSA 4LSTL 1VFAA 4X5LA 4QF1B 1CE6A 1INDL 4JDVB 3D85B 2DQDL 1GOHA 3C8KB 3OR7B 2PCPA 1JHKH 1IILE 4TNWK 5I6XB 1DQML 5MEND 3SDAC 3SKNA 3IAGC 3C2SA 3ULVD 5KW9L 5IQ9A 4LLQB 1FNSH 3CFDB 1NUGA 1DJSA 3S35H 3STZB 3QEQE 1ZLWH 4NFBA 3DVNB 1BQSA 3L7EA 4R4BB 3C08L 1CVRA 5IMOB 4GKNA 2UWEF 5CIPA 1ZV5A 1T7ZA 5C07D 2ZKHH 1V3MA 3O41A 4M9OA 4NC1C 3IDGB 1JPGB 5B3JE 2IEPA 1PGRB 5CCKL 3ARFC 5C07A 1GOFA 2VXQH 5EWIL 1TDQA 3WJLA 4I3RL 4NQDB 1Q9KB 2NTFB 2VDMH 3EO9H 4WEUD 4D3CL 3SOBL 2W9EH 1XF2B 1X44A 2G9HA 2IANB 3KS0H 3QEUA 3BPCB 4P9HC 1QLEH 4RAHA 2RCSL 2HMID 4U6VH 1R3IL 3F6IA 3D5OF 1F90H 3G5VB 3QQ3A 1T22B 4KJQC 4PREB 5FUOL 4PGBA 3W11C 5L7XL 4QRRB 4I5BB 4HD9A 5CS7A 5GJSL 3V0AC 1F4XH 3MROA 2XZZA 4I0PD 3IDIB 5DD6A 2Y07H 2P44B 5F6HI 4AEFA 3K2UH 4UNTA 3FO1A 1ZLUH 2R2HA 4YDKH 3MLVL 2YZ8A 5CZVH 4UT6L 3UTSD 5JDJA 3KYNB 4JN1L 4PFEA 5C70A 4C56B 3UTSA 1HH9A 5FECB 1N7MH 1P7KB 2VH5H 2OP4L 1A7NL 1YC8A 1Z5LA 2YEZB 2Y7QB 5EU7E 2AGJL 4NRXB 2DQJL 1RUML 2CO6B 4WHDA 4P5TB 1NGYA 1F58L 2ATPA 5IM7B 4DFHA 4XP4L 2FIKB 4C57C 1E4XI 1RUKH 4G3YH 1J5OL 3JV4B 2AJSL 2DQHL 4WGVB 1HOCA 3MV7D 2WLYA 1BEYH 2D4FA 3QUXA 4HC1A 4NZRL 4JY4B 4F57L 2R0LH 4NN6B 3MV7A 1K3IA 3MLWL 4OCRL 2OMNA 5DJ2A 3QH3A 3S5LA 3F7YA 3T0WA 2DM7A 1HQRA 3IJYA 4F15B 5FYJD 3OJ2C 1H0DB 3NIGE 5CJXC 3UZVB 3KS0J 3BGMB 1TJIH 1AH1A 4RA0C 3VFTB 1LNUB 4H20L 3OB0K 5JHLH 2FH8A 2VQUA 4KKBD 4PY8I 5H94B 4H88L 1WJ3A 1CD9B 4PRID 5H35B 4MAYD 4UBDD 5C7XH 2PTTA 3SDXF 4LKCA 4PRIA 4U0RC 1A9BB 3EGSB 1AHWA 4MAYA 3BMWA 5F1IA 4YHLL 5HYEA 2ZUWA 1DDHB 3G9AB 4Y4KA 4L9DA 5ITBH 5C86A 4HXAL 1U8OA 5D6DA 1JPTL 2ZCHL 3O2DA 3P4NA 3HZVA 3CC5B 4P57B 2BSRB 4G9FD 4HIIA 4JR9H 4R8WH 3UYRL 5B3NA 4ZPTB 5EBWA 2FECL 4M1DH 5HGAB 2AJYH 2IALA 5AAMA 5EN2B 5ISZB 2HTLC 4G9FA 4JFXB 2X40A 5H8DA 1LD9A 4G42A 4HBQA 3PV6A 2V2XB 4PJEB 4JRYE 5D93B 3GSQA 1YJDC 4P46C 3FQWA 4GSDH 2C7UA 2A1WH 5CKGA 1A3RL 4Y8AA 5DRWB 4ZYKB 5HYJB 2MHAB 4LSPH 4L4JA 3FT4B 3CNKA 3NZHL 3KLHD 1G7HB 1R6VA 2XICA 3KPLB 5J8OA 3D39E 4HUXA 4PJCE 3IT8D 3ARBD 4FG6D 4P23D 4A2LA 2QSVA 2QQLL 4MWFB 3F7VA 4MLIA 1KV3A 5DD5H 3WIIL 5I0DA 3IU3B 3H7LA 3ARBA 2VN7A 4P23A 4Z6AT 4XPTH 4BFIB 4Z7NF 5HYQA 5EO0A 4BQ6A 2BNUA 5C0BD 4TUOA 3QI9D 1ZHBA 3MLYH 3MLPA 4U6YA 3PG2A 2H2SD 4D9QE 2BDNH 1OARH 5BVPL 5C0BA 1DVFB 5IQ7L 4I77L 4ZUUA 3TGXA 1DFBH 3M17B 3DMMB 2H6PA 4ODWA 2Q6WA 5DD1H 3K80A 2RHEA 2BJML 3OG4B 1ZLSL 5MERB 2VR9A 4Q9QL 3P9MA 5MEPA 1L7IL 1BQLH 3B9KD 2VL5A 2XZAL 4U4BA 5TDOA 1AQKH 2CR3A 3B9KA 3QIBD 2VNCA 1BOGA 2G60H 1UB5A 2F74B 2D31B 5JUEL 1OGTA 3MCKB 3TJEL 4PJGE 4QOKB 1C16A 4ZO6A 2OL3L 2UV3A 1O0VA 2X7LA 4MA1B 3AXLA 43CAB 2HLAA 1OD7A 5F88B 3OAYK 1B4RA 2WBKA 1Y18B 1FPTL 4RAVB 2C1PA 4QCIB 3OZ9H 3UZQA 5E8PB 3V5DB 1E4WL 1I7RB 2IMNA 1DBJH 1S3KH 1P6AB 5CGYD 2FGZA 2BVOB 1MFAL 1MHPH 2R1YA 2CPCA 4AYFA 1IGIH 3OXSA 1U2HA 1CQKA 1CXKA 4EUPG 1DN0B 4H5SA 2BOCA 3CDCA 5DFWH 4X6BA 1TZGH 3VW3H 2PR4H 5KSUB 3LKOB 3IETB 4PRDB 5IB5B 5C0DA 2VR4A 4X4XB 3PWLA 3QJHB 3WFHA 3E6HB 3MLXH 4XBEL 1WT5C 1CGXA 1A6TA 4FQCL 3DXAE 3IS1X 4LPVA 4NBYB 5EULV 1HSAB 4XP9L 2F5AL 1B0RA 12E8L 2PXYB 3D2UD 4RFEB 1T89A 4X4MA 4HF5L 5IEKA 3L5WA 4HQQH 4ALAL 5J6HB 1I3GH 3D2UA 3ALXA 1B0GB 1WBYB 2VE6A 4NWTL 2DYPD 3C60D 3AM8A 4Y5XC 1HHJB 2W92A 2EXWC 2DYPA 1RJZA 4PGCA 3C60A 1INQA 3FOLB 1CVSC 5AUMA 4MZ3A 1X5KA 1HXYB 5JMRA 4NKOA 5EU3B 1JIBA 3K8LA 1PFCA 1T0MA 1AXSA 1CD8A 4ODHH 2VDNL 5I17A 1X4XA 3ZKNC 4G6AD 5A2LH 3TCLB 3MXWH 2P46B 1NBVH 1BREA 2XWTA 3MFGB 4Y88A 2OZ4L 4Z5RA 1JYVA 5C08E 3NBNA 3MRHB 5C2BL 1NGWA 4HJJH 1K8DB 1S9WA 4HGWA 3BDYH 5E2JA 1V5JA 5F8QC 3V6ZA 3INUH 4OLYL 5JHDD 1TJHL 3FB8B 4N0YH 5EU4B 1OAXH 1HKFA 2VAAB 3EKCA 2IG2H 2DTMH 5JHDA 5C0EA 4O9HL 3VMNA 1NLDH 4OQTL 3R1GL 5IFAL 2E6PA 3DUHA 2FB4L 5DHXB 2R1XA 4ZXBC 1EHAA 2CXGA 1NAMH 2ZG3A 3BJLA 3GSUB 5DRZA 4ONOA 4R7NB 1LO3H 3RZCC 1J1OH 4XTRD 1BX2A 1GIGH 4NQED 5LJYH 5KSAB 5D5ME 3SKOB 4PS4L 2ESVB 3IB4A 4NQEA 3JBG7 2BY3A 1UWGH 4KRPD 5IVZB 1UM6L 1YEIL 2EXYD 5ADOL 2DD8L 4XP6L 3SE8L 3MNWB 4OLUH 3M45A 1NGPL 1J7VR 3VXOB 1A6AB 2W60B 5HHPB 2CKNA 4YO0A 1UCTA 4X7EC 1QLFA 5B21A 4YWGH 5A16B 3TH2T 2EDEA 3SDCD 1H5BB 3MLZL 1ORQB 1FJ1A 3HMWH 3MRJB 3WXWL 2NYYC 1XT5A 2GT9B 4JKKA 3RDTB 4ODXB 5IFJA 3SDCA 4WEBL 5ID1A 1NGZA 5JW3H 4EJ1C 3VXME 3THMH 4Z7WE 4YE4L 2ZOLB 3VXNB 4QYOA 1AR1C 5FUCC 4OFIA 3RGVB 4PJIA 1ITBB 4MNQA 3EDFA 2VDKH 4XBPA 1KJ3H 2IQAA 4N0UB 5FKAB 3NFNA 4KI5C 1MFCL 3DVFA 2H26B 5GJTL 1MSPA 5C6TH 1YQVH 2VIRA 4KTDH 1HE7A 3WFBL 4AL8H 5I0ZA 4ZD3H 5I18H 5ERWA 5AZ2H 3RY5A 3REWB 4ISVA 4JREC 5J7CC 4JE4B 1MWAL 1OT1A 1GGIL 1NEUA 4Y7MA 3RVTC 2NY4C 4G7VL 4PRBB 5BQ7A 5CINL 2VZTA 3UTPE 4NHUB 2BHUA 3OSKA 4LCCB 3RWHB 1A0QH 4LLVA 3BW9A 4L5FH 2DQIH 2P8MB 3MRFB 5D70H 2M26A 5C0IB 3CFKB 3JWDH 1P7HL 2XTJC 3BI9X 2F58L 2YPKA 5FA4B 2VXVL 5C0RH 3BUYB 4M1CD 3PGDB 4EI5B 2YSSA 1YEEH 4WWKA 1LEKA 2R56L 2NY6C 5C0JB 1S7WA 4PJIF 3U2SA 1C8PA 1R0AH 1KJMB 3DX8A 4XVTL 2VISA 1OLZA 1RJLB 1FAIL 3VGGA 5IHLB 5HI5C 1NC2D 1T21B 3ZHLA 1F13A 4ELKB 5TE7H 1N2RB 4RMVA 5IBTL 3UC0L 2AJUH 1NC2A 2CIIA 4YK4B 4EDWH 5CILH 3IF1B 3CSPA 3V7AG 2P24B 4APQC 3S5LG 4J3UA 2VDPH 3I84A 4MSWB 5CHNA 1K4DB 4EBQL 3FAXA 3RL2A 4J7RA 4DVRL 2W65B 3BRGC 5KBNC 3CZJA 5I8CA 5JMOC 1MVFA 3ARXA 3N1FC 4MNHA 1WZ1H 4OKDA 2W59A 3WDHA 4J2XA 3BESR 1NMBH 4R3SB 1P5VA 4JG0L 4M61A 2R0KH 4QRTA 1TZIA 4F58L 4GQ9H 5DUPH 2Q87A 3Q6GL 4XWGH 3NABL 1AXTL 3MXVH 5HDQH 1BFTA 3QDJB 4YUEH 3D18B 3BFOA 3GRWL 3N0PB 4OAWB 4L8CA 5KVDH 4IDJL 1W8OA 5A43C 5F89B 1DBBL 3DUSA 3DNKA 3IYLW 1RU9L 3MRIB 1WZMA 2IADA 4KFZC 2WIIB 5F6IC 5GGUB 5E03A 2EDTA 2JJVA 4PRPE 1MAMH 5J6GA 5D8JL 4BK5A 1KNOB 4P5MA 1FN4B 2DQFB 4OCYL 5C9JA 4OLVL 2MCPH 2YPLE 2DLIA 3MRRB 5CSZB 4OI8A 5EIIB 1IM9A 2AJ3B 3CFIC 1H3PH 1HSBB 1G6VK 1OSZB 5BMFL 3UJIH 3C6LB 3TO4C 2DDQH 3HI6L 2IAMC 2I60L 1CE1H 3ROLB 4RMTA 3AY4C 4Y19A 4QRQA 4M8QB 5DEGB 4QGTA 1LMKA 3TN0D 1JZ4A 3MMEB 5AYUL 3TPKA 3W9EB 1FVEA 3SY0A 2I24N 3TN0A 7FABL 4I9WE 5JXAL 2P8LB 3MTRA 1IC5L 3WL9B 5J12B 4YX2L 3IJSB 3PWPE 5IG7B 1KCSL 35C8L 1F3RB 2P8PA 3VJ6B 2IBBA 4OLXL 3TYGH 4S1SL 5TF0A 2XN9B 5GRJL 1CDIA 2UZIL 3IAPA 1MLCA 5I71C 3IRZA 1NCWL 2GTWA 4NCDA 1QSFD 4I18C 5BV7L 2Q8BL 1FFRA 1BFVH 3PHQB 4I3SH 1QSFA 4FQXB 4XPAH 4XAKE 3NN8B 5I1IH 2R4SH 1XCTB 1QSEE 1MVUA 3HPLA 5IOPA 5CMAA 5E1AB 3UP1A 1AC0A 3ZSSA 4IDLA 3CVHH 3NCJL 4PJCB 4XCEB 2XKSA 4KKLD 4HUKB 4S1DD 5IV2B 1XZ0B 5J1SC 1N59A 2VLLB 5SWQB 4G80A 1S7XB 2Z0BA 4KTYA 5EBMB 3VMPA 2I27N 2RGSA 1KPUA 1SJEB 5GGTA 4YFLF 5B38B 1FE8H 5ANMA 1D5MA 1LO5B 1BWWA 4OFYD 3KPSD 4OLWL 1ZT1B 3DROB 1KB5L 1BM3L 3O6MH 3MBXH 3KPSA 5EDXA 4YC2B 2IFGA 1L6ZA 1BVKA 1RUAH 3SE9H 4DUXA 3P73A 2CLRB 4TPRL 1T7XA 3BIBX 4QTIL 4OIIL 3MJ8B 4XC1H 3B8SA 5K9OA 2GKIA 1UQSA 4NQCD 4MJIA 5D1XD 1IAIL 2FLRT 5TGBB 3V6BR 2FJFB 4NQCA 2VITB 1DUYB 1L7TH 5C8JA 5LAXA 3OB0H 3STBA 4HIHB 4F2MA 2F5BH 2OTUB 1RZGA 4L3ED 5I19H 4J6RL 2DJUA 1NAMB 2EDRA 1X5GA 2R29H 3UYPA 3WN5B 1CDHA 1B6DA 1ZHNA 3EO0B 2BRQA 4KV5E 4L3EA 3MUGA 5DMGD 3FO9B 1U8PB 3LKNB 2VZOA 1BBDH 3D85D 2FH6A 4QF1A 2MFNA 5IT2H 5C9KA 3D85A 3C8KA 4NQTA 3OR7A 3QDME 5JZ7C 4GBXB 4O5LH 4YR6B 1JF1B 5IVXA 2XKUA 1SQ2N 1YEFH 3W2DL 1KCRL 4LLQA 5GGSY 3CFDA 1TENA 3ARPA 2R8SH 5FYKD 3STZA 4ZS7H 3IDNB 4GKOA 4OUUB 4MCYB 3UX9B 4G6JL 1OP3K 1HKLH 4BSWB 1NBYB 2AK1H 1WCQA 2DLGA 3FKUS 1G7PB 3QG7L 2HKHH 1KPVA 2WQRA 1U58B 3IDGA 1JPGA 3CLFH 4KKAC 5FM4A 3DXAB 4NQDD 4G6MH 5E2WH 4LCIH 4HZLA 4PV8B 1JTTA 3D6GA 5M95B 1FNGB 4NQDA 2BVUA 2IAND 2NTFA 1QPXA 1UENA 3PWNB 2KQNA 3HZYB 4XCCH 3OGOE 4NQXB 2IANA 3BPCA 3U46B 4NC2B 3MRDA 2FDBP 4QRRD 1I1RA 2JK5A 3KPOB 3D3VE 4UI2A 1RD6A 2FX8H 1YNKH 3G5VA 1KTKE 3B9DA 3WBDA 4I5BA 4QRRA 1G7IA 5B8CC 1RZKH 4Z7QE 5K9KB 1KCVH 1NSNH 4NKMB 5EZLB 5LGHL 2X89D 1A5FL 4MX7B 5FA3B 5JDSB 1ZA3A 1NFIA 5D7KE 2X89A 5IVXF 1KLGA 4XCFH 3TBSB 1MUJB 3L9RB 1IC7L 4UTBH 2EH8H 3GGWB 2DWDB 4C56D 4HWNA 1NMAH 3B9AA 2APWA 3FB6B 1SMOA 1MFEH 1SEBA 2HRPL 3PJSA 4JFZH 4C56A 4ZNCD 1YZZA 1AGDB 5ID0B 2E6QA 5FECA 5C08B 1P7KA 3QUKB 4P5TD 1ZTXH 2Y7QA 3AFLA 5IMMB 1KIQA 3CXDL 3BGFC 3L5HA 4ZPVB 2NW3B 4HUNB 4HS8L 4PRHE 3RWJB 5IM7A 2X10A 4X7CC 4FFVD 2BVYA 2CRMA 2FIKA 3OAYH 2CRIA 4I4WB 3JV4A 4H8WL 4GRWE 3I2CL 4NJ9H 1E4XH 4FXKB 3TC9A 4JM4H 3CJJA 4LLUB 3RIAK 4Y5YA 3UROR 2NY2C 2N56A 3FQUB 1QFUL 4TRPL 1UC6A 2HLFD 1ED3A 3VGEA 4XXCC 1GHFH 1ZEAL 2ZCLL 4WI2A 4XCNB 1P4BH 3VG9C 4AG4H 1JHTB 1CGSL 1Q9OA 4J12A 1SY6A 1H0DA 4MA3B 4CBPA 3B9EA 3VD5A 5EPMA 3RWDB 1CDBA 2OSLA 3CFBB 3ROOA 1MFDL 3VFTA 3HFMH 1BF2A 3VI4E 5H94A 2EIBA 3CPLB 3GMRB 3WHXA 2IMMA 5H35A 1MH5B 1IKFH 1W2KT 2EH7H 2ICWJ 1IKNC 1S7RA 5IGXH 3EGSA 1NCAL 2HH0H 4OJFH 5KSVB 5H2BB 1RZJL 1RK1A 5FYLH 1DDHA 4JO2L 2MMXA 3MACH 3MR9B 1ZWIA 5F6HJ 3VXMB 3U0PA 2IPKB 2YUXA 1EHLL 3LHPH 3MCLH 3CC5A 4P57A 5ISZD 5KZCB 1EJ6A 3KYKH 2X4NB 5HGAA 3OHXB 1LE9B 5EN2A 1MRDL 5ISZA 5C0NC 2X4TB 4FA8A 1FVCA 2NY1B 5EZOL 4NN7B 4D9RD 3QIUA 1CF8H 1Z9SA 1U92B 4L4VB 4PJEA 4R0LC 4ZTOH 4PJBE 1FYTE 5HYJD 5TQ2H 1WIPA 4O02L 5F9OH 5HYJA 5JNYB 4OZFA 3ULVL 1JP5A 1G7HA 3DARA 4H8WC 3X3GL 4PJ9A 3ZDZF 5KJRL 1FDLL 5KVEL 3O6FC 4JQIH 4RGNC 4S0SD 2VR5A 4FTVA 1OPGL 4O4YH 1JYXA 1S7VB 3V0WL 1Z3GH 1K6QL 2VOTA 3P2TA 5GS1C 4JFFE 2VDLL 4PB0L 1D5BB 4BFIA 5D2LE 4F7TA 5TF1L 2AJZB 4LLMB 1UYWH 1DVFD 5EC1B 4N5EC 1JPFB 4KY1L 3H9HB 2E9BA 2VWEE 3BKYH 1RFDL 3ARGC 1N0XL 3DMMD 5ACLA 5KS9E 1DVFA 4PY8J 2Y4SA 4IIQC 5I8OL 5EOTB 1KJ2A 3M17A 3DMMA 3P0GB 3NCFB 2J12B 4URTB 3QO1B 5MERA 1A9EA 2EEAA 3HC0B 5DO2C 5H37H 1NPUA 3BUTA 4GRWH 3DURB 4MQSB 1RZJC 2OS7A 2CH8A 5I1JH 3FTGB 3HCVB 3VFMB 1MJ8L 3CVHB 2UY6A 3DI2B 1KFAH 5E0QA 4CJ1A 4QOKD 2F74A 5SWZB 2D31A 4N90E 1J88A 1P4IL 3MCKA 3ORJA 4AK1A 2VXTL 1MJUL 4QOKA 5L2KE 1IL1B 2ARWA 3T2PA 4KWUA 4QGYA 1LO4H 1Y18A 4RAVA 5IMLB 2HFTA 3S3PA 3AREA 5E8PA 5DMIL 2BRRL 1I8MB 3MRNB 1I4FB 4N0FB 2BVPB 5F7HA 3ULVC 1IFHH 1DN0A 4RSVA 5DDHB 1TQCB 3OPZL 4X9BA 2CKBH 4JFQB 2EKSB 1J0YA 1KEGH 1H8OA 3LKOA 1YA5A 1X5FA 4IS6A 4WFGD 2UVFA 4UINL 1F2QA 3QXAA 4X4XA 3S36L 4PRPB 4BQ9A 3QJHA 3E6HA 4G43B 3UTZB 3WMSA 1A3LL 5GSRB 3NZ8B 4W6XB 4HV8B 3K4AA 2CRYA 5FYJL 1NUNB 3QFJB 2ORBL 1MJ7H 4V2CB 2PXYD 2GJ6E 4PLJD 2GJZB 3RHWF 5IK3B 1G9EA 2N4IA 1HSAA 5DJCB 5DJDA 4U6XB 2GFBA 2PXYA 4MNGA 5GGVH 1JGDB 3NIDE 4LPYA 2NY7H 4TNVK 4X4YB 1DBKL 4ZMAT 1A21A 4GRLB 5IP4A 5I73B 5J6HA 3R4DA 3WKML 3DX6A 3LRGA 1B0GA 1WBYA 1W72H 3O2DL 4I0PC 1S7TB 3DSFH 1K2DB 3RX8A 3T1WA 4U1KB 4DN4L 4RAUB 1B2WH 2WUBL 1SM3L 4JFPA 3RVVD 1RVFL 3QDGB 1VGEL 4R7DA 4QY8B 4X7TB 3L3GB 5EU3A 5F7EH 5GGRA 3T2NL 4NM4L 2A9NL 4L9LB 1FSKC 2UZYB 4X7DC 2B7DT 2VXUH 5E8OB 3MRHA 3SE3A 4HEPG 1NBZA 2VTFA 1K8DA 2CRZA 3E3QE 4X99A 4XC3H 3S34L 1X6NA 4S2SB 1XGYH 3ZKXC 5ESQB 2VLJE 1D9KB 3GO1H 3LPWA 2YS4A 3U82B 1QBLL 1FNEB 1KELH 4WCYH 1ZGLB 1T5XB 3DLQR 3MJ6A 2VAAA 5DD3H 1OGAA 4U1IA 3O9WA 1PLGL 1XGTB 4JB9H 1LGVA 3BO8B 3SBWA 2ICWB 4D0BB 1AY1H 4D8PA 1OT2A 1EO8L 2ED8A 4KVCL 2K1MA 1BD2E 3OR6B 3NCYS 5HHOE 3GSUA 4X9HA 2ZJSL 4R7NA 5KSAD 3PQYB 4V1DB 5DJZB 2ESVD 3E2HB 4KHTH 5EH1A 5HDOA 3LZFH 3VFGH 4OCWL 3H3PH 4DTGL 1RURL 3TNNB 3SKOA 1XF3B 4KKBC 2FO4A 1H3XA 3MQIA 1AHWC 4MAYC 1HK6A 3LD8B 3G08B 5D7LB 5E99L 4EI6B 1JNJA 5JOFB 4GMTH 1MCCA 5F7KC 5HVHB 1JGLL 1A6AA 3B2UD 2W60A 3HNSL 1FFOA 3CDGA 4J3TA 3D0LB 4QXUL 3RDTD 3VWJA 2NMSA 3O0RH 1ORQA 3L5XH 4K23H 1EEQA 3MRJA 3RDTA 2GT9A 3GSNH 4UTAL 1EHNA 3RGVD 3VXRE 2DRUA 1Q8MA 2CLZB 4CN1A 3BKJH 2FJHB 2ZOLA 3VXNA 3RGVA 1PBYA 1EO7A 1VEOA 2VDQL 3BPNB 4YZFE 1IGTB 3QHFL 4YNYA 1KN4H 5KOVC 4DKFH 5KN5B 3BE1H 5FKAA 5DWUL 3QWQB 3RGHA 5JQ6L 1DBMH 2FZ3A 3MLUH 2F54B 3ZE0F 4P9MH 3QDMB 3ILPB 2DIAA 3X14B 3WD5H 3REWA 4NHCH 3KLHC 1BVLB 3GNMH 5EIVA 4MXWH 4YAQA 1GRWA 1CFQB 1MF2L 5D2NE 5DHYB 5IFHH 3TV3H 1LO2L 3ARBC 3PGFH 4P23C 4NHUA 2SEBB 5IB4B 2DL9A 4NGHH 1XF5B 1CLOH 1HQ4B 2IFFH 3BJ91 5E1HB 1KC5H 3HC4H 1J87A 5L9DL 4M7LT 3LSOB 3QI9C 4D9LL 4ODVL 3MRFA 5C0IA 4X6CE 4HH9A 2H2SC 3GUTB 4EI5D 5EUOE 5FA4A 3VFRB 1UVQB 1EGJL 1QACA 2CR6A 2X9WA 1OCWH 4HKJB 1JBJA 3J7HA 3X13B 4EI5A 3OKYA 1FAKT 4M93B 3AS1A 5T5NF 1JNNL 1ACZA 5C0JA 3VD3A 1BECA 1SYSB 1UZ6F 3B9KC 4ELMF 4CN6A 1RULL 3D3VB 1IAIM 4R4FH 1LWRA 3KJ6H 4ELKA 3QIBC 1N2RA 1Q1JL 3JTSB 4N9GB 4AMKH 4KVNH 3IF1A 4GAJL 5D7SH 2H41A 2XXMB 1K4DA 5EOCH 3RU8L 5DR5H 2V9QA 2W65A 2KZ1B 2VLMD 5I1KH 2W0FB 3D9AH 4HULB 3RNKB 1IQDB 4YBQD 2KL6A 2BVEA 2H8PB 3OKLB 2YC1B 3CCHB 4OCLC 5CGYC 1I8IB 3ZT5A 1YECH 4HEME 3SO3B 1EUTA 4YHPB 3QDJD 5B3JF 3MREB 3UPRA 2D7QA 1CT8B 4E0RA 1FP5A 5A40E 1KCLA 4OAWA 5FB8A 4GRWB 5ENWA 3FO0H 4W6WB 3TWCH 2IH1B 5F89A 1NCBH 1WIUA 1PY4A 4M7JL 1SJXA 1T66D 2B2XL 4Q97A 4KH2A 5DMKA 3U9UB 3I9GH 5J3HD 3UYOD 1A14L 3WLBB 1T89C 2D3VA 1TJGH 4N8VB 4AZ8A 1KNOA 3TBVB 2DQFA 1JV5A 3C6LD 1EBPA 1QFWL 5CSZA 3BP4B 4OZFG 5EIIA 2WWKT 2AJ3A 2JTDA 2Z8SA 1BFOB 5KTEL 5L88H 1KN2L 1OSZA 1CZ8H 4KROB 4LARH 4XNUH 3IXTB 4C54A 4JCLA 4UIKL 4PR5A 3C60C 4LHJB 4GW4A 4FQJL 4M8QA 1JHLH 5DEGA 5EOCJ 4HFUH 3PP4H 5DJXB 3MMEA 3O3AB 1MCLA 3PWJB 5F3BB 2BSTA 1JMZA 4PJ8A 5AG9A 3UJJL 2DQUL 4MD4A 4YHYC 3WL9A 2OK0H 4Z7UE 4ZUVB 4G6AC 4M4RA 5IG7A 3AB0B 2XN9D 4LVNC 1FGVH 3VJ6A 1V7ML 5JXEA 4JDZA 3V6FB 5DD0L 3B9VA 4F7EA 5DJYA 4F3FB 3JUZA 1MFBL 1FZJA 4OGYH 4L8BA 2FJGB 4PJBB 2AERT 4FQXD 1I7TA 3G6JE 4WW2B 4FQXA 3WHE0 3NIGF 5E2TH 5BO1L 4PUBH 4MA8H 1H8NA 1W72B 4NZUL 5E1AA 5F7UA 4PJCA 4XCEA 1CD0A 4XNQA 3V8CA 5IV2A 3FB7B 1FZKB 4HMCA 2VLLA 3WUWA 1S7XA 1EAPB 4XTRC 4XNXL 4RMQA 4OD1H 3R0MA 5GRXG 4HBCL 3RQ3A 1SJEA 1WSST 5T5FH 3EDKA 5B38A 3BH8B 1F3DH 2C3VB 2D7OA 2LVEA 4Y2DD 1ZT1A 3B5HA 4KRPC 1ADQL 2EXYC 3PHOB 1WITA 3G6AB 4JAMA 3OX8B 4Y2DA 1CDCA 1CGWA 5FK9A 2FL5A 3RP1A 4XH2B 5TQ0H 1AKJB 1Q0XH 3H42L 4JJ5A 3WS3B 4N8CH 3SDCC 4WDIB 4F37K 3DWTA 4M6NH 2H32H 3BEWB 1AIFB 5CJOL 5IW3A 4JVWA 4K8RH 2J4WH 4PYHA 5TGBA 3TA3B 5MHSE 1A1OA 2B8OT 2FJFA 3F62A 3NFPB 4KMTH 1E27B 2VITA 1DUYA 1NL0L 1G0DA 4GMSH 4TOYH 4OGXL 4HIHA 4XGZB 1I9RH 2OTUA 5L2KB 5GISL 2R2BB 1I85A 1NAMA 1TQBB 5CEZE 3EO0A 4PJCF 1OW0A 3E8UH 3JXAA 2WZPD 1A6UL 1HZHH 4NIKB 1MCKA 5EZJA 4OD3L 4QXWA 4P2RE 4GBXD 1X5LA 4TULL 3DO7B 3DX7A 3HG1E 4X6DF 2CSPA 3O4OC 2AK4E 4N1CA 4GBXA 4UUJB 4E41E 3W0WE 4RGOL 2PO6A 2V7HB 4NCC2 4YR6A 2DB8A 1JF1A 4CDHA 3FQRB 3MLTB 3EDEA 1PX3A 4JKLA 1JYWA 4GG6B 3CZFA 3PIQA 5T1LB 2ZUUA 4EXPX 2ADJA 1XGUB 2WBWB 4I48B 3IDNA 4X7SL 5IHZA 3GSNB 5J1TC 4HCRA 1FL6B 2X4RA 4OUUA 4LHUA 1F3DJ 3FAWA 3DXAD 3OAUH 1NBYA 4M1CC 3LV3B 2NY4B 1G7PA 5DUBB 1U58A 4L3CB 4NJAL 4PP2A 3DXAA 3TT1H 4HK0B 2GJ6B 3SE4A 4P3WA 4LSRL 4HX1B 3GMNB 4PV8A 3V5KA 4ZUSB 1HH6B 1FNGA 3B3IA 2FATL 2QSTA 2XOTA 3CDYA 2Q20A 4PJGF 4DK6A 3HE7B 5ICYA 1OD9A 2XA8H 4WV1C 5IMKB 5DFTA 4DGIL 3HUJE 2Y06L 4WI4A 5JPMB 1B88A 4S11A 1V8HA 3FOMB 4KUCD 5D96C 4F8QA 2QSCL 2AXFB