4N8CH

Three-dimensional structure of the extracellular domain of matrix protein 2 of influenza a virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
QVQLQQSGPEVVRPGVSVRISCKGSGYTFTDYAMHWVKQSHAKSLDWIGVIGTDNGNTNYNQKFKGKATMTVDKSSNTAYMELGRLTSEDSAIYYCARRDRDDVWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Heavy chain of monoclonal antibody
publication title Structure of the extracellular domain of matrix protein 2 of influenza A virus in complex with a protective monoclonal antibody
pubmed doi rcsb
total genus 46
structure length 220
sequence length 220
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n8cH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n8cH02
1VEPA 3LCYA 3WNPA 5I8EB 3NFNB 4WEBH 4M93C 1NEUA 1CICD 1YEEH 5EORL 4BFIB 1INQB 4PGDB 5C0JB 4UIMB 3MREA 3MACL 3IGAA 5DK2A 5C6PB 4OM0H 1E27B 1VFMA 3BGFB 4ZAKD 1TFHA 1EGJA 2MQ3A 2VDKL 1LP9E 4H0IA 4L3EB 2VDMH 5BV7B 4LLVA 1MFAL 1VADB 2VDOH 2XTJE 2PF6A 1G7MA 5E8OA 3BT2L 3D18B 4PP1C 3TEUA 4KI1A 1A7OL 1U3HC 2FWOA 2OL3H 3ROLA 5L2JB 4ZQKA 4GBXB 4YZFE 5K93A 4HFUL 3KYMA 3QRFM 1FNLA 1URLA 1EO7A 3OR6B 4M48H 2QSCL 1MWAL 4I3RH 4R97C 2WIIA 3U6RA 1FN4B 4U05A 3VXPB 4JQVC 5IB5B 1Q72L 2VITA 3VXTB 1HQRB 1JL8A 1Y0LA 4Y89A 2YKLL 1S3KH 4PJCB 5AUMA 1XT5A 5DD3L 5ISZA 3TH3T 4OIIL 2QQKH 4WFGE 1HHKA 3W39B 1AGEB 4X7EC 3V4PL 4RZCB 3IRPX 3MJ8A 4JREB 1KCKA 5HHNA 1MHCB 3T77B 2I9TB 2BVQA 3QA3B 3QAZB 1B6UA 2ZNXA 5LJYH 1J0YA 5GHWL 2Z8WC 3O9WC 5IHUH 4Y5XC 5IIEB 1F97A 2CKBB 3O4LA 1WWAX 1W0YT 3LIZL 3ARDA 5AYUH 4ZOAA 2FYYA 3IDJA 1J0IA 3BP4B 3FB7B 5IJVA 1NC2A 2BHUA 2WBJB 3V6OA 3TBVB 4N9OB 5I2IA 4HS3B 5IT2L 1ZEAH 5FUCC 1YNLH 4I5BA 2FGZA 3MRKB 3MFFB 2C1PB 5TE7L 1P7HL 3LD8B 4Y8DC 1HK6A 1MFCL 4HCRA 2QSTA 1UC6A 1FYTA 1XF4A 3EDDA 2IG2H 3O0RH 3JV6A 4TUOB 3EYFB 1NGWB 1WCBA 1EGJL 2XA3A 1WFUA 2VXQH 1YNKH 4B53A 4MJ5B 3C6SB 1REIA 3IDIA 1TJHH 1OGAB 1C7TA 1H5BC 4XGZA 1E4XL 1QSZA 3RGHA 1IBGH 4FXLA 2V9RA 4KGJA 4M7KH 4OCRL 4Y19E 5BO1H 3HS0B 4HC1A 3RNKB 4K55A 5F89A 3KPQA 4PRPE 4H1LG 3GMQB 2PXYA 5TDNA 4M1CC 5HHOB 4WV1A 5DVNA 1RU9H 1UVQB 1FZMB 4DGIL 4XX1G 2X4PA 1J0ZA 3O81A 3KJ6L 5IVXB 2CIKB 2IQAA 1R3KB 5JIHA 3KNBA 1A1MA 3F58H 2M2DA 1J0JA 1CXHA 3QNYB 3IETA 1LE5A 4JDTL 1DBKH 2XTJD 3SQOL 3WFCH 1A6VH 3ALXA 3PWNB 1AE6H 2OTPA 3JTTA 2GJ6B 3DHJA 4XPFL 4UIKL 4EUPA 5LBSH 2VR4A 1A4KB 2R0WH 3R8QA 3QO1A 3I02B 3U48A 5DSCB 5EUKB 4LVOB 1GGIH 3NCMA 4NC1C 1S7UB 2N56A 5GS1C 2A6JB 5CLTA 2ADJB 4EI5A 4GRWF 3S37H 1TITA 3U9PL 4WFGD 4HCRL 4GS7C 1DQLH 2CDGB 4R8WL 1EEZA 1HIMH 2B7DT 3T3ME 2W0FA 4MHHG 2AABL 4HIHB 5DRXA 4JM2B 2NY5C 4X6CF 1RD6A 3IJSB 1OAYH 3PWJB 3VG9B 1RZJC 1F3JB 2P24A 4HWZA 1T21A 3RTQB 4GMTL 1OOAA 2CLRB 3RHWF 1PZ5A 1ZLWH 3SBWC 1BAFH 3SCMD 4KWUA 5ABDE 5K33A 1ZSDA 5D1XB 4LGPB 1U3ZA 1DQDL 4JHAH 3QUYD 3A6OA 3DX7A 4GG8B 5CGYD 1IC4L 3L3IA 2NW3B 4YDVA 4NKDB 4M61A 4TSAH 1NDGB 4MJID 1K8IA 3QXTA 2F74A 4PB0H 1VGEH 4HIEB 2LVEA 1XZ0A 2VXSH 4FQCL 4B50A 1FL3A 1OHQA 4GXVH 4YLQT 2P8MA 4LSSH 5D96C 5B3JF 4YIQA 4X7TA 3V8CA 5D7LE 4KK8C 4L8BB 3BEVB 5LWYH 5KSAA 1DSFH 3JSSA 2DLEA 1MCKA 1WISA 3DI2B 1GZPA 3NIGE 3PHQA 1Q1JL 4YHYC 1QSEB 4LIQE 5JR1H 4KV5F 1SHMA 4OM1L 5FEBA 3H9HB 4Y19D 1N2RB 2E5EA 1FE8H 2F53A 3OKDA 1ACYL 1DLFH 2P46B 2P5WE 1CD9B 2QSVA 4LMQE 5F3BA 4EZMA 1IZJA 4PRPD 4E41A 3QFJB 4UINL 3ARYA 3CDGB 4I18C 3K74B 4GAGH 4B7IA 5IFHL 3IDYC 3AY4C 2WLZA 4BK5A 4W4OA 2KBGA 2VWEC 4KZDL 5DURB 3JTSA 3VMOA 2DLTA 1T1XA 4X5WA 5D7KD 4OI9A 1W8OA 4LCYA 4Q74A 5F9OH 3STLA 5KAQG 1CLOH 4ETQA 1T5WB 4BZYA 4FQ1H 2PW2A 3GSXB 2BMKB 1IAKA 3K80A 2H26B 4ZS7L 4NQDB 4Q9QL 5GRJH 5J6HB 1BQHA 4IRZH 4M7ZB 3B9KA 5I1KL 4YBQD 1QP1A 2IFFH 2VO5A 4KMQA 4V2CB 2DQEL 4TRPH 1WT5C 2ZCLL 1UM6H 2AK4A 5C86A 3RJQB 1OPGH 1R5IA 3I75B 4DOHB 3LS5H 4L8DB 1YEIL 4JB9L 2IAMA 5H35A 4DUXA 2X1QA 4Y4FC 3ZKXB 1J8HE 3ARBD 2K7QA 4J3VA 4H8WC 1HDMB 1RIUL 1K9TA 5CSZB 4BZ1L 3LPFA 1UA6L 1SEBB 4HKZA 2R23A 2VXTL 4CKVX 3RUGB 1KBGH 4RGNE 4Y5YA 3AM8C 3UTTD 2AJVL 3QHTC 5CJBA 4P2OB 4PJ9C 1DTUA 2B2XL 1B0GA 3WFBL 2OX5A 4FQLH 2VDQL 3RDTD 1RUMH 5DVKA 2VLLB 4ODSL 3OZ9H 3NIDF 4DK3A 2OZ4A 4LNRA 5C0IA 5DS8B 4NUJB 3HI1A 1XIWD 3DXAB 3QZWG 4HS8L 4OFYD 4Y1AD 4X6DF 5EPMA 3TBTA 3ULUE 3QWRA 1U6AH 5D5ME 1KB5A 5B4MC 3VGFA 1YUHA 5D7JC 1JF1B 2BERA 5I1JL 1D5ZA 1UWEH 4JFHE 3MUY1 4HK3J 4LSQL 4J4PC 5GGTA 5HI4C 1TZGL 2C4XA 4CADB 3BJLA 2ZSVA 1X5HA 4IIQB 4TNVF 5D7LD 3BXNB 1MF2L 1A7QL 3OXSB 4GH7B 4HV8A 4TQEL 1TTGA 5FK9B 1T3FB 3UO1L 4G8FB 1RULL 1IGCL 5BVPH 3P4MB 1IGMH 4NRXB 3AREA 1G9NC 4L3CB 4MSWB 3LQZB 5EZJB 2OM5A 4NKIH 1AY1H 1OT2A 4LPTA 3WHXA 3HAEA 5AWNH 1RSFA 4JY5L 3VGAB 4M93B 4P5TC 3VGDA 4OCXL 4J3TA 1U36A 2EDRA 1AXIB 2ERJC 3MBED 4WY7L 1R0AH 2JTDA 3ARFA 3WJLA 5I76A 4LCUA 1ZVHA 5HY9A 1Z9OA 4LCWD 4Z9KB 1MIEH 4EJ1C 4ZUTB 4UOW1 4F57H 1QSFB 4M7JH 2DB8A 4RFOL 2KZWA 2B1HH 5EBLA 1P84J 3QEHA 3BP6B 2NX5B 3BZFA 3G6JB 5MI0C 3DPBA 1IM9B 5E8PB 2I9LB 4JFPB 5EORH 1A6AA 3MACH 1S78C 2K7PA 4GUPA 1GOHA 2WBKA 2XTLA 4UBDC 2R0LL 5KAQF 2VDKH 4GMSH 5C6TL 4DKFH 2Y5EA 1YY9D 4PRHB 4PJAB 2GI7A 5F97E 1J8HD 1KB5L 1MFAH 1MLBA 3HTLX 4YBQC 4MD4A 3VI3E 3BT2H 1JTOA 2D7OA 5DJYA 4APQB 4FFZL 1A7OH 4LKCB 3QNZB 4WI7A 5C2BL 1PY9A 4PR5A 3L3GB 4JKPH 1PYWB 2OK0H 4QYOB 4HFUH 2FIKA 2E6QA 4RGND 1AGFB 2A73B 2QSCH 4JGJA 3FMGL 4P23B 5IOPA 4YO0A 5FF6B 4F9LC 3TV3H 5DQDH 4MA1C 4NQVB 1UACH 2YD1A 3X14A 5DD3H 3Q5YA 4M6NH 1L0XA 2V7HA 4OIIH 4PJIF 5CIPA 3CFIC 4MMZC 3QQNA 1W2KT 3PWVB 3V5HB 4AENB 1CFBA 3BZ4B 4XVJL 3QQ9C 3S96A 1RIHL 1IARB 3C08L 1MH5A 2HFFB 3DV4B 3HE6B 5GHWH 5HHOE 4AH2A 1MFBH 5F72S 4JFHD 1FNGB 4XHQA 2HJLA 4JR9H 1U8KB 1KJ2H 1EZVY 3LIZH 5FYJE 3OXRA 4P9HL 1XIWC 5FKAB 1ZHBA 3HRZB 4MZ3A 3X3FL 1NCDL 4TVPL 1H9VA 3N85H 1KT2B 1WQVT 5IT2H 1BQUA 1B0RB 1XF3A 3GMNB 5TE7H 4GBXD 3VRLF 1RFDH 1I8IA 2DQJH 5JORA 3VFUB 2V5SA 2MHAB 2V5RA 3CFEB 1XF2B 4M7LL 3TZVC 3A67L 5CBAB 3MJ7A 4PY7A 1MI5B 3LHPL 2HRLA 5SWSB 1R5WB 3D5OF 1EGJH 4XVUD 2RFXA 4TYUA 3ULVF 4PG2C 1F2QA 4MVBD 3VFNA 5E03A 3ZE0F 1PQZA 4U0RB 4WUUE 4U6VL 1BBJA 1S5HB 4OCRH 3CMOH 5ALCL 2VSCA 4JDZA 4BK4A 1LMKA 3FFCB 3OAUL 5E5RB 2VLJB 1AJ7H 1T20A 3SKNA 1KLGA 4DGIH 4PLKC 3PJSB 3KJ6H 2WBJD 4QHUB 4QOKB 1T4KB 1FZOA 3P4LA 1AXTH 4ELMB 3BESR 3FQNB 2EEDA 4G6FB 5FGBC 4KKCD 2YBRA 4PV8B 3RIAF 2DM4A 2JCCF 4JDTH 4F9PA 3FT2B 1FBIL 4S10A 4EIGB 5L8KB 1HHGB 2DL9A 4XPFH 4UIKH 3C5JB 1JMXA 3KPLB 3LKOA 4X0KA 5CKGA 3CDYA 1JNNL 4U1IA 4RX4D 2YUVA 3LSOA 5D6DA 5HYIA 5CWSB 5L2KE 3EYUL 4XP5L 3QDAA 2DQDL 1U58A 1X44A 4HUMB 4NSKB 3GZKA 2JELL 4YHPB 5HGAA 1IT9L 1QSEE 4Z7VF 3VMPA 2VLME 1TVHA 3U9PH 5IW6A 4HCRH 3O3BB 2P8LA 3S5LG 3QFJE 5C0DB 4NO2A 4JZNA 4ALAH 1EAPA 2AS5M 1DANU 3CGTA 2AABH 4NBYB 1N26A 4MDJB 5A16B 5HHOD 4KI5C 2FH6A 3OJDA 4JFEE 3G9AB 1E4WL 4MD5B 5JPNA 3EDEA 4GMTH 5EBMA 3WFDL 4OAWA 2DQCH 3MRIA 5FYJD 3SGJA 5JOFB 4WW2A 3K8KA 5ID1A 2YR3A 4B0MM 2OJEB 3IU3A 2BOCB 2ZUXA 3V4VL 4R26L 4TSCL 4X4ME 3ULUC 2EDLA 4XBEL 1DQDH 4HC1H 5J06A 3QDHA 1IC4H 4GRMB 2EXWD 3ZKMC 4DZ8A 5JTWA 1HHJA 1QR1A 4CGTA 1NGQL 2GJ6D 2G2RA 1U95B 5F6HI 4PJ7A 5IGXL 1IGTB 2XACC 2YSSB 5J9PA 1E28A 3RPIB 3B9DA 3FTGA 3VWKA 2YHGA 1ZHLA 3H8NA 4R90L 4Z76B 4FQCH 1XF5A 1RJLB 2GFBB 1F13A 4DOHE 4YHNB 5GS0L 2BVOB 1M05A 2JLLA 1C7SA 4QHNB 5F1KC 2B39A 2XFXB 1EJOL 4KQ3L 4YDIL 1Q1JH 1JWUA 3HUJB 5IEHB 4OM1H 1AKJA 1MLCB 5E6IA 3RL1A 4EUPH 1G7LB 3IF1A 4HPYH 2ADIA 2YD3A 4UINH 5E4EC 4JQXC 3GBNL 1LO0H 1MCIA 2WQ8A 5IFHH 3RTQD 1SMAA 4QY8A 1EX0A 4KZDH 3D0LB 3H9ZA 5I1DB 1J1XL 4LOUC 4OF7A 4MVBC 3RBGA 2ED9A 3CFDB 1FFPA 2GK0B 3O2WL 5D1XD 2CRYA 1IAOA 1YY8A 3IDMB 4KK9D 4R7NA 5CD5C 3W9DA 3T4YB 3O6FA 5DHVA 2ZKHH 3HC3H 4PJDE 1VGKB 4LEOA 4WU7A 4ZS7H 1YN6B 2AJZB 3D25A 4Q9QH 4EN3A 1TQBC 5I1KH 4LPCA 3PIQB 1TJIL 3TNNA 1K85A 3D69B 3PHOB 1WBZB 2AW2A 5I1HL 5TF1L 2ZCLH 4Z18A 5L2KD 3U30B 3BIBX 5M95B 2NY6C 1YEIH 5DZNA 3OL2A 4JB9H 4NFBA 4P2RA 4LDEB 3WS3A 1QSED 2DWEB 2VLMD 1YJDC 2J1KA 4M6OH 5KVFL 1A4JA 1F11B 1RIUH 3GGWA 3MRFA 3RGVC 5C08A 3QFJD 4BZ1H 2Y23A 3MRJB 5D72L 5DT1L 2VXTH 3RWDB 5DJ8B 1ZLWK 4JO1L 5JPMA 3LVEA 1YYMH 4CUCA 4W68A 2AJVH 5DURD 1T22A 4JFED 4G42B 3C8HA 2B2XH 3X11B 1RUPL 4M7LT 3LKRA 2VDQH 5I8CA 4ODSH 3JWOL 1QRNA 5KSVA 3S98A 4X6FA 1SVZA 4P4RA 5FB8B 1HHIB 4FNLH 5DFVD 1ED3B 1M4KA 2GJZA 1LQSR 3H6JA 3FFDB 4HS8H 5D7IA 5E8EB 2AQ1A 5C8JB 4EQ3A 1YEJL 4BKLB 2VDNL 3QXVA 1ZOXA 4ODVL 4Y4HA 3P30L 3OKEB 2NX5E 2YD5A 3G6JE 1CE1H 3EJZD 5I73B 5I1JH 3PP3H 1TLKA 4YR6B 2Z92A 4J1UA 2R1YB 1QA9A 4LSQH 4KVCL 3MC0A 4U49A 2J8HA 2IADA 4WTWA 4QHMA 2Y07L 1TZGH 3SE4C 3HG1A 4IMLB 4KKBC 1S8DA 4ODBD 1MF2H 4PRHE 3QB7C 4PJAE 4TQEH 4U3HA 2BP3A 3UO1H 4F80A 2CLZB 1UM5L 1RULH 1IGCH 5FGSA 5C09B 5E7BA 4GQPH 2VQ1B 4K23L 2AK1L 2BRQA 3LRGA 3MNWA 3H0TA 1DUZB 2OL3B 1MRFL 1CU4L 1EA9C 3UTSA 4FXKA 4P2OD 4YHLL 1C12B 2IPKB 1XAUA 5ITBL 1EH9A 4EDXB 5FYKL 1W8NA 3U9UA 4JVPA 4NN7B 5GRUL 3ZE2F 1YEFL 1HN1A 3DXAD 2BCKB 3EO1B 4GKNB 1V3LA 4PJXF 5CJXC 5GZOD 5HXMA 4L9LC 4GKZA 1A9BB 1ZE3C 5SWZB 4I0PC 4RFOH 1H0DA 3CPLA 1OWRM 4PRAA 4YAQA 2BOBB 4FA8A 1UT9A 1YEDA 4WHCA 1FIGL 3IYLW 3I3BA 2BC4A 2ZWLT 3QWOA 2H3NB 4XP4L 3CDCA 1I8LC 4KC3B 1WVZA 2ADGA 2P43B 1CD8A 3UTPE 4U7MA 2R0LH 2P1YA 2XOTA 5IMLA 1Q9WA 5C6TH 4LARL 2O5XL 1KB5H 2CUMA 1D5MB 3NCYS 4OQ1A 1CYGA 1KN4L 4JY6B 3IJHB 4PP2A 4IM8A 2C1OA 3DVIA 2HT3C 5GGTH 4KPHL 4PD4J 1FNHA 1UJ3A 1MI5E 1WWWX 3R4DA 5SWSE 3VE0A 3BUYB 2R1XA 2ICES 5C07B 3MA7B 2E7HA 5DWUL 3GSOB 5IB2A 1WK0A 2FL5A 3FO9B 3GHBL 3V5DA 2LQRA 2EDXA 3GSRA 2APBA 5LVEA 1G0YR 1UXWB 4MA8L 5F8RC 4NQEB 4KXZH 4CW1B 3QUKA 4WO4B 1ZS8B 1K2DA 1QSFD 3QCTL 3QIWA 4N68A 4XVJH 1CGVA 3GMRA 2W38A 1RIHH 3K8LA 3HAEH 1YDPA 2XKSA 1QR4A 2NX5D 2EE2A 1IKNC 4L8CB 4N5EC 3S9DB 5J12B 1IM9D 4PJ8C 4JO3L 3TYFB 4N1EA 1KCUL 3S3PA 2F19H 4QOKE 3T0EC 1T2QL 4OKVB 4P9HH 4ZG1A 3WFHA 5HVFB 5JW5A 5L0QB 4ELME 1WZLA 1LK3L 4HGWB 1NCDH 4TVPH 3SGEH 4PRHD 3CH8A 5FHAL 1U91A 1X5KA 2HKFL 4ZUSA 4KHXL 2GT9B 3H9SB 1UENA 3E6HB 1ZA6B 3QIUC 3AU1B 3BUTA 4YHOL 3KLHC 1DQQB 3EGSA 5E1AB 2XZQL 2JB5L 3LN4A 3QXUA 4HWNA 1FVEA 4B41A 5I19L 4P23D 3PWLB 1IGYB 3A67H 5ILTL 5TPWL 4OZGB 4XXCA 3LHPH 1AC6A 2PTTA 2DQHL 4ZFOB 2X89D 2QSQA 2BFVL 3DRTA 4FQXA 5IP4A 2ZPKL 4U1MB 2CDFB 2IQ9L 1XGUB 1OB1B 5DJXB 2BNUB 3L7FB 3BHBA 1AGBA 1FV1B 4U6VH 1JZ7A 5HI3D 3X13B 2FB4L 5ALCH 4KRNA 1NCTA 4AEHL 3HE6D 5CAYB 4PBXA 1CGUA 4XC1L 2JJWA 4PS4L 4X83A 2NZ9D 4LGSB 3FT4B 4HJGA 1EIBA 2X4TB 2G60L 3L3JA 2Q86A 4L29B 3IFPA 3LKSA 3NN8B 2AXFB 3FB8A 5I1LB 1XR9B 3JZ7A 4GO6B 1XCQB 1TMCB 1JV5A 2APTA 2YZ1A 4IDLA 3GSVB 4MNQA 1GIGL 1AO7A 2J3SA 4HXBL 2JIXB 1Q38A 1U8PA 5T1KA 4X6CA 3REVA 3BEWA 2VLKB 1ZANL 3L3KA 4YPGA 1MI5D 4PG9B 5SWSD 4LDLB 1JNNH 5IHZB 4JDVB 3EYUH 4BUGA 4Z7WB 4ESKA 3DX8A 3HZVA 4NRZA 1R3JB 2GK2A 3CFBB 1RK0A 2DBLL 2JELH 2DQIL 2CUIA 3HUJE 1FAKT 5EOCL 1IT9H 4LK4A 2BY2A 1MVFA 5EU5B 4X5XA 2HFEA 5J13B 1U2CA 1BFTA 4U3XA 2VLJD 2XI9A 2A6KA 2W92A 5EFIA 4LLMB 1G7IB 1HOCA 1WFTA 3TYGL 5SX4H 5EO0B 3VD3A 3V6FA 5TQ2H 3SDCB 1E4WH 4JM4L 2NNAB 1G9MC 1VSCA 3WFDH 5C0BB 4LVNC 2FBOJ 4QOKD 4XPTL 2MFNA 1OAUL 2FIRT 3HMXA 3VXRA 3PWUB 4QRUA 3BPOB 2EYTB 1CGSL 4G6FD 3V4VH 1TJGL 4R26H 3RWIB 4PJEB 2VTFA 4XBEH 4WRLA 1FL5B 3HC4L 1CGWA 2BSTB 1V7ML 2YUXA 4XPHL 1NGQH 3B5GA 4MAYA 4P5MB 3RY6A 1F4WH 2UY7A 1NGPL 4LHUG 4O5LL 5IGXH 1C1EH 2YD6A 2EDHA 3T65A 3O3AB 2HVJB 1UADC 1MUJA 5IHBA 4ZOEA 4DWHA 1NFIA 3BGMA 3TBYB 5DJ2A 4XXDA 3TNMA 3TP4A 1QD0A 1QLRB 4OLXL 2X4OA 3RY4A 1N8ZB 3WD5L 1P4LB 5GS0H 1N59B 1OLLA 2R15A 4RNRA 1CIDA 3NA9L 1HQ4B 1EJOH 4JE4B 1KIRB 3RQ3A 3VFGH 4KQ3H 4YDIH 4R96B 1XR8B 2VN7A 1DBML 1YMMA 4IEFB 5ICYB 2F58H 1S9XB 1JUFA 2D9CA 3ELAT 2F5BH 2RBLA 2YC1A 1AXSB 4CAGA 5IBLD 4H1LA 1D9KC 1CLZH 2ORBL 5AZEH 5ANMA 1CXLA 5FYLL 1EEQA 5I9QC 1CFNB 4UUJB 1FGNH 5D1ZA 5T5NG 3IXAB 3K1DA 2W60B 2QHRH 3H7BB 3HPLB 4HZLB 1P5UA 5I17A 5DJ0A 3O2WH 4ZS6D 5FDWB 4KXZI 3GNML 1PFCA 1RV6X 2VB5A 1A7NH 4U1GC 3MRCA 4AG4L 2IANA 3O2DA 4O58L 1NBYB 1UXSA 3CSYB 3VGHA 4K3HA 5DC4B 2YN5A 1ND0A 2FATH 4LSRL 3P9WB 5FV2A 1TJIH 3SDXB 5IFJB 3S4SG 2P44B 1LO4L 3I6KB 5I1HH 3QRGL 5TF1H 4RWYL 4XCEB 4WGVB 3EOBA 5DEFA 4PJHB 3SGEI 1ORQB 4K9EL 1AQKL 3H3PL 4LSUL 4X9HA 5HI5C 2R2HB 5D2LF 4R4ND 1F90L 3MOAH 4P46B 5KVFH 3KXFB 1KXVC 1KYOK 2Z4QB 1I1AA 1A0QL 5HGDB 2J8UB 1OW0A 5E8NB 2FLBT 5D72H 1VPOL 5DT1H 2CMRL 1T04A 5HVHB 4ETYA 3ME0A 1YNTB 4PGZA 5B38G 2P7TA 3R1GL 3ARZA 4OZHF 1GCFA 2IH1B 4QXUL 5IM7A 3JWOH 3MR9A 2VZSA 1U8OA 5CMAB 5CP7A 4K94C 3ECBA 4N1CA 3EDFA 5SWZE 3HZYA 3MV9B 2D4DA 4QCIA 2NLJA 4KRMB 2C3GA 5F21B 4XNMA 1KEML 4PJBB 2VDNH 5KN5B 2APFA 4ODVH 3QI9B 1R3HA 5DK0B 4FTVB 2VZTA 15C8L 3P30H 4LCCB 4FRWA 4ELKB 2VXVH 4FHBD 4KVCH 3QCUL 4PTTB 5HDQL 2VE6A 2Y07H 1D6VL 5BXFA 5DD1L 4AEIL 3FQRB 5INDA 2IAMC 3F7YA 3W5MA 4I48B 4OZFB 5DHVH 3MGOB 4X99B 1UM5H 3O2DL 1I7TB 3OMZA 5BZWA 2A83B 2AK1H 1GXEA 3MRMB 4F7CB 1Y18A 1KTDA 2Q8BH 1CU4H 2ZUWA 5KSUB 5BS0A 1XEDA 2VR9A 4XPBH 3KHOA 1KFAH 2H45A 5SV3A 5ITBH 3FO2A 5HHPB 3TH2T 1IC5H 4Y5VB 5FYKH 1N6UA 2CK0L 4MQXC 4HUVA 5GRUH 4PJFB 5IQ9A 1EK3A 4NQEE 3WMSA 4WEMB 1T1WA 4F7TA 2NCMA 1JGVL 4H26B 2NY4C 2B4CL 5MEOB 5FKPA 5A43C 4WI8A 4MNGA 3MRPA 4HGKC 4OFIA 2EH7L 3GSWB 5F1NB 2QR0A 1KLUA 3B9VA 3FAXA 1EXUA 1FIGH 3C6LA 1KIPA 2D4FA 3D85B 4P2YA 3BQUB 2QADB 4HUXA 3VFSA 3MCKA 5CJ8A 5TJWK 4X8XA 1KJ2B 1DVFA 4NT6A 4XP4H 5AEAA 5HD8C 5T5NF 1T0MB 3ZKND 3FOLB 3L6FB 5GGVH 4DFHA 3MLUL 5C09D 3H9SE 4PJIA 2O5XH 2AJ3A 5IVNA 3KPSA 5HHMB 4DUWA 3HR6A 2E7LC 1SJHB 4PRDB 2LU3A 3V0AC 1BJ1H 1K4DA 4S2SA 4OZGE 4KPHH 3NTCL 4L4TE 1F5WA 3CXHJ 4Z5RA 3MREB 5DK2B 3IGAB 2ZP0T 1IFHL 5I66A 5DWUH 2LAGB 2VLRE 3RX7A 2ICEA 3GHBH 3GSQA 1BVKA 4LLVB 3PP3K 5E7FA 2AXJA 1G7MB 4MA8H 5E8OB 5SWZD 3TO4A 3QZWA 1P6FA 5D6CA 2DJ4A 2FWOB 3ROLB 4ZQKB 1CR9H 3KYMB 2Z31C 5A2FA 2FJHA 2GQHA 2W07A 5J56B 4JFDE 2WIIB 3U6RB 1J10A 1RZKL 4JZJC 1Y0LB 4NHUA 4ONGL 4JO3H 1KCUH 2H2PD 1T2QH 4QGTA 2E8ZA 5AUMB 5ISZB 1LK3H 1CDJA 1HHKB 5FHAH 1CDHA 5B39G 3MJ8B 5HHNB 1ZAGA 1YPZF 1ZT1A 3X12A 4TPRL 1KTLA 2HKFH 2BVQB 4KHXH 3CZFA 5ETUA 4KK6D 3F8UB 3NABH 4I1NB 4YHOH 3C60A 1S7VA 2JB5H 1N5YH 3O4LB 1INEL 4U1JA 5FA3A 3V4UL 1EHNA 3ARDB 3IAPA 5ILTH 2FYYB 4JHBA 4U1HA 5TPWH 3D87B 3IDJB 3CU7A 4DEPB 2DQHH 4QTHA 5IJVB 2PO6B 2F8OA 5DQ9A 1NC2B 3NCEB 1ZGLP 3TCLA 2BFVH 1TNNA 5HHVL 5I2IB 2ZPKH 4D0CA 2FO1A 2IQ9H 1CIUA 4I5BB 4NQED 2E3VA 4RFNC 4WO4D 2CH8A 1NCWL 5T3XL 2JCCA 2FB4H 3BD4A 2VKXA 1FYTB 4ACPA 1XF4B 4AEHH 2XQBL 4D9LL 1RZ8A 4U1KA 2MPAH 2VDRL 3JV6B 4P4KA 1X5IA 2EE6A 3DGCR 5JZ7D 4XC1H 3PDDA 5BRZE 5KJRL 4PS4H 1WCBB 5IROA 5C0BE 4O02L 1P9MA 2HG5A 4FXGA 3K2MC 3IDIB 3RZCC 3O11A 3I3EA 4KJQD 1CDCA 4XGZB 4PJEE 4K3DL 4XHJD 4Z7VA 1UG9A 5BV7L 2ZCKL 2X4NA 3H9SD 2Z35A 3KVQA 5F89B 3C2AL 3KPQB 3WV0A 1YECH 3H2WA 1GIGH 1BVZA 4IRJA 5FGRA 3WS6A 2ZCHL 2PXYB 4HXBH 5TDNB 2FJGA 3UJJL 4YEFA 2HVKA 4WV1B 5FYJU 1MQ8A 4L4TD 1DDHA 1FLRL 1BJ8A 2W1NA 4CJ0A 2Q7YA 2X4PB 4CVUA 4YGVA 4F8TA 5IK3A 5BW7C 1F58L 5CS7A 4F37F 2IQAB 3ULVL 3KNBB 1A1MB 3V95A 2Q76A 5IF0A 1BZ7A 5H37G 2DBLH 3AGVA 2DQIH 4U0QB 3IETB 1QFOA 3DX6A 5EOCH 3SGKA 1LE5B 1T6WA 2I24N 3V0WL 3JTTB 2EDNA 1C16A 2Y25A 4FFWD 4ZFFA 2DJUA 2BVUA 4X4XA 1MCBA 2DI7A 4YXKL 4EUPB 4L8SC 1CCZA 1MREL 3QO1B 3TYGH 1JWSA 3ARGA 4LDOB 1JF5A 1KJ3L 5C7XL 5A2LH 3ZDYE 3IKKA 3L1OL 3LMJH 3P73A 5T1MA 1WGOA 4EI5B 2BNQA 1OAUH 1OQOA 4XAWL 4Z7UF 5ITFA 4URTB 4F15C 2P5EA 4H25A 3A0OA 1CGSH 2A9NL 1TJGH 4OTXL 2XN9A 2MCPL 1EEZB 1IM3A 3UZVB 3HC4H 4RIRA 5GRZA 1GC1L 1I85A 1V7MH 4X9GA 4NJAL 2W0FB 2GTWA 2JIXD 5DRXB 3OG4B 4AYFA 4O5LH 1NGPH 2EZ0C 4EDWH 4NCC1 2VLKD 4YDKH 1BZ9A 2P24B 4HWZB 1T21B 4JKLA 4KI5F 5CCKH 3QP3A 1PZ5B 3VWJC 3WBDA 4HW6A 5TDOB 4PJHE 4OLXH 4HFWA 3WD5H 1T7VA 3L3OA 3MXWL 2Y6SC 4GRWH 3RVXC 1ZSDB 4JFFA 4MGXA 2XG4A 2B0SL 3DX7B 1HE7A 4LLQA 3L3IB 1Z5LA 3ULUF 4YDVB 4NKMA 2PYFA 5D5MF 1ZK9A 1DBMH 2GIYA 1QYGL 1QHOA 2NPLX 4M61B 3SDAC 1BD2E 1K8IB 3DBXA 4XC3L 5EDXA 2F74B 2DLGA 3DV6A 4P9ML 2ZOKA 5CEYA 1XZ0B 4E0RA 2ORBH 2H41A 3EYQC 3SDCD 1C8PA 1FL3B 2AGJL 4S1DD 5FYLH 5BRZD 4MQ7A 2P8MB 1OARL 2G5BA 5C0BD 4YIQB 4X7TB 2D0HA 4WFEE 3GUTA 3B43A 4GRLC 4WNQA 5DA0B 5KSAB 3C5ZD 4WW2C 1OLZA 5KVMC 1GZPB 3PHQB 5K9QI 2AEQL 4KRPB 3MV9E 1R24A 1I9RH 2FHBA 5DHYA 3GNMH 3TVMA 4YE4H 1MY7A 4W6YB 3SEPA 2DDQH 2F53B 4F2MA 3OKDB 4R2GB 3NZ8A 4AG4H 1EFXA 5F3BB 2W9EL 4FTVE 4E41B 2ESVE 4ZPVA 1CBVL 2DQUL 1UCBL 2PTVA 3PL6D 5D7SL 1IILE 4O58H 3UCRA 4LSRH 4NO0D 5HHQA 4NFCA 1VFBA 1K6QL 3JTSB 2MSPA 1T1XB 4X5WB 5J1SC 2W65A 4NQCE 2Z8RA 1LO4H 5DD6A 1GYAA 3QRGH 4LCYB 2BHYA 2AI0H 3PQYE 3STLB 1BIIA 3T4AA 5I1AA 1BQSA 4HWBA 4ETQB 4KTEH 4K9EH 4HMCA 3STBA 1AQKH 1ZXQA 2D7QA 3MRRA 4AMKH 3H3PH 1HSAA 4OBRA 2PW2B 4LSUH 4NKOB 1IAKB 4KUCD 1F90H 4Q0XL 4LPYA 3G6AA 1BQHB 3S5LA 3B9KB 1EBAA 1VPOH 5KANI 3UDWC 2CMRH 4YDJA 1KIQA 3DARA 1DEEA 3AB0B 2AK4B 4HAFA 5CZXD 2D3VA 3EYSL 3R1GH 1R5IB 1M7IA 3MLWL 1CFTA 4ONHA 5ESAA 5H35B 3ES6A 1S5IL 5EU6E 1BWWA 2B8OT 3LAFA 4HK0A 1LD9A 3WEXA 4OJFL 1JVKA 1CXEA 2KDGA 1KEMH 4HKZB 2IALA 2R23B 1FFNA 5D2NA 4Z0XA 4H1LH 5J6GA 1GGYA 4NQXA 4Y5YB 2WWMD 4YUEH 2NY2B 2OCFD 1L0QA 1B0GB 4GOSA 4HPOL 4JAMA 1PLGL 2PYEA 5HDQH 2E6JA 1D6VH 4LNRB 5C0IB 3ZDZE 4Y16A 2C4FU 4UNUA 3HI1B 4AEIH 1MHEA 4JY4A 4OQTA 2WINA 1KB9K 1O7SA 4P46D 5EPMB 5ESQA 5HHME 4PJXA 3G5YA 3GSNA 3KXFD 5FA4B 5IVOA 3TBTB 3NVQA 3O2DH 1KB5B 3ZTNL 3PP4L 1I9JL 1RQ5A 1YUHB 3Q2CA 1D5ZB 3TJHC 1IGFL 4QXGL 4FQIH 1XGTA 3SO3B 1B4RA 2FJFA 2ZSVB 3P0VH 4ZNCD 4HWBL 2GHWB 2BXYA 4WFED 4HV8B 3OTTA 2YD9A 2A77L 3B8SA 2V17L 2FEEI 1HI6A 1M7XA 2CK0H 1T0PB 5GGQL 3MV9D 2VZOA 3QIBC 1JGVH 1KACB 2XY2A 3AREB 2B4CH 3QI9D 4FTVD 3HR5A 3QUXA 4IDJL 3WHXB 1IE5A 3HAEB 2EIBA 2O5YL 1QBML 1VESA 5LQBL 5DTFA 5IQ7L 5HDBE 3C5ZC 1ZT7A 2VQTA 4MX7A 2HFTA 2NY1B 4FG6C 3MUZ1 3RVVD 3PQYD 5I15L 5ISZE 4UAOC 1G1YA 3ARFB 3DTXA 3GJEA 1F6AA 4LCUB 5I76B 3U0TA 5HY9B 1SJEA 4KDWA 4UZGA 3MLUH 4M5YL 2FEDC 5TH2A 3ALPA 3TGXA 1EDQA 1WTGT 3EKCA 3BPLC 5J3HD 5EBLB 5MENA 3QEHB 1B4JL 2VDPL 4U33A 4N0FA 3BZFB 1U3HA 3O4LE 32C2A 4J3UA 1NFDE 2YOCA 4KHTH 1UYWL 5TQ0L 3NTCH 1X5ZA 1X5YA 3V52L 1RHHA 4XTRC 4Z7NF 1A6AB 4E5XA 4FFVD 4JQVA 4JRYA 4XMKL 4DQOL 4GUPB 4OD3L 1IFHH 3RIFF 1NAKL 4QNPE 5EU6D 3GSNL 1NCAL 3NZHL 2YEZA 3K8MA 3SDYH 1MLBB 4MD4B 3MX0A 1OP3H 4TTGA 3CFKA 5DMJB 4FZ8L 1FYTE 5DJYB 4HG4K 4RA0C 4PR5B 4RGMC 4MNHA 2FIKB 2ICWJ 1I1RA 2B5IB 5HHXL 4KDTC 3GHEL 4NC2B 4P2QA 3QH3A 3D85D 3O9WA 5IOPB 3M45A 2QADD 4YO0B 1WIOA 5DEZA 1RZKH 4Y5XA 1GZQA 2IMNA 4LSDA 3SJVE 2LTQB 3FHQA 1J05A 3X14B 3MV7E 5KW9L 2V7HB 3NGBB 5E94A 1ETZA 5MP6L 4ZMAT 3C8DA 3OKNA 3S96B 5HHMD 5AAMA 4TPRH 4M3KB 4WWKC 4YHZH 1MH5B 4BQ9A 4U6TA 5E2WL 4AH2B 5C0RH 5EIQA 1YEGL 3OKYA 2VL5A 5AD0A 2HJLB 5D9SA 1INEH 1I7RA 2YS4A 3OXRB 5IB3A 3KLAA 1ZHBB 3BKML 4G8EA 3UTZA 1K3IA 5F3HA 1OAQH 1TQCB 5HHVH 1DP0A 1RUKL 4LSPL 2XZZA 1XF3B 3F5WA 1H5BA 3E6FA 5T3XH 1I8IB 2R4SH 4KROB 5JORB 4OI8A 2XQBH 4D9LH 4PGEA 2VDRH 4YBLC 3MJ7B 4WGWB 4MQTB 5I18L 1BWMA 4GXUM 4M8QA 5SX5H 4O02H 2RFXB 1F00I 2VL4A 3MOBL 5ISZD 5E2TH 5CINL 3VFNB 2D7NA 3D39A 1PQZB 2NY3B 4K3DH 1BBJB 3CH1A 5BV7H 4XNZC 2ZCKH 2DYPA 4I9WE 4JDZB 1T89C 4QKXB 3C2AH 4LVEA 1ZLVH 1EFQA 4YWGL 1BZQK 1HZHL 4DVRL 1P7QA 2ZNWA 3MUJA 2ZCHH 1T20B 3ARXA 3VRIA 3UJJH 3O4LD 3SKNB 1KLGB 1MHHA 3CCHA 4PY8I 3D2UA 2YD2A 1FLRH 2HMID 4XXCC 1RZFL 4JPWL 4POZD 2PO6D 5J0BA 5EUOA 1F58H 3ULVH 4UNTA 1L9MA 1FZOB 4P57A 3LH2L 5GS1A 2H8PA 2YBRB 3S3SA 2HH0L 3S8WA 4PJDF 3WLBA 3V0WH 1FYTD 5EIIA 3HCVA 2NXZD 2AP2A 1DQML 1NBZA 4YXKH 3LKOB 2BDNH 4X0KB 2HKHL 2MQCA 4U1IB 2CDEA 4L4VA 5KS9E 3LSOB 1FH5L 1P2CA 4XWOC 5MEQA 1KJ3H 5C7XH 3OPZH 3SJVD 1U58B 3G9VA 2LAAA 2X9XA 3QEQA 5HGAB 4IOIB 4XAWH 3SBWA 1TVHB 5IW6B 1FHGA 2P8LB 4H20L 4OTXH 2MCPH 4E41E 4E42A 4NO2B 1MQKL 4JZNB 1MFNA 1DE4A 1GC1H 4MHHI 4RMTA 1EAPB 5E5UB 2PXYD 3VFVA 5DMGD 5FGCE 1VACA 3BH9A 3F7VA 4JFYA 3OJDB 4XCCL 3HNSL 4LF3A 5JPNB 4GW5A 4AIXA 5EBMB 4OAWB 2YD4A 2E8YA 3B4NA 3MRIB 4EBQL 4WW2B 5ID1B 4PUBL 4UT6H 3IU3B 3MXWH 3I9GL 3E8UL 3JUZA 1A6UL 2BZDA 4LRNL 5D1QD 3VG0H 5DJCA 2B0SH 4NWUL 2X2YA 4DZ8B 1QR1B 1HHJB 4I0CC 2G2RB 4DCQA 1QYGH 4PJ7B 4BQBA 5J9PB 3RAJL 1X3DA 1E28B 3W82A 3MMEA 3FTGB 1CWVA 4IOFC 3VWKB 4I18A 1KXQE 1ZHLB 4MA7L 4P9MH 3CVHA 4TOYL 2AGJH 3AY4A 1JMZA 3G5VA 1OARH 1M05B 1X7QA 3BI9X 4EI5D 3DIFB 4JFQA 3PGCA 1NBVL 1JWUB 2AEQH 4OLVL 2L0DA 5D2LA 1AKJB 4I9WD 5E6IB 3LOWA 3RL1B 4XNYL 3IF1B 1L7IL 3GB7B 4WU5B 2ADIB 1CBVH 2DQUH 1UCBH 5D7SH 2KPNA 4NN5C 1RZJL 3GO1L 4QY8B 3RJDA 3TA3C 1WT5A 3WSQL 4OZHA 1FFPB 1A14L 1U8MA 1QLFA 3SKJL 1IAOB 3BX7C 1YY8B 2BVEA 4R7NB 3T08A 3W9DB 4Y2DC 3DVNA 2OR9H 3O6FB 3WN5C 1P1ZA 1KNOA 5DHVB 4X7CC 4LEOB 4WU7B 3OJVC 4Q0XH 1S9KC 3D25B 5IVZA 4PGBA 4EN3B 1WZ1L 2IGFL 3TNNB 5FO8A 3O8XC 1DL7H 4Q6YA 3MLRL 2ZZUT 3VH8G 2H2SD 2VJXA 3DWTA 1WBYA 3AM8A 2D7TL 3MFGB 3DSFL 4KKAD 1AR1C 4PJ9A 3EYSH 3EZJB 4ERSL 1CLYL 5K9OA 1CVSC 3MLWH 5KSAD 1RVFL 2WMPA 2XG5A 3CDFA 2MKWA 4KRPD 1S5IH 4P2RB 3WS3B 2A6IA 4IS6A 1JF6A 2F53D 1A4JB 2NXZC 1T5XA 4FQQA 3UZEA 4R2GD 4OJFH 3GGWB 2PW1A 3MRFB 4WEUD 4E41D 5C08B 5GGSY 3WIIL 4IJ3C 5JPMB 3CVHL 2WK2A 4LHUA 1T22B 1VB9A 5D7JA 3CVIH 5I1CL 4WI2A 2H6PA 1G6RA 4HPOH 3LKRB 3OJ2C 5A2IH 4J4PA 1UZ6F 2QKIA 5I8CB 1RZIA 3C09B 1LVEA 1QRNB 4LLDA 5KSVB 4OV5A 5IW1A 2YA2A 4N9GA 2DQFA 4X6FB 1OTTD 4TVPE 4NRYA 4P4RB 2GJZB 4N5UA 1FFOA 2EYSA 5CGMA 2M1KA 4ENED 3B9KD 3ZTNH 3PP4H 4Y4HB 1N4XH 1I9JH 3HE7C 2KH2B 3WO3B 4R0LC 4TUJA 4BFEA 4CN6A 5IMKA 2Z92B 2VERN 4J1UB 1II4E 1QA9B 3FB6A 4QXGH 2IADB 4QHMB 4H88L 2HP4A 3UXFA 3QULA 4P5TA 5FUOH 2OTUA 4HWBH 2HA1A 3HG1B 5D1QC 2ADFL 1S8DB 4M62H 1FYHB 3LKQA 3UPCA 4DVBA 4X9FA 5GGQH 4G8IA 4ZUUA 4ZXBC 2J88L 1A1OA 4H8WL 4K3JH 1MNUL 4DN4L 3NIFE 4P49A 5C0GA 1YMHA 4PRPA 3OB8A 3CXDL 1A22B 3H3BC 3MNWB 3H0TB 4P2CG 3RI5F 4WJ5A 3NFPA 3ZYIA 2R1WA 4IDJH 3UTSB 2Z91A 3P3YA 4FXKB 2NY2D 2O5YH 3VD4A 3O6ML 2R9HD 3V7AG 1EPFA 2EIZA 3BP5A 4OFVA 4AQ1B 5IQ7H 1S7QA 3S4SA 4NGHL 3KPRE 3CNKA 1OSZA 3FN9A 1CTNA 2ARJQ 3O2VL 1J87A 3HFML 4YQXL 2GEEA 4GKZB 2JJVA 3QWRD 4M5YH 4D9QE 3LDBC 3HRPA 1U8LA 2QTEA 1H0DB 3CPLB 4C56E 3WUZA 1O5DT 3HKFA 4PRAB 4LQFL 4YAQB 2EDJA 4J8RA 1UKQA 2VDPH 5JLZA 1FNEA 1YEDB 1D5IL 1FCCA 3BGAA 2BC4B 3V0VB 4KKLC 3ZSSA 4YHIA 3IVKA 1UYWH 5TQ0H 3QEGL 1SY6A 2HWZH 1EJ6A 3QWOB 3V52H 1P53A 4NUGH 5B38A 1NSNL 2ADGB 2BRRL 2EO1A 3EW3B 4OD3H 2HN7A 4J3SA 4F9LA 1NAKH 3P0YL 2X5PA 5IMLB 1Q9WB 5IJKC 2R0KL 3GSNH 3ZO0A 1NCAH 3NZHH 3FO1A 3J7HA 1TENA 3ARED 1QLEH 1YPZA 3L5HA 1G9NL 4FZ8H 2HLFC 4PP2B 2FGWL 4WCYH 2C1OB 1W72A 5DO2D 1UJ3B 3GHEH 2EXYD 3VE0B 3E2HB 2VABA 2R1XB 5EC1A 4NP4L 5BJTA 2NY1D 5IB2B 1NEZG 2FL5B 1HXMA 3ARFD 3V5DB 5A2JH 1XGRA 1DVFC 3GSRB 3K7UA 1XIWA 4TVPD 4JCLA 4OM0L 5KW9H 4XB7A 3QUKB 1K2DB 1FG2A 3QIWB 5HJ3A 5MP6H 3GMRB 3IKCA 4YNYA 2VDOL 5GRYA 1SM3H 25C8L 2B1AH 1YEGH 4J12A 1OP5H 3QBTB 3EAKA 4PB9H 5KBNC 4QHKJ 1NMAH 3TZVA 5D7LA 5C92A 4I3RL 3WFHB 5JW5B 5MEPA 4OFPA 5ACZA 3W2DL 5E2JA 3BKMH 1S3KL 1U91B 3B83A 4R4BA 1RUKH 4KGLA 2X70A 4IOSD 4PG2A 4LSPH 4ZUSB 4UTAL 2WW8A 3B2UD 4IRSC 3RBSA 4WIQA 2P5WA 5EA0L 3D3VA 4RMVA 1MJJA 4TNVK 4NQUA 3EGSB 1FZKA 4WUKL 3JXAA 3LN4B 1HHHA 1FVEB 3DLQR 5E5MA 1SY6L 1BIHA 2V2TA 5IHUL 2PTTB 5DYOB 3BISA 4QRSA 2LABA 5GSRA 2AV1A 3DRTB 4FQXB 4ZD3L 3MOBH 3KPRD 2DIBA 3BPNB 3BHBB 3QSKB 1AGBB 2PNDA 4U7SA 2BSED 2CRMA 5E9DA 3QXWA 2V2XA 3VDBA 4D9QD 2B20A 5FGBA 4C56D 4YWGH 2R9HC 4KJPC 3QYCA 4YFDB 4NN6B 4KK5D 2PN5A 4G6AC 4Q97A 4EI6A 5IG7A 3V2AR 1WLHA 1UFUA 4HJGB 4LQ1A 5DFTA 5JW3L 1RZFH 3L3JB 2X10A 2Q86B 3IFPB 5LCVL 2VXQL 3LKSB 1YNKL 4GRWB 3FB8B 4Z7UA 1TJHL 3GSUA 4NDMA 2RQ8A 2X1WL 4MLIA 2HH0H 1JV5B 4TNWF 4MNQB 2XIDA 1AO7B 1A6ZA 4KROD 4LFHG 4M7KL 5BO1L 4PLJD 1U8PB 4YXLL 1DQMH 5EU7C 5T1KB 4X6CB 3REVB 3BEWB 1IMHC 3L3KB 1HEZA 4YPGB 5E56A 1C08A 3OGCA 1FH5H 5IROC 3DX8B 1EO8H 3HZVB 4NRZB 1RK0B 1MAJA 5DXWA 4UDUA 2NY3D 4BQ8A 5GRXG 3F58L 4JKWA 4LCIL 4DGVL 4H20H 4X5XB 1JZ4A 4P5KA 2HFEB 2WLYA 5D5MA 1MQKH 2LVCA 2A6KB 5EFIB 1A6VL 1HOCB 4BUHA 4HXAH 1MCFA 3V6FB 4XCCH 3HNSH 2FZ3A 3L95A 4P9HC 2R39A 5LBSL 2YMXL 3MLTA 4LKXA 4XP9L 2CJUH 5D93C 5KOMC 3NBNA 1WJ3A 2R0WL 4TUKL 4JRXE 4EBQH 5GS0D 5ALBL 1JZ2A 5EU4A 4HBCH 3VXRB 4QRUB 2Y5TA 5GSVA 2K3TA 3I9GH 4JG1L 4Y4KC 5HPMA 1A6UH 1BGXL 1TZHA 4LRNH 4NWUH 4MAYB 4JVWA 3QPXH 5SX5K 2YK1L 2Z93A 3T65B 3RAJH 1MUJB 4NZDA 1NFIB 3BGMB 5DJ2B 4XXDB 3TNMB 4WFHE 5CBEA 3DMMC 4JQXA 4OF5A 3Q1SL 4OZIF 3LKPA 3GM8A 4MA7H 4TOYH 3MLVL 2X4OB 3GK8H 4PBWD 2HT4C 4I0KA 1ZLVK 4AL8L 4I2XA 4P2RE 5FYKE 5EULV 4JFOA 3IDNA 2X05A 1IRAY 2E9BA 1NBVH 2VRAA 2LU7A 5F7EL 1B3JA 3NCBB 3IJYA 1YMMB 5C08E 4OLVH 1QPXA 1JUFB 1L7IH 3RKDC 2YC1B 4H1LB 2NY5H 4HIJA 1A6PA 5ANMB 1I3RA 1RZJH 5INCA 2ZG2A 3GO1H 2CUHA 1OD7A 3PUCA 1VGEL 3MA9L 3UJIL 5D1ZB 2QQLL 2VYRE 3WSQH 5BOPA 1JYNA 3OAYK 3DX9A 3WIFA 5I17B 5DJ0B 1A14H 3C8KA 4WW2F 3SKJH 1H3XA 1T6VN 3B2VL 4LAJH 4DAGL 3MRCB 2IANB 1WUNT 1CXFA 2VOTA 2R2BA 1UXSB 5F7NC 1ND0B 4GW4A 2DIJA 2IGFH 2P48B 3RGVA 3L3HA 1DLFL 2RHEA 3VWKD 2DM3A 4FQHA 3MLRH 5JQ6L 3DURA 3RIAK 5FO9A 2R56L 3HG1E 2D7TH 3DSFH 4RAUA 3EOBB 4ERSH 5DEFB 4JQIL 1JPFA 1QBLL 1JWMA 2ZUQC 5F9OL 4PJGF 3SHSA 3VXSE 2QQQA 2OTWA 1ZT4A 4ZDHB 4HUKB 1JIBA 1AKJD 1CLOL 5E6ID 3QEUA 3ILQC 1FORL 1I1AB 3FJTA 3UTSE 4HWEL 1LDSA 4YFEA 3ABZA 1I3UA 1T04B 4OCWL 1LEIA 1J11A 1KCLA 3S3JA 4WHYH 1AHWC 3CVHH 3QXAA 4LLUA 2YRLA 2X40A 2P7TB 2IFFL 5I1CH 4M1DL 4NM8L 1F42A 4L4JA 2J2ZA 4LSTL 5IM7B 4CN1A 5IV2A 3MR9B 2HAZA 2V5TA 5GS2H 1U8OB 5CP7B 3SE4A 2AVGA 3ECBB 3LEVL 2A1WL 1PAMA 3LS5L 1A64A 1CI5A 3HZYB 3O6FD 4QCIB 2NLJB 2QJDA 1GPOL 1H8NA 43CAA 1JTTA 4XNMB 3QQ4A 1R3HB 4EN3D 2IF7A 3OGOE 4PV9A 3TN0D 1KEGH 4DK6A 1BBDH 3BIKA 5TE6L 4ZUWA 2A9ML 2NQCA 4LRIC 4WFHD 1KBGL 1JGDA 1X5XA 4H88H 2VE6B 3CLFL 5JNYA 3TIDA 3AFLA 1F8TL 2HRPL 2ADFH 5BXFB 1Y6MR 5FYKD 4P2RD 5INDB 1ADQA 5IFAH 3F7YB 2XWJA 4KMTL 3VFPA 4AK1A 2X7LB 4WUUA 1MFEL 5F6IB 5JXEC 1FFRA 1MCRA 2J88H 3MXVH 4H8WH 1MNUH 4IMKC 5BZWB 5C08D 4DN4H 4HSQA 3K2UL 5CJXA 3O3DA 5L7XH 3CXDH 4L9LA 1Y18B 5FUZL 1KTDB 3DROA 4I0PA 2RR3A 2DM2A 1RK1A 3O6MH 5BS0B 3TO2A 4M8VA 1UWEL 4GAFB 1IEAA 3FO2B 5FOJA 1QRND 4NGHH 2UWEF 1DFBL 3P4OA 4HUVB 5IQ9B 1H3PH 1I8LA 2Q3AA 1CDBA 4GG6E 2XY1A 3O2VH 1T1WB 4F7TB 3OV6A 3HFMH 4YQXH 5FKPB 4MXVE 4NPYA 2XQYG 2ARJA 1H3WM 4Y4HD 4MNGB 3MRPB 5D7IF 4CRPA 4YDLB 4LQFH 5IR1A 4Q9BA 2QR0B 1KLUB 1G6RH 1EXUB 3C6LB 1KIPB 4ODXA 1AY1L 1D5IH 4HUXB 3VFSB 3MCKB 5L2KA 3HG1D 1DVFB 2OBGA 4NT6B 4WWID 2BRRH 1F3DH 1PKQA 4UB0L 3SPVA 2CRIA 5C1MB 3P0YH 2BSSA 3LPGA 4WHTA 1R0AL 1FVDA 1MFDH 4PJIB 2AJ3B 3KPSB 1B9ZA 4D94A 5T1DL 1G9NH 1C5CL 3UTSD 2QQNH 1K4DB 4Z95L 2FGWH 4S2SB 4QRRA 4JFEA 1D7FA 2X4SA 4XMPH 4Z5RB 1IKNA 3EO0A 3REWA 1SBSL 4M6ML 4F7EA 4NP4H 3QUZC 1ADQL 5I66B 4PJ8A 1IEBA 2ICEB 3GSQB 3T0EA 1BVKB 3LRSA 4X4MA 5E8DL 2NXYC 4XT1C 3TO4B 1KTKE 3QZWB 4U2YA 4GMSL 4DKFL 5MHSD 4YX2L 5D6CB 1HWGB 4MXWL 4M9PA 2VXUH 3EJYD 2FJHB 3PG2A 4ZTOH 1A7RL 3QIUA 3DUHA 1QHPA 1Q0XH 25C8H 3UBXA 1FL6A 5IBUG 4BSWA 2EH8L 3OKOA 4JKPL 2OK0L 3RWHA 4NHUB 4O4YL 1QOKA 2NY0B 5B8CC 3O6LL 4GRWE 1JGEA 4ZO7A 3W2DH 5F7HA 2O5ZL 2DMCA 4HT1L 3TV3L 5DQDL 5A3IC 4QXTA 5JOPD 1T7XA 3VFTA 2Z8SA 2W59A 1UACL 1ZT1B 4Y2OA 5SWQA 3W9EA 3X12B 1KTLB 3TN0C 3MLXL 4UTAH 4MNQE 4M6NL 1AO7E 1PG7X 3CZFB 5ETUB 2HTLC 3DO3A 3SDDC 5EA0H 2BY3A 3UAJC 3C60B 1S7VB 4G6JL 3ESUF 4WUKH 2YD7A 1NGYA 4HLJA 1SY6H 5IMOA 4U1JB 3PHSA 5FA3B 4QRPA 5FYLE 4LBEA 4U1HB 4XVTL 1MFBL 1FO0A 4LVHB 3W0WE 1P4IL 4QTHB 3BDYL 1GRWA 3HNVL 5DQ9B 2XZCL 1DN2A 3TCLB 4JR9L 4ZNEA 1KJ2L 4ZD3H 3EHBD 2EDDA 4D0CB 1L7TL 1I1FA 1Q94A 2A6DA 4F7MA 3B9AA 3ZHLA 1J88A 3QIWD 2JCCB 4GSDH 3N85L 4YC2C 4PJDA 3G04A 1D5BA 3MPCA 4X7SL 3WL9A 1RZ8B 4U1KB 4P4KB 2OI9B 1RFDL 3TWCL 3WLWD 2DQJL 4MJIE 2E9WA 3AS2A 4RFEA 5B3JE 2HG5B 4FXGB 5JMOC 2L7UA 3ZDXF 4L5FH 3VXRE 5JW3H 3RVWC 3O11B 1DBAL 4MCZA 1U0QA 4HQQL 4PGCA 3MLSL 5DI8A 4X9IA 5LCVH 3S34H 2GSGA 3THMH 3DYOA 4Z7VB 4G6MH 3EFFA 2X4NB 1NLBH 1I3VA 1TPXC 2Z35B 3MLPA 2IBBA 3IS0X 1K8DA 2I07A 1DLHA 1BOGA 4CMHB 4IRJB 1G7JA 3CMOL 5HGGS 2J5LB 4PGJA 1LO3L 1IL1A 2FJGB 4YXLH 2Q6WA 2YRPA 2HVKB 4O2CA 3MUGA 1KENH 1NGZA 1DDHB 1AJ7L 2Q7YB 5K9KA 1KIUA 4YGVB 5IK3B 5DMYA 1OQXA 3U7YH 4K71C 5E00A 1Q9KA 4FQXD 4YFLI 2FSEA 1UKTA 3EDJA 2Q76B 5IF0B 5D7KE 4PJ5E 1BZ7B 1YMME 3DX6B 2EECA 5B3NA 1F4AA 1OP5K 1OT1A 1S9WA 4G80A 1NAMA 3T0WA 3K4ZA 4LCIH 1AXTL 4DGVH 1C16B 4ZFFB 5GRVL 3KJ4B 4X4XB 3U4BL 4UOJA 3FQUA 1IGIL 3KYOA 4JCMA 1R3IL 3MO1A 4K8RC 4XCNA 1JWSB 3ARGB 4K3EL 1FO0L 4XNXL 2YPLA 1JI1A 2IPUG 1CICC 2YMXH 4XP9H 4LLAA 5HYJA 2QBWA 4XX1E 4HS6A 1MIML 4JKKA 4TUKH 3P73B 5T1MB 3TIEA 1KJVA 2BNQB 4ZAKC 5J1AA 5ALBH 5ITFB 4Q6IC 1R3LA 2P5EB 4H25B 1RJYA 3KLDA 4MS8D 4JG1H 1NANH 3Q48A 5ICXA 3BN9D 1BGXH 3WJJC 4LSVL 1QPPA 2XN9B 1BX2A 1A1NA 1IM3B 4RIRB 1YN7A 4MNQD 1AO7D 1WIUA 2GTWB 1KPUA 1YC7A 3IDGA 5T1KD 1DR9A 1I4FA 1EO5A 2YK1H 4JPKL 3BAEH 5HDOA 4NM4L 3OWEA 1BZ9B 4C83A 3MV11 4ALAL 5FF6A 1H15A 3N1MC 1WWCA 1D9KA 3Q1SH 3VXNA 5FYLD 4RMSA 2E7BA 3UTTE 3QCVH 3MLVH 1UM4L 4HFWB 3L3OB 3ZDZF 3W0WD 4N0UE 4CMMA 2F8VA 1ZMYA 3QDJA 4JFFB 4LU5L 4AL8H 2DQCL 3BYTA 5DFWH 3G5ZA 4X6DE 3NPSB 4LLQB 1Z5LB 5F7EH 4NKMB 2PYFB 4OCMC 1G84A 4WI5A 1KCSH 3DV4A 2YA0A 4OCNC 3N1FC 4HC1L 4Y1AE 3S6CA 5I74C 3DBXB 3U7WL 3CFJA 5EIVA 3WE6A 2OSLA 4HKBA 3DV6B 2ZOKB 5CEYB 4E0RB 3WO4C 3NACL 4R7DA 1TDQA 4MQ7B 1G9ML 2G5BB 2YPVL 3UJIH 1TCMA 3MA9H 3N1GC 5L9DL 3GUTB 5L8LB 2EEBA 4WNQB 1U8JA 2QQLH 3O4OC 3VXRD 5E08H 3RZWA 1EHAA 1NAML 4PLNC 1R24B 4Z8FL 4PBVC 4KZEL 3TVMB 3ULUH 3B2VH 4F2MB 5C0ND 3IU4H 3QHZH 4MAYD 4DAGH 3NZ8B 1EFXB 2CD0A 4ZPVB 3W11D 4RQQA 4MJ4A 3VXQA 2Y36H 3QUMA 5HHQB 1VFBB 1SBBA 2CO7B 5F7LB 4HPYL 1R5WA 3ILPA 5GGSA 5JQ6H 2DJSA 2JB6A 2W65B 5DD6B 8CGTA 4OD1L 2R56H 1LO0L 1BIIB 2WWKT 3T4AB 5I1AB 2APVA 1FVCA 4JQIH 2NR6D 3MRRB 5TGBA 1QBLH 3MRQA 2ICWI 4PJ5D 1HSAB 1YMMD 1XFPA 2WIMA 4LCWE 4OKDA 3G6AB 3JWDC 1FORH 4YPJA 3S5LB 3ROOA 1YYLL 4HWEH 2EC8A 1A7BA 5F9WB 3RKPA 3KGRA 3LKNA 1ZKAA 1KIQB 4YDJB 3A6CL 1NFDF 2ZKHL 3HC3L 4OCWH 5BS0E 1DEEB 4YXHH 2XWBA 2X4RA 3LB6D 5D1ZD 1M7IB 1CFTB 4M1DH 4NM8H 4ONHB 5ESAB 4LSTH 3P9LA 3ES6B 4JO2L 5DMIH 5F9DC 1AC0A 4JPIA 4E9LA 3LEVH 3IXTA 4HK0B 1LD9B 2A1WH 3WEXB 4RA3A 3VU2A 2IAND 2XTJC 1GPOH 3SGDH 3S97C 1T7YA 2W9DH 2IALB 2CLVA 1FFNB 5D2NB 4Z0XB 5J6GB 4M6OL 1VCAA 3BE1H 4NQXB 3OF6A 1RURH 5TE6H 2A9MH 5EC2A 2X41A 2ZG3A 3P9MA 4JAMB 4OLEA 1HSBA 1YYML 2PYEB 1CDGA 1UQSA 3CLFH 1N7ML 5HYSG 1BFOA 1F8TH 4U1LA 3U4AA 2HRPH 4Y16B 2IBZY 3DYMA 3UPRA 3WNOA 3PABA 1MHEB 4JY4B 4DTGH 2MCG1 2WINB 4PJIE 4OGXL 4KMTH 5H37H 1DUYA 1SYVA 3KPSE 5ESQB 2VAJA 3G5YB 1MFEH 3GSNB 1YJDH 2DLFH 3EZ8A 4PJXB 3V8OA 4WVRA 1EZVX 1I1AD 4FNLL 3QJHA 5T3XE 4LPXA 3K2UH 1SMOA 4WI9A 5FUZH 4S11A 4LP4A 4O2EA 3TPKA 1XGTB 5BQ7A 3RY5A 3I85A 5CJOL 2FJFB 1CE1L 4KTDL 2ID5A 1P7KA 5IMMA 2W0LA 3DOSA 1XH3A 3LPWA 3RVTD 4KFZC 1DFBH 1HI6B 1I1YA 1OF2A 3SCMC 5FDYA 4K94L 4LMQI 1FJ1A 1CXIA 2FECL 3QUYC 4L3EE 5CGYC 5ADPL 1VERA 1NCBH 3VRLE 4W81A 2EDWA 3HR5B 3QUXB 3HC0A 1IAII 5IB1A 2E7LA 1PBYA 2O61A 3QG6A 3MOQA 4HIIA 4P48A 5DTFB 2A0LD 3OHXA 1CG9A 1ZT7B 3VH8A 4MX7B 1QFPA 4BJLA 4AIZA 3GJEB 4QXWA 3DTXB 1F6AB 4UU9A 1KSRA 3U0TB 3ULVE 2DKSA 1SJEB 1NANI 4UB0H 4PJCE 3RRQA 3F7RA 1NLDL 1EEYA 3QFDA 5TH2B 4ZO6A 4B7LA 2FRGP 2XXCB 4LPVA 4JHWL 3BD3A 5T1DH 5MENB 1C5CH 1X4ZA 3MRDA 4N0FB 4ZO8A 2K9UA 1U3HB 4K3GA 1T66D 4Z95H 32C2B 1LEKA 3INUL 1JNHA 1KJMA 4X9BA 5BS0D 2Z31A 4CJ1A 1NC4A 4WI3A 5DEGA 3MTRA 1M7DA 1RHHB 2WM0A 3GKWL 4R97B 4E5XB 1SBSH 5I71C 2JK5A 4M6MH 4JRYB 4JZJA 1ADQH 3QDMA 3RWEA 2OZ4L 5JA9A 2YEZB 3JUYA 3DRQA 1B90A 4U6HA 2E7MA 5D71H 5E8DH 3HAEG 3CFKB 1MPAL 3VI4E 4OZFH 4YX2H 4MNHB 4M6AA 4MXWH 3ZKSD 4UQ3A 5KSBF 1A7RH 3QPQD 2FR4A 4JGMA 3BPCA 3C6LD 2C26A 4P2QB 3QH3B 3O9WB 3JBG7 5KS9F 1QEWA 5DUML 2EH8H 4Y5XB 2YPKA 1AH1A 1GZQB 3NPZB 5GGTL 4O4YH 4U6XA 2ILLA 3Q3GA 4QWWD 1TCRA 4DN3H 3AMKA 1CTOA 1J05B 3O6LH 1CZ8L 1MRCH 4NIKB 4Z7VE 2O5ZH 3UC0L 4HT1H 5E94B 2X1XR 2CO6B 1ETZB 1OGAE 3ARBC 3KPSD 3OKNB 1H3GA 3NCJL 3VGGA 4XNUL 3MLXH 4UMGA 3T2NH 5J11C 2MQ0A 3LV3A 3GM0A 5T3XD 3MGTA 5KTEL 4KAQH 4Q58C 4G6JH 1A21A 3QQ3A 1Z2KA 2VL5B 5AD0B 1LO2H 4GKOA 5D9SB 1I7RB 5IB3B 4XVTH 3O6KH 3RDTC 4GLRH 2G5RA 3KLAB 4HJ0D 5LGKA 1P4IH 3ARQA 3BDYH 3HNVH 4G8EB 5GZND 2XZCH 5F3HB 5DLML 4POYA 5IVXE 2F19L 1L7TH 4YK4C 5T3ZL 3RZCA 1ODAA 4N90E 1O7VA 1DZBA 3F5WB 4L3ED 1H5BB 3E6FB 4YHKL 4AY0A 1FRGH 4XVSL 1RUQL 4X7SH 3MLYL 4PGEB 2GJ6E 1AIFA 1BM3L 1UEMA 1JGUL 2PCPA 4M8QB 3TWCH 1D3CA 4JFXA 4KJWD 4UILL 1MCCA 1EV2E 2DQTH 3WHE0 2BNQE 2NY0D 4R3SA 3VD7A 3MUHL 3HZMA 4DZBA 3VGEA 1ZGLA 5EH1A 5BW7A 1DBAH 3ULVD 4UV7L 5DJZA 4HQQH 1M6OA 3MLSH 3D39B 3VJ6A 2XN9E 4Z78A 1ZWIA 5LXGL 1FC2D 4M4PA 3CH1B 3SGDI 2DYPB 2Y9RT 3CFCL 4MD0A 1NBQA 4G9DA 4I3GA 5ELIA 2IBGA 3C60D 1P7QB 2XZAL 2KL6A 1VHPA 3QDGA 4YGAB 1F6FB 1HWHB 3EJJX 1LO3H 3VRIB 4AJ0A 4A6YA 2VN4A 2ZUTA 4L8SA 5F6HJ 1MHHB 4OSUL 5F7WC 4DKEL 3RU8L 3CCHB 3D2UB 4XI5D 3IDXH 4XCFL 2BJML 5EUOB 2ICCA 3SY0A 4JJ5A 3MBEC 1A3QA 5J4MA 1NEZA 4P57B 2UY6A 5GS1B 2H8PB 3MNVA 3WLBB 3ULSA 3U36A 1CD1A 4GS7B 5EIIB 5DA4A 3HCVB 1G9EA 2EYRA 5IBTH 3U4BH 4P4KD 1NBZB 1IGIH 2XKNA 1R3IH 4DFIA 2WAHA 12E8L 1ZHNA 4K3EH 1FO0H 2CDEB 4L4VB 4X6EA 4XNXH 1P2CB 5MEQB 4OZIA 1VEOA 5C0AA 5DJDA 4KJYA 1MIMH 4QF1A 3VWJA 2CPCA 3QEQB 4HKXA 4N0RA 1WAAE 1YY9C 1QKZL 2D0GA 1Z3GH 1OGAD 2AJSH 4LSVH 4HWUA 3IFNH 4E42B 3QWQB 4MB4A 1DE4B 4IRJD 3F6IA 5KZCB 4NQTA 1A3RL 2ZUUA 3VFVB 1TTUA 3WO4B 3CK0L 1VACB 3BH9B 3F7VB 4JFYB 1LILA 3SDAA 2QL1A 4JPKH 3RP1A 4O2FA 4RGNC 4NM4H 1JZ6A 4GW5B 4TTDD 4NWTL 5FO7A 1IAIM 4M5ZL 1UM4H 3MRHA 4I4WA 4MXQD 5FOBA 5TQ2L 5D96B 1NMCC 3FRUA 4LU5H 4GRLA 4F33A 5DJCB 3N1QC 2L7JA 4N90D 5F9JA 3N0PB 1QFWL 2D7MA 5LGHL 1CFVL 3D6GA 4YHYB 4MJ2A 2DQGL 4DCQB 4UT7L 3OBAA 1WICA 4LLYA 5GPRA 4AZ8A 2EDFA 5CHNA 3EOTL 3U0PA 3KPPA 3U7WH 2P47B 1U3YA 3MMEB 4NQDE 4PRIA 3ARGD 4NO5A 1MCNA 4I18B 3C5SA 5LGJA 1F4WL 3NACH 1C1EL 3CVHB 4HHAA 3IDYB 4RSVA 3G08A 3G5VB 1G9MH 1X7QB 2YPVH 5L9DH 2BNQD 3BGFC 4JFQB 3PGCB 2P5ED 1G1CA 2ATKA 2RCSH 1NCUA 1TXKA 1NAMH 1XGYL 3M8OL 2XN9D 4Z8FH 4KZEH 1AI1L 4PJGA 2C9AA 5D2LB 3SE3C 4N0YH 3VD9A 1T0NA 5D2NE 2W0PA 3VFGL 4NQSA 5JMRA 4FP8L 4GBXC 3STZA 4KJWC 1INDL 3WUWG 1A9EA 2F58L 3RUGE 4L4TA 1JYWA 5DD5H 2R69L 1DEDA 2F5BL 3WNKA 3UDWA 4JM2D 1PSKH 2KUTA 4M03A 3U46A 3U0WL 1CLZL 5AZEL 4OD1H 4OZHB 5EOQL 3BW9A 4XVUC 2VLRA 1EVUA 4JFFD 1U8MB 3KDMA 3JV4A 1QLFB 3FO0H 1G7HA 1FGNL 1I3GL 5J8OA 1FV1A 2QHRL 4Z77A 1MCEA 4JREC 3DVNB 4Y4FB 3CD4A 1P1ZB 5D4QA 1KNOB 3DXAE 3QAZC 5I8OH 4NHCL 4BH8A 3BN3B 4N0CD 5IVZB 4F37K 4PGBB 4J3WA 4HBQA 1A7NL 1YYLH 5FO8B 3L5WB 4JGUA 4JFDA 2YRZA 2HT2D 3A6CH 1KGCD 1QO3A 5JOEA 1WBYB 4JG0L 1B2WH 4GLRI 2FATL 2X4TA 4PJ9B 5FYKU 5K9OB 2CIIA 5CEXA 4LHQB 1EUTA 2WBJC 4JO2H 3RWFA 1I1CA 3DO7A 2A6IB 4IS6B 3MYJA 3TFKD 4KKCC 1T5XB 1C5BH 2JKXA 4FQQB 5F7KC 1EFXD 2PW1B 3LD8C 3WIHA 4D0BA 5CZKA 3BO8A 4QHKI 5DVOA 4KRLB 5B21A 1AD0A 1ZLSL 3MOAL 3ARWA 2YD8A 3NAAH 4LHUB 2EO9A 5D7JB 2H6PB 1G6RB 5IB4A 2QKIB 4N8VG 1RZIB 1OD9A 3U1SL 1HYSD 4LLDB 4OV5B 5IW1B 1KYOJ 4N9GB 2DQFB 1Q8MA 1N7MH 2UWEA 4HKJA 4QHLA 4NRYB 2X09A 3P0GB 1CFQA 1FFOB 1X5JA 1RY7B 4OGXH 3IAGC 5ID0A 2UYLA 1VENA 3QIBA 3R06A 1MCOL 5FIEA 3UBXI 5DR5L 3RX8A 4TUJB 1QSFE 1EVTC 4TTDC 5IMKB 1AGDA 4JANA 4NQDD 3FB6B 5BRZA 3FQXA 5JA8B 1X5FA 3QULB 2VNCA 4HUNB 5D70L 4P5TB 5CJOH 4OLYL 2AXGA 1QZ1A 2OTUB 2NTSP 2VXVL 2H9GA 4KTDH 1OY3B 3C5ZA 2WUBH 2ERJB 3LKQB 4DVBB 4K94H 2EDYA 2WQRA 4Z7QE 4G8IB 4ZUUB 3C87A 1A1OB 1A3LL 1HH6A 5KOVC 5C0GB 1YMHB 2EXWC 1HCVA 4PRPB 2UV3A 5ADPH 1ACZA 1LHZA 4K2UL 5CEZL 3PL6A 4WJ5B 3NFPB 2R1WB 5FM4A 2Z91B 4P2QE 4NO0A 5ACMA 5LAXA 3B5HA 4LVOC 3BP5B 2EIZB 1MOEA 1S7QB 2PYED 2Q8BL 1RPQA 3S4SB 5JIIA 3PDGA 5MI0B 4KVNL 3KYKL 3RVUD 4Y16D 1OSZB 5F44A 4XPBL 1KFAL 3S35H 4JZOA 1IC5L 3WIHL 1NLDH 4PYGA 4NOBA 5FUCE 1U8LB 1MEXH 4MJ6A 4JHWH 4J8RB 4EEEA 4JM2C 5I8KL 1M71A 5AG9A 5JLZB 1FNEB 4WW1A 3LS4L 3VG9C 3INUH 4YHIB 3IVKB 3RTQC 4I8DA 3P77A 4KDTA 4OT1L 3DGGA 3GKWH 5B38B 3EBAA 2HN7B 43C9A 3T1FA 3T0BA 5D1XC 3KS0H 2OZ4H 4MA1B 5FHBL 1FNSL 3FO1B 1JZ5A 4N0CC 2F54A 3WYRA 4KK9C 1YPZB 1MCPL 5GGVL 1MPAH 2FO4A 2HT2C 3QUXD 5BOZG 1TETL 1JPGA 3CLEL 5C0CA 2X1PA 4WWKA 4UNVA 1IC7L 1WF5A 1W72B 4I13B 4M9OA 2AQ2A 4L3AA 3DNKA 1U8HA 2VABB 3MJGX 3FRPG 5DUMH 5EC1B 5I6XC 1U92A 5BJTB 1HXMB 2Z8VC 5A2KH 1BF8A 5SV4A 1XGRB 4M43L 4YK4B 2YZ8A 4AM0A 3BOVA 1XIWB 1MVUA 1CZ8H 5F7MC 4BSVA 3UC0H 1KTRL 8FABA 1FG2B 5HJ3B 2GAZA 1U8QA 3NCJH 3IKCB 5GIRB 4XNUH 4YNYB 2BVPA 4PP1D 1F6LL 1BD2A 1C5DA 4V1DA 1N5AA 1U3HD 5KTEH 4CVXA 1JHKL 3FFCE 1O0VA 1CR9L 2VLJE 2XICA 3NFSH 2V5YA 3WXVL 4EVNA 1MY5A 4JRYD 3TZVB 5D7LB 5MEPB 5CMAA 5ACZB 5DLMH 4R4BB 5T3ZH 5DFVC 5JHLL 2X70B 4HH9A 2P5WB 2AQ3A 3D3VB 1MJJB 1YQVL 5JDSA 4YHKH 2ESVA 4M7ZC 1FZKB 1NCCH 4XVSH 1T89A 1LE9A 1HHHB 1RUQH 4P2QD 3MLYH 3EJZC 3H3KA 5E5MB 4APQD 1BM3H 4L4VE 1JGUH 2R4RL 3QT2A 4G9FA 1GOFA 3NABL 2V2TB 1ZTXL 4NQCA 4UILH 4QRSB 5GSRB 1JHLL 3PQYA 1N5YL 2AV1B 3QEQE 2EIEA 2VZUA 5L6YL 1N0LA 4ONFL 4UV7H 3ZKXC 3FONA 5E9DB 1G0XA 5LXGH 2V2XB 3H7LA 2DIAA 5DUBA 5FCSH 3CFCH 4QLRA 4NYLA 5EBWA 1JRHH 1AQDA 4G7YL 2XZAH 5DVMA 4P2OC 5IG7B 1CGTA 4EI6B 3GRWA 1MWAA 4Z0BL 2Q87A 1GJIA 4C57C 2MPAL 4OSUH 3OKMA 4DKEH 5HHPA 3RU8H 2V5MA 4XCFH 1UKSA 2BJMH 5HGHA 3K0WA 4JN1H 5EU6A 3MRGA 3O41A 4Z7UB 1BP3B 2AEIT 4NDMB 2YXMA 5GZOC 4X6BA 5CIPH 1KOAA 1A6ZB 4MCYA 4BYHA 1HKLH 2Y72A 5HGBA 1KPVA 2FHCA 3RIFK 5J1TC 1X5GA 1HEZB 1C08B 1YECL 3RWCA 12E8H 3AC0A 4M1CD 3OGCB 2V9TA 3KWWA 2VWEE 3P4NA 4HAGA 4IIQC 4HF5L 3CX5K 2PTUA 3L5XH 1CT8A 3OX8A 2OMNA 2FX9L 5DZLA 3D39D 4UDUB 2FECI 2DWDA 2R2CA 2DYPD 1QKZH 1CD0A 4P5KB 4POUB 5D5MB 1UH3A 2FEEL 1LGVA 1JK8A 1S7TA 1P7QD 4OB5L 1QACA 9CGTA 1A3RH 3VA6A 3CK0H 3ZT5A 3JVGC 1Q9LA 3VGAC 3FFCD 3ISWA 3HZKA 2FZ3B 2NTFA 3L95B 3D2UD 3MLTB 4LKXB 5K9JH 2R2EA 4P59L 1V3KA 4OZHE 2F8XC 4NWTH 4NO3A 3RWJA 1H3TA 2Q1EA 4M5ZH 4Y8AA 5EU4B 2Y5TB 5GSVB 3L3DA 3LQAC 5HPMB 1CL7L 5EUOF 1TZHB 3KPNA 5ENWA 5IEKA 3LMJL 3OG6B 2OJZL 1I8KA 1QFWH 5LGHH 1ZVYA 1CFVH 2DQGH 5ACLA 4UT7H 4OCLC 1ES0A 5I1EL 4DGYL 2Z93B 1JI2A 3EOTH 3GRWL 4RAHA 4A6YH 4M1GL 4UDTA 3ZHDA 3ET9F 5E4EB 5CBEB 4L4VD 1IC1A 3LKPB 4H0GA 4EDWL 1ZA3A 2VH5L 3DVGA 5IESL 1IQDA 4S1SL 4YDKL 3T3PE 1WFNA 3TA3A 5CCKL 3QEQD 4I2XB 4HUWA 3PNWA 4JFOB 3IDNB 1MJ8H 4F3FA 1R5VA 2ZJSL 1KCVL 3KAAA 1XGYH 3IJYB 3M8OH 4FFYH 1AI1H 2APWA 5KG9A 1H3VA 3LEXA 2GITA 4APQC 5KZCD 4Y2DA 3S36H 4FP8H 3WN5A 4V2BA 1INDH 1HXYA 4HIJB 3M17A 1NFDA 1TQBB 1I3RB 5INCB 3PWPA 1RUAH 4P23C 3KPOA 3MCLH 2R69H 3O8XA 4YHML 3B9EA 4OCSL 4ODWA 2PO6A 3U0WH 1N6QL 5EOQH 3DX9B 4KK8D 3WIFB 5GRVK 4GG6F 3C8KB 5FM5M 1I3GH 1SJXA 2NY6B 4GW1A 4MXVF 1PD6A 1PG7L 3CC5A 3KYAA 3GIVA 5HI3C 5F7DA 1I9RL 5CKAA 1QVOA 2R2BB 3BDXA 4NHCH 4YE4L 3HE6C 2DDQL 4GW4B 3RGVB 3L3HB 3GKZA 3ZE1F 4FQHB 4CVZA 3FCTA 4PLOB 4K7FA 2AJXL 2CRZA 5JXAH 3DURB 5FO9B 4JG0H 2NZ9C 4RAUB 4QGYA 4K7PY 3HHRB 4NZJA 3SJVA 1JPFB 4AT6A 1KG0A 4MWFA 4X7DC 3MV7A 4OCYH 5GS2D 1JWMB 3F12A 3HMXL 3MV8A 2AI0L 5H2BA 2OTWB 1ZT4B 1HCFX 3MSPA 2JJTC 2D7PA 2FH8A 4KTEL 4X98A 3QEUB 3ZYZA 4C58B 4AMKL 3O3UN 2JJSA 2WZPD 2H32A 5C09E 3HLAA 3P11L 4P3DA 1LEIB 1ZLSH 3VXUA 2G75A 2EE3A 3HE7A 1ZLUH 3QXAB 4LLUB 2D9QB 1AGCA 4R0LA 1GAFH 5CJQH 1TZIA 5CSGA 2SEBA 4CNIA 3U1SH 5IV2B 3TT3H 1Z0NA 1CGYA 5TF0A 4LL9A 5D1QA 1FFQA 3VCLA 4U0RC 4Y4FD 1LP9F 5HYQA 43CAB 4KKNA 1JN6A 4LLWA 3QQ4B 4YFLF 3I84A 3DSNA 1JRHI 4ZXBA 3QXDA 1MCOH 4PV9B 3U79A 3EOYG 5DR5H 3BIKB 4ZUWB 5DVLA 4YZFF 3BRFA 1KCRH 3EYOA 1JGDB 2MOVA 4PJ9D 1DJSA 4OIBA 3B3IA 1KC5L 4YUEL 5D70H 5JNYB 4OLYH 3QNXA 3TIDB 4DKDC 2XWJB 3VFPB 4WUUB 1YPZE 5AYQA 1T83C 3SKOA 1A3LH 2UVFA 3O3DB 2GSIA 5IWLC 4L9LB 3DROB 4K2UH 5CEZH 4ZFZA 1N0XL 5B4MD 4I0PB 4LHUD 5CSBA 5D7JD 1RK1B 1JPTL 2DTSA 2ENYA 3TO2B 3MNZA 2C7UA 5TDOA 3U7AA 4J4PD 5GXBB 1KB9J 1D5XA 2MKLC 1IEAB 4FQIL 1LWRA 5HI4D 4KVNH 1T7ZA 3OKKA 3KYKH 3P4OB 1JZ8A 5C07E 3P0VL 5DD0L 2BNRA 1NH6A 1TVBA 3GJFA 1J1PL 3WIHH 1UB6A 2EIDA 4NPYB 5IJKA 2ARJB 1J12A 3CSPA 4HEPG 2YXFA 3PF2A 5IR1B 2BSRA 2DOCA 5I8KH 5IBLC 2A74A 5KSBA 5I6XB 4ODXB 3LS4H 1XGPA 5C9KA 4P5TD 5EN2A 5KS9A 4XMLH 1U8NA 5L2KB 1K5NA 3VW3L 2G9HA 4OT1H 5DMKA 1MELA 1A47A 1PKQB 3SPVB 1FNAA 2BSSB 4WHTB 4ZS6C 5F7YC 1QFWI 1FVDB 2XPGA 5FHBH 5E0QA 5DGQA 1FNSH 2PETA 4NZRL 3D3VE 2DN7A 4PYHA 1MCPH 3V6ZA 4FMFA 4BQ6A 1TETH 5ERWA 3CLEH 1E4KC 2V9QA 1IC7H 4XP6L 4QRRB 4JFEB 5F1IA 4BM7A 2X4SB 3EO0B 3REWB 4F7EB 1GGTA 4PJ8B 1VDGA 1IEBB 1JGLH 4KHTL 5T5FL 4JN2A 5CGTA 1S78D 4M43H 3T0EB 3SKMA 4UBDD 3LRSB 5E9DE 5HYSA 4NKOA 2EC9T 3DUSA 4HH8A 5L88H 5M94B 5DRNA 4R4NC 4QRTA 1FGVL 3MODL 4GKSA 3SDYL 1GGCL 4IRSA 2DLIA 1E6JL 2GUOA 3QIUB 4XRCA 4EKXA 3UBXB 1P4BL 3W5NA 1FL6B 1JHKH 1S7XA 3T04D 4BSWB 3TC9A 3OKOB 5C3LD 3RWHB 3WXVH 3RA7H 4CL7A 1RJZA 3VXMA 2VITB 4C4KT 4HG4J 1JGEB 4X8JA 4Z7UE 3CU1A 4QXTB 2FLRT 3MBXL 3VFTB 2GTZA 3W9EB 3R8BB 5SWQB 5JHLH 5GGRY 2V7NA 1IGJA 2ED7A 2IC2A 3QQ9D 1YQVH 3TLRA 3MROA 1W0WA 1NGYB 4YHZL 1F4HA 1PVHA 3T3MF 5IMOB 4KI5E 2PKDA 1Q0YH 1T03L 2R4RH 4FQPA 4QRPB 4LBEB 1RMFL 5C0RL 3I50L 1FO0B 1ZTXH 2VLKE 1T1ZA 4UT9L 1WEJL 3V6BR 4FN0A 1VFAA 1JHLH 3U30C 2WUCH 3I6GA 3RI5K 5C07D 5L6YH 1CLCA 1I1FB 1Q94B 2A6DB 4ONFH 4F7MB 4Z7WE 5FA4A 2VUYA 5I1IL 1OAQL 4PJDB 3G04B 2BY0A 1D5BB 1PKOA 2H1PL 3BKYH 5F88A 3WL9B 2FD6L 1WZMA 4G7YH 2R4SL 4P0DA 1ZHKA 4GQ9L 4RFEB 4Z0BH 3TZVD 3ZKQD 4BZ2L 4R9HA 3N06B 3LQMA 1UB5A 3FN0L 4U1SA 4HMDA 4MCZB 5E24E 4D0DA 4PGCB 3Q6GL 5DI8B 2GSGB 5BZDA 3GBML 3EFFB 3PXHA 5E2TL 2P5WD 3NIGF 1QQDA 3D3VD 1K8DB 3IFLL 2I07B 3EOAA 5F7FA 1DLHB 1BOGB 1G7JB 1A6TA 1IL1B 2Q6WB 5I73C 4GAYA 3MUGB 1RJCA 4O2CB 1NGZB 1BJ1J 1ONQA 1XGQA 5K9KB 1NFKA 1J0HA 3FOMA 5E00B 4I2XE