1D7CA

Cytochrome domain of cellobiose dehydrogenase, ph 4.6
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
190
structure length
190
Chain Sequence
ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLOBIOSE DEHYDROGENASE
publication title A new scaffold for binding haem in the cytochrome domain of the extracellular flavocytochrome cellobiose dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 36
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 1999-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1d7cA00
1D7CA 1PL3A 1D7DA 4QI3A 1D7BA
chains in the Genus database with same CATH superfamily
4YSQA 4JKPL 4NQEB 1JZIA 1I8MB 5HYSB 3V4UH 3HS0A 2IPTL 3VXNA 4F20A 1RK7A 1SMAA 4L8DB 4W4OC 1U3HC 4U1LB 4P5SA 1SHXA 3OD3A 4GB9A 3Q44A 4IYKA 2EXYD 1R3HA 2O6EA 1SQ2N 6TAAA 1U8QB 2BVQA 2GC7C 4DP1X 1RULL 1LO3H 2ZUSA 4PMFA 4PJFF 3BUQA 1CVRA 1LQBC 2WCSA 5IMKB 4PJGF 1Q4NX 2K78A 3P30L 3CFUA 4FG2A 1JZJA 1QI5A 2HFEB 2RGSA 4JHAH 2ICEA 4KK5D 2DWDB 3CH1A 3F83A 2OMXB 4JFEE 1ZHNB 4GRLB 1BZ7A 4K7PY 4XAWL 4HS8L 4V1DE 3MNMA 4XPGL 4M7ZB 1DE4B 3HLKA 4J3WA 1KLGB 2EC9T 1TLMA 3LNHA 4FCAA 3WNNA 4MKTA 3GK8L 1AP2B 6PCYA 3UZVB 1ZTXH 1JZHA 4JG1L 1QASA 4K5PA 5JXAL 1HIML 1XH1A 1LD9B 5I71B 5FV2A 3LB6D 5M7QA 4G59C 1E4XI 3GSUB 4Q9CA 2NY1C 4M7JL 4QRRB 4JFPA 3S8GB 1FI8C 1OHQA 4OB5L 1OSZB 3QIUB 4DIXA 1NPNA 3DETD 4QUOA 2N0KA 3LXUX 2DBLH 4PJ7B 4GW5A 3ZRCC 2VXTH 4WFED 5ADPL 5F9WC 3DURA 1XCXA 3KXFA 4ZX4A 3NZUA 1QSZA 4OLXH 2HSIA 1O5PA 5E1GA 3QNXA 3FAWA 2XPGA 5HVHB 5I6OA 3N43B 4LCCC 4M43L 3UTTD 1MDTA 1RD6A 4OLVL 3FONB 3TFKD 2XYCA 5IFHL 4FTVA 1UXWB 4NWTL 4K5LA 1FWXA 1TZHB 4FG6C 5AOKA 3BCFA 4WENB 1ASPA 1ZV5A 3L2NA 4LQ1A 2JKNA 4E9YA 2ITDB 1U2HA 4K94L 1C7TA 4AGQA 1GMEA 1SEBA 1JPGA 4DKAA 2HG5A 1I7UA 1XX9C 4P5TD 4PRPD 1UWYA 5DD0L 3QXDA 4WWNA 3QQXA 2KZBA 3IGKA 2HUEA 1V3MA 3VE0B 4DT2A 4ZSOE 5HPMB 3N91A 3MODH 4G8EB 4KI5E 1EH9A 3CN3A 3QI9B 2EUZA 4YHNB 2FIKA 3NEXA 4KXBA 5E1AA 1R17A 4YAQB 3MRFA 3QJFB 4HWBL 1MW3A 2ICWI 1UT9A 1CIUA 4J6IA 4RDBA 4Y4FA 3TV3L 4Q9QH 2V8LA 1F4XH 4FQQA 4E9RA 5DD5L 4HUVA 4JREB 2ZF8A 4O02A 4MNHB 4OGYH 5ANHA 4ZXBD 3GGWA 4HUUA 3RVUC 1OT1A 1RJZB 4F1SA 5GIRA 3QJOA 3O3BB 3TO4B 1QFWH 4H8HA 3DROA 4W9ZA 1NUDA 4NQTA 1ZVSB 4MJIB 1CZ8L 4X5XA 3M1OA 5MP6H 1AG6A 1HU8A 1UQSA 3BWZA 4XGZB 3GT6A 4LAJH 1EO7A 3HG4A 4XN4A 4G9FE 2MHAA 3OSVA 4BQCA 2EEBA 5EZOL 2WAQA 4I0KA 1SHMA 2AXWA 3D69A 1S8DB 1KXTA 1R3JA 4D8PA 4QNPF 4KX8A 3DTXB 3HB3B 2WQRA 3WKQA 4UIKL 1P2CB 5KBNC 4TULL 2VDKL 4NT6B 2K4AA 5JW4Q 5F7FA 4PJCE 2RCSH 4L9LB 4RQQA 3V2AR 3K2IA 4F2MA 2DQFA 5HBBA 1ZEAL 5FDYA 5LJYH 2WYZA 2DWXA 1CICB 2PXYB 1MY5A 3DI3B 4L37A 2WZ0A 2IOMA 4RFEA 3B8YA 5IK3A 4ZMWA 4P5TA 1E42A 4PRPA 4V33A 5KS9E 8CGTA 1FJ1A 4F24A 4C8XA 4X6EA 2B1HH 5K9QG 3F7VB 5H94B 3PWPD 2APTA 3EJSA 4K7PH 5E95B 5FYLD 5IB1B 2OMTB 4YFDB 3RILA 3LNGA 2N1TE 3ZE0F 5I1AA 2OW7A 1NCIA 5I26A 3F85A 4PM1A 2B1AH 3U7WL 3WNPA 5EU7C 4MKMA 4UINL 1KIUB 1BOGA 5TGBB 4EUPH 4ZNCD 4WFGD 5FUZL 1OP4A 1PZ2A 3EJYD 5IUCA 3WIHL 4EZJA 1HINH 4AWJC 3S9DB 5J6GB 4FEMA 3TEYA 2CRZA 3DXAD 1B88A 4O2EA 3CFCH 1ZA6A 1SDYA 2A38A 1FUNA 1M42A 3MRNB 4LF3A 5E99H 1TUPA 4PLJC 1KEGL 1ECZA 1ZT1A 2YPVL 4F5CA 4EI5C 2NOYA 1IFHH 1PMYA 4FFYH 2A9BA 3QK0A 1HWHB 3KLKA 4MAYB 4YE4L 4TVPL 1ZSDB 2KI6A 3B2UD 1A1NB 1IBGH 1W0YT 4KO7A 3GSVB 1J0YA 5I18L 1EJOL 2LV4A 3C08H 4MHHI 1EMTH 4HGWB 4KUCD 1T83A 3GXFA 1RZFH 5J6SA 2EAEA 4ZQKB 5BZDB 3E1F1 3PWUA 3MLTB 2EDLA 4H40A 4TUOB 1TVHB 5EFIA 5HGBA 2ZCZA 2V8MA 1U91B 3K0WA 4KJYA 4L3AA 3HC3H 5KYXA 3FB8A 3IMTA 1D7BA 2E27L 2AEQH 2AXJA 3PNRB 1KBVA 3RWDA 3PDGA 5H2BB 1QACA 1SOQA 2FAUA 2ZYSA 5DEFA 3NCWA 4FQJH 3B5HA 1IUZA 1NCNA 2A6KA 2ODIA 2BM3A 3S3SA 5EPMB 2WYTA 1K4DB 4TV3A 3RNKA 3W9DB 1K6QL 1AZNA 3ETBF 3TEXA 2QADD 3UACA 2ITEA 2VH5H 5E8PA 4KDTC 1PZAA 5T1MA 2LAGB 1RL1A 5HI5D 2WQ8A 3FO2B 3AU1B 5T5NF 1SMDA 2C9QA 2BOLA 1U8JA 1G7HA 3RA7L 5IJVA 2VW4A 3GRWH 4OUUB 4LP8A 5BRZE 5F7NC 4KUCF 1ZA3B 1D6EB 3L5IA 4R2GB 5IMOA 2P7TA 4UUJA 1HEJC 1KT2B 4I89A 4OZFA 5JW5B 2A83A 4XWOC 3UAEA 4UANA 2Y69B 4Y5XC 3T3PB 2MNWA 3T8VA 4ZMTA 1CXIA 1KPUB 2UZYB 2ALWA 4PBWD 4PJ9C 4P9MH 3BVUA 3EH2A 3ZLQC 3EJRA 4TPRH 3ZTNL 2AJXL 4XCCH 5JQ6L 1TSRA 3M8OH 3G5VA 1WK0A 4UTBH 1OARL 5I76A 2XPZA 1G1KA 3QULB 5C0IB 3DJZA 2JI1A 1KJ2H 1JDCA 2N7SA 2WXIA 3GMOA 3HFML 3PWVA 5I0ZA 2GBAA 2XY2A 5INCB 2X2IA 2WNWA 4FQXB 3RUGF 5DD1H 2L8AA 5C0RL 1U8OA 2MJWA 1Q8MA 3V0EA 4AENB 3KYMB 1D5XB 2JKTM 1UZ6F 2CUAA 1AVAA 4MA3B 3B7UX 3KMDA 4PJBE 2YAEA 2XJLA 5TD4A 1QAWA 1XIWC 3VVWA 3ZDZF 1ID2A 2QGBA 4X98A 5E8OB 4YE0A 1TENA 5HHXL 1E67A 3CHRA 4BKTC 3VD4A 5E9AA 1UJ3A 4MAUH 4GKSB 3UPCA 4Y8DC 5GS0L 3MBWA 3SQRA 2J2ZB 4NRZB 4D7BA 2D7TH 4O9HL 3OG4B 5HVWA 1GYAA 1BG1A 1RVFL 2W8CA 4OZ4A 4PSRA 5I8EA 2X4RB 1TJXA 3FPYA 3N2JA 4N5ED 5KSAB 5D1ZC 1NKOA 3K2KA 1SOKA 2Y7NA 1GGBH 2JJSA 2V9QA 4LZKA 5DK0A 4QXGL 3MOAH 4KVNL 3EFFB 3ULSA 5EIVA 1P84J 2JVUA 4GW1A 2F7OA 5DQDH 1DLFL 1ES0B 3FC8A 2BIQA 3FSOA 2V9RA 3VW3L 4KFZC 3STZB 1CFQB 5IHWA 3P4NA 4N0UA 4KTDL 1RUML 5F3BA 3ARZA 2P24B 3X11B 1TFHA 2XTJE 1PZ5B 4S1QH 2HLFD 5FPIA 4LSSH 3SDAA 1M57B 5BW7A 5BO0D 1AIZA 4OCMC 3VSQA 4OAWA 4IK6A 2VLLA 4JFFD 1AQKH 5EBLB 5MENB 2VLKA 2NR6A 5ALBL 3BGAA 4E41D 2UVEA 3P0VH 4GKZA 1TKWA 3GIVA 3U79A 5GSVA 1PIGA 2V7HB 3AS1A 3ILQC 3VYOA 4DVBB 4Z7WB 2DBJA 2YSTA 4NN7C 3LZFH 5LQBH 3BRDA 4AKPA 4X5WA 3LAFA 2XRAH 3I9IA 4ZZKA 1YYMH 1FNEA 4MAZA 4QTIH 1C5CH 1DJWA 4GIPD 4XNUH 4Y1AB 3LXBA 1F3JA 1IGMH 1ZV9A 1QMUA 1YY8A 2YPKA 4F15B 5SV3A 3SQBB 3V6ZB 3O9WD 3QA3B 5SX5K 1HE8A 2QZQA 5E2UL 3VGAB 1RJLA 3MA9H 5A16B 3LNEA 3P2TA 1JZ7A 2PWFA 3O4LB 4LSQH 1XGQB 4Y7OC 4B5ZA 3JSSA 4XTRD 2IEPA 2HG0A 4JRLA 4P2YA 1VFBB 4PJ5E 2IALB 4PRIE 3W0WB 5AOZA 1UD5A 1WV7T 4L05A 4JUSA 2ATPA 3RPKA 5KSBE 3MBXL 1KEMH 4GIOA 1S7VA 3MX0B 1QW9A 4JO1H 1N3NA 1OALA 4L4VE 4IBYA 1MZYA 3ULUF 1IKFL 2JELL 1JZ6A 3N6YA 1E27A 1MHCA 3FCTA 5CN2A 3AROA 2R2HA 3IDXH 5DURB 4RA3A 1EHXA 3MYJA 3UBXB 4N26A 1QSFD 1P9MC 3MTRA 4QF1B 4X0NA 3OKDB 3DK0A 4U6VL 4UQDA 3MUGA 4F7CB 3FO1B 4E5XA 1HNGA 2I9TB 3VXMD 4LCYB 4JFFA 4NAJA 2YD7A 1NCUA 1Z66A 3MLUH 3DGCR 5AKVA 5I8OL 2XYBA 1Q9WB 5E9NA 3LMJL 3ZKND 3ATEA 3UIYA 1MNNA 2WQWA 3SY0A 3UZEC 4E9TA 1QWHA 3L3DA 1KJ3H 2MH4A 5LAXA 4KKCD 5EBWB 5DS8B 1T1XA 3QCVL 1QQDB 1S3KL 1EHAA 4GMSL 3DX9B 1HL4A 4AQOA 3TZVC 2BCKA 2GEEA 4FOMA 4XR8C 2ZYHA 1RERA 3VO0A 3S88L 3TNNB 2VITB 4L8SA 2CU9A 4QOKE 4R96B 3GMPA 1WIOA 1XGUA 3IAPA 1OAUH 1UOVA 2FQFA 3L7EB 4I9WE 4P23B 4J8RA 2X4UA 2DRUA 3FNKA 1E3FA 2ZXWB 2E9IA 4LHUB 2V33A 4ZFZB 4ZUTA 2Z7ZA 4HWBA 3FFCA 4QXWA 3TT1H 3P9LB 2X70B 2QQNL 3L5WB 1H8LA 4BFRA 5DUPL 2IWGA 1S9VB 1G9MC 1XT5A 1E28B 4CILA 3HR5B 4AEHH 3FU5A 4KKBD 5MEPB 1A0QH 4UQ2B 4HV8A 2E74C 3T77A 5IQ9B 1JYNA 4ELMB 3ZDYE 3C8HA 3F58L 3L3KB 3EIFA 5FCSH 1FCCA 5L2JA 1R3LA 5EF3A 4TVPD 1WIUA 3OR7B 2EDJA 4JN2A 4J3OG 3DDFA 2JV6A 3G08B 3WIIL 1UM6L 1AQMA 3U6XS 1T2QH 1UCBH 1MJ8H 3RTQB 4XXDB 3LPGA 35C8L 4HEMA 3DX0A 3VXMA 5DMKB 3UTQA 2CGRH 5DO2D 3PFUA 2DQJL 1Y6KR 2AK1L 5E08H 2XXFA 3SBWC 3VJ6A 4YOKA 1CN4A 2H6UA 4EN3C 1M05A 3GZOA 3MV7E 6FABH 3CVHL 3ULVF 3FOMB 3KBPA 1A7BA 1MFNA 1B4JH 2G2PA 4HMDA 1PZ3A 3MJ9L 2NX5E 2ICWJ 1BBDH 2VGLM 3DUUB 4Y4HC 5D71H 3RFZB 2I5YL 3L4UA 3LIZL 2QGDA 4YHOH 4FZEL 2ENYA 3L3OA 1X5GA 2N7AA 3W39A 2FLBT 1ZKAA 4XN2A 4LK4A 4D9QE 4XC1H 5T3XE 1MCPL 4JG5A 3EFOB 1FNLA 2JKJA 3BSHA 3P11H 3SYCA 1VENA 4MCNA 1O9VA 1U8KA 4XP5H 5JIQA 4JY4B 1LK2A 5CHNA 4JCLA 1J1PH 1T6VN 2LU5A 3FKUS 4Q0XH 4JKWA 2YPLB 2E6QA 2PW2A 4BQ8A 5J11B 4QHLB 3VD0A 3NJGA 1MF2H 4PJFB 3QWOA 5CXPA 2IANE 3B3BA 2AXFA 4IU3B 1KB9K 3U0TB 4C4KT 5JHLH 4PJGB 4B27A 5F7DB 4QCIB 2E4TA 1WRFA 2YKLH 1E3XA 5B8CA 2VLJB 4JO4L 4WUUD 4IGBA 1QFWM 5L88L 4GSUA 4M8RA 1Y0LA 4GXVH 2BIHA 5I6XB 4X6DF 3L6FA 1HEHC 5BJTA 3D8MA 1VFAA 4UM8A 1UB5A 1KDJA 3VVVA 3O11A 5C0JB 2UX6A 3N40P 2PO6B 3DVGA 3HZVB 4WLCA 1Z5YD 1S5HB 2GW5A 2ZSVA 1ET8A 4KJQD 5DC0A 3BZEB 3ARWA 3POHA 3FZUC 1WZAA 5DRWB 3PAVA 5L7XH 1I8LC 4C47A 2DQTL 2Q7YA 2FE0A 3CTTA 3EJUA 3OHXB 4N6QA 3WFCH 4HIXL 5GS0D 4X6DA 4ZW5A 5HGHA 3S34L 4RDQF 3OM3B 4XB7A 15C8L 3IJHA 4MQ7A 1OO2A 5JZ7C 5BV7L 5DO8A 5K59E 3IB4A 5D1XB 4IRSD 3DTUB 1J9QA 4EVNA 5CJ8A 5GGUA 5JYMA 1ZLWH 3IJ8A 3RGVC 1WT5A 1CLYL 1YPZF 2QQQA 2D3NA 1HESA 4DEPB 2ZKHL 4ZX3A 5CJXA 3VD5A 4FQHB 2ZUWA 1KGUA 4GNKB 2ZXEB 2F8OA 4E42A 5CM1A 1MFEL 4URKA 3W3BA 1F2QA 3L3GB 2ZCHL 2PP7A 1OGTB 5FW8A 2YBRB 3DPDA 4P4RB 3DHPA 3BIAX 4A7QA 5T8IA 4P2RD 3UABA 1JVOA 4AH2A 3EFDL 5CJQL 4I0PA 4KC3B 2WYIA 3MR9A 4J3XA 3L4TA 1Z7JA 3L9YA 4CBPA 2ZXAA 4N1HB 1KPVB 1YPZA 1QVOB 2E6JA 3IPFA 4WUUA 5I19L 2JJTC 4I3RL 3BVTA 2V5TA 3PP4H 4ZX6A 3JVFC 4TL5A 2R2BB 2AV1B 3MO1A 2EDXA 2QEJA 2AEPL 1UXLA 3FCSA 2J88H 2C5DC 3N41B 3OPZH 4FA8A 1IM3D 4F8QA 1U58B 1WH0A 1RUQH 3NJLA 5LGHH 5IOPA 3L3HB 4JFDB 3L54A 3MDJA 4TF4A 2WKLA 1M6OA 1BMWA 2DW5A 3GSNL 4PJHB 3SO3C 1JTOA 4UWQB 1EZSA 2FL5B 4JDEB 3T0VA 4Y2DD 1QUNA 2PMZA 3PF2A 3UL4A 3MBED 1TJMA 3IMBA 2XN2A 4N1CA 1CL7H 3H3PL 4IJ3C 2Z93B 2QKIC 4B9CA 4HU8A 1A4JA 1KZQA 2A4ZA 3HBGA 4DZBB 2YOCA 4GKNA 4YSRA 2VJXA 1MIML 4N2MA 2YZ1A 2UZXA 1A9VA 2JKIS 1DBJH 1NCDH 4F92B 2TSBA 3WNJA 3NFPB 3FTUA 4H1LH 5CLZA 1V7NH 3K3QA 4W9GC 2KT6A 4YDVA 4JFOA 5EN2B 5G2NA 3C9NA 3PQYD 2OJ1A 3S36H 1Q9OA 4BH8A 2GFBB 4ZFGL 4JN1L 5ESVA 5FA3B 4W9KC 2LW3A 2BNRB 4HQQL 4W9IC 1AHKA 4YXLH 5IV2B 4H20H 4OF8A 3D39A 2IDFA 5JHAA 2HTKD 4P2RA 2UY6A 2DL9A 4Y9CA 1H15A 5EZJB 3ECQA 4DGYH 1NMCB 5IEKB 2AITA 2FX7L 4X6CE 1U8CA 1XR8B 4MHHG 4JM2C 4QYOB 1U93B 3L95A 5KJ7E 5J6HA 5EOCH 1HHHB 3B3IB 3HC0A 1U8PA 3N40F 5DI8B 3HTLX 1A7OL 1M3IA 4A2LA 3AADB 4XMWA 2R0WH 4N0FA 3VFUA 4OTXH 1IM3A 1CXLA 2YQGA 4HFUH 3L7FA 4JB9L 1OAQH 4EZKA 1QFUL 1X44A 1D3CA 1WBZB 3MXWL 1HQ4B 3NZSA 5FHAH 3NABH 5C3IA 2E76C 2E59A 4Y2OA 3CHOA 1KN2L 4OCXL 4Y5YC 1WBXA 4CVZB 4JRFA 2KL6A 2XY1A 5D6CA 3MLZL 2WOYA 3MBEA 4YHKH 1JPTL 4KHXH 3H7LA 4NN6C 3BE1H 4CL7A 3MLWH 1V3JA 5CIPH 3BEWA 1RY7B 1OWRM 1JPFB 2CIKA 4FL4B 3T4AC 1CDIA 3MRCB 4BK8A 1WTGT 4M7LL 5C0BB 3DO4A 1T5WA 1KGYE 3IFLL 1FZMA 4NO0A 1U8LB 1WFNA 1RZKC 3ENEA 2V2TB 5KBDA 1RUKL 4OCRH 2XWZA 1NIDA 2DQUH 2FLRT 2VDLH 5DZNA 3VFWA 1SOSA 4GQPH 3MRLB 3X14A 3IDGA 3P4LA 4BHUA 3RYMA 4YSUA 4R90L 3MRJA 3WUZA 5HDQL 4RH4A 3TX4A 5CP3H 4NJ9H 3BKJH 3QEQD 2NY1D 5AQ0A 5DWUL 3ZKSD 4OZIF 1HXYA 1UZ8A 5EO1A 5D4IA 2HX9A 2DQDH 1J05B 1D7FA 1YDPB 1EJFA 3UERA 1I8UA 1NCBH 5I8CA 2OTWA 3DX6A 4WI2A 1S7XA 1VGEL 1E4KC 2CMRL 5IB5A 1HQRA 2BCMA 4HS6B 4JFTA 1GGTA 4RETB 4TSAH 2BVYA 3MUUA 3ZT7A 1U3HA 3SDXE 3ZE1E 1MAMH 4A04A 1YMHA 4LNRA 2GYSA 1DBKL 1F45A 4P2QA 4FG6D 4KTEH 1RZGA 4GQZA 4OZIA 1FHGA 2ALAA 2XI9A 4OCLC 2ITCB 3NCBB 3P73A 3BAIA 1RURL 3WY1A 1IQDB 4L4JA 4XMLH 1QBAA 3K6SA 4X0KA 1BVZA 4GO6B 2V5YA 5ACLA 1Q0XH 3QVAA 4ZUUA 4QLWA 4JG0L 1RHHB 5MEOA 4HKXB 3V4PA 4FQIH 1PVHA 4DVRL 5GGVL 3EYVA 4XP6H 3MCKB 3T8XB 1UA7A 1J0ZA 3CLEH 1QBLL 3RUGB 1OGAB 4CC0A 5CAYB 5BVPL 2YMXL 4P57A 1H0DB 3OXSB 4PP1C 1A4KB 1CFNA 1UD2A 3FYEB 3RVUD 3ZDZB 4N2BA 1OAZH 3A3YB 3IFNH 3F5WB 5EG6C 5KTEH 1IO4C 1AH1A 3QEQA 2X89D 4FFVC 1T7VA 4FABH 2CO3A 3TA3C 2K8QA 2OMVA 4HUKB 1TQBB 2AMGA 3CU7A 1F5WA 1D7CA 3T0ED 3X13B 1MLBB 1I7RB 1DQDL 2W91A 2Y3AA 1NA8A 4GAGL 4KK6C 4DNLA 1L6PA 4RNRA 4UAOB 1AMYA 4PLNC 1JS4A 5EO0B 3EYQD 2DJSA 3GSRB 2AJZB 3D0LB 5C92A 2YQ3A 4OSUH 4LCCA 3RJOA 4OT1H 4IOFC 1UVQB 2W94A 1RK0A 4JGMA 5DZVA 1FL6B 3VI3F 2E8ZA 4B9YA 3W37A 4JL2A 3Q06A 3VSTA 1HKLL 1CXHA 4OFYD 1X4ZA 3A6CH 5JLZA 3EJJX 1VADA 4PLOB 1N19A 4Y19D 4HHAA 2VLRE 32C2B 3QQ9C 2VOTA 1INDH 4XODA 2DH3A 1LMKA 1R33A 3QORD 2O5YL 3JV4B 3MJ9A 4MCYB 1ID5I 1I4FA 4QRPB 2EO1A 1VZIA 4L3ED 1QSEE 1JRHL 2QPEB 2EC8A 3GEWB 3U36B 3BSZA 4HCRL 3EYUL 2L7JA 3GLEA 2KQMA 4HMEA 4ADGA 3REWB 4LKCB 2GJZA 5I24A 1A4AA 4JPKL 1JTPA 5FB8B 1EGJA 3QDJB 4QHNB 1YJDH 4XE0A 3WSQH 1G9ML 1BJMA 4HIIA 5C0BE 5DJDB 5ACMA 1PAZA 2Q20A 5JTWA 4FI8A 1J5IA 1BAFH 3QUMA 4IKNA 1C1EL 3KPQA 4LB8A 3U0PB 4PLJD 1GOFA 4ANVA 5FO9B 1IAKA 3TFBA 4JRXB 3PHQB 1EVUA 1GHFH 4FULA 1G7LA 1I7TB 4PV9B 4YDJA 3BLBA 2H1LM 5G55A 5FYKH 3SOBH 1NM4A 4PW3A 1SM3L 2BNUB 1AKJB 3TBVB 3DKHA 3IFOA 3MNVB 4WU5B 1I1AC 1P4IH 3QDAA 1D9KD 1JGVH 2KC0A 3QDGE 2R8SL 1ZT4A 1KTLB 1XGPB 4HPYH 3MREB 4Q2ZA 2VAAA 1PF3A 1CK0L 4PRBA 1IT9L 2QL1A 4RRPG 4Y5VA 2BSRB 5G5DB 3V7AE 2CGZA 4DN4H 4EXPX 4IBTA 2J12B 1U21A 1J9SA 4LEXL 4AL8C 4KY2A 2WLJA 2M83A 4ZW8A 1UKSA 3P69A 3LKSB 1S78D 3O3DA 4K23L 4PS4L 4C56A 2KZKA 3WO4B 4AMWA 5E1HB 5L6YH 3UMTA 3QYNA 4M48L 3ISWA 5C6TL 1VCAA 4YHPA 4JGJA 1QSVA 4DO6A 3SCMC 2ARJA 3BKCL 1TJHL 2KPWA 4PTUA 4L3EA 4ONOA 2PWEA 3MROA 4TL4A 2P8MB 2Z8WC 4IRJC 3I3EA 4M6OH 4D9LH 2GTQA 2GIYA 2QQKH 3B2VH 2NY4C 3LHAA 1YECH 4PN6A 1PKOA 5EUKB 4ATTA 1JMXA 1CLCA 4NRXA 2XQBH 4DK3A 4QRQA 4XWOD 4KDWA 1SJHA 2CRIA 3KM2A 1DANT 3AWGA 4PJ9D 1UT1A 3NJFA 4WWID 1XR9A 1XHHA 2BLFA 1BMZA 2O5ZH 3LN4B 4EI5A 3V0VB 1A47A 3BWUC 3FT0A 1TZGL 4ZAKB 1ZLSH 3SE9H 5TK2A 4WWKB 3GS0A 3LKQB 2A1WH 4WHTB 1QYGL 1EIBA 1O7DC 3BGMB 4FLSA 3VFSB 1CF1A 4G1MA 3WUWA 3VFOB 5C09D 2OMZB 2J8UA 4U6XA 3QUZB 4FMKA 1KC5L 2JKSA 3OMZA 1RK1B 3QUYC 5DRNB 4JY5L 1Z3RA 2VQ4A 4PB0L 2NY6C 2UYLB 4Q14A 4F7EA 1J5OL 5EZPA 3L3JA 3GUTA 2HUHA 4KVPA 2V2WB 4LGPB 4OJYA 1I7ZB 4PRHB 5GS1A 2XSKA 3OGCA 4KZDH 3APCA 2XU9A 5LWYL 2HKHL 1NFKA 4FXKB 2BX5A 4Q4EA 4MB4A 4UV7L 1NDMA 2AJUH 3ZYJA 2EYSA 4TRPH 5DZPA 4XPAL 3GSNA 3ZHLA 4I18C 4CA4A 4K3EH 3UO1L 1YEWA 3QCTH 5I74C 4KDTA 5L2KE 1EEZB 4ODVH 1B0GB 5D1ZD 1ECYA 4FERA 5CIPB 4G82A 4YVNA 1XSOA 1WAPA 2XCMC 4X5PA 4PD4K 2ZNWA 4HFWB 5DC4B 4TLUA 2YMTA 3CIQA 3L9RA 4XWGL 1SF5A 5IKCA 4ZW3A 4XN8A 4DGWC 4RMTA 3NIGF 2FNWA 25C8L 1XZWA 1OTUC 3KNBA 4CUCA 2G9KA 5E8EA 4V2BA 3O2DA 1ND0A 4Y5XA 4CU7A 3DV4A 4PJ9A 3OHMB 5LGJA 4KV5F 1ODAA 3BGFC 5DTFB 2P44B 3HKFA 4AG4H 3RNQA 1DL7H 4J3SA 4UDUA 1MG2C 4M3JA 4NFCA 1WZLA 4JNXA 5E6IC 1R0AL 3W81A 4NAMA 4ADJA 4BCYA 4G6KL 3FS9A 5F96L 4RCAA 3T3ME 2YGPA 3AXLB 1KTDA 4Y0GA 2IBZY 3BX7C 2X4TA 2JCCE 1AC0A 2GSIA 2A6JB 1K2DA 3QR2A 1L0PA 1IBFA 3WXVH 4LP5A 4DP7X 3NJMA 2C9SA 1W0VA 2EIBA 1ADWA 3A6BL 3JV6B 4AVIA 1VERA 2D31A 3U2IA 2FYYA 3OV6A 1WGVA 3PXHA 5AVSB 2XQYK 5ALCL 2PTTA 1SHWA 4J3TA 1KSRA 1XIWA 4PG9B 2GG1A 3RDTC 1UH2A 1MWAB 2HAZA 3DDGA 2I9LB 2DJ4A 4PJEF 4Y16B 2E56A 4LLYB 4UQ3B 4ONFH 2ADIA 5CKAA 1KV3A 1KLUB 5F7AA 3S37H 1GRWA 1WFMA 3ARBB 3CBRA 1TOXA 4AYBA 1E8YA 3KEDA 2VXSH 3VFTB 1MCRA 1N70A 3JZYA 1SGKA 3JT2A 2XN1A 3A67L 3OJDA 5E6YA 3T04D 4AQ1C 3NJVA 4PI2A 3U30C 1A2YB 1HZHL 1DEEA 2XBTA 4PJEA 1TU2A 1MH5A 4S2SA 1YEJL 3WFEL 4AM0B 1L6XA 1HH6A 2FLMA 2ZKXA 4O00A 1ESOA 1ED3A 3MUZ1 2PTUA 4OLUH 4HKJB 2YRZA 4N0YH 3GNMH 4NB7A 1RUAH 4G6JH 1KB5L 1LO2L 3W38A 1OF0A 3G6JA 4PGBB 1DVXA 5KANI 2KZ1B 3HG1E 4GUPB 3BEVB 3V4VB 4EQ2A 4U1NA 1Z5LB 1A6TB 2R4RH 4M6NL 1ZS8A 4M4RB 5HDBE 2VSCA 1RHFA 2P48B 4JFED 1F1DA 1SFDA 2R56L 1RIHH 1KCRH 3OKEB 4ZPVA 1CFVL 5DRXA 3MGTA 5D6DC 5AYUH 4YBLB 2BOBB 4GAJH 5A7EA 4NWUL 2FIRT 2OX5A 5L4FA 5GHWL 3TF7C 4Z23A 3BVWA 1R3IL 4MQSB 2ETWA 1TYRA 2JF1A 4FQLL 4HD9A 3FRUA 3ZHDA 4AYFB 3NIDF 1DSYA 1PD0A 2WNKA 4D0DB 5E1QA 1N2RB 4QRUB 4WIQA 3U9UA 1FVEB 1KCVL 5ISZB 2IV9A 4HJIA 3TZVD 3UPAA 1FFPB 3FOLA 3WMQA 3RVVC 3NBNA 3AC0A 3HRZC 1D5MB 5IB4A 1UA6H 2YGQA 3RURA 1SJEA 1FZJB 4XNQA 5EUOB 1PY0A 2ZP9A 3AJ7A 3QWNA 2J1KA 2I07B 3QZWB 1RZKL 1GS7A 3E3QE 1VEMA 2BVPB 3FULA 5EU5B 1P7QD 4R4ND 2EKSA 4HCIA 4YEEA 3PGCA 2P43B 5C08B 3WG7B 3PV6A 3IMSA 3CDFA 3I9GL 1HCYA 1YMME 4U1JB 1CT8A 1XGYL 1T66C 1BA9A 5KSVA 2OQJB 3TBBA 1SN0A 1ZANL 4LL9A 5AYTA 3ATFA 4GBXB 2J7LA 5D7HA 4XMVA 9PCYA 1JNHA 2ZKWA 1JD9A 1N4XH 2W0FB 5BOJA 1MCOH 5T1KD 1KIRB 1P9MA 1YEGH 4KI5D 4KBPA 1EBAA 2FO4A 4NP4H 1QLFA 2OR9L 4U2ZA 4BFIA 3NSCA 4AK1A 4NENA 1N59A 5EC2B 5K9JH 3HVNA 1YEFL 2DH2A 2JI2A 3TV8A 1AFVH 4I4WA 1QZ1A 4L8BB 5LKNA 1MCFA 3UTZB 2V6HA 3MV8A 3MQIA 3EDFA 4JFYB 4HZAA 5EU4B 3B2DC 5SWZA 2BWIA 5I1EL 1P6FA 1DBBL 1EEYB 1WZ1L 2BRRL 4HK3J 5AW0B 3UZEA 2VJ0A 1ZT7A 1J5DA 1NQBA 3HNVH 2VDPH 3L4XA 5DYFA 4P5RA 3ASWA 5SV4A 4JVPA 2BSCA 1FA4A 2J5WA 1B2WH 4LCWE 4PIRF 3TZVA 3VXSE 1LO4L 4OLYL 4FNLL 3CVCA 3BAYA 4NDMB 4X7FC 5BMFH 1A7PH 3ZQWA 2BZDA 4G9FD 3FMGH 4G8IA 2CUIA 4Z7VA 3HE6C 2IGFH 3W56A 3X3FH 3Q5TA 3IMVA 4LLDA 2FWUA 3L4ZA 1H8SA 5FYKU 1P7QA 2VUKA 2AGJH 3V4UL 3NCCB 1CDCA 1M3JA 5C0CA 2VDOL 3W9EA 1G7PB 3G7TA 2FWOA 2CM5A 2LTQC 3E2HB 5D1QC 4R84A 2BNQD 4JDTH 3NH7L 5CR8A 1KNOB 3D85B 5LG1A 2BHYA 1DQKA 4LARH 5E24E 3RZCC 3CXHK 3MFGB 2IVFC 5HYJE 1NBZB 3CUPA 5GRZA 2Z31C 5T1KA 1P5VB 2VB5A 3IGLA 3HZKA 4JQXC 1EQWA 2J43A 5TDNB 2GI0A 4FMVA 4DP2X 1ZSHA 2ZSWA 2W65B 1ZK5A 5EZLB 2DZEA 4F7TA 3ELQA 4R0LB 5AW9B 5HYFA 4YPGA 1Z5HA 5HGDB 3RWJB 1BHGA 4WV1C 3ZOAA 2G5UA 4XRCB 3VACA 4PS8A 1JGDB 4NAQA 1XF4B 3QQ3B 1B2YA 1KB9J 4M61B 4EN3A 2H3NB 8FABA 2WGXA 4MB1A 5CEXA 3V4LA 4JRYB 1R5VA 3FZUD 4K0OA 4X80H 3US0A 4HIHA 4C83B 3R8QA 3TS8A 5L8LB 4Y4HA 1H6EA 3ZKMC 1KZYA 4X99B 1D2OA 2NLJB 3OKLB 1NAKH 2EH8L 4QO1B 5I15H 5B22A 1X6LA 4F7MA 2VR7A 2RBLA 5JZ7D 3MGOB 4JFQA 4HULB 4FKEA 3P3YA 4KI1A 3TEUA 2B7DT 3RGVD 4PJCA 4OZHE 2MQ3A 4YZFF 4YL4A 5GGTH 1IGJB 3ARDC 2F58L 3LKOA 2GTWA 2XA8H 5K5YA 3DHJA 4NZTH 2BNQA 4JFVA 2GPZA 4PJIF 4PR5B 3S2AA 1SXZA 4X4XB 3MZGB 2G3MA 5GQBA 3FSZA 4LESA 2DMHA 3Q2CA 1T0MA 2AK4E 3J2PA 1F41A 4EMZA 2WJ5A 4MCMA 2D9CA 5D7IF 2EYRB 1YN7B 1BIIB 3AAZB 1P5UB 3B9VA 5T3XL 5I6NA 2DI9A 4X6BA 4Z7UF 1A65A 3WS3A 5DA0B 5IVXE 1M7DA 1IJ9A 1JUFB 3KE0A 1JZGA 3VG9B 5ID1A 5DFWH 5CWSB 1MFVA 2PWDA 3IXTB 3EO9H 2H45A 4AV5A 2J57A 1KXHA 5BRZD 3QH3A 4GPVA 4BZ2H 1MJ7H 4PJIA 1RZ7H 5FYKE 5HYQB 4L18A 4N8VG 4AL8L 5K9KB 4EAEA 1SXNA 3C5ZC 2X4PA 3UPRB 1X3DA 1GW0A 1FCGA 2OK0H 1W8EA 1F4XL 4EKJA 4XNBA 1S9WA 5CD5D 5KYNA 2C1PB 3HMXL 3NACL 4JCMA 2YOAA 5FWQA 5MI0B 3TURA 2ADYA 4OGYL 5FKAA 4AQ8C 5FLUA 5CU5A 1RKRA 5SWSE 4Z7UA 3WJJC 1ETJA 1FC1A 1REIA 2BP8A 2OTUA 3CFMA 3QIWB 4I2XA 4ZUWA 3TYFB 4BZYA 4DPRA 2X4SA 1F6AA 1YEHH 3PDDA 1ZK9A 3VSUA 3RKDD 1G7QA 2A4CA 3VD2A 3QJHA 3CDYA 4OCWL 5FGBC 3LS5L 2GJ6E 4ZRGA 1UWXK 3GQFA 1F86A 5GJTH 1E9PA 4DH2A 5IZ7A 2H1PL 4NPYB 2F53D 3QQDB 3RGVA 3VI3B 3HAEH 3QIBC 1EHLH 3FRPB 4IS6A 2IAAC 1PX4A 3J7HA 2XA3A 4N20A 4WDIB 5HHOB 2ZOKB 4AVHA 3HNSH 5TFSL 5MEQB 1NWPA 2F5AH 5HHPA 1K4CA 3MRBB 4H88L 2WW8A 4ZO8A 1GS8A 1MI5A 1Z1WA 2A9CA 3KDPB 4ZJ9A 1S7SA 3CZSA 3PHOB 4LHQB 4X9HA 5CILH 3P4OA 3L13A 2GKIA 3II1A 4JGUA 5IIEA 5JNYA 3KPPA 2KDYA 2ZG3A 3WE6B 1DVZA 1XGZA 3KM1A 3QUXC 3KCPA 2B1HL 5CGMA 4JM2D 4ODHH 2JJTA 1MIEL 1KTJA 2CH8A 1PG7H 1LDPH 3Q1SH 3V5KB 4BKLB 5LN4A 3F05A 4JCWA 4M62H 5AW5B 3M88A 4UYQA 3IYLW 4BKSC 1BP3B 2XT1B 2H5UA 1G7MB 3BVNA 1QFWI 1CE1H 5I66B 2SEBA 5BS0B 2YUXA 1G9NH 5I1IH 2R1WA 3L3IB 2Y22A 4UMSA 4PV8B 3SE4C 4QXUH 2IWFA 3TXAA 2UZIH 2NY2C 5E99L 4AQEA 2WWKO 1NC4A 1H5BC 2EACA 1MWOA 4PJXE 5AEAA 4FFYL 2QKIA 1SJMA 5I8KL 1PYWA 3FT2A 3NFSH 1IC1A 4MS6A 3WNLA 3WLBA 5D4HA 2WBJC 2R4SL 4J3OF 1XCTB 1FZOB 3FQWB 3ZBMA 2QSQA 5DJ0A 2D9QB 4HPHA 1KFAL 2F53A 3TT1L 4YXKH 3NZHH 2WPGA 2DS4A 2UWEE 3BXNB 4JM2F 5EWIH 3SY6A 2VZVA 3F65A 3VXRB 4WJ5A 1XL6A 2Z7YA 4GSRA 1J8HB 5BZWA 5ICYA 3WL9B 5JDJA 5K1NA 3QZOA 2B59B 3FQXA 4WTQA 3BP5B 5IESH 3U82B 4GY4A 5IBUB 4XVJL 4XBEL 1R1CA 5IJKC 2X3AA 4FQJL 3MOBH 4JBSA 1KGIA 4TTGA 4NQSB 5C07E 1FHNA 4PYHA 2B15A 1RZ8B 5ICXA 4PJDF 1F11A 1BGXH 3LV3A 4JM2A 1S7UB 5EBMA 3PWNA 3HPLA 3UYRL 4PJ5D 4V2CB 1IEBB 1NFDE 4YDZA 3EOAA 5FAAA 1OZUA 5HP5A 2X4OB 4FP8H 3MUHL 1NSNH 3P40A 3IGUA 5JHDB 1MCHA 4O51A 4L4VD 5C6WH 4NM8H 2VDPB 4XPBL 1TTUA 3FB5B 2NXZC 3BD4A 2OCFD 4NX0A 1E30A 1SN5A 4Y5YA 4PJDA 3FT9A 1FG2B 3FTXA 4P9ML 2JTYA 3D4YA 4N9GA 4JO8A 1FL5A 5FKPB 2WINB 5A6MA 3NN8B 4IRZH 3KPSE 1NGZB 2DLEA 5DYOA 2E8YA 1SLVA 2R0ZH 4QDGA 1QI4A 2CG9X 2H26B 2Y1AA 4O02H 4BH7B 1R19A 3KR3L 3FCUB 4G71B 2BXZA 5CN3A 4BFNA 1JF1A 1AO7E 1NC2D 2G9HB 1G9EA 4AXWA 2VQ1B 1G6RH 3Q3GA 1CGYA 1MJUL 5DDHA 5L0QC 5KYUB 4FFVD 2P80D 3TA3D 4LEOB 4WGKA 1XL4A 4LCUA 2EEDA 3IJSA 1H6TA 3NDZE 3OKMB 4RX4D 3VH8G 4R7DB 3B4NA 4K71C 4F3FA 1T20A 4J1UB 2VDQH 2WLKA 4FYQA 3H42H 1E4KA 1BZOA 2X9WA 4TNVK 2AC0A 3VG0L 4NUJB 2OFQA 3UC0H 4LASH 3O6KH 2BP5M 2JQMA 2X4QA 2VRQA 3P2DA 2XWDA 4UMGA 2W07B 3MOAL 5E1IA 1ITCA 4Z7NE 4GSXA 3CCHB 1FNAA 3D18A 1GYWA 1IM9D 1X5HA 1RFDH 2G75A 3QEHA 2R2EB 4G7RB 1JV2A 3QQ9D 1YUKB 2D3JA 3G6AA 4N3UA 1PW3A 1SEQL 3HHMA 1P1ZB 4Q6IA 4PREA 2K6ZA 3IMRA 3O45B 5C71A 1X7TA 2DQGH 5I30H 2F6AA 3TBYB 3HC4H 3CC5B 4F7PB 4PJ8C 5DHXB 1AGEB 12E8H 1NEZA 3ILPA 2DIEA 3VFMB 4WO4A 4L1SA 3H9SD 1G87A 4E0RA 3IRPX 4V11A 4MBOA 4P5MA 4MA1B 1IB5A 2YFOA 1NC2A 2WSDA 2AAVA 2V9TA 3VXUE 1W72L 1AQKL 3A21A 2YD4A 4FQ2H 2I60H 2QDWA 2J5LC 3MV7D 3P0VL 2E75C 4FQ1H 2VDMH 3FUIA 4BJLA 2R7EB 1B0RA 2IIJA 4KJPC 4HKZA 4PWEA 5BVJA 3Q2NA 5JORB 2P80A 3IKKA 5GRUL 1YYML 3TA3A 4NKIH 5F6HJ 5LB1A 4XNUL 5EU3B 2YARA 4YDNA 2QSTA 3N0AA 3C6LB 1IGML 5E2VH 4FHKA 3GHBH 2X7LA 2FSEA 3IGAA 3LS4L 4RX4A 4D9QD 3QR1A 4L29A 4GAYB 2F1EA 1TPXC 2XN9B 1QD0A 5T3XD 1I1AD 1FVCB 1SDDA 4U7KA 3TNMB 4HIEA 1LXMA 1EFXA 5D5MB 1F3DJ 2CPUA 3RKPA 2ATKB 1CFSA 4BGLA 4LSQL 5F88A 3VTMA 1C5BH 2LT9A 1S7WA 4FXLA 4MDJB 4TQPA 3GO1H 5AZEH 3QO1B 4PVLA 2WGNB 2W88A 1IM9A 3GJFK 4L4TE 5I75B 3CSYA 1U41A 3PDOB 3PRZA 3ZSTA 3MRPB 1M7IA 1PNDA 4KJWC 4K55A 1A3LL 2BO0A 3SCMD 4AZ8A 2EDMA 3ZMEA 2E6PA 2QR0B 3HN5A 2H0FA 4YO0B 1LILA 4OZFH 2CUHA 2R0LH 3H9SA 4QIRA 1QO3A 1VB9A 4RWYL 1NL0H 3BPNC 3D5OF 1UB6A 5HHQB 4M7KL 2NY4D 4N2GA 1R5WB 1HN1A 1N0LB 1HXMB 4JHBA 4P9HC 4OGXH 1IQWH 4K8RH 1T89C 3MLUL 2AKRB 1JZFA 3S96A 1N8ZA 3BUYB 4X8CA 5IMLB 2IAMB 4XCNB 4BFOA 1GZQB 4M8UA 2Y5EA 1KJ3L 1UXSA 2ROXA 5CEYB 4MLSA 2YEZA 1C5DB 3M1CA 4IMKA 3SKMA 3VRIB 4I48B 1JGEB 4RMVA 1UCTA 1UT2A 1NEPA 2WLMA 4JLRB 4JY6A 4PY7A 4IBQA 1HZLA 1FRGL 1RV6X 3U6XA 2CHWA 2XKNA 1QFOA 1I1AA 5FEBA 1L9TA 3QUYD 3O6FA 1WCBB 5D55A 2A73A 4DERA 2NY6D 3M1BA 2JB5H 4NQDA 2KERA 3KW7A 1GYVA 3NSFA 5IHUL 1E5CA 3FT4B 4JHVA 2DB8A 2YA2A 1DDTA 2HJFB 2EH7L 1OHZA 4TN9A 2P52A 4PGCA 4FD0A 1CFTB 3OKNB 3X12A 3QAQA 3HMXA 1YJDC 1JHKL 2VMJA 3BP7A 5KVDE 1IC5H 3VXTA 3T2QA 3D25B 4NQXB 3HUJB 3SEPA 4YHZH 4HX1A 3L4VA 4JMXA 4FKKA 3PP3K 1E4WL 1I3GH 3BWUF 3CZFA 5KW9H 3TBTA 2VXVL 4G8GA 1AGBB 4F57H 2VO5A 5I73B 1AS6A 1GMIA 1LO0H 3GLZA 4IRJA 1X5FA 3S35H 4D2NA 1MFAL 5E9DE 2O30A 2X0VA 4LOUC 4XMKH 4APXA 1S9XA 2M1KA 3ZE2E 4A7GF 3C60C 2KKQA 4DTGL 3RWEB 5ENWA 3QWRD 4M93C 3VI4E 3D2UA 1OTUD 3QJQB 5IQNA 4OJFL 2V3FA 3VU1A 3ARYA 1SRDA 4X2UA 3DOSB 3FH8A 3WGUB 2E3VA 2DWEB 1KWKA 4UT7L 2FO8A 1V05A 3NMEA 2F7IA 1HI6A 4WHYG 3K72A 5ILTH 4GRLC 1E4XH 3RWCB 3HIZA 4JKPH 2CLVA 1PPIA 1VA9A 3GBNL 4PD4J 1BBDL 5E6ID 2IPTH 4YH6A 3QDHA 1ZJAA 1YRKA 4M7ZC 5BUGA 5I1DB 1I8KA 2DYPA 1GGIL 3UGUA 1PJ9A 3GBDA 3O8XB 2GT9B 4YPJA 5TDOB 3M45A 1W9XA 2IFGA 3QUYA 1P53A 5KZCD 2YD8A 2VL5B 2KLTA 1ZVNA 2NW2A 2ERJB 1I7UB 1RULH 2X6AA 1NBYA 4APQB 4FC3E 2CKBA 5KSUA 4ZMLA 1VGKA 4PJAE 1S4IA 4OQTA 3RDTD 4ELDA 5BUPA 1AQHA 3QIUC 4UDTB 1XZ0A 2OYKA 4L2LA 4Q0XL 2FIKB 2H3XC 1NIEA 3P30H 4NHUA 4UT6L 4KMQA 1EXUA 2ZXGA 4XAWH 4X7SL 4XMZA 1MHHB 1AXTH 1FYTE 5DJ6A 4I18A 5I0WA 4HS8H 3MLPA 2HCZX 4D0BB 4XPGH 3WEXB 2VXUH 3BIBX 1IVTA 5J56B 4ANKA 5ESAB 4HUWA 2Y7SA 3BQUB 4MMZB 5GRJL 1HHJB 1R24A 4O02B 5IB2A 1KV7A 1BV8A 3GK8H 2ZUXA 1VACB 3OG6B 1QRNE 1J48A 4JG1H 4LMQE 5F93C 3MTXA 5JXAH 4OD2A 1DJGA 1HIMH 2PYEA 3QWRA 4NEHB 2YR3A 2DM4A 3CFEA 3H85A 4GP8B 3KLHC 1E5ZA 4M7JH 1X4YA 3H9HB 3RVTC 3D4CA 1P4LB 1G6RB 3SGJC 3HE7C 1J0IA 2E4FA 4MMYA 2MHAB 2ZOWA 1A66A 1KTCA 5DK2A 5GRXG 5KJ4A 5ADPH 1N6QL 3P77B 3ES6A 2DY2A 5CP7B 5E6IA 5EOTA 5EHFA 3UTTB 3F7LA 5HYIA 3VD3A 3ULUH 3P3UA 4M43H 4YEFA 3MJ8B 3O3AB 4OLVH 4AYEC 4BFJA 5F1KC 4RQQB 3LTVA 4F8OA 4NWTH 3G5XA 7PAZA 4AE1A 4L23A 4JHWH 4NO5A 2J1YA 3GM8A 3ARUA 2XKUA 4KQ4L 2QBWA 4WFFE 4K94H 1R5IA 3H8NA 4P5TB 4KROC 2ENSA 3U1SH 3OVUB 3BRGC 2FHCA 2OCJA 4WW2B 4KK8C 4Z7OE 4KVCL 3H4HA 5DD0H 1ETZB 4QJ3B 5CBEB 3HBZA 2MTPA 3NK4A 1TETH 2EDEA 4TVUA 3RVVD 1YUHA 4YVUA 1CG9B 2NZ1A 3VXQB 4DSYA 5D7IB 2P1YA 5HJDA 5J1AA 2OYLA 1TLKA 3HB3C 3MLSL 2C4FU 4HWBH 4N6RA 3HN3A 3TV3H 3QQ4A 1DQTA 4L9LC 4FYSA 5DJXB 3L5JA 4OVVA 4B3VA 3ZDXF 3LRMA 3QPKA 1CICC 5DD5H 5LNDA 1CVSC 4ZXBB 5HY9A 5D7LA 3PP4L 2C1OA 1EV2E 2EVGA 4DO4A 5I17A 2P5EA 1MHEB 1ZT1B 3BUPA 4UIMB 2CSPA 1T66D 3PWLA 3KPOB 2J88L 4OZGF 2WN3A 4PGZA 3B9AA 1AXSB 3MRRA 5IGXL 5LDUA 1G43A 2XQYG 4AEIL 2M26A 1BVNT 5KUMA 3MVSA 3RB7A 4EZLA 4N2OA 5EZOH 2HT3C 2GY5A 4JO5A 3PWUB 4OKVB 3VD9A 4A55A 3SDYH 3KXFE 4UIKH 5D6DA 1BQSA 1LLAA 1LYQA 1M7XA 2YS4A 3FB8B 3KPRA 4TULH 2G30A 3JZ7A 5E8NB 4QHUB 4OZGA 1ZEAH 4NRYA 3RY5A 1NCDL 1XF3A 3P9MB 4FTVE 2OMWA 5I16B 4KAQL 3HI1A 3IDMA 3BWAA 2A6KB 3GYRA 4K15A 4ZFFA 2APWA 2IQAA 5FO7A 1O75A 5DMJB 4MAYC 3VFGL 4DFIA 4I1NB 2AQ2A 4PGDB 2WXLA 3RVXC 1BPVA 3PWPB 2PYFA 2X2HA 3CFBB 1LEKB 4MRBA 5HI3C 3HRZA 4H20L 1QLRB 1BQHA 1EANA 2B2XL 3ULVH 1S6NA 2XZCL 4MJ5B 4QD2E 5KG9A 2Y5TB 5DJZA 2CDFA 2C8NA 3FBQA 3RJDA 4K3JL 2HRPL 1MCQA 4UINH 5FUZH 1AI1L 3T1FB 2OI9C 5HHNB 3DXAB 4JKKA 3EF7A 1T1YA 1LEGB 3ECVA 5GPRA 1IL1B 4PG2C 5B38A 3GRGA 3I9AA 1JP5A 1ZHBB 3FFDA 2VLRD 1GZHC 4YE4H 4XMXA 3TF4A 3KPNB 4L3CA 2XWCA 3D3VD 4X50A 5C0NC 3S4SA 3RZCD 3KYKL 1P6WA 5DHYA 1AHWB 1S3RA 5I18H 1EJOH 1CL7I 2BSBA 2LAAA 2XFXA 4AC2A 1HE7A 2Z31D 5CMAA 5KAQG 4ES9A 2B9BA 5D96B 3TCLB 2EIZB 3VSVA 3LKNA 1DSWA 1N26A 3Q6FB 5FECA 3BE1L 4J3BA 2LLNA 2QPDB 2LU7A 4R2GC 3UTSA 2MKLC 1XF2A 4K5NA 4ISVB 1CBVL 3SKNA 1HH9A 2BPBA 4MGXA 4EUPG 2E27H 4GS7B 1RSFA 5BZZA 2GBTA 2YAOA 4KNQA 1II4E 3QJTB 1URLA 4HXAH 4LVOB 5JIKA 4F2ME 1Y07A 2TRYA 3CXHJ 2WUBL 1A6WL 5GRVK 4OCRL 2VDLL 4A38A 4R8WL 1IGTB 3F04A 4FS0A 1AZVA 4U0QB 3W5MA 2AABH 4AJWA 1K6QH 4ENZA 4XE5B 4U1MB 2NZ9C 3RGBA 4NJ9L 4PRPE 3ZKMD 3AY2A 4AGPA 3FFOA 5H37A 4FQXC 3QJSB 5C0AD 4QNPE 1J86A 2C7UA 4XNYL 3HE6A 3K81A 3ULSB 3M17A 3RA7H 1J9TA 1YA5A 5F7EL 2F8XC 4B95C 3FQUA 1BVKA 1NCBL 3WFHB 5F7UA 1OP3K 3QDGD 2F1BA 2W92A 3QFJB 2OS7A 3L16A 2LLGA 3AREA 4L8CA 3DSFH 3NA9L 5GGSY 2VUYA 2CBQA 4XT1C 1HAWA 3M07A 1J9RA 3ARDD 4TSAL 4R5XA 4HJTA 4AQAB 5D1QA 1DFBH 1UHVA 1MAML 2Y72A 1MW1A 5FLVA 3IDNA 4KTEL 1VIWA 1C7SA 2AJXH 4Q74A 5JQ6H 5DJYA 3MRQA 1OARH 3D3VA 3NIFB 1KTBA 1CLZL 3RZCA 4F5CE 3K5SA 1TEYA 3CMOL 3ZE0E 3B6SB 3HFMH 4MB5A 4OAWB 5I6KA 2RFXA 3GZPA 4BK5C 3EG9A 5C0RH 1DQLL 2XG4B 4NNYA 4M3KB 1O6SB 2FUTA 1YHPA 5I5RA 4JPIB 4ORGA 1ZGLB 2X1PA 3CLEL 3DSNB 4A6YL 5C0FA 2VKXA 1IIKA 4FLOA 5DR5H 4WV1A 3C5ZD 4AT6A 1C12A 2Z64C 2WBWB 2VR3A 4M56A 1F3JB 2FX8L 2IADA 3P1VA 2P8PB 4NUGL 4TSBL 5DMGC 5T5FA 1YY8B 5HHXH 1TQVA 1ZY9A 1A6ZA 5F1NA 4KTYA 4HT1L 5I6LA 1CFMA 1NDGA 2R2CA 2WP3T 5GS0H 4CN4A 2HX7A 4HJ0C 1ACYL 4RGNE 4O9HH 2OXHB 3ZRSA 5I1CL 1RVFH 3E9TA 1HC1A 1WWAX 1I3RA 4FABL 3L81A 4PCKA 4K7PX 3B7TA 3VQMA 5C0AA 3VAEA 2NSXA 4YXHL 2OP4L 2BVOB 3IWVA 3MRGB 4QXGH 4TUJA 4UNIA 1KN4L 3CVDA 3QPQD 4KVNH 4UTCA 5F7BA 1AZCA 3SZKC 4ZMXA 3R4RA 3CPLA 4YSOA 1FN4B 4P9HL 2NCEA 1GOGA 3B56A 1HHIB 1N3NB 1NOFA 4M8QA 4RESB 4R26H 4WK4B 3ZR5A 1SMOA 3QIBD 1LO5A 5E5LA 3V8CA 2ICWB 2C3VB 3N9GL 3O2WH 1E5UI 1HXKA 5IB3A 3MRMB 3GMNA 2IF7A 1Y18B 4GLRI 4ZPTB 4GQ9H 3A6CL 2BY2A 1E9QA 4L0PB 4QJ5B 5ETUB 4G3YL 1MAKA 2OAAA 1XB8A 2EDHA 3QS2A 2VDNB 4N8UA 5L2KD 3NZ8A 3DIVA 4CVXA 2CUMA 2R1YA 3QUXD 4E41B 4HH9B 4H26B 3IXAA 5DSCB 2LLLA 3PPSA 2XVGA 2PPFA 1E7VA 4PMEA 1G84A 4XCYA 3IFPA 4HWZA 3DO7B 2KBGA 1UURA 3EH1A 4EI6B 1T1XB 4WZ9A 3IJ9A 3C5ZA 1MJJB 1JGUL 2BCKB 1PFOA 3LRGA 4PP2B 5EDSA 3O9WB 1YJDL 3FF8A 4HK0A 4P2OD 3EJPA 5I1JL 5E7FA 4BCZA 3EAKA 4AQ8A 5E0FA 4W9HC 4X8JB 2NY2D 1ZWIB 1WEJL 4FA7B 1X9RA 3APFA 1KXQA 4BQBA 3VWKB 2UZPA 2OW6A 2IQ9L 3AITA 2WLIA 4PRNB 1BZ9A 3SBRA 3JTSA 1OCWL 4UT6A 1DBAL 3LZPA 5FGBA 1PIFA 2IH3A 4JQVC 2X2YA 1FAIL 5FYKL 1AQDB 1UZ6E 3AABA 2A6IB 5DEGB 2WBJD 2CZNA 2L3BA 4HDIB 4PH8A 3H0TB 4RWHA 3B9EA 3R19A 2CO2A 4WI0A 4QR7A 1NCWH 3MBXH 5ID0A 5JIDA 2EQDA 1P7BA 3EO0B 1ZAGA 3AVEA 2A74A 3QXAA 4QHMA 4FFZA 1FVDA 3QIBA 3VRLF 2VMEA 2HFFB 5F1IB 2JQZA 2OMUB 1IKFH 2JELH 5EIIG 1TJIH 5AW7B 1KCUL 1QSFB 2NNAB 3PAYA 1CTMA 1T2JA 4N0UE 3C2AL 2XDHA 4P23C 3KL5A 2BSTB 5KVGE 4NERA 1ASOA 4Z78A 3RWIB 4Z8FL 1DJYA 4LFHD 4U6VH 2NSMA 2NNRA 4PTTB 3SDCD 4HJUA 4ALAH 3IETA 3BJ91 3PXJA 4NUQA 2DN7A 2Z4QA 3UTQB 4HKBA 4BFFA 5C9KA 3FQYA 1NCOA 1FGVL 2Z35A 1JPST 4XOCA 1T0NB 3HHSA 3LMJH 4MZ3A 3S3JA 3OB0K 3P4MA 2VDKB 3PABB 2VLKE 5FO8A 1OF2B 4D9LL 4XBPA 1W6WA 3NYKA 4LPTA 1PG7W 1A9BB 2XZZA 5I2IB 2QQKL 3DGDA 4NQCD 3S5LG 3B2VL 3QCVH 1S3KH 2JKWA 4GMSH 4QHKI 1VAHA 3PL6D 3TJHC 3FSVA 4Z7QF 1WF5A 3GMQB 1SYSA 3PIQA 3SPJA 1WLHA 3S88H 2NXZD 2ED6A 3HG1D 3KJ6L 3SE4A 2XXCB 1Q9KA 3VRJA 3P2BA 3U4EA 3DV6B 3PJLA 3VM5A 5KN5B 1H5BA 4GG6F 4QT5B 5AVQB 4CJ0A 2LOEA 2J73A 3GMRA 4FJYA 3DC0A 1U8KB 2P4AB 4YGVB 3U0WL 3ELAT 1WQVT 1EHNA 3UAFA 2BW5A 2WBJA 1IAOB 3REVB 1JNLL 2QQNH 4KXCA 5TJWK 3VFPA 5TE7L 3L17A 3MLVL 1XH2A 5DUPH 1WICA 1CGSH 3QWOB 4LVNB 4KX9A 1ZCRA 4ZQTA 3TOPA 2CM6A 4Z77B 3T09A 1IBYA 2VR6A 3LKRB 1Y6MR 4GRMA 1KTKE 3BQVA 4F2EA 1AD0B 3EO1B 3ZYOA 5A2KH 4P46B 3F58H 1EK3A 5ADOL 1F6FB 2F2HA 3CZUB 5M95B 2F54B 1UM6H 2XZAL 2GSGB 3HPJA 4H25B 5GRVL 2ICEC 3VFNA 1VFAB 1FZKB 4XNZB 1E9OB 35C8H 3TJEL 4LLUA 4MLIA 3QCTL 2OYPA 4ZDHB 4JRWA 4AKOA 2DQJH 5B39A 1QA9A 5AB0A 5K9OB 2AK1H 1BVLA 3SIKA 4I0CC 1YMMD 2H9GA 4JFFE 3GJFA 5ERWA 5BZXA 5J11C 3FN3A 3PGFL 3QNYB 3CVHH 2V2XA 1U8NB 2EIKB 3ULUE 4ZUVA 2IGTA 3HI6L 1T4KA 4NQCA 5CCGE 1D5ZB 1QFPA 1CI3M 2DLHA 3MJ9H 2P26A 4Q4IA 4RSYA 2I5YH 4PRAB 3LIZH 4FZEH 2YAFA 1BXAA 1AIFA 2IDSA 3JTTB 1U3JA 4PWJA 2CNYA 4UNTA 4DP4X 1URZA 2K4WA 3WFDH 3ZTDC 5I6XC 4PJ8D 1U3ZA 1JYXA 2FATH 5DRZB 3CJJA 4GEIA 5J1TC 1BFVL 1UM5L 1HHKA 1EA9C 1NFIB 2UX7A 3ESVF 1WITA 2H41A 1KBGL 4M03A 3DVNA 1FGNL 4GRWF 4GG8B 5A6IA 1B4RA 2ZTBA 2P5WD 3FFCE 3L08A 1PQZA 3O6LL 1HCZA 5FO2A 3T6XA 3ECBB 2FR4B 4MNGA 4NNXA 4R7VA 1FPTL 4GI8A 4JO2L 1CCZA 4KJPD 3OHXC 4LCWD 2MKWA 5HJ3A 3DUSB 2P9RA 2OL3B 4OCYL 2AQQA 2J71A 5C8JA 1XSKA 4MD4B 5HDOA 2IC2A 1XGTB 2K6WA 1IBZA 1RMFL 5EU6A 5IM7B 4JO4H 4XVUC 1A9EB 1N5AB 4PRDB 2C9XA 3LNFA 3TVMB 1MRFL 5ITFA 3D4ZA 1OQXA 1E6OL 1NBQA 2ZG2A 4LGSB 2VXSL 4UZSA 1I1YA 3FUDA 4XVOA 1I75A 3QYMA 2Q86A 3EF4A 4UOW0 4MD5A 4HEME 3VXME 4XN1A 2LVEA 1S7RB 2VZSA 2DDQL 3TONA 4E9SA 3SB3A 3SJVB 4WK0B 3F12B 2DTMH 4M00A 5AAPA 5AENA 4CGTA 2CDEA 3DJRA 2DICA 2DQTH 4DOHE 4NFDA 2GVYA 3OR6B 4OLUL 5HYJD 4HIXH 1G7JB 4LKXB 4KJWD 4G6JL 2J72A 3JWNE 5FA4B 4Q9BA 3WJLC 3S34H 1A6AA 1NGXB 2Y25A 2WXNA 3DX7A 15C8H 4IRSB 3H53A 4PJ8A 2FJHB 2R4RL 3FU7A 2Z8VC 1JWMA 3ZGHA 1MNUL 2DJMA 43C9A 2RA1A 1CLYH 3KBHE 1BQRA 1BQUA 1RIHL 4POYA 3K7UA 2ZKHH 1G4RA 2Z4TA 3QUHA 2COQA 4CKVX 3ULVE 4LCVA 1MFEH 2P5WA 2ZCHH 3RZWA 4M9OA 3T4YB 3CQFA 1NFAA 3QO0A 1KBKA 5CJQH 1TCRA 3WTUA 4A66A 1HJBC 4XN9A 4WGVB 3TBSA 2HB0A 3GZKA 3KYOB 5CSGA 1AGFA 7TAAA 5I19H 5D2LB 5DQ9A 4I3RH 3BW9A 3B8SA 3VGDA 3O41A 5JDSB 1KJVB 2UY7A 1C9SA 4WSGA 5IJDC 3HCVB 1L7IL 1LEIA 4J7RA 1Z2KA 2AEPH 1X7QB 3NGBC 4LEEA 4B0MM 1NANH 1C8PA 3VFUB 5SX5H 5E51A 3FQTA 3L7FB 1VKXB 2R9HD 5G4NA 4OD1L 1JHTA 2PCFA 3FPXA 1ZV2A 2OSYA 4KXZH 2OYMA 4M1DL 2OSWA 1KY7A 4WRLA 4A67A 3V0WL 4HS3B 3GSNH 7PCYA 2PWHA 3LKPA 4J27A 4Y2DB 2YD1A 4MWFA 2W60B 2Z1PA 1BD2D 3C8KB 3WFBL 5F70A 4GXUN 3H9ZA 2DEXX 3PU7A 4NQED 2IGLA 3H3PH 1K8IA 2CHDA 5DC9B 1OAKH 3MV9A 2JLLA 5GGRA 2VM3A 3MFFB 5GGVY 2F74B 3Q0HA 2E47A 4AZUA 1F6LL 1KYDA 4X7TA 3NEEA 2HP4A 4PCTA 5D2NA 4X6DE 4EE2A 3C5JA 1TVBA 4M6AA 4LLWA 4EDWL 1T83C 4NP4L 1BLNB 2F19H 3BMVA 3EH5B 3GLAA 2VSMB 5EEXA 2H1XA 3PQYB 4JFUA 3O2DH 5BUAA 5FYKD 4LOUD 5F7MC 1LP9F 3KL0A 5HVGB 3N1QC 2B9AA 1AFVL 3C60D 5GGSB 4WCYL 3VQLA 4ELKA 1X4XA 1NMBL 2OPCA 4JN1H 4GW4A 4LFHG 3EYFA 2EIDA 5A2AA 1KIQA 4P3DA 1A8ZA 3ARQA 1T2XA 1BOYA 1MCLA 1Q94A 3JWOC 5SWSD 4OFPA 3HNVL 3QS3A 4GRLD 4FL4C 4CADB 2V17L 5IB5B 4WU7A 4G80B 1T5XA 1HJCA 2XG5B 1L6ZA 3FQRA 1FC2D 1PZBA 3U2SB 2H32A 1LP9A 1A7PL 4I5BA 1PKQB 1E7UA 1YPZE 4WUUE 3I02A 3WYRA 4LRNL 2IGFL 3DJTA 2L7EA 4H1LG 1O9ZA 4BSWA 4JKLA 1V7ML 4KY1L 3NJKA 5JPNB 1QFUH 1J8RA 4QRRD 2L7QA 3MXWH 2H47C 5KS9F 2EUXA 5MERA 3HMWL 1URIA 5G4OA 3QIUD 3CFJA 1KN2H 2OZ4L 4NOFA 3S98A 1BD2A 2XBZA 4JDTL 1D5BA 5IW1B 3MLZH 5EZIL 4BYHA 1JPTH 5FGCB 2W81C 4NQEA 3TBCA 3WU1A 1I8MA 5HYSA 1OCZB 3G5YB 3RTLA 3VGGA 4YUEL 4GKOA 4L8DA 4M7LH 3C12A 1ORSB 3H2WA 4U1LA 5C0DB 1GGUA 3HZYA 2ZYRA 3QG6B 2W9DL 3DARA 5CKGA 5I6PA 1RUKH 4U6TA 5GJSL 1YNKL 1U8QA 3KAAA 1O7VA 2EUVA 4R90H 3C60A 2JK5B 4XB8A 2VR9A 5HDQH 1Z6JT 3UBGA 3KLHD 2EE3A 2FEDD 2ZF9A 5B3JF 4TQEH 2UVFA 2WSKA 5DWUH 3RVTD 4BRVA 5IMKA 5KVDL 4B6ZA 3HE7D 2W80C 4BUGA 4H8VA 1J8SA 2HFEA 1HSBB 1IE4A 4OGAD 5F9WB 2DWDA 2JH2A 4J3UA 2OMXA 3D39E 1ZHNA 3KDMA 4GRLA 4B7LA 3M7OA 2N59A 3N85L 4P2RE 4HUMB 5DVLA 5HGGS 2IXQB 2ZKMX 1VGEH 4PJ7F 3O4OB 2CMRH 2B5IB 3HG0A 2QPFA 2O6DA 3JUZA 1DE4A 3DI2B 1KLGA 3FF7A 1J7VR 1SBSL 2CBMA 1EAPB 2GK2A 1NAKL 2JJSC 3ORJA 2VR8A 1AP2A 3NCYS 3N43F 1DBKH 4GXUM 3UZVA 1Y1DA 2OXGB 2HT4D 5IEHB 1LD9A 4JPQA 4B9JA 4KK9C 1RURH 3GSUA 4KROD 1B0WA 2W59A 3CVHB 4KRPD 1TQBC 4H2CA 4QRRA 4KK8D 3ESPA 2FHFA 3QIUA 4BEIA 1MHPL 3PLYA 3VFRB 2NQ3A 4PJ7A 2H0PA 4JG0H 4UAOC 4OIBA 4HHWA 2BXYA 3U2JA 4QRBA 3LHPL 4HXBL 5IBLC 4RRPM 4DVRH 5GGVH 5TTRA 4PCYA 5C07D 2YRLA 4JPVL 3HB3D 1QBLH 3SDAC 2JFCA 2GJZB 3FONA 5EO9B 2BJMH 5KBPA 1UXWA 1B0IA 1TJGL 5F3HB 5BVPH 2YMXH 4NC1E 2CIIA 1TZHA 1MUJB 3ALWA 3GXUB 2NR6C 1DUYB 1DVTA 2ITDA 1GOHA 3S36X 4B97A 5AB2A 3EO9L 2GI7A 4PCSA 4C4UA 3AMKA 1MJ7L 1RZ7L 2X5PA 4UCFA 4OJAA 5IHBA 2MPVA 3T0EB 1DJXA 2OK0L 4L0ZA 5HPMA 3SGJA 4G8EA 4U1KB 5E2TL 4FFWC 4YZWA 3U7AA 1TO4A 1DQDH 3QI9A 1Q72H 4KWUA 2XHNA 4GAGH 4N2CA 4YHNA 3EXJA 2HT3D 4YAQA 4JGNA 3QJFA 3RL1B 4LRIC 3KPSD 4G7VH 3LSOB 3PGDB 1TCMA 1IZKA 4QHKJ 2ZT9C 4PJBF 1KIPB 2YK1L 2VABB 1BFTA 4MYWB 3GSQB 3QNZB 4MNHA 3SYPA 4Y19B 4I9XA 1QLEB 1RJZA 2BMKB 4Y2NA 3O3BA 5I1HL 4P2QE 2A2QT 3K71B 5FOBB 4OZIE 1S9YB 3A4DA 2NCMA 2VTFA 3CZKA 4MAYD 1PZCA 2P45B 3QORB 1ZVSA 1ZJBA 1GJWA 4MJIA 3HG3A 3LN5B 1OCCB 1CF8L 1T1ZB 3RVXD 1BG9A 2O5YH 4XGZA 3VM7A 2FJFA 1UYWH 1CD8A 4DKTA 3GB7B 5HI3D 1JRHH 1S8DA 5DHVB 3LQMA 4Z3EA 1SFHA 4LDCA 4JFWA 3DTXA 2FH6A 2Z65C 1XTMA 4HCRH 4DK5A 3EYUH 1P2CA 5BV7B 4NT6A 5F3FA 3HOGA 4XAKD 4L9LA 4XVTL 4JPKH 2QZ5A 1L7TL 3RU8L 1M4KA 4A2DA 1CICA 2PXYA 1HL5A 2ZX9A 1G9MH 1WZKA 5FR3A 1LDPL 3KLQA 2YAMA 4JJHA 1BZDA 1C1EH 1UGNA 2XIIA 1OEZW 3ZQ9A 2X1OA 4TTDC 1SHSA 3BZDA 1CDHA 4W81A 5AVTB 3BAXA 3SZ6A 3F7VA 5C0ND 3QEQE 2VWEE 4J6RL 3KGTA 3WY3A 5IB1A 3SHSA 4LMQI 4PAZA 1SM3H 3L2LA 3NTCL 5K9QI 1JCKA 1D9KB 3ZHKA 4CRPA 1NCCL 3OAZK 4NKDB 3V0JA 2R8SH 1KIUA 3MCLL 5TGBA 3NCEB 4JFXB 3L3JB 2VIRB 1CK0H 1IT9H 4TMPA 1JHLL 5J6GA 1ZTMA 3QPXL 4CN6A 1N5YH 1L9RA 2FEJA 4Y8AA 3MRNA 4LEXH 1GL4B 1OSPH 1TFPA 4OM1L 1JXJA 2LE9A 3SGDH 3TN0B 4MZ2A 4K23H 4PS4H 1QR1B 1U2YA 4ZFQA 2QTVA 3N1GC 4MAYA 4ZAKC 4P2CG 1ZSDA 4M48H 3OLIA 1A1NA 3ME0B 4N86A 5C6TH 1FIGL 1MVUB 3GSVA 1L5GB 3WBDA 1C8QA 3MRDB 3GBLA 3BKCH 1TJHH 3QUZC 5HVFB 4WKZB 4ZQKA 5BZDA 3MLTA 3QZNA 1ZOXA 4TUOA 1TVHA 2G2NA 3LH9A 3V0FA 3CX5J 2ICCA 1U91A 2WTOA 1HFUA 5AG8A 5I9QB 2ESVE 4S1RL 2FHBA 1THAA 3D51A 2E7DA 3PY9A 5GZNC 1DVFB 5T3ZH 3GBEA 5LGJB 5H2BA 5D7JD 1XXDC 4FXKC 2ZWLT 4U3CA 1G1CA 4X5RA 4NQVB 4EKXA 5ABDE 1AKPA 2F61A 2J1ZA 2Y7QB 5EPMA 4OFKA 1AOHA 4ZUSB 1LE9B 1K4DA 3T3PF 1GZHA 1TZGH 4UQEA 3W9DA 3WOVA 3KWWB 3FN9A 3LEYL 3P0GB 2Y1YA 3EGXB 1QYGH 2DI8A 3OKOB 5DQJB 4ZMZA 5C09B 2D7MA 3JWNC 4UQBA 2VZ3A 3FO2A 3RQ3A 5KJRL 4ZMYA 3L3OC 4GG6B 3KZ8A 2XIDA 1N8OE 4OUUA 4BINA 1Q38A 1WP6A 2APXA 3C8DA 1H3XA 4JY5H 4LVHB 1ZA3A 4PB0H 2Y9RT 1D6EA 1V27A 2DWTA 4YDKL 2R0ZL 1J5OH 5JW5A 1OB1B 3BAKA 4X8XA 5DD6B 3LEVL 1KPUA 2UZYA 3B7RL 5DMGD 1SUHA 4KO5A 5LWYH 1VPOL 1WA0X 2HKHH 3FSAA 2WK2A 3IBOA 1BX2B 1FAKT 4G6AC 2Q6WB 4GUCA 4UV7H 2DIJA 4WI5A 4I87A 3QULA 4XPAH 3BLPX 4HJ0D 3GSOA 4C56E 3KS0H 4JG9A 3UO1H 2GEQA 3IF1B 5D1ZB 2GQHA 2YA1A 1IC4H 5INCA 1QHOA 4FQXA 1ROWA 2KHAA 1M6UA 2VW7A 4AENA 3KYMA 1A4CA 1D5XA 1MH5B 4L3EE 3TIDB 4XWGH 4MA3A 2XVLA 2D7QA 5AAWC 3EZJB 2D0FA 2LHAA 1ZLDA 2OSLB 2F08A 4BZ1L 4N2AA 5DD3L 3HFFA 5JHMA 5EU7E 1R75A 5E8OA 3UC0L 2G3XA 4ONGL 1KBPA 4GKSA 4QAMB 4U33A 4TKWA 3E0GA 3ARBC 3BRFA 2J2ZA 4NRZA 1MREL 3QJXA 4IDLA 5IFJA 2QGEA 2X4RA 1R0AH 5KSAA 3ATAA 1LQSR 2B4CC 1KENL 1IIIA 1YEDB 4K7FB 4LSPH 5F96H 4Z7IA 5HD8C 4AJYV 4BK5A 3EFFA 3QFDB 2DQGL 3OX8B 2J8UE 3FRUB 4NN7B 5E9DD 1ES0A 5FUCC 5JOFB 1INEH 3CSGA 2HJKB 5ALCH 1WT5C 3STZA 1CFQA 1Z9OA 2EDTA 4YSTA 5FDWB 2CJTA 3QDMB 4N8VB 3RY4A 5MHSE 4N8CL 2P24A 2ZWZA 1T21B 3ISYA 3X11A 1DDHB 2I60L 2CCLA 1MCEA 3LPPA 1PZ5A 4HLZG 2G4GA 1N7ML 4MNQE 5CSZB 2VDML 1JGIA 1WC7B 3UBFA 2MQCA 3FL7A 1MFDL 4LPXA 4UB0H 4I0PC 2OZ4A 3EJQA 4YBLC 2IPKB 1UD6A 1G7IB 3BH8B 3U9WA 2WOBA 2XWRA 2XWEA 4AGOA 2G3ZA 3DMMD 4NKIL 5MENA 4XZUB 3FQNB 3GSWB 1ZLUK 3GHBL 3WE1A 1DSFH 2V7HA 4YHIB 1VFOA 2XNAB 4Z7WA 5AVWB 4ZYKB 2W9EL 3RHWF 4DVBA 2Q3XA 1UADC 3WFEH 4HLEA 2ZP0T 3CNKA 3RIAK 1I1RA 1OSYA 4Y1AA 2X10A 4AIZB 2HMID 1DLHB 3N06B 2WXPA 3ULAB 1U92B 3IS1X 3JWOL 1KB5H 1LO2H 4OI8A 4BWUA 2FK9A 1C5BL 3SQBA 3V6ZA 3QA3A 4CBZA 4DWHA 1XF1A 2ZOLB 1P7KB 3CFDB 1KF9B 3OF6A 4GKLA 4L5FL 3V6OE 3ZUNC 1IFGA 4M6NH 4JFEB 5AZEL 4P23D 3WKML 1WUNT 1HEZB 3JYCA 1P4UA 5A16A 2EC9U 2R56H 3O4LA 4V1DB 2PCPB 1H3PL 1KG0B 4G2AA 4QRAA 1CFVH 4R9HA 3RWHB 3SD5A 4P3CL 1XGQA 2EVIA 4W68A 4NWUH 2J56A 2CO7B 1VFBA 5GHWH 2IALA 3W0WA 2P8LB 1CGTA 5CCHE 2HT2C 1R3IH 5C0EB 4MSWB 1BF8A 2D3LA 3NIGE 1XQ4A 4FQLH 1QRND 3MX0A 5AVVB 2Y23A 3F3HA 2NNCA 5F71A 3II2A 5IJCC 4GBXC 3CZNA 1DQJB 1F0LA 4OFQA 2WZPA 4KV5E 2Z8SA 3TJHD 5J7CC 1IQWL 3IN2A 3UBXA 3TPUB 3AQXA 1SJVA 4QF1A 4TNWF 4E2OA 5IFAL 3JBG7 4LHJB 4RVBA 4Q9RH 3OKDA 3TWYA 1KMGA 1J87A 1F3DH 4F7CA 2OR7A 3FO1A 2I9TA 1RZKH 1P7QB 3HZMB 3AWFA 4LCYA 1I3UA 3FO9B 4MCZB 5KAQF 1LMIA 1Z9SB 4F1ZA 1UTDA 4JQVA 1Q9WA 3AMLA 3G04A 3I9GH 1IKNC 1AD9B 3APDA 1OPOA 2EXTA 4TSCL 5TE6L 4BE6A 4ZMAT 4O4YH 3JWDC 4WFFD 1WWBX 4PJEE 4YL9A 4LDEB 5DS8A 5EBWA 2KH2B 5ICZB 1QQDA 5FV1L 2R1XB 1ZANH 2N56A 3DX9A 4BDVB 4C4KO 4OM0L 1JPSL 2JB5L 4X9FA 4ZSOB 5IHZB 3TNNA 2VITA 2X2UA 4UNUA 4WJG3 4R96A 5E8DL 4DGVL 4D0CB 2MRYA 2BSSB 4P23A 3G6JE 2OR9H 3MI6A 4QTHB 1FV1B 4WTZA 4ELMF 4YBHA 3TH3T 1YEFH 2O5NA 5E23A 1IC5L 3RPIB 3U6RB 1C08B 4LHUA 3R7QA 4ZFZA 1TXKA 5DHDA 1F58L 2NDGA 4NC1C 3RX9A 3ROOB 3PAUA 1CLOH 4N1EA 3P9LA 3JTBA 3TBWB 3E2HC 2X70A 3LJ3A 3DPBB 4AW7A 1DBBH 1WZ1H 5I1EH 5KYYB 4LOVA 1G9HA 5TF1L 3K2MC 2X6UA 5AG9A 1S9VA 1E28A 4S0SD 2YQ2A 2R27A 3PV7A 3HR5A 1BSIA 4F27A 2D73A 5MEPA 5KVGL 1EXGA 1LO4H 4OLYH 4FNLH 4YFLI 5IQ9A 1E2WA 4ODXB 4EIGB 4ELMA 4ETQB 3CE1A 4G9FB 1UEYA 3L3KA 4ZS6C 2FJGB 3OR7A 1KPRB 3T8MA 2VLJD 1F3RB 3G08A 1JZ8A 3N50A 1QZNA 1JAEA 1KYUA 5F0MB 4XXDA 1HWWA 3APMA 3AFLA 3RTQA 1PLGL 5DMKA 1UD3A 3KXFD 4GUQA 1INQB 4PJCB 5KVEH 2ITFA 2ADJA 4IW4C 3T0WA 2RIKA 2VDRB 2GIMA 1X5MA 3PWJB 5IW6B 2VDOH 3NIDE 2EJ1A 4Y9GA 2Q7AA 4ALAC 3MRHB 4FTVD 4I1PA 4LPCA 4W9DC 4FLRA 1I1CA 3FOMA 1OAXL 2N3JA 3NH7H 3LQZB 5KS9B 3LDBB 4GMTL 3OXRB 3DUUA 4I7ZC 2GTZA 4M5ZL 1MFMA 2YFNA 4TVSa 2XUWA 3UIZA 3BN3B 5EIQA 4DGIL 5F0LB 1PDKB 3OPUA 4XVUD 3P3SA 4KH2A 4KXDA 3EFOA 3CSPA 2AVFA 3GRWA 3VH8B 1AXTL 2RACA 3EYOB 4E36A 4JY4A 5BRPA 1P4BL 3SPCA 1A21A 1KOAA 3F01A 3N3EA 2VXUL 4Y4FD 3CIAA 5DC2A 2YPLA 1KJMB 2OM5A 4ZNEA 5KBLA 3MV8E 4QHLA 1NGYA 3ZO9A 3BOVA 3OQRA 1B6DA 5SWZE 4EBQL 4PJFA 3WIAA 4CN1A 4C55A 4IU3A 2H0EA 3MGAA 2VE6B 4DETA 3U0TA 2EABA 2RQEA 5AUMA 3CLWA 4PJGA 2VWEC 4E9LA 4LSTL 3KPMB 5F7DA 4QCIA 5LNEA 1SLUA 3QJHB 1HOCB 4OBRA 3X2QB 2HLAA 2ZKYA 1TDQA 4KRLB 5F89A 2VLJA 2EH8H 2RR3A 3MNWB 4JDVB 4TLKA 1YNTB 3WHXB 4Z7VE 1PSKL 1W6LA 2ZX7A 2BK8A 5CCKH 5C0JA 2XTSA 2VN4A 3ULUL 3WLWC 5CEZL 2PO6A 2F58H 2OMBA 3HZVA 4U3XA 3TLRA 1QUPA 4JFDD 5CZKA 4E9VA 5FM5O 1S5HA 4I77H 5MI0C 2W38A 4NYLB 1BCIA 4UQ9A 5C0CE 5DRWA 4JHWL 2ZNXA 1WIPA 3UAJA 2WHVA 4XOBA 4XC3H 1ZVYA 3QIWC 1I9RL 1CXEA 4RSVA 1FFOB 1ADQL 5GRWA 3OHXA 3NRFA 2AJYL 3U1SL 1EO8L 1O9WA 3CVBA 4QYAA 5DZOA 4F33B 5T3XH 5ACZB 4JW3A 3OTTA 3X1EA 1EXHA 3IWUA 1UUSA 2PW1B 1A1MB 1TETL 1TNMA 4ZTOH 4YDLB 2YEQA 3PREA 5D1XA 3SDXF 3ZE1F 2IBZX 5BRZB 5HHVL 1HNYA 4IKIA 1I1FB 1ZIBA 5TQ2L 4Q6KA 4AL8H 5KOVC 1DCEA 4FQHA 2HPOA 1MCIA 2SEBB 3ABLB 3SPVB 4FTDA 2BNRD 3L3GA 1E5YA 1G1YA 1OGTA 2YBRA 3HMXH 3MSPA 3NACH 1TTBA 4P4RA 3V9EA 4IBWA 4Q8BA 2QV4A 3N41F 1X5XA 3WDHA 1BYOA 4E68A 1UACL 4WTWA 1GVIA 4HWNA 4IJ3B 4WEEA 3GHEL 4B5EA 4PJHF 2IH1B 2G0LA 2VERA 3FT2B 3ML9A 1KPVA 1QVOA 2NUPB 4OCWH 4TM9A 3LS5H 3WLBB 4QRTB 5DJ8B 5IT2H 1L9OA 3WJLA 2AV1A 3BP6B 2H1PH 2O4EA 4BQ6A 4HJEA 2MPAH 4PJBB 2EKJA 2HVJB 4G7QB 1LTXA 3SDYL 4YDMA 1BBJB 2NY5C 1U58A 4KZ0A 2X2JA 2EEXA 2EYTB 1YNLL 5FW7A 3L3HA 4JFDA 4IEFB 3T6VA 4Y5VC 3JT0A 1NIAA 5TFSH 4Z0BL 4BZ1A 3ZY7A 4PJHA 4HG4K 2VSKB 3MLRH 4H88H 4JDEA 4L1DA 4UILL 4CAGA 1W2KT 2BNQE 4N87A 1KB5B 3RLSA 3TCXA 4RGND 4LLMB 2Z93A 5IHHA 1FORL 1A25A 5T3ZE 4DZBA 3RI5F 2Y4SA 1U8HB 2XWBB 4DUWA 3QJRB 5AW4B 4IOSA 4FN0A 1MIEH 4UQIM 3NFPA 1AACA 2CO1A 3CV5A 1WD8A 5EN2A 2WO3B 3H2QA 2AXGB 1BJ1H 4LPUA 4KX7A 4YZFE 3UP1A 3ULVL 1H19A 4YGAB 2DQHL 4JM4L 3DGGB 5DUBB 2GFBA 3HAEG 4PJIE 2BNRA 4QRSB 2ZUTA 5IV2A 3IU3B 2ZX5A 2CCWA 3MACL 1JYVA 2XTJB 3QRFM 4F80A 4TNGA 1NJ9B 2YXMA 4U0RB 1WFJA 4NN6B 5EZJA 2JKLA 4NUPA 5IEKA 4K8RD 1U95A 3BAJA 3T4AB 1XR8A 4Z7UE 2X40A 1E8XA 5I8KH 4QYOA 3SDDB 4I2XE 1U93A 2CK2A 3RAJH 4P8QA 2A9MH 1HHHA 3B3IA 3QEUA 4MDIB 3NCXA 1I9EA 4R7LA 2R4SH 5DI8A 2WVSA 5AKRA 5F0PB 1MWAL 1EAQA 1KFAH 1NCAL 2XICA 3QGVA 5AL8A 2WIIB 3DX2A 3IJYB 1TT6A 4LNVA 4AXWB 1YYLL 5J3HC 1BLIA 1DZ0A 5CZVH 2Y2WA 3POCA 1JXDA 3NCJH 2ZPKL 3HNTL 1WBZA 3OKKB 1HQ4A 4OUOA 1NH6A 3B9KB 2PCYA 5GS1C