1D7CA

Cytochrome domain of cellobiose dehydrogenase, ph 4.6
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
190
structure length
190
Chain Sequence
ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CELLOBIOSE DEHYDROGENASE
publication title A new scaffold for binding haem in the cytochrome domain of the extracellular flavocytochrome cellobiose dehydrogenase.
pubmed doi rcsb
total genus 36
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 1999-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1d7cA00
1D7CA 4QI3A 1D7DA 1PL3A 1D7BA
chains in the Genus database with same CATH superfamily
4GW4B 1IV8A 2F61A 4MA7L 3HS8A 2DI9A 4AV4A 4QF1B 3WNOA 5HP5A 5D7IE 2DBJA 2VLKE 3KBPA 3SDDD 4K23L 4X80H 4Z6AT 4U7MA 5EIVA 4IRSC 2AI0H 4DP6X 4AVKA 4AQEA 1DQLH 3MRKA 3RGVA 4BQBA 2W9LA 3HMWL 3E8VA 5D96B 5JQIB 5J6GA 2B9AA 2YGVA 3LJ3A 1EXUB 4G8IA 4WJG3 1VFAB 3VQ2C 1IC0A 3ARGA 5F0JB 2K78A 2JF1A 3L9RB 4IBUA 3ZE1B 3OD3A 4BUQA 2A9NH 5IQMA 3T0EA 2CRIA 2D7NA 1MNUL 2FQFA 3RX9A 3ZVVA 2DH2A 3T8XA 3O2DA 1NGYA 1DQJB 3DX9B 4XVSH 5LNDA 1LNUB 5CP3H 2CGYA 2X4SA 1P7QB 5DJ2B 2DQHH 3NRPA 3BIBX 4UQIM 1GY1A 4UILL 3LX9A 1DEEB 4OGZA 5IB4B 4TRPL 2OMXB 2AW2A 2BWQA 4H2AA 4KGJA 4FXGB 3T9WA 8PAZA 1E8WA 4KJYA 1JD7A 4UANA 4K7PL 3FH7A 3LEXA 4DOHE 2EEFA 1XGYL 1WZ1H 2X87A 1OCWH 4V1DB 3WENA 2APTA 3M8OL 4C4KT 4U1SA 2BW4A 4J8RA 4OQTA 5BUPA 4JVUA 1JZGA 1ZIAA 2AXFB 4AL8C 2CUIA 1H9DA 4HJEA 3NZHH 2Y5EA 1JYNA 4MJJA 3H9SD 4I18A 2ENSA 3IU4L 5CNHA 1PLBA 1YA5A 1BQHB 4IKKA 5LO7A 5CBEB 4I1PA 1IGIL 2R2HB 2O26U 1INEH 1AE6L 4I3RL 4YHML 1AHWA 2VDNB 2YQGA 1A0QH 1NA8A 5ITBL 1YN6B 4L1BA 4XB8A 3WTSA 4MWFA 4XWOD 1QFWL 5EU5B 3UZEA 3ZHKA 2R4SH 3B3BA 2VQUA 2B1OA 3QO1B 3FQWB 1F6FB 4XZUA 2LLLA 2XKNB 2ZOLB 3OAUH 2OJ1A 4NXSA 3LAFA 1ADQA 4PV8A 1CG9A 4Y9GA 1WE5A 3WFEL 2ADJA 3V9EA 4AENB 3AS3A 4LSSL 4AZ8A 4BCZA 2ZCHH 3CFBB 1Z9LA 3O3AA 1S7TB 2BRRH 3U1SL 3N40F 3EOAB 2ZE0A 3TXAA 2WP3O 1PZ2A 5BV7H 3CLWA 4C83A 1OAJA 5DJCA 4FP8H 3NJMA 4OT1H 3OKOB 1WGOA 4UT7H 1O6SA 1UVQA 1VGKA 2EUVA 3B7RL 1T6WA 5A2AA 4YXHH 3DVNA 3Q05A 4ZSOB 5HY9B 2D3VA 1Z3RA 4MD0B 4W68A 1G7JA 1VEOA 4PTUB 1AGBA 1SRDA 5T3XD 4ZNCD 1UURA 2BSRB 1JK9A 3FOMB 5DUBA 1PD0A 3F04A 2BMKB 4NUGH 4N2HA 5AEAA 1XB6A 3D4ZA 4M93C 3WFHA 4OUUB 5I1JH 1LJMA 2OJEB 3FONA 5F7HA 1E8YA 3CFJB 4IMLB 4QXUL 3UERA 1HI6B 1M1XB 3F7KA 1E9QB 2BC4A 2ZOWA 3NJIA 1JDAA 4GEIA 2YPVL 3ROOA 2XWCA 5JR1H 1FAIL 2R29H 3K8KA 3WS3B 1HH6A 2YXVA 4KPHH 5CJXA 4YPGA 4D9RE 1O7VA 1A7RL 1MJ8L 4R9HA 3O6FD 2F7PA 4K3EL 3ZTNH 5AVSB 4H8UA 5FUOH 1ZIBA 1ORQB 1HHIB 4EBQH 1EGJL 3GBML 1HHKA 1NPNA 2F53B 3DHMA 3RZCD 4DP5X 3V4VA 2Z31D 1JGDB 3MC0A 3ZE0F 5F7WC 1R3LB 4ELMF 1OAQH 4FQJH 2XICA 3U25A 1ND0A 4M43H 5HXMA 4EIZC 4XCCL 5GGRY 2OMTA 2AEQL 2WVSA 3IE9A 1MCKA 3SHSA 3HI5H 4CJ0A 3FDWA 3O6FA 3CFDA 5D7EA 3MRGA 4YVUA 4BWUA 4ISVA 5K9KA 3IU3A 3VJ6A 1MHCA 1HWWA 1YG9A 3F58H 1MG2C 4B50A 4K5PA 4RAVA 4F7MA 4FHKA 3RZCA 3WUWA 2CR3A 4XVTL 1HYSD 4XMLH 2Z31A 3RVXD 4XVJH 3T4AB 1T83C 3IS0X 3IWUA 1KNOB 7FABL 2HMID 2TAAA 1FN4B 4FHJA 2JJVA 2G3MA 5LGHL 4JGJA 4PBXA 2WINA 1UASA 2NTSP 4JGUA 5D6DC 5F89A 3VFUB 4PJDA 5GZND 4Z7QE 1JNJA 4CN1A 2XZAL 3N1MC 3MRFA 1BFVL 2WLNA 2CPUA 2YKLL 1RZ7H 2P5ED 3LIZA 3ALPA 3CZUB 2G5RA 4GRWH 5J1AA 4AH2A 4AGNA 2AJZB 4DPAX 5CEZH 4GSQA 2AHIA 1XTMA 1CF1A 4H8HA 1I8AA 3KPOA 12E8L 2XXGA 2BX5A 4JFHD 1P7QD 2OX5B 1YEIL 3CWGA 3DURB 3OPZH 3QW9A 4YDNA 5GZNA 1CICC 1U8KA 1DTUA 1NEZB 2G60H 1TQWA 4GQ9H 5DMJB 4BQCA 4K94H 5HI4D 1FGNL 1QACA 1EXUA 4QKXB 5IJKC 3RIFF 2NW2A 25C8L 3K71B 3L9RA 4XOBA 4FCAA 4BUHA 1FVDB 1MZYA 1UD2A 3P11L 4W6YB 3PQYD 2XN9B 4AV5A 3O0RH 1CVSC 4LSUL 1ZT1A 1W72B 4Z0BL 4CN4A 1S5IL 4XB3A 3DX9A 2X4RA 1LNUA 3EGXB 1P7QA 5DJ2A 2YGOA 4LIQE 1G7HB 1WBZB 4JPKL 1DEEA 3MREB 4HEPG 5IB4A 1NLBH 2OMXA 2E7LC 4FXGA 3PNWB 5DYOB 1FC1A 2C4FT 2XTJB 3QAZB 1XXFC 3PHAA 3HLKA 3QS2A 2M1KA 2A9ML 2H2SC 1F4YH 2HPTA 2OJZL 2ZOKB 3O6LL 3ECUA 2AVGA 3CZEA 3OGOE 3HBZA 3QO0B 1AO7D 2AXFA 2BOBB 2XQYA 4JPSA 4APQD 4MMZA 4QHUB 1U8JA 2EH7L 2GTZB 3C87A 1FL3B 1P9MA 4NQSB 4L9DA 1PIGA 1WLHA 5CBEA 2WVUA 3MZTA 3K72B 1P4BH 3DO3A 2GK0A 2ETWA 1BZ8A 3LB6D 2NYYC 1YN6A 5AAWA 4KI1A 4JRXD 4FI6A 1SNRA 5EU5A 3CHXA 3DSFH 3I02B 1BSIA 2MPAL 5AKVA 3MCKB 3QO1A 1E2ZA 2WM0A 1UB5A 2X1OA 1DBJL 1AO7A 3MRLB 4APQA 5FO9B 2DMGA 2VLJB 3MRMA 3LS4L 2WXRA 3FQ4A 3VH8G 1QOKA 4RMWA 1A7NH 1CTMA 3VXNB 5I18L 5F2FA 1XBDA 1SOKA 1LYQA 2G2PA 3ME0B 4DZBB 2WTPA 4PJIE 3L5XH 2X05A 3IMSA 1QMUA 2O6PA 3D18A 3RWDB 4NCC1 1M9SA 1P4IH 4PJ6A 1AZCA 2R0ZL 1Y07A 2WZPA 5ICXA 1FF5A 3UTZB 1H6UA 1TVBA 4ZQTA 4CADB 2KPWA 4NQXB 1M7DB 4HIPA 2FNBA 2QADD 3QXUA 4MQXC 2I85A 3OKOA 4A39A 2Z93B 3PPEA 4DVBB 2X44D 3PAUA 2EZ0D 4XXCA 2OTWB 4ZSOA 5BCAA 4X42A 1F4XL 4MD0A 4JPIB 5I1HL 4S1DD 4PTUA 3VWKD 4G11A 1OLZA 5DHDA 5MEND 2BSRA 5HGDB 1T66D 3FOMA 3BUYB 2VL5A 3ZX1A 4TUOB 4P5TB 2B3IA 2XI9A 3DJRA 3UADA 5BXFA 3MLZL 1GYVA 2OL3H 1JJUA 3B2VH 2VITB 3ILDA 4LFHG 2Y23A 2QSCH 2FSDA 3GBNH 1VDGA 1OY3B 4ACTA 3CFJA 4IMLA 5CLZA 5A6MA 1M1XA 1TZAA 2X7LA 1E9QA 1BXUA 3DYMA 3GC3A 4OAWA 2DQTL 4NERA 4I77H 2J20A 2MEJB 1IM3B 1NGWB 3TM6A 3JVGA 3WS3A 3FCGA 3AQZA 3BKCH 4UQ9A 1QI5A 2L04A 2OMUA 3O45B 4PREB 5DR5L 3WN5B 1MVYA 4UNVA 5MENA 3QIWD 5C0NC 1FGVL 4HXBL 2QSVA 3ZQXA 2ITFA 1A6VL 1HHIA 2IAAC 3LQMA 3WS6C 3GPSA 3MLRH 3T2QA 5I75C 4GXVL 1TTUA 1F0LA 2JLLA 1T89C 1JGDA 4KVCH 4FQXD 3Q01A 3QI9C 5C7ZA 1WA2X 4FD0A 3GBDA 4XBMA 4XO5A 4JQIA 4F58H 1FIGL 3FCSB 4JDVB 1Q1JH 2NXZB 3QIWA 5LDSA 4K71B 4Q74A 3MA7B 1HEZB 4IRZH 5I1GL 4FI7A 4K5OA 1QA9A 2AAVA 4JM2B 2HFFB 4E9QA 3H3PL 3HZYB 5EN3A 1D6VL 1MJ7L 1IC7H 4X7SH 1LO2H 1YMMD 2OR9H 4HIEB 4OJFL 3VXQB 3T4AA 1KNOA 1F8TH 4NQEB 1TKWB 1FN4A 2RFXB 2KLTA 4YZWA 1I3VA 3QFJB 3O3DB 1F02I 1XSJA 2WZ0A 4S1QL 5DK2B 1RPUA 2NCMA 2YC1B 1NZRA 1AG6A 3RGVC 3OAZK 1TFPA 1N6UA 3UYRL 2NY6C 3E7JA 2EJ1A 4AEFA 3ARBB 5DRNB 1SM3L 4OI9A 2FBJL 3ARGC 3UC0H 3NCJH 2AJZA 3NCMA 3O3UN 4ZUUB 3T0EC 1YMMA 3WE6B 4OD1H 2YEVB 2X40A 2Y7SA 3O81A 2FWUA 1DLHA 3B2XA 2A2QT 3SJVE 2W60A 3EUUA 4HZ1A 1UA6L 2N0MA 2NRDA 3FF8A 3B9EA 4MSWB 2UZIL 1NEZA 1Q72H 5D1ZD 4UQ3B 2ZNWA 5JIQA 3ULUE 4OTXL 1E28B 2XTJD 2E9GA 1RPKA 3SDCD 1FVDA 1DE4B 3SKMB 3H6JA 2YD8A 4K55A 5AKTA 5DGQA 4YSCA 2WBKA 2XN9A 4HCRL 4CC1A 2VMCA 1HJCA 1MI5B 4YHYB 5EWIL 2N01B 1B3JA 2LGNA 3IWVA 2VQTA 2KS0A 4HMDA 4PRAB 3EGXA 4RIRB 1E50A 5E56A 2BIQA 5T1MA 2XWJB 4I18C 1G7HA 3VU2A 1QHOA 4W4OC 3MREA 4NZ8A 3IGFA 3CIQA 1FHGA 4Q9CA 1KXHA 4O2CB 2NY2B 5D1ZA 3NJHA 4WEUD 3PNWA 3U30B 3VGHA 4D0DB 1DVFC 1OAUL 3SDCA 2PO6B 2ZOKA 3UZEC 3HUJF 5EZLB 5LVEA 3AGVA 1YY9D 2AQSA 1J9CT 2OSXA 4ODXB 1LEIB 3FT9A 1BD2B 3CN1A 5ESQB 3CVBA 4NC0B 3N1FC 2YGNA 2AQQA 4QHUA 1GGIH 1BZOA 5GS0L 1PJ9A 2BSBA 5CLWA 3K72A 1MHPL 1DBBH 3OWEA 4O2FA 3TA3D 5D1QE 5AVQB 3FCTA 4UIMA 2GC7C 1F4AA 3U0TB 1KXTB 4G80B 4DK3A 3ARUA 4TQIA 1Z9OA 4XWOC 1EZVY 1TJGH 1GA2A 3R4RA 2ZSVB 1KCSH 4IHOB 4QLRA 3LRKA 3MRLA 2UY6A 4WWPA 3CX5K 5FO9A 3ULUL 4UTCA 2VLJA 4G7YH 5DFTA 5DZVA 4A67A 3JWNH 4WUKL 4C4KO 5A2BA 1XCXA 3BWZA 3EJQA 4HUUA 1J5HA 1F90L 4X50A 3D39D 4QRSA 3ME0A 4Q0XL 4DZBA 3TBTA 4G83A 1JL8A 2SEBA 2FEDD 4LVNC 3RWDA 4F9LA 2C3XA 1FCGA 1CFVL 4M29A 2ZWSA 3DTDA 1QR1B 1NAKL 4CADA 2X0WA 1TQVA 1M7DA 4NQXA 3N44B 3LZFL 4DVBA 1HZHL 3CZJA 1WF5A 5HHOB 5DEGB 2OTWA 2CXKA 1T2QL 4PJGE 1MFNA 5EV7A 4EN3C 5CJXC 3HE6D 3IDXH 3D39A 1O9WA 1K4CB 5HGDA 1R1CA 5HTSA 3BUYA 3GTNA 4KQ4H 1BREA 4HJTA 4TUOA 4P5TA 2EXWC 3M6DA 3H4HA 4RESB 4UNTA 3SE3A 3VE0A 4A7QA 1DCLA 2AQRA 1V3KA 2ARWA 4TF4A 3VFGL 2IOIA 5DU7A 3UL4A 3QEQE 2P47B 1HDMA 1L9PA 4I13B 1ZXKA 1NGWA 3GSNL 3VMOA 3GGWB 5J13C 3B2UC 2OSLB 1KTRL 4ZD3H 3O45A 3HE6A 4PREA 5GHWH 3WN5A 4XN4A 3GXFA 1N4XL 2D4DA 5B1BB 2R2EA 4GRWF 4TQHA 4RWHA 5TQ2L 3EUDA 3WO3B 1DQVA 3EO1B 4JL2A 4A2DA 4F37F 1Q9KB 3CFCL 4PY8I 4IOFD 2Z31C 3PGDB 1ZHBB 4I85A 5TE4H 1TYRA 4WO4C 4K0OA 1UM5H 2H26B 2KI6A 3CXDH 2VZ3A 1IM9B 4W9JC 3MV01 3C5ZD 1TZOA 5I6NA 4G6KH 1HHGA 2I60L 3PU7A 3BT2L 4NIKB 1EJ6A 1HEZA 3MA7A 3HG1D 4HOMA 1OE3A 4P2QE 2Y6TE 4X9GA 2HRPH 3V0JA 2HFFA 3HZYA 4A7GF 1F4WL 1JZHA 2GYSA 5CEYB 2IANB 5I1CH 1RUQH 5ADOL 5LWYH 1HYSC 4JFYA 3VXQA 1A7PH 1TKWA 5DMGD 2F5BH 5GS2D 4HD9A 1NCWL 3QFJA 1SY6L 4CVXB 4F2MA 1JMXA 1I1RA 1BM3L 2BM3A 5DK2A 1IBGL 1IEAB 2VC2B 2YC1A 5HYSG 4Y4FB 1VFOA 5KW9H 1X5KA 4NI6A 3BAXA 5C0CB 5D96C 5ID0B 4ILDA 4AVJA 3ARBA 3Q5OA 4Q56A 3FZUD 3HG1A 2WPGA 3EYFA 5DRNA 4LSRL 1ZLVK 4Y1SA 4J3BA 1DHKA 4PLNC 4Y5YB 4JW3A 1MFAL 3I3EA 4ZUUA 3OPUA 1A14L 4H1LG 4PQXA 3WE6A 1J7VR 1Z9MA 1BAFH 1CD8A 4X83A 4OIFA 1BEXA 1ZE3H 2O6EA 1A3LL 1JWUA 2X4TB 4WW1B 2F1BA 2F74B 4NBZB 1ET5A 5E2JA 4FL4B 4MSWA 3I9PA 2B9BA 1N64H 4FXGC 4A37A 4DQAA 4LVOB 3VFTB 3P2DA 3FN0L 1E28A 2DLGA 1D9KD 2G0KA 2CHDA 4J3UA 3K3QA 3QH3A 4G9FB 3VNZA 3FTXA 3DXAB 3C5XA 3SKMA 4C59B 3EJJX 3RHWK 3MV9E 3FQXB 1CQKA 3U36A 1MREH 5KAQF 1OAXL 1AKJB 3WTWA 5I6XB 2F2HA 1B2WL 2JKNA 4PRAA 5BRZD 3SBWA 1FA4A 3SY6A 4ZOAA 2WXHA 3HMXA 4M6NL 1C5CH 3LVEA 3UGEA 4O2CA 3RVTC 4RVBA 5FHAH 2BY2A 1MFDH 4ZFGL 2ZKXA 3RVUD 2XIDA 5AAWC 4PRNB 2UZPA 4D0DA 1S3RA 3HVNA 3CX5J 3ATBA 3PWVB 2P48B 5EZLA 2JJUA 4OFVA 5D7JB 4F57L 2YEQA 4AGLA 2OP4L 3L5WB 3SBPA 3KPNB 5LN4A 4APQC 2VZSA 1CGYA 4NN5B 5L9DH 3STLB 4OLXH 4DVRH 2IGFH 4QMEA 4PG9A 2HFGL 4ZUVB 4FA8A 3ZE1E 2YRLA 2JJSA 1UUNA 3P0YL 5IZ7A 4B6ZA 3U0TA 3LB6C 1ZKAA 4WY7H 3U1PA 3EO9H 5E9NA 5C2BH 1JNNL 5F7KC 1I7TB 3B2PA 1DSYA 5IQLA 4AXWB 2DZEA 2PXYB 2ZSVA 1OGPA 4U33A 4IHOA 3VRIA 4FXLA 1RZGB 4LCVA 4ANUA 4AYID 4XPGL 4XXCC 32C2B 2B1AL 2Q7AA 3D07A 3VFNA 4UM9D 3GIVA 1U95B 3FK3A 1VEMA 3IXAB 4KMQA 2DLFH 1EAQA 3KLAB 4YHKL 5FYKD 1A4KB 4YQXH 3UG5A 4B5EA 1H5BB 1NIAA 5JW4M 3L1EA 4Z7UB 4JHAL 1AYRA 1Z66A 4JPVL 4NUJB 4E9VA 4QO1A 4CILA 1F18A 1QR1A 2QVTA 4JJHA 2QZ5A 2XXFA 1IQWH 4GOSA 4QTHB 3AB0B 3AXLB 4M48L 4HEPA 1YQVL 4RBPH 3S3DB 4ZS7L 1DVZA 4KBPA 4NI3A 4P9HL 2VZUA 2XQBH 3MCLH 2PETA 4FA7B 4LOUC 3JVGC 2I9TA 4S1DC 2O1AA 3WIIL 3ZE0B 1K4CA 4YX2H 4TQEH 1T66C 1MIMH 3KPTA 2XOTA 1AKPA 1I3GL 4R5TA 4EUPH 1I53A 3FB8B 3X11B 1BFTA 4AV0A 2XN0A 3CMOH 3WJJA 4YDMA 3BSZH 3U4EB 4ERSH 5CZXD 3UPRB 4XNZB 1HU8A 1A8ZA 1V7MH 3ECVA 4PHZA 5T5FA 3VD4A 2QQKH 1U21A 3VI4F 1BXXA 3GGWA 4NGHL 4KK9D 1AACA 4IGBB 2CHXA 1G9ML 4LLQB 2AJ3B 1R46A 4OUOA 3G08A 2XCMC 3DECA 2ZSWB 4ZX3A 1MH5B 2RA1A 3EO1A 3EADA 1J1XH 3TN0B 1Q9KA 3DVGB 4BFBD 2VZTA 1SEQH 4K9EL 1KEGL 4M1CD 4L8SA 3D85D 3AT8A 3T4AC 1RIHL 1A5FL 3WLWD 3NH7H 1U58B 2X4OA 1EVTC 4JHVA 4TUJB 2R7EB 1KDIA 5C07B 2W80C 3BAEH 4LFHD 2IV8A 4HBQA 2QKIB 4X6FA 1R5WA 5F9AC 1WC7B 4LOFA 4ZO7A 3EAKA 5I66B 2IANA 3BJ91 4HIXL 2UZYA 2ODHA 1MAML 4Y2LA 3VXUE 1HWHB 4FTVE 2BSCA 3D85A 5HHVH 4B53A 5F9OL 3D06A 1C5BL 3N91A 4RLDA 4S11A 4PBDA 1RU9H 3QUHA 5C6WH 4HIJA 4IK6A 3RBGA 4ES8A 3RVWC 4UBDD 4E9YA 5C9JB 4Y4FA 3PP3H 1YJDH 4LBAA 4ATWA 5LNGA 5C0CA 5ID0A 1KLGB 2C7UA 3F7LA 2NY5C 3MACL 4AEHH 4U1GB 1FLRL 1J5IA 2WTOA 1OW0A 3OHXB 1X5LA 2VDQL 4G9FD 3DXAD 3QQXA 4A2MA 4Y16B 1BXAA 3AG3B 1LO5B 4IKNA 3NFSL 2C9QA 5F7EL 4MA3B 4UIKH 3B1TA 2X4TA 1W2KT 4WW1A 2F74A 1ZLUK 3BESR 5HYQB 5J11B 5CIPH 4BBWA 1JMZA 3ULVE 4P3DA 3U82B 1KN2H 2N56A 3HC4H 5D1ZC 4OF3A 1CBJA 2EAEA 5FFOA 3GS0A 2NNAB 3VFTA 4JFOB 1THAA 1DBMH 4FFTA 5E8DH 3O9WB 2ILLA 4DFIA 1NGPH 1SVBA 1X5JA 2XTJC 3QAZC 1EDHA 4G9FA 3DXAA 1QTPA 2R15A 3HAEG 4F24A 4PWIA 4Q9QL 4YXKL 1AKJA 3NFPB 4A6YA 4CKQA 4LARH 5FXCH 4GUQA 1GYUA 4N0YH 2L3BA 3UZQA 5JW4N 1TOXA 4CGTA 3D2UB 3GQFA 5EOQL 5IG7B 4X9BA 1VLXA 3MLXL 3ETSA 5B3NA 4PVLA 4AJYV 1RZFH 2P7TB 5C0AB 2EDMA 3NYKA 4QOKE 3MBED 3WGUB 4BWTA 4Z3JA 1HK6A 4F91B 1NCUA 1YY9C 4AE1A 4LLVB 3L5WA 4P5SA 4X5PA 3L8QA 4L3EB 3ARXA 2VDRB 1UZ8B 4NQVA 4AEIH 3STLA 4G43B 1Q90A 1SBSH 2WGXA 1L7TL 4RA3A 1S78D 3MJ9L 3PGFL 3UJTL 3ZHFA 4GAYB 4N8UA 1XL6A 1ESOA 2FQGA 3MJ8B 4F9LC 4NWTL 2FO1A 1BG9A 1JVOA 5GJSH 4I88A 4XMPL 5I74B 1I7TA 4ZXBD 3LPGA 5A43C 5KSUB 4AXWA 3CZNA 4KJWC 4OCMC 3ULVL 4NFDA 3KGSA 2JKXA 5BJTB 1IBYA 4JAMB 2ZYHA 4BZ1A 5PAZA 1MCDA 1QSEB 1USQA 32C2A 4R83A 5F96H 3BCDA 1ZGLB 2ZAIA 3EHBB 4G1MA 3H0TB 3IXAA 2D0GA 4AUYA 3KLAA 4X7FC 3QCUL 4P2RE 4AITA 1H5BA 1CFQB 4K3GA 4KXDA 4P5TC 1TITA 4ZUTB 1MW2A 2IDTA 4L1HA 3SE3C 3MRDA 3REVB 2E9WA 1FORL 4NUJA 4UQCA 3VO0A 3WN6A 4NO2B 4LQFL 5L6YL 4ZXBA 1X44A 5IM7B 5D7LD 1Z3GL 2Z92B 5ALBL 4K7PX 1MFMA 2BWDA 3AXLA 1KB5A 2BIOA 2A73A 5EC2B 3L9BA 2NSQA 1LO4H 4JFEB 1TXKA 3H42H 4RAUB 3PCYA 4QHKJ 3L3OA 1E27A 5DHMC 5DHVA 1FG2B 4KJPD 1XH2A 3WN5C 4ELMA 5T8IA 5F7BA 1ZLWK 2AGJH 2VSMB 2WBJB 4F2FA 3VI3F 5KAQG 2WWMC 3AM8A 2YGQA 2VLRB 1ZAGA 3TN0D 4FF9A 1EAJA 1FE8H 3HB3D 3UPRA 3MLWH 2NW3B 1M7UA 1YNLH 4UNIA 3RIFK 5IB5A 3CDYA 1IBBA 1OTSD 2F6AA 4DTGH 1I3UA 4FFZH 5ABZA 4H0LC 3QEGH 4BFKA 4OBRA 4TVPD 5CM1A 1EXHA 5C07D 5L7XH 2F54D 2XPYA 4MNGB 4HMEA 5CZKA 1NANI 4LLQA 2AJ3A 1X4XA 2NXZC 4K71C 3WOVA 3QNZB 4X8XA 2ZSWA 3FC8A 4PJFE 2BOLA 1O7DE 3ELQA 3TN0A 4HH8A 4OCXL 3P4MB 3AAZB 1XCQA 3RTQD 2J8UA 2ZCKH 3ETBF 3HNSL 4IOFC 4MQSB 1CE1L 5GRYA 2VXUH 4TUJA 5HI5D 3F84A 5FUZH 3ZXAC 1NMAL 2A77H 3GWJA 2H2PD 5C07A 1TEFA 2F54A 4XN7A 1NCOA 2A6JB 3WIHA 1AGDA 2QGCA 2Z4QB 2QKIA 4LL9A 1J8HB 1ETJA 1QLRB 1KGJA 3ARBC 4Y2DD 3THML 2JLPA 5CFAA 5I66A 1LL1A 4P23D 2HP4A 4TUKH 3KPSB 1D5MB 3RTQA 4AJ0A 3FS9A 4DERA 5J7CC 1DQIA 1ZEAL 2W9DL 2X0UA 4HWUA 1I85C 1S9WB 5DHEA 4QXGH 4G1EA 2DM3A 5GGSB 5C9JA 1BM7A 1OSPH 5IEHB 1QBMH 1HZKA 1WVZA 5I8OL 5BO1L 1KLGA 2NUTB 4N22A 1TQCB 2Z34A 5JLZB 4JRYB 3FZUC 3WFBL 4CC4A 3OHXA 4AE0A 1NLDH 5AW3B 5DO2D 4YDLB 3CFEB 1WTLA 4LRIA 4NQCD 1LO5A 2AK1H 2FTAA 3TO4D 2AFNA 4YHYC 5E6YA 4MA3A 1F00I 5HYIA 3H53A 2PABA 3QQ3B 4ICXA 2XZZA 4TVSa 5D6CB 5I1KL 3EOBA 3HUJB 3PAYA 2C3VB 3D2UD 3V6OE 3U6XS 5HYQA 1MVFA 1PVHA 3MOAL 1CL7H 3KZ8A 3S3SA 1HQRB 5ESAA 4ZTOH 3LQZB 3GNMH 1MNNA 1QPPA 1LMKA 2NY2C 4HFWB 3WEMA 4AIOA 2N59A 2WVVB 4N0UE 2CLZB 2NNAA 4JFOA 4XPAH 4PGDB 4Q9RH 4NQEE 3WD5H 1DVUA 1T5XA 1FNEA 4BFRA 3GT6A 3JV6A 3U30C 5DFVD 5GGVY 1TJHL 2PO6C 3IFOA 1QEXA 4MZ3A 2Y72A 1O5PA 4PJ9D 5D8JH 2HVKA 2UVEA 3WEOA 1IGCL 3MMEA 4IJTA 4UTAA 3TO4A 3DIDA 4L3ED 2J6EH 1F4HA 3SPVB 5F3HB 3O8XB 5AVYB 3D2UA 5IG7A 2AEPL 3IFNL 4U0QB 4DIXA 1SYVA 5HGGS 3SPCA 2JJSC 2AJXH 4UINH 2NZ1A 5C0AA 3VSVA 3UTTE 1AVAA 4NJAL 1G7QB 2MCMA 4H8WC 2DWDB 1FYTB 4XO8A 4Z3TA 1BVKA 1DANU 3TYGH 4F8PA 1I1AD 5JXAH 5ES4B 4HUWB 1KGCD 2ARJQ 3BAKA 4ZBJA 4S1SL 4W9CC 5F7NC 3QCVL 1OSEA 5HYSA 2XC8A 4LLVA 1MWAL 1X7SA 2IPTL 4L3EA 2YFNA 4PCKA 3HC0B 4L1LA 4HK0B 2QJDA 2R51A 1JGIA 1KTJA 4G43A 1KY7A 2ZNXA 4KI5C 4KQ3H 5T1DH 1ZANL 1GL4B 2BNRE 4PJHF 4GAYA 4ESKA 1JZ3A 4L48A 5FW7A 3BAYA 1NIFA 5LDUA 2CU9A 5IFHL 3IGLA 1RUPL 3HNVL 2DQIH 3HTLX 3C6EA 4Z3FA 5IIEB 2F68X 4R84A 3WY3A 1I1AA 5HVWA 4YE4H 1NDMA 3B56A 1RURL 4PR5B 1P5VB 2CQVA 4KGLA 1S7UB 1TPXB 4U0RB 4KTYA 4YHOH 4JAMA 5AENA 3TASA 4F7EB 3QBTB 3KJ6H 4JFED 4ONGL 4O4YH 1P7KB 2VDOH 5HYJE 1HYRC 2D9QB 4FFYA 2WQWA 3V4UL 1YEKH 2UXFA 2ENQA 1CFQA 4ZOCA 5D4HA 1B0GB 2WBJD 3U6XA 4L9LB 1AR1D 3T5WA 3APCA 1BD2E 2VAJA 2VLRD 2WNWA 4JKLA 4NO2A 1RD6A 4WI7A 1GYAA 4O00A 3CSFA 3KPMB 3WJJC 4P9ML 1UCBL 3T6ZA 5IM7A 2Z92A 4XNYH 5FM5M 4JKMA 1KIUB 1QFPA 3O3EA 4ANXA 2A6KB 2EE6A 4P2YA 4PSPA 4JFEA 3F7VB 1JXDA 1TCRA 4RAUA 1T3FB 1FFOA 1AGEB 4XMKH 3WFCL 1UT1A 1YEGL 2O5YH 2XN1A 2OCCB 2CLRB 2WBJA 3OF6D 3AWGA 5DK3A 5JXED 2AKRB 5EZOL 2VLRA 4XP4L 4MMXA 4U4BA 2RAMA 1NEUA 3H85A 2ZYIA 3BP5A 2CH8A 4XP1L 5AOKA 3D1MC 3QPKA 1TQTA 2Q8BH 4XR8C 3UP1A 4MA1B 4L23A 1FH5L 4M5TA 5BQ7B 4QUOA 5MEOB 4Y9BA 2EH8L 5D7SL 4P5KB 5C3LD 4N8CH 3SKOB 5DQ9A 4MNGA 4IK7A 1TZGH 3P0VH 4KK9C 5CP3A 2W94A 2P44B 4OCYH 4EQ3A 3C60B 2E0PA 5EIIB 5FR3A 3C6LB 2DBLH 1J8HD 3QNZA 4BHUI 4CNIB 3PWUA 3CDGB 4OM0L 4D9QD 3JBG7 4K5NA 2VDML 3VDBA 5FWQA 4P4RB 4PMEA 5T3ZE 3P4MA 3AAZA 2X0VA 1ZTXH 2NXYD 4GKNB 3TPUA 3KXFB 1JV5B 1M71B 3VAEA 2W59A 4PJ5D 1DVXA 4JEGB 3DO7B 1ODAA 3IGUA 3ABGA 1UADC 3LRGA 3T3MB 2AITA 4WI9A 4Y4FC 4LESA 1FL5B 4JY6A 1AXSB 1L3WA 4ABQA 3QPXL 4JVPA 1J8HA 1QLRA 5IWLA 1TEGA 1EJOL 5AOLA 4MA8H 3ZUNC 4TN9A 1D5MA 3QQ9C 4Y5YC 3C2SA 3V0VB 3DARA 3QIBB 1KC5H 4KKRA 4NPJA 4R2GB 3C09C 1EDQA 2RTTA 5DLML 5DZPA 3RIKA 3VFRB 1S9WA 5IHHA 1M2OA 4HP5A 4KKCD 5AUMA 3K2KA 5GGSA 2UZXA 1M3IA 4LE8A 5IEHA 3CBRA 1HSAA 4Z7VF 2H3NA 4FL4C 2NYKA 1DR9A 3KDMB 5K39B 4LVOC 5AB2A 5HVFB 5JLZA 1RUMH 3W0WB 4GUOA 3F62A 2BVOA 3CFEA 4GW5B 1F86A 1KCVL 4XH2B 2VW7A 1IL1B 1WCQA 4UTBL 1OM3L 4DKFL 3KPPB 4I4WA 2KC0A 4IKLA 4JO1L 4JZOB 3GXTA 1WFJA 1WJ3A 3QQ3A 5D6CA 5I6XC 3HUJA 4OIAA 2C3VA 1QFWI 2FO4B 2FH8A 2JXMB 1G1OA 3LQZA 1SOQA 2RALA 4G6FB 1UWEL 2D0FA 2WVVA 4UOQA 2DQDH 4IDJL 3SGJA 4PGDA 4OLWH 4OFDA 2G3XA 1DFBL 1LVEA 3HI6L 3V0HA 3QGVA 3VX0A 1SLXA 2VXSL 1IIKA 2OL3B 1RY7B 2HYMA 5MHSE 5D7JC 2HJKB 1REIA 4Y0GA 1GGCL 1OSYA 1VGEL 3SPVA 3MLYH 5F3HA 5LGYA 4NN5C 3K5SA 1CLOH 1WFIA 3ZUCA 3QFDA 2PPCA 1Q94A 5KSAD 3HZKB 3QPQD 2JQMA 4KHXH 2Z35B 4G8FB 2GTQA 2R29A 3MBXL 3OJDA 4RGOH 4GIOA 1FSKB 2IPUG 4OFQA 3U4BL 1BPLB 1MFVA 4JM4H 3EO0A 3P4LA 3GHEH 1XZ0A 5LAXB 3AY4A 4HUWA 4RFNB 1K6QL 4MDIB 4BD4A 3GS4A 1WS8A 4KUCF 1AFVL 3VFSA 5J4MA 1FI8C 3VWJB 3EJTA 4B96A 1NIDA 1NAMB 1KGIA 4HK0A 2EYTB 5I6LA 1PG7H 4FXKB 4NCC2 2K4WA 2X6VA 1CBVL 2ZYSA 3CIAA 1EO8L 1Y1UA 5EBWB 1KPVB 4FYTA 1Q0XH 2DWYA 3NPSB 1H5BC 4OZFH 5IIEA 4LOVA 2DOCA 3IMTA 2D3LA 3SO5A 3GPEA 3II1A 4PR5A 1HILA 3CK0H 4NZUH 1MW1A 1P5VA 1A7BA 1S7UA 1WBYA 4URTB 4LNRB 3AB0C 2FGWH 4GAGH 2BVEA 4EJ1C 4F7EA 1JRHL 3Q1SL 1E6JH 2EDXA 5FGCE 1P7KA 4PWEA 3IDGB 4HS6B 4DO6A 2OYKA 5INCA 4ABVA 5KYNA 4N90D 3S37H 4QXTA 1JIBA 4Q4IA 1B0GA 3VI4B 2K7QA 4MS6A 1RMFH 3Q44A 2VSDA 2HH0H 1PKQE 3DUUB 4GFXA 4OCSH 5EEWA 1NMCB 1YAIA 3GI8H 3KPMA 4F7PB 1AYOA 5HHME 1H3PH 1IC5L 1PJWA 4FQIH 4HU2A 3GTTA 4P8QA 4HEME 3TEYA 2A6KA 1VERA 1ZV2A 4L4JA 1MCPL 5CZVH 1T3FA 1K5NB 1UD5A 1ECZA 2G2RB 1AGEA 2GBVA 1TF4A 4TLSA 2X6AA 3EJZC 5EB9A 3U0WH 1RSYA 2CLRA 1OF2B 2AKRA 4AQZA 5I26A 2RJMA 4Z0XB 5EO9B 5HDOA 1BYPA 3TN0C 2G9HA 1RK1A 3GRWH 3L2LA 1AQ8A 15C8H 4TTGA 4YSEA 4XP6L 4A7GA 1OTSC 3GBEA 5BQ7A 3NA9H 4TQ8A 3GM0A 5MEOA 1GJIA 4XNAA 5DS1A 3SKOA 2R9HC 1T7WA 5C71A 2EVHA 1UA3A 2D7OA 5BVJA 1OCCB 2YGPA 2Z6FA 4LCWD 4MXVF 3VTMA 1UOVA 3ISYA 5IHUH 3TC9A 3NACL 3C6LA 4NNPH 5C9KA 2QKIC 1BQUA 4CNIA 1KJ3L 2VDKL 1KCWA 3WCYA 1A4JB 4Z7OE 5KZCB 5JW3H 1CXKA 2W91A 4B9KC 1E3FA 4YGVA 1WDAA 3KXFA 3CAFA 8CGTA 1B3IA 1H9VA 1H15B 1JV5A 3BDXA 4J3TA 4WTZG 3PWJA 4JMXA 4OLVH 3DO7A 1NCAL 2VMEA 2V37A 3GLDA 3H2PA 1QFHA 4HPYH 4DPBX 3I9GL 2UWEE 3LQAC 3D69B 1FL5A 3LKSA 4GG8B 3U9UB 5KSVB 2OW7A 3S37X 1B4RA 4GIPD 1G6RL 3CNKA 4U1GC 1KELL 3OHXC 1A6UL 3IBOA 5J6HB 4UT9L 4TPRH 3V0VA 5I28A 3HJ0A 1Y18B 4Y16C 1D5XB 4LRIC 1RIUH 3BUPA 4U2YA 4EZLA 3QIBA 3RX7A 3BPLB 5F7LB 1OT4A 5DJXB 4B9PA 1FFRA 4XO4A 4C4BA 2F7RA 4K23H 1WCBB 5J11C 4JFTA 2MFNA 2FR4A 2DQGL 3ORJA 4B3VA 3CVHL 3EYSL 3KDMA 3ESUF 4FNSA 5K39A 5K1VA 3ASNB 4ZUWB 3AWFA 1ZHLB 4XI5D 5F7MC 1KULA 5FDWB 3O9WC 3UEQA 2VDPL 1TQBB 4XH2A 1JGVL 5SWZB 2Z0UA 3KPPA 4N3TA 4NQUA 4XAKD 3J7HA 5DC9B 4H0HB 4JZOA 5JPNA 1MNUH 3AXHA 3FU0A 5L2KB 1JPEA 1H3TA 4KX7A 1MY5A 3LEVL 5KSBF 2YIHA 3UTSB 1GOHA 4NM8L 4TKWA 1B6UA 1BYOA 4UILH 4TRPH 3PRZA 3VXSD 3WEXB 2E8YA 4ZAKD 4K7PH 5EU6B 4EKXA 4TNFA 3MRNB 2MQ0A 3CSPA 2OL3A 1XGYH 3UABA 3OR6B 3WAJA 5JPMB 3ZKXB 3M8OH 5EO1B 4LDLB 2A9CA 1PLGL 3IXTA 2DQUL 2VSCA 4Y19B 5E8EB 1J5CA 1NL0L 3LN9A 2ZWYA 1CN4A 3FRPG 4H40A 4ODWB 1F3RB 1TLKA 3PPSA 4XCFH 2Z35A 2OTUA 1QO3A 3A0OA 3DX3A 3IU4H 4WI5A 3RWGB 2CA4A 4N4YB 4B60A 2ZOOA 4NO5B 4YHMH 3DMMB 2NT0A 4ZAKA 5ITBH 4WFFD 5I74C 2FK9A 4AKOA 4CSTA 2VZVA 2EDTA 2F8IA 1QFWH 1BJMA 3GHBL 3WE1A 5BS0E 3GMOB 1X5YA 1SBBA 2DYRB 4FXKA 1P6FA 3LPFA 3JWOC 2ADIB 4ZFFB 1JFQL 4Y88A 3EHBC 1XFPA 5BZDB 5EBWA 1KPVA 1H3GA 4D2NA 1LK3L 4PJ7A 4U1HB 4XNQB 4LSSH 3S3BB 5LNEA 3ZR5A 2NUPB 4OLZL 5IJVA 1MPAH 2YPKB 3EG9A 1G1CA 3U1SH 4IRZA 3QYMA 2R4RL 5D7HA 3JQOB 3H9YA 1PPIA 3SBRA 2I32A 3MOBL 5B7MA 3VI3B 5JORB 4PWGA 3L7FB 4LNRA 2ZX7A 1YEEL 2WXGA 2Q5BA 3RJQB 3WO4B 4QRFA 3ZIYA 3VXRB 3IDGA 4HS6A 5CSGA 4M7LL 4W9LC 4AC4A 5CGYC 3VI4A 3TBVB 3BH4A 4RDBA 2WBJC 3P02A 5B3SB 3W11C 4EE2A 3DUUA 1ZSDB 3MV7B 3BKYL 4PVNA 3M1CA 2NYZA 4PB0H 3VGEA 2CSPA 3G04B 1PQZA 4QXUH 2FUQA 1I4FB 4FE9A 1Q9LB 4OGQC 1ILUA 1K5NA 2YPVH 1ZJBA 1KB3A 2A9BA 1FAIH 3T2NL 5I1LB 4OD3L 3HBPA 4QGYA 3GMRB 1A7RH 3ARQA 4BSVB 4K3EH 5GSRB 3RJOA 3QG7L 2H45A 4Z0XA 1SVCP 5EO9A 2AK4B 1E4XL 3L6FB 3GBMH 5K1JA 4PS7A 1E5YA 5EU4B 5TH2A 1BGXL 4CDGC 5CCJA 5E9DE 5KYXB 1NWOA 5MP6H 2GUOB 2R1XB 1K8IB 4MBRA 4PW4A 1CFMA 1OGAB 3P4NA 4L1DA 1V7NL 5D7KD 1ZS8B 1XSKA 5ECGA 1U8QB 1USZA 3FSZA 1NFDF 3BWAB 4BJLA 4Z9KB 4LQ1A 3K6DA 3MJ7B 2JFCA 4XCCH 3GK8L 2AEQH 4NJ9L 2WV3A 3TONA 5A2JH 5BZXA 5IWLC 2BVTA 2W5PA 3KS0H 1A4JA 3FT3A 4UV4H 1DDHA 3KAAA 3K46A 2VSKB 4EAEA 1BP3B 3S35L 2N7AA 4OI7A 1H15A 5MERA 3KLQA 2PWEA 7FABH 3NABH 4P04A 1EEZB 5F93C 1HQ4B 3CVCA 1GZQB 4AK2A 1NIEA 4APXB 1V5JA 5ISZB 1WIOA 4LPTA 4YR6A 4GG8A 2NY4B 3AMKA 4XHQA 5DJYA 3U9UA 5KSVA 1JP5A 2VXVL 2XZAH 2NX5E 5D4QA 1TQCC 4KOBA 4YDVB 4I1RA 4EO5A 2VR8A 2YKLH 3Q8CA 4HJ0D 5GJTL 2HFEB 4KK6D 1ZSHA 4YDLC 3PWLA 4JLRB 1MF2L 1Y18A 2Y4SA 1IZKA 2WZAA 2DQEL 1XGUA 1G84A 4JNXA 1T7VA 1KENL 5DJXA 2XY1A 5L2KD 3DHPA 2X1WL 4N2LA 3E3QC 5AW1B 1M6UA 4M3HA 3D34A 2VAAB 1WCBA 4X7CC 5IW1B 4XE5B 1YEJL 1YEIH 4ODUA 4LEOB 4X8CA 4BXSV 1QHQA 2JCCB 5DD1L 2CCWA 2GJZB 5D93B 5FDWA 2ZUXA 4OZHB 3SGJC 5K59E 3QJOA 1WV7T 4DK5A 4R7DB 5C08D 3Q2NA 4JN1L 1FCCA 2EUZA 4N8PA 5KVFE 3P11H 3KYMB 5JHLL 2HT3D 4OB5L 3PFQA 2X9ZA 1T0NA 4LSUH 1RK0A 5L2KA 1IMHC 4Z0BH 4MQ7B 3S3JA 3AWEA 1ZWIB 5FV1L 1S8DB 3BLPX 1FZMA 3E0GA 3O8XC 3T0BA 3WKNA 1JE6A 3UTSA 3OZLA 1VAHA 4PWFA 4JPKH 1KSRA 1YEFL 4HYTB 5SWSD 3T2PA 3NCYP 1TMQA 2RQEA 3BIAX 3WEXA 1E4WL 3QJQB 4YDZA 3CHRA 5EU6A 4X6BB 3I85A 4XX1G 4NX0A 3QDHA 5C08A 2A9MH 3AY4C 4EUPB 1LD9B 1JV2B 1IGJB 5JPMA 1T7XA 2OJZH 3HRPA 2P42B 1KMGA 2ATKA 4M02A 3IJEB 3BD5A 1VENA 3APFA 3RI5K 1JHTB 4YNYB 2EH7H 3QPQC 4HSAC 2WQAA 3RWGA 3INOA 3BRGC 1W9XA 4Y4HB 1KFAH 5I19H 5DVMA 4NO5A 2XV0A 2EECA 1HL5A 2UXVA 3PDDA 4KTEL 1E6OL 1I9IL 2ESVD 4HSCX 3DETD 4O02B 1SHWA 2MPAH 3QZWB 1TPXC 4U0RC 2IG2L 5LAPA 3DTUB 4LHQB 1DBJH 2OTPA 2LU5A 5GGSY 2ADIA 3VXRD 4ZFFA 1JZ6A 3PJSB 3U4KA 3Q2WA 2BS8A 3CZLA 1DVTA 1TJIH 2IPUK 4N86A 4XNQA 5KVFL 5F71A 3UBXI 3MA9L 4OD2A 1F6AB 4L9LC 2H1LM 4OZIF 2AV1B 3MV7D 1CD1B 2RACA 2R0ZH 4HS3B 3PDOA 3FB7A 3VI3A 4KKQA 1IC4L 2ESVA 4LIQH 4XE0A 3L7FA 2P8LA 3SE8H 1A2YB 2OULB 4F5CE 3MLPA 2E7CA 1KT2B 1Q1PA 1PDKB 3PHSA 1YN7B 3NSJA 3GSXB 2O6CA 3VXRA 2JI1A 3FW6A 5I1HH 2P4AB 1UB6B 1F4XH 4B9GA 4MDJB 1QLEL 3V4PL 2JE8A 3A23A 4PMFA 2BP3A 1A4CA 1JCVA 4LSQL 4NC2B 1MHHB 4GP4B 3TBVA 3RP1A 2WXQA 3N1GC 3MV7A 1G5GA 1ZSDA 2AEOA 4RFOL 2DD8H 3MLZH 1G9NH 4LPVA 2MMXA 2MPVA 2V3EA 1TETL 4PP1D 1GYWA 1T1WB 2B59B 3H9SE 1YNKL 3AS0A 4S0HA 1OGAD 4MA1C 3KVDD 2DQTH 3OMIB 5IMLB 3QXTA 4PGBA 3X3GL 1E4HA 2WZ5A 3O2DL 2YJLA 4LAQL 1NDTA 1MCNA 5EZJA 5HI3C 5DHXB 3LKNB 4PS4L 1RAMA 3GMRA 5DR5H 3C6LC 4N20A 5CIPB 4BSVA 4UWQB 3EBAA 2YJQA 1FGVH 1S5HB 2HRGA 4V11A 5FGRA 1Q8MA 4KZ0A 4AVIA 4QLWA 2AK4A 3LEYL 3L6FA 3PJNA 3CZFA 4ZI8A 3R1GL 2MTAA 4J3OH 3T09A 1M53A 1A7QL 2HLFC 4GXVH 4WU5B 5GZOC 1OGAA 4N26A 2OV0A 2NY1D 4JKPL 1TENA 4ZFOB 1U8QA 4X9HA 2FO8A 4OQTL 4PYHA 4D9LL 1E5BA 1P4LB 3QDMB 3QJHB 3F8UB 3RKDC 3VYPA 4NDMA 3MJ7A 1FIGH 5LG6A 1C7TA 1HIML 3SYAA 1BXVA 2XA8L 4Z7VB 1EX0A 3UFIA 2KLSA 5I1GH 2WLLB 2BVQB 4NKDA 5JOEA 3T08A 1TQSA 1CC3A 3PWNA 3RB5A 3G6DL 3QIBC 1D6VH 1MJ7H 2ZXEB 3KE0A 4N6QA 4R2GC 1JN6B 3PWPB 4BZ2L 4OJFH 2X4PA 4ZFZB 1EEZA 4Z5RB 4G7RB 1GZQA 4DK6A 2VOTA 1E9OA 1ID5I 3OX8B 4APXA 4S1QH 4LEEA 3ULAB 2IAMB 2JMRA 2WBXA 4B0MB 4L4VD 1ADQL 3AXIA 1OANA 5IHBA 1MJJB 1AHMA 3IFPB 2HFEA 4U1JB 4P5MB 1SM3H 2FBJH 4JLRA 3A4EA 4ZX4A 1TO5A 2QLYA 4R8WL 1KCLA 4IEFB 4JG1H 3ZKSD 3DO4A 2E6PA 1U2YA 1IRAY 1BZQK 1JXJA 2VAAA 5IW1A 4U1MA 2Y1VA 1UWFA 4DQOL 5IESL 4HH9A 2VXTH 3NIDE 4JRWA 4LCCA 4LEOA 1N8OE 5E6RB 5F3BA 1UA6H 3A4DA 1OE1A 1A64A 2GJZA 1WPCA 3DX4A 2HUEA 4OZGE 3Q3GB 2BNUB 2R0KL 4OTXH 5GGTL 1O0VA 1HOEA 4X8JB 4KRPB 4R7DA 4R96B 3WNLA 4AQ8A 1IAOB 4R4ND 1Z2KA 3KYMA 4B5ZA 3UO8B 1P7HL 2WCPA 4HCRH 4UT6H 2NY0B 3LTVA 2KUTA 4MQ7A 1ZWIA 3FOLB 5EWIH 2C1OB 3BFWA 3VXTB 3N04A 2PPDA 4PLKC 2YBGA 4S10A 5CS7A 4XPHL 2VWEC 4Y4HD 4K3JL 5DJDB 1MFEL 5CEXA 3ULSA 1FSKC 3BUQA 3K91A 4PJHA 2V5YA 4X6BA 4CVZA 4EUPA 5CJOL 4N2IA 1N0LB 4RFNC 1IGJA 4G8AC 3ETBJ 3MODL 3NCEB 3QNXB 3S8WA 4NENB 3WNPA 3TFBA 2CO7B 4BRVA 1KZQA 4FXKC 1FVEA 3IJEA 4KAQL 3V8CA 2P5EE 3NSYA 1JHTA 4YNYA 3BIKA 5E8PA 4RWYL 2PYEB 3MRIB 2CGRH 3NPSC 1OB1B 4DW2H 5EF3A 1D3CA 4Y4HA 4N2AA 2YSSB 4JRFA 1MHPH 5JOPE 1RUAL 3FSVA 2IWFA 1I8MB 3PXHA 2CKBL 2VZ1A 4JFHE 1AOZA 2E27H 2Q86B 1HX0A 2BIHA 2EYRB 4U6YB 3SYCA 5IJDC 4DGVL 3ZZLA 3APMA 3ULUH 2KZKA 4JKKA 3NCCB 4YUEL 3SCMB 4WUKH 5EDXA 3WKQA 3P40A 2EVFA 2ZJSH 1UENA 1QNZL 4YSQA 3VD7A 5F44A 3A6CH 3PQYE 1SHXA 5E1QA 1CFVH 1CTNA 1NMCC 4FQQA 3T3PE 4I5BB 3WHXB 3LIZL 4U3SB 3KW8A 4F8LA 4PRBB 1SJEB 1F13A 3UBGA 2XT1B 1A2YA 3LZFH 3RWEA 1HZHH 1KT2A 2GEEA 4NLAA 1YN7A 3S36L 1KPUB 1UB6A 1PYWB 5ANMB 5MEQB 2HJFB 1FNFA 4QRRB 1PF3A 1ASOA 4GAAA 4OF5A 5IQ9B 4DP7X 3JZYA 1MHHA 2BS9A 3D05A 4AYMC 5D1XB 3AABA 5I15L 3L45A 1AO7E 4JO2L 1RULL 3UPAA 1T1WA 4WTWA 1KF9B 2B59A 3PLYA 4TNEA 5DQJA 3GMPB 4Z3GA 3ZKMC 1QASA 1WUZA 2WLMA 2QVFB 3QDMD 1UWXH 4DT2A 4PS3A 3GSNH 4J3XA 1HSBB 2EP6A 1ED3A 3LKNA 4JRXE 4KWUA 3QHFL 1L9NA 5CIPA 5FYJD 4D3CL 4RCAA 5JIDA 3U0PB 1KTKE 1CGWA 4ZODA 3QR2A 1NC4B 5AW8B 4MZ2A 4ELKB 5T1LD 5E4AA 3CFCH 2G4GA 2OCJA 3PWPD 1AJ7L 5IB3A 3PP4H 3O6KL 4NUPA 5T5NF 4L8CB 2YUXA 3UIYA 2C34A 3ETTA 5DI8B 3QDMA 3QJHA 4P0DA 2MOQA 3QXAB 4IIQB 2IAMD 4ONHA 5EC1B 3BH9B 4WKZB 3TYFB 1KYOK 2B1HL 3C2AL 2I60H 3GM8A 4YDKL 1RSFA 3BT2H 2ZX9A 2D2CC 5ABDE 4Z7VA 1I7RA 1KUMA 3A3YB 5E5LA 2WLLA 1SXBA 1BIIB 2WQSA 1EV2E 1CTOA 3JTBA 1F4WH 2BSSA 2NTFB 4JX0A 4NN6B 5ADOH 3UROR 2OMYB 1FVCB 3PWPA 4IBSA 4BH8B 4ZFZA 2JTYA 4DN4L 5C6TL 5MENE 4Z5RA 3K2UL 1AIFB 2XACC 3LHAA 3OX8A 1NCWH 4MXQD 1SY6H 5CP7B 1Y1DA 5CCKL 1BM3H 3FN9A 3MLSH 5TGBB 1IBGH 1JYVA 2IAMA 1H6TA 3JWNC 5D71L 4DGYL 1FP5A 4JFFB 2Y6SC 5CD5D 1MJJA 4TLTA 5F9DC 5EN2A 4KRPD 1TQBC 2C5DC 4LSRH 1N68A 4P5MA 4LSDA 1WITA 5IFAL 4PI2A 1BVZA 4Z7QF 1MFAH 4Y8AA 4CW1B 3VFPA 5L4JA 2ICES 3V5HB 4N9OB 4LK4A 1A3LH 1DUYA 4NNXB 3VGBA 2DWTA 5TD4A 3LZNA 4K3DH 5GPRA 2VDOB 1NOAA 2QPDB 3Q3GA 4I9XA 2NDFA 4YAQB 1TVHA 3FN0H 3PV6B 5L88H 4GSXA 4X0KB 1IAOA 1EFXB 4GRMB 5JPMC 3ZKXC 2HT3C 1GHFL 3NSXA 1JI2A 3FOLA 1OAXH 2LU4A 2C1OA 1U8NA 1QQDB 1B2WH 3DPBB 4K2UL 5H37H 4YWGL 4W1TA 4M6NH 3VXMB 5KWYC 3RWFB 2Y25A 4GAJH 4PY8J 5ESVA 2MCPH 1YMME 1T1YB 5FHBL 2ADYA 4ZFGH 4KC3B 4FNTA 5E00B 1N0LA 2W0KA 3HZMB 1QSFE 4NENA 2IH8A 4GBXD 3O2WH 3DDFA 1EUTA 4F57H 4CBPA 2C4FU 3J07A 2OP4H 3QE5A 4UAHA 1QAWA 4FFZA 4Z7NE 1D2PA 1OB1A 4JQIL 1NCBH 2HFGH 2IMMA 3DX1A 5SWZE 2GFBB 2YSSA 3RURA 4LEBA 3P0YH 5KUMA 2D03H 2EE3A 3CV5A 2NMSA 4R90L 5E99L 4U1KB 1JNNH 3CXHJ 2Q86A 3LZPA 4U6YA 2OZ4L 2QGEA 2ZD0A 4GBXA 2K1MA 4Z77B 2W88A 4JO4L 3WO4C 3ARDB 4J6IA 4XPGH 3WY1A 4BIKA 1T80A 5I71B 1JF5A 2B1AH 1DQML 1OARH 4QRRD 4PJEB 4C56D 5FOBB 3ZGHA 2ICEA 1YYCA 2XV3A 4ZTPL 3GSRB 5LCVH 5IMKB 2V17H 1XQ4A 2WSKA 3NEEA 1QWNA 1OAYH 2FUTA 3ARRA 4GINA 4JHAH 4QYOB 2WOBA 4J3OF 4U3CA 1NOLA 4M5ZL 5E4OA 5I1EL 1CQYA 1M4KA 1U8PB 1T7YA 3WHXA 3GSVA 4I5BA 4U3SA 4PRBA 1SJEA 1MELA 1G1KA 4PJIF 3QQDB 1GGTA 2B2XH 1KPUA 1R0AL 2I27N 1JPFA 4JG0H 5EU3A 1ZE3C 5E1AB 2OXGB 4P9HH 3EXLA 5ANMA 4EIGB 2VR7A 4QRRA 3CXFA 4ODSL 4XMWA 4C56A 5IQ9A 3G6AB 3EOYG 5TF1L 4GH7B 3AS2A 3WIIH 4YLBA 3SDYL 3D52A 3VB8A 2AJYL 4PPTA 4A2EA 4NZFA 3VVWA 5D1XA 1J0HA 1ZPUA 1I3GH 3DRTA 4UAOB 3TH2T 4TSCL 3VD9A 2IIJA 2BP8B 4PP1C 4MZRA 3BISA 3L1GA 4NC1C 4DUWA 3TJHC 3WIFB 3NP3A 3GMPA 2EKSB 4KO6A 4XXWA 5A7BA 5FEBA 3BP6B 4QRUA 3F6LA 3MNWA 4NGHH 6TAAA 1J1PH 3C08L 2YARA 4B41A 4HVBA 1JZIA 2ZIDA 3B9KD 4MB4A 3U0PA 2H0PA 4ELKA 3CN2A 4UOW0 2ZXWB 3C5SA 3FQYA 1BIHA 2AABL 3TH3T 4K9EH 5CAYB 1KEGH 1RIHH 1A5FH 1TMCB 3CUPB 1PY9A 4BKLB 5JYLA 3FTZA 2PTTA 2J6EA 4KY1L 4IIQA 4TUUA 2OSWA 4KK8D 1A1NA 3PIQB 3BH9A 2NY4C 3TYFA 3CC1A 1ZOXA 3IJSB 4IOSD 1JERA 4O9HL 3OR7B 3B9KA 1DJZA 4U3XA 2KH2B 2AS5M 2ADFH 4WI8A 3SDAB 1SJHB 2BVPA 1G7LA 2VDNH 1NBQA 4HIXH 1MAMH 2OMYA 4PP2B 3UO1H 2QEJA 1A1OA 5AVVB 5E6ID 3ECQA 1KFGA 3LV3A 5E5MB 1I7ZB 2A3TA 3IJ9A 1J0KA 1TU2B 1I1YA 2H6UA 2Z91B 4POZC 4IOSA 2EC9U 5D93C 3MUJA 5KSBA 2J8HA 3MACH 2UX7A 1GGUA 1U6AL 3VD0A 3UYPA 2QVKA 2MNJB 3D3VB 4JN2A 3D09A 4OZFB 5DVKA 4AQ8C 1L3NA 2UUDH 3O3BB 1T5WB 2QZQA 3QHZL 1B4JL 1LGVA 1JXGA 2QR0B 4M4RB 5DD0H 5FYJU 4CW1A 4WK4B 2P3YA 1YMHB 3NFSH 5E6IA 4NNXA 4RGMB 5H35A 3DV6B 1NUGA 5LBVA 2GIXA 1HCZA 1A3ZA 4XPFL 2EQDA 5FUCC 3A4FA 2R1YB 2YA2A 3ZL1A 1HCFX 4OF0A 1DDTA 1RP9A 4UCFA 4CL7A 3PV6A 5I76A 1CGVA 1JNLL 4X0KA 3H3BC 4F2ME 1PSKL 3FH5A 5B38B 1NM9A 4R4NC 2GY7B 4GRMA 5HBBA 3NZ8B 2VH5L 4JHWL 1MN4A 1TTRA 4Y5VA 1KTDB 2NQ3A 3ULUF 4Q9QH 1T21B 3DPBA 3HG1E 1J05B 2X4NB 4XODA 3RRQA 5EOQH 1OHQA 2CK0H 4Y4HC 4DPCX 3MLXH 1OAKH 2J5LB 1T1YA 5HDBE 5DFWH 1T4WA 4WEBL 1K85A 1UKQA 3HZMA 4WCYL 4OZIB 1OCRB 2Y2TA 1DBAH 3B8YA 3OB0H 5F1IB 3R8QA 5GGVL 3X17A 2GJ6B 2VE6A 4PRPE 2X1PA 1O9VA 3US9A 3FU7B 5AL0A 1ICTA 1AQKL 4OZHE 4FOMA 3BZ4B 1RL1A 2DLEA 4J12A 1AGCB 1L7TH 1CFNB 3MRHB 2VYRE 2PCPB 5TFSH 2AXHA 2GFBA 3PGFH 3UJTH 1TYEB 2WK2A 4GKOA 1JPGB 4KKLC 4KRMB 1IFHL 2E46A 5ANHA 1UD3A 5C0DA 4NWTH 3N3EA 2VM9A 2G3NA 4U1KA 4XMPH 4KFZC 4IS6A 2LT9A 3NIGF 2DJSA 3LPPA 3Q8AA 4KRNA 3ULVH 4E2OA 3ARDA 4GXUN 2E7HA 3DI3B 2X53A 2NZ9D 4YVNA 4L1SA 4RETB 4BSWB 5DD6B 1VFUA 5DURB 5I6KA 4PS8A 5FOBA 3MKKA 3QXVA 3QDJD 5IUSA 3L9EA 1XF5B 3GSRA 5FM8A 3QCUH 1JPTL 1R5VB 2OI9B 4IDLA 3TP4A 3P30L 1FORH 5BRZE 1U8PA 5L6YH 4LQFH 3X1EA 2QHLA 1U8OB 1SN2A 2WZ6A 5F7AA 2D3JA 1Z3GH 4G42B 1UFGA 1WHPA 5ALBH 1TZ8A 4QRQB 5CN3A 4HISA 3T6VA 1A9VA 1MXDA 1P69B 3OL2A 5E1AA 2OXGA 1WTGT 1S7RA 2X4UB 5E8NB 3WNJA 4BFOA 5IOKA 5J9PB 4NZRL 4GG6A 3RDTD 2XFGB 4HUXB 1NFDA 2KYIA 1OQXA 1W16A 1XHHA 4QRPD 3CGTA 3UYOD 2MOGA 2XSKA 4G9DA 4NAMA 5G2NA 4KK5D 1UOWA 3U2SB 3IFLL 4PLJC 3VQMA 4P2OD 3CMGA 2XDHA 1LO3H 2EKSA 2WLKA 3BP6A 3BN9D 4JFDD 1W72H 3CSYB 3RDTA 2ALWA 3FO0L 1J0YA 3HMXL 3P0GB 4YSAA 4GP8B 5DD5H 3GKWH 1S4IA 1T2JA 4B7IA 1RZIB 1ZMYA 3ATEA 1JAEA 2CPCA 4HXAL 1MRDL 4NN7B 4B9ZA 2CMRH 1PZAA 1QWUA 2A4ZA 2F58L 4ZMZA 1C8PA 2G2NA 4IYKA 4P2OA 5EZIH 1R19A 3FQTB 2HWZH 1CE1H 1DEDA 1HKFA 3JWDL 5DQDL 3S4SG 4ZOBA 1EO7A 2H0JA 3UTPD 4HQQL 1DN0B 3ISWA 1NMAH 2D73A 2V5RA 3MRJA 3PIQA 3ENEA 4AYFB 4ORGB 2IAMC 2MQ3A 3TBBA 3BXNA 3IJSA 5JDSB 3OR7A 3ESNA 3L5HA 3FL7A 4XXDB 1KGYE 3D3VD 1CU4L 3THMH 3SDAA 1SJHA 1BFOA 5D7IB 2VLKB 3FT4B 4HJUA 1UM6L 2ZG3A 3X14B 5IFJB 4PP2A 1Z1WA 4UOW1 5C0JA 2W9DH 3IN2A 4QHMB 4FERA 4KZEL 2L0DA 2MNWA 4FABL 3QJFB 2CZNA 5E5MA 5HVHB 1I7ZA 4OF8A 4WUUD 2GSIA 1PBYA 5FA3A 4J3OG 5IOPB 1TU2A 3GXIA 1AG0A 5LXVA 2Z91A 1P5UA 4MNQD 2PP8A 1QZ1A 4QKTA 3D3VA 2HT2D 4KRPC 3BT0A 3WFBH 4AYGA 4YHNB 1GC1H 4PVMA 4W9DC 3O3BA 5DWUL 5I1DA 4MLIA 1T5WA 2HG0A 4FZEH 4JO3L 4M4RA 3ASOB 2FBRA 2RD0A 2PCXA 3KLHC 2NY0C 1UH4A 1F1AA 3HI1B 3KWWB 5I1KH 3OKEB 3EF7A 3FUMA 4WUUA 3MOAH 4NKIL 4CMMB 3OLEA 4PJCB 2IH1B 3F5WB 2XWDA 5FKPB 4MNQA 1WFNA 3RUGE 5K9QI 4HG4K 4PJAF 4DOHB 4CRPA 5KS9B 1XAKA 2CUHA 5FYKL 4AWJC 4BDVB 2VQ1B 3VW3H 3C5JB 1BZDA 1XIWB 2X41A 1TJHH 4AQAA 1IGCH 2HKHL 1DJWA 1QRND 1R3IL 2JKRM 2H6PB 3MVSA 3S35X 1J05A 2X4NA 5E24E 1B0RA 2AJVL 1VPOL 2OMZA 4I2XA 1RZKL 2V9UA 4JPWH 4M6MH 5FW8A 1OPGL 2AEPH 5T5FL 4L2YA 3BPOB 4H0GA 2YLHA 4KNSA 1N12A 3TNMB 3ZDXE 1J18A 3HR5B 4NJAH 2OW6A 1YNTF 2BSED 4AM0A 3QUYD 3SDXE 3ZT5A 3X2QB 5CMAA 2BDNL 4OZIA 3T2OA 1RV6X 2GJ6A 1WEJH 1DQKA 3DJ9A 3QCVH 4L05A 3GRWA 2QSQA 3FO9B 3NRFA 6PCYA 1MWAH 1R33A 1CZ8L 3FU7A 2DY2A 2GBUA 4HCIA 2WMPB 1N5YL 1FYHB 3BZ4A 3SCMC 5K69A 1AGCA 1ZANH 1ZVSB 1CFNA 3O0LA 2O5ZL 2PCPA 2F7OA 4HHAB 2W07B 1K4DA 4XN5A 1JPGA 5IFHH 1NUDA 2IDQA 3TV8A 1U91B 2Y7MA 4RMBA 4QJ5B 4XCYB 2BSEA 2WBWB 1E42A 2DEWX 3TESA 2EIJB 3QUYA 3HR6A 1KIRA 4EPSA 1RURH 3TBYB 3ZE1F 2I69A 2B0SL 3HS0B 1HHHB 4AI7A 1JF1A 1WT5A 5AVZB 4F33B 1XR9A 4BSWA 1J0JA 4ONGH 3GMLA 3TBWB 1KYDA 1N8ZA 5LJYH 1XF5A 4JMNA 3V4UH 4PTTB 2FX9L 2OMVB 1PLCA 1R5VA 3P9LB 3SBQA 5D1XC 1CF8L 2IO5A 1MCWM 3IT8D 3K6OA 2DWEB 4TOYL 1TZHB 4LBEB 5HDLA 3RZWA 1UCBH 3N1PC 4N1EA 2YR3A 3V10A 2X6UA 2LFGA 3K2IA 3FYIB 4G42A 4ODVL 3RKPA 3Q06A 5J1SC 2H1XA 1OGTB 4QRQA 1TDQA 4XXWC 5AB0A 2Y7QB 3VVVA 3MXVH 3GLZA 5C09D 1MDTA 1UH2A 3CPLA 4BHUA 3N41F 4HUXA 5E4EB 1FO0L 3WFCH 1X5FA 2AMUA 4KU1A 1YEGH 4P3CL 1HCYA 2BNQD 2EDBA 1CWVA 1JHKH 3FHAA 5EZOH 3SKJL 4OIIL 5JIIA 4LU5H 4ZUSA 5D72H 3U2SA 4XP1H 5BRQA 1QUNB 3TF4A 2LW3A 5ACMA 3RNQA 4LSPL 3VM7A 3NTCL 3SOTA 1FH5H 4WGVB 2NY3D 2EH8H 5D7SH 5IBUB 5ACZA 4E9SA 4IIQC 4A6YL 3CSYA 3TPKA 4WJ5B 4U1LA 4DEPB 1BCIA 1SMAA 4ODTL 1H3XA 1ZCRA 5DVOA 4G2AA 2YRPA 3B9KC 4LRNL 2IV9A 4BK5A 5EU7C 1EQWA 4OM0H 4AMWA 2VDMH 3BZEB 2XKSA 3BH8A 2F19H 5SX5K 1MY7A 4NN6C 3FUEA 1TZIB 1T1ZB 4G6ML 3QIUB 4Z7WE 1PLAA 5DC0A 2AEIT 3K6NA 2K8QA 2YD0A 4HGWA 4J4PD 3IDUA 5B39B 5F6IB 4GKZA 3IMRA 4YBLB 2VR6A 4TSBL 4Z7QB 1E7UA 1U3ZA 2B14A 4U49A 2PF6A 3R06B 4AG4H 2V2WB 2EDDA 3LRLA 1IB5A 2JIXD 3P77B 5JDSA 5D7LE 3QPXH 4KXAA 2H41A 1WZMA 5HDQL 1ACZA 3B6SA 2YK1L 5FC9A 1EJOH 5DJZB 2WJ5A 2F5AL 5G55A 3V6FB 4OFIA 1AD9A 4Z78B 3QP3A 2DQJL 4HLZG 5IFJA 3X14A 3BGFB 4J4PA 4JFVA 2AXGB 4QHMA 3S6CA 4FHBD 4WHDA 4YEEA 5IOPA 3U46A 5IK3B 3IMUA 3W5NA 4A38A 2K7PA 1ZK9A 2JIXA 4W6XB 3QG6B 2J8UE 5E7BA 1GPOL 1GIGL 1M42A 2I24N 4ZO6A 1XBRA 7PCYA 2RCSL 3MRCB 3GRBA 3VB9A 4FNPA 4TVPE 4AGPA 1KCVH 1LQSR 1QI3A 3EJUA 5T33L 2XPGB 4UTBH 1YC7A 2ZKMX 5DEZA 1OM3H 4DKFH 2BPBA 4BWWA 4Y5VC 5EORL 5I0WA 5LBSL 3KWWA 3U79A 5SX4I 3EDJA 3WEBA 3QJSB 2DS4A 4ZDHB 1KB5L 2BHZA 2C9RA 2IBZX 3DYOA 4UNUA 4CMMA 2FJFB 5BNXD 2IH1A 3F5WA 5T3ZH 3QZLA 5FKPA 3BD4A 5BUGA 1UWEH 4K07A 3CFKA 2NCEA 2QQLL 4IDJH 4IRSD 3C5JA 2QV4A 4HK3N 1JHLL 1OM9A 3KNBB 1LXMA 3X3FL 4PWKA 1XT5A 1RIVL 4JFFE 1BF5A 4B9JA 3WEAA 1JUFB 1GGCH 1VGEH 1ECYA 4NIYE 5KOMC 5E6UB 2ZOTA 3IGKA 5ADPH 2UY7B 4L8BB 3MDJA 3TIDA 1TJXA 2YPVA 3ZSTA 3RU8L 2E6JA 3QQ4A 1MQKH 4ADIA 4IRSA 4J3VA 4KX9A 3U4BH 3GUFA 2HKFL 4Z7IA 5DEFB 1T6BX 2KZ1B 2XZQH 4BA8A 5HJ3B 1K6QH 4UM8A 1K3IA 1AFVH 2X89D 1NGXB 3FO9A 4P3WA 3ARDC 4NZJA 2B15A 3INUH 5KTEH 4PJIB 5C0GB 1ZVSA 4FXTA 1EO8H 1BQLL 4TVPL 1YDPB 2D7QA 4HHAA 1XF3B 5DZJA 3ARWA 4HC1L 4LLDA 4NQCE 4W93A 1GAFL 2W9EL 4F1ZA 1U91A 4TL5A 5T1KD 4XCYA 3D4YA 2AZUA 3EFDH 2JKLA 3PXJA 4LSVH 4FG2A 3TBYA 1OK0A 3QZOA 4JDTH 3RL2B 3VXME 1AMYA 3HS0A 1HHHA 1ZLSL 1E4XI 3B9AA 4D9RD 1YECH 2NZ9C 4F33A 3MLVH 1J5OL 3Q1SH 4NQTA 1D5BB 5CXPA 1JZ2A 3TBWA 4QT5B 1BX2A 2G0LA 3IETB 4UQBA 4PTTA 2VC2H 3LQAL 5IUCA 2OMVA 3P9LA 1IZJA 1KV3A 4JG9A 2XWBB 2N4IA 4M1GL 3FTYA 4UAOC 2ZKYA 1XMEB 4Q89A 5T1KA 3PHQB 3PL6B 5E70A 5GGRA 4MD4B 5I5MA 1HEHC 1TZHA 4LBEA 3US0A 1VADB 1RZPA 4NLHA 1IC5H 1NMBL 4E5XB 5IV2B 5GGUA 1LDSA 1OGTA 1QFUL 4M1DL 4O51B 2E6QA 4X6EA 2H3KA 3OAYK 5CSBA 1MCPH 1IKOP 1JGUH 1S9YB 3BP4B 2Z3FA 3IDMB 4TNVF 2Q6WB 4Z95H 1KGCE 3DHJA 4U6XB 4I1NB 3W39B 3GJEA 4L29B 1CO1A 4HKBB 1KJVB 3QQNA 3CZGA 1XGQA 4JZJB 3U9WA 3IDJA 2QGDA 5I23A 3QIUD 5KVEE 1MJUH 1LHZA 4PJEE 4P2OC 1EEYA 5A6LA 4AQ1B 5KYUA 3CFNA 2JQAA 2WWNA 2PR9A 3BN9C 3CQFA 5E1GA 3ZMEA 3DX2A 4RGNE 4F93B 3DA0A 4DH2A 7CGTA 1BDYA 1IAII 4K8RH 5J8OA 3NACH 2EICA 5BOZG 4MKTA 1KJ3H 2VDKH 1L7IL 4Y9FA 3BZEA 5KBNC 3SDAC 2EUXA 4FRWA 1T1ZA 2XETA 3QIUA 1DJSA 2BOCB 2HCZX 2I9LB 5DC4B 2Y1ZA 4OCWL 2CO6B 1OP4A 2DDQL 2VUYA 1ZV5A 1URZA 1T22B 2H7WA 4PJFF 1CURA 3I74A 3AREB 5CD3A 3CTTA 3I9GH 3V6BR 1KXQA 3S36X 3P77A 1SF3A 1F1DA 3EYVA 1CR9L 5L8LB 3N43F 1G6RH 1KELH 1RJCA 3QARA 1RJYA 4X4MA 4PRID 2V9TA 3V6FA 2V7HB 3ZRCC 3WU1A 4HS8L 3BEWB 3TCTA 4LHUB 4RGMC 3TBCA 5I0XA 4L0YA 2PCFB 5KVEL 2H47C 1IKFL 3EYSH 3QG6A 2VIRB 4FFYL 3M17B 4HUVB 2R0WL 2HT2C 5EUOA 4ZG1A 5I30L 2VDPH 1QBLL 1ZTMA 2XQYG 1QP1A 4NP9A 4PRIA 1II4E 3GB7A 1JGVH 5DF0A 2YMXL 3HBQA 3X1FA 2XPGA 3N55A 4EQ2A 2NPLX 4QHPA 3LRHA 7PAZA 1BQHG 5KOVC 4AEEA 3KPRD 3LEVH 2FJFA 3GXMA 4JFQA 4NM8H 2XWEA 2J5LC 1JYXA 4X80L 4L18A 3DX8B 4XPTL 3SYPA 3G5XB 2DH3A 4PJ5E 4FQCL 2XJKA 4WGKA 4JM2F 4UDUA 1CXLA 2A1WL 5I24A 1COBA 3KYNB 3B9VA 4J3OD 4E9LA 3D5OF 2V2TA 4N6RB 4WHTB 3ARYA 1PLGH 2ZXDA 2JK5B 4OLYL 1NL0H 1OALA 3KPRA 4G6AD 2ODIA 3UBXB 2UY7A 5D1QB 1BOGA 4L8BA 4DKEL 1MCCA 5F7UA 1J5DA 3L95A 3GSNB 4WLCA 1VIWA 2DQHL 3G5ZB 5E0QA 1UYWL 1HL9A 1WO2A 5DEFA 1PZCA 3F3HA 5SX4H 2R1WB 4IBYA 2AJSH 3HA0A 4ABWA 5IJKA 1NGXA 3GHBH 2V8MA 4XN8A 1BYNA 3JTSB 3DX7B 2H2SD 2P8MB 4Y2OB 1SVZA 4MX7A 1JFQH 3V9FA 1HXMB 5EEXA 4EIBA 2OK0H 1YDPA 2W0PA 5D4JA 3RDJA 5EBMB 1LK3H 1XF3A 4QRAA 4KMTL 3QZPA 4FJYA 5J12B 5JIPA 4WNSA 3M7FB 3PL6D 1UATA 1XH3B 2CBPA 2DRUA 3D25B 3IAGC 1I3RB 3SGEH 4MCZB 2ZQKA 5TQ0L 3LXUX 3GJFB 4PJGB 3O4LE 3RL2A 5A3ID 3ZY7A 4ZW3A 1YEEH 4XBPB 1S3KL 4HV8B 2J3SA 2ZCZA 3FFDA 2VERA 3IDIB 4LZKA 1D5BA 4LASL 4QT5A 1FLTX 4PJBE 1A3QA 3S34L 1PAZA 4WK0B 3IETA 4M7LH 3V0FA 1X7QB 2E76C 3CPUA 4H20L 3DROB 4ZFQA 1GRWA 1DVQA 3DOIA 1Y0LB 3RILA 5AW9B 1AZUA 4A2HA 3L81A 3HNTL 3PL6A 4MD4A 1AQDB 3QEQB 4NNYA 2VQ4A 1CCZA 1BG1A 3V9CA 4E5XA 1OE2A 2JKWA 3AZUA 2XV2A 4JZNB 4ZMNA 4WI6A 5BV7L 3BE1H 3EKCA 3V95A 2ZWNA 1LO0L 4FP8L 1DN2A 3BP4A 2FD6H 3IDMA 2WWKT 2OPCA 2EIEA 3T2NH 1PS3A 3C6SB 4OD3H 5HD8C 1C12B 4YXHL 4LPWA 3W39A 1PCSA 4L29A 2N7SA 4BK5C 3QG7H 3OXRA 4FNRA 4RMUA 1EMTL 5I8CB 3S96B 3RPKA 4NN7C 2L8AA 1CB4A 1E4XH 1HL4A 3MUUA 2X4QB 3JYCA 3ZTJH 1BGXH 3D6GA 1TJMA 4MCNA 3ARFB 2XBTA 5JW4Q 4NHUB 5B4MD 2HB0A 4AQ1A 1V7NH 1KB9J 3LPOA 4FQPA 2NY3C 4UT6A 3Q1EA 2BHFA 4OKVB 5I73B 4J2XA 2EDLA 2J71A 1CXIA 4P2QB 1VCBC 3GK8H 4NJ9H 1JGLH 1Q9WB 1U93B 4U3HA 3HPLB 5I8EB 3KGRA 4LGPB 5CJ5A 3P2TA 4PJ8B 5J57B 1ASPA 3TV3L 4NQDD 5C7XL 1A6TB 2YPLD 1KLFA 3NSFA 4GRLB 4RFEA 2OR8A 3X12B 3K0WA 5C0ND 2TSBA 1FFNA 1XGRB 1SMOA 2BOCA 2PUQT 3SJVD 3NMEA 4JS7A 2CO6A 4J4PC 2HZHA 4ACPA 1T22A 4N90E 1NEZG 1MAKA 3L1OH 3AREA 3LCYA 4LHUD 3L4YA 3Q43A 5HVHC 1SEBB 4HT1L 1T4KB 4BYHA 4DUXA 3ULUD 5DJ6B 2K9FB 2VDRH 3QI9D 3BVWA 1NCIA 1UEYA 2CIIB 3HZVB 5ITFA 4TSAH 3RWIB 3RWCB 2WLIB 5GJTH 4UYQA 5SWQB 4ZO9A 3HI5L 1MF2H 4WSGA 2K0RA 3AGWA 5CWSA 3SJVA 3F58L 4W9FC 4WI2A 3DOSA 3FUNA 2CCVA 1KENH 4F15B 2YUVA 1IAIH 1RHHA 5L4FA 2AJUL 1BV8A 4LHUA 2XWTB 5IVXE 2BERA 2FZ3B 1U8HB 4KNQA 5FX3A 1UGKA 4GI9A 1YEJH 4HKXA 1E65A 1ZVYA 3QI9A 1YZZA 4LCIH 5IMMB 2JELH 1UWXK 5DD1H 5KBLA 2Q76B 1E0OB 5IVNA 3WNMA 3UEZA 4HUVA 2YS4A 4D7PA 5B21A 2R23B 1TSHA 3MV9B 1MZZA 1XIWC 2DPKA 2NY6D 3RE0A 1C08A 4HBCL 4JN1H 1F3JA 4LCWE 2EXYD 2ZUSA 1GS8A 1U8CB 1YNTB 5JHLH 4OB5H 3ARGD 3BGAA 4UMSA 1LM8V 4J39A 3MLTA 3T0ED 5D1QD 5DRZB 1BZ7B 2QBWA 4HG4J 4EOWH 3BPOC 3AG4B 4OLEA 3SO3C 4DEWA 3LNGA 4QIRA 1OV8A 3V0AC 3DX8A 1R75A 4H26B 1NM4A 2I7SA 3G5XA 3MI6A 1AS7A 1DUZA 1UEMA 4GQ9L 1ZLDA 1GSMA 4K7PY 4K94L 4RQQB 3KYNA 3VU1A 4E0RB 1SXNA 4WZ9A 4N6RA 1MFCL 3UJIL 4Z76B 4NS0A 1IAIM 5CO1A 3UBXA 5D1QA 3O0RL 1WBXB 2VL4A 2JNZA 3NQIA 4RAHA 3RWHB 2J56A 3RLSA 4D8PB 4X98B 3GSNA 2QFRA 1ZVHA 1MRFL 5C0EA 3G5ZA 3TEZA 1IILE 1ZGLM 2IFFH 4ORZC 5I17B 3SPJA 3WBDA 4PB9H 4KTEH 3W2DH 3IDNA 2QPUA 1E6OH 1I9IH 1ID2A 2KERA 5CJ8A 4PJCE 4LVHB 3HS0C 4MJHA 3TO2A 2IG2H 5C0IB 5JOFB 3JTSA 3DX7A 1IGTB 3GHPA 4FNLL 4Y2OA 1DVFD 5KS9E 3QEUB 4URKA 3KLDA 5EBMA 2A74B 4NRYA 5KVFH 9PCYA 3MA9H 4F7TB 4XAKE 4FN0A 1SQMA 3OB8A 2WXKA 4QRBA 3N41B 3D25A 1RJZB 3KM1A 4X9IA 3QEQD 1I3RA 3DUHA 1EHXA 1P4BL 4MVBC 5AW2B 5J0BA 2ZX5A 4AC2A 4E9TA 4Z8FL 5DTFB 4DP2X 2VWEE 4HV8A 5E9AA 3FUDA 3V0GA 3DSFL 1DVFA 3R0NA 2BCKA 3VXSE 2HT4C 1D7FA 4JVWA 4L2LA 3SOBL 5E4EC 1QLEH 3V4PH 4PLOB 1X7QA 3QORB 1C7SA 3DROA 2CHNA 3KL5A 4I3SL 1I8UA 3JV5A 1YCSA 1A7NL 1AGFA 4KDTA 4N2FA 4RFOH 5DRWB 1AQDA 3KPQB 3QEQA 3I84A 2X3CA 3LN4B 2QMKA 2YSTA 1TETH 3OKLA 5JO5B 2W0LA 1P4IL 2VDQB 1VACA 1YNKH 4R7VA 5E8OA 2BZDA 2DYSB 4PJ7E 2BHYA 4JZNA 1OP3K 4DN3H 4AUUA 1NKRA 4PV9B 3X3GH 3LSOA 3FBKA 2FE0A 1CDCA 2OFQA 2ICCA 4LAQH 3QCTL 4M03A 4U1IB 1C12A 4PS4H 3UAFA 3AT0A 3TT1H 4EN3D 1LILA 5DZ9A 3CLFL 3Q8FA 3H7BA 3S96A 3LEYH 2X4QA 2YZ8A 3KL0A 3R1GH 2EDJA 3QIUC 2C1PA 3QRGH 4O58H 4TNWF 3ZGIA 2EXWD 1A7QH 2ZAHA 3ARFA 3O2VH 2OL3L 5DJAB 1A6AB 4HKZB 2ZPKL 5F6IC 4YBLC 2QPFA 4JKPH 1ASQA 3GBNL 3F7YA 2VABB 1C9SA 2HX9A 4FYRA 4OKVA 1N5AB 3W56A 1FZJA 4OQTH 2VXQL 2X70B 5H37A 5ID1B 2L4OA 1KCUL 5ENWB 3LN5B 1U93A 5CHNA 1KN4H 1HIMH 5I8EA 4EN3A 3VXUB 3B2UD 4Z7UF 4FTVB 4G71B 3X1NA 4GRLA 5E2UL 1B6DA 3X12A 5HHQB 3BGFC 4BZ2H 4UDTA 3GUTA 5CUSL 3MLRL 2PTVA 2DIJA 3LNHA 5AYTA 4G8GE 3UBHA 3HEIB 1SEBA 5IB2B 4JB9H 1T4KA 4X7EC 2QQNL 5DJ6A 5LGJA 4QYAA 4UQEA 2CCLA 1SFDA 2OYMA 4WO4D 1OSZA 1HH9B 2F18A 4V2CB 2CIIA 1HXYB 3HZVA 5FKAB 3RWIA 3RWCA 4F58L 2WLIA 3MV9D 5SWQA 4OCNC 2UWEF 4PJAA 1Q1JL 4JL1A 1CI5A 2R83A 3F6IA 1WP6A 3LVTA 3W5MA 3KMDA 2XWTA 2FZ3A 1U8HA 3N42F 3TF7C 4X7SL 2OR9L 1QZNA 3QSKB 4DQOH 2LAGB 4NXKA 1F8TL 2YA0A 2BCMA 4BFJA 4BQ8A 4M8QB 2WANA 3NJNA 5IMMA 4WO4A 5FGSA 5GRUL 3HRZB 3V0EA 5D7KE 5LCVA 1A9EB 2R0KH 3GYRA 2O6FA 2R23A 1NFIB 2Q2EB 1DBKL 3MV9A 5GGTH 4FKEA 1EAPB 4XT1C 2EDYA 1DLFL 1G9NC 1H8OA 4G72B 4N25A 3KBFA 2HKAA 4Q6IB 2FX7L 4EI6B 2IMNA 5B8CB 2XXMB 1S9VB 4GW4A 4EDXB 5LKNA 1I9RH 2H8PB 1CYWA 1E5ZA 5DZAA 4QF1A 2Y1YA 3LD8B 3L4VA 4QOKB 1EHLL 2XQYK 1MFEH 4H26A 2QHRL 3RJDA 4Y1AE 4GT7A 4F8OA 1KIQB 2NZIA 1Q72L 1GS7A 3BVNB 1YUHB 1A02N 5CJOH 4KY2A 3DV4B 3IM1A 4RQQA 3R7RA 4E0RA 1A3RL 1BECA 3R8BB 3MODH 1VFAA 3ATAA 3LKPB 4J3OC 4CU6A 4FJ6A 3OZKA 3T71A 4V1DD 4Z76A 4U6VL 3VFVB