1D7CA

Cytochrome domain of cellobiose dehydrogenase, ph 4.6
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
190
structure length
190
Chain Sequence
b'ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLOBIOSE DEHYDROGENASE
publication title A new scaffold for binding haem in the cytochrome domain of the extracellular flavocytochrome cellobiose dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 36
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 1999-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1d7cA00
1PL3A 1D7DA 4QI3A 1D7CA 1D7BA
chains in the Genus database with same CATH superfamily
3F58L 5FV2A 1CFSA 1MRFH 4JFFB 1IBHA 3H9HA 2ZG3A 3IGFA 4N5EC 3RA7L 2W9LA 1EDQA 1HCYA 2JSFA 2GAZA 1R0AL 3OAUL 1FFTB 2BNRD 4WI3A 1QA9B 3QORB 4HUUB 2ZUTA 5BVPH 3DURB 1ZY9A 2P8MA 3KGSA 4YS4A 3GD1C 3D3VB 2CO7A 4YXKH 1HHGB 4JFFA 4ODWB 1IGIL 2D7TH 4KUZH 8PAZA 3R19A 3V0AC 5FO7B 4G7QB 4BK5A 2QQLH 2Q8BL 4JMXA 1XIWD 2VDKB 4UUJB 2R0LH 4HUUA 4TOYL 4RISH 1NH6A 1UA7A 4YFLI 2DYRB 2PMZA 4H4NA 4UT9L 2GY7B 2FGZA 4MJ5B 3W9EB 5DMIH 2ADFL 3D3VA 4E42B 3HAEH 3T8XB 3EBIA 2J1WA 3NPSC 4ODWA 3GK8L 4IMLB 2Y3NA 3OXRA 5FUCC 1JRHL 3G6JB 2BDNH 4DKTA 1XZ0A 3PQYE 3BPNC 2VT0A 2CJUH 4LCCC 5GSVB 3QI9B 3W9EA 2ZT9C 1UM4H 4MJ5A 1AYOA 5J8OA 1J5IA 1BLIA 3IJEB 5L8LB 4M6NH 5D5ME 3L9BA 3T8XA 2ZWNA 1T1XA 4AIZB 4IMLA 2I5YH 5IQNA 1WBXB 2K7PA 3DYOA 3ULSA 1FVEA 5DQ9B 5G4MA 3JVGA 3H85A 4XN8A 5INDA 1BXXA 3T0EB 3RB5A 1PFCA 2OMVB 3MRRA 2XWBB 1THAA 4LU5H 3IJEA 3A22A 4K5NA 4OZHF 1I3UA 1BIHA 4AIZA 2H32H 3ZE1E 4U1GC 2OL3H 2GHZA 2HG0A 1U2HA 2HN7B 3TPKA 1KIRA 2F8XC 3VW3H 3QIWA 2EZ0D 1BVKB 3CFJA 4YXLH 4PJAF 4O02H 3VJ6B 1UFUA 2JFCA 3HE6B 1LQBC 1M1XA 2DIJA 2R29L 4OR1A 2B4CL 3UTSB 1HHJB 1MN4A 2UUDH 3DDGA 2OCJA 3VRIA 3WFCL 3WEOA 3DRQA 2HN7A 4H8QA 4NQCA 2BY1A 3O2WH 3WDHA 3RWIA 3UTTE 5ABZA 5DRXB 5D1QC 1E6JL 1FDLL 1WA1X 35C8L 3QWRD 3VJ6A 2PF6A 1RIHL 2XIDA 3SQRA 4XMWA 4MAUL 2XKNB 2PYEA 2UXTA 3NFSL 2F7RA 2FX9L 2W94A 1BVNT 4KRPB 3GIZH 1CK0L 5F1IB 4L2YA 3AY2A 3CSYA 3C5SA 2WGXA 2X9XA 3FTZA 5AEAA 1JGIA 2FH6A 2ZUSA 1N59B 2XKNA 5ID1A 1HNYA 2P1YA 4ZMPA 4ZW5A 1DQMH 2D3JA 2F5AH 4K94L 1OP4A 4CVZB 3AREB 3CHQA 4KNTA 1D9KB 4TLSA 2D7MA 5IMKA 4RFOL 2ICWI 4TUKL 3CQQA 1N59A 3IETB 5DZPA 4J3OD 3WUWB 3EJYD 5IFJB 2OM5A 2AJZB 3B2PA 4J8RB 4V1DD 3SQOH 4AIXA 1CCZA 4CVZA 4E9SA 4MA7H 3W5NA 2NY3B 3MMEA 5IJKA 1G7JB 1I3RA 4LSTH 4P9ML 4WEUD 1CN4A 5JORA 1NCBH 1ZVYA 1X9RA 1MIMH 1A7BA 5A16B 1RURH 5J1AA 3VDBA 1WCBA 4X4ZA 3WUWA 1WP6A 5CD5C 4XMXA 3WGUB 5IFJA 3GBLA 1E4KC 2AJZA 4G59C 1TJXA 2V7HA 1A6ZB 4P5MA 4FZ8L 4PJAE 2OTPA 5KSBF 2JI1A 3O0LA 2ROXA 1EAPA 3BUPA 4R96B 2O6DA 2ARJQ 3JTSA 3G6DH 2WXPA 1GYUA 2A9AA 3L3KA 3O2VH 3OMIB 5I6LA 4J3SA 3QJFB 4KGJA 3T6XA 4LL4A 1S3KL 2WQUA 4PJBF 1A6ZA 1RUKH 5HVWA 1K6QL 2HT2C 1Q9KB 3GTTA 3LY6A 3PABB 5I17B 3EDDA 3O6FD 3DO3A 1Y6MR 1JZGA 4JFUA 1G6RL 1GHFL 1G7HA 3C60A 2F8VA 4ODUB 4L1LA 4Y1AA 3S37X 2TAAA 2IDFA 3N9GH 4HIXH 2NY2C 3ABMB 4PRNA 1T0NA 4NQEB 4Z7WB 1RUMH 5IB2A 3KXFE 3D4GA 3RL2B 3LV3B 2NUTA 3F84A 2Z0UA 4D3CL 2KPWA 3I02B 4ODUA 4QXWA 3FQNB 3MLTA 5I28A 4IYKA 1UVQB 3QZPA 1EXGA 4WI8A 3ZMRA 4Z7WA 4ZUSA 1R17A 4KTEL 5IVXB 1CUOA 2AJVL 3LV3A 3BPCA 3VRLF 1JUFA 2AXHA 2PPEA 2WWMD 3RUGB 1A25A 4AE1A 2P5WB 5EWIL 1BVZA 3I02A 4HGWB 1W0YT 4N0YL 3FQNA 5JDSA 4NO5A 3W57A 3CFKB 2PLTA 4L9LC 2EUWA 1NMCC 4H20L 3T1FA 4WCYH 1AO7D 3Q06A 5CSZB 2Y23A 1FNAA 4XN4A 1O7DC 5CJOL 1ZTXL 5JUEH 4XC3H 3WIIH 2J1XA 1U2YA 1XGUA 3RUGA 2IAMD 4PG2A 4J3OH 4NDMA 3CIQA 1YMME 2X28A 3VD1A 1TZGL 1LE5B 3K3QA 5GGVH 4YHOL 1MOEA 4BYHA 4KMTL 5J3HC 3UGUA 1OZTG 5TF0A 3CUPB 1XH3B 3SPCA 5DD0L 1I8MA 4N3UA 1FVCB 1J8HA 1FIGL 4PJBE 2R1YB 2C5DC 3GRGA 2P44B 4F91B 2GT9B 5DGRA 2VDML 1HXYB 5L7XL 5FF6A 4RDBA 5JLZB 1J5OH 1QFHA 3LQMA 2Y9RT 1NAMB 2X40A 4HXBH 2OSYA 2YARA 2RAMA 3BFQG 2EADA 4JFEE 5CEZE 3ES6A 4EUPB 2GT9A 3AT8A 1HXYA 5JLZA 4MXVF 4OGXL 3MRDB 2QV4A 1NAMA 2FQDA 3U0TA 2C1PB 1L9SA 4A7UA 5IBTL 1XF5B 2OQJB 1NMAL 4YC2B 1XZWA 2J8UF 3SE6A 2VXVH 2CUIA 2CBPA 1FV1B 2HT4C 4JPWL 4WEEA 3GMLB 3POCA 3X12B 1LEIB 3VRLE 4IBLT 2Z93A 4XPGH 3MRDA 4JN1H 2GJZB 5D4JA 2C1PA 4E0RA 1D6EA 4J1UA 4WSJA 3GNMH 4ZO7A 1YYLL 1YEJL 2RACA 5C86A 2A0LD 4B9FA 1IE5A 4ZD3H 2VWEE 3EO0A 3RWEB 1FV1A 3KPRB 3X12A 3LXBA 4JFQB 4PJEF 3U1QA 3AGVA 4ZS6D 3SDAB 4IQHA 4WI4A 1MCSA 4LARL 2WHVA 1B0IA 3NIGB 2WXMA 2WQSA 4BFKA 5KSAB 3O0RL 4HCRL 4KC3B 3SDCD 2R7EA 3T0AA 1TLKA 3RWEA 3KPRA 4ZTPL 4ZW3A 1MFEH 1N3NB 1MVYA 4FFZL 3SDAA 5GS2D 2CGRL 1DTUA 3WIFB 2QDVA 4JR9H 5SWQB 5D72H 4XAKE 1BF2A 3SYPA 2FYYB 5KSAA 1UOKA 2GBUA 4FNSA 5KG9B 5D1ZA 1L5GB 1IZJA 1UWXK 3RVTC 5HYJD 3K4ZA 1HWGB 1N3NA 1DL7H 1J1PH 5EO0B 1L9PA 3NJXA 4QLRA 4BCXA 4WO4D 3WIFA 1BXVA 2CIKB 2JNZA 5SWQA 5C0ND 4M5SA 2EH7H 4RAVB 4S0TD 4NZJA 5BZDA 3L3OA 5D2LF 2D8KA 1L5GA 1FHGA 2BWDA 2WWKO 4MXVE 3DETC 5EO0A 1R24B 2QMKA 4IGBD 5GGRB 4PRHB 1XMWA 5G4OA 2CIKA 3MRIB 2APSA 2VDRL 5D7KD 4JY6A 1BQ5A 3ARUA 3D0LA 4FOMA 4RAVA 4X5PA 4Z0BH 2A83B 1DO5A 2R15A 2VDQH 1B2WH 4XOAA 2F58L 4HU2A 4ZPVA 3Q05A 4AJWA 4G5ZH 1X5ZA 5MI0B 4W70A 3D09A 1KDJA 4GW4B 4ANUA 4PJ5E 3KL0A 1FNSH 4UZGA 4W9DC 5KYYA 4K5PA 5CJQH 3DX9B 3T6QC 3LVEA 4MMZB 1ZLDA 4YDZA 3ZQWA 3FU9A 1CVSC 4I18B 4OLUL 1JFQH 1EWHA 4ZAKA 1PTZA 4HT1H 2M1KA 1H15A 4TSAH 5GZOC 3KNBB 5C8JB 2E6QA 1M71B 2CJTA 2GC4C 2HLEB 3BVNA 4CU7A 5CR1A 4DUXA 3LSOB 3DX9A 2OYMA 2F18A 1ZXKA 2HX9A 4I18A 4QHKI 3WFBH 4Y2OA 1Q72L 4RWYL 4IBWA 3PL6D 3WEXA 4TLKA 4R4NC 3ZHFA 1SXZA 2CO4A 4NQVB 5JW4R 4G6JL 5C8JA 1QRNB 2FLRT 2C7UB 4J6RH 4NUPA 2MCMA 4Y19A 3T4YA 1NCAL 1KBWA 1T04A 4YHIB 1LO4L 2Y6SC 4XN2A 4OU3A 5F88B 4AM0B 5GS2H 1TVDA 3VFGL 2Q7NA 2K8MA 4NQVA 2IALB 1HE8A 5JR1L 2XN2A 4XWOC 1QRNA 3LKOA 4KDVA 4MQ7B 3NIDB 5T1DH 4YOKA 3TF7C 4IK6A 2ZG2A 5F88A 1IEAB 4BDVA 1ZT1B 3SQBB 3ILQD 3FFDB 4XX1G 5C97A 3NT0A 1DQIA 2DTSA 1Z0NA 4MQ7A 5I1IH 4JDVB 5A2LH 1IQWL 1Z9NA 2FEEI 2DM2A 2FJUB 1DBML 1GIGL 1IU1A 2Q7YB 1IEAA 4AH2B 3NG5A 1ZT7A 3Q8BA 3SQBA 3FFDA 3TJEH 4DP2X 2G9KA 4OB5H 4E41E 1KFAL 4WUKH 2F08A 2AJYH 2R1XA 5HYSG 3MLSL 4JGJA 1A3RH 3L4TA 5ANMB 1XCXA 4AQEB 4JDVA 4GYBA 1NKOA 4WHDA 1ODAA 3KPSB 3SD2A 3VI4E 3O3AB 4YHPB 4NENB 1IAOB 3P4NB 4WWOA 3SODB 2ZYSA 2P5EA 4NIKB 5K1NA 2CDGA 1M9SA 3VFUB 2Y1ZA 3B9DA 2BHYA 1XBRA 2JJTC 4O5LH 5EBGA 3WNLA 1GYAA 1U42A 1TNNA 4AQEA 2DV6A 3ZRCC 1MWAB 2LV4A 3KPSA 4NKQB 3O3AA 4YHPA 1W16A 4NENA 1AGEA 3P4NA 3QISA 5C0FB 4I77L 4MXQC 4NO2A 1AKJD 4OKVB 1J9RA 2EP6A 5GS0D 2BY0A 4UINL 3OMZA 4YZFF 3VI3B 1KXTA 1EZUA 5IWLC 1R3LB 2F7QA 2FHCA 3AY4A 2BSRA 2GC7C 5L2KB 5IROD 2Y4SA 2OSXA 1XGRB 1D5IL 2J6EL 4L4TD 3MRNB 4OKVA 2DWEB 4B5EA 4Z7VA 3BVUA 3VI3A 3H6AA 4M62H 1JN6B 3U7WH 2HX8A 4EDWH 4OV5A 3FNKA 2YJLA 3CHOA 5I18H 4EZJA 5L2KA 3ABLB 5KOMC 1WIUA 4YHKH 3MBED 2R23B 1MNNA 3ULUD 2C9RA 3L4VA 3WTSA 3SOBH 4XTRD 3TN0D 2DWEA 1MFCH 1YCSA 4OQ1A 2AV7A 3MBXH 1BBDL 3WTWA 1S9YA 3BO8B 3EKCA 3DC0A 2RBLA 5GGTA 1G9NL 2V5TA 1KJ3H 1WWWX 3VD3A 3P4MA 5KYXA 4J12A 4P5TB 5D8JL 5H37A 2CRIA 4K7FB 4PGEB 3PHOB 3CN4A 4NUJB 3B2VL 4QRQA 4QRTB 3UGEA 5JNYB 2QLYA 1J1XH 3GMOB 3GRWL 1MJ8L 3BO8A 5IQ7H 4HJ0D 4CUCA 5HHVH 3K1KC 1U21A 3CSTA 3BQUA 3L2MA 3PHOA 4R4BB 1H0DB 3KLHD 4LKCA 5DJAA 4U6VL 3MLXL 1RH8A 1DJYA 3L3GB 2PTTB 5JNYA 4OLZL 2AQ3A 2WIIB 4QR7A 2C9PA 4L3EB 5F72S 5AW6B 4P2QA 5BRQA 4YQXL 3IDNA 3MTXA 3II1A 3NFNB 1G7IB 2QQKH 1S7QA 3AM8A 1H0DA 4YZFE 2H6UA 3C6LC 3QFJE 1PQZA 1E67A 4NQDE 3BX7C 2X2HA 3QUXA 3FUEA 4NT6B 2FJHB 3QZWA 4NFBA 2FEEL 5JO5B 1HIML 2WIIA 3TX4A 3FBKA 3HUJB 1WO2A 1QKZL 1GPOH 4L3EA 3IDIB 5I75C 3E6FA 2YD2A 1IKOP 1JI2A 4U7SA 4U1SB 4UT6L 2BINA 4N26A 3NFNA 4WHYG 3ECWA 2V5RA 2ROYA 1IFHL 3ARZA 1CF8L 2B2XH 4PJ6A 4ZYKB 4QYOA 1GSMA 4NX0A 4AZUA 4NT6A 2AAAA 5JIDA 4YO0B 3VXRE 3GSNL 3QNZA 3HUJA 4BWUA 3HNSH 2DWTA 3LZFL 1A7NL 5EZOL 1NFDB 1QACA 4ZXBB 3RX7A 2WYIA 4U1SA 2BHUA 2SODB 2YPLB 3M17A 3LJ3A 1DVFD 1XF3A 3TYGH 3MOAH 3RWDA 4WI5A 2OMUB 2VZ1A 2Z8VC 4KY2A 4G6FB 6TAAA 3UBXB 2IVFC 4KXCA 1P4BL 3WJJA 4B9KC 2UX6A 3VGGA 3T0XA 1AHWB 4ZXBA 3P11L 3O6KL 5FW7A 3I2CL 3FUNA 4M3JA 1K3IA 5BZXA 1I9RH 4GW1B 3ULUH 2WO3B 3NPZB 1CYGA 4PRIB 5A1AA 3ZIYA 2XV6B 4S0HA 4UT7H 4PWGA 4JPIB 2FGWL 4A55A 4P46B 3X14A 1AHWA 4KK8D 4YK4C 3BGFC 2YXWA 3AACA 3TWYA 1GZQB 2YD5A 3V6OE 1UADC 5FHAH 1U8NA 2X4QB 4PRIA 3L9RA 3IDUA 1EXHA 2BNQD 3HS0B 1CLOL 4RDQF 5D4QA 1I7ZA 3MYZA 3VYOA 4OZFB 4P46A 3H56A 3HBQA 1DLFH 4KKLC 1QHOA 3TZVB 1SM3H 1ODUA 1JZJA 3GLZA 5D1XB 2VXQH 3QP3A 2XZQH 4NHUA 2VMCA 1C5BH 3D34A 2A4CA 1X44A 5DD3L 3HS0A 2VKWA 3QHZL 4RGMC 1HOCB 3QQ9D 2VLLA 4UOJA 3TZVA 4YHZH 1MXGA 5D1XA 3AAZB 1RCYA 1OEZW 4J27A 4ZOAA 3A67L 3V0JA 5TFSL 1FJ1B 3HI1A 5LHDA 2TSBA 3DTUB 5DHYB 2RGSA 2YBRB 1HOCA 5FO2A 5EEWA 1DJIA 3FSAA 1OLZA 4YFEA 1TLMA 2V7NA 1WIOA 5AZEL 2CMRH 3AAZA 2YD0A 1F02I 3IKCA 1HX0A 5C92A 1FJ1A 5D7SL 1YN7B 3SKJH 4OFQA 2X6AA 4A2DA 3IJ9A 3ET9F 4E9LA 4HLEA 1NGZA 4HG4K 1EX0A 1S7UA 1P5UC 2AANA 3O8XB 5MENA 3TBTB 4GP8B 4M1CD 4PP2A 5JW4N 2FX7H 2VDKL 3CZNA 4AUYA 3PQYD 3EJCA 2Y5EA 2UY6B 1IV8A 1TTBA 1NKRA 4XX1E 5EFIB 4DP6X 1BLNB 3OHXA 1KPVA 2BZDA 3H42H 3K2UH 2FT8A 3HG1A 4MDJA 1PF3A 2EUZA 2J88L 1X5HA 3O8XA 4XP9L 3T9WA 5AVZB 2OXGA 4KO5A 3F01A 2PABA 1NGPH 3J27A 4F80A 3TJPA 3HAEA 4W9KC 8FABA 5F7UA 3WTXA 4U3HA 4WJKB 1BQUA 2UY6A 3FFCA 2HXAA 4S1DC 1T22B 3W11D 5I1DB 3KYOA 2YRLA 4HJGA 1CDJA 2P3YA 3NSDA 3VM5A 3B9VA 4MWFB 4W81A 3GBEA 1MJJB 4TXVB 4FQIL 2B39A 3O9WD 5TE6H 5T1KD 5GJTH 3AJ7A 1Q9OA 4HZ1A 3RTQC 2R2HA 1E4JA 2ADIA 4R4FL 3OKOA 1T22A 2ZP0T 5I1DA 1NCUA 1UGNA 1BZOA 2VLJA 3PV7A 4IRSA 3JWDC 4GW5B 2YQ2A 4A1RA 3FYIB 5C09A 1IC5L 1Y7VA 2ZF8A 4PJFB 4M5ZL 4YX2L 3SPVB 1MFBH 2F19H 3F2LA 1WZMA 2WV3A 2H32A 4QWWC 1NCCL 2B5IC 2J7LA 4N0UE 2OL3A 1FHNA 1MHCB 3KS0H 4HX1B 5DD5L 4PJFA 1MLCA 4O02A 1HVXA 1J5CA 1ZLUH 3SPVA 2HKHH 2A74B 5K1VA 1KACB 5HDBF 2A9MH 2YFOA 1I3GL 1P2CB 1GC1H 5I23A 4O2EB 3UERA 1N5AB 4YR6B 4NPKA 4CBZA 1ZK9A 1ZGLB 4HX1A 3BN9D 4EN3C 2PCFB 3GSWB 1ACXA 1F5WA 1MCJA 4XVTH 5C0AE 4MCMA 2V17H 2WLJA 2A74A 4V33A 3DHMA 1NSNH 3IAGC 2X0WA 3D07A 1E5UI 5LG1A 2GBVA 4BZ2H 1N5AA 4LLMB 5GGRY 3B3BA 1XIWB 4W9GC 3ZDYB 1IBGL 4GY4A 1Z1WA 1Q94B 1ZGLA 5B1KA 2AK1L 4I89A 2YKLH 3V4VB 1BG1A 2PCFA 1PCXA 4TUJB 1F11B 5FB8A 2VZUA 1VDGA 4J28A 4NJ9L 4HGMA 1A7RL 1SDDA 2MQCA 3IFLL 2K6YA 3JTBA 4P3DA 4C58B 5IBLD 4LQFL 1DQTA 3C8KB 5IFHH 1TDQA 1XIWA 5CN1A 2JWYA 1RZ7H 1A6UL 1NGWA 1Q94A 3BUDA 5DVOA 1FL3B 5B38A 3NK3A 2WNGA 1JHKH 4N8VB 4IBQA 3DJ9A 4M29A 1PG7X 3MAWA 3QEQB 1VFUA 5KBLA 3WS6A 2PW1B 3C8KA 4IS6A 4D94A 3FUHA 1D5BB 3AB0B 4LFHD 5JXAH 1UH3A 3S35H 1FL3A 4LSVH 4U7KA 3OPZH 5D2NA 3T77A 3EHBD 43C9B 4OCXH 4CC4A 1YDPA 2AJSH 4N1HB 3T2NL 2IDUA 2E47A 5HJDA 4GG6B 2DN7A 1QNZL 4G8EB 1UCBH 2LABA 4MJ2A 3GHEH 2DQDL 4DPRA 3CZFB 2BC4B 4LASL 1REIA 2LFGA 5J13C 5HDBE 2Y06H 1BOYA 43C9A 2QQNH 5I8CB 1LL1A 2HTKC 3VU1A 4LKXB 2F7OA 1JWSA 4RBPH 3MJ9H 3Q2CA 3QO0B 3KL5A 2XWDA 3CZFA 4JJOA 1A7QH 2ZKHL 3PGFH 1G0XA 4I0PD 3QDGB 2N56A 1A2YB 2HRPL 5T3ZE 3QJVB 5I8CA 4WI0B 2GCYA 4R7DB 3N0AA 4LKXA 4GKSB 4RZKA 5CSBA 1A4JB 5I8OL 4ABVA 1QUPA 2G3XA 4N3TA 2A9NL 4OLWH 2WLNA 3S3JA 1QFPA 3QO0A 4JDTL 2NUPB 2CGYA 3FONB 2APBA 3P30L 4QOKB 2BP5M 4AQ8C 1IQDB 4M7KH 4X4MA 4JB9H 2X1WL 5BOZG 1U91A 2VE6A 4AZ8B 2FHFA 1A2YA 1B6UA 3LIZH 3QWRA 1A1NB 3RYMA 1INQB 3BPNB 2ZNXA 5D71H 4LCCB 4P23D 1BZ7B 5CKGA 1H8NA 1YN6B 3P3YA 1TCRA 2NUPA 3FONA 3F05A 4QOKA 3RU8L 4Q2ZB 2YJQA 2VLMD 1R6VA 3MODL 4NQXB 1QYGH 5CGBA 3P3UA 4ZMYA 4GT7A 4FKEA 5L6YL 3WFZA 3DGDA 2QSVA 2FB4L 1MFAL 3BVWA 3M7OA 4O2CB 4RFEA 4U2ZA 5EEVA 1CR9H 1BZ7A 1YN6A 2WWNA 4WV1B 4H7VA 1Y6KR 4ZFOB 3ZQ9A 4YDLC 1M1SA 4HIEB 2CO1A 4HCFA 2I32A 3EYUH 4U1GB 4PJXF 2OYKA 1RK7A 3ELQA 7PCYA 1MY7A 4O2CA 2FQFA 4ZQTA 1R5VB 4NOBA 3ZHNA 2L7JA 3ETBJ 4WV1A 3WKPA 5ENWA 4ZFOA 2R9HC 4V1DA 3O6ML 4HFWB 4JG1L 3T3MF 1CDBA 4BH8B 4M6OL 4FMKA 1NGYB 4KJQD 4K2UL 2X5PA 4JRYE 2DKMA 3BQUC 4WDIB 5CEZD 4JFOB 3B2DC 3ZKND 4QNPF 5C07D 3NJLA 2ZZUT 1MKFA 1R5VA 1EZLA 5D1QB 3RZCB 1NAML 2R69H 4ABQA 1NIDA 1XQ4A 3QJHB 2GUOB 4HFWA 2W9DL 4BH8A 4L8CB 1NGYA 2Q6WB 3J8F7 3AS2A 3L2LA 4WDIA 4WGVB 3AM8C 1KN4L 1GW0A 4HV8A 1BIIA 3UJIL 1CXHA 2NY1D 4P8QA 4CW1A 4ZFGH 3QUXC 3IPBA 4AV0A 4NPYA 3FN0L 5ITBH 1AMYA 5KJRH 5DEZA 4ZX6A 2AZUA 2AXJA 2Q6WA 3CVCA 3OJ2C 5T1LD 3O6FA 3O3BA 4MSWB 4X80L 3KLLA 3L4UA 4R7LA 2HTLC 2Q2LA 3D87B 5FFGA 2V3DA 4H0IA 3MYJB 4U7MA 3B3IB 2WJ7A 3HMWL 4H88L 3RVWD 3UACA 2GTZB 2UWEF 4ZZFA 2GK0B 4OZIF 1YEFH 1ETZA 3QUMB 2ZSVB 3R4RA 4GMTL 4MSWA 5DC4B 5EA0H 1IGTB 5C9JB 4JZJA 3W2DL 4WHCA 32C2B 5E5MB 2EDLA 3MYJA 4TSBL 4X6CF 1CURA 5IEHB 1MHPH 4XAKD 2GTZA 4N24A 3IN0A 2WQXA 5L9DL 2FHBA 2BO0A 4I2XA 2XQYK 2EQDA 4U05A 1T3FB 2BVUA 2J56A 4NNPH 4YSAA 4LVHB 5KEZA 1F4HA 4RAUB 3RY6C 1IGJA 4X6BB 2RCSL 1LNUA 4PW3A 32C2A 5E5MA 3L9EA 4KRMB 3AG1B 1QWUA 5JHDD 1ECZA 4UM9B 3C9NB 4TV3A 3U9WA 2P24B 2DW5A 2WXKA 1KXHA 1S7RB 1OWRM 1JGDB 1NTDA 2EH8H 4R97C 1J0ZA 4N85A 5FR3A 2IAMA 4BH7B 3QIBD 4HF5H 3ILPB 1KV3A 4U6HB 1KN2L 4YLQT 5E9DB 4WWNA 4PJ8B 4D9LL 3IDGB 1KEMH 4PV9B 2ZOTA 4UBDC 2ZCHL 5HHOE 3QUYB 4OD2B 3C9NA 3IDMA 3OMAB 1YNTF 4FQPA 4UAOB 4Z7NB 1XGQB 3IJYA 4FXKA 5E94B 1ONQA 3UJTH 2HFEB 2NY2B 2PP9A 5AW7B 3QS3A 5CEZH 4GIOA 4OSUH 1QABA 1JF6A 1W8EA 2YGVA 4U6HA 4HIIA 1N0XL 1KGIA 4PJ8A 1PNCA 3I6LE 4PV9A 3TBSA 4DGYH 2AP2A 1ADQH 2IFFH 3QUYA 2WUCL 4PJ5D 3HI5H 2QT6A 2I9TB 3GLDA 4YDNA 3C8HA 5EG6C 5E94A 3BPOB 2HFEA 1UD3A 5GRJH 4ZS7L 4XCCH 1DQKA 2X2UA 2MPAH 1K2DA 2UWEE 4P2YA 2K6WA 1J18A 2J3SA 3X13B 2YMXL 4TKWA 4L9LB 4H0GA 1E3FA 4MJJA 4E5XB 3I74A 3BMVA 4L5FH 2AJ3B 1T7ZA 5HHMB 3BYTA 4LAQH 1BA9A 4UIKH 4ISVB 1A7OL 2WVUA 1M6OA 1HCZA 2DD8L 1MCWM 5GZNC 1MEXH 4EI5D 3SGJA 2CCWA 3A6BL 4HD9A 1QEXA 4OKDA 4ISVA 2B7DT 3BW9A 6CGTA 2IGLA 4YNYA 1NWPA 2XWJB 3LS5L 1OK0A 2HJLB 2PUQT 3VD4A 3S37H 3SDCA 1HL5A 3EYFB 4XX5A 4PVNA 4R5TA 5DQDH 3O45A 4HISA 1MY5A 2BHFA 3CN3A 2APFA 3A6CH 3GDCA 4MQXC 1NFIB 2DBJA 3LNEA 1T1WA 1VSCA 3FYEB 4EKXA 1E6OL 3BAEH 1NICA 4FQLL 3LPOA 4I3RH 3QAZC 3ULVD 3EYFA 1AS7A 5HYJA 4G8GE 5K1JA 3GSVB 1MG3C 2G30A 2GABA 5EU6E 4IRSC 3ARBD 1ILSA 4QRPB 4WO4A 3B8SA 3L5WA 1CLZL 5PAZA 3NTCH 1ORSA 4PEEA 1K5NB 3MGTB 3X3FH 4GQ9H 3V6FA 5DJ8B 1B4JH 2AVFA 1AACA 4GBXC 4U6TA 1QBBA 2DBLL 4DGUA 4UQCA 3QBTB 2XIIA 4JFSA 2RTTA 5HHXL 1JERA 3HB3D 4LNRA 2NY6C 2XWTB 4ZOCA 4QRPA 1ITBB 2H8PB 1EXUA 4JHAL 3MGTA 3THML 3NA9L 3P69A 5DJ8A 2BPBA 4KKRA 3VE0A 4L9DA 1OO2A 3CK0H 2MQ3A 1G1OA 4CA4A 4P9HC 3Q48A 2J1ZA 1TQUA 1KF9B 5FCSH 3UTZB 3UBXI 2H8PA 2I24N 5IBUB 2XZCL 4XC1H 2CU9A 2J55A 1K3ZA 4Z9KB 3FBQA 1FAIL 2X53A 1TQCB 4N2LA 1E4XL 3QUZC 4UAHA 1IAIM 4PJIA 4WFGE 1UH4A 3ZE2B 2FVNA 4MFHA 5EEYA 1Z5LB 4HWBH 3UTZA 3SJVE 2W0FA 4KQ3H 1ZGLM 2ZXCA 5SX5H 5IHLB 4AYID 5JOFA 3O3UN 3R06B 4UV7H 4XNXH 2X9ZA 1NM9A 2MOGA 3VTMA 4X98A 3CLWA 4MB5A 5AZ2L 4XN7A 3IMBA 5LWYL 4JE0A 2BLFA 2YXFA 3SBRA 2I26N 4KJWD 5GGTL 1U41A 3N43B 5JW5B 4X9BA 3VH8A 1AGDA 1LEKB 5T5FA 3DTXB 4OD1H 2XXGA 4UB0H 1SRDA 3IDXH 3JXAA 1INDH 1AKPA 3EYQC 3S96A 3WKML 4S1SL 2IMNA 1D5XB 1T5WA 1Z3RA 1BM3H 4PREB 1N26A 4JO3H 4Z3JA 2VKXA 1JNHB 1SXCA 4NAQA 1P1VA 3SKMB 3ULVH 5I1EL 2XU9A 4PCSA 5KS9B 1D5XA 4A2LA 4LIQL 2X10A 1LK3H 4JZNB 5F0MB 3FCTB 5FS5A 4S1RH 2YD8A 2FZ3B 3O4OC 3TNNA 4CL7A 2W38A 1NCIA 4NNYA 3SKMA 1CU4L 4P07A 3FUKA 1HL4A 4AMKH 4PUBH 3QFJD 4MCYB 5KS9A 5DUPH 3N44F 1UH2A 3OGCB 2N0KA 4FNRA 3WFHB 1ES0B 3FU7B 4W4OC 2NW2A 2QHLA 4PTUB 1SXSA 1WD8A 5A2CA 4LCIH 1F8TL 4K23L 2D31B 4MCYA 2IQAB 5JIQA 3VXRD 5IUSA 2OXHA 1Q1JL 1DVXA 3MUJA 3UG3A 3A4FA 4G80B 1IT9L 1JXDA 1QFUL 3WFHA 4Y7MA 4IOIB 4PTUA 1IC4L 4XCNB 5EZLA 4TSCH 2IADB 2D31A 2KLTA 3A4AA 3ARGB 4Y4FD 4ODVL 5E7FA 2F8OA 1AZBA 4OBRA 4G80A 2EDXA 4BV1A 1NKGA 1CGYA 1OE2A 1QI3A 4M00A 4PAZA 5FYKD 4JKWA 2GG1A 5GGSB 2BVEA 5EU5A 4ODSH 1JDDA 3IU4L 2IADA 2ZUWA 1HZHH 3GSRB 5IROA 4QTHA 1DBAL 1R47A 3GXPA 4U1NB 2WLHA 3NP3A 2WBJD 4HG4J 4L4TA 4K3JL 3K74B 5I1AA 2IH8A 5KVDH 3MUGB 5DK2A 3EYVB 4J3OC 4QRRE 1TQBC 3O6LH 4MAZA 3PHQA 4K3GA 4OFVA 4PJGB 2Y2YA 3EJYC 5GGSA 3EYSL 5I73C 2BSED 1ETA1 3CFNA 3GSRA 3DX6B 1NL0H 4HBCH 4UQAA 1QSEE 3ZYOA 2IPUK 3MBEA 4U1NA 3TN0A 3B9AA 4R5VA 1I8UA 4POZC 4FRWA 2X9YA 4YEEA 5SWZD 4NLAA 1CQKA 3D39B 4YDVA 5E00B 4PJGA 4J3TA 3NZ8A 3NCWA 2CA3A 4H1LG 3VUAA 3SE3C 3GF8A 5IMLB 2VDPH 3BVXA 3MRHB 3CDCA 4O9HH 4UU9A 3C6SB 2IOIA 5IJCC 1IAII 2ENQA 1TPXC 5IHBA 2P9RA 4B9GA 3KH4A 2UVFA 4JRFA 3N1MC 1EAJA 2XX1A 5JA9A 2VXQA 5TPWL 1RVFH 4UQ2B 1W72B 2J5LB 2WBKA 4BK4A 1F3JB 3WXWH 4AL8L 3T2LA 1ZLWH 5I6MA 1SMDA 2JQZA 2ZOKB 3IB4A 3I6KA 5CF3A 5ITFA 1R33A 5DJDB 3ZDXB 3GS7A 5FXCH 4HCIA 5SWSE 4MYWB 1YEEH 1MRFL 1RQ5A 1IBFA 3U0PB 1HWWA 4JAMB 1SOSA 1PJWA 2A99A 4LEEA 4UQ2A 1F3JA 1JXKA 4LLDA 1CFVL 2JELL 4YSCA 4B96A 3WI9A 1OGAB 3UH8A 5H8DA 3V79C 2QPUA 3APMA 4JZJC 3AWGA 5K93A 2JKWA 3BZ4A 2OMZA 4YXKL 3VSUA 3U0PA 5JW3H 1NA8A 1G1CA 1WS8A 2D7TL 3B2UD 3CPLA 4P4RB 3GJFK 5D4HA 1B0WA 3ETBF 4LHQB 1EO8H 1JPTH 1TVBB 3BUBA 3HR6A 4HU8A 4F2FA 5EUOF 1LE9B 2UYLA 5TK4A 4DT2A 1JF5A 3H9SB 2XN0A 2WWMC 4KKQA 4RISL 5JOEA 1JZ7A 2WMPA 3NIFF 1ACCA 3V6ZB 5DMIL 5FYKH 1AP2B 1OP3H 3O4LD 4LCUA 1HSAB 2EC8A 3OG4B 1KC5H 4P4RA 1TO4A 4PJHA 5LNDA 1CMOA 1WHOA 2BDNL 3U2IA 3AGWA 1RK0B 1FE8L 2CJUL 2N1KA 3H9SA 4RRPA 5DC0A 2IAMC 3ZPDA 1QPKA 3MCKA 4LOFA 3WN5B 4UOW0 4AY0A 2I25N 4KQ4H 4M6NL 2DTML 1MCWW 5CEYB 5FECB 3T0VA 1HSAA 1EIBA 5DO2C 2I5YL 5EBMB 2XY1A 3RNQB 3RVUD 4F7MA 4Y4KB 3MA7B 2YR3A 4NP9A 4X9YA 3D33A 3BT0A 5JTWA 3FT2B 1ZE3H 4N2IA 3RPIB 2DWSA 3WN5A 3V0WH 1IGMH 3VXNB 5CEYA 2ADJB 2KUTA 3QT2A 4FQXC 4ORGB 4JJHA 2GI7A 4WJ5B 2OL3L 1ULVA 4Y4KA 3V5DB 3VW3L 5LDSA 2LE9A 2MCPH 1E5BA 4C55A 5FO9B 3FT2A 4U2YA 4IOSD 3RPIA 4AGNA 2BNQA 3KBHE 4YXLL 4O02L 4JFZH 2VSDA 4NWTL 4ZMLA 5E8PA 2YQ3A 2ADJA 4ORGA 1HEHC 5A2BA 3LXAA 2H9GA 3Q7JA 4KI5E 1KLFB 2KQMA 3QQ4B 1GGTA 3O2WL 4GQQA 5FO8B 4Y89A 3TA3C 5E2VL 1A9EB 4QHMA 2FTAA 5FO9A 2WNWA 1I3VA 4MB3A 4WW2F 4L4VD 3PNWB 5KN5A 3BPLC 5C0AD 1T21B 3JV4B 5BUPA 1PZDA 1G87A 4ONGH 3GIZL 1IAIL 4KKNA 1AD9B 1YYMH 3OM3B 3OBAA 1KPRA 1HHIB 1A9EA 1PSKH 5C9KA 3BKYH 3GWJA 1LP9F 3K4AA 5HI5C 3PNWA 4PI0A 1T21A 1L9RA 2IGTA 3JV4A 1O9ZA 1LLAA 2HUHA 2FH8A 1DQML 3PNRB 4M6MH 4PJ7A 2F5AL 2ED9A 1GVIA 4GXUM 4WTZG 4JM2F 1GGIH 4LPYA 4N0FB 2WZ5A 1NINA 3MLUH 2VLRB 4YK4B 3ZSTA 3TIDA 3VG9C 3B7TA 3SDCC 3EW3B 4GRMA 4OCYH 5LXVA 4KK9D 4JPKH 1DQQA 4LO9A 1YQVH 2E7LA 1F56A 4FMFA 4NZDA 5LN4A 1UWEH 1GY1A 2O1AA 5D5MB 3SQOL 1EEQA 4MA7L 3PJSA 4PSRA 1B2YA 4LSTL 4F15C 1RERA 3PQYA 3PUCA 4N9GA 1MIML 2E8YA 1RURL 1YY8B 2IDCA 4PJDF 4XMZA 4KKCD 4KFMA 2J1KA 3R4DA 3GBNH 3DUSA 3WN6A 5I74B 1K8IB 1VEPA 2CHZA 4UOW1 4WFEE 4RGMB 2OK0H 1OB1A 4X4XA 2HLAB 5IVZB 4K3EL 5F3HB 4A7SA 5T1KB 3OQ3B 2WLLA 3TT3H 4BQ8A 3QR0A 3G6DL 3ME0A 3O2VL 3NN8B 43CAB 1ZVSB 2Y72A 2VLKD 4I0KA 2MFNA 1YY9D 2RFXA 2ZJSH 3AUWB 4PJ9D 4IGBC 1K8IA 4M48H 3Q2NA 4RIRA 2FLMA 1NWOA 2ZKMX 3SDDC 5A43C 2OR9H 2GB2A 1CIDA 5F3HA 3S4SG 5T1KA 1L9TA 4YL4A 1AZRA 1LO3H 3UTTB 1FZMB 1MIEH 3QCTH 1ASQA 4H8UA 3OKKB 5T3ZD 1OPGH 3INOA 2PR4H 2ZE0A 5MEOA 1TZAA 2GIYA 4HIXL 3SGKA 4B3EA 1NIEA 3D4CA 3OG6B 2Y36H 1LP9E 1X5GA 5B8CC 3DVNB 1PY0A 4APXB 5EOQH 3V55A 4Q6IB 1P5UB 4IJTA 3UTTA 5K5YA 1FZMA 2MRYA 5C7XL 3M7FB 1ZHLA 4XT1C 2Y1YA 4L1DA 5HPMA 4NYLB 5I0YA 2PPCA 4NP4H 2VC2H 2VJ8A 2X4PB 1C8PA 5GS1B 3RZWA 3BCFA 5ESVB 4LK4A 3EFFA 4FEMA 3VXOB 2GSIB 5CP7B 4OJFH 4JFVA 2Z31D 1GCYA 3D2TA 4M7JL 4YBLB 2VUOA 4NYLA 3PL6C 2GJ6D 3AADB 4WCYL 4ZODA 2X4PA 4IRJB 4PMFA 2YWYA 5JUEL 2R2BB 1TO5A 1YEHH 2CBTA 3MV8D 4LCVA 4XC3L 5ESVA 4ELKB 1ZWIB 2GSIA 4X7CC 1CLVA 4OZHB 2BWQA 3BOVA 3FH7A 5KVEL 5EULV 4Y5VB 4ZFOL 3KM2A 1WFNA 4DJMA 4JFHE 3RTQB 5GGVL 4NAMA 1MLBB 4IRJA 3QWQB 4RGNE 1F45A 2YC1B 3FO9B 4AGOA 1HT6A 4PJAB 1HSBB 1NEUA 1WE5A 3JWOL 3KJ4C 4JRYD 3R8QA 1KIPA 2DMKA 4G6AD 2ZXEB 4AITA 4ZMNA 2QVFB 4WHTB 1B9ZA 1KTDB 3E3QC 3P02A 4OJDH 4R8WH 5CCKH 3B34A 2B5IB 5JPNA 3Q5OA 1AFVH 3TWCH 2VXUH 2HH0H 3I84A 4HPOL 4JS7A 5D4IA 4ALAC 3VVVA 2O26U 2YC1A 3FO9A 3KPMA 4F58L 4HXBL 3K6DA 4PJAA 3QEHA 2Y5TB 3OQRA 4NWUH 3OLIA 4UTAH 2ERJB 4WHTA 1I1RA 2B1OA 3CX5K 4E68A 1SVCP 3BSHA 2ZWKA 5I0VA 1T2QH 4N28A 2PO6D 3B56A 1INEH 4Y8DC 4ODXA 4AKPA 2XV3A 5CM1A 4PLJD 4H0LC 2R69A 1KGCD 1TYRA 3EDKA 4FG0A 4XN1A 3KXFB 5ILTH 4AXWA 4EN3B 4YHNB 5A7BA 3L17A 1YNLL 4KROD 5T3ZH 2VXVL 1WV7T 4EAEA 4GEIA 3CFDA 1W6LA 4KUCD 2WB7A 4XP4H 2WNKA 2VL5A 1Q9WA 5IF0A 4XPGL 2FNBA 2ZG1A 4XPTH 2VITB 2IG2L 5L88H 1KTBA 3ENEA 3GNML 4L1SA 3SCMD 1PJ9A 3QXDB 5AAWC 3ZYJA 4YHNA 1JV5A 1N2RA 4MNGE 5T1JA 1LDPH 5E8OB 1M05B 4ZD3L 2ARJB 3ECBB 3SO3B 1HDMB 2DQGH 4I0PA 3FTUA 4PR5A 4QRAA 2EINB 2WLIA 4PWFA 2J8OA 2XBZA 4LOVA 3L7FB 3S6CA 1XF2B 2ZF9A 5DXWA 4K7PY 3QXDA 1A4AA 4A7GF 1N18A 4K9EH 3T6VA 5E8OA 5E8NB 1CDYA 1M05A 2XC8A 3ECBA 2KL6A 5IROC 3NBNA 2DI9A 1MFEL 2NW3B 1MDAA 1VGKA 1NIBA 3D30A 1U8IB 3MJ7A 5KSBB 1YMMB 1OW0C 4NUQA 1XF2A 4P23A 5D72L 3T4AB 3AG4B 5IUCA 2QZ5A 3IJSB 5LG6A 5E8NA 1QBAA 2ZCZA 2OP4H 3IDJB 1TTAA 2EVHA 4GRLD 5B39G 4PJBB 3ZO9A 3ULUC 1J1PL 4XTRC 1RP8A 1ACYL 3OWRA 2EDDA 2L3BA 3T4AA 5FUOH 1TT6A 2Z1PA 5BRZE 5JPMA 2EH7L 4Y9EA 4OUUB 2Q9OA 3ZZQA 5T33L 3GXIA 1N0LA 5F21B 3OAYK 4PJBA 1F0LA 2D3LA 4JFEB 5DR5H 1C12B 1WGOA 1MWOA 1FYHB 4BFJA 3FAWA 4DZBA 3TEYA 3I6LD 1MCLA 4NJAL 4OVUA 5I1LB 4R6UA 1KJMB 4OLVH 2H1PH 1PMYA 2XY2A 1RZFH 4HJ0C 4Z0BL 5IW6A 1OSYA 4OUUA 3VMPA 3ARRA 2VDQL 1B2WL 1HOEA 4ADJA 1NJ9A 3ARDC 3SBQA 3BRGC 3WELA 4HWUA 3KLHC 1C12A 3D0VB 2OW6A 2AC0A 1QSFB 2Z7YA 1BFVH 5I5MA 5F89B 2NXYD 1ADQA 5LBSH 1FNSL 2FBRA 1SQMA 1FRGH 4ATWA 2NQDA 1JFQL 2CIIB 3O2DH 2V3EA 4EF3A 3IDYB 3I3BA 1PG7H 3DVFA 4TRPH 1OLLA 1O5DT 4R3SA 4TSAL 1WCQA 1YLBB 2EVFA 2A73B 4HQQH 3BDBA 4C56E 2DMHA 2NT1A 4KK6D 3ATBA 4J4PC 3C5JA 3G6JE 5T1LA 3WFBL 3AT0A 1BAFH 2CIIA 4JKLA 3DTDA 4B60A 4HLZG 1Q38A 3ARFD 5DUJA 4OI7A 4ATTA 1SLVA 2BVQB 4I5BB 4WWID 3D2UD 4J6RL 2A73A 1ADWA 4O4YH 2AABH 2EDRA 1EHKB 3W9DA 3RDJA 3FB6B 1D5RA 3BIKB 4MDRA 1DVFC 3ALPA 1BQRA 1E5AA 4XWGL 3DBXB 3DJTA 1MCRA 4XMLH 5FFLA 4FJ6A 5I1CL 2YAFA 5EPMB 4BA0A 1OSZB 2Z65C 4ESKA 5CZXD 4AENB 5C6PB 1FZOA 2GFBB 4QCIA 5K69A 1E5YA 4JUTA 2EE2A 2DQHL 1OM3H 2C3VA 2HFFB 4GRWF 1NUGA 3BIKA 3QG6B 1FPTH 3ERXA 3OR6B 4G8GD 4YUEL 1KB5B 1QZNA 1SLXA 2QFRA 4NNXA 1R3KA 3MV7B 5EPMA 5EU6D 1OSZA 2KKQA 5HGBA 5E1AB 3EO1A 1F4WH 4XNAA 3UTSE 5I1IL 2J8UB 5JHDA 2X4SB 4MHHI 2VQTA 4HVBA 1RZIB 4ZMOA 3ZTJG 3C8DA 1G7QB 2FSDA 3L3IA 2XBTA 4H8WH 3QG6A 2NR6D 5CGYD 4ZFFB 1KB5A 3RGVD 4FCHA 3ZT5A 4OB5L 4WUKL 2EE9A 2B77A 5E1AA 1A3RL 4B97A 1C1EH 1N6VA 5CIPB 4AW4A 3CIAA 1IM9B 4PJ5B 3WMPA 3L48A 3OKLB 4A2FA 4ZFFA 2CXGA 1PLGL 3NRQA 1J05B 4QXVA 4GQRA 2ZXBA 2XDHA 1YYCA 2XG4B 1OTTD 4KXBA 3VFMB 2X4RB 4YHYC 3S2AA 3QQ9C 3U46B 3MOBL 4PJ5A 2ALWA 3AMLA 3OKLA 1M53A 4DP4X 4WFGD 1JRHH 3IMUA 1J05A 4KRNA 1GC1C 5B1AB 3V52H 5L2JA 2XG4A 4MNQE 3VFMA 4CU8A 3SJVD 4KPHH 3U46A 2CO3A 2DQMA 3RWGB 3ML9A 4F5CE 1RJYB 2ADYA 2G5BB 5DEJA 3C09B 3ZTNL 1AI1H 4DPCX 1MRDL 2XQYG 3CPUA 3QIUB 5ACLA 1ZHKB 1Z9SA 2NX5B 1SJEB 2OSWA 3COOA 4GRWE 4E9TA 5E6IB 1ZSDA 5T5FL 4M62L 3BISA 3KE0A 1EVUA 4HWBA 4Y4HC 5D2LB 3U7WL 1EUUA 2F68X 4EDWL 5LXGL 4YVUA 5I18L 4EVNB 2G5BA 5DTFB 4M1CC 3FB7B 1NLBH 2C1OA 4FQHB 5JZ7D 3WYRA 4ZUTA 4LMQE 2BMKB 4EI5A 5I1GH 3SOBL 5FDYA 1XXFC 2P48B 1FH5H 1MFCL 3JV6B 3H0TB 1KXVA 3QIUA 4Q89A 4LSRL 1ZHKA 5IEKB 5KBKA 1CYXA 3MBXL 3FF8A 1S78C 4AMXA 3T08A 1JV2B 4OZ4B 2WZAA 3KEDA 2B4CH 5G2NA 3U1PA 3BJ91 3TNMB 4N8UA 3WFCH 2BMKA 5JHAA 3MR9A 1ASOA 1E28A 3B7RL 2RJMA 1E6JH 4ZMZA 3VXMB 3ZT7A 1J1XL 3SKNA 3W11C 3VXQB 4F93B 4E41B 5IQ7L 2EICA 1MI5E 4F2ME 1LEGB 5I6PA 3HC2A 4N2BA 4PGBA 2EECA 5HHVL 3TNMA 3VI4B 4TYUA 5CGMA 3O9WC 2GBAA 2VDLB 3PLYA 4APQB 1RZGB 2R2CA 1XL4A 1CD0A 4ZO6A 5EO9B 3VRJB 4I88A 4I1PA 2E8ZA 2XETA 3HB3B 3VXQA 4E41A 1HAUA 2XVKA 3CSBA 4DK3A 3ARBA 3CH8A 3CE1A 2NNRA 1LEGA 1NIAA 2AQPA 3VI4A 1S7VA 2QQKL 4DP1X 1IEHA 4DN4H 4YL9A 3OHMB 4APQA 4FQQB 2JQMA 2P5WE 2YSTA 5D96C 4HDIB 4X7DC 2XWXA 2EO9A 4ZPTA 2ZXDA 1GPOL 3WJLC 3FHQA 4JQXA 3UAJA 1CTNA 2MIZA 2A6KA 5ETUA 4EN2A 3CHSA 4JRXE 1JF1B 1SDYA 2CAKA 1KGWA 5GS0L 4L0PB 4HDIA 5ID0B 1LM8V 5AKRA 4V2CB 5I15H 2E7HA 3AU1B 2JJSC 1V3JA 4DEPB 4HKJB 4LVOC 3VXSE 4F7EB 3ZTEA 4OCRL 4FZ8H 1JF1A 3BUTA 3UAEA 1QASA 3MOAL 4ZZKA 2JE8A 1NUDA 3OX8A 5ID0A 4HUVB 2R56L 3AU1A 3KGUA 1G4MA 1GZHA 4QRRD 5CWSB 2WVSA 1ZJBA 2G5UA 1OP5K 2FJGA 3U9PH 1D7BA 1I9RL 1MZZA 4Z3GA 4WWKD 4YDJB 4KITB 3ULUL 1A9BA 3BQVA 1I7UB 3GB7B 5FYJE 4Y5YC 1GSKA 5IG7B 4ZJ9A 3CBJB 2VN3A 1ZEAL 3MRFB 3SPHA 4NS0A 1DDHA 3IU3B 5JPNC 2W07B 1IM3D 3VSQA 3PWJB 5GRYA 4UQIM 1EPFA 2R4SL 2NY6B 4PY7B 4OFIA 2KHAA 4XPFL 1M9WA 2Z8WC 2WYTA 4G2AA 4LDOB 5FM8A 2EDNA 4PWEA 4W9ZA 5IJVB 5F7DB 1DLFL 1BJ1J 2W07A 3DPDA 4I9WE 4N2HA 3EHBC 2VXQL 4YSSA 5AWNH 1KLUA 2OI9B 2XZQL 1M4KA 2YUWA 2O30A 1C5BL 3PXLA 1OT2A 3GMRA 3BLBA 3BUIA 3NOIA 1U8JA 2AJVH 2V8LA 5B1BB 1FH2A 5I6OA 2H2SC 3HS8A 2YLKA 4NQDB 4ZMTA 5DLMH 3NCFB 1UD6A 5F7DA 3FQTB 3RDTB 2AF2A 5TF1H 1GMEA 4YHZL 1DQJA 3ECUA 1KENH 3UYRL 5D6CB 3FUJA 3QUZB 4H20H 4WF7A 4JGNA 1ZTXH 4OLEA 5E6YA 3VWJD 3G9VA 5DRZB 3QFJA 3QO1B 2JVUA 4NQDA 3EO9H 4GH7B 4AJVA 3FQTA 1O6TA 4XPHH 2W95A 3VXRB 4Q56A 3II3A 2WKOF 1SYVB 2CMRL 4DEUA 3BESR 4NHCH 5IW1B 4NO3A 4P49A 5D6CA 3OKMB 1SQ2N 1TZGH 3TF4A 1I8KB 3FQ4A 1WS7A 2XQ0A 2Q20A 3HRZC 3GSXB 3L9YA 4N22A 4A37A 3EJZD 3SKJL 4CRPA 5BQDA 5DVKA 4JFXA 3VM7A 3VXRA 3RVXD 4MJ6B 5IB1A 1ZV2A 3BRDA 5IW1A 3B5GA 2F53D 3OKEB 4Q58C 3OKMA 2P52A 2VDMH 5L7XH 1BJ1H 1WC7B 3QQNA 2FX7L 3G7TA 3GSXA 4P23C 2V0AA 3FU5A 3FCSB 1JZHA 5C0IB 2W60A 3EH1A 1JK8A 3LEYH 4UMSA 4MZRA 2J20A 3ARXA 3LPWA 3H42L 3K2UL 4Y4FA 5DCCA 4MJ6A 5I82A 1G4RA 2BVYA 4XN5A 4PRHE 3UP1A 1NGPL 4OGXH 4NOFA 5C0IA 2Z3FA 3ZX1A 2VERA 3VDCA 3CZSA 1J86A 5JIKA 3Q2VA 2R1WA 4HWEL 3VX0A 1MHEB 1JWUA 1G7PB 2ITFA 1EDYA 4TF4A 4A2HA 3KVDD 4D7BA 1FNLA 4HK3J 4AQOA 4QT5A 1KJVB 3FQRA 4CNIB 4YDMA 5CZVH 3KLAB 5A6LA 5TE6L 2R39A 2BSEA 1SY6H 5H4YA 2PWDA 1T1YA 2CO6B 3W0WE 1HZKA 1MHEA 5HGHA 1BEYH 1G7PA 1XO8A 4ZNEE 3K5RA 4R26H 2FJFA 3BGMB 1JGEA 3ZKNC 2K4WA 1HXKA 3U9UA 4KI5D 4A2MA 2ED7A 5KW9H 1MFBL 2D7OA 2F19L 5E70A 4HSAC 5FIEA 4FYTA 5IR1B 1AJ7H 2YOCA 2HRLA 4HCRH 3GXMA 3CVBA 2CBOA 2DIAA 4U6XB 5D9SB 5EIVA 4Z3HA 3QNXB 3NJMA 3HRPA 2VSKB 4WW2C 2Q10A 5FKPA 3UL4A 2ZUXA 3WNPA 2NSQA 5DFWH 2HKHL 2CGRH 3CU1A 1PDKB 3VCLB 1W2KT 1KTKE 2I27N 1IUZA 3H55A 3EGXB 4GO9A 1LO5A 2DIBA 5D9SA 2WVTA 5B3JF 3NCMA 3JYCA 1XF4B 2VXTH 3BWAB 3LH8A 5DS1A 2C8NA 2WZ0A 4S2SB 3WLBB 5C3LD 4NIYE 3X11A 2V17L 1U3HC 3FS9A 5HY9B 1PDKA 3VCLA 1IX2A 1NSNL 1QW9A 4JM2C 4NC1E 3DX8B 4RQQB 4WEMB 1L3NA 5KZCB 1YRKA 2AEPH 3CFIC 4JG9A 4HIHA 4AWJC 2Y0SA 1Y0LB 2JIXD 2AQQA 3STLB 1G43A 2AEIT 3APDA 2VDRH 5IFHL 3BZ5A 2ZNWA 3TV3L 3TFKD 5AVWB 2NQ3A 3IRZA 3G5XB 1JMXA 4X6EA 1RZ7L 4ZW7A 4AIEA 2IPUG 4PRDB 1WFJA 3QJOA 4JDEB 2YUVA 4KRLB 2F58H 4PHZA 1JHKL 4DERA 1Y0LA 3W38A 4HUKB 3STLA 3Q6FB 3JWNG 3O4LA 4UM8B 3MTRA 4NZTH 2BWIA 1TPXB 1SFDA 1LO2H 1KJ2B 5JXAL 5DMKB 5HYSA 2G75A 1XEDA 4Y1TA 3QIBC 3OPZL 4JDEA 4RGNC 5DD6B 4OCXL 2KT6A 5DK0A 4M7ZB 5KBMA 5IQOA 2QFPA 2JKNA 1H5BA 3OB0K 2WD0A 1V27A 1TR7A 4W9CC 4IU2B 3WY2A 4Z77A 5FGBA 4CSPA 1UCBL 5DJXB 3IJHA 4UV4H 3GHEL 2YRZA 1KJ2A 4N0UB 1BFOB 4QLWA 3IGAB 1F18A 4XO9A 2NNAB 4J7RA 3S5YA 2QQNL 1RIVH 2OYLA 4LESA 5IIEA 4XP1H 2ITDB 4IU2A 2H2PD 5I5IA 4BXVA 5DJXA 3HJEA 1P5VB 3LEXB 3HC0B 4A39A 4BUHA 4N0UA 3I9AA 3IGAA 1A7QL 3PGFL 4X7EC 3CX5J 2BOBB 1LO4H 4IOSA 5E95B 2HYMA 3RJDA 3MQIA 4DVBB 2HCZX 3KW7A 3CDFA 4OLWL 1I85A 5C0AB 5CZRA 5IM7B 2ITDA 2BSBA 3IMSA 3WEAA 5D7JD 5C0BE 2C4FU 3UG5A 1P5VA 3RGHA 2E9BA 2E27H 3HC0A 3NSJA 4AYFB 5C71A 5F7KC 3FRPG 4Q6KA 3LIZL 4HC1A 4DFHA 1IE4A 3D4ZA 5C0CE 1IZKA 4QY8B 2D2CC 5ISZE 2IXQB 2AW2A 4FG6D 3BSGA 5D71L 5C0AA 2KDGA 3KBPA 1P69B 3BP7B 2O61B 2E7MA 2LAAA 1MVUB 1T89C 3VYNA 3QC5X 4AYFA 1MAMH 1AGCA 1I1AC 1QYGL 2DQEH 4UZSA 5DSCB 1DBMH 3ZN6A 4JDZB 2KZBA 1KXVC 4QY8A 2ZX6A 1XB3A 3NESA 3ABKB 3S2CA 1KFAH 2HKAA 5CSGA 2FSEB 5DMGD 4BXSV 1IKNA 1JGLH 4G1EB 3MLSH 5IJDC 1MVUA 2DY2A 5FEBA 1V3KA 2K3HA 5DJ6A 2OMTB 4JDZA 4D8PB 2YAQA 3US0A 5KVMC 2WN2A 3GLEA 3PWPB 3DECA 4D9QE 3E6HA 5BVJB 4HOMA 5HD8D 3SY0B 5LAXB 3NACL 1A3ZA 4M43L 3AQYA 1RPKA 1JJUA 5BOJA 2KQNA 3ULVC 1PAMA 5FGRA 5HDBB 1DE4B 3CX2A 3TA3B 2R69L 3U30C 4C83A 3ARBC 3SY0A 1AZUA 1ETJA 5HI3D 2DYPD 5FC9A 3T2PA 1YPZF 1RMFH 1CDGA 2C34A 5JQHC 4PLNC 4U6YA 4UTAA 4XPBH 3RVVC 1D5IH 4D7PA 1XR9B 2YAHA 2VLKA 3LB6C 5ITBL 2J43A 1BBJB 1KYUA 1A6VH 4EI0A 1GYCA 2YPLE 2FECI 3UZEA 1RJLB 2OBGA 1XL6A 4XVOA 5F9WC 1BVOA 2EABA 2BCMA 1KWKA 1BXUA 4WUUD 1HH6B 5IV2B 1BBJA 1B4RA 3MV9B 5FPIA 5DMYA 1XB8A 1OSPH 5E8EB 5IQLA 3MCLL 1G9NH 1YEFL 2V2XB 1RJLA 3VFNB 5EA0L 4XVSH 5DI8A 1BZ9A 2JTYA 1HH6A 2VW4A 2Z31B 1KCWA 4WFFE 4F15B 4QO1B 4X5XA 4N68A 5I66A 3Q5YA 1MHPL 3GRWH 3CLFH 2HPTA 1CFQB 4I1NB 5E8EA 3V4PB 5L0QC 1HCFX 4NNPL 4X99A 1YG9A 2IBBA 4GSDH 3HBZA 4N8CH 2Z35A 3UYPB 5D7IA 4NRYA 3KH3A 4IKNA 2PCPB 2Z31A 2VAAB 4LHUG 1P6FA 4N2NA 1QOKA 4B9YA 3STZB 4XRCA 3D85D 3DVGB 1CFNA 3TO4D 5CBAA 2A9DA 4AGPA 1CFQA 4X9HA 2VMFA 3LYRA 2EH8L 3D48R 3CLEL 1BFSA 4MZIA 4YQXH 3UYPA 1V7NH 2AJXH 3GEFA 4N90E 4HF5L 2V2TB 1ZAGA 5JIIA 3FT1A 5F1NB 1UEYA 4YSEA 1KEML 3QG7L 1PX4A 3N1FC 1RZPA 2YLHA 3LPPA 4GFTB 1QUNB 4BINA 4EI6A 4R7XA 4JFFD 3GI9H 3FOLB 5BV7H 5JMOC 1NDTA 2X4OA 3UJTL 5CEZL 4JRYA 2IF7A 4K8RL 5B8CB 1B0GB 2V2TA 4XO5A 4YJZL 5EIQA 4IJ3C 3RWCB 3PGCA 1YAZA 3CZGA 3QORD 4YBHA 4UANA 3RE0A 4DGYL 1ADQL 2IFFL 3D3VD 2DQUH 1A7NH 3HI5L 4OGYL 2CGZA 3HLAA 3MRLB 1FFPB 3AW5A 3VWKC 5CBEB 4X5QA 2FAUA 5GRJL 3P9WB 2UY7A 3X1NA 1B0GA 4AI7A 7TAAA 4KROB 2VMJA 2MPAL 3O11B 4NZUL 4Z0XA 4MASA 2PO6A 3BP5B 4PGCB 1UZ6E 5TDNA 1KXQA 3SE4A 1C7SA 3MRLA 2WPGA 1XCTB 4RX4D 5CBEA 2EXYD 3J7HA 1ZA6A 3P11H 3O6KH 3I2CH 5LBSA 3D25B 4L5FL 4Y2DB 4OF6A 4P2OB 1KPUB 3QI9D 4LAQL 4UIKL 2MH4A 1KCRH 2FGWH 3O2DA 3EGSA 1FO0B 4L3FA 4QJ3B 3TOPA 1G1KA 1P9MA 2D0GA 3CXHK 3WE6A 3LN5A 4PJXB 1MEXL 3M1CA 4HJUA 4MB1A 1QTSA 3SCMA 4ODBD 5BMFH 3QQDB 4Y2DA 3T0ED 2ILLA 4P2OA 1UEMA 2FECL 3JWNE 3U1SH 3KJ4B 3VMNA 4LP8A 4Z3TA 3FOMB 5BO0D 3RI5K 4J5VA 4JVWA 3RLSA 1T6VN 4BWWA 1TZOA 2XPGB 1CFTA 5K39A 4KKBD 4RMUA 1OK8A 4KO9A 3INUH 1KMGA 5DD3H 5DQDL 1MCNA 4KXAA 2WBJC 5I0ZA 4FULA 3HE6D 3A6CL 3FOMA 1JGVH 1XGZA 2DWXA 3UTSD 2NOYA 5F9JA 5HHOB 2VB5A 4U4IA 2GTWB 1I31A 3MPCA 5IK3B 3A67H 3BAEL 2XPGA 4WY7H 1KB5L 4XI5C 2YHGA 1WG3A 3QUKA 5BJTA 3UPCA 4KV5F 1JS4A 1HKFA 2QTEA 4GRLA 4NZ8A 1BFTA 3QNFA 5K9OB 2MWCA 4Z1PA 1ZE3C 1N67A 3I3DA 1UGKA 3NTCL 5HHOA 6PAZA 3X3FL 4DKAA 1QBMH 5IK3A 3K1DA 3FN9A 3Q8FA 2QKIA 3EADA 3B6SA 4WQOA 1LQSR 3DGGB 4S10A 1A6TB 2QBWA 4YGAB 5DJZB 3VXTA 3ZK0A 5K9OA 2UWEB 1XT5A 1I1CA 1E42A 1DJWA 5FA3B 4DGVH 2P49B 4JBSA 4BELD 2NXYB 3KYNA 3ARED 3CK0L 3I6GB 2VDKH 1D9KD 1EZVY 2IPKB 2JF1A 4GINA 5C2BH 4X6CB 5T3XE 1T20A 3HFMH 2LTQC 4MNQD 1S5HA 1P7KA 2UWEA 2VZVA 2DI8A 5CD3A 2XTLA 1FZKB 4QYAA 2MCG1 4E5XG 4WK0B 4XC1L 2WSKA 5ESQB 4FEIA 3H3PH 4C4KO 2NY3D 2WQ8A 3HBPA 3V0DA 4K5LA 4P2RE 4HWBL 3AS1A 1FZKA 2XTJE 4KQ3L 3S8GB 4B7IA 4BSJA 3ARFB 1R9FA 4WK2B 1A66A 1UB5B 1CGVA 1QFWM 4UV7L 4LPXA 2HA1A 3QEQE 4N87A 5AW2B 4GAGH 4CSSA 1IBBA 2H3XC 4JKPL 3DI3B 1NOAA 2EXTA 2EC9T 4BSVA 4J3UA 1YNTB 4BZYA 3ARFA 3ROLB 4KV5E 1UB5A 5T5NG 2WLKA 1IC5H 2B1HH 3D2UA 4IMKC 2PPAA 5B1JC 4M5ZH 4YX2H 4GG6E 2L04A 2NZ1A 3DYMA 4OD1L 4UB0L 3IDXL 2QMJA 1INDL 3FT3B 4L29B 3U36A 1NCCH 5J12B 3AC0A 4N2FA 3TLRA 1NCJA 1BM3L 1ACZA 4G8IA 5TE4L 2CCVA 2VAJA 3MRMA 4JO3L 4JCMA 4HH9B 1MAJA 2CUAA 5AALA 1J0YA 5EU6B 3ROLA 3RY4A 1NM4A 3ARDB 3P40A 4KJPC 2FDBP 4NQED 3F7YB 2BY3A 1QX1A 1B3JA 1A9VA 2HJFB 3FT3A 3SYCA 4FF9A 3OKDB 1EHNA 1I3GH 3C12A 3FAXA 3M8OL 3QZBA 4G8GA 1FFNB 1LK3L 3MUUA 1WPCA 3QDGE 4L23A 15C8H 1J1OH 3GJEA 3KPQA 5EU6A 3QDHA 5LNEA 2UUDK 4N6RA 4ZDHA 1TMQA 4E2OA 3VFWB 4GKZA 4AMKL 3T2OA 4PUBL 1ZLVH 3OKDA 3DV6B 2HRGA 4Y2NA 5DUPL 3P77B 2NR6A 2P5WD 4GJTB 3LZRA 4CMHC 1X5LA 4ONOA 3RGVA 1XGTB 4BQ6A 5FUCE 3VFSA 1S7WB 3N1PC 1A47A 2AK1H 3SE8H 3OTTA 4TUOA 2H6OA 5INCB 3LZQA 2HVJB 4JREB 5F0LB 1EAQA 3VFRB 4JKMA 2BVOA 3IPEA 1U3ZA 4NJ9H 2I85A 2O4EA 1A7RH 2NY0B 4KMQA 3ZDZF 5EIIA 4LQFH 2CSPA 5J11C 4H8PA 5JA8B 1TZIB 1XGTA 3MO1B 4X4YB 1C5DB 1WEJH 2XG5B 5FLVA 5INCA 3A24A 1WITA 3ZSSA 1JDAA 3A0OA 1Z5YD 1I8IB 3PV6A 4HUWB 4P2CG 5EEUA 1AD0B 4X4YA 2AVGA 1C5DA 4M9PA 4W1TA 2CLVB 3F00A 4TULH 3T09A 3SJVA 1EGJH 1E9QA 3BWSA 2YGOA 3FB5B 4BSWB 4EKJA 1HYSD 4GOSA 5ESAB 1SDAB 3S3PA 1RSYA 3SKUD 1I8IA 1NEZG 5I9QB 4C47A 2NY5L 1ZANL 3DJSA 1AD0A 5FYJD 5KUMA 1PZ5B 2YFNA 1JAEA 3G5VB 2WTOA 2HG5B 4LASH 1PBYA 3DX0A 5KVDL 1ZHBB 2B08A 1E2VA 1YAIA 3QFDA 5D1QE 3O6LL 3U6RA 4ZW8A 5HVHB 3FB5A 1W15A 5EOTB 3FUIA 2Z92A 5J9PB 3DV4B 4YLCA 4HBCL 1TTCA 4W6XB 2CO2A 4PCTA 1PZ5A 5E0FA 1CL7I 3PP3H 4NRZB 3G5VA 2EC9U 4OGAC 2BCKB 3UDWA 4I9WD 1S8DB 2IANE 3Q13A 5EOTA 2CBQA 4QHLB 5IHHA 5I8OH 2UV3A 3DV4A 3UIYA 2HLFC 1IC7H 2QTVA 4JG5A 2Y5QA 3P30H 1AQ8A 1KCKA 4Q9QH 3B4NA 1LMIA 4G9FE 4O9HL 3KPRD 1QD0A 1JZIA 4XE0A 1S8DA 2B0SH 1S6NA 3SDAD 1YY9C 4X9GA 1MRCH 2DH3A 1R1CA 4PJ9C 4QHLA 4UDTB 5LO7A 3ZDZE 5IOKA 1Z32X 3QNYB 2R8SH 5KJ4A 5KSAD 1HXMB 1RVFL 4JN2A 4MHHG 4I8DA 1QFWI 3WXWL 3UZEC 3D05A 3GSQA 1XV8A 1KTLB 4XXCA 3V0GA 5DS8B 1OARH 3NFPA 1EEZB 2XYBA 3IBOA 1E30A 1MCDA 3AXIA 4PD4K 2FB4H 3MNWB 2CRMA 4UDTA 1YEEL 4WI2A 1UQSA 4BE6A 3QNYA 3ATEA 4NQSB 3X1EA 2E46A 2AMUA 2NYYD 3A23A 3NZUA 4CSTA 1GXEA 4DUWA 3V7AG 1OKEA 4FDWA 4Z7IA 3EJRA 5DS8A 1AZVA 1EEZA 4F27A 4AVKA 1TFHA 3MNWA 5JHBA 1N68A 2BIMA 2FCBA 2IH3B 5JW3L 2CPUA 2ETWA 3OJVC 4NQSA 1K8DB 4NZFA 3DSFH 1OHZA 5KTEL 1EO8L 4JG0L 2AGJH 4TVSa 5GIRA 1HQRB 3P2TA 1DZBA 1HS6A 4PRHD 2QZQA 4OBSA 3GXTA 2VDNB 2P80D 1NAMH 4DFIA 2LGNA 4L1HA 2PWFA 1K8DA 5FYJH 1FQ9C 2ICWA 4Z7NE 2JI3A 4OIIH 5I5JA 2J2ZB 4DIXA 5ACZB 3NDYE 1QSEB 4EUPH 3UJIH 3APFA 5DLLA 1J5HA 2X0VA 1Q0YH 3KDPB 4F9PA 2A1WL 1MHHB 2R2EB 4G8FB 4QRRA 1BAGA 2E6PA 2J71A 3M1BB 3U4AA 2VR3A 4OH2A 3N44B 2VISB 4S1QL 4WWKA 2QGCA 5J56B 4ZFQA 1QSEA 4XNMA 1OAUH 1UD4A 3BWUC 3OV6A 4G6AC 5CUSH 1IGML 1WHPA 3FRUB 1AHKA 4G8FA 4PTTB 3LD8B 3LNHA 4NO0B 3MREA 1NCGA 4W68A 2VISA 2XYCA 1EQWA 3HMXH 2MCPL 4POUB 3VFVA 2ENYA 2X4NA 1R5WB 1SY6A 2VABB 4X9IA 1O7DE 4GMTH 4JFZL 1SLUA 4K7PX 2JJVA 3W2DH 1CL7L 2CDFA 4NO0A 5SWSB 2XIBA 1QRND 4JCLA 4R7VA 5HJGA 4GUPA 4HHGA 5F7NC 1BREA 1I9JL 1GOHA 3N41F 1IMHC 1R5WA 3K72B 1JNJA 4LVOB 1UENA 2QV2A 1RZJC 3TL5A 3VWJB 4UCFA 3ZMNA 2A6DA 2D7PA 1PD0A 1J8KA 2H41A 4PGDB 5BXFA 2SEBB 1U0QA 3TCLA 5SWSA 5E1IA 4FQ1H 1YYML 1I9IL 3RWFB 1B4TA 4HP5A 2X3AA 3BKYL 2YIHA 5AFAA 3P73A 3E1ZA 3L45A 3TCXA 3VWJA 2ORBH 1AGFA 4PGDA 4M6ML 2NRDA 3L5IA 2SEBA 5EU3B 3ZZ1A 5ECJE 1CICC 1GGIL 2ZXAA 1I7RB 1JZ4A 3MLUL 3NCYP 4MAYB 3ESUF 3TURA 2KBGA 3DRTB 1I7TB 4OCYL 1YQVL 4IEFB 2F53A 3FUMA 2ZOWA 2NY4D 4KO7A 1I7RA 2ZWYA 3OB0H 1TQVA 4IIQC 4DO5A 4MAYA 4Y16D 2NLJB 2CM6A 1I7TA 4HS6A 3QGVA 3HZMB 3PWLB 3LNDA 5KBPA 3G04B 4FTVB 2XXMB 3GBNL 4IEFA 2FLBT 5GJSH 5TD4A 1U8CA 2OK0L 5DFVC 1WQVT 2P7TA 4M9OA 1KJ2L 3MNVB 2Q1EA 3CU7A 1NDGB 3VD5A 4PCYA 1HJBC 4TTGA 3TT3L 4QHUB 1FYTB 3LS4L 3QULB 1ZRUA 4FNQA 2D4FA 5JHLH 4M1GH 3G04A 4M8UA 1MQKH 3AXLB 4H8WC 4MS6A 5H2BA 4L8DA 1KTCA 2XNAB 1U33A 3OF6D 5DDHA 3N3EA 3CFBB 3D69A 3BZFB 4M7LT 1X5FA 1H9VA 3P4OB 2OR9L 5BPPA 1X5XA 5KYWB 5L2KD 4TVPE 1MIEL 3QCTL 2XACC 3CH1A 2WOBA 1E40A 3HRZB 4ETQB 1HAWA 3AXLA 1EJOH 2XNAA 3VG0H 3LQZB 4XB8A 2Y36L 3D8MA 1SXBA 4X6FB 4OFKA 5EUOB 3P4OA 2W0LA 3VNYA 3FTYA 3CD4A 1QW8A 5KYWA 4OW6A 3D4YA 2GEEA 4HC1L 5AD0B 1CGSH 3JV5A 4Z7UF 4HJJH 4ETQA 1AMXA 2LHAA 4LDCA 2X7LB 1NIFA 2FQGA 4G83A 4GG8B 3FSOA 1A22B 1WTLA 4GAYB 4GI6A 4UTBH 4X6FA 3RURA 4NP4L 4HW6A 1BQLL 1F90H 4GB9A 1DVTA 3V95A 5HYFA 3MUZ1 3QPKA 5B7FA 4NKMB 4P5TD 5AL8A 3ZZLA 4KK6C 1E6OH 2AKRB 5BCAA 3TBBA 1HN1A 4OJFL 2JXMB 4MD5B 4FQLH 5KVGH 4NM4H 2BERA 4M02A 3UADA 4GG8A 1CJYA 5K9KA 4CBPA 2OTUB 1ED3B 3WXVL 5GGQH 3TGXA 3B5TA 5E2JA 5FUZH 1YEHL 3K6OA 3ILEA 1A4BA 1P4UA 1P1ZB 1WBYB 2AKRA 4NI6A 4ZOEA 3V9FA 2AK4E 4PU2A 4HJ1A 4MD5A 2WUBH 5J7CC 4QXGL 5E6RB 5EBLA 3GI8L 5E6SB 5C6TH 4WKZA 1ZLSH 2OTUA 4IBTA 3TYFA 1ED3A 5FYLE 2F54B 4D9QD 5A3IC 2F1AA 4HAKA 3I50H 4XODA 5F96L 1X5IA 5CJXC 2JIXA 4P2AA 1Z2KA 3WGVB 1EFXB 3QH3A 5I1KH 1WBYA 1LO0H 4M61A 5AAMC 2B4CC 2Q86B 1UJ3C 1X7QB 1XEUA 4R8WL 5CCKL 4XAWL 1AFVL 1E4WL 2VXUL 3LKRB 3TWCL 4X6DE 4DWHA 3H9ZA 1C08A 4KNSA 1MWAH 2A9BA 3OSVA 4WW2B 1ROWA 4CVUA 2YUXA 1YA5A 4GT0A 3EOAA 4XNYL 1S46A 1FG2B 1MCQA 1X7QA 2P28B 2ZUUA 4UTAL 4P0DA 5H35B 1FAIH 2N0MA 4ONFH 4XNZC 5HYQB 2KH2B 4H26B 4K4KA 1T2QL 2Z91B 1RZKH 1INEL 4XOEA 3RGVC 5IVNA 3QJRB 3GO1H 1M7IA 4Z7UE 1LP9B 3V7AE 1L7TH 2YPLD 5ILTL 5AQ0A 1QSVA 3LZPA 5T3ZL 1U3HB 4GNKB 5C0EA 1AR1B 5E99H 4G6FD 5HYQA 4XP4L 4O2FB 4JM2B 1DHKA 1BYOA 2Z91A 3LRGA 4FNTA 4KVPA 1BVLB 2XVGA 1TU2B 2H6PB 3OMNB 4XPTL 1LP9A 2CBMA 3TO2B 5L88L 3D9AL 2C3WA 3RFZC 5FA4B 5ECGA 1GCFA 4H5SA 5EN3A 1XD1A 4TNEA 4G1MB 2DQGL 2MQ0A 4O2FA 3HZ3A 4S1SH 5C0GB 5M94B 2EVGA 4P46D 1TYEB 1BVLA 2AXFA 1V7ML 1JZ8A 2IEPA 5D7JA 4DK5A 1F6AB 1PZAA 4K9EL 1T66C 2IBGA 1ZHNB 2Y22A 3BEWB 2QR0B 4G1MA 1A5FL 4NSKB 1TUPA 5F6HJ 3GMPA 1FWXA 4H1LB 1JZFA 4NQCE 1WWAX 2XICA 5D1XD 3CXHJ 2JJWA 2CXKA 4RGNB 5DRWA 3WDJA 3STBA 1HZLA 1HKLL 5JZ7C 2E4TA 2OP4L 4MMYA 4E9RA 3BEWA 4N90D 1MCOL 1WD9A 4NSKA 5EC2B 1HESA 1S9XB 4M03A 3G5YA 4TS6A 4W9HC 4H1LA 4AYMC 3N40P 5IMOB 3FQ1A 5FUOL 4ZUUA 1RZ8B 4PS4L 4OQTH 2AQ1A 1BPLB 3I75B 3MV01 1F1GA 3KR3H 5E6UB 3PWVB 4QAMB 2PYFB 2F74B 5D6DA 5IQMA 1S9XA 5DR5L 2DKSA 3ZUNC 4YSQA 1UWGH 1ZS8B 4KX9A 1QQDB 2GTQA 3IF1A 3ZDXE 4M8RA 5E1QA 2QJDA 4OLVL 1BWMA 2H1PL 1L0PA 1KCSH 1RZFL 4XBMA 4Z7WF 5LVEA 1U8LB 2KS0A 3PWVA 1BQHG 4LF3A 1WAAE 1IC4H 1WZ1H 2BVPB 3AZUA 1T2XA 2OMXB 3IS1X 4P99A 1ZS8A 4XXCC 4LDEB 1QQDA 1XFPA 1BFVL 3L95B 3VO0A 3QR1A 4MMXA 3TJHD 3WS3A 1GAFH 1JWMB 5CCGE 4JVPA 1AG6A 1CE1H 4HIJA 3ETSA 5LBSL 2WQWA 1N7MH 3G6AB 2DYPA 1RV6X 1FRGL 5HJBA 1B0RB 2BVPA 4P57A 2OMXA 3EJJX 3FQ2A 4MNGB 1RK1B 3KL3A 3Q5TA 3KPTA 3O2DL 5AYTA 3B1TA 2WQVA 3VFPB 2C9VA 5AB2A 4TRPL 4JANA 4TQIA 1I1AB 4K3JH 5EU4A 2PP7A 5GRXG 1ITCA 2EIMB 2P8LB 4XCEA 5AKTA 3WHXB 1ZIAA 4LGSB 2DQIH 2MKWA 1E7VA 1BVNP 5I76B 4R7NB 4FNLH 4MKMA 1YEGL 1T7WA 4MNGA 1RK1A 3Q43A 1BAFL 4TNVK 2X38A 3NCYS 1A3QA 3KHOA 4W9LC 2E7CA 4GP4B 4MDIB 5IHUL 2VRKA 2YD4A 2P8LA 1FN4B 3SKOB 4BGLA 1KGUA 4O4YL 2AABL 2HJKB 4WI6A 1DANT 4QPEA 4Y1AE 5F6IC 3T65B 3T5WA 2X12A 5MHSE 3E8UH 3TBVA 4OZFH 3CCHB 1QEWB 3MOQA 3V0IA 4OCSH 1BEXA 2UZYA 4O00A 4JVUA 4F7KA 3ZIMA 1WJ3A 5AG9A 4UDUB 1JPGA 4YIQB 5AG8A 2F7IA 2YA1A 3C6EA 4XXWC 3C5ZC 5CXPA 4OT1H 5F8RC 5BRZB 5JXEA 1FA4A 2YAPA 4FHKA 4TTDD 2AEQL 5F1SA 3U30B 3F7VB 3R18A 3T65A 1FPTL 2JCWA 3OAZH 2UZXB 4QRBA 4AL8H 1QEWA 3EUDA 5MEQB 1XD0A 4Y7OC 3D85A 5IFAH 1F4WL 5TGBB 4YIQA 5IB4B 3TO4A 5BRZA 4NRXA 1SJXA 1X5YA 3IE4A 4XMPH 3F7VA 1ID5I 2W1NA 3OLDA 4H8WL 1DVSA 1D5MA 1CFVH 4HULB 6FABH 5MEQA 1S9KC 2DDQL 3GSUB 2VIRB 2X2IA 1ZDQA 2JELH 5I6XC 5IB4A 5TGBA 3W37A 1C1EL 5BOPA 3HG5A 2CD0A 3KWWB 3VXPB 4Y5XC 4KJYB 1D3CA 5T3XD 5HBBA 3EF7A 1IFRA 4XGZB 1LWJA 3SBWC 1CLYL 1QA9A 2WYZA 3QORA 2DB8A 2WXIA 1UYWH 1U95B 3DURA 4M7LL 2IBZX 2WXFA 2JV6A 3LDBC 5K33A 3IN2A 3NIGF 5DVMA 1J8HE 5KAQG 1HHGA 3KWWA 4UYPA 1CD9B 3VXPA 3VSVA 4E9VA 4C56B 1D5ZB 3FW6A 1RXLA 2EKJA 4MQSB 2WQRA 1NGXB 2VLRE 1AOHA 5FO7A 3PREA 5LCVH 5C0JB 4UUJA 1FE8H 4P2RD 3V52L 1X5AA 1LDSA 3NJHA 4WTZA 5G5DB 4A7TA 1U95A 4KPHL 1QATA 5EH1A 2BRQA 4E42A 2DTMH 2ITCB 4HZAA 4RX4A 1FNEB 2FYVA 4C56A 1D5ZA 3LQAH 3QEQD 2K8QA 1JHTB 3DMMB 1G84A 1H8SA 1AI1L 1JPEA 3G6JA 2X6BA 5GSVA 1QLFB 3QI9A 1DSWA 2PP8A 3FHAA 3MHZA 3MJWA 4XCFH 1N6QH 4PB0L 3Q3GB 1GYWA 3ZRSA 3N06B 4YWGH 1NLBL 4I48B 1JHTA 3DMMA 1WBXA 2ESVE 4Q4IA 3U82B 5I1GL 1BSIA 4FERA 5DYOB 2YKKA 5DQ9A 1FH5L 3HE7C 3T0EA 1WAPA 1VPOL 3HI6H 1QLFA 1IO4C 4N5ED 2OMVA 3S8WA 2AQ2A 2J44A 2XWBA 4GO8A 3OB8A 2CA4A 4NWTH 2NXZC 3S4SB 3Q3GA 3WU1A 3K2MC 1T0MB 4QTFA 3PWNB 1HE7A 4I48A 3V9EA 1M42A 1MREL 5AOIA 2WP3O 5DYOA 1DANU 1BVKA 5E2VH 4AEIL 3A5VA 3VWKB 3QDGD 3GZQA 2HPOA 4LSQL 3BFOA 4QD2E 3ZE0F 3HE6A 3FTGB 1G0YR 4S0SD 3S4SA 3DUUB 4P5KB 3UTSA 1T0MA 3VFTB 1HHJA 3PWNA 5EOCH 3BE1H 3L6FB 1WH0A 3EUUA 3SOTA 4QOKD 1IAIH 4PJCF 4U3CA 4BGDA 5ES4B 5IHWA 5DRXA 1EHAA 1OPOA 2YGQA 2KLSA 1SHXA 1RHHB 1X9QA 3WIAA 4LLUB 3FTGA 1SBBA 4OJYA 5ABAA 4ANVA 3DUUA 4P5KA 1ZLUK 4F1ZA 3VFTA 2WAHA 4PCKA 3MC0A 2PXYC 3RY5A 1RP9A 3LRSB 3ROOB 5F1IA 2AITA 4DN4L 4Y0GA 1T03H 3QVAA 4GKNB 5T3XH 3U25A 2C7FA 4X5WB 1LJMA 1EEUA 3JSSA 3V4VH 1RHHA 1M6UA 4MNQB 2RD0A 2YRPA 4F8NA 3ROOA 1NAKH 1SZNA 1ZV9A 2JKJA 3AREA 2YAEA 4GKNA 3OWEA 3BKJH 3FZUD 1D9KA 4JO2H 3VD2A 2VYRE 4OZHE 4N1EA 3BP6B 2ITEA 4Q9RH 2VZ3A 4LNVA 4MNQA 3IETA 4G9DB 4PD4J 5I15L 4LLYB 4GRWB 4F57H 3BHBB 2L7UA 4HEMA 1JNNH 3WO4C 4WEBH 4D0BB 1E0OB 4J8RA 5TQ0H 4F5CA 4PP1C 1AE6H 1MXDA 1DSFH 3WL9B 3WKYA 1G7JA 4K3EH 4H2AA 3RPKA 3BP6A 1WFUA 4ZMVA 5A16A 4G9DA 4ZI8A 2P4AB 4G7SB 3P3TA 5D1QD 3RZCD 1QVOB 4YSRA 4RESB 3U9PL 1EGJA 3B1UA 1S5IH 5BRPA 5IOPB 2LAGB 3KJ6H 2HFGH 2JK5B 4HUCA 2Z7WA 3MLRL 3TFKC 1AANA 1RL1A 4DH2A 4R96A 1QSZA 4BFGA 3QJFA 2HZHA 2YZ1A 1QVOA 4PJCE 5I19L 1SEQH 3IFOB 2CR0A 1MI5B 4YPGB 4F2MB 2H4EA 3TVMC 2VZOA 4IDJH 3WLWD 4HJEA 2JK5A 1Q9KA 2NTFB 2YPVH 2ZOOA 3PABA 3ZKMD 5I17A 5C7XH 4FXGB 2XPZA 1UUNA 1X7SA 3BD4A 5KVFH 4Y19E 4I3GA 4QXUH 1LK2B 3KPOB 4Z3EA 3CVHB 3IFOA 5AWNL 4B7LA 3TC9A 4RBPK 4JGUA 4YPGA 2RB8A 1OT1A 4NQEA 4JQVC 2B9BA 3RL2A 3K71B 3DWTA 3BH9B 5C7ZA 1T83A 3HC3H 1JXJA 3HA0A 4NLHA 2DYSB 5DLML 5IMMB 4L1BA 1Y18B 5FK9B 5TF1L 5AENA 2X6VA 1KENL 1UVQA 3AT9A 4Z7VF 4M7JH 5TDPB 3SYOA 1J88A 5