1D7CA

Cytochrome domain of cellobiose dehydrogenase, ph 4.6
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
190
structure length
190
Chain Sequence
ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLOBIOSE DEHYDROGENASE
publication title A new scaffold for binding haem in the cytochrome domain of the extracellular flavocytochrome cellobiose dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 36
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 1999-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1d7cA00
1D7BA 1PL3A 1D7DA 1D7CA 4QI3A
chains in the Genus database with same CATH superfamily
1TJMA 2G0LA 4O9HH 1DN2A 4YDVB 3UZQB 3VQMA 1MCNA 3B9KC 1EVTC 5HHVL 3QJZA 5IESH 4G72B 3C60B 3ZZ1A 2VR7A 3NJXA 2WWKO 5J6GA 2ZPKH 1SXSA 3PWPA 5FF6B 3SDDA 2MHAA 3MSPA 1IGML 4BK4A 5KOVC 3CSGA 5GS0L 4N8VB 1JVOA 2ATKA 3WENA 2ROYA 1G94A 1F5WA 43CAB 1T80A 1RZ8B 4KXCA 4OLYH 4L23A 4RZKA 1M1XB 5BOPA 1CU4L 5JXAL 3V9FA 3JUYA 2W07B 5LN8A 3ZHNA 2VZUA 2VO8A 2C9XA 1FLRL 2QR0B 3GB7B 4YHPB 4NWUH 2R1WB 3CHPA 2XFXB 3MBEA 4TVSa 3NFSL 4YDJB 4K9EL 2IGFL 1GPOL 1FYTB 1HQRB 5FOBB 2ZYSA 2GCYB 1M05A 3EF7A 4K07A 3OR6B 1QA9B 2X4PA 1IKFL 1MRDL 4LT7A 4LSTH 5TDPA 1R4XA 1XGQA 4BKTC 2EEBA 4XPHL 3TBWA 4FZ8L 3TGXA 5LGJA 1KTJA 2P26A 3K80A 2QHRL 4C8XA 1PX8A 5EZIL 2LTQB 4FE9A 4AKQA 4CDHA 1PBYA 4O2FB 4Q9RH 1CQYA 1E28B 2FIRT 1CLOH 3KYNB 2ZAHA 4WI6A 3BIBX 3QH3A 5DUPL 1P7BA 3BH8A 3I50H 3L2LA 4JFYA 3QXVA 4UTBL 1WT5A 1T66D 1G4RA 4PV8A 4IDJL 5SWQB 2EYRB 4W9ZA 1HZLA 4I13B 4XBPA 5AW0B 3RBSA 2D8KA 3KPSA 1F4WH 1KLGA 2EUXA 1XCQB 2AV7B 4RGNE 3FFCB 1AZCA 5CBEA 1FGNL 4FHKA 3KWTA 2D7TL 2VC2L 3M17B 4LXFA 1LD9A 4GLRI 1MCJA 1ORSA 4EZJA 1EK3A 4MJID 2IOMA 3UYPA 3D39D 4U1KA 4GQQA 1TIUA 3VD3A 5HDBF 5EC1B 1KTCA 2NYKA 3QRLA 4DP7X 3O2DA 1IEAA 2NZ1A 4WHCA 3RTQD 4M7ZC 4JGUA 4LRNH 1S7SB 5AAPA 2HT2D 4TQHA 1WAEA 2NY4D 1DQDH 5E8NA 4YHNB 1W16A 3CLEL 4GQRA 1X5GA 4F1SA 3RVXC 3ZO0A 1KIUB 1DJZA 4S1DD 1T6BX 1WWCA 3EJQA 2Z65C 2YWYA 1AHMA 3VGEA 2YZ8A 1MHHA 4PJ7B 1RIUL 3KNBA 4AKOA 3IGUA 2BIQA 1XL4A 3QCVL 4CNIA 3IRZA 4J2XA 2MCG1 3NUKA 2GBUA 1BFOA 4LASL 4RFOL 4YHKL 4S1SH 2D7QA 2YIHA 5IT2L 2YGQA 4GAFB 1HHIB 3U9UB 5HHNA 4YEFA 2D31B 4APQA 4I3SH 4BQ9A 3C8KB 1YHPA 3BGFC 4FXKC 4N6QA 3WELA 3ULUL 4HD9A 4MD5B 2VMEA 4RESB 3Q5OA 3B7TA 1KIRA 4N9OB 3EOYG 4JQXC 3WJMB 1H3TA 4NBYB 2DKSA 2CO7A 1DBAL 4M7KH 4LOVA 5FUCE 4YPGA 1ZVYA 3OAZK 2EH7H 4UTAH 3ROOA 2FJGA 1AANA 2HJKA 1G7IA 2QFPA 4AEHH 2YOAA 2X6CA 1TUPA 5C07E 4HWZB 4U6TA 5CKGA 5TK2A 2FJSA 3CWGA 2HSIA 2ZUYA 2J43A 1U3HC 1MKFA 2NX5D 2BOCA 4KH2A 1V3JA 3AC0A 3CJJA 5KVDL 3TWCH 3HLAA 3UOAB 4B3VA 2VW4A 3PNWA 3VM5A 1KELL 4JDVB 2JE8A 2HPTA 5IVXE 1WAAF 5L2KE 3OKLA 4G8GA 4GW1A 2DWTA 3P30L 4X5PA 3TA3C 4B95C 1A6TB 4QHLB 4F57H 2V5TA 1AACA 3NACL 1S4IA 4POUB 4A66A 4TTDC 3O6KH 1LEGA 4NENA 3KYOA 4M43H 3N04A 2ZP8A 1KCLA 3C5ZA 3RL2A 5GZOA 4OD3H 1HI6B 1SEBB 1WIPA 3MRPB 4U1HB 4EXPX 2VDPB 1P2CA 2R0WL 2C9UA 2G75A 3BEVB 2XSKA 4PBDA 9CGTA 5A6IA 3I85A 2XPYA 3MAWA 5E6YA 5GHWH 1BQUA 1PIFA 1ZANH 2CR0A 3ZE1F 2QSVA 4JZNB 3GBNH 5BQDA 1JPTH 3IDYB 2F1AA 3EO9L 2XICA 1KWKA 2ERJB 3NZHL 2JJUA 1JTPA 3T2LA 2Q8BH 1MRFL 3AB0C 1L9PA 1WZMA 4FHBD 4ODBD 1RK0B 3D52A 2CU9A 2VDMB 1H8NA 3HZYB 3V0GA 1A0QH 1A4CA 2BSSB 1FZJB 1MCDA 2A74A 5KSBE 4KKAC 2YXVA 2YK1H 1KBGL 3FH8A 3D18A 3IMUA 3PGDA 4JFPB 3DJSA 4KY2A 4Z7VA 3HRZB 1F02I 3LX9A 3G9VA 5B7FA 1FL6A 2ZX5A 1NGYA 5I76B 1W91A 4XI5C 4KV5E 5DUBA 1OGTA 1P5VB 3O6FA 3CIAA 1WA2X 3HFML 3TO2B 3OC5A 2D0FA 1ED3B 3N50A 4E36A 2BFVL 2D9QB 4KI5F 1A7PH 1I1CA 4MGXA 2VDRB 1JWMB 3MV11 3MGAA 3REVB 5EU6B 2J1YA 2J8HA 2DYPD 1M1SA 2ZUQC 5HGAA 1A7RH 4FNTA 5IOPB 5DEJA 1IM3D 4M48L 5C07B 2WBJA 4X7EC 3AREA 4MZRA 4DP4X 4KVCH 1OARH 4OGYH 1B6UA 3CDGA 3CGTA 2RBLA 2UVFA 1LO2H 3O0RL 1LP9A 1JP5A 4PHXA 3FCGA 4GPVA 1I4FB 3VG0L 3MRRA 1MRCL 4JKLA 3SOTA 1UXLA 5TTRA 2HJLA 2UZIH 5B3JE 4DVBA 5IVXB 4JDTL 1MHPL 2OYPA 1JK9B 3Q6GH 5DJZB 5L2KB 5J8OA 3QNZB 1S5HB 1OAQL 2EKSB 4MD4B 2ZG1A 2MPAH 5BPPA 1VESA 2G4EA 1J05B 4R7XA 1SYVB 4WNQA 1L9SA 1QYGL 2R29L 4Q2ZB 2DI9A 4PQXA 5DVKA 4AVHA 1BA9A 4PJEF 1T83A 2OMYA 1KCBA 2Y7SA 3QFJA 2GI7A 1XAUA 1CDUA 2IH9A 5BZXA 1M6OB 3IGKA 3AMLA 3O8XC 1N59A 1N0XH 4GBXC 2DJ4A 4ZBJA 4GO8A 4JR9H 1CFTB 1KN2H 3LDBB 2HUEA 5HY9A 4LSUH 1RZKC 5HI5C 2YD2A 4HT1H 1QLRA 3GINA 3WJJA 1A02N 1XF5B 3LS5L 4FFYH 1NC2D 3DMMC 4FZEL 3UBXG 1VKXA 1VDGA 4X7FC 2W60B 1JWUA 4JZOB 2IANA 2OX5B 4A04A 2BIOA 3ATDA 3CVBA 3SOBL 5CGTA 2BS9A 1Y6KR 5HDBB 1FG9C 4QCIA 1RU9L 2J6EL 3HI1B 5K39A 3L3KA 5BV7B 4OTXH 1MCOL 1EJFA 1T2JA 3D85B 1VACA 1P1VA 1F2QA 2EDXA 2DLIA 4CSSA 4HJ1A 4JFVA 4P9MH 1PZSA 3RNQA 4Z1PA 1KGIA 4ODSL 4Y4HD 1NCIA 3ZMNA 4EN2A 2IAAC 3T4AC 5IUCA 2PP7A 1KJ3H 4XT1C 2OKMA 5FECA 2DQFA 4PS3A 1I9JH 4RISL 3S3BB 1MFBH 5MI0B 1R19A 4HVBA 2QVTA 4R26H 2OMWA 3SPCA 2VDQL 2WXRA 1II4E 5I0ZA 1U8CA 1KXVA 4EIZC 3QQ4B 4BFEA 1AE6H 5F7NC 3MLWL 4U1SA 5DD6B 3RLSA 3MNZB 3ORJA 3APNA 1JSYA 4NWTH 2A4CA 4YFLF 3QI9A 1FNFA 2NNCA 3EZJB 3SQRA 4RA0C 2VDPH 2WQXA 3FFOA 3LH2L 4OAWB 4POZD 1TSRA 4QHKJ 1OY3B 2VKXA 2B5IC 2VL5B 3MBEC 1YMMD 4JW3A 1MWAA 3P11L 3PDGA 5CGMA 3FW6A 5DFVD 4UIMB 4OJFH 4P48A 3TNMA 2BP8B 5AVYB 3QIUA 4LRIA 1JTTA 4UILL 2E9JA 1URLA 5MP6H 3MZGB 1FFNB 4NHUB 3L3IB 3KBHE 4XWOD 3GZKA 4P9HH 4A6YA 3PWUA 4QLRA 1S7WA 3VFPB 2X5PA 4FXGB 3D3VE 5GQBA 3LHAA 3S35H 4F15C 3GPEA 1BZEA 1EDHA 2VDMH 3HZKA 3NA9L 4KKNA 5T1MA 1I9IH 1HEZB 3E0GA 4ALAC 4IRJB 4FQQA 4Y19B 1E4XI 4XB3A 5ADOH 5E8PA 1PVHA 4G80A 4NUQA 4AYFA 3F5WA 1F0LA 25C8H 4WRLA 4L1BA 4KUZH 2EE6A 3JT2A 1AGCB 2FIKB 3EJYC 4NJAL 1TMCB 4UIKH 4XN1A 5TDOA 4JRFA 3D09A 4X5WA 4HS3A 5HYSA 5KSAB 4TULL 3DXAA 2LE9A 1FSKB 3UTPE 3WO3B 4Z3GA 4WEBH 1HC1A 1NBZB 3QZNA 1MCHA 2ROXA 4W81A 1KLFB 1S9VA 5E8EB 2ICES 3V4PA 2YEVB 3HAEH 4P04A 4R0LA 4DUWA 1YEDA 3QWOA 4JM4H 1TZAA 3H54A 3NPSB 4HIIA 2KZBA 4MJ4A 3WE6B 5MEQB 3S37X 2WANA 4QJ4B 3ZTNH 2VDRH 3KPRD 1BYNA 4NHCH 1VPOL 2FJFB 3LKQA 2BNUA 3SQBA 1EFXA 1JNHA 2LOEA 5ACZB 5D1XA 4F7EA 5JIDA 1HDMA 2AP2A 3UTSD 2KLTA 4KDWA 4H1LH 1IM9A 1WHPA 4HHAB 5T1KB 4DP1X 1DBJL 1JXKA 1PNDA 3DUUB 4CA4A 3EOTL 1X9RA 1EFQA 1A9BB 3GRWA 4O51A 3WFHB 2KZ1B 2NY0C 1W15A 4F93B 4X4ZA 1FNLA 1UYWL 2CKBA 5FIEA 5K9QG 3QCUH 1IO4C 3L08A 3GO1L 1MREL 1NMCC 2C4XA 2YAPA 3QRGL 2V7HA 2OK0H 1HEHC 1S7RA 2ARJQ 4QXTB 4KU1A 2IOOA 2EDHA 1NCOA 4APQC 3Q7JA 3BWSA 5AW8B 3T04D 3SKOB 1VAHA 2PYED 4HC1L 3WUWA 5GGRY 4ZK8A 3GK8H 1I9RH 2V9UA 3ZMEA 4OI9A 3ZE0B 2VZSA 5BVJB 2JCCE 5EOCJ 3CZUB 4N28A 3SDCA 3VSQA 1AR1D 1B0GB 4ANVA 2D0GA 1DQQA 1HHHA 4JJ5B 5IP4A 4A2HA 4I8DA 1OCCB 3OAUH 3TIEA 5C0RH 4EI6B 3VXME 4DN4H 3S8FB 4MWFA 4XCYA 4Z9KB 3BCFA 2KT6A 1PX3A 1IAOB 4N0YH 5LG1A 5T5FH 2DQEL 5IKCB 2EQDA 3G6DL 3EO0B 1VFAB 1MEXH 4ORZC 1IX2A 1T7VA 2OV0A 1N7MH 3ZYIA 1LEKB 4AGPA 2XZAL 3MRNA 3QRFM 3TBCA 1V05A 1RUML 4K5NA 2NYYD 1EZSA 1WUNT 2E6PA 2P45B 3PCYA 3VJ6A 1E4WH 5DXWA 4AV0A 3KPPB 1BREA 3S96B 1JNLL 2R69A 3GKWL 5JHDB 3PFQA 2XACC 2HFTA 3HE6A 4Q52A 3T0EA 5A2FA 1R9FA 1PY9A 2ESVE 3GJFA 4NLAA 1AIFB 4GFXA 5GZOC 5D5ME 1IAIH 3RWJB 3Q3GA 2YSSA 3SEPA 1XDTT 2J57A 4PRHE 5DK0A 3SIKA 1LWRA 3D2UB 3HI5H 3AABA 5SWZB 1DVQA 3VI4F 1LNUB 3MBXL 5FO8B 5HYFA 5AD0B 1F86A 4N26A 5DJYB 2C5DC 3UJJL 2WZAA 4ZMQA 5A2JH 3BKCH 4FLQA 3PQYD 1BQHA 2MKLC 4U1IB 4YFLI 5IFHH 2EIZA 4AQ1A 1IZKA 3CHXA 3MBWB 1UG9A 5D2NE 2ZAGA 3EYVB 4YIQA 4CL7A 1TQUA 2I60H 3NJIA 3QNYA 1KFGA 1MFUA 5B8CC 4KK5D 4N0FB 1UH2A 5B1JA 3N06B 1WGOA 4X4YA 3F7RA 2IGLA 3SD5A 2NUTB 4LCUB 4XVOA 3HS8A 3LS4H 1I1FA 2IH1B 4WTQA 4ODUB 5E7BA 4MAUL 5E1QA 5IROC 5LCVH 5DRZA 4ZFOL 3D3VD 1KC5H 3ALXA 4H13C 2L4OA 2AK4A 1SY6L 3R7RA 2A73B 4BQCA 4HEME 3O9WD 5E2WL 2NUPA 1I1AA 1A6PA 5E6IC 4PP2B 1YJDL 2FT6A 1J5IA 3VFNB 2NXYD 4WU7A 1PLGL 2Z91A 2OQJA 1JPFA 3II3A 2UZPA 1TR7A 5FYLL 4MHHG 1HHGA 3UAJD 5GSVA 1BJ8A 1L6XA 3CN3A 1ZOXA 2JCCB 2VQTA 3QYNA 3L9YA 3P4LA 4JGMA 3FT3B 4PGEB 7FABL 5FYKD 4JFZL 2FL5B 1Q9OB 4MB5A 2WBJC 3VXUB 2OLDA 3VXMB 3ZPDA 1SOSA 4Z3FA 1CICA 4Z3EA 3ETSA 3OKOA 3UC0L 3UPRB 1KG0A 4F27A 3INUL 3QXAB 1PKQB 3CH1B 3IU3B 5I1LB 1QHOA 1NEZG 1RD6A 3IMTA 3T3PF 3FO2A 4A2FA 4PRIA 5J1AA 1BYOA 1Y1UA 2A6KA 3PXJA 3SJVA 4B7LA 2G2NA 2PMZA 4JB9H 4MAYB 4K7FB 3WNJA 3LXBA 4R96B 2N1KA 3Q2LA 4RNRA 4EIUA 3BUPA 4LEXL 4LVOB 2YD5A 2ESVB 3Q43A 2DF3A 1T83C 4I0PB 1PDKA 1YNLL 4L8SB 1YMHB 3AUVA 4Z8FL 1J87A 5I6PA 4NBXB 2X6AA 5EF2A 4JKWA 5EIIA 1QX1A 4OU3A 4UOW0 1AS8A 2HB0A 4XNYL 3MA7B 3LYRA 1G1KA 1HFUA 4ZMVA 2G9HA 4K9JA 2R1YB 4PVBA 4LSSH 2ZSWA 5DZOA 5FO7B 4AGNA 3QFDB 3U7AA 4RFNC 1Z7JA 3S5LG 3BN9D 4PJ8A 3OLDA 1WH0A 3WJJC 3ZK0A 4HFWB 3VCLB 4D7PA 4KTDL 4ZNEE 1JXJA 1PQZB 5I6MA 3CXDL 5D2NB 3EYQC 1F58H 3T0XA 3T77B 1KPRB 3CMOH 3GMRB 2DWXA 4PCYA 2Q8AL 4JKMA 3B2UC 3QULA 4NKIH 5ICXB 1FQ9C 4KFMA 1D9KD 1ETJA 1JZ2A 2Q10A 4G7YL 2CBTA 2DWDB 1DJHA 3DETC 2BHUA 1YPZB 5D7IE 1OQXA 2BVEA 4HUKB 1UTDA 4ZUTB 1IBBA 1MFAL 3HUJF 3N40P 4QRTA 5F3BA 4B9CA 3CTTA 3VXQB 4FJYA 5I28A 3R06B 4G9FD 4WFHD 5K5YA 3SCMA 1G0YR 2ZCHL 3S97C 3OB8A 3CSFA 1I82A 2YO3A 1K9TA 2F54A 5CJQL 3RZCA 3BRGC 3MV9B 4U0QB 4PRBA 4NZTL 4UYPA 2F6AA 4WO0A 3KPLA 5KW9H 1MNUH 4KKBD 4PRHD 1EH9A 1HWHB 4HFUL 1MW3A 1R3LB 1NFDF 2IWEA 4FA6A 2P80D 5FCUH 3FUNA 3NCBB 4S1RL 3QI9C 2DQDL 1DJIA 4GSRA 2J6WA 4MNQD 3QDJA 4X7SL 4PD4J 4AQAA 5JOFA 3L17A 1UURA 2NNRA 2ITDB 1H9DA 1D6EB 4ZMNA 1A2YB 2AJZA 2H8PB 1FV1A 3N6YA 3SYPA 1N8ZA 5DEFA 4XNMA 4D9RE 1T7ZA 5DMJB 5F9AC 1PAMA 1S5IH 2WZ6A 2D03H 3MKGA 1AO7A 2CK2A 2YMTA 3QAZC 4LRIC 3HNSH 3HBZA 5I15H 3BRFA 2B14A 2R56L 2FO4B 3RPKA 3ZQWA 1QSED 3HE7B 1ND0A 3AMKA 3B83A 4FCAA 5BRZD 5C9JA 5H37H 3V0WL 3W3BA 5GGTL 3ELQA 1XCWA 2QEJA 2GT9B 2ZF9A 2ZCZA 1CGSH 5FOJA 2Q6WB 1GHFL 4C56A 1TZGH 3KJ4B 2A7BA 3QORD 2IBGA 3RY5A 5E8OB 1MIEL 3BWAA 2YEZB 1FN4B 1XF4A 4JG0L 4L8BB 4QWWC 5CILH 3SDYH 5E4OA 3E9TA 4M56A 2IQAB 4LPXA 2R7EB 1JGEB 2HMID 4X6DA 4F33A 4U1LB 3EH3B 3GC3A 4HDIA 2WCGA 2ISDA 3H2WA 3IPBA 1OW0A 5I5IA 1E6OL 3GI8H 4HUVA 3JWNE 3ERXA 4GRLA 3SDXA 5BUPA 1SJVA 2V3EA 5I9QB 3WL9A 3NCJH 4WZ9A 5DVLA 3KBPA 5HPMA 1RP8A 2BMKA 3POCA 1QOKA 1N4XL 1YNKL 4ZW7A 1ZSDA 4NRYB 4FP8H 4LDEB 2F8VA 5D7IB 1P4BH 3M1BB 3VFVB 2R4RL 4XAKE 3BPCB 3TYFA 5ID0B 3MRBB 1I85A 5D70H 1W80A 2X4RB 3BIKA 3LIZH 1G7HB 2Y36L 2OW7A 4HH9A 1N70A 2OI9B 5E56A 1DQMH 4XCCL 3QDAA 5I0YA 3KPMB 4ZUWA 2PW1B 3MRFB 4NKDB 1NBCA 4ODVL 3RX5A 4O02A 4TVUA 4AYDC 1A7QL 5DLML 5E1AA 4FYTA 12E8H 3UP6A 1N2RA 3MR9A 2Z31B 3RGHA 1BGXL 4LOFA 5M94B 1GRWA 1CR9H 1IBGL 4GAYA 5FA4B 3RKDC 1SHXA 1BBDH 1NGZB 2CH8A 4J3TA 2PCPA 4ZTOH 4DP5X 1NL0L 2AQSA 3NCWA 2DTMH 2YAFA 1AHWB 2CO3A 3CC1A 5C0EA 4YQXH 4K94H 2IADA 1JHLL 1FFRA 2WXJA 3HG1D 2RIKA 4P0DA 2ZXCA 4PJFA 5EZLB 1N3NA 4KO9A 1GYWA 4O4YH 4PGBB 2G3MA 1HQ4B 2ZG2A 1NMBH 4GMSL 4JFDA 5DRWA 4C4UA 4TRPH 5I8CA 4UZUA 4B60A 1GGIL 4Y16B 4F24A 1YEGL 2IBBA 5CIPH 4D8PA 3KEHA 2E0PA 4EQ3A 1C16B 1AH1A 1BMWA 1WITA 1ZEAL 4HSCX 4QPEA 5FLUA 4OZIF 4HIXH 1TTBA 3WNIA 5IHBA 3WEMA 5MERB 4FTVE 2VAAA 1WC7A 1IQDA 4EIBA 3PY9A 1KB9J 4E0RB 4YOKA 3H7LA 4EOWH 4LVNB 2FZ3B 3HZMA 5L2JA 2NDGA 2WIMA 5F1NA 2WTRB 4MCNA 3L1GA 4M7JL 4LPYA 3S36H 3HE6C 2LT9A 4GAJH 3B5TA 1ASQA 4CADB 5HYQB 3R0NA 4NGHL 4N6RB 3ME0A 3UG3A 3ASNB 2IGTA 4POYA 4JMXA 5TE6H 4ZMAT 1XR8B 1LO4H 2IPTL 4IU2B 1N64H 4J1UB 3EFFA 2BHZA 2I7OA 3FRUA 1ZHNB 1E5AA 4XTRC 3SO3B 3PE9A 4XVSH 4L8CA 4HS6A 4F7PB 1S7TB 5JIQA 1HESA 4IOIB 3I3EA 1XGPB 5B7MA 1F4AA 1ZVSA 5B1JC 1CTMA 2BWIA 3POHA 5DJAA 3AG3B 3D51A 2Y5TB 4OGAC 5I0XA 4XB7A 2WNWA 2DWEA 2UZYA 3GPSA 3SE4A 4V1DE 3VXNB 3ZDZE 1CBJA 1TKWB 3HMXH 4BFJA 2XQ0A 2YLHA 3G5VA 2W0KA 1CZ8H 3MUGB 3NN8B 5JO5B 3WLBA 2X2IA 4KITB 2WYTA 3KLSA 3FB8B 5LQBL 3HUJB 2BIIA 3WXVL 2YRPA 2F58H 4HWBA 1T4WA 1FORH 3L4TA 2ADYA 3AFLA 2IQ9H 4E9VA 2OTUB 1PLBA 1I1AC 2AKRA 3PUCA 4Q58C 5I6XC 4UOW1 2CHWA 3LOWA 4LP4A 2ZOLB 4N25A 4PJHA 4KKLC 2ZX9A 4UF7C 4XC1L 4FULA 4PG2A 1AKJA 3V8CA 1CS6A 1HKFA 2JV6A 3KEDA 3AQDA 4I48B 5DFWH 3QUYD 5EWIL 1K8DB 3A4DA 3TO4B 3HG3A 4GSDH 4Y4KB 4PIRF 4U2YA 5IM7A 5IJVB 4D9QE 5IG7A 3ILPB 3IK2A 4P06A 2QGCA 3UACA 4E2OA 1X7QB 3TF4A 5KS9F 2BW4A 3BVDB 1ADQH 1U4EA 3L4WA 5DC9B 3TIDB 3GXPA 1ITBB 2QVIA 1CICC 2C9SA 3QCTL 3V0IA 1VENA 2WUCL 3K4AA 5D7LD 4NQEA 1KYDA 3DRQB 2DJSA 3UBXI 3C9NA 2FJHA 4FTVB 1OGAA 3BUIA 5EFIA 3IEAA 1AD0A 2Z92B 4K3HA 4UQAA 4MTMA 3DPDA 1W9XA 2FGWL 4GQZA 3H4HA 3ESOA 1YCSA 2VDKL 2CE6A 4J6RH 1OSPH 1OLZA 5E99H 1J0IA 4ZAKD 5DZ9A 3PV7A 3OR7B 5IB1B 5J1SC 5DC4B 3RGVB 3MGTB 2CJ3A 2A99A 5CAYB 2ZWKA 2R9HD 2IC2A 3T71A 1OM9A 5AUMA 5LNDA 1NFKA 2NW3B 4KAQH 2IF7A 4XE5B 3IN0A 4H0HB 3ZDYE 3SGEH 3K6SB 1BJ1J 3CVHB 4PJ5A 1MW0A 3DPBB 4BFOA 1DUYB 4BGDA 5DJDB 3B9KB 4BFFA 2X4SB 4RGOL 4H88L 4N8UA 2OJZL 3DO4A 4X80H 5DTFA 4BHUA 1GMIA 1KN4L 4PJ8C 3ALWA 5IBUB 5T1LD 3BP5B 3HI6H 2AI0H 4H40A 4B0MB 3IXAB 1XF3A 4K8RC 4G8FB 1WWBX 1Q9KB 4LMQI 2OXGB 5DT1L 4XN9A 5CZXD 2ZXWB 1TTGA 4JRYA 3GTTA 2FHBA 4V1DB 1XGTB 2EE3A 5F0JB 3ZDZB 4M93C 4P5TD 2P8LB 1FFOA 1IARB 1W0YT 2VOTA 2XZCL 1JN6A 1ZXQA 3FQXA 3PGFL 1GTFA 1EQWA 4JNXA 2QZ5A 3G6JA 2NY5H 4LPCA 3ZUNC 2R1XA 2UX6A 5KSVB 1YY9D 2O5NA 2YFOA 3KYKH 1KXQE 3QHZH 1JZFA 1S7XA 2DQCH 3BVXA 2QV4A 4P4KB 2CGZA 5LGHH 5TGBB 2V2XA 1MZYA 1BIHA 2FSEA 1MLBB 2MNUA 4XP4L 3ABZA 1TITA 1MY7A 3QUZD 4UOJA 4LLQB 2GTZB 1EJ6A 1BIIB 2PPEA 4NBZB 5FM5M 4OJEH 1UFGA 2CMRL 4RSYA 2H0EA 5HHXH 4D0DA 1WBXB 1Z32X 3EG9B 4HMCA 1OIOA 4G1MA 4ZUVA 4DF9A 6FABL 4JQIA 4G8AC 1IZJA 2JKLA 5IMOB 4MDJA 5DHYA 2SEBB 4O9HL 4PR5B 5CLZA 1Y0LB 3FSAA 2EYTA 3NGBB 3P0YL 3Q1EA 4XCNB 3OAYH 1N26A 2G2RB 3I6GB 4A55A 4IOSA 5E9DD 1YNTB 2C9PA 2D3JA 1WJ3A 3PDOB 4P2OA 4KKCC 3DGGA 1L3WA 2OL3B 3OLEA 2FNBA 1XB6A 3NMEA 3LTVA 5DR5L 1M71A 1F6AB 4WGVB 1U8OA 2CHXA 4WJG3 5LBSH 5TE7H 2ZXAA 4HJJL 2JI3A 1NAMB 2C7UB 4R9HA 2IV9A 3GMQB 4M1GH 4RAUA 4M8QB 3ARDA 3O4LA 5J89A 2IOIA 1NIAA 3RIKA 2GI0A 1QWHA 4U6HA 2ED6A 3VE0B 4HSQA 2DW5A 1DLHB 3IFLH 4GKZB 4LFHD 5K9QI 4KDTC 4PV9A 3OKDB 3ZDYB 4LQFL 3F64A 1RIVL 1MUJB 2CDEA 3FF8A 3KD4A 3LXAA 4HXBH 3P9WB 1NAKL 4B3EA 5KVEE 4MCYB 1MHEA 1OW0C 1VZIA 2WLYA 3P69A 4NKOA 3RNKA 3VWJD 1KT2A 2YUVA 4YNYB 1OAUH 4QRQA 1R5WA 1INQA 2DQIH 4OD2A 1LWJA 4PTTB 4D94A 2OJEB 4QDGA 3K0WA 4R2GD 5JW5B 4RFEB 4OUUA 1I8MA 1ZPUA 3S2AA 2IH3A 5L8JB 5DURD 2M83A 1DDHB 3R4RA 4Z7NF 4ZX4A 1UWEL 2AGJH 1HINL 3C6SA 5GRJL 3P73B 4HJUA 4X50A 1MVUA 1FRGH 3BO8A 3MX0A 4BH8A 3LNEA 4JFFA 5E6SB 4TUOA 5IB2B 1XB8A 3VFUB 2J8OA 4DGUA 2N59A 1U3HB 2NW2A 4AT6A 1E30A 2NNAA 2P24B 3GLEA 1ZD6A 3CFKA 1N6QL 4JANB 3CH8A 2ATPA 4JFEE 1HH6A 4L4VA 2AJSL 4FRWA 1G7QA 4KOCA 1HSAB 5D2LA 4FQ2L 4GW4A 2ZIDA 4WO4A 4A7TA 4ONFH 1DR9A 3MVSA 2BNQE 3TA3B 4HV8A 4M5ZL 2XWXA 4YAQA 2FB4H 5FC9A 1T03L 3ZYZA 3FSWA 3PL6B 5FYJD 3HN8A 5LAPA 3A3YB 1C5CL 5EOCH 2WKGA 4LLWA 3VXRB 3OKKB 4GW5A 2A3TA 3CVHH 1WHOA 3ZT7A 4OCNC 5IEHB 3TT1H 4PLKD 1O7VA 2KZWA 2WKOF 3GLZA 3ZSTA 3BD4A 4LB8A 4URTB 2D3VA 4P3WA 5HD8C 1CDBA 4G1EB 3ZL4L 5BMFL 3MU3A 2JB5L 3RY4A 2EXWC 3NCYP 1NGXB 1EEZB 3ETBF 1BD2D 4GINA 4M62L 4ZMPA 1OAYH 1W8OA 4ZZFA 3GJEA 3KR3H 2DYSB 3PG2A 2CPUA 4XWGH 1RZGB 3AB0B 5BOJA 4UTAL 3QZOA 4ATWA 1UZ8B 4PJXA 1VZHA 2IDCA 1K8IA 1O7DC 3QUMB 2RFXB 4AEHL 4XP6L 4TQ8A 3IXTA 4P5RA 3H7BA 1XAKA 3MJGX 4ONGH 2J1XA 3GSWB 1E2ZA 2BOBB 2BNRB 5KN5B 4S0TD 3WN5A 3MJ9A 1CL7H 4NCC1 2APTA 2LAGB 4XP1H 1Q72H 2W9DL 5JPNB 1MELA 1H8LA 2IH8A 2Y7QA 4NLHA 5IW3A 4AQEB 1YLBB 3NEEA 4ONHA 4TTDD 5HDRA 1TVBA 4X5XA 2JJVA 3AROA 5K59F 3F7YB 4DQOL 5J9PB 3AWGA 3KGUA 2F0CA 2HFGL 1MJ8L 1CFSB 1QFWL 4CJ1A 2JXMA 1FFPB 2GFBA 4F3FB 3PWPE 4Y4FC 4XMLH 4XRCB 5D1QB 2XVBA 3BC9A 3BX7C 5FWRA 4GI8A 5DQJA 1ZIBA 3WNLA 1GZQB 1RSYA 4MHHI 4YVUA 1HNFA 1J8HE 3IB4A 2YPVH 1Q0XH 4A7VA 5C0AD 4CC1A 1D3CA 5GISL 3MLZH 3J27A 2MTPA 3QO1A 3Q2VA 1Y6MR 5I17A 3S37H 3DARA 4FQIL 1KGJA 4JDEB 5EN2B 2VIRA 4JZJC 1E5ZA 4NS0A 5GS2H 4R4BA 4PREA 2HP4A 1EHNA 3FN0H 5ALBH 2QLYA 2NNFA 3FUKA 4JKPH 4CC4A 2OL3H 3L1FA 4U1NA 3UMNA 1S7QB 1RIHL 2CUHA 4O2EA 3GBNL 2FJUB 3ATEA 1JPTL 3MLVH 4GAGH 4JPQA 4HUUA 1B4RA 5IHWA 4FQ1L 5L8LB 1SOQA 1BF8A 2G5UA 1R0AH 2NZ9D 3CDYA 1NAMH 1Z66A 2GJ6A 4KKAD 4MXVE 3BQUC 5CEXB 1QPPA 2Q0ZX 4ICXA 4NC2B 1N5YH 4HQQH 1NCUA 5EZPA 5IQ9A 4J5VA 4WHTA 1U30A 2A0LC 2CO2A 4GS7C 1ZCRA 1OD7A 4N3TA 4WTXA 1MJUH 4I4WB 2XXFA 1GYVA 3NEOA 3ZOAA 1G1OA 1N18A 5HJ3B 5I6OA 2XG5A 4G70B 4QOKD 4OIIH 1MCIA 2VR9A 5B39A 1VRSA 2X4UB 1ZT7B 1X4XA 3O8XB 3ET9F 4GBXB 2WZPD 1QI4A 3HG5A 3BSZA 3D69A 1ACYL 3GIVA 4UQBA 1U8LB 1AJ7H 4LL4A 4U6YA 1QSFD 2DIEA 2EYSB 2I69A 5HYJE 4LSPL 5JR1L 5DJ0A 4ANXA 5IB3A 1LO0L 4EUPB 2VKWA 3DSFH 1DQLH 4FQCL 5HDOA 4KKZA 5C8JA 3F7LA 1G84A 3M45A 4K5LA 5JTWA 2A9NH 3W2DH 3DMMB 1K5NB 4YHMH 3FQRB 2CIIB 2O6FA 1LO3L 1XIWA 3L9RB 4KMLB 4P46D 4B6ZA 5C7ZA 1J5OL 1A7PL 2J8UF 4OLXL 5F7EH 4DZ8A 5C3IA 4RMQA 4LPUA 1JHTB 4JN1L 5GJTL 4NXKA 1NEZB 1ZJBA 2Y06L 3CZEA 4JFED 4JL1A 4XP5H 1TCRA 1IAKA 1G5GA 2XWJA 1S9WB 1SFDA 1JI2A 2BNQD 2Y1YA 2YD0A 3NESA 2GUYA 5LB1A 2ZJSL 3CUPA 5AYUH 1ZV9A 1XV8A 4QYAA 3RY6C 3UDWA 5C1MB 2YPLA 1SJHB 3ZZSA 2VH5L 5CJOH 2V4LA 2UZIL 3D06A 1WICA 3DHJA 4BZYA 1Z5LA 1AGFA 1ZWIB 1REIA 3L7FA 3AWEA 2I9TA 1CE6A 4H8UA 1LVEA 1GZPB 2XIIA 2ZWLT 3QT2A 2WQUA 2QGBA 3N1FC 1Z9NA 5JPMB 2N7AA 4X4ME 2ZKYA 1J8HB 2QTVA 3L5WB 1RJLA 1J7VR 1N0LB 3EGXB 3L8QA 4P49A 2H32A 3QG6B 4JRXD 4KI1A 5I19H 5EORH 4C47A 3CVIH 2Z7WA 2A9AA 3LEXA 4GG8A 4K3DH 3OKNB 4Z7NB 1B0IA 2BSBA 2B5IB 2DWSA 3LKSB 2EEAA 4H0GA 3MBEB 2FLRT 2GIYA 4U7KA 5TDNB 3PP3K 3U0TB 4HT1L 5L9DH 1ZE3C 2C1PA 4IRZL 2WWMD 3BLBA 2CCVA 5DJ8B 1EXUB 1WZLA 1XO8A 5DJXA 4F7MA 1P9MA 4M5SA 5GJSH 2WJ7A 1H19A 2X4PB 2BDNH 4L4TA 5TDPB 5AVQB 4EIGB 5AVWB 4PSPA 1JF6A 3EXLA 1AP2B 5E8DH 2CG9X 3N42B 3QUMH 1AHKA 3MXWL 5AOKA 9PCYA 1WZ1H 4F15B 5CJBA 5KBNC 5CHNB 2E7LA 4XVTH 1S7VB 1ZV2A 3SZKC 1OVZA 4UM8B 4YFEA 5ABZA 4XPAH 4GKSB 1KULA 3V52H 3JWNG 2EDOA 3PAVA 4NZUH 1P7KA 2J72A 2Y6SD 4DUVA 2CKNA 1EXGA 5FV2A 1HNYA 3II2A 2EECA 1YDPA 4Y1AB 1CLYL 1DJSA 5FM4A 2IG2L 1L0XA 4GIAA 4DO6A 4NN6C 2EZ0D 1V27A 3O45B 3PWPD 4EVNA 3SDDD 1CVRA 2EH8H 1H8SA 1RV6X 4LHUA 1QPKA 1TXKA 5ESAB 2QVKA 5KVEH 2IALA 4DP6X 4JVUA 3SYOA 1QHQA 2OMBA 3CQQA 1NSNH 1A47A 4NI6A 4OF5A 3D0VA 4ZJ9A 5HYJB 2HLFC 3DX7B 4JFXB 1CG9B 1MH5B 4U1KB 3B9EA 2HG0A 2XQYA 4CAGA 4XO8A 4JM2C 3M07A 1H6UA 3MLSH 5I1CL 3MUHL 1A5FL 3KVQA 4AXWB 4DKFL 2CBMA 2AERT 3RA7L 1M7DB 1DFBH 4MDIA 1TPXC 5EU4A 4LBEA 3O41A 4DKTA 4IEFA 4NQXA 2A77L 4ZD3H 5EZJB 2OMVB 3H85A 4Z7VE 2NY0B 1E9OB 3V0VA 3AWFA 5I16B 1AGEB 3IMWA 5C3LD 4KX7A 2BHFA 3R1GL 1MFDL 3KPNB 2HRLA 4P9HL 2AK1H 5H2BA 2G3ZA 4IIQB 5IB4A 3G5YB 1SEQL 5ETUA 4AW4A 1X4YA 3BUYA 1WEJL 3ARPA 3DYMA 3DO7A 1ZK5A 3KPSD 2ZOKB 3FJTA 3P3SA 4WY7L 1BFVL 4ZUSA 5JHLH 2X4TA 1KIRB 4WVRA 1S9YA 1RZFH 4HJGB 1V8HA 4NRXA 3N9GH 2PR4H 2D73A 1M2OA 2E8ZA 1YECH 1C12B 4RH4A 2BJML 5KWYC 4BQ8A 2F53A 4Z7WF 3FUEA 5D71H 5B1KA 4HK3J 2RHEA 1RZKH 4BBWA 3TXAA 4W93A 4EUPH 2ZKHL 3DVIA 4H5SB 2FYYA 3QEHB 4XZUB 4PJ9A 1BWMA 1U8IB 2X12A 3U6XS 1LP9E 5J6HA 1R5IA 3MLXL 3GS4A 4FNRA 3GRGA 1BQKA 4L3CA 4W68A 3QG7L 4UDUA 1KXTB 3B9AA 5DQ9A 2BVPB 5HGDA 3RIFF 5FB8A 1HVXA 3TEUA 2K45A 2AVFA 2ZOUA 2MOQA 4Z0XA 4XPTH 5HHPA 3H42L 4NENB 3QDME 3CMGA 4MKMA 5AVRB 3GS7A 2NTSP 1X5LA 1ZDQA 4TM9A 3QNFA 1FZOB 4A2MA 2H6OA 2W91A 2GYSA 1EZUA 5MENE 2WYHA 3FSOA 2P5PA 3HEIB 4UUJB 4YHLH 4YO0A 4APQD 4MB1A 5A40E 2XBZA 2SODB 3RIFK 3T1FA 2ADJA 1KIPB 1F8TL 2YD6A 3ENEA 4HWEH 3IJHA 2WNKA 5DJ6A 3UC2A 3V79C 3MACL 4XX1G 4ZSOA 1RUAH 4TUJB 3ABLB 3ASOB 4MQ7A 3WTSA 4LCIL 5CZVH 2P42B 3CFBB 3NIDF 5B8CB 1CLZH 1HXMB 1SYSA 5GZNC 1OB1B 1NBYB 2V33A 3S3PA 2DD8H 2M1KA 4ZO6A 4LFHG 2PUQT 3ES6B 3OMNB 4PTUA 1L0PA 1NFIB 4Z5RA 4DGIH 4AITA 1T22A 1CO1A 4MNHB 1T1YA 3WN5C 2B2XL 1IGFL 4FG6C 2L7UA 4LSQL 4YUEL 4G8GD 3LV3A 3W11C 1A1OB 2Y7MA 3GBEA 1OF2B 3O3DB 3AXLA 1NH6A 3QUKB 3C6LA 1TYJA 4NM4L 3O2VH 5L6YH 5JDSA 2V7NA 2OSLB 1SQ2N 1F90H 3C5ZD 2A83A 3ULAB 5D7SL 5E6IB 3X13A 5GZOD 1CDCA 4JO4H 4BZ2H 2DQUL 3NJVA 5IW1B 2X2JA 2X4OA 4PWKA 3VGFA 3W0WE 4ALAH 4UQ3A 1F6FB 1ZHBA 1WVZA 4PWHA 1ZA6A 5K9OA 2NLJB 2WLJA 4ZS6C 4PRPE 2ICCA 1YO4A 3GMOB 5D7KE 5B7EA 4OSUH 1NCGA 1IAIL 4Z7QF 1MI5A 1HCZA 3L3JB 3L4CA 2WLHA 1L9QA 4PY8I 3VD1A 5ICZA 3A6CH 2PO6B 4WSKA 2GHWB 5DD3H 4OQTL 4RAVB 4MXWH 5KG9B 1DFXA 2DBJA 1U33A 2IPKB 3CBKB 3DX4A 4CU8A 2ENQA 4LLUB 1U92B 4FFVD 5GRUH 4OIFA 3KWUA 4WGKA 1XSKA 2V0AA 2AMGA 3ILQC 4G7RB 1D5ZA 2LVEA 3FQUA 4X0KA 5SWSE 4X98B 2F19H 5EEVA 1X7TA 1CXFA 2XWBA 5JIKA 1UM4L 2J1ZA 1FL5B 4FG2A 3O2WL 4FYRA 3V4VL 3WTXA 2K7PA 3JXAA 4BSVB 3K5SA 2JKNA 4NZRL 3T4YB 4XGZB 5G5DA 4AGOA 1BZ7A 3QDMB 2VN5A 4M61B 1ONQB 4GRWB 4PVMA 2X3BA 3MO1B 2J1KA 5DVMA 5T3ZD 1KBWA 5MENB 1WIOA 3QUXB 4K55A 2K4AA 1UOWA 3O6FD 4U1JB 3BKJL 5C09A 1OTUC 1KDIA 3U4EB 1V7MH 5E6UB 4NQCA 1A4KA 3IFNH 3LKRA 1E7VA 3VFTA 5FDWA 1JJUA 4IGBA 4OZFG 2K8MA 4GUPB 2ZCKH 3H4FA 2PXYA 1KEMH 2CZNA 3IVKB 2H45A 32C2B 2XG4A 4ZPTA 2CO1A 5I1AA 1DSFH 4EBQL 2X0VA 5AB0A 4BK8A 3FBKA 2WBJD 5E2VH 3ARED 3CD4A 4LARH 4XOCA 1KPUA 3CSPA 5IHHA 3EJZC 3QXTA 3U25A 2L0DA 1DEDA 2UY7B 5LNGA 3IDMB 3RTLA 2YAQA 3TTYA 3H2QA 2HH0L 4I2XB 1I8LC 1MFCL 4G6KH 2JIXB 4JKKA 4K73A 1MSPA 2H4EA 3RNQB 1LQBC 3MUZ1 5DD0L 2DRUA 1U8KB 3O0LA 2GC4C 3BWUC 4KKPA 4NO0A 1EGJL 3FPXA 5ABAA 3VFSB 4LHQB 5GGQH 2CBQA 4N2FA 2WLLA 4OCMC 3QFJD 1U93A 1EAJA 3LQZB 2AC0A 4G42A 3B7UX 3K6DA 3W0WB 1JGDA 2P1YA 3D4GA 3PQYB 4PRDA 2V9RA 4JPSA 3ZTEA 3EYFA 1YEHH 5J5EA 4PRPB 4NQSB 5J57B 3MRKA 1CFNA 1T7YA 3ZR6A 3AUWB 2VRQA 2ZTBA 5IBLC 5HGHB 4FKKA 3KDPB 1T1WA 2IFFL 4K3GA 3BIAX 1IFHL 4MCMA 1HAWA 1JGUH 2FH8A 1DVTA 3OB0H 3EYQD 4CKVX 4BK5A 4FD0A 3JYCA 2IAND 3RDTC 2V8LA 2HKFL 4Z7WB 4DP8X 4ZDHA 1T21A 1NEUA 4QMEA 1IGJB 2F74B 4BWTA 2XA8L 2O1AA 3U7WH 1Y7VA 3QAZB 2HVKA 4P2QD 3B2UD 5IFJB 3LN5B 4NUGH 2UWEF 4R7DB 5BCAA 1PLAA 3IPFA 3LKOA 2P5EE 3P0VL 4F8PA 3F12B 4JFHD 5DO2C 3E6FA 3DETD 3K8KA 5I26A 5EHFA 3TJEH 3LSOA 5SWSB 3CMOL 4EN3B 3N44F 1T3FB 5L4JA 1GS8A 1NANH 2ARJA 4HPYL 3RWHA 3UH8A 3AXHA 1BQSA 4YH6A 3P9LB 2KDYA 2Y2TA 4OD1H 4YDVA 3UZQA 2QJDA 3FTGB 2K4WA 2V3FA 2OZ4L 3IMRA 3C60A 3HG0A 3FFDB 5EOTB 5FF6A 1EWHA 3VXOA 1MNNA 4N8VA 1D7FA 2R8SH 4CMHC 1HU8A 4JLRB 43CAA 1RZ8A 4YBQC 1H5BA 1M1XA 3K1DA 1DCLA 2W07A 3CSYB 5D7KD 3QC5X 3VD7A 3P77B 5F96H 5T1DL 1E6JL 2FD6L 3QI9D 5KZCD 3K6SA 2KYIA 4UTBA 3BW9B 3BKMH 2QR0A 3OQRA 5KYWB 1F13A 2VNCA 3EADA 3AADB 3GB7A 4YHPA 4C57C 2R1WA 4D3CL 4EDXB 2XFXA 4PJBE 4OCXH 2RCSH 3KH3A 4YDJA 1HQRA 1FYTA 1MCFA 5FOBA 5A2KH 5HPOA 2GCYA 5LWYH 2EC9T 3P2DA 3V7MA 5LKNA 3EIFA 3A21A 1BVLB 4RBPK 4UAHA 3FO0L 3KVPA 3OR6A 3QIUD 1QA9A 3HS0A 3MUY1 4J3WA 4ES8A 3ZIMA 3AG2B 3QJHB 1U8HB 2D7MA 4O2FA 4O51B 1EAQA 5FYKL 1E28A 1XZWA 1Z1WA 3KYNA 1G9NC 1C1EH 2YQ2A 4MBRA 3SDAA 4J23A 1MN4A 5KTEH 1W72L 4GRMB 3RUGB 3OG6B 4BCXA 5HHME 5SWQA 3MRGB 2EYRA 4DP9X 3FN3A 4QWWD 1L5GB 1XCQA 2AV7A 3FFCA 5TQ0L 2FVNA 3L1EA 4GRWH 4JDZB 1JVLA 1R3HB 3FF7A 4PM1A 3DXAD 2NY6C 3M17A 5FV1L 3FB6B 1PNCA 1FIEA 3VI3F 1DLFL 3SDYL 4NN5C 2OR8A 5CUSL 1AIZA 3Q2NA 4G7VL 1GC1C 2X09A 5E08L 3VD5A 1ZMYA 2QT6A 4WK2B 3R4DA 5EC1A 5F7YC 1CFQB 3SE9L 1OAKH 2ZYIA 4AEIH 4ZW5A 2Z4TA 5HI3C 1BM7A 3QJRB 4OY9A 1OAXL 1S7SA 1KTRL 2H41A 1E4KC 4YHNA 1EFXD 3HLKA 2FNWA 5D1XD 2P5EB 1KIUA 1FE8H 1IM9D 1AMYA 4H2CA 5AVXB 3UO1H 5B1AB 4HLEA 4PRIE 1Q1JL 1BXXA 3SJVE 3KMDA 4PJ7A 3IJ9A 2P8MB 5SV3A 5IIEB 3VXSE 4X7DC 2W0LA 2WLZA 3LMJL 4KJQC 3PHQB 1HWGB 3B2DC 1G6RL 3PWNB 1JNJA 3TH2T 5FAAA 3QEQE 1E9PA 4LESA 2CSPA 4ZMLA 1PMYA 1DQIA 1EDYA 1HHIA 3U9UA 3X3GL 1QFUH 2D31A 2G5RA 2MQ0A 2ZXEB 2XPZA 3L13A 3MOBL 3C8KA 3STBA 4WW2F 4ZW6A 3JZ7A 4MD5A 3MRQB 4FFYA 4WTZA 4LIQE 5ESQB 1UM6H 5TFSH 4KZDH 3RKDD 3SE3C 3WJMA 1NDTA 1A3QA 4NM8H 4LAQH 1L6ZA 3QC6X 2YSTA 3SDCD 3QR2A 4OZGE 2QADC 3IDNA 5C0JB 4AJ0A 1IKNA 2VJ8A 4HWZA 4LCYB 4PJBB 5GGVH 1YEKH 2V37A 5EA0H 1MG3C 5DC2A 3ZN6A 4MKTA 1QSEB 2DTML 4YQXL 3DV6B 3PV6B 4QXGH 3UZEA 1DEEB 1GGCH 3VGAC 4JDVA 2N1TE 4G9DB 5KEZA 4WIQA 2XXGA 4ANKA 4DFHA 4Z77B 4QRRB 1A6TA 4QHLA 3MRJB 4CW1B 3OXRB 3NJMA 4KQ4H 5JHAA 3OLGA 2D3LA 3MCYA 3HE6D 2ZCLH 4RX4A 3T0ED 1AY1L 5JA9A 3KCWA 4EOWL 4U1HA 1HI6A 5E5LA 5HHMB 1F3DJ 3MRPA 2FWUA 4FG4A 4GH7B 4YXHH 1FIGH 1YQ2A 1BVKB 5I6XB 3X1GA 1U3YA 3KPOB 5FUOH 4NOFA 3S36L 3QJQB 1SHSA 3C75A 3BEVA 4HUCA 2J2ZB 3EJRA 2XV6B 3LQAC 4ATTA 1JIBA 1LO4L 4JZNA 4OFDA 3D2TA 3UJIH 3A4EA 5TK4A 4AENB 1QFHA 2Q7YB 4AL8L 4EZKA 5D7JC 4H8PA 1KGCE 4Z7UE 3A6BL 4BSJA 4K3EL 4BSWB 1TQVA 5DRNB 2O6CA 1RK0A 1ZTXE 1JZ5A 2X7LB 4UZGA 3HZYA 4PLNC 2BSSA 1FZJA 4J12A 4XOAA 5DGQA 2KLSA 4PRIB 1NLBL 2A6KB 4JFPA 3VXSB 5D7HA 3HRZA 4MMYB 1YEIH 1LDPL 4LL9A 4NFDA 5IQ7H 3A47A 4XE0A 4YBHA 3O6LL 5I76A 2LU3A 3QEQB 2AK4D 2K3TA 2KDGA 3S4SB 5I1IL 4LZKA 1BFTA 5H94B 3QA3B 1FWXA 5AOIA 3Q5YA 1JF5A 1TJGH 4E9YA 5I75B 1I1AD 4QTFA 5AZ2H 1P5VA 1DYZA 2XDHA 1J12A 1FNEA 2HT3C 3WI9A 2HKAA 3HG1B 3OKEB 4QGYA 3TO2A 3PREA 1ED3A 3QJXA 4Y5YB 3TJPA 4HKXB 4QHPA 1K4CB 1J0HA 2IQ9L 1FHNA 1U8PB 4X6DE 1WD9A 3LZFH 4HJTA 4B41A 2J5WA 2GUOB 1JWMA 3K2UH 4S1QL 3REVA 4Z7IA 8FABB 5EU6A 5A1AA 1PX4A 2VDOB 4UDTB 1OCRB 4W4OA 4OZGB 1CFBA 3NABH 3S5YA 5C07A 5IOPA 3LZPA 4TTGA 2P8PB 1LILA 4B9GA 1U8QB 2BSDA 2OYMA 1I9EA 5B3NA 1CICD 2FX7H 5L7XL 1M9WA 4D2NA 3CLFH 1I4FA 3QULB 4M5YL 4HOMA 4PFEA 5D8JL 3D12B 3DBXB 5CD3B 5IVXA 5DVPA 3WDHA 5TF1L 3BH9B 1JK9A 5DJZA 5L2KA 1EIBA 2KLRA 3SJVD 3QNZA 1S5HA 5F3BB 2EKSA 4MD4A 1J05A 3N43F 5EB9A 5ACMA 1SYVA 3BCDA 4Q2ZA 2I5YL 3VWKC 1BXAA 3B8YA 3WHE0 2VDOL 2NQDA 4HIHB 4CN4A 2OSXA 2XWEA 5B4MD 5T3XE 1M6OA 5E99L 4EJ1C 1KLUB 4J3XA 2R0LL 3RWIB 1AOHA 1K3IA 3FSVA 1CFTA 3Q8FA 3ZGIA 1IC1A 4L9LB 3WNKA 3QPXL 4LF3B 1FAIH 4KVPA 1U9KA 3S88L 5CNHA 4DP0X 4I3RL 3WGVB 4APXB 1YZZA 1XF5A 5T5FA 1KBVA 1BQLH 4PJFE 2W60A 1JV5B 2YA2A 4JZOA 3VI3B 1NEPA 5DMYA 2OX5A 3WY3A 2DEWX 5AL0A 4QXUL 4Z7UB 5GS0C 1G5AA 3S34H 1MCWM 2RQEA 3HI1A 4CMMB 3O6ML 3ZKXC 3D85A 4PHZA 1AXSB 2JQZA 1XB3A 4IS6B 4KVNL 1YYCA 3TEZA 1G43A 2H0PA 3TF7C 3BT0A 4F8NA 2XLLA 3BOVA 3DDFA 1K6QH 2VQ1B 2WUBH 2J4WL 3SCMD 3NIFF 4K9EC 1O7DE 5F1KC 4WCYL 3KGRA 4X7TB 3IJ8A 5D6CB 3GMMB 2F54D 3RZCD 1KGXA 1NUDA 1GSMA 2X6UA 3C60C 4Z6AT 4DAGH 4BE5A 2BHYA 4YHIB 4QRPE 4ZTPH 2GABA 2VXQH 5DD6A 3I6LD 3MNZA 5AW1B 1LK3H 4FG0A 4AYGA 1KTLB 4P23C 1H5BC 3QHZL 2LU7A 1TYEB 1M7IB 1ZK9A 1T0MB 2EDYA 2LU4A 3BGAA 3QDJD 4OAWA 2Z8SA 3KHOA 4NQDE 5DSCB 5HVFB 2VL5A 2JI2A 5C7XL 2NY1D 2XZQL 3P54A 1M42A 4KO5A 4UIMA 2WXFA 2F5AH 2BP8A 5LCVA 2V17L 1AO7D 2H0FA 3UAAA 2DQGH 3MRDB 2BVUA 1FFNA 3PS6A 3L3IA 4NHUA 5CU9A 3HS0C 4KKCD 2EEDA 4H0IA 4OI8A 1A7OL 1T5WB 3PPSA 3RAJL 2NR6A 3VFPA 5ID1B 1DQTA 4Q0XL 3MA9H 4TVPD 3JUZA 4FXGA 2Z9TA 3MODL 2J73A 4GG6B 2FX9L 4KOBA 4FA7B 1SJEB 1LLAA 1UH3A 2EICA 1HEZA 3L5IA 2DQTH 2X1QA 3CCHB 3SDAC 1XVSA 1VSCA 3FCBA 4O2CB 4IRJA 4Y19A 3QGVA 4HCRL 1Z3GH 2E76C 4OIBA 5CSBA 1MQKL 4C56D 1CI5A 3BQVA 5DVOA 4JKNA 1UEMA 4E68A 1AGCA 4XBMA 5FO9B 2FIKA 1LK2B 3DVGB 1KGYE 1R3IL 4LDCA 3JV5A 5GGUB 4J3OD 5FGCE 1ZGLP 4PJHE 1FFTB 5KSAA 3BE1L 5DLLA 1S8DB 3EHBD 1KSRA 5L88L 5L0QC 2JTDA 1BWWA 1NBZA 2IMMA 4PN6A 1JNNL 2YMXL 2KQNA 5I5MA 1KLFA 5E8EA 1R24B 3T0WA 2O5YH 1UWGL 5CP3H 4LIQH 2A4EA 2YAEA 3LN9A 1BAFH 2DMHA 5MEQA 3WE6A 4GRLD 3WMSA 2NTFB 1NIDA 3KL5A 2FJFA 1Z5HA 5I8CB 3ULUC 1UKSA 4RBPH 1OHZA 1QLEL 1RULH 4FEIA 1JD9A 1P4UA 1UOVA 2VN3A 5ALCL 2KZKA 3ZQXA 5ACZA 1J9RA 2AEPH 1HTYA 2EDJA 1TJHH 1DQVA 3IS0X 1NCTA 1SMAA 1JZIA 2XQBL 4HHAA 1J0KA 1OAJA 4K8RH 1IT9L 4TSCH 5T1KA 2CLRA 2AV1B 2DLEA 1DDTA 3DUUA 3FT9A 1A9BA 3CDCA 3WFHA 4YSAA 4OLEA 3S5ZA 3B5HA 3H1ZA 4HWUA 1YN6B 3VRJB 5D1ZI 5JXED 2Z7UA 4QXTA 3KLAB 3CVDA 3EGSB 2DLFH 1GL4B 1A6UL 3SKOA 3CC5B 2XU9A 4QRPB 3MLTB 2A9ML 3APDA 1T1XB 2EIBA 1A6AB 2VWEC 4CUCA 3FRUB 2WLIB 3FO9B 1IKOP 4OZHE 5BVJA 4M8RA 4Q7DA 3WMPA 1HKLL 3TEYA 4G6AC 3WBDA 3UTQA 5J3HD 1B0GA 4L8CB 4XMPL 2DKUA 4JJ5A 4Y4FB 5DMKB 3IWVA 4I88A 4NQDB 1IKNC 3OHXC 4Y9EA 3NPZB 4Z3HA 4LGPB 3WKMH 2Z64C 4FGMA 4EI6A 5K93A 3B56A 4Z76B 4JFDD 4QJ3B 3EJCA 2VO5A 1IAOA 3NSDA 1ZVSB 4PJIE 4QRUB 3C5XA 1UOKA 4JY5L 5IKCA 3L95B 3NJFA 3CZLA 1VFAA 3EO0A 4EI5C 3ATAA 4KRLB 3NP3A 5HHQB 3STLB 2PP8A 4JRYE 1LEKA 2LR4A 4JZJB 4XNUL 4ZXBC 5IBTL 4ZOAA 1CXEA 1ZTXH 2XKUA 4WV1C 3KPPA 4KGLA 3S96A 3LZNA 2QKSA 5JHDA 1KIQB 1X5AA 1QBML 1CBVL 4FNSA 3MCG1 3HJEA 4HYTB 4QY8B 5D1ZB 3SKNB 3LRSB 1OAYL 1WV7T 1AIFA 3TWYA 4U4IA 3RWJA 5HYSG 4XODA 3BQUB 2F61A 4ZS7L 3VWJB 2FHFA 1HOEA 2HFEB 5FGCB 3D2UA 4KTEL 4PJHB 5SWZA 1LNUA 5FA3A 2DN7A 1CCZA 3MNVB 5FO8A 4MQTB 5KYNA 4XO9A 5AD0A 1JZGA 5DJYA 1KYAA 3OMIB 4N2EA 4UB0H 3VYNA 2Y69B 2WWOA 4U1IA 2ZX7A 3PRZA 1UA6L 3SGKA 5IW6B 3MBWA 3IDYC 3GHBL 3EYVA 3VNYA 5B38B 1E50A 4RETB 3RHWF 1BMGA 3SQOH 2ERJC 2B39A 1MAJA 4HZ1A 3FPYA 1THAA 5I1EH 3H3KA 5J06A 4N0FA 4DT2A 2NXZD 1MW2A 4XHJC 2NY7H 3FOLB 4DEUA 4DO5A 3CZJA 2VZ3A 4YE0A 1JF1B 2CHDA 1PZDA 3VMPA 4Z3TA 1YN7B 2NUTA 2AJVH 2AJXH 4LCUA 2DDQH 1L7IH 2A4ZA 2FJHB 3GLDA 2IH1A 4ODUA 2R2HB 3ZYOA 3M1OA 3IJYB 4JPVL 5EPMB 1Q0XL 3I3DA 4QNPE 3GSNL 3HPJB 4HPOH 3CN4A 4Q8BA 3WHE1 2A73A 4Z7OF 2K3HA 2ZX6A 3MXVH 1Q9LB 2QSTA 4ZRGA 3NIFB 3WUWG 4DVRH 1FJ1B 5I30L 4FKEA 3FCUB 4UV7L 3LZQA 4PP2A 3WIFB 5CR1A 3VFNA 2NY3D 4P8QA 1D5IH 4ELME 4FQLL 2OTWB 2VISB 4X6BB 3QJSB 5AW9B 4D9LL 1R0AL 1AKJD 2K9UA 5T3XH 1MCPL 4OZHB 4PYHA 2JCCA 3WSQL 2EO9A 2YQGA 3FT3A 3C2SA 4PGEA 4W4OC 4Y2DC 15C8L 5LLIC 2FL5A 5CMAB 1Q9OA 4PWIA 5K69A 2F15A 4OLUH 3VXUA 3HPLA 4QRSB 3VXMA 3TPUB 2VDNB 1E5BA 4C83A 1SFHA 3T9WA 4BZ1L 5KSUA 4ZW8A 3UPRA 4J28A 4PJIB 1AQHA 3QXAA 4KJWC 4BCYA 3BVVA 1PKQA 2XY1A 4GY4A 4NQED 1TZHA 3IU3A 5FYJL 3LIZA 4X6EB 4D7BA 5I1LA 4DEPB 4MXQC 1HIML 1CK0H 3FH7A 2AXFB 5I71C 4DTGH 1OGAD 4MXVF 2BERA 1UD3A 2ZWNA 3A4FA 4MAYA 4K7FA 4OM0H 4JFFE 2H2PC 4UNUA 3C87A 5IV2B 2IBZX 3U9PH 3ZKQD 1XGRA 3HFFA 1ERNA 3BZFB 2XY2A 3I3BA 3AQYA 3LXUX 4NC1C 4EE2A 2OW6A 3QEUB 2Z8VC 3D25B 3QIWC 4EMZA 2ESVA 4I0PA 2MCPH 4L8SA 3CFJA 4X6CE 1YMHA 2P28B 1XBDA 2IPUK 2LLNA 3TVMC 5KJRH 3T0DA 3MA7A 5KBLA 1EJ8A 1ZTMA 1BQHG 2NY2C 1F11B 2R1YA 4PJ5D 1DVSA 4XX5A 5FO7A 4XP5L 4ODWB 3QFDA 5H35B 2BRRL 5F21B 2N0MA 1JXGA 4HFWA 3VCLA 1PQZA 1FO0B 4NN6B 5D2NA 3UJTL 1ZLVH 4B96A 2ADIB 4ADGA 2JF1A 1WFIA 3T77A 1V7NH 4IBWA 3AT9A 1KPRA 3GMRA 4AM0B 1YC8A 4N8CH 2VUOA 3QHFH 2AAVA 4PB0H 4XPGH 4TOYH 3ZKMD 1QR1B 4K3JL 1JGLL 5ICXA 5BV7C 2B0SH 5CSZB 2DWDA 5F89A 2PPCA 3CHQA 4HLZH 2OMXB 4N1EA 1YPZA 5L4IA 4E41E 4ZUTA 4JM2B 2VLKE 3MC0A 2X9WA 5L8KB 3VXQA 1E5YA 1SVBA 2C7FA 3R06A 1P7HL 1HZHL 2WQWA 3SY6A 2DQHL 1I3GH 2E59A 5EORL 4DO4A 1JZHA 4Q9QH 1TPXB 1S46A 2BP0B 3IU4L 4HEMA 3MV9A 3GMPB 4A7SA 4YSSA 3ISWA 1D6VL 4FFZH 3GSUB 3D6GA 5CU5A 1ZHKB 3D48R 3UBFA 4ELMB 1R3LA 4ACPA 3HMWL 2KMWA 4OLWL 3NFNB 2X9XA 3ZSSA 4A2GA 3X2QB 1Q90A 2VR8A 5AB9A 5GS1C 1QASA 3RNKB 1YEJH 3W38A 1ULVA 1JDAA 1GOHA 2ITDA 3B2VL 1TVDA 1D6EA 5FM8A 1A2YA 1D5BB 1EO7A 4NNPH 4YDZA 5DO8A 2H8PA 5I8KH 4BFRA 4M7LL 1G7LA 2WN3A 3HMXA 3OHMB 2BC4B 4B53A 2R59A 4V11A 1X5IA 3EOAB 3OX8B 4IOSD 3K6OA 4OT1L 5D6DC 1UZ6E 3UG4A 2VXTL 1HYRC 4P2OD 3B1TA 1ORQB 4TNVK 1ES0B 2FO4A 3ZZQA 1J1XL 3HE7A 4ANWA 2X9YA 4OGQC 1MF2L 2NR6C 1UCBL 5AL8A 4YZWA 1S3RA 1ANUA 2QZQA 1CJYA 4KRMB 3WN6A 4RIRB 4DGVH 2R0ZH 4YFDB 2GT9A 4OIAA 3NFPB 2HKHL 3TU6A 2YQBA 3ARDD 3WJLA 3MROB 2Q6WA 3M46A 3O4LD 2GPZA 4JGJA 3FDWA 4KZCA 3VD2A 2XN9E 3OM3B 4MX7B 3K46A 4X6CB 4XMXA 2CM6A 3R19A 5E8OA 4GXFA 2YEZA 1FN4A 4L8BA 4TSAH 5F6HJ 3BH4A 1J48A 2IQAA 3FUDA 1UQSB 2R7EA 1JGEA 2F1BA 3NZSA 3T3ME 4AK2A 3ULVD 4HV8B 4IMLB 1S3KH 1AFVH 2W0FB 4U1LA 5E1HB 3CFCH 5IHZB 1ADQA 2ZUUA 5AOMA 5SX4H 5KYYB 2HFFB 1KYOK 3AU0A 3L5XL 3EXJA 1JHKH 3GXTA 4GAAA 5C0GB 1QBLH 2A2QT 4NRZB 2YHGA 1OGPA 2AK1L 4FJZA 5DWUH 1SN5A 3V9EA 3MLUH 3KS0H 3QJVB 1PG7X 4MS8C 3IETB 5I1JH 1A6VL 1KB5B 2GTWB 4X5LA 1B4TA 2WLMA 4NRYA 2D4DA 3ALPA 4JHAL 3FL7A 3HHRB 4JHWH 3V5KB 1T6VN 2VDNH 4W6XB 4YSTA 2AQ2A 5D7IA 4E41B 3M1BA 3VFVA 5ID0A 3BPCA 2VLKB 3MRBA 4XMKH 5J56B 1QTYT 2BK8A 4JFFD 4YWGH 2EILB 4NIKB 2X4RA 3N9GL 1BX2B 1IILE 3NJLA 2JB6B 4M1DL 4DOHB 1JOIA 2DMBA 2Z1KA 3H7BB 3KPMA 1A7NH 4TUUA 3X3FL 5IHLB 2PW1A 3MRFA 4IHOB 4L4VD 2A6JB 4NKDA 2WMPB 1ZE3H 2EXTA 3ARUA 4CBZA 4Z7OB 3G5ZB 4WO4D 4AIOA 2Z31A 1XF2B 4WUUB 2PYFB 3NRQA 5C0NC 4UZSA 5FA4A 1V3KA 1MJJB 2OCCB 3ZHLA 1NGZA 1NWOA 2H3NB 2XXCB 3NRFA 3QWNA 1MLCB 3HC3L 1AHWA 5HI4C 3BP4B 1DBML 1MJ7L 2EDWA 4F58H 1E40A 1RKRA 2AJUL 3QDGE 3CPLB 4K2UL 2GFBB 5EZLA 1JMZA 4GO9A 5JOPD 1LE5B 4PGBA 1DTUA 1YYLL 1HQ4A 2DQJL 5TH2B 3RVUC 1BG1A 4Y16A 3QWRA 1LMIA 3TJHC 3KXFE 4KROC 1QFOA 5EC2B 1C16A 5EUOB 1VCBC 2IAMC 2QTEA 4YHLL 2EVFA 5E5MB 1DVYA 2VE6B 5MERA 2W95A 2BM3A 3NQIA 4Z0BL 4ORGB 2HN7B 1IB5A 4E0RA 4OLVH 1OP3K 5IB5B 1UVQB 2FZ3A 4HK0B 1ZLSH 1NCCL 2WTRA 3RU8H 1EVUA 4G3YL 3X11B 4N2GA 1AZUA 4PG9B 1NOAA 4RWYH 4CADA 2Q3ZA 5HYQA 4J3OG 4IRSC 4N6RA 4FYQA 2XN9B 5CZVL 5AENA 5HJBA 4QYOA 4CSTA 3A5VA 4XNBA 5JMRA 2NMSA 3ZO9A 3FRPG 1VJSA 1XR8A 3U1PA 1RZPA 4IU2A 1BZ8A 2Q1EA 3W11D 4J1UA 1FNSL 3WIHH 3SODB 2YLKA 3QZPA 4IDLA 2OMUB 3LEYL 1ZHNA 4U3CA 5C3TA 4GB9A 3GBDA 2HLEB 1IRAY 3Q1SH 2BSEA 3IAGC 2YN3A 3U1SH 3RDJA 3SGKC 2ZYHA 5JUEL 1S7TA 4F7PA 2EACA 3UIYA 4QUOA 4JX0A 2EDRA 3KWVA 4IOIA 4TNEA 4B27A 1XGPA 4HG4K 5A2LH 5DDHB 4ZS6D 4MQXD 3U79A 2QMJA 4PLOB 1RFDL 3VRLF 5JYMA 5IB3B 5CJXC 3F58L 5LBSA 2Y5TA 4WHYH 4Y9CA 3ZRSA 1ICTA 4X9GA 3U0WH 4H8QA 5HDLA 5I1KL 3VXNA 1MY5A 2XKSA 1TKWA 2Y24A 4DESA 2X89A 4OSUL 2ADFL 3NN8A 5JO5A 3WFDL 3N91A 1GW0A 3DOIA 4WI7A 3FB8A 3HUJA 3NAAH 5AALA 4J39A 4XPFL 4NC0B 2BPBA 2QPUA 4EKXA 3ECQA 3ILQD 4F92B 2I27N 1XZ0B 4GQ9H 4XN8A 2OTUA 4MA7H 1X9QA 5FR3A 5IGXL 3N41F 3O3EB 3OJDB 5HYIA 2GJ6D 1RUPL 2OSYA 5AW6B 1N6VA 2VXSL 4N85A 2ZOLA 4CVZB 1D5XB 1VHPA 3ARBB 3O2DL 4I48A 2HRHA 1O6VA 1K8DA 3TO4A 4Y4KA 2WVVB 1NUFA 5F7AA 5IJVA 3LHPL 1PS3A 3ILPA 3QDGB 1X7QA 3CXHJ 1G0DA 1DL7L 1IV8A 1I8AA 3QQ3B 1OTUD 3F00A 3OV6A 4U0RC 4M6ML 5LAXB 3JVGA 2CGYA 4M5TA 3KXFB 3DRQA 4LSRL 3OZ9L 5BO1L 1JFHA 1SOKA 1CVSC 1RUKH 3CHSA 3RB7A 1C5BL 1URIA 3M8OH 1CYXA 2F53E 1EO8L 1NGPH 3GTNA 5C2BL 1G1YA 2ED8A 2Z92A 3JTSB 5TF0A 4FOMA 2I7SA 4PUBL 1KB5H 1XIWD 5EIVA 3RDTB 2X38A 3S98A 2QQKH 2Z35B 2DS4A 4P99A 4JM0A 1KUMA 1IGTB 5AVZB 4MA8H 3OR7A 5IB1A 1FI8C 1ECYA 4EDWH 5DVNA 5DYOB 3RGVA 4LVOC 1DSFL 3MGTA 1QSVA 1VGKB 2O4EA 1OPGH 4I0PC 4FEMA 4LARL 4L8SC 1TSHA 2DLTA 3FTUA 2NW3A 2H1PL 2QQNH 5E6ZA 5C0DB 1AG0A 1E3FA 2HX8A 2AJYL 4P3CH 2HVJB 3LY6A 3C8HA 3CVHA 2C34A 4UV4H 3NT0A 4XBEL 3DPBA 1KCKA 1CT8B 1DUYA 2YPLD 3B9KA 4G6KL 2X4SA 3MV8E 2CJUH 3MV01 1NINA 1NGQL 3Q2WA 1R3JB 1W8NA 1X6LA 5CXPA 1RZ7L 4BEIA 3N0AA 1ZA3B 5AW2B 1LDSA 3G6AB 3CVCA 5CEZE 3BP5A 3UBGA 2JKXA 5DF0A 4L29B 3U83A 4TQEH 3IXAA 4D8OA 3IFOB 4CMHB 4P5MA 2VQ4A 4KHXH 4G8FA 1Q9KA 1A3RH 4G59C 2EIMB 2BZ7A 4GP8B 3THMH 1OT4A 2EXYC 2OXGA 4HKJB 3WTYA 4PJAE 3QQ9C 3QPQC 4PWEA 2QQQA 5ERWB 2JELL 4DNLA 2O5ZH 4XMUA 4V1DA 5D72H 1XGTA 4ZSOE 1OSZB 1KJ2B 2CO6B 2E46A 2XFGB 5FK9A 2P8LA 5HDQL 1AQ8A 1RP9A 1WGVA 5JW4N 4U6VL 4BFIB 5A2CA 2K78A 3HNTL 4M6AA 1BFSA 1KFAH 3GBML 4NZJA 2W1NA 5KSVA 1GSKA 4Q9BA 4KMTH 4MA1C 4OM1L 4B9KC 5HGBB 1AI1H 1OALA 4L4TD 1NPUA 3OPZL 5TGBA 2DMGA 5DO2D 2NQCA 4P4KA 3SKUD 4ERSH 3EYSH 3HC4H 4R3SB 1X5HA 4WWKC 1P7QB 1MLBA 3BXNB 4FMVA 3OXSB 5CCKH 4LLQA 5F7LB 2GTZA 3DX9B 1BIIA 5TE4H 5AG9A 3WY2A 4OB5H 1IEHA 1WZAA 3MRHB 3DOHA 5CWSB 3U7YH 1WBXA 3N2JA 2VLRB 3EG9A 2YPVA 1Z9LA 5IJDC 2AF2A 3TFBA 2PTVA 5MEPB 1C7TA 5IMOA 2SEBA 2KPNA 4PR5A 4EQ2A 3V8OA 1Y0LA 1R1CA 3H9SB 4XCNA 4LHUD 2GJJA 3ZZLA 1XH0A 2G2RA 4PMEA 3I6GA 4KRPB 4A67A 1Q9WB 2G5BB 1YNTA 4YS4A 1YQVH 4ADJA 3PDOA 1MI5E 4QGTA 4JPKL 2KC0A 4NN5B 5F8RC 3TZVB 4P59H 2OL3A 1A21A 2FO1A 3QQDB 1F18A 1F6AA 4YR6B 1TJXA 2LU5A 3K5RA 3MMEB 5G4MA 5T3ZL 2WXGA 3GF8A 4BFKA 1NAMA 2C7UA 1URZA 2F5BL 3GMQA 3GSVB 4M8QA 2PW2B 2WXQA 1F4YL 3P2TA 3S0PA 5AB2A 3QZBA 4DGWC 3VE0A 4JG1L 5CO1A 4GKZA 4PS4H 1RHFA 2F18A 4PJDF 4KHTH 1TNNA 3WFBL 4DPCX 1I8KB 1T1ZB 3OKDA 1DHKA 1AQDB 1RZIB 4BDVB 1MUJA 2P4AB 4W9EC 1RURH 3T8XB 4H8HA 5C71A 3MV8B 4MCYA 3KDMA 1ZLUH 3RPBA 2R0KL 4CKQA 3GJFK 4YNYA 2DJUA 4PVNA 3MLRH 5IOKA 1Q8MA 3HR6A 4DGYL 3V2AR 4HUNB 4PTTA 2B1AH 4H7VA 2OJEA 5C09E 1DVFC 4RFEA 4YHZH 4DERA 4NQCE 4WU5B 3F6JA 4IKLA 4R4NC 5T33H 3WY4A 1DDHA 2NY6D 5E24E 4PJAB 4DEWA 2OYLA 1BVZA 3H56A 3I75B 3P73A 4OFKA 1HXYB 3BAJA 2QADB 2RACA 2F1EA 2GSIB 2F53D 2IXQB 2ZWZA 4N20A 4I3GA 2PN5A 3FTSA 5IB2A 1UWXH 3VFUA 1U0QA 5HI3D 1HXKA 1U3HA 3LZRA 4MLIA 4PJ9D 1F4XL 2P24A 1MFEL 4HXAL 4A39A 4JANA 1MPAL 2OI9C 3H3BC 4KQ3L 3VGAB 1KXQA 3VH8G 1A4AA 1NWPA 1HSAA 3DK2A 4GKOA 4AEIL 4J4PC 4BUGA 2MEJB 2ICWI 3TA3A 5ILTL 2JTYA 5I24A 4W1TA 3PL6A 2IEPA 3UP1A 1EHLL 4K71B 1AHWC 1TEYA 4U4BA 3VXRA 3OKKA 3FMGH 1VFBB 1GGTA 2H2SC 5CEZD 3V9CA 5IEHA 4OJYA 3RVVC 2X4OB 1J5HA 2F8OA 1JGVL 3WD5L 1L9RA 1TLMA 3LRHA 3LPGA 2W80C 1HS6A 3B5GA 4Y16C 1KENL 2IDFA 1G9HA 2IBZY 4G1EA 4FABH 3RWGA 4E5XB 3MLYL 4NN7B 4RMTA 1Q0EA 3ARGB 3P3UA 4O5LL 3H8NA 1EEZA 5CJ8A 5D4IA 2HTLD 4V2BA 3BKYL 1OCWH 1QVOB 4XPBL 5D7JB 3R18A 3D7PA 3NP4A 4LAQL 1RZGA 4UBDC 1RUQL 1UZ8A 4HBCL 2CNZA 5C08B 1F00I 3QUMA 2RFXA 1NCNA 4I7ZC 3WFEL 3CSBA 3HR5B 3GSWA 3KBEA 4HUMB 4ZI8A 4UINH 3SZ6A 4AQZA 1H3PH 3HRPA 5EA0L 2BOBA 2BNRA 2WVTA 2X53A 1NKRA 2J88L 5BQ7B 1QABA 5KN5A 1HYSD 4YZFF 5KJ4A 4MD0B 4TNWF 4MVBD 2ICWB 5JPNA 3P40A 1UGNA 4E9QA 4AQEA 1FGVH 1MWAL 2MSPA 3C6LD 2YAMA 3DX0A 5AAWA 4KK8D 3F7YA 5J9PA 3SO3C 1NCAH 4L0YA 1CFSA 4AZUA 4Y5VC 1FFPA 1UASA 3E1ZA 1G9NH 4R97C 3PP4L 4F3FA 2N56A 1HEJC 4XRCA 3SKJL 1G1CA 2ITCB 5D1QA 4A6YL 3DKHA 2TRYA 1GZQA 1SXZA 2ZNXA 5FFGA 1QPXA 3B7RL 2W5PA 2Y72A 4LLYB 4XO3A 1MI5D 2NCMA 4N5ED 2FBJL 4XMZA 1H3XA 2DEXX 4JDEA 1DSWA 1OP3H 3T6VA 1QTSA 1TEFA 4PB9L 4NFCA 3QVAA 4IMKC 4HJ0C 1FYTE 3UAFA 4KY1L 2WGNB 4D0CB 1GC1H 1S7QA 3UJIL 4AEEA 3GMLB 4J27A 3KWWB 5LG6A 1U95B 2VDLB 4RGMC 5JW3L 4CN1A 3HB3C 1CI3M 4JO3H 4R4FL 1IAIM 5CEXA 1QKZH 3V4PL 1PKOA 2PWHA 2WQRA 4G6ML 2JJSC 5I1HH 1KEGL 1L4IA 2AEIT 1T2QH 1VA9A 3UTTE 5BS0D 1PTZA 3VWKB 4I4WA 3VA2C 5HJ3A 5IJBC 5JHLA 4Y4KC 1EDQA 4HGMA 4UT9H 2BS71 2L8AA 1FVCB 1KPVB 2X4UA 4K23H 1ZT7A 5FXCH 1WFOA 1LHZA 5JDJA 3VTMA 2X6VA 3O8XA 1JYWA 4GBXA 1YYMH 4PW3A 3RP1A 4LSDA 4OFIA 5CP7B 5C09D 4XN4A 3TV3H 1U8LA 3GRWL 3P4MB 2W92A 4NQCD 2EYSA 5CEZH 1OLLA 2H5UA 5AVTB 4NP4L 4EUPA 4IGBD 2CKBL 3DGCR 3B37A 1VGEH 5D9SB 2PXYD 5F3HA 3DMMA 2XV3A 1K5NA 1SUJA 4QLWA 3FQRA 3SHSA 3FTYA 2GG1A 4M7LT 3BP6B 2CIIA 5FHBL 2IDSA 4KPHH 2C3VB 3L9RA 3K1KC 4MMZC 4ZMZA 3L3HB 3BDYH 3HNVH 3Q9QA 2CCWA 2VLME 3FCSB 3TCLB 3VGDA 3ULUE 1MVFA 3LAFA 2DM7A 5ADPL 5CLWA 4XVJL 2BWQA 1HN1A 4ODHL 5MHSD 2E8YA 7CGTA 2WB1A 1JHTA 3LNDA 1SPDA 1NEZA 2XN1A 3NEXA 1N6UA 4ESKA 2N0KA 4XCFH 2XBTA 5IK3B 5E1GA 3VSUA 3BT2H 3ZTCC 4LPWA 1S9WA 4QTIH 4XHQA 5F93C 2P3YA 5F1OB 4J3OF 4ZFFB 4S2SB 3FO1B 1X5ZA 5I74C 1SJHA 1PF3A 4PJDB 4YK4C 4X6DF 3V6FB 4R7NB 4NO0D 1ECZA 4K7PX 3WTVA 4WF7A 3EBIA 5KVDE 1IEBB 3C2AH 5E94B 1ZWIA 1B4LA 4X8JB 4Y9GA 1LXMA 4LCWE 1NC4B 2Z4QB 1IJ9A 1X3DA 1BHGA 1MCQA 1CIUA 4OCYL 1GZPA 4ABVA 1XH2A 3QIBC 4FF9A 1PJWA 3SDXF 3VXOB 1K5WA 3PUUA 3ZDWA 4XNAA 3RWFB 5JPMA 1J8HA 3L5WA 2XWZA 4P23B 1N0LA 1H5BB 3DSNB 2VWEE 3EGXA 1ZLWK 2W9EL 3ZL1A 1IGCL 1NCWL 3QG6A 3L3OB 4PJCE 2R69L 4TSBH 1GAFH 5I8OH 4ZOEA 4O58H 5CBAB 1A14L 2F7IA 2ARWA 3OKNA 4U6XB 1XFPA 3LKSA 1FAIL 1QEXA 5TDNA 2VXUH 1F97A 5KUMA 1N12A 3LQAH 3U0TA 4MJ5B 1C9SA 1RZJL 1E8XA 3DECA 5K33A 4M4PA 5DJ8A 1EXUA 1J1OH 4UM9B 2OR9L 4HU8A 4NJ9L 3WKNA 2VC2B 3HS0B 4R8WL 4LKCB 1WFJA 5LXGH 1SGKA 4P4KC 5BXFB 2X6BA 1AP2A 2YD4A 3VFRB 3OTTA 5CHNA 1PPIA 1S7VA 4FQPA 4ZFGH 4YHOL 3QO0B 4UM8A 1TNMA 4BZ2A 1J1PL 4GKSA 4OV5B 3ZDXF 3UTTB 5B39G 2YKLL 3SDAB 5A2IH 2WCPA 4E9LA 4M1CD 4Q56A 2YC1B 5TPWL 5E2JA 5TQ2H 4Y1AA 1KCRH 3C60D 3BAKA 1JXDA 3O45A 2WUBL 1K85A 4XC3L 1U6AL 2IDTA 3B1UA 5ESAA 3NGBC 3VX1A 3U6RB 1BAGA 5ICYB 4JFUA 1JCKA 2ENPA 1FNGB 2OCJA 5HYJA 5L0QB 3BPLC 3FU8A 1GS7A 3DX7A 4JFXA 1FH5L 2JH2A 1CG9A 1MH5A 1RHHB 1RPQA 2DQ6A 5I18H 2F08A 1GGBL 1HHJB 4V2CB 5IEKB 1KCUH 5I1DB 1IFRA 1F1GA 2E56A 4IJ3C 1ADWA 1FYTD 4FS0A 4HIPA 1PY0A 2EDBA 2WOYA 4AXWA 2P48B 4UWQB 1M7DA 1PSKL 3VSVA 1E9QB 1I3VA 2ICEC 4N0CC 1NBVL 2EUWA 2OZNA 1IC5L 4U33A 4AUYA 5EZJA 1P4IL 3GHEL 3MOQA 5IR1B 2OMVA 4JHUA 5I16A 1E9OA 1CD1B 4YSDA 3EH4B 2Z3FA 5LBGA 1AGEA 1LEIB 2VDLH 3KPNA 2VERN 2XI9A 1SLWA 3FQ2A 5AOZA 1PG7L 3VW3H 1E9PB 4IIQA 5CFHA 3G5YA 3MA9L 3B3BA 3VNZA 2YA0A 4LCWB 5EBMB 4KUCD 3WXWL 1QNZH 2ZOKA 2R23B 1EAOA 5E9AA 4X4MA 1HL9A 3EYOB 3FFCD 4YDIL 4EO5A 3IJSB 3LPFA 4BKLB 5IWLA 4HJGA 4HIEB 4PJCB 2QSCH 2C9VA 4AYSA 5E4EC 5EU6E 1Q38A 4JY6B 2DWYA 1C12A 1NPJA 2ITFA 2J55A 3IDNB 1HILB 1MZZA 3OHXB 3ZTJG 4MA3B 1CC3A 1ET8A 4H5SA 5HBBA 3QEHA 4XZUA 4ECNA 2VLMD 1U8IA 4FA8A 5HHVH 1ZKAA 5DUJA 4LIQL 2CD0A 2FWLB 5IQLA 3X1BA 1IQWL 4UTCA 4Y8DC 4EI5B 2J56A 4ONOA 1IGMH 4FLSA 2QGEA 2X88A 1KXTA 5GS0H 3HVNA 4L3EE 4I77L 2BVPA 3L7EB 4ZXBB 3OGCB 1RULL 1VZGA 3TM6A 1CF8L 1CU4H 1ZS8B 4WV1B 5A43C 2FAUA 2HRPL 4NC1E 3VFOB 2DBLL 3PL6C 4MJJA 1FLRH 3N1GC 1FZOA 3NFSH 3SB3A 4UUJA 4K9EH 2IGFH 3OMZA 1GPOH 1RI8A 5JLZB 4YSPA 2B4CL 5EOQL 1ETB1 3Q8BA 2ZUXA 5KBKA 1KCWA 1ILSA 1KIPA 3PFUA 4KKQA 2V9TA 1FF5A 1IGIL 1L9NA 2Q86B 1IKFH 1ET5A 1AGDB 1MRDH 1P4LB 2GSMB 2XQYG 4UT7L 2DLFL 5L4FA 4XPHH 2QHRH 2VCOA 4WEMB 5EZIH 1GY2A 4TUJA 3HIZA 3SGDH 3CFBA 5B8CA 5DUPH 1H15B 1HXMA 1OB1A 1NBYA 4UTBH 3TCXA 5HDBE 3LVTA 3ES6A 4IDJH 3QE5A 2J8UA 1C08B 1QACA 1NFIA 3PGCB 4QHMB 2WIIB 4UQDA 3SKMB 6PCYA 4MNHA 5IROA 1CDGA 1FPTL 4P57A 1FGNH 5BZWB 5IFAL 1T66C 3WEXB 2CBOA 2D7TH 4FQHB 1A1OA 2VC2H 1CTNA 4HA1A 1OF2A 3O3DA 4MB4A 5JPNC 1IE5A 3MQIA 4GEIA 3QUKA 3UYRL 1U8JB 2OSLA 1HCYA 3K0YA 4LKXB 4FFWC 5AAWC 4CC0A 4YJZL