1CFTB

Anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated d-peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
QDQLQQSGAELVRPGASVKLSCKALGYIFTDYEIHWVKQTPVHGLEWIGGIHPGSSGTAYNQKFKGKATLTADKSSTTAFMELSSLTSEDSAVYYCTRKDYWGQGTLVTVSAAKTTAPSVYPLVPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Polyspecificity
molecule keywords PROTEIN (IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN))
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 1999-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cftB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cftB02
1KEGH 3SDDD 4TNVK 1SJEA 2LVCA 3RPIB 1ZTXL 4Q97A 4FFZL 5J89A 3FQWB 1MCFA 1AI1H 4X9BA 4ELKA 2BNQB 4U1GB 4PJ7A 3HPLB 1CDIA 4WFFE 3V6BR 5EZOL 1QLRA 5L9DL 4OD3L 4M61A 1B90A 3C2SA 3SE9H 4QRRA 1QBBA 3GMMA 1J12A 4LMQI 5ICZA 4RMRA 2EDEA 5DD5H 4ELMB 1I1AB 1TZGL 2IFFH 1VACB 5CEYA 1HXYA 2D3VA 5F3BA 2ZKHL 4NJAH 1FL5A 1G1YA 4X6CF 2AQ1A 4Y19B 1B9ZA 2C3VA 3IDNA 1QTYT 4X5XA 3UTPE 2V2TA 3JTTB 2UVEA 3GIVA 4RDQG 4JO3L 1XIWA 1YJDL 2NY1C 2P8LA 2W60B 5CMAB 3RAJL 5JMRA 1GRWA 4LOUC 5BVJA 4IMLB 2A74A 4Z0XB 5A16B 1QFOA 1HIMH 4OZHB 1JZ8A 1JHLH 4M00A 5GSRB 1T1ZB 1S9VA 3QXAB 5LXGH 2MHAB 2BJMH 1MRFL 3BAEH 4NQVA 4UV4L 3NCYS 1FFOB 3HMXL 1J11A 1I1AD 5D7SH 4GG6F 2FD6H 5F9DC 4HCRA 1ZA3A 3LHPH 1SJHB 4Y19D 2KBGA 1DLFL 2VXQL 1C16A 1ZHNB 4ZUSA 2J8UF 2XZQH 3ARED 2A38A 1JGDA 5D5MF 2Z8SA 4U1KB 1IQWH 4Y4KA 1T5WA 4WHYG 3GMPB 4HWZA 3U4BL 1JPFB 3E6FA 4FFYL 1FGVL 1NL0H 1NGXA 5DQJA 3FT2A 2G75A 1NANH 4Q9QH 1KLFA 1GC1L 1F4HA 1IGYB 1F2QA 3NFNA 1L7TH 2OTUB 4R7NB 3W0WE 2P5WB 3SBWC 1BGXL 5JNYB 3HI1A 1RZJC 1SJVA 3DX8A 1CDBA 1QBAA 1RPQA 1N0LA 3ARFA 1FP5A 1F4WH 4QEGA 4I9WE 4WI2A 4NHCL 2EDTA 4GS7C 5IVXE 2YRLA 3RKPA 5IG7A 2RGSA 3U48A 2HFTA 1RIHH 4RDQF 1A4JA 4NQSA 2AK4B 3B9DA 1TXKA 5LG1A 1PG7H 2W59A 3EYSH 3HNVL 3NBNA 2H1PL 2DI7A 5IESL 3DETC 3T2NL 1KEGL 1WFNA 1PKOA 2P5WD 4M5ZH 2E5EA 5DMKA 3BJ91 3QUMH 3VXPA 2APFA 4KKAD 4TPRH 5C0JA 3ESUF 1QHPA 3BH8A 4P2QA 1AI1L 3LKOB 4DGYH 2NTFB 1C5CH 1QO3B 2XYCA 3O11B 2Q8AH 4ZG1A 1K3ZA 4GKNB 1HQRA 2EZ0D 1B4RA 5F88B 3MRMA 4QF1B 2X05A 1OSZB 1FNLA 3MUHL 4O2CA 2X4NA 1IGJB 4RAHA 2IFFL 2NW2B 5J57B 2IEPA 1WLHA 1Q0YH 3FO1B 4NJAL 3IT8D 2AK4D 3BKML 4HWBL 1OVZA 5D2NC 4XX1G 5FO9B 3MZGB 3TESA 2YC1A 4J6RH 4YK4B 4KRPC 1CDJA 5BCAA 4G8GE 3BP4A 1I75A 3O45B 2B5IB 4LSRL 5E56A 5I6XB 4R2GC 5H35B 4PJIE 4FRWA 1Y18A 1EEZB 3BUYA 3IFPB 5I1DA 4BZYA 4JGUA 4U0QB 5DMGD 2VKXA 2XNAB 4OFDA 3GSQB 2YS4A 4LK4A 3ALPA 3C8DA 5LXGL 2BJML 3DXAD 2F8XC 1UKQA 3BAEL 4WU7A 3GJEA 1ODAA 5FDWA 3PGCB 5D7SL 3UJTH 1B4JL 2FD6L 4HC1H 4D0CB 3CDYA 3W9DA 3PGDB 2P48B 1KF9B 5C3TA 2UY7A 3FB7A 3D85B 3FQNB 3PJSB 1IQWL 2BY1A 3B6SB 2XQBL 5MERB 4N68A 4XI5D 4Y1AA 1NGQH 3DRQB 4KJQD 4AH2A 1MFDH 4Q9QL 1L7TL 2QADB 2DB8A 4RA3A 5AWNH 2A6JA 5JPMB 1MCDA 4Z76A 5FYKH 3K4DA 5L88L 5DJAA 3VA6A 4LCWA 1BREA 4WW2A 4FFWD 4TUOB 4I4WB 4ZDHB 2AXFB 3BXNB 1YYML 1XCQB 1F4WL 2HFGH 4HWNA 1RUPH 1CQKA 4PBXA 3NACH 4OF5A 5F8QC 5KSVA 1U8LA 1Q38A 5IBTH 3QI9A 1T0NA 1RIHL 4UUJA 5DA0B 3D85D 1S7WB 1Y0LB 3OTTA 1PG7L 3I50H 3EYSL 5J9PB 2GT9A 5MEQA 1LP9A 2QR0A 1HQ4A 1XCTA 2CUMA 3QCUH 5C6PB 2R9HC 3U82B 3VU2A 1D3CA 3D2UB 2EE9A 2X4TA 3DHJA 5HHQB 2EH7H 2QADD 3S88H 1J1OH 1HINH 2FLBT 3QUML 4P59H 1PAMA 4TPRL 3TBVB 5FUCC 2R8SL 5IMMA 3I02B 5DD0H 4JN1H 3BPOC 3QDJA 4DGYL 3WUWG 1P84J 2X89A 2Q8AL 4Y2DC 5CP3A 2H2SD 1G9ML 2C4FU 5TJWK 1PX3A 5HYJB 5IOPA 1XGUB 4TN9A 2I9TB 5I1LB 4K3DH 3BDYH 1Q0YL 3MRKA 3O4LA 3ILQC 1I3GH 4Y16A 4L4TA 1S8DB 3QXWA 4GRMA 4YEFA 4U2ZA 4DFIA 5KVGH 4WI8A 2DLHA 4H1LG 1IM9B 2V7NA 3D2UD 1LEKB 3NTCH 4G9FA 4HF5H 5KTEH 5DS8A 4YLQT 4D0BB 2YN3A 4QXUL 1XH3A 2R2EA 4LL9A 2ARWA 4KI5C 4L8BA 2OMNA 1Q9WA 2A0LD 3HCVB 4KXZH 1NGYA 3QWOA 5ICYB 4L4VA 1X4ZA 5JPNA 4JFQA 1OTUD 5HYJD 2IADA 5FKPB 1U8HB 1A7BA 1KTDA 3NZHH 3PABB 4OZGA 3T0EE 3L7EA 4XAKD 3ZYOA 1KT2A 2OI9C 4M7ZC 4N8CL 1MCJA 4R90L 3SDAB 3UJTL 3AAZA 4HC1L 5E8EB 3Q1SL 3FAWA 3VI4E 1QR1B 5D8JH 1IM9D 5HHOB 4IRJC 4M7LT 3G6DH 4TUKH 5DJ2A 1NFDB 2KQNA 5CIPB 4PGCA 4PJEF 1NGQL 5DGRA 1N2RA 4KI5F 4XT1C 4JZOB 5AWNL 3VDAA 5FYKL 3ALXA 2BP3A 1I9RH 5CBEA 4YBHA 4F9LC 3E3QC 1BAFH 4EKXA 3LD8B 2JELH 4KJWD 2MCPL 3SDAD 3UZEA 3NACL 4PJ7B 4QRPE 2XICA 1JBJA 1L9NA 2YD3A 3OKEA 3O2DH 4N5UA 5IBTL 4BK4A 1QLRB 3MRCA 3NPZB 3PV6A 4M61B 1OOAA 5DYOA 4QRRB 1S7XA 3V5HA 1VFBA 3BW9A 1A1MA 4Z5RA 3SE3C 5ICZB 4MQXC 3WN5C 1AGEA 3V7MA 5CEYB 1VADA 3MNVA 3NOIA 5J1AA 4XNZC 5IQ7H 2X1PA 3IDNB 4H5SA 4JG0H 4QYOA 5AZEL 4X5XB 4N0FA 3QCUL 5KSBE 2GW5A 2V2TB 5D1ZC 2GAZA 4QOKD 3GIVB 3DYPA 2EH7L 4PGBA 1WBYA 1F3DJ 4OSUH 1XIWB 1WITA 1XF2B 3VGHA 1I7TA 2P8LB 3SKOA 4PB0H 5BVJB 3CMOL 2A74B 2CJUL 3BGMA 5DEFA 1ZVSA 4N0RA 1GGYA 3UTSE 1S9VB 4FQCH 4K3DL 3BDYL 4NQVB 1X6LA 1IGFH 1S7UA 3RVTD 2IH1A 2DQHH 4L1DA 3DBXA 3AM8C 4LEOA 4O2FA 3QDAA 1D9KA 5KVGL 1C16B 2XIDA 4RWHA 4ZUSB 3NTCL 1JGDB 3GFUA 1WVZA 3P4OB 3MJ8A 1XIWD 3DIFA 4Y4KB 1BF2A 1T5WB 3RJQB 2P44B 2BRRH 4HWZB 3E6FB 5LGHL 2WWMC 1N59A 5DQJB 3FT2B 1F3RB 4OZFH 2G75B 4OCXL 1N5YH 2VR9A 3B2UD 3NFNB 4MXVE 3NZHL 1U42A 1WBZA 3IAGC 3B9VA 4M7LH 2UVFA 1E4WL 2F8VA 3HI1B 1NAKH 2L4OA 3PP3K 2FYYA 3DX8B 3OQ3B 2BK8A 4IS6A 2BVYA 1BQLH 3PWLA 4JFPA 4K8RH 4Z8FL 3ARBC 5FYJD 3ARFB 5CJXC 1NEZA 2FGZA 3QEQE 5D7LE 3UCRA 4X5LA 4AL8H 1N6QH 4B5EA 4U1IA 5D8JL 1GZPA 5EFIA 4DAGH 4HH8A 1Z0NA 4E41A 5IG7B 2C5DC 1BBJA 4TUKL 2OL3B 4NN7C 4HBCH 4GRWB 4LDLB 2WV3A 4CVZA 2RR3A 4NQSB 2B7DT 4Y4KD 5FF6A 2RCSH 3ZKSD 3ULUE 1MFCH 2QEJA 2VDLH 4ZXBC 4P23D 4KK5D 4QXGL 3FQTA 3K8LA 5K59F 2L0DA 1IEAA 1F58H 1DJSA 1I9RL 1U58A 3MC0A 1N5AB 2YXMA 3VXPB 2F58H 5DO2C 5C0JB 2AEWA 3BH8B 2IMMA 3Q6FA 4ZSOA 2JELL 3HAEH 5MHSE 3O2DL 4U1MB 4MJ6A 1HQRB 4U33A 4D9LH 3MRMB 3G6JA 3WCYA 1CL7I 4K71C 4NBXB 1CIDA 4JRWA 4O2CB 4FQ2H 4X0KA 2X4NB 3SDCC 4N8VA 4WJ5A 1J0KA 3ARGA 1KXVC 5DK2A 4HUUA 5IQ7L 4JG0L 4RBPK 2OCFD 4FOMA 2FR4A 1FN4A 2GK0A 4I2XA 2PYEA 4OSUL 1A7NL 2Q3ZA 2YC1B 1OTSD 2ENSA 1J88A 4NUJB 4V2CB 3NCEB 1MCOH 3MACL 4X8JA 3BP7B 1QQDA 4PB0L 1ZGLP 3VXNB 4KMQA 4PV8B 4P2QD 3EO0A 1Y18B 4GMSL 4L29A 5F7DA 3IDGA 3L3GB 3WHE0 4FMKA 3BUYB 2UYLB 1UH2A 2PN5A 4H8WH 5I1DB 5E2TL 4P0DA 3KPQA 5IJKC 4WU7B 3GJEB 4YDIH 1IGCH 3KPMA 3UAJC 1BIHA 1I9JH 4JKLA 4KROB 2XWBA 1HHGA 4UOW0 3BO8A 3AUVA 4LVOB 1U3ZA 1QSFE 3GHEH 3W9DB 2X4UA 3SKNA 2FSEA 3F7PC 3FB7B 3WXWH 5I66B 4XNYH 3LRHA 3V6ZA 3AS3A 4J7RA 4YDKL 5J12C 1TTUA 1MCWM 5J8OA 3QCTL 4MS8D 2BRRL 3HI5H 4Y1AB 5IMLA 3S35H 4AH2B 4TVPE 5D1QD 1PG7W 1RUKH 2DQCL 3H7LA 3K0WA 2A6JB 4M7LL 2PTVA 3QEUB 4LCWB 4J4PC 4LVNB 4QTHB 4WW2B 1NAKL 1LO5B 5HDQH 4K8RL 4RMUA 1BQLL 4JHWH 4ZO8A 4ZAKA 4KROD 4XVTH 4AL8L 1N6QL 1T6VN 1J86A 1U8LB 3ARDA 3TGXA 2RAMA 3QI9B 1NEUA 3I6LE 3UZVB 5F21B 2Z8RA 5TDNA 5JIIA 5JUEH 3Q5YA 4UUJB 2L7UA 5MP6H 4WFGE 5DEZA 5BRZE 2ZSWA 2Q7YA 3N85H 3LRSA 3KYMA 2O5ZH 3VGEA 5J56B 5F9AC 4ZFOA 1MFCL 3PNWA 5MEQB 3CH1A 2GT9B 2VDLL 1IGMH 1LP9B 1HQ4B 4R4FH 4Y1AD 4QHLA 5DUBA 3WFZA 5DJ6A 1CT8A 1B6UA 2D03H 4D9RD 4U6VL 3CX5J 3EO1A 5GGQL 4CMHB 4JFDA 4R3SA 1QRNA 1HCVA 3LB6D 2F58L 4PJ9C 2CKBA 4LCWD 5IMMB 5FCSH 5GS1A 3O8XC 3QDJB 5I1AB 4JO2H 4P4KD 1GIGH 2W0LA 4D9LL 1TPXB 1U8OA 5IOPB 3GB7A 4ACPA 1CGUA 4Q7DA 5GGRA 5TE4H 2JJSA 3VXMB 1MAMH 5DVOA 3O4LB 3MRKB 1I1RA 1INDH 2EYTA 4L1HA 5HVFB 2NXZB 4FZ8L 4OFIA 3K2MC 3WJLC 4OGZA 4MNHA 4X6CA 4Y16B 3EJZD 4L4TB 4X4XA 4GRMB 4FP8H 5ID1B 3IF1A 3I9GH 2V7NB 4Y4FA 2B1AH 4G9FB 3H3BC 3V5KA 5DRWA 1FCCA 5ACLA 1WUNT 3VGBA 4YZFF 1BBDL 1XH3B 2A2QT 2R2EB 3DI3B 3KJ4C 4L8BB 3QDJD 4NZRH 5CWSA 5C0ND 1KTLA 1NGYB 3QWOB 4H8WL 1S3KH 4OAWB 3I84A 4L4VB 5JPNB 4JFQB 3P0GB 2IADB 1BM3L 1KTDB 2CUIA 4OZGB 4YDIL 1IGCL 5CZXC 1I9JL 2DM7A 4O4YH 5KSAD 1FAIH 3AAZB 3LY6A 4KJPC 3BH9A 3ZKMC 2NXZD 4GG6A 3DECA 3V8OA 4Y16D 3NA4A 3GHEL 4L4TD 4FMFA 4BH8B 5H94A 2JE8A 3EOBA 4ZD3H 2X4PA 2J8UA 1CGXA 3MXWL 4XNYL 3WXWL 1HILB 4X5WA 5D5MA 4X83A 5BVPH 2UY6A 5DJ2B 3UX9B 5F1KC 4LSPL 4KTDL 1FYHB 3QFJE 1N2RB 4RZCA 1X5AA 1YN7B 3SDYH 4ENEC 5EULV 2BNRA 4JGMA 4K94L 5CBEB 4L3CA 4KV5F 3VFOB 1OAQH 5IIEA 4JHWL 4W70A 4MA1B 3V9FA 4XVTL 1TQBB 4KRMB 4U7MA 1FSKB 1ZT1A 1CR9H 3PV6B 5DYOB 3N1QC 5D4QA 1S7XB 1T83C 1VFBB 3BW9B 3V5HB 1A1MB 4Z5RB 3MRNB 5LAXA 3SKJH 3N85L 4DWHA 4PJDF 1AGEB 2O5ZL 1VADB 3IFLL 2VLMD 1KXQE 3MNVB 4M7JH 5J1AB 1OP9A 3T0WA 4H5SB 4QYOB 4R4FL 3W11D 4MX7A 3SGEI 3QP3A 4FQXC 4YHPA 4O02H 2GAZB 5JIPA 1A2YA 1WBYB 2CO7B 4GKZA 2HH0H 1MFNA 2ESVB 2A77H 2XG5A 2GJ6E 1I7TB 3SBWA 3SKOB 4BJLA 4JO2L 2Z35A 4OFPA 1ZHLB 1IC7H 3WFDH 1Q94A 2EO9A 3TIDA 3BGMB 4PP1C 2PXYC 5DEFB 1ZVSB 4HMDA 5DA4A 5CEZE 1TJHH 3RP1A 1S7QA 3PWPE 1BFTA 3H9YA 1MAML 5FHAL 1IKNC 1INDL 3SGJA 5HVGB 1S7UB 2ZUQC 2IH1B 5JHDE 3DBXB 3FONA 3LSOA 1SY6L 4LEOB 3D69A 4O2FB 3EJYD 2ARJQ 4AIZA 2Y25A 3I9GL 1OB1A 4EBQH 4NRXA 3O2WH 2VXVH 1JZ4A 3DIFB 1INQA 3HS0A 3CD4A 2OJEA 3L95A 2DLIA 1NCUA 2DICA 4NZRL 1N59B 1KLGA 1S3KL 1SEBA 3SO5A 5F1NA 3SE8H 1BFVH 2E7LC 1WBZB 2DYPA 3L5JA 1EHLH 2IQ9L 2YZ8A 2HN7A 2FYYB 4IS6B 5GJTL 1H5BC 3PWLB 3ORJA 1FAIL 3VGDA 1URLA 1WZ1L 1NEZB 2ERJB 3MUY1 2CDGA 1S5HA 2AXJA 3QDHA 1G0YR 1EERB 4XPTL 4LCIH 1LEGB 1D9KD 4U1IB 4ZPTA 4ZD3L 1GZPB 5EFIB 2NY5L 2OR7A 4K94C 3MLVH 1WGOA 4E41B 3S96A 5BVPL 5D2NA 1BBJB 1KCKA 2WBKA 3VFWA 3LKQA 4CVZB 5DRNA 3VFNA 1AR1C 5FF6B 2DI9A 3TWCH 1ZLSH 1MREH 2CIKB 3QNZA 1NMAL 2FX9L 5ERWA 2RBLA 4S10A 5EC2B 3FQTB 4JO1H 3RX8A 3SDYL 1GZQB 3FHAA 1IEAB 2SEBA 5EBLA 1KN4L 1U58B 3OJDA 1P4LA 2HWZH 3NIFE 1OAQL 4IHOA 2Z31C 4CW1A 1I7ZA 5C0BB 4HLJA 2CGRH 4KGLA 4MJ6B 1CR9L 4YDJA 4ZUWA 4NCC1 5IEKA 1E4XI 4P5KA 3JSSA 2ZUTA 1G9NC 4E41D 3O6KH 1T89C 3SKJL 5DJXA 4N8VB 4WJ5B 4XPHL 1MRCH 3ARGB 4GH7B 4WHYH 4M7JL 5DK2B 2WP3T 3A6CL 4Y7MA 3LH2H 3GIZL 3SEPA 1JNHB 3QBTB 3MR9A 1U8IA 5HTSA 3LKSA 4O02L 1FN4B 3MBXL 2X42A 4I2XB 2PYEB 4WUKH 2HH0L 5IBUB 4MXQC 4TULL 4POUB 3NZ8A 2EDQA 1T4KA 2ADFH 4X8JB 5E9DE 2DL9A 1IC7L 4J2XA 3EO0B 4ZFFA 3K80A 1L9MA 2EEDA 3MJ6A 4L29B 5F7DB 3IDGB 2I5YH 2A1WH 4RGMC 4F9PC 4Z7VA 4ZUVA 1GJIA 1W72B 3KPOA 4NWTH 3MLZH 3RVXD 5ENWA 5SWSA 3S7GA 3KPQB 2VDRL 5J11B 1A02N 1NCNA 1F6AA 5L2JA 3KPMB 3MNWB 2XWBB 4I13B 3ARGD 4JPKL 1FG9C 4BUGA 4R9HA 4U3HA 4XPFL 5I17A 3P0VH 2X4UB 2A9ML 4EBQL 3SKNB 4TSCH 2FSEB 3V6ZB 2PYED 4DN3H 1B0WA 5D7KE 4WTXA 3TV3H 3D1MC 1ZS8A 1MPAH 3NIGE 5IMLB 1KSRA 4YHYB 1OD9A 5MENA 5C08E 5I30L 4HWBA 1GHFL 4W4OA 4Y2DA 2NY5C 4WTZG 3JV4A 4X6FB 4DUWA 1BFVL 4YDVA 1EHLL 1XT5A 4HIJA 4P3CH 2ICES 12E8H 1UKSA 1X3DA 2GK2A 3S37L 2UZIL 4NHUA 3RNKA 4LCIL 5I1CH 5F9OH 3ARDB 2JJUA 4HK0A 3MLVL 4FN0A 3VWKB 5IF0A 3SE4C 4EQ3A 1BVZA 5L8LB 5TDNB 4QTIH 3MCKA 3GMNA 3MCG1 4PJHF 3LRSB 1X5XA 3JWOH 3KYMB 4JPWH 3TWCL 3PHSA 4ZFOB 1ZLSL 2VSDA 4P2CG 4PJEA 3PNWB 1ZA6A 2Y7QA 4M1GH 4HS3B 3EYQD 5J0BA 4IM8A 3WUWA 4X7CC 5CILH 5DJ6B 1CT8B 4PJCF 4F2MA 3EO1B 4JFDB 4R3SB 2NY2C 1QRNB 2HWZL 3JBG7 2CKBB 4HV8A 4DVRH 3KAAA 4D2NA 4ZAKD 2CGRL 2NQCA 1CDYA 4J3XA 5C7XH 1U8OB 3TNNA 4WEMB 1A6PA 4OCMC 4X4ZA 3BP6A 4H1LA 1F3JA 2QLVB 5GGRB 3O6KL 3GHBH 3W2DH 2BVEA 4OLUH 3VFRA 1MRCL 4IRJA 2EYTB 4XVUC 4P2RE 3N1FC 4MNHB 4X6CB 1LEIA 4S1RL 4PJAB 2EICA 1K8DA 3IF1B 3ZE0E 3MV8A 3DURA 4YHMH 3I3BA 4WUKL 2D7NA 4Y4FB 2AAVA 5AYUH 1BPVA 1IAOB 5E70A 2XI9A 1QRND 2IH3A 3QUZC 2ZOKA 4NDMB 2ATKA 1J9CT 4RMWA 1JZ6A 2DJSA 4F9LA 1MJUL 2AEIT 2I5YL 3OAZH 4WUUE 5CWSB 2A1WL 1EPFA 2F5AH 3VFVA 2RIKA 4NWTL 5E5RB 3KPRA 3S6CA 6FABH 5ISZE 2WLYA 1A3RL 1PKQE 1YEEH 4LNRA 1T22A 4M93C 5E6YA 3BH9B 1P5UA 4GG6B 4BSWA 3FO2A 1FDLH 5A1AA 3X11A 2PUQT 2NY6B 2NX5A 3P0VL 5EN2B 1NFIA 4MLSA 5H94B 3D0LB 4J3WA 4TSCL 3EOBB 4YBQC 2X4PB 5L7XL 5D1ZA 1WCQA 2J8UB 4DUVA 4X5WB 1KN2L 2GHWB 4DN3L 2NY1B 5F8RC 3TV3L 2E27H 4Z7WF 2B0SH 1CXKA 4RZCB 4NO2A 3FTGA 1FJ1A 2OXHA 2P49B 3CXHK 3I2CH 3ULVE 2MWCA 1RU9H 3F58H 2FB4L 5F9WC 3V2AR 2ED9A 2BNRB 4P3CL 4MQSB 3QNYA 4NQDE 4CJ1A 5IIEB 4KZEL 3SDXF 12E8L 3H0TA 4IEFB 3LN4A 3LN9A 4C83A 5F9OL 3AM8A 3KHOA 4JVUA 5HJ3A 1ZT1B 4P5TC 1ORSA 2KDGA 3MLPA 4QTIL 5HYSB 2FRGP 2DQUH 5LAXB 4LQFL 2OTPA 3HN3A 3EOAA 4HIIA 3JWOL 4JPWL 4M9PA 4P48A 4XNUH 4G8IB 2NY1D 5KS9F 1A8JH 4M1GL 5JOPE 3VXOA 1OAYH 2DQJH 2XWTA 1LO2L 2DKSA 1PBYA 5CILL 3SY0A 1S78C 4LOUD 5FB8B 4PJBF 3VXTA 4GOSA 4YHPB 5I1IH 4K9EC 3EDJA 3RBGA 5K93A 2BVQA 4YHZH 1E4KA 4DN4H 5GRWA 2BNRD 4F57H 3CVHH 2Z35B 4N1EA 4X9HA 2P4AB 5JXEC 1G0XA 3ARBA 5SWZA 5CJXA 3EUUA 4FNLH 5C7XL 1HSBA 3G9AB 1FNEA 2EDLA 2VDKH 3R06A 1S7QB 2W92A 4GS7B 4LLVA 3U7YL 3GHBL 3W2DL 1ZOXA 2E8YA 4OLUL 2Y1VA 3P9MB 3IDUA 5JW4Q 5KW9H 3WDJA 2WP3O 2JCCF 4RA0C 3LSOB 2Z8VC 3V6OC 3D69B 1RV6X 4UT7H 3JZ7A 3N0PB 3SCMB 2Z92A 5C09A 1S7TA 1OB1B 4DKDC 4ZXBA 4MDJA 5AYUL 4HX1A 4NRXB 3FQXA 1INQB 1G7IB 3HS0B 3L3HA 2OJEB 4PRHE 3FL7A 4XBGA 3NAAL 5I0DA 1C8PA 2AP2A 3HZVA 43CAB 4WFEE 1YMME 3GI8H 1KLGB 4KUZH 4ZPVA 2F5AL 3ALWA 3MRFA 5KOMC 3G5XB 4XMLH 2ICEA 4BYHA 4QWWC 3KR3L 3TLRA 3RX7A 3VXRA 4B50A 2DYPB 1TETH 1MHEB 1YEEL 3TCLA 4YFLI 2HN7B 1U8MA 3AU1A 1F42A 3SDCA 5FAAA 3ZSTA 1UM6L 1FDLL 4PJXE 2OP4H 4M1CC 1I85C 4ZPTB 5GS0C 2WQ8A 3DV4A 4KQ4H 1GAFH 3SGDI 5D2NB 3RPKA 3DETD 3RVWD 1ZHBA 3VFWB 4NQEA 4KRPB 3LKQB 2E27L 5DRNB 3VFNB 4ALAH 1Z0MA 1G9EA 3JUYA 2DBLH 5IBLC 1DBMH 3FT4B 4R2GB 5IW6A 4XXCC 3NMEA 3MJ9H 5ERWB 1Q9KA 3I2CL 1NBZB 3MNZB 3F58L 1TVBA 5EBLB 4D8PB 5FYLD 3OJDB 1P4LB 4LARH 2DYPD 1L4IA 4YR6B 1DVFC 4IHOB 5IJKA 3QIWB 1Q8MA 4XP1H 3ARVA 2F53A 4S11A 1HZHH 1I7ZB 1KB9K 2MFNA 5MI0B 5JW3H 4NM8H 4YDJB 4ZUWB 4MNQE 5IEKB 4P5KB 1EHNA 4ODSL 3OXSA 1ZLVH 2DQUL 1J8HA 1OGAE 5EU7E 1PG7X 1DBKH 5DJXB 5F7EL 3G5VB 1T66C 3IGAA 1MF2H 4RX4A 1KEMH 4G5ZH 4KRPD 1U8JA 3S34L 1K8IA 1OAYL 2DQJL 3BYYA 3TN0A 3U36A 4QO1A 1MHCB 1NUDA 3MR9B 4H88L 3QDME 4R2GD 1RAMA 5JW4R 3TC9A 2XTJE 3NZ8B 2VC2L 4DN4L 1IT9H 3O4OB 3KLSA 2CRYA 3TYFA 2YMXL 3CVHL 1RUML 4J4PA 3VGAC 1A6UH 5E8DH 4GSDH 5J1SC 3FJTA 1X5YA 4AIOA 4WFHD 2VUOA 4QCIA 3GSVA 2YZ1A 4FNLL 4GAFB 4Z7VB 5KANI 5D93C 3RI5K 1T7WA 3DVNA 4C56A 1TTFA 1QFPA 5ENWB 5SWSB 2W9EH 4KJYA 5JR1H 4NC0B 4XP6L 2KUTA 5IVXF 1F6AB 5L2JB 5KW9L 1MLBA 5A2JH 3V52H 1U41A 1UENA 3F7QA 1BZQK 1UADC 4UT7L 3IS0X 2Z93A 4PTTA 3NCBB 3TFKC 2VDNH 2IANA 3DARA 2EC8A 3WIFA 1T2QH 3PWJA 1UVQA 3QB7C 3EFFA 4NYLA 4GW5A 2CXGA 1N6VA 2NY3C 3BZDA 3CFDA 3IFOA 4DK6A 1H3XA 3GI8L 3O8XA 3BPOB 4KUZL 3PL6C 4YC2C 1I8LA 2HG5A 4S1SH 5E99H 3JV4B 4YDVB 3QSKB 3T08A 3ZO0A 2VNCA 4HIJB 1DUZA 5SWSD 4JREC 4FTVE 4DW2L 1JHKH 1RZKL 2XN9A 3WJLA 1Y6KR 4NHUB 4CN6A 3IS1X 3UBXB 1CZ8H 1SM3H 2OP4L 3D3VE 4POZC 4QXTA 3DVGA 4HK0B 5CHNA 1FORH 4D9QE 1EVTC 4KQ4L 5IF0B 5IW1A 2R9HD 5FK9A 1F11A 3GMNB 1FFNB 4NSKA 4HD9A 4XNXL 4ALAL 1T80A 1IAII 4U1SA 4PRPB 4HIEA 1OSPH 2DBLL 5E6IB 1DBML 4AY0A 1ZA6B 2Y7QB 3VJ6A 2AV7A 1E28A 4X80L 3WUWB 3H42H 3F6IA 8FABA 4PJIF 1NCDH 5MEND 3EOYG 4Y2DD 5JOFA 4PS4H 2DIJA 5JXAH 4CUCA 1Q9LB 4HV8B 1NMCC 2C3WA 4N5EC 4PY8J 4XP1L 4GT7A 4JY6A 1OTTC 3WNKA 1HZHL 3E8UL 4OZFA 2LVEA 3ILQD 1ZLWK 5SV3A 4EI5C 3TNNB 3ULUH 3BP6B 4PJ5E 1R3IH 4H1LB 3LKPA 4BFGA 5TE6H 4LGPB 1DBKL 4JZNA 4KWUA 4Y4HC 1FHGA 4E0RB 3ZYJA 2W91A 1UH3A 5E8NA 1MF2L 3AMKA 4IRJB 1KEML 4PJDA 5DXWA 5DHVA 4YXLH 3VFRB 5CD5C 4YDLB 4WV1A 1AD9A 3UDWC 5F70A 1LEIB 1K8DB 3C6LC 5EBMA 3H6JA 3MV8B 4KI5D 1ZEAL 3LKNA 3DURB 3DTXA 4MCYA 1KUMA 2WUBL 3DUHA 1QFWH 1MELA 2IH3B 5E2WH 9CGTA 1A6UL 4GSDL 2PF6A 2X7LA 2ATKB 4DGVH 2D9QB 1FBIL 3BZFA 4LPYA 5DVMA 5DJ0A 1WISA 2Q6WA 3T0VA 3C5SA 1EX0A 2W9EL 3MLTA 1ZT7A 3PHOA 5JR1L 1KNOA 3RWDA 2DOCA 1T20A 1T83A 3SO3C 1EDQA 3P3YA 1BMGA 4LNRB 3N1PC 3ROLB 1II4E 4IRJD 1UCBL 4BSWB 3L3IA 3FO2B 3X11B 2NX5B 4XNZB 2VDNL 1NFIB 1T2QL 3MV8D 5CINL 5D1ZB 4FQXA 4G6FB 2OTWA 3CLFH 3WD5H 1RZKC 3DJ9A 2CLRA 3MLYH 2B4CC 1MWAH 3EGSA 3O6LH 5CJ8A 2EXYC 4MHHI 5DJZA 1EVUA 3ZTJH 4EI6B 1YY8A 4NO2B 4S1SL 1JGVH 2BHZA 1FJ1B 2LAAA 3FTGB 5E99L 3DPBA 3W9EA 3L3JA 3EHBC 2PXYA 4PJ8C 4JFYA 3REVA 5F7LB 3KPRD 1YC8A 2Y23A 2ZZUT 4OZIE 3QNYB 1K9TA 3H0TB 4K3HA 1IKNA 1JHKL 3T0EC 3LN4B 3I6GA 4MA8L 3TO4C 4C83B 4MQXD 5CBAA 4LSVH 1CZ8L 4FQPA 1FNAA 3BEWA 5HJ3B 1FORL 2NX5D 1ORSB 3QDGE 5D1ZD 1QKZL 4G6FD 2VLJE 2BCKA 3DLQR 4R96A 2DJ4A 1OSPL 3S97C 3D39E 1IGIH 1FYTD 1QD0A 3VXOB 1V05A 2XWTB 4Z7UA 3SY0B 3JWDC 1CVSC 4GKOA 3MCLH 3TO2A 4PS4L 3LPWA 1RIUH 4HXAH 5AEAA 2AJYH 2BVQB 2E7LA 1AR2A 1OL0A 1CE1H 1KCLA 3D0VA 5A40E 3IJSA 2E3VA 1A1NA 5B8CC 1H5BA 4HIHB 1CGSH 4F58H 1LD9A 3ARBB 5SWZB 3WBDA 4YX2H 2BOBA 1YEKH 3VRIA 1FO0A 2DQIL 2IBBA 1HSBB 2APXA 3ULUL 1DBAH 3O2VH 3VI3E 3R06B 4LLVB 5TE6L 1M71A 1O5DT 3OPZH 4U05A 3L5IA 4BQCA 3VI4F 1QBLH 1UEYA 4MB4A 3MRDA 4YXLL 4LDOB 3GSXA 3NA9H 5D96C 3EZJB 4LVEA 3HG1A 1G7HA 4PUBH 4PJFF 4ODTH 2Z92B 3HRZB 1XR9A 2WWMD 1S7TB 1WAAA 4JE4B 3F7VA 4MDJB 5T3XH 2G2RA 4HX1B 3FQUB 1ZANL 4G6KH 3FQXB 3P30H 3VFMA 3L3HB 5FOBA 3E6HA 3HZVB 3CFCH 1AXIB 2IC2A 1UT9A 2Z31A 1QSVA 3MLRH 4ZPVB 3MRFB 3ARBD 5SWZD 2ICEB 3OR7A 5C07B 3P9WB 3VXRB 3VE0A 2GQHA 4EDXA 1DUYA 4OD1H 3TCLB 2GSIA 3MYJA 4V1DA 1T89A 4M4RA 1U8MB 3AU1B 1IZJA 2C4XA 3DXAE 5EA0H 5CS7A 5DRXA 4NZTH 4WI4A 3IDMA 3MGTA 2ZNXA 2HT4C 5C09D 3UYOD 3DV4B 4ZXBD 1CFNA 5KSBF 4YAQA 4X4MA 1FIGH 3WD5L 2Y06H 4NQEB 1MWAL 1AO7E 3O6LL 5DO2D 3OB8A 1SY6A 5M95B 2FCBA 1M7IA 5CLWA 4F9PA 2X4RA 4XNMA 1TVBB 1OAUH 4L8SB 3VXRD 3MRBB 3T4YA 2PTTA 3SDCD 3FFCB 2F53B 2UUDH 2PW2B 2VWEE 4JHAH 3HR6A 4OIBA 3AFLA 3DX7A 3DVFA 5DVLA 2CIIB 3L1OL 4TVPL 3JV6A 1F4YL 3K46A 3OXSB 4G43A 4UZGA 1J8HB 1D5IH 5E8PA 3BKCL 5HHXL 2XA8L 5E08H 4PJHA 4TRPH 5C6TH 3IGAB 4NQED 4ORZC 1U8JB 2ZUWA 3OXRA 1K8IB 3TN0B 1XGYH 3U36B 4I77H 5FV1L 4OZHF 3T4AB 5TDOA 4RFOH 2PYFA 5AUMA 3OGCB 2AJYL 5GGVY 4MZ3A 4HJ0C 5E4IA 4MXVF 3TYFB 1MVFA 4GBXB 1MCLA 4G6AC 1CGSL 4QCIB 1YEKL 3GSVB 3UAJD 2F53D 2G5RA 1ZE3C 3O2VL 4ZFGH 3CCHA 3DVNB 2YD8A 2QQLH 4WRLA 3PWUA 5F6HJ 1QBLL 3SE4A 2ICWB 4K2UH 1J8HD 4KDTC 4WY7L 2XTLA 4BKLA 4RX4D 2QQNH 3O3BA 4PUBL 5EWIH 2Z93B 2MJWA 3M1BA 4PTTB 3GSOA 1LK3H 2IANB 2YSSB 2YUZA 2F15A 5T3XL 3PWJB 3HFMH 4WTZA 4UDUB 3P30L 3EFFB 4NYLB 4GW5B 2X1OA 3LQAC 1KPUA 4M1DH 4NCC2 3VMOA 5BXFB 5I73C 3CFCL 3QXTA 4NQCD 4S1DC 3MV01 4J4PD 3CFDB 3FRUB 3IFOB 3MLRL 5LWYH 2FH8A 3O8XB 1UG9A 3S36H 5F1SA 4F80A 1ZGLA 4JFFA 1WT5C 2HG5B 1CN4A 4FQIH 4U7SA 5KN5B 1PDKA 4X6BB 3DUSA 5E95B 4C56D 3UTQA 1DUZB 4P46B 3MV9B 4OD1L 2N7BA 4WO4C 1BD2B 3U0TB 1AD0A 4JFOB 4DK3A 2P47B 5EA0L 4YXHL 1U9KA 1UWGH 4XAKE 1K85A 4NZTL 2FO4A 3M07A 3PE9A 4QXTB 3X13A 5BV7C 3DVGB 2J6EA 4KTEL 4KK6C 4XPAH 5IW1B 4M6NH 2R0ZH 1KB5H 1Q0XL 4RNRB 2YOCA 1F11B 2Y06L 5FK9B 3WSQH 2VLRA 4EIZC 4NSKB 3S35X 2B5IC 5DLMH 2CLZA 5DHYA 4HIEB 2IALB 1YMHA 3QUZA 4PJ9D 5DDHB 3VJ6B 2VDMH 2GTWA 2AV7B 1OLLA 4JFXA 3O8XD 8FABB 3LQZA 3BEVA 4BQ8A 5JOFB 1OW0C 4Z7OE 4N8PA 3SDXA 4OF3A 3ZT6A 4HLZH 4M5YH 4JY6B 3QQ4A 4JHAL 2XN9D 4OZFB 1UZ6E 3O3AB 5DJYA 2J88L 5M7QA 3H9SE 2VYRE 5E08L 1J05A 5E8NB 4LPCA 4PJDB 3WXVH 4WV1B 1AD9B 2N4IA 2EDBA 1VENA 4I77L 3GMQA 1X7QA 5EBMB 3WKML 3WIIH 3LKNB 4RFOL 3DTXB 1MH5A 1G6RA 3LEYH 2EIZB 1I1YB 2X7LB 3BIBX 1OP3K 5CZXD 4P9HL 2IPTH 1F4AA 4KJPD 4ZFGL 3BZFB 3ZKMD 4JDZA 1A7OH 5DJ0B 2Q6WB 3C5SB 2QQLL 3MLTB 1ZT7B 3PHOB 2EECA 1KNOB 2CRMA 2E9JA 3QG7H 3RWDB 4K2UL 1TCRB 1T20B 3D25A 3UBXI 3VMPA 2YEZA 3F65A 3ARYA 4OKVA 2JCCA 3HAEB 3WL9A 3RA7H 2FATH 3BT2H 5EWIL 3WLWC 3L3IB 2ARJA 2DLGA 1V7MH 1LK3L 2BHYA 5DFWH 5CCKL 1F6LL 2PR4L 4FQXB 5JOEA 4G8EA 2DKMA 2OTWB 4ZNCD 5E6ZA 4OQTH 5CEZL 4M1DL 4ENED 2CLRB 3ZKQD 2GUOA 2Q87A 2DQDH 3EGSB 5LWYL 1CFTA 5EC1A 3S36L 2CMRH 2ED8A 5JXEA 1YY8B 1CXLA 2OZ4A 5JA9A 5B39G 3W9EB 3L3JB 2PXYB 4JFYB 3REVB 3RWJA 1AP2A 1AGFB 3FCTA 1LMKA 5CSGA 5HPOA 1NANI 5FYJU 5T3ZH 1H0DA 1NC2A 3I6GB 2DKUA 5J13B 1UWXK 5ANMA 4JVPA 1UWGL 4HEME 5CBAB 2ZUQB 4OLVL 3V6OA 2VXUL 2C7UA 4WGWB 5IMKA 4PB9H 2VLKE 3VGGA 4M6NL 3UYRH 2R0ZL 2YPKA 4FQXD 3RZCC 1T2JA 4X98A 3RY6C 2BCKB 5DLML 3FOLA 4Q6IC 4JN2B 1BLNA 2C9AA 1D6VH 3CXDL 4FQLL 3O41A 4TUJA 1GOHA 2VDML 3K3QA 2EKSB 1QFUH 4FZEL 4R8WL 3OZ9H 3AMLA 4Z7UB 4F7TA 4ZTOL 3TO2B 3HZYA 2CQVA 4PP1D 4WGVB 2PXYD 3VFSA 1WQVT 1TCMA 5JQ6H 3D0VB 2KQMA 2PNDA 1MEXH 3DRTA 3QZWG 3IJSB 5L2KA 4M5YL 1A1NB 4N90D 2R29H 2YK1H 3ISWA 3VRIB 3QUXC 1KGCD 4NGHL 3PP3H 5DMIH 3B9KB 1I85A 4YO0A 5HHMD 4MA7L 1M71B 3MGOA 2ZUXA 4ETQB 3MV7B 3MRDB 4ZNEE 3WXVL 3GSXB 2RFXB 4P9HC 3VDBA 1J5OL 3HG1B 1G7HB 5M94B 2VAAA 3WIIL 5I76A 1Z9MA 4XXCA 5TE7H 2BSRA 4YIQA 3LEYL 4ERSH 3RWHB 4HPYH 2Y5TA 5FOBB 4KVCH 3U9PH 3E6HB 3HE6C 1AC0A 1MIML 1DVFA 2XQYG 2Z31B 3WV0A 4CN4A 3RTQB 4U49A 2IPTL 4NZDA 1PZ5B 4NKIH 4X6EA 1GSMA 5FYKE 2VITA 3OR7B 1DEEA 1FH5L 3GRWH 3QG7L 5EU3A 5FO8B 5J4MA 4EDXB 1DUYB 5IVXA 1UFUA 2GSIB 3LS5H 3MYJB 4V1DB 2AV1A 2A9NL 3WDIA 5EH1A 3RA7L 2FATL 2ZCHH 5C0EA 3T2OA 4M6OH 4Y89A 5DRXB 3UJIH 1AR1D 3HG1D 3JV5A 3MGTB 2XZZA 4JPIA 5KBNC 1B2WL 1KIUA 3C87A 4NC1E 4ZO6A 4G7YH 3K8MA 1CFNB 4YAQB 5I18L 4RBPH 3RWEB 2DMKA 1HOCA 3WLBA 2VTFA 1LO3H 3RNQA 1OQOA 5EORH 2Z31D 1RUQL 1M7IB 4PIRF 4TSAL 4KK8C 4NN6C 4XNMB 5I8OH 1A7PL 5ADOH 2ZUSA 4RMQA 5F1IA 5EO1B 3T4YB 1NGWA 2XZCH 1ND0B 4QHNB 4V1DD 5FUZH 2WMPA 3EOTL 3ZE2F 3RI5F 5F6IC 4NNPL 1INEL 4A2MA 3GKWL 3L5XL 4PB9L 5KVDH 3UYRL 5T1DL 2DIBA 3JV6B 3L3KB 3CSGA 5CSZA 4KKNA 4RRPG 4LFHG 4PJHB 1D6VL 4HIXL 3MA7A 5I8KL 3OXRB 3V4VH 5CGTA 1R5WB 4C59B 1FVEA 1NFKA 1O7SA 3PL6A 4PJIA 5LCVL 5TDOB 2V5TA 3FO0L 2PYFB 5AUMB 2XXCB 3A67H 5EUOE 3S4SG 4NBZB 5IB4A 2D0HA 4D9RE 1EHXA 3V0WH 3CX2A 3ARFC 2R29L 2YK1L 3RZWA 4LCUA 4ONFL 5E4EB 1TQCC 4OM0H 3EW3B 1IEBA 3UTZA 2AJZA 4KHTH 4NKOA 5FA3A 4OV5A 4JJ5A 1OGTB 5BMFH 3PWUB 3NIDE 4OQ1A 3T09A 1JTPA 1FIEA 4BKLB 4ISVA 1A3LH 2EYSA 3C60A 3M17A 3O3BB 3T3ME 3M1BB 3GSOB 4Q2ZA 1CGYA 1RZFH 3KXFE 1QSZA 5TE7L 4YGVA 2AJVH 1HYRC 4ERSL 4KY1H 4TSBH 4KVCL 1KPUB 2NY2B 1IFHH 1JWUA 5CUSH 5FO7A 4CNIA 4EXPX 2H32A 2DQTL 4NKIL 1J1XH 1ZGLB 1YY9C 4HG4K 4PRNA 4HPOL 2YD5A 1NCBH 4GFTB 4EI5A 3DUSB 4ZQKA 1P1ZA 3OKLA 2MOVA 3UTQB 5GISL 5DFTA 4GRWF 4Y4HA 3CZFB 3CVHA 1BJ1J 3HR5B 2YPVH 3BMVA 1AD0B 4KZDH 1Z6JT 4M6OL 4BELD 3QUKA 2FO4B 1ZLUH 3X13B 3AB0C 4I0PC 4HS8H 2ZWLT 2VZ3A 2H9GA 3MO1A 4G7YL 4XNQA 1EO7A 1UM5H 1T0MA 2VLRB 1YYLH 2I25N 2CLZB 1C7SA 5DHYB 1LO3L 2NY2D 3VG0H 1MY5A 3QUZB 3TJHC 1KCVH 2GTWB 5EORL 4JFXB 4JJHA 5E94A 4R26H 3BEVB 2O5YH 5CJQL 5EU6A 4JFFD 3MRGA 4U6XA 1HHIB 3SJVB 5I8OL 1M4KA 3CDFA 1JN6A 5GXBB 2MQCA 2FL5A 4LASH 1X44A 3SDXB 3MODH 2IFGA 2WM0A 5F89A 4LVOC 3QQ4B 2J4WH 4M93B 4PRDA 3KPSE 4OI8A 2ICWI 5KVDL 4JR9H 5DJYB 3OAUH 2VL4A 2YKLH 3H9ZA 2HLAA 5A2LH 4P5MA 1EUTA 3ULVL 1J05B 4PLNC 2VLRD 5DI8A 4B7IA 5CLTA 3FHQA 3V4VL 5CZKA 3QUZD 4L5FH 1UXSA 3GMQB 2QSQA 1X7QB 1SEQH 4OBSA 4I48A 2VLME 1KPRA 4OCWL 4DOHE 4OTXL 3LIZH 3A67L 1MH5B 1SHMA 1G6RB 4PJ8A 5F9WB 2AS5M 1DSFH 2AJ3B 2D7PA 4HKJA 3V0WL 4ODUA 1JZ3A 3QR2A 5F96H 1RZGA 2CRIA 3T0EA 1LNUA 2XACC 4Z77A 5T3ZD 4OM0L 3TO4A 1GCFA 4L4JA 4KHTL 3QI9C 3D18A 4JDZB 2FJGA 1UM4L 2XY2A 4XMKH 4TTDC 3WDHA 5FIEA 4MJIE 1L0YA 1Z3GH 3ARRA 4YBQD 5GGTA 4A6YL 3D25B 1NH6A 2YEZB 3P11H 4UQ3A 4OKVB 4FABH 2JCCB 3WL9B 1A3LL 2ITDA 3DO3A 1S9YA 4UNTA 1A9EA 2E7CA 1RZFL 2X4QA 3G6AA 2AJVL 3A6OA 1EBAA 1V3LA 1Q9OA 4G8EB 4KY1L 1VEPA 4AIXA 4ODBD 3CGTA 1IFHL 2GUOB 3B2VH 4G3YH 5B8CA 1F02I 5EC1B 5DMYA 2VUYA 2XXMB 1DQMH 1TPXC 1ACYH 3DHMA 3VFGH 1NCBL 1BWMA 4QRPA 3RWJB 1NGZA 1IC4H 3JVGC 3FCTB 3UXFA 4PREB 4P5TD 1VERA 3F7RA 2YPVL 4KZDL 4JQIH 3A6BH 1A7QH 4Y0GA 4HS8L 3U7WH 4AT6B 1S78D 5KSBA 5E2VH 4YWGH 4X98B 4YPJA 3ECBA 5ALCL 3FOLB 3RPIA 3VG0L 1BLNB 2R39A 5D6CA 1CTOA 1YEIH 1JTOA 2BNQA 4R26L 4F7TB 3K4AA 4CN1A 2O5YL 5JXED 4XWGH 1MIEH 3TZVA 2VISA 32C2A 1CD0A 1KFAH 2D7MA 5IKCA 3ULVC 1GGUA 3VFSB 3OKYA 2AJSL 4LASL 2VQUA 1CBVL 2VH5L 3MRRA 4WFFD 3MODL 3DRTB 2PCPA 3UTSA 1F00I 1X5HA 4ZUTA 3RIAF 1NC2D 3PIQA 4LGRB 1NCCH 4S1QH 2J4WL 3GBLA 5IHBA 2Z9TA 1G1CA 4U31A 3WNPA 1EHAA 3GSNA 4YO0B 3ZTNH 4AG4L 1CYGA 1MCPH 3GMRA 5GRZA 1FE8H 3MGOB 4YHLH 4M48H 1DQDH 1CU4H 4ZS7H 4M62H 4UINH 5GHWL 3VWJC 4HXBL 4L5FL 2ATPA 1GPOL 2XY1A 4WWKC 2VAAB 3SPVB 5IROC 4GG8A 3J7HA 5B3JE 4XCFH 4U1JA 4QWWD 2DM3A 2Y5TB 4O51A 2MHAA 2L7JA 5F96L 3W0WB 2LV4A 2EDFA 2UWEE 1DVFB 5L2KD 4POYA 1SMOA 1TQBC 5T1LD 1FSKC 3QEHB 4X6EB 2F54D 4NO0A 3QEQA 4HFUH 4JRYE 5D7LA 3WIHL 3G08B 1DEEB 4XMKL 4M1CD 3I3DA 5GS0D 2K7PA 5IVXB 4HUMB 1EGJL 5TFSH 3P11L 1EFXD 2AV1B 4FABL 1NAMA 5DURD 3G6JE 1H8OA 5C0EB 2HJKA 2BC4B 3GMPA 4GAJL 1KULA 2ID5A 4JPIB 5IBLD 1FFQA 1DQQA 1NBYA 3EYFB 4PV9B 4GXVH 1HOCB 1AGDB 3WFHB 5JNYA 3B2VL 3WLBB 3VGAB 4IIQB 2AEPL 1DVFD 1DQML 2YWYA 4ZO7A 1HYSC 1U3HB 3VFGL 1BIIA 5D93B 4NZUH 1JI2A 5KANG 4CU8A 4I9WD 3EYUL 3RHWK 2VZUA 4IMKC 1NGWB 1MCWW 1JPGA 4KDTA 4JQIL 1M6OA 3A6BL 4WI6A 1T66D 5C2BH 1A7QL 1HCFX 2R56H 1CDUA 1XF3A 3UJJH 4MNGE 1BVLB 1YDPA 5CSZB 1RZIA 3CMGA 3M45A 1BQUA 4LNVA 3MA7B 4BQ9A 1PFCA 4G8GB 2NY3B 4J3OC 3BD5A 3O11A 1FVEB 2X4SA 4PJIB 1MIEL 2E7HA 3RWGA 1WT5A 4B0MM 5C0FA 4QF1A 5EOCH 3STBA 1ES0A 5JHLH 1OSZA 5IB4B 1JL8A 4QRSA 3FO1A 4JREB 1MHHA 4UIMA 4S1QL 3BKYH 4WO4A 2V9TA 4J3SA 1N4XH 5AG8A 3KGRA 3UTZB 4W6YB 5FA3B 4NKOB 1VPOL 5KVFH 4OV5B 3TA3C 1MUJA 1CFSA 5FO9A 1FE8L 2HJFA 4YHLL 3TFKD 4M48L 4N8VG 4KH2A 4ZS7L 4UINL 1ZXQA 4N0UE 2O93L 4R4NC 2F5BH 3C60B 3M17B 2NY3D 4NFBA 3OJ2C 3MA9H 1DQJA 3PL6D 5IBUG 5KAQG 1AIFA 4XCFL 3U0WH 3KPLA 3NN8A 4OZ4B 4XHJC 2KPNA 2XTJC 4PD4K 3V7AE 1WCBA 1OW0A 1JWUB 1NMCB 4EUPG 5FO7B 2X9XA 3OMZA 4CNIB 3P4MA 1A0QH 2H32B 5IFAL 4PRNB 2FEDC 4POZD 4ZQKB 4LEXH 1P1ZB 3OKLB 1D7FA 4Y4HB 3CVHB 4Q6YA 3PP4H 3U7AA 3KYKH 2M2DA 5BRZA 3B8SA 1JGEA 4EZMA 3QO1A 2HKFH 5DFVC 1R3JB 3MO1B 4XNQB 2QL1A 4XAWH 5I9QC 1T0MB 1KC5L 2LTQC 2NXYB 1S5IH 5EOTB 5SWQA 3RL1A 1NKOA 3BXNA 2B2XL 1XCQA 4NCDA 4N0CC 4N5ED 1F4XL 4JY4A 4LLDA 3UYPA 1TTGA 43C9A 4L9LB 1OTTD 3MRGB 1VB9A 4U6XB 1FVDA 4NZUL 5J11C 4EI5D 2FL5B 3HA0A 1TVHA 2ZG2A 4JFHD 2X70B 5F89B 3SO3B 1A6AA 4Y4HD 7CGTA 4X99A 5C2BL 5CD5D 4UILH 1KCSH 4PRDB 3AVEA 1KBGH 2WQRA 3KPNA 4UTBL 4PLKC 3UJJL 3C6LD 1F97A 2BVPA 4P5MB 5ECJE 3WJJA 2P45B 1A14L 1WTGT 5E2UH 3TBVA 1A3QA 2G5BA 5D5ME 3GJFA 3UPRB 3WFCH 2DTMH 1EAJA 4I48B 1KPRB 4LF3A 4X9FA 4MHHG 5EOCL 5EU6D 1S7VA 5JHLL 2D7TH 3MV11 4PJ8B 1JJUA 5I1LA 4HKJB 4ODUB 1RZGB 3BKYL 4UNUA 3MRQA 3BGFC 3T0EB 4M43L 4Z77B 3ARDC 3IU3A 3WS6C 1JTTA 1MNUL 4J1UA 3VWKC 1SJXA 1KCUH 4M6AA 2ZG3A 2HMIC 1OPGH 5GRXG 3RZCA 3LDBC 3RY6A 4UQ3B 3BGAA 4Q6IA 1RFDH 3EKCA 2QSVA 4KVNH 2ITDB 2W38A 3MOQA 4G6MH 4MAYD 3ZL4L 1S9YB 1NQBA 3MPCA 3ARZA 1A9EB 3MA9L 2X4QB 2EXYD 3QFJA 4JLRA 3U0WL 5E5UB 5HD8C 5B39A 1Q9OB 1CD9B 4C57C 2P8MA 3PGFH 2EH8H 5FUOH 3EHBD 1MFAH 4PJ8D 2VABB 5BZWB 3DX9A 4OD2A 5H8DA 3X3FH 1DTUA 5B8CB 5D70H 3T0ED 3G5YA 3TO4D 3QUXA 3KPPA 1WZMA 3RY5A 4QRPB 1QR1A 1NGZB 1QLFB 5HHOA 1F5WA 3PP4L 3LVEA 4YXKH 1BWWA 3KYKL 3N9GL 4ODWA 4X7FC 2ZJSH 2HKFL 4OIIL 4OLEA 4LSSH 4Y4FC 5KSBB 4XAWL 1UZ8B 2XOTA 5BO1H 5JLZA 3ECBB 1BQHG 1RJZA 4I8DA 5D6CB 1BJ8A 2B8OT 4X6DE 3QZWA 1QYGH 3HE6A 2GJ6A 3C2AH 1XF5A 5F7HA 4QHKJ 5D6DC 2CK0H 3SGKC 2EIEA 5FXCH 3TZVB 1CVRA 2VISB 32C2B 5IKCB 2OXGA 4QRPD 4YFEA 3KJ6H 3MRRB 4LBEB 3PQYD 1N26A 2DDQH 2PCPB 4XH2B 3UTSB 1R5IA 3PWPA 4ZUTB 3PIQB 4IRZH 4WU5A 2NY6C 1KBGL 4PJAF 2IMNA 3ZLQC 3IJHA 3UO1H 5JHDA 3GSNB 5HYSG 3GMRB 1RULH 1VFOA 4ZFZB 5IVNA 1NUFA 3FZUC 1XF2A 5E2UL 3HKFA 3PHQA 4LP5A 1XEDA 3RGVB 4OF0A 2ATPB 2BVTA 3WFCL 1EJ6A 2VIRA 1NDMB 1FRGH 2MMXA 4TOYH 2BNQD 4GG8B 2D7TL 4U1JB 2WIMA 3DSFH 5A2FA 3O3DA 4O51B 1DFBH 3ZDXF 3K8KA 1OD7A 1B6DA 1KYOJ 1P7KA 1FNFA 4OGYH 1KG0A 2ZCKH 3DOSA 1WSST 4NO0B 1KCUL 3QEQB 5D7LB 2IPKA 2DAVA 2H26A 1I8IA 3CFEA 3P4OA 2HT4D 4C55A 5CIPH 3MFGB 1EFQA 4DZ8B 4YUEL 1NAMB 1RFDL 3QWQB 2HJKB 4OKDA 1H15A 1PQZA 1JF5A 4EXKA 1OARH 4LPXA 1CS6A 1DQQB 1TENA 3PGFL 1TDQA 2EH8L 5FUOL 1NBYB 1MFAL 4UTAL 1UGNA 5AZ2L 5C9JA 4OGAC 2QSCH 3HE7B 2MPAH 4C4KT 3WNLA 4CMMA 4OUUA 5HGAA 1FV1A 3OAYK 4NO0D 1BIIB 1QHOA 3QEQD 5IHLB 5DMJB 3VI3F 2OL3A 3SGJC 3UPAA 4YXKL 4RRPA 1V7NH 1JPGB 4CBPA 1BX2A 1FGNH 1M6OB 1QFWM 2ZJSL 1VGEL 3SCMC 5HYIA 3J8F7 4O9HH 1YEHL 1FC1A 4LSSL 1XF3B 3HI6L 1D5ZA 1YDPB 4HDIB 1RZIB 1NSNH 3S4SA 1N5AA 3T0XA 3P0YH 1UCTA 3L9RA 4HJ0D 3C2AL 5I73B 4URTB 2CO6B 3DUUB 2CK0L 2X4SB 3GO1H 4G6AD 4U1MA 5DQDH 5L8JB 1YEGH 3RWGB 4WNQB 5C0FB 1YJDC 3SE9L 4WVRA 1ES0B 5MHSD 5E00A 4NUGH 3KJ6L 5FYJH 5J6HA 5MENE 5DD5L 2IG2H 2DDQL 1P7QA 4QRSB 4NNYA 1MHHB 1DBBH 1F8TH 4UIMB 3ROOA 4HCRH 4WO4B 4F7CA 2IAMC 3STZA 2VWEC 4I0PA 3WMSA 1MUJB 1N7MH 5GQBA 5BV7B 1CFSB 2HJFB 4JKKA 1QSFB 5K9OA 4NUJA 4PBVC 1FLRH 1BJ1H 3BP7A 3VXNA 4LCCB 4X7EC 4PV8A 3CSPA 2IJ0C 1X5GA 1HIML 1FRGL 1JPSH 4TOYL 3L3GA 2FX8H 4S1DD 2UYLA 1DQJB 5E5MA 2FHBA 2W0FA 1AIFB 1JHLL 3KPLB 3NN8B 4PJEE 5C08A 4OFVA 1BFOB 4KI5E 5C0CE 1DFBL 1J0ZA 1WCBB 4XPBH 3QIWC 1ZWIA 4IOFC 3MJ7B 4ORGA 3P4MB 5MI0C 3RIFK 3LHPL 4WO4D 3VFUA 2ZCKL 2V9RA 1GC1C 4ZOAA 4XP5H 1I7RA 1LDPH 5ITBH 3GSUA 2YA1A 2XZQL 1AE6H 4GRWH 5I66A 3S98A 1Z9LA 2H2SC 4KK6D 1HWHB 1ZLWH 3VD7A 5I71B 5E2JA 5BRZB 3U0PB 1NL0L 5DD1H 1JGEB 3QO1B 4U1HA 1OARL 4H0IA 1J0IA 3R8BB 2EDDA 4Q74A 3O4OC 1JFQH 5TF0A 1FNSH 3QEUA 4QTHA 3S36X 2O61A 1LO5A 5SWQB 3RL1B 1NGPH 3AROA 5FHBH 2APBA 2M1KA 2OR9H 1EBPA 4JY4B 4LLDB 3MRIB 43C9B 4K23H 2IGFH 5DJDA 4XTRC 3BQUC 1FVDB 3E3QE 2AK1H 3B3IA 3RWFA 1JYVA 1TVHB 2X1XR 2OJZH 1V7NL 1A6AB 5J3HC 3HC4H 3I6LD 3KPRE 3MMEA 4X99B 3UBXG 4O9HL 2EO1A 4PR5A 4WFGD 3ES6A 3RGHA 4P2RA 5EIIA 3KPNB 3GMLA 4P2OC 4F33A 1EEYA 3TT1H 2BVPB 4QNPE 2W1NA 4M5ZL 1JE6A 3IFNH 3P0YL 4OLWH 5DZOA 5KG9A 1MY7A 4HJGB 5I1AA 1C5CL 2G5BB 4OT1H 4OCLC 5EO9A 3GJFB 4CU7A 3GO1L 4W4OC 5DQDL 1PD6A 4RFEA 1YEGL 4Z7VF 4LF3B 1FYTE 5CJ5A 1S7VB 5FYJL 3VXMA 3JVGA 1DBBL 1F8TL 2GJJA 5HBBA 4HCRL 5ISZA 3CVIH 1T21A 3UTTE 1A22B 3MRQB 3RWCA 2DWEA 5JTWA 3NFSH 1KJ3H 3HB3C 2KZWA 5ID1A 1KJ2A 3IU3B 4CRPA 1FG2A 5HPMA 4J1UB 1ADQA 3WLWD 5IUSA 1N7ML 1ZT4A 4KTYA 1AFVH 4YHIA 2B1HH 4J6RL 2NPLX 3ILPA 3HUJE 5IGXH 3RZCB 3UEZA 5IK3A 5E6IC 4F7MA 4FXKA 2FX7H 4Q6IB 1RIVH 1T3FA 1ZVHA 2DL2A 3LMJH 3VG9C 2FX8L 3ARSA 4Y5XC 2YD7A 3QFJB 4JLRB 4OAWA 3WFEH 3B5HA 5B39B 4ONGH 2P8MB 4XPBL 1XAUA 1IAMA 5K59E 3T2PA 3DX9B 4OD2B 4NQDA 5I74C 1F13A 3G5YB 3H3PH 3VXUE 4XP5L 1LDPL 5ITBL 1CFBA 3QUXB 4BH8A 3KPPB 1QVOB 5DSCB 5FM4A 4ONHA 1AE6L 1HILA 1UZ6F 2CUHA 1WF5A 4RWYH 4YDLC 2YUXA 2HFEA 1WICA 5GRUH 3RZCD 4HWUA 5ADPH 4ODWB 5DD1L 2VZOA 3VWJA 1MFDL 2COQA 4NPYB 3BDBA 4WWKA 3KHQA 1YN7A 3QFJD 5IROA 1JFQL 1J18A 5D72H 1FNSL 5JLZB 4A6YA 3NFPB 1RJZB 2GYSA 3VFOA 3FRPG 1NGPL 3L5WA 4F15B 4C4KO 1YEFH 3QZWB 1AJ7H 3HE6B 2HFGL 2GJ6B 1YZZA 2OR9L 5CP3H 1RUPL 3C09B 4YNYA 5DUPH 1RUAH 1U2CA 1XF5B 3QQ3A 4JGJA 4Q9CA 4W81A 1X4YA 2JJWA 3PDGA 2IGFL 3D9AH 4BH7B 5GZOC 3EDEA 1J1PH 2EE3A 3F8UB 4JRXE 2EDYA 2KH2B 1G7PA 2OJZL 4DKAA 3MRNA 5HHOD 1R5IB 3PWPB 1NUNB 3HC4L 3I50L 4WU5B 4IRSC 4CJ0A 4XCNA 4EN3A 1G9MC 3IJHB 3IDXH 1LK2A 5JHDB 5C92A 2V2WB 1B0RA 3B9AA 3U4AA 1PEZA 1RJYA 4IOIA 3S88L 1J1OL 1HINL 4UB0H 2ESVA 3IFNL 4P59L 1P9MC 3MQIA 4DQOH 4OLWL 1QBMH 5DD0L 4JN1L 3D6GA 3PHQB 1ZHLA 4RIRA 4OCNC 5AYQA 4PRHA 2VIRB 3HE6D 4JPVH 2GJ6D 4TNWF 3W81A 2E7MA 4PLJC 2XFXA 1JCKA 1OAKH 4NN6B 4NT6A 1FPTH 1JHTA 3O3DB 5I2IA 4M6MH 4QRRD 4U1LA 2YBRB 5CEZD 3CVIL 2BX5A 4IMKA 1I3GL 4KAQH 1AQKH 1P7KB 3NFSL 2UV3A 1KG0B 4H0GA 5F6IB 3L3DA 3TBWA 1BFSA 2IPKB 2B1HL 4UT9H 3PWVA 4WW1A 3RHWF 3EO9H 1BECA 2H26B 1K2DA 4HF5L 5KTEL 1I8IB 3CFEB 4MAUH 4EOWH 4EVNA 2HVKA 3VDCA 2FX7L 2AXHA 5T5NG 1WV7T 2NY0B 3E2HC 2C1PA 1H15B 1PQZB 2UZYB 1W0YT 3WE6A 1LILA 1E4KC 1UC6A 2VAJA 1OY3B 4KK8D 2VSCA 1CD1A 3T1FA 5C9JB 2YA0A 1QOKA 4HZLA 4DFHA 3MOBH 4CMMB 3H3PL 1FZKA 4OUUB 5HGAB 1LEGA 1FV1B 1TQCB 4NQCE 5F7MC 5L8KB 3O9WC 1VKXA 3TA3A 3WEXA 3K7UA 3G6DL 3EAKA 4F3FA 4MNQA 1BP3B 5GRUL 1OGAA 4C56E 1BX2B 5ADPL 1MCEA 3F5WA 4OCYH 3BSZH 2CIKA 5BOPA 1NLDH 5JIHA 5JO5A 2BNUA 5EC2A 5EZIH 5I1EH 1PJ9A 1D5ZB 1GZQA 3WIHA 3QDMA 2DM2A 3QNXA 5D72L 3RVUC 4LIQH 2OBGA 3S4SB 1EGJA 2YA2A 3VGFA 1BAFL 3L9RB 1YEFL 3WKNA 1AJ7L 4NQXA 1RUAL 4NO5B 3ARFD 5E9DB 1FNHA 3QXDB 1JMXA 5C0BA 3D9AL 4PGZA 1J1PL 2JB5H 5E00B 5HY9A 4GQPH 5GZNC 4DKFH 5J6HB 1P6FA 2VO5A 1P7QB 2XA3A 4NNYB 4HT1H 3ROOB 4BFIA 2ZUYA 3D87B 4LFHD 2DQGH 4F7CB 1T7XA 5FKAA 1JNHA 4UDTB 5T5NF 5E1AA 3IDXL 3N1GC 3STZB 2W9DH 3AB0B 4I0PB 1VHPA 2VJXA 2AI0H 5ESVA 2XN9E 1NJ9A 3LKRB 4UB0L 5HDOA 2VLLA 5K9OB 2NTSP 3GSRA 4JANB 3CK0H 5H37H 5I75B 3Q5OA 4JPVL 4EUPA 4CDGC 4U4BA 1OAKL 2OS7A 2J1KA 5E5MB 1W72A 2W0FB 4LAQH 4L8SC 5SX4I 1H3TA 1YY9D 5C08B 5K9QI 1FPTL 4FQCL 1DL7H 1EO8H 1X9QA 4HGWA 1IGFL 1ZWIB 4KAQL 3MNWA 4ORGB 2DQHL 4HKZB 3VFUB 4FTVA 1P84K 4MB3A 1AGCB 1I7RB 2ITCA 3NABH 3GSUB 1P7HL 4MD0A 4Q9RH 3V0VA 4XP4H 1OP5H 4I0PD 1WK0A 4EOWL 4YFDB 4LAJH 5I19H 3TN0C 4U1NA 5C71A 3GNMH 2EEAA 4YPGA 1TIUA 1TNNA 1EV2E 4GJTB 3LRGA 3LS4H 1N5YL 4AEHH 4U1HB 4HZAA 2DI8A 3TJHD 2FZ3A 2J3SA 4X6FA 4KKLC 1OWRM 3CH8A 4XZUB 5I8EA 2OLDA 1F2XK 5C08D 3QJFA 1MFEH 4EEEA 1TZHA 2O61B 4GBXC 3BRFA 2P1YA 2EDJA 5EUOF 4WI5A 5GRJH 5IFHH 4DGIH 3Q6GH 1T04B 3MTRA 5L6YH 4WEUD 5DJDB 4HUWA 4DAGL 3WS6A 1A64A 1OP3H 3VWKA 3EYOB 3KPTA 3B3IB 2H3NA 4IOSD 5D7IE 3RWFB 2D0FA 4HBCL 3PUCA 4PJ5A 2QHRH 2RCSL 3MMEB 1XMWA 3NIDF 3GUTA 3PDDA 4OCYL 3BSZL 4HS3A 4XC3H 1IAIH 4PR5B 3ES6B 5EIIB 4P2RB 2X1QA 4K7PH 1NLDL 3GMLB 3M8OH 1YPZE 5AD0A 5EZIL 5GPRA 4F33B 5I1EL 1EEYB 3T3MF 1MLCA 1DLHA 1F58L 4GW1A 1HI6B 1G6VK 4QGTA 3GBNH 2HJLA 2DIAA 2BHUA 5KG9B 3VD5A 1I8LC 5EO9B 5T3XE 1LO4H 4RFEB 1NBVH 2DQFB 3OAZK 1AGBA 1I7UA 4WUUB 1LDSA 1TJGH 4P46C 3QI9D 4FQ2L 5GSVA 5LKNA 5EU4B 4TTDD 5C0DA 5ISZB 3RUGB 1T21B 2DQGL 2ED7A 4OZFG 2DWEB 3RWCB 1DANU 2NLJA 1PKQB 4PJAA 4K07A 1KJ2B 4I18C 5EIQA 1FG2B 2W9DL 5HPMB 1QACA 1I8KA 1RHHA 1ZT4B 2AI0L 3NPSC 4YHIB 1UWXH 5D71H 1GGBH 2PO6B 1KGCE 1IAOA 3ILPB 4P3DA 1ACZA 1MCOL 3JTSA 5IK3B 1J8KA 5HHME 4XVJH 4F7MB 4FXKB 3P4NA 4NDMA 1T3FB 3GM8A 5CFHA 2GEEA 3RX5A 2LABA 1JUFB 2X89D 1S9XA 5D6DA 4LAQL 3SGKA 3UTOA 1GGIH 1EO8L 1A47A 2FEEL 3QXVA 3VXMD 2WNGA 4LLQA 1YUHB 3O4LD 4LRIC 4WENB 4OZIA 1IC5H 5ISZD 1FVCA 4YQXH 4NQDB 2BY0A 1X5LA 5EN2A 4LPWA 4Q9RL 3D0LA 2QJDA 3ZHLA 2R1WA 1JK8A 4ONHB 4K8RC 1D5BA 2D7OA 3QDGA 4RGNE 4WV1C 4G9FD 3HAEG 1G7LB 5I19L 3LQMA 2HFEB 3C9NB 1BQHA 4QY8B 3STLA 2Y07H 5CAYB 2VLJA 3HI5L 2D4DA 3EIFA 1CLOH 4UAOC 3S35L 3VWJB 1CQYA 3LS4L 1JGUH 4AEHL 3D39A 1F45A 2J5LB 4WWKB 1RUKL 4K3JH 2P8PA 2ZUUA 5A3IC 3WHXA 4L4VD 2NY7H 2CKBH 1MFEL 4A6YB 3EJYC 4UMGA 5HDQL 1UJTA 3L5WB 1ZVYA 5GRJL 1UACH 4PGJA 4DGIL 4B7LA 5IFHL 3Q6GL 4LSDA 4HUXA 4YNYB 4W6XB 1K4DA 3QQ3B 3EBAA 1FC2D 4NQDD 5L6YL 1MJ8H 3FOMB 1T7ZA 5JUEL 5CEXA 5HYSA 2FDBP 5FGCE 5MP6L 4A2LA 1G7PB 1HE7A 5T5FH 1PYWA 3RU8H 4G8IA 4G6JH 3U6RA 4AZ8A 1CLYH 2FIRT 4XC3L 4XCNB 4EN3B 1IGML 5TF1H 4K7PL 3VWJD 1U2HA 2D03L 1LK2B 5FB8A 1B0RB 5BS0E 4WWKD 1RJYB 5JDSA 4IOIB 1MSPA 3QIUC 3VFPA 3GBNL 3C08H 1IBGH 3TBYB 4AQOA 4PG9A 2BXZA 4JZJA 3O81A 2EDKA 1UA6H 1GIGL 4RIRB 2FJHB 4PRHB 2DLEA 4U0RC 2JJVA 3MRHA 4JQVC 4JO4H 1NBVL 2XFXB 2AERT 1YMMB 2R23A 1TJGL 4PG2C 3MLWH 2J8OA 5TE4L 4NT6B 1JHTB 5I2IB 5IV2A 2ZP0T 4U1LB 3P9MA 5J13C 5IWLC 2IWGA 2GFBB 4RSVA 2C3HA 4P2YA 4FP8L 4H8WC 4M9OA 3SCMA 1A6TB 1U8NA 3L3DB 3TBWB 1P2CA 4WW1B 3PWVB 4PJXB 5D71L 2B1AL 1K2DB 1V3JA 4EVNB 5H2BA 1G7IA 2ESVD 2HVKB 4XVJL 5DC9B 3IRZA 2HFFA 3H8NA 43CAA 2C1PB 2EIDA 1AO7A 2AKRA 3IKCA 3G5XA 3WE6B 1JWSB 4WFED 1HYSD 5TH2A 5IB5A 1CD1B 1MHEA 5LGKA 3T1FB 4PJCE 2W0PA 5C0IB 1SBSH 4O4YL 1GOFA 1JV5A 4KU1A 1Q1JH 2ENYA 4JKMA 4HZLB 3VFTB 4QRUA 1FZKB 1X4XA 2IAMA 3B9KC 2YD9A 4J3UA 4AK1A 2OMBA 5K9JH 2VMFA 1VKXB 2FGWH 3TA3B 3WEXB 5C3LD 2F74A 2QQKH 4F3FB 1HKLH 4MNQB 3DSNA 4ZFOL 3BWUC 4KUCF 4Q58C 2Y07L 3HMXA 1OGAB 1CLOL 3F5WB 3VRLE 1JGUL 3FT4A 4Z7UF 5ELIA 1YQ2A 3RWIB 2E7BA 3BJLA 3N50A 5JO5B 2BNUB 1NBZA 3MNZA 4D94A 3QDMB 2NY7L 3QNXB 4XC1H 5GJSH 4D8PA 3O6FB 4NN5C 2LE9A 5TDPA 2XTJB 4JKPH 1RZJH 4YR6A 5B3JF 2FWOA 4P4RB 4NQXB 3RTQC 3QIWA 1HSAA 2X6MA 1N8ZB 3QAZC 1H3WM 4JFZH 5EPMA 1GGCH 1MJ8L 3THMH 5F44A 3CUPA 1OWWA 3VXSE 5HY9B 4FFZH 1CFVH 4JFFE 3TA3D 1HWGB 1ITBB 3G5VA 3RU8L 3RIFF 1RURH 4G6JL 4MNQD 4BFIB 4YH6A 2R4SH 1CLYL 5TF1L 1OGAD 4AMKH 5FKAB 1NDGA 1MHCA 4R4ND 5E1AB 5EZOH 4APQC 4GKSA 4HSQA 4P99A 1WAAF 2P24A 5ESVB 4B53A 1DEDA 1NJ9B 1IBGL 2A77L 3QDMD 2VLLB 1U0QA 5FCUH 1ZK9A 4XHJD 3GSRB 5I9QB 5J7CC 1X5IA 1RZ8A 4FQHA 1UA6L 2LTQB 3DI2B 2XTJD 3PWNA 4JFEE 4XP9H 2HVJB 3WFDL 1QLEH 4EUPB 1SVZA 2VQ1B 5FYLH 2Q20A 4S2SA 5C0BD 1TJHL 5DRZA 4JO3H 4Z7WE 1YJDH 1LVEA 1CXHA 3BQUA 3CX5K 3SKMA 4KRNA 3S3JA 2D9CA 3V7AG 2FEDD 4HGWB 2VL5A 4Z7QF 5C8JB 4XCEA 4FTVB 3KS0J 2ITCB 4ZMAT 2A6DA 4MD0B 4P2OA 5T3ZE 4HGMA 4JCLA 3V0VB 2F19H 3D3VB 5DFVD 4NKDA 3O2WL 3CC5A 2X10A 1MRFH 3BRGC 2VXVL 1A6WH 4U1NB 1H3UA 4L3AA 4YPGB 4LHJB 3QPQC 1DLFH 4FQQA 5CZVH 2FZ3B 4N0CD 4HKXB 3SE8L 5KS9E 4R4BA 5I8EB 5EZLA 3X17A 1E0OB 3ZDZF 5IB3A 3QJFB 1KCRH 1TZHB 3DX6B 4PJBE 2GY5A 4HFWA 3U4BH 5JW4M 1Q1JL 1N6UA 2MKWA 2VE6A 3H9HA 5E4EC 2H45A 1I4FA 3BGFB 3UBXA 4FTVD 3UMTA 3HZKA 3LN5A 4HUWB 2GTZB 3QUYC 2FGWL 2IPUK 2QV2A 1K4CA 5DQ9A 4PLKD 1SMAA 4O5LH 5DZLA 2H3NB 2QQKL 1HKLL 1UH4A 1FFNA 2XZAH 3KNBB 4PJ5B 4D9QD 2RB8A 4GLRH 4PRPA 3H9SA 3WNMA 3LDBB 3GUTB 1MAJA 5E6IA 1MREL 3OB0K 2VZ1A 5T33H 1MI5E 5AD0B 1L0QA 4JO1L 5DF0A 1MLCB 1DLHB 4J3VA 4Y5XA 4GW1B 5E7BA 3VD3A 4Z6AT 4J23A 3HPJB 3BIKB 2HJLB 4JKPL 1RZJL 4AYFA 5HYQA 1Q9LA 4LPUA 2LU3A 5DJ8A 3HNVH 1BOGA 4DUXA 1MCIA 2H1PH 4JFZL 1AY1H 3NVQA 3THML 1AGBB 1T03H 1I7UB 3ARDD 2W0KA 3I75A 1CFVL 3VWKD 4E0RA 5GSVB 1RURL 5CKGA 2HMID 1KXTB 2R4SL 5C0DB 4PJ5D 4AMKL 3LH2L 2NLJB 4GXUN 4N1HB 4LP4A 1RHHB 1I8KB 5E8OA 5ANME 4OI9A 5EIVA 4P3DB 5FCUL 4JFDD 2ADFL 5HD8D 3V6OE 3JTSB 5ALBH 4Z7NF 2AQ2A 2JIXA 1PSKH 3A0OA 1WZLA 2EDNA 4XP9L 1QEWA 1BZ9A 3BKMH 3P4NB 2GY7B 5ETUA 1QLEL 4KK9C 4HWBH 1WC7B 1HHKA 3AREB 3QYCA 5FYLL 1S9XB 3T77B 3MLZL 4Y5VC 5IB1A 4UBDC 1N0XH 3RUGE 1W8NA 3QUMA 4LSRH 1B88A 2Q7NA 4LLQB 1C7TA 3ROLA 5EZJA 4PRIE 4OZIB 1DN2A 4QT5B 1FVCB 4GMTH 1LO0H 5F9JB 3VMNA 4OLYH 3ZE1E 2C4FT 4IRSA 5L2KE 4S0TD 3MFFA 3QHTC 1V5JA 4LLUB 2R1WB 1JK8B 1YN6B 2F19L 4Z95H 5C6WH 2F54E 1A6WL 1D5BB 2VLKA 4Y4FD 4F8QA 3L7FA 3QDGB 1MOEA 15C8H 1P9MA 1BQHB 1B4JH 2BY3A 4JHZA 3STLB 2H41A 2VLJB 1MPAL 1AKJA 3FRPA 1FL6A 2P43B 4EI6A 2NCMA 3ABZA 3D39B 2HT3C 5CZVL 5INDB 3ZHKA 1FFPB 3PF2A 3FB5A 5CGMA 2P8PB 2RHEA 4MA3A 3WHXB 1V8HA 2XQBH 5TGBB 1KCRL 5GIRA 3BZ4A 5L0QB 4P23A 4PFEA 4JHBA 4HUXB 4PY7A 5HHPB 3UPCA 1J7VR 4Q9BA 1K4DB 3NGBB 5I1CL 3VD4A 2NY6D 4H1LH 3IU4H 4Y5YC 5L88H 4M4PA 4O5LL 5CEXB 3O3UN 4Q0XH 2BMKA 2XZAL 3NH7H 3TF7C 1YYMH 1PYWB 3QDGD 3TPUA 1X5FA 3ULSA 3U6RB 3FZUD 3MJGX 5F7KC 1BQSA 4HC1A 4ZNEA 2VLJD 5T33L 3Q5TA 2ADIA 3D39D 1ZSDA 5JDSB 5JORA 3VW3H 3VFPB 2Q76A 3U46A 1FNGA 1U95A 4PG9B 4JZJB 4DVRL 1L7IH 1I9EA 3BOVA 4WI7A 1IC1A 4ONOA 2WBJC 1KIQB 4HIHA 1AY1L 1H9VA 1NCWH 4MZ2A 3MRHB 3RVWC 1T03L 2V5SA 5JMOC 2R23B 3QG6A 4XGZA 3C6SA 4OCRH 3O9WA 5IV2B 2R8SH 2BSSA 5EG6C 1MCNA 4KQ3H 3LPGA 4FA8A 4QRQA 1G9MH 4RMSA 3IXAA 1U8NB 1QRKA 3HRZA 3FB6A 3DXAB 4O00A 4YHML 1P2CB 3GJFK 3FQUA 4MQTB 2R4RH 5C70A 2J12B 5ALBL 3WO3B 5H2BB 3WO4B 1PSKL 5ILTH 5GS3A 2HFFB 1CICC 4OGAD 3DV6A 4X6DF 1AO7B 2AKRB 2KL6A 3IKCB 4IDJH 1OF2A 3Q3GA 5C07A 3IYLW 6FABL 5TH2B 3GEWB 1N0XL 5IB5B 1W0VB 4QXUH 4Z18A 5KVEH 2Z0BA 1JV5B 5D1QA 4GMTL 1LO0L 4OLYL 4QRUB 2I07B 3KLDA 2IAMB 2UUDK 5GS2D 3SCMD 4Z95L 1NKRA 1QSEE 2F74B 2DS4A 2GI7A 4N8CH 15C8L 4R90H 2DM4A 2EIBA 4UOJA 2B0SL 3Q1SH 3RQ3A 3QJHA 3MZTA 5CSBA 3OKOA 2P5EE 1EIBA 3IJYA 1ZV5A 4PY8I 2RQ8A 2H2PC 1AO7D 1RU9L 4L8SA 3T2QA 3JWOC 3MRBA 5TDPB 5EUOA 2FWOB 1ZHKA 3V8CA 4HJJH 1HSAB 3FFCA 3S5LB 2PW2A 4PJGE 5EPMB 3IU4L 1L6ZA 3LPFA 1GYAA 1ZKAA 2IAMD 2CIIA 3CUPB 2X9WA 2ZOLB 3MBEC 4Q0XL 5KZCB 4P4KA 4P3WA 3NH7L 5IQ9A 1MCRA 4XNUL 1GGTA 1N3NB 2MCPH 5FM5M 1MJJA 1ONQA 2R1XA 4CL7A 1NDGB 4JFHE 2DTSA 4U3XA 3T04D 3KWWA 4GKSB 3T4AA 5I1IL 5GRVL 2P24B 4G42A 3VW3L 4NM4H 4XXDB 3OGCA 1IMHC 5ESAA 1CK0H 4YHZL 1PVHA 2Q1EA 3KXFA 4F57L 2WINA 1RZ8B 3FO9A 4FQHB 1L7IL 2FIKB 4IIQC 4GBXA 3PWNB 5AZEH 1GVIA 3QO0A 1NCWL 3QIWD 1U3HC 3QRGH 4IOFD 4ZOEA 4S2SB 5DRZB 5JIKA 2VDKL 4OBRA 4OCRL 5C0AE 3BQUB 3P73A 3SKMB 2ICWA 4KQ3L 5KZCD 2BVOA 1Q72H 3IAPA 5EU6E 3CMOH 3O3EA 1SYVB 2VL5B 4L3EE 4X4YA 3QIBC 2CJUH 1U3YA 4XCEB 4AQ1B 2VDQH 3O2DA 1I8MA 1RVFH 2YSSA 4YJZL 2A6DB 4P2OB 2XQYK 1XGRA 1R3KA 4K3GA 4UDUA 5ACMA 2R4RL 4NKDB 3CC5B 5KSAA 5ILTL 1SVCP 5BXFA 4NQTA 5SV4A 5HVWA 3FRUA 5FV2A 4XWOC 1W8OA 5JDJA 5F71A 2F8OA 4FQQB 4IDJL 4XMLL 3TEUA 5KN5A 4F7PA 4R4BB 4X6BA 1VFAB 5EZLB 1TETL 4P46A 5IB3B 3MV9A 3EFDH 4XTRD 3BQUD 5KVEL 2HP4A 3BPNB 4HFWB 5LGHH 1BD2A 4LLYA 3U0TA 3TBSA 2VE6B 3GI9H 3H9HB 4JFOA 3TP4A 1I4FB 4OCXH 5J3HD 5DC0A 5B38G 3HZKB 4I18A 3LN5B 5D2LE 3KPSA 1GAFL 2YPLE 5DQ9B 1K4CB 1T7VA 5LGJA 4P2OD 3MRJA 1E4WH 4RNRA 4HAGA 3EDDA 4Z8FH 3H9SB 3C60C 2IALA 1IL1A 3TVMC 4MD4B 5DDHA 4DTGH 4AJ0A 3MJ9L 1WBXA 3VG9B 1NLBH 4Y2OA 1A1OB 4Y5XB 1WIUA 1EZVX 3QCVH 1JWMA 1KV3A 4LARL 4PJFE 4NOFA 4CVXA 5HYQB 1EXUA 4HJJL 5DJ8B 2JB6A 1BOGB 4KKBC 4HQQH 4LRIA 4QOKB 4QXGH 5JW3L 1NC4A 4NM8L 5I74B 3QWRA 1MCSA 1X6NA 3O3AA 3VXQA 3HB3D 1JI1A 1J87A 1SJEB 2BOCA 3MUZ1 4OUOA 4RFNC 4RQQA 1FLTX 3I75B 4BUHA 2M8XA 5KJRH 2VDPH 4G5ZL 4ELKB 4MJIA 4HKBA 4W68A 4PRPD 3H9SD 5IR1A 3LV3A 3PQYE 4OF8A 5E6ID 2VXSH 5KVMC 4Y88A 4NM4L 4S0SD 3GMMB 5E8OB 5JW4N 1CK0L 4GRLC 2NXYC 4NWUH 1IT9L 1HXYB 5F3BB 2HRLA 5B4MC 5DD6A 1FL5B 1JNNH 2EIZA 3QEGH 2JIXB 5E8DL 1I1YA 1VFMA 2C3VB 1QEWB 1BZ9B 5ETUB 3P4LA 3GM0A 1HHKB 3QRGL 4L9LC 2VB5A 2D2OA 1A7NH 1ZAGA 5IB1B 4HHAA 2FBOJ 1IKFH 4OIAA 2BNQE 3MACH 3RFZC 3QUMB 3T65A 1Q72L 1TCRA 1PGRB 3QA3A 3RDTC 3V52L 4CU6A 5EZJB 4GMSH 2XKUA 3HAEA 2K9UA 2VDQL 4WI3A 4IRSB 5E2TH 1RVFL 2M26A 4ELME 4IBLT 1E6JH 3MFFB 1QG3A 4OM1H 4Y19E 3QIUA 2VLKB 3L7FB 4QNPF 5EDXA 4F8TA