4OLWH

Crystal structure of antibody vrc07-g54h in complex with clade a/e 93th057 hiv-1 gp120 core
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
228
structure length
228
Chain Sequence
QVRLSQSGGQMKKPGDSMRISCRASGYEFINCPINWIRLAPGKRPEWMGWMKPRHGAVSYARQLQGRVTMTRDMYSETAFLELRSLTSDDTAVYFCTRGKYCTARDYYNWDFEHWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
publication title Enhanced Potency of a Broadly Neutralizing HIV-1 Antibody In Vitro Improves Protection against Lentiviral Infection In Vivo.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 40
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2014-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4olwH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4olwH01
4Z7VE 1CL7H 3DARA 4Z18A 2AJ3B 5E8PB 3QUKB 4ONHA 4PJDA 4FQCH 1VADA 1T83A 1ZT1B 3HE7C 1CE6B 5L8KB 3HC0A 3JTSA 1K8IB 1U36A 4XZUA 4MNGB 1DQJB 2I5YH 5E94A 1YMMD 4YHOH 3DUHA 1X7QA 3SCMB 1RK0A 3LN9A 1UWEL 4PRDB 2G60L 1NCWH 1EHXA 2CIIB 4IRJD 3QHTC 3M1BB 2YUVA 5BO1L 4TN9A 1IMHC 4WTWA 3HZVB 3V52L 2P8PA 1IBGH 4R3SB 5BVJA 2FCBA 4I18B 1CICD 4UILL 5EUOB 5IMLB 4HS3B 1UA6H 1WIUA 3MRQB 3O6KH 4U3CA 5ICXA 1NGQH 5L7XL 2A6JA 4S2SB 3FRUB 2P44B 3MYZA 1BIIA 4NO5A 4MMZC 1K4DA 1P6FA 4L4JA 4QKXB 4OCNC 2XWBB 3DYOA 3WLWD 3TJHC 3MJ6A 1RMFL 5F72S 1E6JH 1RUAH 1ETZA 3C6SA 2GY5A 1DLHA 3RUGA 3CX2A 2IANA 1Q72L 2BY1A 2Y5TA 4KRMB 1NFDF 1RZJH 2WLYA 4RFEA 5FUCC 4RAUA 3QJFB 4JFYB 5AG8A 1MEXH 1I85C 1P5UA 4F7EA 1W0WA 4XPTL 2XKUA 1YN7B 5MENE 4TPRH 1GHFL 4X4XB 1OTTC 2YMXH 5FB8B 2CDFB 3TVMB 4ODXB 5BVPH 4M3KB 4HS6A 5C07D 2ADGA 4XNZC 1RFDH 1QTYT 3MA9L 5IBTL 1RZ7L 2AS5M 4V1DB 5D7JD 4I77L 4QRSB 5EA0L 1KB5L 5CEYA 2NX5A 2P1YA 4M03A 2HVKA 3FQWB 4U1IB 5D1ZC 3CVHA 4ZO9A 3QAZB 3O3DB 1PY9A 1U93B 3MV8E 3QIWA 1C5CH 4JFOA 2JB5L 4OJFL 5ETUA 3QNYB 4YUEL 3O9WA 2DD8L 2HT4C 2GJ6A 1S7SA 3DRQB 2QQQA 5CUSL 2W0KA 2PTUA 2CXGA 3O4LB 1G7IB 1GYAA 3CFJA 4AIZB 1LE5B 4TULH 3IDIB 2PW2A 5ENWA 5LGHH 1T22A 4KVCH 2NTSP 3HE7A 4YHZL 1VFUA 5D5MA 5F1IB 3D18A 2VR5A 4XP6H 2RJMA 3ZSTA 4L5FL 1KCUL 1YPZA 2CDEB 1S9YA 4HX1B 2WWKO 1MHCB 4FG6D 3UJIL 4XC3L 4EUPB 1PG7L 4G6FD 1KYOJ 4RFOL 2X1QA 5KZCB 2VN4A 3EOAA 1P7KB 3WFBH 4WEUD 4PP1C 3WS3A 2DDQH 3DVGB 4OF8A 2ZG2A 3FAWA 4K23H 4PGEA 1T0PB 1U8HB 4HV8B 2DYPB 3VFWB 1OAZH 5B39B 1A7BA 3HZMB 1E27A 3FB5B 3NFPA 4U7KA 1T0MB 3OR7B 2FZ3B 3H3PH 4YPJA 1J8KA 4MAUH 4QF1A 2YD3A 5B38G 3GMLA 1FZKB 4P2QD 1F58H 4H1LA 2LU7A 1EXUA 3B6SB 1J1OH 4K7PL 2P24A 3M8OL 3S6CA 1BECA 5GGTL 2YN3A 2BCKA 2WQ8A 4UMGA 2NY5H 3DSFH 1I85A 1QBML 2NW3B 1MREH 1BOGA 3FN0L 2YR3A 1TXKA 4H25B 3ARGD 1XAUA 5KS9A 1AGCB 3MBEB 3VD9A 4LHUB 3EDDA 1S9KC 4LGSB 5C9JA 5KVFH 5T3ZD 1RU9H 1FRGH 4QHMB 1ZT4A 2YXFA 5CGYC 2N7AA 2FR4B 3OSKA 4HPOH 2YPVH 2XQYK 3T3PE 4Z76A 2HT3C 3G08A 3I75B 5FYJD 2XZQH 1SY6L 4DN3H 3VI4F 3VFPA 2NY2C 4GRMB 1XGTB 3HI5L 4S10A 3EO0A 3BXNB 2JIXB 3TNNA 2VR4A 1JN6A 3ULSB 4WDIB 5D1ZA 4LSSL 4HUNB 2VOTA 5CZKA 4CDHA 4QO1A 2IMMA 2D4FA 4DGIL 2EXWC 3RVWD 3QIBC 3TO4B 3FFCD 3HB3D 1LEKA 1N59B 3PGCA 1UH3A 2GK0A 1N2RB 2CGRH 3MCKB 3X11B 1XGQA 4PJHB 5KSBA 1H8SA 2G9HB 5DD3L 5F93C 2EKSB 1CFNB 3BP4A 5E03A 2VL5A 1ES0B 1FYTA 5DT1H 5DVNA 5IQ7L 1AO7D 3VDAA 4OZFH 2QADB 2OZ4H 2Y7QB 3F62A 4GBXC 3BH9A 4JE4B 3DV6A 4FS0A 3SE9L 5E4IA 5ISZB 4IOIB 3O45B 3SCMD 2ZCLL 1YY8B 1A1MB 1TVDA 3EFDL 1LO3H 5E5MB 3QUMH 3P77A 5CSGA 5C7XL 3KXFB 1OF2A 4LCIL 3VXNB 3HUJB 1MCRA 4AIOA 3T2OA 3LH2H 1U6AL 1WBYA 4OLYH 1QYGH 5EO9B 4NQED 5HDQH 3K81A 3TV3H 3U79A 2DLEA 1M71A 4QRTA 2RIKA 2F58L 2O5ZH 1DFBH 3JV4B 1U8QA 4Y19A 1TCMA 4ISVA 3NZ8A 3CLEH 1ZHLB 4KHTH 35C8L 3FMGH 4HAGA 4RZCB 5JW5A 2PCPA 1CLYL 1U8MB 3WYRA 2VSCA 4YEFA 2VKXA 5T1DL 2CJUL 1KJ2H 4NZUL 1JFQL 5T1KA 4XGZA 1KJVB 1QFWH 2B2XH 3VH8G 3DMMD 2APVA 2P8LB 1QHPA 3SDCB 3W9EB 5C0NC 1G7JA 4JDZA 2Y06H 5F7MC 1G1CA 1I7TB 3U36A 1UM6L 1CK0H 5EU3A 1FO0B 5FCUL 4RWYH 1WZKA 5KG9B 1M05B 2B4CC 2VZSA 4PRIA 4RRPA 4KK9C 3TVMD 2V17H 4BA8A 1ZLUK 4XVTL 1IC7L 1XCTB 2VR9A 1KEGH 2C7UA 1AD0B 1G6RH 1FJ1B 4V1DD 4E5XB 4PFEA 1IC4L 4TVPD 4IIQB 4RA0C 1XCQA 4OB5H 3JTTA 4HLJA 3C2SA 4XPBL 3V0AC 4AEEA 4R90H 4P2QE 2ITDA 3QIBA 3OF6A 1ERNA 3WNLA 2B0SL 4R0LB 5SV3A 3A6OA 3U9PL 1GH7A 3CCHB 4P5KA 3DYMA 4ZFZA 1SJEB 4PY7B 4DEPB 4GG6A 4RQQA 2OL3L 1HSBA 4GBXA 5DHVA 3L3HB 1UM5L 1W2KT 4PJ8B 1N6VA 3QPXH 5T3ZE 5CMAA 2W9EL 1A14H 4HIXH 3WV0A 1H8NA 5F6HJ 3HR6A 5C09B 3KPOA 4D8PA 2OSLA 2W07A 4ZPTB 3RY5A 5FYJE 2EDBA 2UUDH 1MUJA 5BS0B 4YHIA 2JCCA 1AGDA 3V8CA 3WHE1 3G5VA 1CU4H 5KZCD 2NR6C 1OAUL 3V0WH 5EWIL 4HKJA 2VJXA 3IFLH 4MNQA 2D31B 3BPCA 1BZ9B 3C08H 2OS7A 4JN1L 2FJHB 2NY6B 3PHSA 1SMOA 4LSTL 2DYPD 5J3HC 4K9EH 4QGTA 3OKYA 4ETYA 3FFCE 3QRFM 4HJ0D 3E8UL 3SKNA 1FORL 3BUYB 5JO5A 4M48H 3KJ4C 2E9IA 1TJGL 4KJQD 3I3EA 3EHBC 5IVXF 5EIIB 3AGVA 3VXOA 3HMXA 4KDWA 3QCVL 1JPST 4MNGE 4JPWL 4NJ9H 5LGJB 3QDMA 1XGRA 4QXUH 5BRZA 4JAMB 4BSVA 3VDCA 4WTZG 2KBGA 1CT8B 2D0FA 3MBED 5DD1H 1P7QA 3LKOB 1AXSA 3Q6GH 1H3WM 1WF5A 3UTOA 5GS3A 1S8DB 5C2UB 2J5LC 4FFZH 1KTDA 5EUOE 1DQLH 5MEQA 1BX2A 2D7PA 2NY0B 1NFIA 4P57B 2UWEB 3EYOA 2NXZB 3TYFA 2JIXD 2CLRA 4OAWA 2CKBA 3GM0A 1TZGL 3QUZD 3IFPA 5H37H 1W72H 3WN5B 5IGXH 1R24B 3TO4D 5KJRL 3SGEI 3D3VB 1KPVB 2DMCA 4G7YL 4JKPH 1HILA 5HSFA 3LDBB 5BZDB 1IAMA 5C0BA 5HVGB 2GCYB 4XPFL 4APQC 4M7ZB 4NNPL 1DANT 3LS5L 2BC4B 4KMQA 5C0AD 3T2NH 3QG7H 1G7QB 3ZT5A 3QG6A 2C1OA 4YE4H 1A6VH 2OCFD 1RK1B 5FGCB 3U46A 2SEBA 3W0WB 4Q58C 1SBSH 4Q0XL 3FQUA 4GW5A 3VWKB 3D39B 5B3NA 4V1DE 5F9JB 1S5HB 1R3IH 4TVPE 1WCQA 1ONQA 1Y6NR 3ALWA 4P48A 1QFUL 3SDYL 4QTIH 4M6OL 4HUMB 3TBTB 3U4EB 3DUSA 4ZS7L 4ZAKC 5LCVH 4HQQL 3QUMB 3O4LE 5F7DA 2EYTB 4Y88A 3CH1A 2WINA 3UEZA 1G9ML 5FV1L 1MRDH 1MFCH 5TE7L 4FQ1L 5IR1A 3TP4A 2W65B 1SM3L 5CJ8A 3FOLA 5KOVC 4OGXL 1FZOA 3ULUF 3MRLA 5DK0B 5C2BH 2DQUH 4YDJA 2PYEB 3F6LA 1F2QA 3P9WB 5ICZA 4AIXA 4EIZC 2GTWA 4Z7OE 4K2UH 1A4JA 3MRDA 2Y1VA 4YXKH 3UBXI 2Q8BL 2W0FB 4OLUH 3MRRA 1CFVL 1RZKH 1NC4A 3GSXA 1S7UB 3T3ME 2V2TA 1JHLL 4DOHB 2X4SB 1MY5A 3AC0A 4CBPA 1V8HA 2R0WH 1IILE 2ORBH 4CN1A 4U1HA 1F02I 3PP4L 4OIAA 3CMGA 3P2TA 1QQDB 5GSVA 5E8EB 3Q3GB 1D9KD 1Z9OA 5HGDB 3AMKA 2PNDA 4PJFB 3STLA 1B4JH 4ELMA 5LQBL 3SOBL 1RUKL 1TMCB 3GHEL 5JOPE 2FO4A 1IGYA 1R3LB 1RY7B 4HUXA 3QFJA 4TSAH 3BESR 2ZJSH 4ZPVA 3VG0H 4OQTA 1RIVH 3BT2L 3RGHA 1HHHA 1FNEA 3ARRA 2OI9C 1CFQB 3LRHA 5C0JB 3GIZL 4APQA 3B9KB 4OZ4B 2WM0A 4YHKH 4O51B 1JNNL 1C5DB 2Y6SD 4NGHL 5IB5A 1Q8MA 3GSUB 4ZXBC 4UBDD 4JFFD 5C71A 4KQ4H 2HJKB 3NA9L 1CG9B 4Q9BA 5EUKB 3M45A 1EGJL 3BRGC 25C8L 4OD3H 2HN7A 3AY4C 4EN3C 2I60L 1Z0MA 4LAQH 2AW2A 4PTUB 3EBAA 3F5WB 3V5HB 2BSTA 2EDQA 3CMOL 3GSNA 2YPLA 1I4FB 2R2EA 3P4MA 2FATL 2BVOA 2YEZB 2P49B 2KZ1B 2A9ML 2N56A 2BSED 3IDYB 5EU6A 2ICEA 4F7MB 4ZAKA 3EO1B 5T3XE 4JRYB 2JJTC 4PJHE 4X6DF 1SVZA 3EO9H 5IMOB 3RHWK 3GBLA 1MFBL 2DWEA 2PR4H 2HG5A 2FDBP 4PTTB 2AK1H 1CFTB 3ZL4L 1G1YA 4AEHH 1H9VA 3RWHB 4KPHL 3GSOA 1MJ7L 4LSVL 4X6CE 5JIIA 4X4YB 3AS0A 4XBGB 5ISZE 5C0AE 4N0FA 4XHJD 5HVFB 1JWUA 3GUTB 3GHBL 1UWXH 4QXTA 4E41A 3H9HA 2X4UA 3FB7B 3HUJE 1I7RB 4MJIA 4HGWA 2VLJB 4XAKD 3B83A 1TPXB 2IADA 1K5NB 4MXQC 1X5IA 1T03H 1B4RA 3WFEH 4HFUL 3AS3A 3SKJL 4YX2H 1I8IA 1JRHL 2NY0D 1AXIB 5GISL 4WHTB 1A7QH 4F3FB 2HTKC 4O02L 3VXSD 2NXZD 3HRZA 5FF6B 2F54A 1WK0A 3GJEB 1MCPH 4PJDB 2ESVA 1VADB 4BH7B 3I2CL 4HXAH 5FO9A 2I9TA 1HNFA 3JWOL 4HKBB 5FGBC 3SGDH 4J6RL 2BVPA 5E94B 1HIML 1EO8H 2EDJA 4LDEB 5DZNA 5D72L 3D3VD 4KUZH 4ZNEE 2ZZUT 3BEWA 5HTSA 3BZDA 2IQ9H 5HDBE 4J12A 5FK9A 1EDQA 1GC1L 3IF1A 4FXGA 1BPVA 5BVJB 1QPPA 4ZSOA 2WIIB 1EAPA 5ICXB 1CBVH 3KPLB 4XT1C 5IB3B 4NO5B 3BRDA 4MWFA 5DJ2B 3LMJL 1WUNT 5AWNL 4ZXBA 3PP3H 3MRBA 5CP3A 3K8MA 4PRHA 4JR9H 4BZYA 3EGSB 3W0WD 1P84J 3UBXG 3I02A 3VWKD 2NY7L 3AY4A 1ETZB 4EN3A 4TSCL 2IJ0C 3RUGB 5I16A 2IANB 1PY4A 4I3RL 1IGTB 1T66C 3F6IA 1LDPH 3MXVL 4FTVD 4NKIL 1MJJB 1A6ZB 3KNBA 4RFEB 1JGUH 4GSDL 4CN4A 3AS2A 2M8XA 1SJXA 4J3OC 4JGMA 3UJTL 3I50H 4CVXA 2JJTA 4ONOA 2APBA 1KLFA 4CL7A 3L3JB 1I1YB 4JPKH 4MDJA 2FB4L 1Y0LA 3BUTA 5FV2A 3SKMA 1RZIA 1KCKA 4HXBH 4LSUL 1JVKA 4M8QA 5GS2H 3WKNA 1MQ8A 1A5FL 5D8JL 4LVNC 1YYLL 4NO0A 5EDXA 2CH8A 4TUJA 5EBMA 4I4WB 5CEYB 1B2WH 2DWDB 2PYED 4Y1AB 2H6PB 3X17A 4LRNL 3BIAX 5TF1H 4ONGH 1OD9A 4JG1L 2F5AH 3GMMA 4U4BA 2YA1A 4WW2F 3O9WB 5T1LB 4S1RH 1RULH 4GKOA 2GJ6B 1S7SB 2HWZH 3VJ6B 1RUQL 3D85A 4UOW1 3S3JA 2DI7A 3CFJB 3RVXD 2DIJA 3L7EA 2PW2B 1T22B 1LO0H 3FQRA 3BOVA 3HE7B 4N5EC 5FGBA 2PETA 3D18B 4K8RC 3ARDD 3VFOB 4W68A 1UEMA 4Z7UA 4ACPA 1YPZB 3ARQA 1IAIM 3CC5A 4J3SA 4OFDA 4MA1B 2XRAH 5KSAC 1EJOH 1TETL 5L2JB 3F7RA 3SPVB 1CD0A 3QXDB 5DC4B 2M1KA 4GAJH 1J12A 2QQLH 3UTSA 1NBZA 1Y18B 1MHHB 4XAKE 4AENB 1UXWA 3GZKA 1DBBL 3C09B 1KG0A 3CSBA 3BDBA 5TH2A 5GRXG 5FDWA 1A6WH 1G7LA 1E27B 5B4MC 2OXHA 5ANME 2UWEE 4UT9L 4NC2B 2Q6WA 5KVDL 3GMLB 4JHZA 2ADIA 4F58H 4H1LB 3PV6B 3CH8A 4OCLC 3NIFF 3OXRA 4M7LT 1KCVL 3MJ8A 1A4KA 4DKAA 2D9CA 4U1MA 1LK3H 1V7NL 3V5DB 5I0DA 2BCKB 3TIEA 5IJVB 5IB1B 1Q0XH 3TO2A 4FQQB 3O2DH 1WAAE 1X4YA 1FAIH 3KS0H 1BOGB 4JRYD 5SWQA 3RX7A 3S88L 2Z8VC 3DX9B 3D3VE 4KK6D 5EZIL 5L9DL 4FQLH 5EOQH 3S5LA 2OR8A 1YNTA 4I9WD 1ZT4B 4JFQA 5LG1A 3RIFK 3RWDB 4Z77A 1CS6A 4OV5B 3FZUC 4LKCA 3RVVC 1D5ZA 3K4ZA 4XP1L 4X80H 2Y36H 4KI5D 2COQA 4H20L 1IAKA 3KYMA 2V9RA 2H45A 5FGCE 3CFIC 1ZHBA 3TNNB 1MVFA 4UNUA 3QH3A 1A7NH 3W0WE 1CLZH 2Z8WC 2AJSH 2VLJD 3NCYP 5H94A 5DYOB 3HG1D 1RJYB 1JNLH 1ZMYA 2KQNA 3D39E 2AXHA 1NCUA 4FQ2L 2JELL 2OP4L 3WIHL 1MRFH 1UM4L 5KSBB 1IT9L 1OM3L 4URTB 2FX7L 5JIPA 3VW3L 1OHQA 3SEPA 1QACA 1OWRM 2VL5B 1UB5A 3QFDB 4MZ2A 2GJJA 5DQDH 1N26A 1FGVH 4MA3B 1N0LA 5A16A 3SN6N 5IFAL 5IQ9B 3ZKSD 5DD5H 5DZOA 5IWLC 4ETQA 5IBUG 4LEOB 3FO0H 1FZMB 4D9QD 2IFGA 4IM8A 4OD1L 5BV7C 4N68A 4JQVC 4L8BB 5CJ5A 5KSAA 2QQNL 2Z4QA 4MQXC 1MI5A 3MV9B 2R9HD 1LHZA 1F3JB 2HRPL 3I3DA 5A2KH 4OGZA 1DL7L 2PYEE 3T4YB 3QQ4B 1OPGL 3WNNA 2EE3A 1R3KA 2NNAA 4LCCB 4OFPA 3AROA 2D7NA 3TA3C 3WEXB 4PJGB 5BJTB 3BZFB 5T3ZL 2FD6L 2IPUK 5JW5B 2PCPB 4LARL 4DOHE 1ZKAA 3BW9A 5CP7B 4OGAD 5I1JL 3MA7A 1EFQA 5T1KB 4XGZB 1MOEA 3MLYL 3RVTD 5F97E 3ZYZA 1H8OA 3QRGL 2YKLL 1OAKH 1MCOL 3O41A 2CQVA 1G7JB 5DFVD 1MHPL 4EVNB 5B38B 3P9LA 4AL8L 1HHIA 3IS1X 3BKYH 4N0YH 1BIHA 4XCCL 4RCAA 4G6KH 2YD1A 2VDML 4AEIL 4KK8C 1CE1H 1HYRC 4LOUD 4OF7A 3LS4H 2E9BA 5T33H 5EIQA 4XMPH 4PRIB 4W70A 5DC0A 5J1TC 4Q7DA 2ATPA 2Q3ZA 1CDJA 2J7LA 2VKWA 3D9AH 3IJSA 2C7UB 1IFHL 3R0MA 3CGTA 2C1PA 4JFDB 4PJ7F 2P43B 4ALAH 2H3NA 4XP4H 4D3CL 1FV1A 1Q9WA 4Y1AD 2B1AH 2EYRA 2FNBA 2QHRL 3VA6A 5HJ3B 3RZCD 3CFCH 4XVJL 4Y2DB 5IM7B 3ALXA 2HFGH 5T1LD 3OAYH 3QR2A 4NOBA 1BJMA 4ZUUB 1JYWA 1OQXA 4PV8B 4PP2A 4KJPD 3NIGE 4ZFGL 5EORH 4FP8L 2BNRB 4ZFZB 1CDHA 4YFDB 3GBMH 5DVOA 1UQSA 2A77H 1JE6A 1VGEL 4M02A 3DGGA 2MFNA 4JRYE 4HAFA 4QXGH 5F9OL 4RQQB 1HSBB 4GRWF 4GBXB 5EH1A 5DR5H 1B9ZA 5IWLA 2UZIH 5CWSA 4M62H 5IB2A 4I9WE 5CMAB 1DBJH 4PRPA 3GJFH 4LLDA 4OZIB 3KPOB 4JQVA 1U58B 2Y07L 4JB9H 2V7HA 1EUTA 1Z3GL 2PF6A 3QUYC 2A73A 3QCTH 1HZHH 4PLKD 5LAXB 1I8LC 5DJ0B 4LPYA 1W8OA 2Z31D 3P0VH 2VLJE 4M3JA 3BPCB 5I74B 3HG1E 3MRIA 4IRSB 3TA3A 3G9AB 2XTJC 3T0VA 1HWGB 1QLFA 2R0KH 2HMIC 1XZ0A 5I1KL 2RGSA 3T77A 1OGTA 3BH8A 3ILPA 3KYNB 4G8EA 3SKNB 2XTLA 4C54A 5M94B 2LVEA 4I0KA 4PJDE 3ZT6A 1CD1B 5EU5A 4XCEA 3L95B 3OJ2C 3VXOB 5DS8B 5EBLB 3S36H 4U3HA 4P3CL 4ZG1A 3KJ6H 1IM3A 2LTQC 1XGRB 5CILH 1KULA 1P4BL 3MROA 3KHQA 4JJ5B 1JPFA 5I71C 1MCHA 1BJ1H 1OAYL 1TQBC 1WQVT 4WO4B 4BSVB 4NCC2 4Z7NE 3STZA 5D1XB 1P7QB 2K1MA 4GG6F 1JGDA 4BZ2L 3K2UH 3BD3A 1ZTXH 5HY9A 5I30H 3DHMA 4HT1H 1IQWH 1U8OA 1NFIB 2DQCH 2O26U 2J3SA 4N9GB 1ZVHA 1AR2A 3EYOB 4PJBF 1YDPB 3HI6H 1AXTL 4X5WB 3BO8B 2JCCF 3C8KB 5JNYB 4OCXL 1FSKC 2CLRB 1BGXH 1WFNA 2CKBB 3MRCB 2HP4A 3TZVC 4ODUA 1KC5L 7FABH 1WIPA 1HQRB 4C55A 4BQ6A 4G42B 5E70A 3RUGE 1PX3A 3E2HC 1H0DB 1HWHB 4TTGA 2IANE 1YECL 4MB3A 5GGQH 2O93L 2VTFA 3JWDL 4U6VL 1URLA 3H42H 4I2XA 4YXHL 3T1WA 1UKTA 1KB5A 3X13A 3DTXA 5E99H 4KRNA 1BQSA 2XPGA 4LLMA 1UZ6E 2QSQA 5ITFA 2OK0H 1UCBH 4JFPA 3K74B 3Q5YA 2VL4A 1MCJA 1N0XH 4O2CB 1Q9LB 1YYML 2QKIB 3PQYA 2QJDA 4Y5XC 2E9JA 2SEBB 5KTEL 3T08A 1PJ9A 4G8IA 4JO1L 1Q9OA 1I75A 1KEMH 4CMHB 3QUYA 3MV9D 3JV0A 4GW5B 3MNWA 3IVKA 4JZNA 2R39A 3MACH 3RJDA 1JZ2A 1MWAH 3GO1L 3LKSA 1I8LA 4POZD 1PSKH 4Y1AE 4G9FA 3SGEH 1M1SA 2EE9A 1EMTL 3G6JF 4LVOC 5DHXB 1S7XA 3EYQD 2ICWI 1CGYA 2HKHL 5EZJB 2GJ6E 1JPSL 3B8YA 2F15A 1MFEL 1FL6B 1CI5A 1MVUB 4WUUB 3CXDH 3W9DA 4ERSL 1NBYB 43C9B 1MCQA 5IR1B 1OAQH 2XZCL 4HC1L 2CUIA 4JKMA 3FOLB 4KY1L 5E2WL 4D0BA 1V5JA 1YPZE 4NQTA 3QQ3A 1EEZA 2IBBA 4KRLB 3STBA 4YDJB 1NCDL 4HJJH 4YBQC 5ICZB 4TRPH 2NY4C 5KAQF 2GTWB 4DW2L 5HHVL 4FRWA 3SKUD 2UZYB 1A6AA 4N0RA 4GS7C 1ZGLA 1P53A 4Q74A 5K33A 3ES6A 1X6NA 3VXRA 2J5LB 5D96C 4HPYH 1F4YH 4KXZH 3AUVA 3IDJA 3ARYA 3IETA 1XGYL 3MODH 4CUCA 4JFDD 4U1HB 1V05A 5J7CC 4QNPE 4TQEH 1KELH 4NN5C 1YEHH 1G0DA 4Y4HC 3VFUA 5CHNA 3STLB 3TZVA 4ELMB 2D7MA 3S37L 1A7OH 4Y2DD 1SY6A 1JGEA 1NJ9A 4HUXB 4LCWA 4RRPG 1CL7L 3OAUL 4A6YH 4YGVB 1OGAB 3WFDH 4CMMA 1EEUA 1TITA 4QCIA 2BNRD 2R1WB 1NKOA 3GMQA 3KLSA 5DJ6B 5DDHB 1I9JH 3FCTA 5E95B 2R2HA 4RIRA 4YHOL 1ZLWH 1Z0NA 1SVCP 5FA3A 5IB5B 1NCWL 3MRNB 2VN7A 1FLRL 5I1LB 4Y5XA 1HDMB 4IEFB 5GSRA 4UB0H 1AH1A 5JHDB 2PO6C 2NY3B 2MTPA 1IBGL 2HN7B 2P5EA 3Q48A 1T04B 5D70H 1UA6L 3O6KL 4P23C 2E6JA 5AYUH 1NGQL 2AV7A 1L4IA 3KPSD 4PJIB 2VDRH 2YPLB 3P4MB 2IH1A 4NQXA 1BBJA 1KN4H 4U6HA 4IRSD 3K3QA 5EN2B 1E6JL 2ICEB 5F44A 4K71C 1RUAL 5IOPA 4RMWA 4XPHH 4JCLA 5F89A 1KB9J 1T4KB 4ZOCA 1RZJL 5GJTH 1ADQH 1JP5A 2R0ZH 3ULVF 1T2QH 5E0QA 1A2YA 5AAMA 4ORZC 3VCLB 3WD5H 1MEXL 3GSQA 3KLDA 1JWUB 2VLKA 3QCUH 4OD2A 3AAZA 3QDJA 4WO4D 3IGAB 4QXTB 3S4SG 4E41B 4TPRL 2BVQA 5D1XD 3BE1L 3OR6A 4X83A 1K8DA 2YMXL 2N4IA 3MV9E 4EIGB 1DCLA 2V5RA 1RUPH 5BVPL 1NH6A 1INQA 4Y8AA 5SX4H 3MYJB 1I8IB 1R5VB 1RFDL 3QWQB 4NRXA 5I19H 5DWUH 3BVNA 5FYKH 5SWSB 1KLUB 1PZ5B 4MXVE 1L0QA 1YC8A 1SYSB 3IRPX 3C2AH 5I9QB 4PJGE 4S1DC 4DVRH 5FO9B 4Y4HA 4HSQA 4ELKB 1FH5L 4PJCA 3TPUB 1HCVA 1C5CL 4JFXA 3C6LB 4QTHA 1H3XA 5FOJA 4LVHC 1S7RB 5DEZA 4RAVA 3UPRA 2MKLC 5INCB 2VITB 4TULL 1UWGH 4KVCL 5FK9B 4E42B 3RY4A 2P7TA 3IF1B 3QUXB 2QSTA 4P4KC 3LCYA 2ZPKH 5F7YC 3QZWG 3BYTA 1A9BA 5D4QA 3FTGB 4XP6L 5ID0B 4P46C 1NAMB 2X70A 3ARBB 4PRIE 3IFNH 1A1NA 5BQ7B 2NY1B 4M4PA 2A6KA 1RHHA 2PO6A 5IVNA 4OFIA 4NQVA 1IM9B 3JZ7A 5HI3C 2OL3A 4JFDE 4EN3B 4YPGB 3WFBL 3EJJX 5I16B 3OKKA 4N8CH 5J6GB 4KI1A 2MQCA 5KAQG 3KHOA 2HT2C 3EJYD 2DN7A 2YC1B 2DDQL 1DVFC 2CK2A 3GB7A 4XWGH 1N5YH 4K23L 3KNBB 1BFVH 5HI4D 3T0ED 1OAZL 1QP1A 5HHNB 3H3PL 3OB8A 3VFSB 4QHKI 3VFNB 5IJKC 4MAUL 1V3LA 4O5LH 4KU1A 1REIA 4WUUD 2AV1A 2BNRE 4FFVC 5DSCA 2G5RA 2EECA 4MDJB 3SJVB 3SKMB 1OCWH 1J1OL 5D2LA 4UV7L 3CUPB 2ZKHH 4M8QB 5ILTL 1NANI 5I8EA 2NY5L 3DSFL 4HJGB 3UZVB 1MREL 4TUJB 5EBMB 2LFGA 4OZIE 2CIKB 1AGBA 4M1GH 5KVFL 4NBXB 5ICYB 2VZTA 2QL1A 1FRGL 4WV1C 3WLBB 43CAA 3QXAA 2YPVL 5DQJB 4OM0L 3ZDZE 4HCRL 1FG2B 3GMMB 3EYUH 2ZUQC 4DN3L 4PJ9C 1CIDA 1FCGA 3N85L 5I1IH 3LPFA 4ZQKA 4G8GA 1WBZB 3D85B 2NZ9D 4NIKB 4YHML 1LWRA 2FBOJ 2VC2H 3G04B 4Q6YA 1CXFA 1JMXA 4PLJD 3TN0B 4MLIA 1WV7T 1PG7X 4FZ8H 3C5ZD 3PGDA 4R4BB 5HYJD 2CGRL 4R26L 5JW3H 4POUB 1OGAD 1K3ZA 1AHWB 2QHLA 5DT1L 5DJZA 5HYEA 1QO3A 1SEQH 2VQUA 5L6YH 4XMLH 3RFZC 3LZFH 4IRZH 4P4KA 4XRCA 4MHHI 4M6MH 1KXVC 2BNQA 2WANA 2JJUA 2MQ0A 2H32B 4P46A 1UXWB 1LO3L 3E6FA 4NKQB 3QUML 5IK3B 3QDGA 1KG0B 1RJLA 5MEPB 1Y6MR 4ZFOB 1G7LB 5JHDD 2NY3D 3LN5A 5HHPA 4OLYL 1QYGL 4WEBH 1U3HB 4F7CA 4YWGH 5HDQL 3D0VA 5JUEH 1BBDH 5TE6H 3TV3L 3HZKA 3MBXH 3MUGB 2O5ZL 2V2XA 1DFBL 5EBWB 5FKPB 1DVFA 3CLEL 4K3JH 4KHTL 3DUUB 3FMGL 3S96B 4PGDA 2WAHA 4M43L 3VFVA 4F7TB 1QZ1A 3EFFA 5H35A 5IJKA 5SWQB 4NDMB 1KJ2L 1QFWL 3BHBB 4HGKC 2BHYA 4P5TC 2B2XL 2X4NA 3IRZA 3S5LB 4JFQB 4AH2B 2X4RA 1GOFA 3QNXA 2A6DA 1IQDB 2R56H 4XPAH 3QO0A 1D5ZB 3MUZ1 3SDXF 3U7AA 2Y06L 4LVNB 2HKFH 2HH0H 3KYMB 5D9SA 3UJJH 1F6AB 2FECI 2NW2A 1ZHBB 1CK0L 3CDGA 2DMKA 4XVUD 3QH3B 4RWYL 1TCRB 5IW1B 5E08L 3BZEB 3O8XC 1JV5A 1FHGA 5JW4Q 2D03H 5AEAA 4WV1A 4R2GC 1Q94B 1K4CB 2V17L 1LK2A 1R3JB 1T2XA 2XG5A 3WBDA 3TESA 3HFML 4G7VL 3CVHH 4PJ9A 3VXMA 1GGBH 1KEGL 1SJVA 4ZTPH 5SWSD 1G6RL 1J05A 1ZGLM 1CWVA 3DJ9A 3WNPA 4OB5L 5HHMB 1P84K 4B41A 2ZNXA 15C8H 2ZSWA 4HH9B 4R90L 5A16B 1GIGH 3OKLA 4WUUE 3C6LD 1I7ZB 1JZ8A 3SKOB 1X4XA 1ITBB 3VI4E 1AC6A 3H3KA 5F9WC 4YFLF 3RNQA 3MJ7A 2DJUA 2Z4QB 2ENSA 3TH2T 1QSZA 4NM4H 1L0YA 5DURB 2CUHA 3QUXD 1RIUH 1VGKB 4LMQE 4YFLI 3QPXL 4XX1G 2ADJA 4LLQB 4YC2C 3TCXA 2EEDA 4H26A 1A14L 3ARBD 4HIXL 1T1WA 2VAAB 4NZTH 2NNAB 4NN6B 1NMAL 2EEBA 4X6DB 1EZVY 5K9QI 1BOYA 4M7LL 3B9AA 2NY1D 1GC1C 3QPQC 3UZEA 1LDSA 3C60C 3RVUD 3BW9B 1CU4L 1IM9D 1QA9A 3PWUB 2YK1L 3CK0H 4GXVH 3HI1B 4FQJH 3C08L 1CLOL 3O41B 1GGCH 4K9EL 2B7DT 1I3RB 2Q7YA 5KW9H 4P2RD 1KXQE 1EGJA 4WFED 1QSEB 3QEQB 4LCYB 1DQDH 5IHUH 1GZPA 1OGAE 5IMKA 4M48L 1JCKA 1N64L 4G8FB 3V5KA 4P5TA 3WHXB 3SJVD 4LSPH 2FL5B 4Z0XA 4PB0H 2VXUH 4ORGB 1BZQK 1CLCA 1VEOA 3REVA 1NL0L 5FM5M 4AJ0A 1VERA 4NJ9L 4S1SH 5CEXB 5TDNA 4QXUL 3QHFH 4MHHG 4NKOB 1QLRB 3BQUC 4YK4B 2DQFA 2PYFB 4KWUA 1CGTA 5DD1L 5DRXA 4WI3A 5JHDE 1FV1B 3Q6GL 4GLRI 4U1JB 1FZJA 1P4IH 3SDDB 3O8XA 1A3RH 1XIWD 4YDKH 2IBZX 1DQQB 4FFZL 5ADPL 1HEZA 1JHTA 5FYJU 4PJIE 3ROOA 2YPLE 1IL1B 3LKPB 4U0RB 3MRJA 5L2KB 3MJ9A 2GQHA 2DTSA 4AMKH 4IRJC 3U30B 2F8XC 1DBAL 4X9BA 3TN0D 4QT5A 1FNSH 4P5MB 1U95A 1W72L 2X41A 5EC1A 1KTRL 5IGXL 1LO4H 1CICC 4UZGA 5BW7C 5IB2B 2B5IC 3JV6A 4PRPB 3L5WA 5DMGC 2V7HB 5C92A 4HUUB 4JKPL 1UVQA 4Y4KB 2VXTH 3O81A 1WEJH 2ITCB 5CFHA 5I8CA 3WLWC 5EO0A 1X9QA 4E41E 1A6PA 5J6HB 3T2NL 2J8UA 4YE4L 1A6VL 1BVKB 1CDIA 1ORQB 4W4OC 5JDSA 1A7RH 2E6QA 2PW1A 1HHJB 4C56D 3VA2C 3WNOA 1S9WA 4PYGA 3KYKH 2GEEA 3T77B 1SBSL 3LHPH 3RWJA 3ILPB 4PJAF 3C60A 2XIDA 5SWSE 3WKMH 3RWIA 1AD9A 1U3HD 3CFEB 3W81A 1R3IL 2EDEA 1WBXA 1EBPA 2GT9A 5GGSA 4NCC1 2P42B 4QTIL 3FQNA 1T7VA 4EJ1C 4FFYL 3EZJB 3ULUD 4P9MH 1MCSA 4CVZA 4GRWH 5F7KC 4ENED 1KJMA 5JORA 5LCVL 1DUYA 1JPFB 1PQZB 1OP5K 3B9EA 4PB9H 3V79C 1MLCA 3STZB 1D5MA 2RB8A 2OYPA 5IEHB 4UTBH 5E9DB 1G6VK 5D7JC 2CLVA 1LNUA 1D5IH 2VISA 1I8MA 1MRDL 1MFCL 2HLAA 3B2VH 5HY9B 2EDLA 3IYLW 4Q2ZA 2P5WB 3BP5A 2Z35A 5C2BL 2MCG1 2DQUL 3DPBA 5I76B 4N9OB 3QISA 5MHSD 4J7RA 1U8JB 3BQUA 1VFAB 1L7TH 3LKNA 5E24E 1S78D 2EYSB 4K2UL 4ODUB 2E27L 2EXYD 5IVXE 4OLUL 3DWTA 4Y16B 5K9QG 4XBEH 4WHYH 3GIVA 5LWYL 4NZDA 3P4OA 2IPKA 4KH2A 4QYOA 2R0WL 2AGJH 3IDNB 1KB5B 1YMMA 3EIFA 4Z9KB 1PW3A 1LEIA 1Q0YH 2XPGB 2OTUA 1BEYH 4WFEE 4IRJA 1B4JL 2OX5A 5HHMD 2R8SH 4FG6C 4X7TB 5E2VH 4JPIA 1IKNC 3SJVE 3ZDYE 4TSAL 1CICA 2FEEL 5BW7A 3VG0L 4YHYC 1RIVL 5DHVH 3QJHA 2RQ8A 1Q9OB 3QUYB 2G5BB 4RGMB 5FYKD 5DURD 3MNWB 3U2SA 5D93C 3DX6B 1K6QH 2BRQA 4YHKL 1HINH 2WWMD 1Q9KA 1NC2B 1Z6JT 1J1XH 4GQ9H 4OIIL 3VFRA 5DMIL 4KQ4L 4W4OA 2MHAB 3L9RB 1XH3B 1S7XB 3LV3A 3PWVA 4WEMB 5HYQB 4FQIH 1HN1A 4PV9B 5C0FA 1NBQA 3ARGC 1CGVA 3BWAA 1GGUA 4NUGH 1LP9F 2GSIA 4HMCA 1QSED 1P1ZA 1TLKA 2DLIA 2FGZA 3QEQD 4UT7L 3EO9L 3T0BA 5I71B 3HMXH 1OVZA 1TQBB 5C07A 3LQAC 2XNAB 4JQIH 1C5BL 2PR4L 2J6EA 2DKUA 2AK1L 3JXAA 4HWBH 5D7JA 4AEHL 4F37F 1X44A 2AJVH 4N1CA 2HFEA 5FUZH 1EJ6A 3RWEA 4MS8D 1OLZA 2G2RA 3IDJB 2Q8AL 2B4CH 4HUVB 2XWTA 3RVWC 5GZND 3RU8H 3HB3C 3OKEB 4C56E 3O6MH 5DUBA 1FVCB 3RBSA 3LRSA 1FSKB 2ZUXA 2AJUH 3TZVB 5AD0B 1JZ7A 3SDDD 4CU7A 5IB4A 1T03L 3WFEL 4Q6IC 4J4PD 3KPNA 4YX2L 1T1ZB 1KTLB 1FL5B 6FABH 1EEQA 4ZYKB 1JZ5A 1IAIH 3GEWB 4LCWB 4KTDH 5JR1H 1QSFB 3FB6A 1NCAH 4HK0A 4QCIB 3SCMC 1CQYA 2CSPA 3WCYA 5L2KD 2D7QA 1R5IB 5K9KA 2C26A 5FUOL 5C3LD 1LE9A 3FCTB 1DLFH 3REWB 4R96B 5D2NB 3J8F7 3WFHB 1ZGLP 3WIHA 3D87B 2Q1EA 3BKJH 5E2UH 1IKNA 1EO8L 4I18C 2DKMA 1F5WA 1RUMH 1ZANH 1E0OB 3ISWA 5GSRB 4KUZL 3SE8L 1BZ7A 4MZ3A 3MUJA 5IG7B 1XR9B 4Y4KD 1QOKA 1ZLUH 5MHSE 4MA7H 4V2BA 1AI1H 1GRWA 1W0VA 2BNUA 4QRUB 4BZ1H 1CBVL 4YDIH 2AV7B 1H3UA 5TF0A 4P2QA 4NQXB 1JYXA 1BBJB 1XEDA 3DMMC 2QEJA 4U6HB 1S3KL 2HVJA 1KT2A 3KPRB 1MHEB 2VLMD 3IS0X 1NEZG 1NCTA 4MYWB 3G6DH 5ESQA 3P0GB 1F11A 4KDTC 4LF3A 1JNHA 3FFDA 1DANU 4OLWL 3UTZA 2J8HA 1IC1A 4JM2F 1LDPL 2FIKB 3ARGA 5HHME 1KACB 1JGUL 3I6GA 1J8HB 3MRGB 1A2YB 3IKCB 4PJ7B 4HWEL 3MR9A 2J1KA 3TVMC 1IEBB 3HHRB 3I50L 3WIIL 2F8VA 4NBYB 4JPKL 4DAGH 5E9DD 1KSRA 3TH4T 1QRNB 3M17B 1K8DB 3OR6B 4HXBL 3HZYB 4F33A 1KTKE 4ODTL 5DXWA 1INQB 3PABA 1F6FB 3QB7C 4NRXB 4OZHF 3TBSA 2P5WD 4OF6A 1H3TA 1EBAA 2GTZA 3FAXA 1B2WL 3FFCA 4X6DE 4NN5B 3L1OL 4M93C 4Y4HB 1AJ7H 1TVHB 4HGMA 1FDLH 1U8LA 5TF1L 4ONGL 1MFNA 4PJCB 2F5AL 3QUKA 5FGRA 4OLEA 1NSNH 4Q6IA 4Y16D 1CE6A 1AO7A 1IARB 1RULL 2Y5EA 4S1RL 1OY3B 1K8IA 3B9DA 3RPIB 2HWZL 4RAVB 1WZ1H 4RISL 1DQJA 3G6AB 4MB4A 4X98A 3UPRB 3SCMA 2ZUYA 1B0GB 4MDIB 5GIRB 2Y4SA 1LO0L 5JPMA 1QSEE 3M1BA 3QEQE 3UXFA 1RSFA 4MB5A 4PD4K 3ILQD 5DHYB 3OWEA 3L5JA 2Z0BA 1A9BB 2CLZB 5FO7B 3OHXA 4R3SA 4XH2A 2X70B 1L9MA 3MV7B 4NQEA 4I18A 4QHLB 4QLRA 4LRIC 1YUHB 5EUOA 2XRAL 4HS3A 2VMFA 3MRQA 1A1NB 1U8IA 3BSZH 2A6KB 2PO6B 4S2SA 2AQ1A 3FRUA 4IDLA 4GAJL 4LPUA 2OL3B 4M7JH 2QQLL 1YEEH 1QKZL 3NN8A 4HJ0C 3VU2A 1TENA 2HRLA 1NC2D 3V7AE 1DQML 3FOMB 5AZEH 3MUHL 4DCQA 4KJQC 1RI8A 4KJWD 3DMMA 4TOYH 5FO8A 2CPCA 3GSNH 1OP3K 4K71B 1KBGH 1VFMA 4JFYA 5L2KE 4F58L 2AV1B 3NCYS 4KDTA 5CBAB 5D2LB 1WCBA 5IFJB 3MBEC 1UJ3B 1YN7A 1LK3L 1PX4A 5I8EB 2JTDA 4PJBB 4MD4A 2CDFA 5BCAA 3RA7H 5I1DB 3TVMA 4ODXA 3O2DL 1FAIL 4PRPE 4YLQT 1BVLB 2LE9A 2CO7B 2E5EA 4FQLL 3C5SB 5EOQL 3S34L 4V1DA 43CAB 4QRSA 3VGGA 2GYSA 3BP7B 3FQWA 4X80L 2Y36L 3QUZC 1U93A 1S9XB 4WFFD 3NBNA 2L7UA 4G8GB 3RBGA 5DK2B 5HYSB 3TO4C 3QNYA 2AK4D 4XXDB 4KMLB 1A7NL 1CLZL 1CTNA 3DRQA 3GM8A 4DTGH 2VLME 1JNLL 1G7IA 3TC9A 4AIZA 4NHCH 3IDIA 1DP0A 2UY6A 2VDPH 1MRFL 2K3TA 3FT4B 4L29B 1VHPA 2DQEH 1QSFD 1BFSA 1I3VA 5DJZB 1ZA6B 4GKSB 1VACB 2O5XH 2EC9T 3CDYA 5DQDL 1FGVL 2F5BH 4RFNB 4HX1A 3TT3L 1MHCA 4MVBD 5DD5L 2BNQB 4EUPA 5E9DE 3PWNA 3FO0L 1KB9K 1X5HA 2HFTA 3E6FB 4MXWH 5GRJH 4LRIA 3VXUD 1UEYA 2HFFB 4D9LH 2P5WE 2EIEA 4M6NH 3DVGA 1A7PH 1JGVH 4HV8A 2DYPA 3VFWA 5B39A 3HZMA 1C08A 1T0MA 3OR7A 2FZ3A 4LEXH 1JPGA 1BVZA 4UU9B 1KLGA 5GZOD 4K3HA 1DVFB 1FZKA 3LKQB 4Q9QH 1BFOA 3MRPB 4L3CB 5DD6B 3B6SA 3PGFH 3KPRD 2YD2A 5H35B 5JXED 2X1XR 1OW0C 2Q7NA 2NMSA 3TT1H 4H8WL 3KG5A 1HOCA 4M5ZH 2DBLH 3IFOB 1AGCA 3MBEA 3QNXB 3VGHA 4Z6AT 2FIRT 1J8HD 3QO0B 1Q38A 4N0YL 4OF5A 2XZAL 2FBJH 4QHMA 3Q6FA 1U3ZA 4Z7WF 4M5YH 4G6KL 5D9SB 5I73B 4B50A 2HTLD 3TPKA 2NW2B 1BM3H 3I75A 1CE1L 3LS4L 1AGFB 1JV5B 2FGWH 3AB0B 3BAEL 1QRND 5IEKB 4XMPL 5T33L 4KZEH 4GRMA 3NIFE 4Z5RA 1D9KC 3BXNA 1LK2B 2JIXA 3ULSA 4HC1A 4WDIA 4RBPH 3D9AL 3QUZA 4HHAB 4PJ9B 4EQ3A 2H9GB 4LIQE 1J05B 3ZKMC 1OTUD 1YNLH 4ALAL 5CINH 5I0ZA 3TO4A 1N59A 3MCKA 2D2OA 2B1AL 2FHBA 4R0LC 3X11A 2BXYA 4PJHA 8CGTA 2G9HA 1UZ8A 2EKSA 5JIHA 3CFCL 3ZTNH 1F3RB 5I1EL 1DSFH 1ES0A 4UAOC 4QRPD 4RGND 4DEPC 5F7UA 3LVEA 5M7QA 3B43A 2HFGL 1IJ9A 3D2UB 4HULB 1QEWA 2JB6B 4X6CA 2Y7QA 4F8QA 1J0KA 2Y6SC 5TPWH 5EORL 5C0AA 3VRLF 3O45A 5GS1C 3GBML 1YY8A 2A77L 4UBDC 1FBIH 4QXGL 3ZTJG 2P45B 1Q1JH 5DR5L 2EDFA 3FT2A 3I6KB 2UZIL 2R69H 3CNKA 4M62L 2NZIA 5HVWA 4H26B 5EO9A 1DBJL 4XCNB 4Y8DC 1T1WB 3LN4A 1CF8H 4JB9L 1XF3B 4G6MH 3QCTL 1HZHL 4BH8B 1EEYB 4JPVL 3ARTA 3KLAB 4NC1E 4RZCA 2F19H 3AU1A 3P0VL 1C16B 1KJVA 3CZFA 4JY4B 2R0KL 2P8LA 4MQTB 2Q7YB 1T5XB 4KKLD 2DTMH 4YNYA 3BD4A 3P11H 3QT2A 1JF1A 5F7HA 4XHJC 1QSFE 1OW0A 3PF2A 4UT6H 4Y4FB 3V5KB 4P5TB 3MRKA 3WUWB 1A1OA 4Z0XB 1I7TA 1OQOA 3VFMA 5DLMH 3S36L 5D2NE 3KJ6L 5TJWK 5KG9A 1NMCC 2XA8H 2OR9H 5CILL 2BSRB 2WUBL 3HMWH 2YRZA 1T5WB 3UYPA 4QRRD 3GI9L 2NY0C 4GMTH 4OCYL 3FRPG 2DRUA 2NXZC 4E5XA 1C12A 3K2UL 4R2GB 1ZTXL 4AYFA 1D9KA 2WP3T 1BJ1J 5I30L 2NY5C 3DX7B 4HT1L 2X4PB 1IQWL 2DQCL 1JHTB 3MLZL 5FYLD 4DZ8A 4RWHA 3NACH 3HI6L 2I07B 4Z7VF 5J0BA 4P9HH 2CDGA 1BGXL 4YHLH 3KPRE 4R0LA 5GQBA 7FABL 1FC2D 4GRLB 1LQSR 4QT5B 3D69B 1JWMA 4LDOB 3PNWB 1YNKH 5HBBA 2X9WA 1XFPA 1SJEA 2OLDA 5GGQL 1E4KC 3JV6B 2R0LH 1MIMH 3H42L 1J0YA 3L5WB 4X7SH 2FWOB 2D9QB 5F9WB 4Z7QE 3L3HA 3QWRD 5E99L 1J8HE 3NA4A 1T7WA 4K8RH 5GS1A 4PJ7E 5TDOB 2OK0L 3MUY1 1UCBL 1YQVH 4JFFA 5L88H 5I8CB 4HZLB 2NLJA 4ZPTA 1N0XL 1RQ5A 3UTPD 1BAFH 4P2OB 3VWKC 2J8UB 1A0QH 1AY1H 3MRMA 1QRNE 3D48R 2W38A 3BISA 4WTXA 1CFSB 4NPYB 1Z9MA 3QA3A 4MA8H 5DVLA 1S9WB 4D0DB 5HPMA 3KYAA 2D31A 1KEML 4DZBB 3RWJB 5ACZB 2FJHA 5HHOB 3RWIB 1WTGT 3MACL 1U3YA 1F90H 2YA2A 1I1AB 1PSKL 4BFGA 5C08D 4HIIB 4ZFFA 2C3WA 3R1GL 5IHBA 4KQ3H 3NGBC 1NGPH 2GT9B 3BUYA 3U9UA 4NRYB 1DUZB 1X5GA 4PJCE 5ACLA 1TNNA 4QRPE 4CVZB 2XFXA 4RGNE 2F53B 5EIIA 1KJMB 5JORB 4PBXA 1EIBA 4P0DA 4TNVF 4K94L 1MLCB 3CXDL 1PLGH 5LGJA 5GHWH 1MFDH 4K7FB 1HH6B 1NDGA 1CN4A 2VISB 2VWEC 3OXSA 3HNTH 3IAQA 4N1EA 4KUCF 1OAQL 4HF5H 1U91B 2NTFB 2X4TA 3LKOA 5CSZA 4Z0BH 4C59B 2OQJB 1V7ML 2Z35B 3MV7E 4HJJL 3QXVA 1UENA 4TRPL 1NGYB 4P57A 5ANMA 2ATKB 3VXSA 3H7BA 3RVXC 3ZDXF 1DN0A 1I1CA 2DB8A 1F4YL 3X3FH 5DRZB 4XNYL 4R4ND 1BQHG 3PJSA 3ARDC 5ALCL 1YMMB 3VFGH 4PBVC 1R24A 4TQEL 1KELL 1YEHL 2OTUB 5BZWA 1WAAA 4IRJB 2VXQH 3WDJA 4OFVA 1WITA 3D3VA 4HCRA 3TBVA 1U0QA 4M8VA 4ZFOL 1A7OL 4JPIB 3R4DA 3NTCH 1QBAA 5BZDA 1CICB 1E4KA 3D2UD 2C5DC 3I84A 5D2LE 2UUDK 5J56B 4NO3B 12E8H 3WO4B 2XYCA 3HR5A 3QQ9D 3QP3A 4PJBE 4OLXH 1RK1A 1I9JL 5I66B 3ULUL 4UDTB 3GGWB 4XNQB 5BV7H 2DM2A 3SQOH 3W0WA 1Q9KB 4GW1B 3N1FC 3VWKA 4NO2B 5F9JA 2YRLA 5MP6H 1S5HA 2L4OA 5CKAA 5E2TH 5HGGS 1IGFH 1MNUH 4FTVA 2G60H 5FYLE 1IKFH 1FE8H 5CSBA 4G8GE 5D70L 1RJCA 2IG2H 5I8OL 4J1UB 1KXTB 3V95A 3ULVD 3SDXB 2VDRL 3BWAB 4KK6C 3QUMA 1I7UB 3MLSL 5F88B 4EI6B 2CK0H 2GSIB 4JN2B 1QFHA 5DRNA 1OTSD 5C07B 4XPHL 4APQD 1F4AA 4Y4FD 3MOQA 5DK0A 5GJTL 1ADQL 2R0ZL 2HFEB 4B5EA 2PYEA 1IZKA 2YBRA 5CLTA 1SMAA 1T2QL 2BNQE 5F1OB 3G6JE 3WD5L 1TPXC 2BRRH 2CMRH 4FMFA 2W0FA 3DV4B 1OSPH 1KJ2A 3OZ9H 3QCUL 2WZPD 1ZEAH 4P4RA 1S7UA 2A1WH 1JHKH 5FHAH 2GSGB 5GRUH 1RUPL 3TF7C 2DOCA 5E8EA 3Q3GA 5HGDA 5J4MA 4MCYB 1GHFH 3DNKA 5I19L 4WHCA 5FYKL 2I9LB 2E8YA 2DAVA 3ARDA 3FB6B 4DVRL 1MLBB 3MA9H 5K9KB 4JY5H 5FXCH 2IGFL 5EA0H 2CRYA 3HLAA 4G6FB 3RPKA 3G5XB 1CFQA 5F7FA 2R9HC 4KTYA 1ZWIB 1JIBA 3IKKA 4GUPB 4OZ4A 4O51A 2JB5H 1C5DA 1BZ7B 1UWGL 4DFIA 2I25N 2DD8H 5E8OB 5TE4H 2ZPKL 5CUSH 2ZCHH 4J3TA 1G84A 4WHDA 5D93B 3WUZA 2BNUB 4TSBH 3VWJB 5EUKA 4P2OD 4OGAC 5IMMB 4J3UA 4OCSH 2CXKA 3RIAF 3EAKA 4PTUA 3IFNL 3F5WA 1K2DB 5AUMB 4Q97A 3IXAB 2HVJB 4L5FH 1KT2B 2GI7A 3T4AB 1KCUH 1I4FA 5DFVC 3BD5A 5HHOD 5ESQB 1JL8A 2YEZA 4N8CL 1JNHB 1Z5LB 1I1AD 1PG7H 4F7MA 3EO1A 3UTZB 4JRYA 2MMXA 3HS0B 2ZNWA 3ARGB 1MPAH 3T0DA 1UC6A 1N5YL 4KHXH 1BFVL 4LOUC 4X7CC 1JTTA 1CFTA 4OUUA 2BFVH 5MEOA 1C8PA 2F53D 4N8VG 3MR9B 3RWHA 2CKNA 3Q2CA 4O5LL 4XBGA 4BUGA 5I6XC 1OCWL 2CR3A 4LKXA 2DQGH 4XWOD 1IE5A 4LQFH 3UZQA 4ZXBD 3PABB 2VLJA 1QUNA 3RZCC 2XG4A 3HG1A 1J86A 3V4VH 4X8XA 3H0TB 4ODSH 5L8LB 3FFCB 1G7PB 1TFHA 2YWYA 4WHTA 4F3FA 4KJPC 1U8LB 3ZKQD 1QBMH 4ZO8A 1WFUA 5FF6A 4UINH 1X5FA 3GJEA 3H6JA 4H88L 4IOFD 4Q6IB 4BH7A 3PHOB 1AO7B 4EXKA 1NAKH 1FC1A 3PWPB 5I1IL 3ULVE 4HKBA 4J23A 1M7DB 4ZD3H 5A43C 4X98B 3TIDB 1FFQA 1GPOH 5JPMB 5TFSH 3RKPA 4MA1C 1BWWA 1CGUA 2N7BA 3I6LD 1XR8A 4H0HB 4FZ8L 4X7EC 4CNIB 3OHXB 1J88A 4XH2B 3ZKND 1BD2D 4PLKC 4NQEB 4NO0D 2DICA 3ETBF 5JW3L 2WIIA 4NNXA 5T1MA 3TYGH 2Z31C 3KPLA 1U8IB 5IB3A 1SEQL 5L6YL 3C09C 5DJ2A 1B6UA 4XMLL 4IRZL 2F74A 1QR4A 1XF1A 1E4JA 1W72A 4M6ML 3WFZA 4MD0A 3NN8B 3EGSA 1FLTX 2WWKT 4WI5A 4E0RB 3GMPA 4DCQB 2ZCKL 1U8KB 4NJAL 3SE9H 3DMMB 2RFXB 5FO8B 1IGTA 4S0SD 4GKZA 1HHGB 2OR7A 3EFDH 1MJJA 1A6ZA 3L3GB 4YWGL 5JUEL 1BBDL 5TE6L 2VIRB 2X7LA 2XQBL 4CGTA 1PVHA 3A6CL 1WCBB 4F57H 2WBJB 4K3JL 2RCSH 3L3JA 1I1YA 3O3BB 3T2PA 4JHBA 4MD4B 1UWXK 4L3AA 1GXEA 3QNZB 4X4ZA 3S3PA 3H2WA 5KVEH 3SDAB 4M9PA 1T0NB 4L9LB 2GW5A 5C0EB 1LD9B 4I5BA 2IBGA 2AERT 3T1FB 4I4WA 4JLRB 5CEZH 2DWDA 1JFQH 1MJUH 2R56L 4XPAL 4Y1AA 2H6PA 5I1GH 3BGMB 4IDJH 1FYHB 3WE6A 2J8UE 5EUOF 3RZCA 3TBYB 1CTOA 3ARVA 1M7XA 4QXWA 1KNOA 2EH8H 1PEWA 5T1LA 4AM0B 1KGCD 3LB6C 3MCLH 4IMKC 4M93B 3VJ6A 2ARJQ 2D03L 1N6QL 5HHOE 2WK2A 3IB4A 2VLLB 3ZTJH 5DJAA 3CVHL 1KCLA 3FHAA 5AAWA 1GGBL 3NCFB 4DN4L 4ZTPL 1T80A 4U49A 3VGAC 2A0LD 2A2QT 4O9HH 3VFOA 4LIQL 2F53E 4XVTH 4MMXC 1WJ3A 2XKSA 3DBXB 3FQXB 3G5YB 4Z95H 4HIHB 4OFYD 15C8L 2WBKA 3CU1A 1E28B 3S35X 5L2JA 4UDUB 3SPVA 3UPAA 1CGXA 4P3WA 3PWNB 5CJOH 3QXDA 4F2MA 2GUOB 3M07A 4POZC 1Y18A 2Z31A 2C3GA 1MHHA 2ZUVA 4JKKA 4KROB 4NM4L 4AENA 1T20B 4LCCC 3H9SD 5F71A 3A6BL 5J12C 1RIUL 3U9PH 3EYQC 3T8XB 3VWJD 1C08B 1JPGB 4NP4H 5ESAB 3O6FB 1KLGB 1LP9B 4NZTL 1CFBA 5FKAB 1BFOB 3PV6A 1HNGA 4FZEL 5BOPA 1D7FA 1ULVA 4M1DH 1YN6A 4HKZB 4RDQF 5CZVH 4OBRA 1YMME 5IW3A 4KK5D 3V5DA 5D7IA 1HOCB 3CK0L 2J2ZA 4GXVL 4N5ED 5IJVA 5IB1A 4FQQA 4FQJL 5CJBA 3U0WH 3I6LE 3DX9A 2NYYD 4MCZB 1MAKA 1GGCL 3EOTH 5KW9L 5ADOL 1F97A 1BD2E 2YD8A 3Q6FB 5LXGL 3RWDA 1DQDL 3OPZH 5IHUL 1L6XA 2W92A 4OV5A 2ZOLB 4LSTH 1KIRB 2UY7A 4LSPL 4XI5D 4PB0L 2VXUL 3CFKB 5H2BA 4Z5RB 4O2EB 2D4DA 1A6TB 4S1SL 3QUZB 2QV2A 4L8SC 3QHFL 2UV3A 4OCRL 5DYOA 1RJYA 4ZUWA 3Q5TA 5HD8D 2NXYD 4Y2DC 5B4MD 2AXJA 3T3MF 1N3NB 2OJZH 4JPWH 1G0XA 4IMKA 1A3RL 3OQ3B 1UZ8B 4Y2OA 1CDUA 2AKRB 1JZ3A 4NNYB 3QFDA 1QEWB 2JLLA 2H8PA 4MA3A 3PWPD 4X6CB 3SDXE 3C87A 1T1YB 5IQ9A 3GK8L 5LGKA 5C0AB 3F58H 4LEOA 4LK4A 4AMKL 5C0RH 4JGUA 4WY7H 1FZMA 5FHBH 4U7SA 5ERWA 4O4YH 1FNSL 4L8BA 1XGPB 4BK5A 5C07E 2LAGB 2AXGB 3MGOB 3FT2B 3MV9A 4U1KA 5KANI 1TZGH 3EDKA 1F3JA 2W60A 4GAYA 3LN4B 3T4YA 3QQ4A 2X1PA 5I74C 5KJRH 1S7VB 2FLBT 4K3EH 4YEEA 4U31A 2VXTL 4IRSC 4LCCA 1WEJL 3WEXA 1VSCA 3BDYH 4JM2B 4MJ5B 4PJGA 5BJTA 3BZFA 3T0AA 2PXYD 5IT2L 3AU1B 1KGCE 4LLYB 2R1XB 5CP7A 1A7RL 3CZFB 4WW1B 4NM8H 1J0HA 3V0VB 3L3KB 4IJ3C 4HIEA 1C7TA 3WKML 1I1FB 4YNYB 4PJ5B 4U2ZA 4EVNA 1JF1B 5B38A 5KN5B 4JM4L 4EXPX 1MQKL 3NCMA 1IVLA 5DD0L 3KLHD 3MRKB 1A1OB 4WO4C 4W81A 3VFMB 2WBJD 5FOBB 5D1XC 4Y5YB 4P9ML 3IT8D 1A9EA 3EDFA 1I1RA 1BLNB 1MRCH 2DLFL 4PJEB 3OB0H 1EUUA 1QFUH 3UP1A 4JRXD 5I18H 2OTWB 1NUDA 1UKQA 3SDAD 1LO5B 4UTBL 3MO1B 1D5IL 4JFDA 4HQQH 3HUJF 1C12B 3TBWB 3B2VL 1D9KB 3D1MC 3ZO0A 2VZ1A 1P2CB 3UAJD 3O2WH 1LVEA 4L8SA 5HJ3A 4DZ8B 1B90A 5TE7H 4Y2DA 5IM7A 1L7TL 1SM3H 2CDGB 4ZUUA 2LV4A 1ZHNA 4PV8A 1JWMB 4XCFH 2BNRA 1XGUA 3DURB 4M4RA 4WJ5B 4XBEL 4UAOB 1ZS8A 1X5ZA 4NRZB 3MRHB 2AGJL 1Q0YL 3GMNB 5GS1B 1BEYL 3NFSL 4HUWA 4W6WB 3FN3A 5LVEA 4JFFB 4OZIA 2R8SL 1ZXQA 4RDQG 1ZLSH 3NZHH 5E2VL 1U58A 5JHLH 2NLJB 3H3BC 1T3FB 4CMHC 4ODVL 4RMRA 2E8ZA 4DGYH 3TH3T 1S7WB 3MRMB 5CJQH 4UIKH 5MERB 5LAXA 1FVEA 5DJ0A 2ED7A 3QA3B 3EJYC 4OTXL 5HPMB 3KPSA 4KROD 1E4XI 1HXMB 4WFHD 5HI4C 4YBHA 4XP9H 4IRSA 3T0EC 4ZUSA 1K6QL 4POYA 1HINL 4IHOA 4ZFFB 5IKCA 2QSVA 3KYNA 1J1XL 4R6UA 3O6FD 4GQ9L 3U9UB 8FABB 1O7SA 4OLZH 4JG0L 4EUPG 1JI2A 1CD1A 2XFXB 3NPZB 3L95A 1AO7E 5IF0B 3PWPE 5DS8A 2YD5A 1WZMA 2OM5A 4PRNB 2D0HA 5EBLA 4LPTA 3VXQB 1BP3B 2X5PA 4LCUB 4JJ5A 3VH8A 5FYLL 1NDGB 2C4FU 2MPAH 4WO4A 2I60H 3OXSB 1DQTA 4U2YA 3K2MC 5A2LH 5D1XA 3S9DB 2X4TB 5CSZB 4NUGL 1NMCB 1D6EA 3QDAA 4RMQA 5CCKH 3NABH 3MLXH 4NQEE 1XT5A 4J3VA 4R8WH 3HMXL 2CD0A 4L8DA 4H8WC 4PJAE 4JQIL 2A9MH 5ANMB 4HWBL 4N9GA 1ZVSB 4LASH 2AJVL 2NZ9C 3SO3C 2VO5A 3H7BB 3VXSB 1YDPA 1DN0B 4YQXH 3OAYK 4X5WA 2IF7A 3BO8A 3C8KA 4M00A 3TNMB 5JNYA 5FUZL 4J2XA 5EOCH 1II4E 3MRCA 2H2PD 5DZLA 3O2DA 2B4CL 3T65B 3V4UH 1HQRA 3PJSB 5JZ7D 3MZGB 4GJTB 4LHUG 4G42A 3RU8L 3C5ZC 3O6ML 1H0DA 5BZWB 4WI9A 3CVIL 2AJUL 1UXSB 5AYQA 4OZGB 1BHGA 2ICWJ 2EDDA 3U7WH 2EDOA 2X9YA 3MJ9H 3TBVB 1IGCH 4PGBA 3W39B 3WL9A 4PJXF 1IAIL 3HNVH 2PTVA 3O6LH 4KTDL 5JR1L 5C6WH 4L3ED 4O2CA 1Q9LA 1NCAL 3HR5B 3N1GC 4HFUH 2QKIA 4P2YA 2VE6B 1F8TH 4NWTH 3BPLB 1DLFL 2NY3C 2BDNL 1AC0A 3BJ91 3HNSH 5E2UL 4YAQA 1RUML 2WIMA 1ZANL 3SE3C 1F13A 4U6YA 4JZJB 2EDTA 1HIMH 4FTVB 4OZFB 3F12A 3T0EA 1OLLA 1AI1L 1CXIA 4JM2D 1G9NC 1DEEB 1KENH 4LQ1A 4BZ1L 2UWEF 5EZJA 4YDIL 3NGBB 2AEPH 1FL6A 1MVUA 4WUUA 1VA9A 4NKMB 2DJSA 3QIUD 1NBYA 2A9NH 43C9A 2VDKH 2ZOKB 5DRNB 3WNKA 3G6DL 3W82A 4PJ5D 4Z8FH 3QWOB 4DJMA 4X7FC 1YJDH 3DX8B 2NY7H 4UQ3A 4YHNB 2YBRB 2HAZA 4PS4L 5D7SH 2CO6B 2DIBA 1FN4B 2H41A 2VDLH 4NKIH 2OXGA 1KJ2B 2DKSA 4F9PC 4P4RB 3RGVB 2AI0H 3VMOA 4DAGL 3X12B 5EULV 3UJTH 1DBML 3R0NA 4WFHE 1KN2L 5I9QC 3GSVA 1TVBB 2Q76B 5DRWB 3B3IB 2Z93B 3BPOC 3FJTA 5B8CC 4OSUL 1CR9L 1LP9E 3C6LC 4LSUH 3ARDB 3UYRH 2NQCA 3C5ZA 3INUH 4GQPH 1AJ7L 1MELA 1VKXB 4YGVA 1OGAA 4FFWD 3RTQD 2WW8A 3HLAB 1BQHB 3GMOB 2R1WA 5KVGH 3QUXC 2ED8A 2DI8A 4K55A 3K4DA 5DJ6A 5DDHA 5KSVB 4JHAH 1G6RB 1WZ1L 3LQMA 5E7FA 1AP2B 5A40E 3ARBC 5SV4A 3MRNA 3ULVL 3KPMB 2IQAB 4DKEH 4YXLH 1JZ6A 5I1LA 3U6RB 1HDMA 1HH9B 2NY1C 2C3VB 4I0CC 4U0QB 5JHDA 1U8NB 3RVUC 4ODHH 5SX5H 3IJHB 1BF8A 1T04A 3SE3A 3JUYA 2W91A 3NH7H 4ZDHB 4ZOAA 3BSZL 1ED3B 2WV3A 3LY6A 3RL2A 3O3AB 4PJIA 5J13C 3UDWC 4OIBA 4JY6B 5DJXB 3ABZA 3BRFA 2V5MA 4M7JL 1YEEL 3MNVB 5FM4A 1IEHA 4GAFB 2BVYA 5EN2A 3BKMH 5A2IH 5ABDE 4NYLB 3CLFH 4PJFF 4ODBD 4TOYL 4OUUB 5MEOB 1T4KA 5FM5O 2OMNA 4LNRA 2EDKA 2C9AA 3GSNL 1QFPA 1DBBH 4L3EE 1KBGL 4PREB 3ZSSA 3VCLA 1X5YA 1Y6KR 3NCJH 4LKXB 3MFGB 4YO0B 2YZ8A 5GS0H 3FB8B 2IAMB 3IGAA 2BERA 4BELD 1XIWC 2J6EH 3HG1B 4PBWD 2GAZA 4K94C 4DQOH 3MYJA 2IC2A 1R5VA 1HE7A 4F9PA 2HJFB 3JV5A 3GFUA 4MAYB 5DJYB 1KLUA 3MOAH 1PZ5A 5SWSA 4P23D 3SO5A 2Q87A 2MNUA 1SYSA 3C9NA 2VERN 1H15A 5L0QC 5B3JF 3TN0C 2KDGA 5B8CA 1ORSB 4WVRA 4ELKA 4CADA 5CIPH 3TPUA 1S9VB 3C6LA 4CRPA 1ZK9A 1S7RA 3K0WA 2DS4A 4DTGL 3PWJB 4DKFL 1AHWC 1IZJA 2M26A 1XR8B 4PJ5E 4QHKJ 5F8RC 2VITA 3LOWA 5INCA 1G7MB 2BY2A 3BEVB 4E42A 2VDPL 1OP5H 3QUXA 3VRJB 3EKCA 4NNXB 5E5RB 5T1MB 4HLZG 3FTGA 4NSKB 2DQEL 5ID0A 1FFRA 3BWUC 2JELH 3WIHH 1NAMA 2O5XL 3ARBA 3BN9D 4PJEE 5HDOA 2F5BL 2F74B 1OM3H 2EH7H 1W72B 1YC7A 5BQ7A 3MV11 4MD0B 4YFEA 4CU8A 1MCKA 2ZUUA 4HDIA 4BQBA 5JPNB 1C1EH 2E6PA 1EPFA 1U3HC 1IM9A 3RKDD 5IVXA 3GMPB 4YPGA 4MXWL 1HQ4A 4UV4H 5J6GA 1MCDA 1YEGH 4BFEA 4D9LL 2YC1A 1R3HB 4GKZB 3ULUC 1JGVL 3DVIA 3UDWA 3QI9B 4X0KA 1AQKH 4ENEC 5CGMA 4P2RA 5HHNA 4LEXL 3RDTD 3VFSA 4ODWB 2X7LB 1OP9A 3L3OB 3OKMA 4IMLB 5E6ZA 3VFNA 5IIEA 4NQCD 4PJDF 4M61B 4Q9QL 3SJVA 2VAJA 1JGLH 2E7CA 1NUNB 3PGFL 3CUPA 3DO7A 2YOCA 4XNUL 3TT1L 3KR3H 4M5ZL 4HJGA 5T3ZH 4Z7NF 4NWUL 4JGJA 4I5BB 4YDLB 5I6XB 2DBLL 1QNZH 2Z91B 2BOCB 4JFFE 4P46D 2CIKA 4KFZC 2MQ3A 5FYJH 1S78C 3LQAH 4ESKA 4OT1H 1E6OL 1X5JA 2EXYC 2FBJL 5ICYA 3DSNA 1XIWA 3WLBA 4JREB 2WUCL 3WE6B 3RZCB 3QRGH 5JOFA 5DQJA 3FKUS 2FJGB 1FG2A 1BM3L 3TWCL 1KNOB 3UCRA 4AL8H 3AM8C 3RGVD 4EI5B 3LEXB 2FGWL 1H3PH 4KZEL 1WBZA 3QULA 2VDMH 4XP5H 4FQXD 3G04A 5DJAB 3TN0A 1MIEL 2EO9A 3LKRB 2BVEA 3RUGF 5DI8A 4I8DA 1YNLL 1WIOA 5C0CD 5C1MB 5BMFH 3PL6D 4R4BA 4JFEB 1MAML 3ZTNL 1AHWA 1KIPB 1UZ6F 1DSFL 1JPTH 2VABB 3E3QE 1UGNA 1J9CT 5GGRB 4F2MB 3UTTB 5JA8B 2FECL 2WWMC 5TPWL 2Z31B 4X6EB 4XVJH 5LBSL 1LMKA 4WI4A 2H32A 1QSVA 2X2YA 3OJMB 3WXVH 3RI5K 5IK3A 5INDB 4NN6C 5MEPA 4C56A 4HWZB 4ZFOA 1FGNL 1OT2A 2DQTH 3V6ZB 2FEDD 5M95B 3HAEG 1U3HA 3VXSE 1BREA 4XVSH 3P0YH 1CF8L 3MUGA 5EBWA 5FKPA 4G6ML 3TFKC 2J88H 4HK3J 3H7LA 1YN6B 1T7ZA 2QR0B 3UBXA 5K9JH 5EPMB 3DUUA 4J8RB 3S96A 2LAAA 5D7IB 1JYVA 3N0PB 5DUPH 3NPSB 1RVFH 2AJYL 4KDVA 4F7TA 4HZAA 3OKOA 5EC2B 1B0RB 4ZOBA 4NDMA 1NLDH 4OZGE 3LAFA 2XZZA 3MX0A 4NHUA 1F2XK 3BHBA 4EDWH 2R2BB 5D5MF 2DTML 1XF2B 4AH2A 3GSRA 3GKZA 4QEGA 1IQDA 2DL9A 5ACMA 4MS8C 3N1PC 2APTA 1YPZF 1UT9A 3IXTA 5D1QB 3BDXA 5GZNC 2FX8H 1F6AA 5H2BB 4YK4C 4FA8A 3MRFB 4KGLA 4NFBA 2AAVA 2IAMD 5DLML 3WFCL 2E7LC 1TCRA 5DTFB 5IW1A 1ITCA 3PG2A 3SDDC 3BZEA 2XA8L 2OR9L 1TTFA 3H9ZA 4ZUWB 1Q94A 4J4PC 1K4CA 1R3JA 4TVPH 1T21B 1RIHH 3AM8A 1P4BH 4FTVE 4MAYD 4U0RC 1ACYH 1CDCA 1ADQA 5E6IB 3OJDB 2DQDH 3K1DA 4PR5A 5J57B 4FQPA 3OKNB 3U30C 2H8PB 4HH9A 2X6MA 4NQCE 5T5NF 3VGAB 4CN6A 3NACL 1OOAA 1I7ZA 1NGXB 2YD4A 4WU5A 4P9HL 3SKOA 1NMBH 4O2FB 4YHLL 3CD4A 3DVNB 3JUZA 2W0PA 5ERWB 2L7JA 1YNKL 1AXTH 3WIFB 4IS6B 1JI1A 4Y4KC 4U1KB 2P8MB 2R0LL 5KS9F 1N5AB 4PYHA 4X7SL 1P4LA 2W60B 4P49A 2H26B 1GOGA 2VWEE 4GAYB 1VGKA 3LQZB 3OX8A 4NBZB 1Z9SA 4LLQA 4EUPH 4K8RL 4XB7A 2GJZB 2FX9H 4J3XA 1YQVL 2B8OT 2VAAA 3GRWH 4YXHH 5L88L 4XTRD 1OAXH 1R0AH 3RL1B 3WXWH 5J12B 4X6DA 3B5HA 3FONB 1BAFL 1EO5A 2CRZA 2BVTA 3HCVB 5TQ0L 1UYWH 1A0QL 1AY1L 4FNLH 4AY0A 4S1QL 3NCCB 3V7MA 3P30L 4N8PA 1IGJB 3PWUA 4MA8L 3HI1A 1M6OB 4HIEB 4HMDA 3MC0A 3VRLE 1F42A 2EC9U 2DL2A 3QXTA 3QI9D 1F90L 4Y7MA 3S36X 3HC3H 1L6ZA 4NQDB 3U7YL 1I3RA 2DMBA 5MEND 3MXWL 1JYNA 1AFVL 5EG6C 1QSEA 5KSBF 3RRQA 3QEQA 2VLRB 1J10A 4L4VB 4LCYA 1NGPL 1HKLH 3QEGH 1M4KA 4D2NA 1A9EB 4G8FA 2AEQH 3WHXA 1YEJL 4M1CD 4WW2C 2FL5A 1YEFH 4ORGA 1LEGA 1CCZA 3W11D 5K59F 3G5ZB 5GHWL 5CEXA 1MFDL 1QHOA 2HKHH 3E1F1 3SGJC 1JPSH 1QLRA 4NKOA 5JQ6L 1TZHB 3MV8D 4K3DH 1X5XA 2PKDA 2PYFA 3EYFB 3W2DH 2X4OB 4Z0BL 2E7LA 4U1JA 1KYOK 3SDDA 2GY7B 2A74B 5A2JH 4L8SB 2WNGA 3ARWA 1DQQA 4LLVA 4Y16C 4J4PA 2X10A 2EC8A 5DFTA 2MJWA 3ARUA 4MXVF 3TCLA 4EI5D 3MGTB 1ZHNB 3T0WA 1IL1A 3LKPA 4RX4D 5IVZB 5TGBB 5L2KA 4BUHA 3RWCB 1XGUB 3MLVH 1ZS8B 3WS6C 1OP3H 3X3FL 1I9IH 3DETD 5T3XH 3ILQC 4WENB 4P5MA 3BP6B 1NFKA 2ZUWA 4F15B 4U1LA 3DI2B 2W9DH 2IBZY 5I1CH 4JFED 4HUWB 2VXQL 1CZ8H 4FQHB 2BMKB 1MCWM 4NKDB 4HUUA 4KI5E 1SJHB 3NTCL 4N1HB 4RGMC 4TTDD 3Q5OA 4Y4KA 5D7LB 2ITCA 3UTTD 5TDPB 12E8L 1FVEB 1NFDB 2O5YH 3OTTA 4PGCA 1U8PB 5J6HA 4OLXL 3KPSB 1BVKA 1ORQA 3OAUH 1ZAGA 4KJWC 1HHJA 1ZA3B 4ZS6D 4ZUSB 2K7QA 3BJLA 5BV7L 3SQOL 1YY9D 4IHOB 5IKCB 1XF5B 5MP6L 3CFEA 4HFWA 1MCCA 5E2TL 1IGFL 3PHQA 1MNUL 2B1HH 2FRGP 1MH5B 2X89D 4IJ3B 3L6FA 4IOSD 3BPNB 1IKFL 1FE8L 1FLRH 3T0XA 3PE9A 2IG2L 4I3SH 3PWLB 3VH8B 1ZOXA 4D9QE 1H5BB 1PQZA 2CK0L 5IEHA 4NT6B 3QXWA 5E9DA 1J0ZA 1VB9A 5DMGD 1J0IA 1D6EB 1E4XH 4WW2A 3E6HA 3OG6B 3UTQB 4L8DB 5T5NG 4H1LG 1X3DA 1FO0H 3O3EB 4X4ME 2P5WA 4I0PD 1DDHB 4OZIF 5D1QD 5I76A 5DA0B 4NC1C 3SGJA 1U8JA 1VFAA 2EYSA 3ZDZF 2BRRL 2H2SD 2CMRL 5LJYH 1OSPL 3OZ9L 4Y16A 1BWMA 1ZEAL 4AQ1B 2A1WL 1JHKL 5FHAL 4CW1A 5GRUL 1WWAX 3IDNA 3MOBH 1WFOA 1GCFA 5CS7A 5E6ID 5C0GA 4PGBB 3WL9B 1FFNA 2V7NA 4GW4B 3WS6A 3BE1H 5EFIA 2BY3A 2GITA 4X7TA 4MVBC 5DQ9B 3N9GH 5D2NC 4BQ8A 5DO2D 5GS0D 1KIQA 1NUFA 3K1KC 3IDXL 3HE6B 4NZRH 4WCYH 1GZQB 4JY5L 1RZFL 2ZSVB 3P9MA 2VZVA 4U1GB 5I17B 3ZDXE 1HHKA 3L5XL 2G5BA 4YAQB 1N4XL 2G75B 1FH5H 3DX6A 4FOMA 2YUWA 4U6YB 1NC2A 4M7KL 5GZOC 2YHGA 3LEVH 5TE4L 2Z8RA 3F12B 1M7IB 2ZCHL 2MHAA 3L9RA 3T0EB 1XH3A 2FYYA 4TSBL 3C8HA 3WSQH 3R06A 5FEBA 5JXEC 2K7PA 2XA3A 4OCSL 3DYPA 5HYQA 4PV9A 3AREB 4X5XA 3NAAH 1OSZB 1FPTL 3GMRB 2C3HA 3EDEA 1EO7A 2OJEA 2AQ3A 2XKNA 4LAJH 4NQDD 4S0TD 5DMKB 3P4NA 4PRBB 4JFEE 2HTLC 3BKCL 4L4VD 2VLRD 1L0XA 2EO1A 1MPAL 4UQ3B 4KHXL 2XNAA 5BOZG 2R1YA 2BFVL 3WDIA 5HYIA 3RZWA 3UTTE 1IEAB 2IH3B 3D25A 5GGTA 1DBKH 3ARPA 4EQ2A 2DM3A 2YPKB 1OTUC 4AT6B 4HUVA 2FHFA 2DQGL 3SO3B 1F3DH 3GSVB 1EV2E 3OKEA 2AK4A 4LQFL 3D5OF 4YZFE 3ZE0E 4AG4H 2BVUA 1FVCA 1PG7W 4KKCD 4QHNA 5AD0A 4UV7H 3V4VL 5E8NB 1INDH 4RGNC 1G9EA 1T1ZA 1KTLA 4ODSL 4HLZH 1FL5A 3C5ZB 5ILTH 4ZYKA 5HYJB 1LILA 1RZGB 2HA1A 1EFXB 5DJCB 4UINL 1QSFA 3OG4B 4FQCL 4MQ7B 5D7IE 4HS8H 5GS2D 2DQJH 1NAKL 1R5IA 4LSQH 3FQTA 4X8JA 5ELIA 2J8OA 4ZD3L 2I5YL 4WHYG 3REWA 3FO1B 4OM0H 4R96A 5D2NA 5J06A 4HCRH 2VXVH 3WFHA 1NQBA 2EIZA 1GPOL 3S8WA 3N85H 1U41A 5TFSL 5ID1B 3OAZH 3VXUA 2X09A 4DKDC 2FSEA 4YHMH 1X6LA 1IGMH 5A3ID 2EDHA 5IG7A 1XR9A 4BJLA 2XN9B 1QVOA 5D7LD 3TYGL 3MLWH 1GGTA 3I3BA 4QRUA 2BXZA 4C83B 4JDVB 3RL2B 3BZ4B 4F7PB 4R26H 4G43B 4LMQI 1S5IH 3EYSH 2QLVB 4KKLC 4U1NA 2XQYG 3KPRA 2YD6A 1MHEA 2DLHA 5JXEA 5K93A 3GJFB 3FN9A 5F1NA 3U4AA 4G80A 1TTUA 4YR6A 2KH2B 4ELMF 2FIKA 1QBLH 4LNRB 1UJ3C 4HEME 4G3YH 4KAQH 1J8HA 3MRGA 4X9GA 3IKCA 4PJ7A 3S35H 3RWGA 1N8ZA 1IEBA 4UTAH 4A2LA 3PDDA 4F57L 2RCSL 3PDOB 2VXSH 1HI6B 3FHQA 1QRNA 3M17A 5JW4R 5F7LB 3HZYA 2GAZB 4X99B 1TJHH 5KVEL 2FJFB 1J0JA 2AJXH 3TM6A 1JMZA 4M43H 5B21A 1D5BB 4TVSa 2HJLB 3FL7A 5AZ2H 3C9NB 4OM1H 5CEZL 4CJ1A 2FLRT 3VD3A 1MJUL 1H15B 4JQXC 5I1GL 5IFHH 3CX5J 3CSYB 1TVHA 3BPOB 3F7QA 4IDJL 5B8CB 4CADB 5EU7C 5HPOA 4QRPA 3FO9B 2EH8L 1OB1B 1OWWA 1QLEH 2DJ4A 2X9XA 2E7HA 3Q1SH 3MCLL 4PJIF 3RPIA 1UJTA 4MNHB 3G6AA 3N06B 3X14B 4JVUA 4MDIA 1B0GA 5GIRA 5LGHL 4NQDE 4UQ2A 2EEAA 4GH7B 3VXTB 5E08H 4L4VE 2VLRE 4RFNC 3HAEH 5J9PA 4O9HL 5DHYA 4CDGC 3MLRH 2CLZA 1TIUA 3V6OE 5FO7A 1WTLA 1U2HA 3HFMH 3HE6D 3MV7A 4G7VH 4QHLA 4Z95L 1YUHA 3I85A 4LSRH 2Q3AA 1HSAB 4HDIB 3P40A 1FG9C 5CJOL 5IVXB 1HQ4B 1H3VA 1JTOA 3ZHDA 3RJQB 3V9FA 5ESVB 5GGSY 4JVPA 4DGVH 1JF6A 2V2WB 4B7IA 3FOMA 5J13B 3CSPA 1RAMA 4X0KB 3O4LD 1ZSDB 1EVTC 3B4NA 4NQSA 4P2RB 5TQ2H 3ZT7A 3Q0HA 4NP4L 3OKMB 1JUFA 2VZUA 5IIEB 1A3LH 5FDYA 1V3MA 3FO2B 4LVEA 1F58L 5E1AA 3ARED 1HK6A 5CBAA 2JF1A 4E9LA 3ARFB 5IFJA 3BMVA 4M1DL 5CZVL 1F4XH 3DO7B 1UJ3A 5GGRY 1F6LL 1FNGB 1MWAB 1NMAH 4PJBA 2R4RH 3DXAB 2CRMA 2GIYA 4M7LH 2GFBA 5I1DA 2QBWA 5I73C 4JANB 3MNZA 2AJZB 3U0WL 3AMLA 1BVLA 4Y89A 4QRRA 1DE4A 3LIZH 3C5SA 2APXA 2EICA 2YK1H 3AB0C 3EOTL 1RU9L 1XIWB 1G9MC 1ZLVK 4HPOL 5JOFB 5D7LE 2BZDA 3OPZL 3BP7A 1CLOH 1NFDE 1I8KB 2XZQL 1RZ8A 3S4SA 4R4NC 1O5DT 3KPSE 1S9XA 5I75B 4PJXB 4U6TA 5DK2A 5HYSA 3QULB 4GXUM 3PXHA 3NIDF 1N64H 2HYMA 4HBQA 4XXDA 5E1HB 3X3GH 5JOPD 5L0QB 4JQXA 4L4TB 3QHZH 4G5ZH 5DI8B 2UVEA 5E4EB 1NL0H 2OJZL 5J11B 4HWBA 5MI0C 3FT4A 1EFXD 3QQ9C 3QXUA 4L29A 3QWRA 2Z8SA 4R7DA 4YH6A 1HXYB 1DR9A 1ZA6A 4LHUD 4GKSA 3DRTB 1VACA 2ICWA 3DIFA 1AKJB 2OZ4L 4OV6F 3ZKXB 1JF5A 1A3QA 5GRVL 3ZDYF 5ADPH 3G6JA 2PTTB 3F58L 2AQ2A 2R23B 5C0RL 4WY7L 1K85A 5FHBL 3MCG1 4O4YL 4C56B 4R4FH 2HFFA 3QZWA 4WWKB 3IU4H 3LH2L 4NUJA 4K7PX 1ZHKB 1TJIH 2VDNH 4A6YB 3L3DA 1DBAH 2XN9D 4ZUTB 3H8NA 4BKLA 5C0IB 5C08A 1EHNA 3O3UN 4NQUA