2X89D

Structure of the beta2_microglobulin involved in amyloidogenesis
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
92
structure length
92
Chain Sequence
MIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY
publication title Atomic Structure of a Nanobody-Trapped Domain-Swapped Dimer of an Amyloidogenic {Beta}2-Microglobulin Variant.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Immune system
total genus 8
structure length 92
sequence length 92
chains with identical sequence E, F, G
ec nomenclature
pdb deposition date 2010-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x89D00
5FHBH 2LABA 1JK8A 3TO4D 4AZ8A 3Q6GH 3FO0L 4ZQKB 3WNMA 3ZHKA 4QXTB 3TFKC 4KI5E 1QA9A 4JHBA 5EFIA 4D8PA 3DO7A 4WTZG 1IC7L 1YNTA 5C0EB 2DYPB 1NCTA 4ZNEA 4J23A 4KKBD 4Y5VA 3W2DH 3C6LA 1M4KA 4XCFL 2BC4B 2J3SA 4JO4L 3U7WL 1EBAA 2QSTA 4L3EB 4CVZB 2VXTH 1JRHI 4P57A 4P2OA 5I1EH 3IAPA 3E6HA 2EDHA 1MRCH 1FORH 3LQAH 2PW2A 3V0VA 2VISB 5TPWL 3VWKB 4PB9L 4YFEA 4YFDB 1UH3A 3BOVA 5EU7C 2AK1L 2GFBB 3ZE1F 1KF9B 1FJ1B 5EN2B 1QVOA 2FRGP 2RQ8A 4JGUA 1T6WA 1FGNL 2XV6B 4ZPVA 3OAYK 1NGQL 3I6GB 1GC1L 1QD0A 1GGBH 1KCLA 4Z7VF 3KJ6L 4DKFH 4BM7A 5BJTB 5DQJA 3UJJH 2DWEB 1J8HB 2D4FA 2NZIA 2J8UE 1TJGH 2JELL 4FNLL 4OM1L 3TYGH 4Z7WB 5C0DB 2EDJA 1U8LB 2X1XR 5HYEA 1X7QA 4LCIL 1RZGB 5T1MA 4CMMB 1FAKT 2JB6B 4F7EA 3O4LE 4GKSB 2CDEB 2J12B 4CRPA 1ULVA 2F53A 4K3EL 4ODXA 2AV7B 3DMMC 3I6LE 5ID0A 1S7VA 2RFXB 4MJ2A 3IJYA 2Y6SD 1FCGA 3ZDYE 3SDDD 2ITDA 3D69A 1HOCB 1X5LA 3G9VA 3B9AA 3CGTA 3NMEA 3UTPD 3UBXA 1JWMB 1ZT7B 4JPIA 4ZTPH 1M6OA 2J88H 4HCRL 4MX7B 1W0VA 1JHTB 1XF3B 1MAKA 5B3JF 1CGUA 3U79A 4FQXC 3PUCA 3GRWL 3KNBB 1DQDH 3DRQA 4AQOA 4CU7A 4WWKD 1AXSA 1KACB 2HWZH 4I3SH 4PG2A 1T1WA 3GSRA 2V2TB 3NCJL 3V6ZB 4J6RL 1FFOA 4V2BA 1RJYA 5LAXA 4HS3B 4JFDB 3K74B 3DVNB 5CS7A 1YEIL 1HYSC 1EEZA 1Q9LB 4B41A 1ZHBA 2ZZUT 1DBKL 1UWXK 3IDIA 4I2XA 1P4BH 3O3EA 3NIGE 4NKMB 3LZFH 4X4ZA 1ZLUK 5SWQB 1TPXC 1BQHG 1F97A 1ZHNB 5FIEA 2JJSA 1IM3A 3QPQD 5F7UA 3BRFA 3CPLB 2YD5A 5CBAB 3O3BB 3P30L 3JVGA 2NY0C 2WIIA 4NGHH 2A74A 4KMQA 2FX8H 5CAYB 5HYQB 3TC9A 4ODTH 1NL0H 3TIDB 3CSYA 4YK4C 5DHYB 3WFCL 5KVFH 1MQKL 4LRNL 4J1UB 3K80A 5LQBH 1A4JB 3EO0A 4L8BA 2EC9T 5LBSH 3PG2A 1FE8L 4R7NB 3BIBX 2VSDA 1KCVL 3TIEA 5H35A 5HPOA 5TDOB 3BZDA 4DKEH 1T7WA 2ADJB 2G60L 4R4BA 4Q9RL 1YN6A 3EYSH 2EDNA 1NEZB 4X6EB 3V4PH 4X4XB 3O6LL 3ARDD 1TZIA 3LIZL 3I50L 4DN4L 5K59E 2AJSH 4QOKE 5F3BB 3DHMA 2CLVA 1EFXB 3U48A 4JRYE 3VXSA 3KPNA 5CJBA 1I7TB 3WUZA 4Q6IB 5T33L 3PDOA 1K9TA 1TJIL 3IF1A 5D72L 4DTGL 4UT9H 1R3KB 3SGEI 3SDXE 3L5WA 3IU3B 4NCC1 2D0FA 4KZDH 2XTJE 4OGAD 1G7PA 2J7LA 5C7XL 2YUXA 4Z7UE 5EULV 3V5DA 1QQDA 1OB1A 1U3JA 5BZDA 4P2OC 1K8DA 2WAHA 4RBPH 3TO4B 2H2PD 1MLBB 4PLJD 2G9HA 4Q2ZB 1OAYH 2OSLA 4PY7B 1N8ZB 4YC2B 1RZFH 4X83A 5IHZA 4JFEA 1UEYA 1WICA 2HTLD 2ARJB 5E7FA 3WHE1 1FVDB 2HAZA 5TE6L 5DHVH 5DRXB 2APFA 4JDZA 2BY2A 2EECA 3QNXA 3FTGA 5HHPB 1KLGA 1AQKL 1HXYB 1BFOB 1BQLL 1T1YB 3ARGD 4HGKC 4HKBB 1RZJH 4ZXBB 4Q6YA 1FZJB 4DZ8A 1FNSL 2ZNXA 1QR1B 2DQEL 5CP3A 5L9DH 1GHFH 3RKDC 4XMKH 2NY6B 3S88L 3TWCL 3VXUB 4J8RA 2F5BH 3GK8H 1T1ZB 3OR7B 3U2SB 5FOBB 1VKXA 3BP7B 1FPTL 2P5WA 1YYLH 3BEWB 5KSUB 4WEMB 3AXLB 1HXMA 3C5ZA 1MOEA 4JKLA 1J0YA 1WIPA 2VUYA 2R39A 3T3PE 2HKHH 4XBGB 1IGMH 1Z9SA 4DVRH 3IFNH 4BQ6A 1HDMA 5JLZB 4HWZA 3RX7A 3OX8B 3I3BA 4NO0A 2F74A 1GGUA 4RWYH 1G9NH 4NZRH 1FVCB 1GPOH 1ZHLB 2R9HD 3UAJD 2GSGB 3PNWB 1DUYA 4D9RD 1JTTA 4HXAH 2Q8AH 1MIEH 4OZGA 3RIFF 4TSBH 1I7UA 7FABL 5CP3H 3RY6C 4H20L 3EOTH 5IMKB 2GITB 2NYYD 3QDMA 4HW6A 4MNGA 1OP5K 5HDQL 5DA4A 4FTVE 3BYYA 3VFTA 5T3XL 1T0MA 4MXQD 1T89C 1WBXB 1AHWB 4ZUTA 4Y16D 1V3LA 4N0FA 4GG8B 4QHKI 2VLMD 4OF8A 2RGSA 4YZFE 3UJIL 2NY1B 5FGRA 4XH2A 1JNNH 4U1KB 4LU5H 4K3JL 5GSVA 5E2WL 2NY2D 4NC1C 1GZQA 1PG7W 3FO2B 3JV5A 4HWBL 2DQJH 4S1DC 4CU8A 1ORQB 4MS8C 5C09E 3HAEA 2RB8A 1DTUA 4XMLL 4U1NA 5DS8B 5EZLA 1WSST 4ERSL 1RZ7L 4JY6A 1W72L 3JVGC 2FZ3B 3G6JB 2CUMA 4WWKB 5H37G 2ZOKB 1YY8A 1SJEB 5D7JC 4NRZB 3BWAA 1YECL 2HFEB 3BQUC 5DRZA 1OSPH 1NSNL 1OW0A 4IRJD 3JV6A 3BEVA 4YHKH 1JTOA 4E41E 2VDNH 2B2XL 4P23D 3MRBB 2ZSWB 3GIZH 4I3RL 4JE4B 3VFRA 2BNQA 4CKVX 3N1FC 4NWUH 1IGCH 5EZOL 5IFHL 2NW2B 3P9LA 3QIUC 5E8DL 3C2AH 4OFDA 4O51A 4NIKB 1UB6A 4L4VD 1IAII 5BRZD 3RZCB 3X3FL 4HLZH 5FGCE 3HAEH 1WZ1H 4XRCA 4LLDB 4YBQD 4CDHA 2Y07L 5C08D 1RZJC 3NA4A 2FJGA 2YPVL 4PREA 5F9OH 1U3HA 3QG6A 2LU3A 4HZAA 2Q86A 5GS1C 1BBJB 5M94B 3H9SE 3OKEB 3C6SA 1U95A 2MQCA 5TJWK 3F5WB 5B4MC 4QGYA 5KAQG 4M03A 1F4YH 4KK9D 1UZ8B 2GK0B 1QP1A 4PRPA 3PL6C 1T66D 1IC1A 4Y4KD 3LQZB 3MNWA 4JFZH 2Z92B 3TN0C 4JZOA 2E27L 2HT3C 2WMPA 1Z3GL 4J3UA 4V1DB 5DVMA 1WFNA 4XP1H 1XAUA 3WFEL 1RD6A 2Z93A 3QHZL 3MLUL 5D5ME 1KG0B 4XCNB 1CD8A 5CJOH 2UUDK 4PS4H 4WHDA 5DVNA 1I3VA 1DLHB 5JDSB 2WBKA 3NIDE 3MRHB 1MFAL 3OJ2C 5BW7A 1ZE3C 1EDQA 1UVQA 2EC9U 4KI5D 1C16B 4PV9B 3RJDA 3GO1L 4RAHA 4WTWA 1P1ZB 4DWHA 3GI8L 4G8FB 2JJVA 4MB3A 5F1OB 4G7YH 5F7FA 3MACH 5FO8B 1DFBL 4HK3N 5H2BA 1Y6MR 5J6HA 1E4XH 4GQPH 4P3WA 5FYLL 2XWJB 1OP3H 4LFHG 4XNYH 2FEDD 4N68A 2UV3A 3SGKA 3PHSA 3WIIH 3WNKA 3RVVC 4E42B 2FR4B 3J8F7 4L1DA 1MNUL 2XTJC 5GXBB 3MV8E 3QI9A 4UU9B 3MZTA 4L9LB 3ARPA 3ZHDA 1DQQA 4LLMB 1RPQA 2BERA 4HK0B 1KYOK 2OK0L 4Y19A 3OXRB 4UILL 5T3ZH 1A1OA 3BX7C 1EZVX 3TNMA 1ZANL 3OKDA 4FFWD 4XZUB 5D2LE 3SOBH 1MRDL 3IYLW 1KN2H 2LU7A 3MSPA 3KXFB 3OR6A 4WU5B 3HB3C 1OPGL 2AJYL 4I0PD 1I7RA 3CNKA 1I3RA 5E1AA 2CLRA 2OL3L 2AEQH 1AFVL 4FQXB 5INCA 3TNNB 4FMFA 3FOLB 5DUBA 3O4LD 5T1KB 2YD4A 1NANH 1AIFA 4XCCL 5FHBL 2MTPA 3WV0A 5IKCB 3HC0B 3CH1A 3Q6GL 5FM8A 4PTUA 4W6WB 3NTCL 2QJDA 5D93C 4PJ7B 4KRPC 1HYRC 4NRXB 5I73B 3SE9H 5I1DB 5DJXB 2X10A 1MJ7H 3CX2A 3HNVH 5DWUH 1FGVH 4MQXC 1TPXB 5LXGH 2C9AA 4YFLI 4Y16B 3W2DL 1K3ZA 4KPHL 5JNYA 5D1QD 3FFCD 5FO7A 5F7HA 2VXTL 4O5LL 3HG1E 4AK1A 2RHEA 5C0EA 1OCWH 4OZIB 1MRCL 3DETD 3LQAL 4YK4B 4U3HA 5JOPE 3WKML 3R1GH 1RI8A 3BH9B 4FHBD 1YDPB 4MA1B 2BC4A 5D6CA 1TVDA 3Q3GB 3RWDB 4RMSA 1EEYB 5EU6A 4CVZA 1Q94A 4C4KT 5CEXB 1FC1A 2GEEA 1ES0A 2ICWA 4LVOC 2OTUA 4HIHB 3VWKA 1N0LA 1ZA3A 4IRJB 3SE4C 4M61B 4DKFL 1YC7A 4JZNB 3B43A 1FJ1A 5BMFH 5C9KA 3MYJA 5F1KC 1TJGL 4XNXL 2VJXA 3TYGL 2Y06H 2VXVL 4U3XA 2CIKB 5D1ZA 3PWLA 3RWGB 3RWFB 2HFFB 4L4VB 1JZ7A 2ORBH 5BJTA 4NOBA 1ZS8B 1J8HA 1EHLH 4PRIA 1RK1B 25C8L 1KELH 2GJZB 3EJYD 4N5ED 4Z7WA 3WE6A 2N7BA 5KW9H 1IAKB 3GSVB 4JFQA 3V4VL 4CMMA 3D39E 5L2JA 4KMLB 4FZEL 2CDEA 2X4PB 4FFVD 3ROLA 3GBML 4NT6B 3WHXB 1G6RB 3MRLB 4QOKD 1U2CA 5I30H 1EMTH 4KKAC 4WI5A 5BW7C 2J88L 2X4TA 4PJFE 4RGNE 2V5TA 2RFXA 4YHOH 3JV0A 3QDGE 2ZWLT 1CGTA 1XF5B 5D2NA 3OTTA 3IDMB 2P8MA 3L6FB 1I8MA 1DQDL 2Z4QB 1TIUA 2X70B 4XWGH 3WN5C 3NGBC 3WSQH 2HWZL 4I3SL 1Q72H 2D7MA 4JN1H 1CR9H 4H8WH 3CSBA 1JHTA 4OZGF 1AC6A 1UM6H 3RI5F 1IAIM 4R90H 3KS0J 3KNBA 4RDQF 3SGKC 1NAKH 4WUKH 3RVWD 4RISH 1P4BL 2NY3D 4FA8A 1MCPL 3LZFL 2NY4C 2R1YB 2IBGA 4WO4A 1OAZH 2OJZL 4PRNA 5CGTA 4GOSA 5GGRA 32C2A 4HMEA 3T09A 4NGHL 3F62A 2F5AH 2FX8L 5JXEA 3KDMA 4ODTL 1VEOA 3LY6A 4L3CB 5TDNA 2VITA 2A0LC 5KVFL 1QBLH 5LQBL 1RZ8A 3BRDA 1I9RH 1ZHNA 4N0YH 1P84J 2QHRH 3O3BA 3QAZC 4GLRI 4UDTB 1QLEH 2CRMA 3HS0B 4DKEL 2FHFA 1CLZH 3TIDA 2DQTH 5DHYA 1NFIB 3EYSL 3PWPE 2EYTB 4XAWH 3V4PL 2WLZA 3W11C 4PJ5E 2AJSL 2IFFL 2AP2A 3QFJA 4A6YA 5FB8B 1FZKB 5C0FA 1OTSD 2D7QA 4YBHA 4X6EA 4X4XA 5JHDE 1VERA 2J8UB 5FYKE 4UT9L 2VO5A 2QQLH 1D5MA 4X6DA 5DJ0A 5BZWB 1NGXB 4X99B 3O4LB 4HZLA 5FAAA 5F7YC 4Q6IA 3FMGH 3O6FA 3NIFE 5D7JB 3GSQB 4DGYH 2VC2H 2PTTA 4K8RH 3BQUB 3BN9D 3IU3A 1UZ6F 3VGDA 3VXRA 2EIZB 1RZFL 1QBMH 1H15A 1UKQA 3AB0C 1I9JH 4L5FL 4UUJB 4FQJH 4QRTB 4A6YH 3TO4A 5KS9F 1JZ8A 2V5RA 3VI4F 3QIUB 3VFNB 3L3KB 4DCQB 1JI2A 3UJTH 1H3VA 1QSEB 3MBED 5C09D 2BXZA 1RFDH 1BQHB 2KL6A 3IFPB 4WENB 5L9DL 1GHFL 1AR2A 4XMKL 5DRXA 2F5BL 1XH3A 2PYFB 3GK8L 4OM0H 4QHLA 2UZXB 4QTHB 1YYLL 1HXYA 4H8WC 4KQ3H 1X4XA 3VFSB 4ZOBA 1PYWB 3EZJB 1D5XA 4IIQC 5GS1B 1LE5B 3BD3A 3LPGA 1IGML 1QLFB 2A6KA 2BVEA 2BK8A 3BP7A 5K93A 3IFNL 3N1MC 3BEWA 5KSUA 3AGVA 3QEGH 3MRGB 3MCG1 3TN0B 4RWYL 1G9NL 4LSTH 3MGOB 4X7FC 1S7SB 1GPOL 4XC1H 1T2JA 1Z9OA 3QUMA 4X6BB 1J88A 4XBGA 3CFCL 4HXAL 3V8CA 1YMME 1MIEL 5TGBA 1QFWI 3Q6FB 5D2NC 4JB9H 3RA7H 1EJ6A 3EOTL 3KYMB 5IBTH 3FQNA 4APQC 1D6EA 2MQ3A 2VR5A 3RWCA 3PNWA 1GIGL 4OZFG 3U30C 4KJWC 4I1NB 3H9SD 4PJGA 2EKJA 1NBQA 4UNVA 4QWWD 1NMBH 4M02A 3CUPA 4X5XB 4EN3D 1R5WB 1XGQB 4O58H 4QOKB 4OLWH 5IMKA 2GITA 4X98A 1NDGB 4M7JH 2DQJL 4JRYB 1G0XA 3HZYA 3FL7A 1C7TA 1AHWA 4WO4C 3SDDA 2OR9H 3V6OA 3T2NH 5CINH 4HX1B 4GG8A 3QUMH 4S0TD 3VDBA 4NCDA 2JJWA 2AEPH 4PLNC 3ZTJG 5E0QA 4GG6E 1BWMA 1PKQE 4M6AA 1F4XH 4G43B 1XF4B 1OAUL 2XTJB 3OKYA 3SDCD 1ORQA 4Z7UB 3MXWH 4B0MM 1OSPL 4PD4K 2XTLA 3MFFA 5C0CE 1JF1A 4KGJA 1QPPA 1I85A 3DJ9A 3G6JA 4WWKA 2VDNL 2VUOA 3THMH 3SY0B 3WFHA 3MPCA 1EV2E 2R4SL 4M6OH 4QO1A 4NWUL 1JV5A 3C2AL 4ODSH 4HS8H 2QADB 3GJFB 2Z8VC 5D4QA 4M1CC 1T7VA 4UMGA 3NVQA 1OTUC 5E94A 5KSBE 5F7DB 3RRQA 5K9KA 2CJUH 2NW2A 2H41A 1JPSH 3I75A 5E2TL 3MV8D 3E6FB 1NUNB 5I76B 4YNYB 5EOCJ 3HRZA 4TNVK 1U8OA 3QWQB 2X05A 5KG9B 4KRPB 3MRDA 1FNEA 4LLDA 3O6FC 4ELMA 1F4YL 2CXKA 4UIKH 1VGEH 2F15A 4JFZL 2BHUA 1BBJA 2HRLA 3H7LA 4IMKC 5GRJH 4Z7NE 4XP1L 4HFWA 4BZYA 1IQWH 2W60B 3HCVB 3BP4A 4L8SA 2GJJA 2PYED 1TQBC 2BJMH 3ARDA 5CJOL 2F19H 2XOTA 4PS4L 4YXLH 3LQZA 2Z92A 2VWEC 4X0KB 1J1OH 3G5YB 2R4RH 2GY5A 5JXAH 1RZKC 4X5WB 1DE4B 1YNLL 4GKNB 4G6JL 1KCKA 2V17H 1KJ2A 5A3IC 4XCNA 3AS3A 2CPCA 4LVOB 3Q48A 5FKAB 3OHXA 3SKNB 2IAMD 5JDSA 2QHLA 1O7VA 4FTVB 1D5BB 1IKFH 2JF1A 4G7YL 3RIAK 3MACL 2I07A 1UH2A 2UY6A 5HGBB 3RWJB 1C16A 1E4XL 4PV9A 4LCWD 3CVHA 1ZLWK 2Z8WC 1S3KH 4NO3A 2CDFA 3HNTH 1P1ZA 3HG1D 3NCCB 3VFGH 2L7JA 3WIIL 3DX9B 1TVBA 1BX2B 5C1MB 4ACPA 3U4EA 5IMLB 5TE7H 4X80H 5IQ9B 5FO8A 3P2TA 2VLRB 5IW6B 2XWJA 1AD0B 3DSNA 5F93C 5T3ZL 3FB8B 5JR1H 2Q6WB 1AE6H 3FQUA 4YHPA 3SOBL 2FR4A 1KJ2H 3ARGA 4LOUD 1KN2L 2BHYA 2VZ1A 4TQEH 4E41B 2PO6C 4HK0A 4BSVB 1B2WH 3OXRA 5HHME 1FH5L 1QRKA 4M8VA 5IF0B 2R1WB 5I0DA 2AEQL 2P4AB 3BGMA 2WWMD 4IRSA 4N0CC 3QQ4B 1MCLA 2YC1B 3CVHH 4RQQB 5EUOE 3NGBB 1G6VK 4X7DC 4DFHA 4Q0XH 2X1QA 3PWJB 5FGCB 2EXYD 5CEYB 4A2LA 5BS0D 3D39D 2BCKB 3LH2H 1SMOA 4O4YH 1AP2B 4G42B 3RPKA 5JQHC 3SE9L 5C07D 4AL8H 3HC0A 5DWUL 1MJ7L 5F70A 1FGVL 3ES6A 1CFNA 2NY4B 5LXGL 3WNPA 5DD1L 1MWAA 3IT8D 4Y5YC 1I85C 4Y5XB 4EN3B 3BD4A 1H8NA 4O2FA 4XVUD 3RBGA 1KTDB 5E99H 3F12B 4CMHC 5DJXA 1OCWL 3FB7B 4P9HC 4EIGB 1AJ7H 3R1GL 4NJ9L 2HFGL 4FQPA 4X6DF 2MSPA 4Z7OF 4Y16A 3QAZB 1OAXH 2NNAB 3IGAA 4P46B 1CXKA 1QFWM 5I18L 1YEHH 1FFQA 4PJIB 2CRYA 5I8EA 3SDCB 3MRPA 1Q38A 5JUEH 5IV2B 3BH9A 3QPQC 4OLYH 2YHGA 4X7CC 5B3NA 3RWDA 5HI3D 1EEYA 2IG2H 5BMFL 1RIHH 5IM7B 4GRLD 1KSRA 3Q5TA 2Y06L 3SGJC 3B9KC 2YK1H 3VA6A 1MWAH 1EHNA 5ESQA 4ZUWB 3OWEA 2XWBB 2YUZA 3ULVE 4MQTB 4IRJA 3FCTA 2ORBL 4JJ5B 4P23A 4HMDA 2ARWA 3IAGC 1KELL 2GUOA 5GRVL 4U2YA 1YN7A 5KW9L 3I02B 1NBYA 3FO9A 2CIKA 2ZUSA 3VFPB 2VXSH 3MV8B 3VDAA 3RWGA 3ARDC 4LRIC 3RWFA 3PWPD 2FJFB 1CICC 4L4VA 2CD0A 4LKCA 4G7VH 5DXWA 5BRZA 2DM4A 3OZ9H 2W0FB 5CIPA 4C54A 2GJZA 4PP1D 5D1XC 5I30L 1EMTL 2P8LB 2FH6A 4QRRD 5D2LB 4ESKA 1IAKA 5GS0C 5C08A 3V5KB 1KPUA 5ITBH 3MREB 1UM5L 4DVBA 3EOYG 5D7IE 5J0BA 5A40E 5HJ3B 1KIQB 4HJ0C 5DMKA 4HHAA 2BX5A 3N0PB 1W2KT 1DDHA 4ZO9A 3WSQL 3T1WA 5DK3A 5E03A 1Q72L 2OYPA 1CR9L 4H25A 3CFJA 3QXDA 1UM6L 1ZXQA 3L3IB 4U1GB 3ZE2F 4QHUA 4R90L 2XNAA 5HDBF 4Y4KA 3D2UD 5GRUH 5I1LA 3FONB 1NAKL 3HPLB 5I9QC 2X70A 4Z18A 1HSAB 1F6FB 4RISL 5GGVH 1Q9OA 4PJGF 3T65A 2MMXA 1RJLA 2PTVA 3GSUA 2L4OA 4JFYA 5CIPH 3LVEA 3PP3K 2JB5H 4YXKH 2D7OA 4XNMB 2APWA 2JLLA 3P4LA 1MJUH 2D9CA 1UACL 4HUUB 1BZ9A 3MJ8B 5CHNA 1CVRA 4AENA 4AEFA 4BH7B 1QBLL 2R1YA 3DVFA 4ZODA 1IBGH 1I9RL 4N0YL 4TOYH 2QHRL 3CFEB 2K1MA 3D0VB 4IRSC 1CLZL 3NFSH 4D9QE 4WIQA 4HV8B 2DL9A 3V5HB 1KV3A 2DQTL 4KH2A 1XGRB 5T5FH 4EBQH 4XAWL 3D5OF 4NNYA 4L4TD 3QA3A 1N2RA 1Y18A 3V6FB 2D7TH 3LV3B 5E8EA 5EBGA 4X6CE 4Y1AE 1YPZE 3UX9B 3RVUC 1RVFH 1A6AB 3H6JA 2KZ1B 5ETUA 2YRZA 3BI9X 2WWKT 3UPAA 5HXMA 4KKLC 2QQLL 3MMEB 2Z0BA 2R69H 3MNVA 5FB8A 1GGTA 1YMMD 1FZKA 4IM8A 5E2UH 1XCTB 1QKZH 3FMGL 4G80B 1CT8B 4I0PA 3HTLX 4R9HA 5T1LB 3VMPA 4DGYL 1C7SA 5ESVB 4K8RL 1MCWM 3RVTD 3D39B 2XA8H 1NGXA 1NKRA 1QBML 1F3RB 3O4LA 2V9QA 1LMKA 3IDXH 5DVKA 2QR0A 4ELMF 1LK3L 1NKOA 3F7YA 4FQJL 2ZSVA 4A6YL 4ODWA 3V7AG 4MA8H 2Y36H 4PJFB 1D7FA 4RGNB 3UJTL 4LEOB 4PJEE 3QDGB 1RFDL 4M4RA 1J8KA 3IDJB 1IGFL 2OP4H 5EOTB 1EAPA 1KT2B 5IVNA 4UUJA 1P7QB 4QRTA 3FB5B 4KDTC 5IK3B 4NBXB 2X4QB 4KQ3L 4TSAL 4GUPB 3OKMB 5D1QA 4D2NA 2R23B 3FFCA 1ZLVK 2ZUWA 1BQHA 3DXAE 5ALCL 5C0CD 4P23C 5F1IA 1FFPA 3MUGB 1JP5A 3TZVC 1B4JH 2PYFA 1XGTA 3CU1A 3VI3F 4TUOB 4RGOH 5I19H 2COQA 1BOYA 4ODHL 1PYWA 2X5PA 1KOAA 1LEGB 5SWZD 2P44B 4XNQB 4LSTL 1JWSA 2P8PB 1CL7H 3IJSB 1PDKA 4XC1L 5BVPH 4Z0BH 2EDQA 4U1JB 1QHPA 1H3TA 1NGPH 3ARFB 3SDAD 1PX3A 1SBSL 2BMKB 1AKJD 2M8XA 3NFPB 4JB9L 4DZBB 5EA0H 1U8PB 2VMFA 2W07A 5IBTL 1S7SA 4YXHL 4OFPA 1C08A 5JORA 3G04A 4WTXA 5ILTH 1CXFA 4U1IB 3KPPA 1F02I 4G8IB 1EGJA 1AD9B 1NMBL 2WWKO 4J7RA 5ICYB 4PJ5B 3NFNA 1KIPB 3KPMB 3O3AA 4L8DB 4O58L 4M1DH 1SY6A 2BOCB 4OLWL 3HE6C 2J2ZA 4GW5B 4U7KA 1PQZB 3SKOA 3UZEA 5EO0B 3DVIA 3LKOA 5J1TC 1AXTH 3EHBC 3T2NL 4DKDC 3MGTB 4LLAA 4L9DA 3QUML 4X5XA 5JHDB 1OT1A 2AEPL 1PKOA 1TZHB 2YD8A 4QOKA 1AH1A 1F4XL 2XN9E 4RRPG 1KPRA 2I9LA 3O3DB 4D0CA 4PGDB 5JZ7C 4KJQC 4KVNH 1A6TB 2V2WA 4ZOEA 2OLDA 2IQ9H 3D2UB 1T21B 4OZHE 4HDIB 4F37K 4LHJB 3SDXA 4P4KC 4G43A 3ESVF 3FRUB 4WW1B 1EGJH 3WXWH 4M6OL 5FECA 1FL6A 2AEIT 3BZFB 2PO6B 3SCMD 4ODSL 1LGVA 3SPVB 3FQWA 1SY6H 4HS8L 5E5RB 1IARB 4ZUSB 4UT6H 4XHJD 5IVXE 5FO9B 3GJEB 3JV4A 3SY0A 2X44D 4M6NH 3L3OB 4O2CB 1UXSA 3DX6A 5DRWB 2QQNH 1JPSL 2N4IA 3IXTB 1WFTA 4MJID 3KPQB 2GSIA 4OCWH 4E9LA 5CZXD 3SGDI 1G7LA 4U1HA 3GJFA 2ESVD 1CU4H 3KLAA 4FFWC 4ZUUA 4HUKB 3DSFH 3QZWB 1JYNA 3DI2B 2ZPKH 4LPXA 3P9MB 1F90H 1OGTB 4PJ8D 4PJ9B 4OT1H 3FT4B 5DGQA 3DOSA 1NJ9B 5I76A 4UIKL 3TBSB 1VGEL 1RU9L 1L4IA 1NLDH 5F71A 1MH5A 3RFZC 4OZFB 3BMWA 5HHNB 5HHMD 3CFKB 2JK5A 2ZCLH 5C0BE 5KSAC 5GRJL 1U8JA 5F9JB 3LB6D 1IQWL 5KTEH 4WI2A 4L8CB 3NABH 1CIDA 1BJ1H 2BJML 2VL5B 3G6AA 2F19L 1R5VB 3ULUE 4YXLL 5GZOD 1QEWB 3QEQE 5F8QC 1VEPA 5DEFA 1ZK9A 1YMMB 5TFSL 1X5AA 3U0TA 5E4IA 2D0HA 1I8IB 2CR3A 2V17L 1V05A 5J9PB 4PGCB 3V2AR 3NH7H 1NC2B 5L0QB 4C57C 2VDKH 1J86A 1D5IH 3BAEL 4U6HA 3RVXD 4Z7QF 3TBYA 4OUUA 1DQTA 4X5WA 1DE4A 5F3HB 5ACMA 4ZAKD 1JPGB 4XVSH 3PHQB 2QBWA 5E4EC 3HNTL 3MX0A 4IMLA 4LLQA 5C0JB 3TA3C 2ZKHH 2NZ9C 3QO1A 1OF2B 2EEAA 1WQVT 2WNGA 2DL2A 1D5BA 5TE7L 1KJMB 4YR6B 4RFEB 4X80L 1NMAH 5HGBA 4GG6B 9CGTA 4BFEA 1PKQB 2ZJSH 5IT2H 5IBUG 2W65A 1ONQB 2BOBA 1XIWC 4LHUG 3EO1A 5FHAH 1AE6L 1H3XA 1KB5B 4YO0B 5IB4B 5DC4B 1CICB 1CDIA 3BPNC 3MBEA 2UWEA 1KJ2L 5C09A 3ZLQC 5KANG 4F15C 4LIQE 4Q9QH 1HEZA 1ITCA 4TQEL 5IW6A 4EEEA 1FN4A 4AJ0A 1B2WL 1PFCA 4MNHA 1CN4A 3W39A 3WEXB 2EE3A 2IH1B 3ZTNH 5J6GB 1MAJA 3DGGA 2Q6WA 3OKKB 4NKDB 2YZ1A 2D4DA 1GOGA 5DD0H 3CVHL 3ZHLA 5H37H 4Q0XL 3PWUB 3IDGB 1RHHB 5KZCD 2X9YA 3H9HA 4UOW0 5EIQA 5KSBB 3PDDA 1MVUB 1KENH 1AKJB 1FYTB 1BECA 1ZAGA 3LH2L 1VFUA 2E9IA 3CK0H 4MHHI 5F7NC 1YEDB 4RQQA 4O4YL 2VN7A 4JQIL 4H1LG 4NFBA 3MJ9A 3V79C 4AL8L 1IVLA 1QZ1A 4JRXB 4X9IA 5CEYA 1JZ2A 2DM7A 2DKSA 1RUPH 2ILLA 3C9NB 2ZUVA 3QXAB 1AP2A 4YBLB 3CCHB 1MFNA 1X5FA 4M7LT 5CLWA 5E99L 4MJ5B 3H9SA 3WS6C 2AJZB 1AJ7L 4XXCA 4LSPL 2OJEA 3DNKA 2FSEB 4YDJB 1WV7T 5HDOA 5IG7B 3T0XA 3QEHA 4EN3A 4ODVH 3EOBA 2VR4A 1OAXL 2NY3C 2KZWA 1YEHL 4IOFD 1U58A 5C9JA 2CRZA 2CH8A 1AGFA 5GPRA 4DGIH 4NP4H 3RL1A 2AS5M 5JUEL 4P3DA 5D5MA 1QNZH 4OBSA 4OLYL 3MJ9H 1UB5B 3GSWA 1KC5H 4PBXA 1IGYA 4KK5C 2I5YH 4UBDD 3VCLA 3SDCA 4MAUL 2CLZB 2YK1L 1MWAL 2Z35B 1D9KC 3U0PB 1MIMH 4EJ1C 4UB0H 3VD9A 4S1QL 3ARXA 1T83A 3VD5A 3ZDYF 4O02H 4NQDE 1OSZA 4OV5B 1N6UA 2IPKA 3WFDH 4KAQH 4WFEE 3V52H 2NY5H 4ZUWA 3UTQA 4ZPTA 2VXSL 2XWBA 3LD8C 1CWVA 1FZOB 4KMTH 5A2LH 1GJIA 4FG6D 3DUSA 1T22A 4G7VL 4RA0C 3OZ9L 2XRAL 1AGBA 3ARUA 1S7UB 4WRLA 5DVLA 4Y2DD 3WNLA 1PJ9A 4Y1AD 5ITBL 3MV8A 1MFDH 3MNZB 4PG9A 4ZUVB 5I1HH 2EKSB 4RFOH 2W0FA 4B53A 2OQJB 5B22A 2ZP0T 4BZ2H 2HLFD 1KIUA 1R3HB 4NO2B 4LNVA 2EDTA 2NR6D 1INQA 2VDPH 4AT6A 4I8DA 5IB5A 2DQUH 3NIGF 4HMCA 5EUOB 5IB1B 3R4DA 4NQEE 3NACH 5GRUL 4HH9B 4OD3H 1FC2D 4QCIA 4CNIA 4EI5D 1EVUA 1FZMA 4P2QE 3GGWB 5GGVL 3RTQB 1P5VA 2PYEA 3MLTA 4NQVB 4FFYH 1EFQA 2JB5L 5DUPH 5BCAA 4YXKL 3HPLA 5HGHA 2YS4A 2PN5A 5AZ2H 5HYJE 1MJUL 3AU1A 3EDEA 4LLWA 4NC0B 3MRKA 2X4UB 1FNLA 2IH3B 1IBGL 1MY5A 2FD6H 4RAUA 3UEZA 3W9EB 4ZMAT 1MF2H 2V5YA 4TOYL 2IAMA 1JNHA 2FDBP 4XNMA 1QHOA 3NFSL 5C3TA 3GSNH 3MJ8A 2QTEA 4BH7A 4EBQL 1UJ3C 5GRXG 4LCWA 1X3DA 4UQ2A 5JW4M 1KEGH 1KXVC 3DV6A 3HG1A 1BBDH 5F6IC 2XY1A 4XNUH 3CFEA 4YDKH 2ERJC 4N9GB 1YEGL 3SDXF 4HV8A 3TT3H 2NX5E 2J5LC 1RVFL 2X1WL 3HE6B 2W0KA 2FIKB 3FN0H 5E6YA 4XBEH 1JHKH 2D9QB 1HHIA 1NAMB 4CW1A 2R69L 1L6XA 5MEOB 3MRIB 5E2UL 3GSOB 4TUJA 5IQ7H 1JGEA 2VRAA 2FJHA 1QKZL 4M48H 2YXFA 5AYUH 3QB7C 3MMEA 5DI8B 1HKLH 2R2CA 3BN3B 2B5IC 2NY5C 3T8XB 4LLUA 2B4CH 3G9AB 1FLRH 1XCTA 3IDXL 4P4KB 5HGDB 2GYSA 3WNNA 1CT8A 1LEKA 3K3QA 3CX5J 3GMQA 1QSFE 5IHBA 4MSWB 2Y36L 4KXZH 5BS0A 5ISZD 1P69B 3D39A 5M95B 2Z8SA 1P4LB 3LRSB 5J57B 1N3NB 4LPYA 2OP4L 4QKXB 5F21B 5C07A 4MD5A 4GBXC 2E6JA 5ACZA 3T3PF 1FO0H 1HKFA 5CWSA 3L9RB 3NCYP 5DMJB 3B6SA 5F7EH 2CXGA 5EOTA 4G6AC 4BQ9A 3FB5A 3QQ9C 3L3GB 5IK3A 2X4QA 1MCSA 2J4WH 2K7QA 4BQCA 4NRYB 4S1RH 1IT9H 4PGBB 1CL7L 2P47B 1UQSA 2BVUA 2YPLE 5KSAB 4Z0BL 5HHOD 3OJDA 2A6IA 2GIYA 4JM4H 1LO5B 4YPGA 1NGPL 3OKLB 1JPST 4YDLC 1IM9D 4YDVA 2D03H 2JCCE 4ELKA 5K9OA 3DRTA 4XNQA 4Z77A 3QHTC 2QSVA 1FNHA 4GRLA 4PRDB 1VESA 4U1JA 4P5TB 4RMWA 5DFWH 5ILTL 4HUXA 3ZT6A 3P4OA 2NTFA 3NFPA 3DPBA 5I71B 1EUUA 3HNSL 2UWEF 3S37X 2NY7H 1H5BB 4M1DL 5FUCE 3KYOB 1CG9A 3EW3B 1PW3A 1U9KA 3BIKB 3PQYB 3RDTC 3SJVE 5C0BD 4QHMB 4U1IA 4X6CB 4Y1AB 2Q7YB 1YPZB 2OR7A 1AD9A 1HH6B 1AXTL 3PWPA 4PJHE 4YE4H 4Z76B 2HKFH 1BREA 3TA3B 5MEQB 4L8DA 3ULUD 2VTFA 1VENA 2WINB 2BOCA 5DJYB 2CQVA 5I74B 5F97E 4U0RC 3KPSD 3DO3A 4QRRA 1BHGA 1S9VA 4KVNL 4MD4A 3W0WE 5KAQF 5CSBA 1XIWB 5LVEA 5IWLC 4M62H 2GT9A 4K9EL 5C92A 4KROC 5DDHB 3IETA 1KPVB 4LHUD 3O3DA 4TRPH 3U36B 1EGJL 3WXWL 5B39A 1OAKL 3LMJH 1MLCB 3K1DA 2B4CC 3STZA 3S8WA 1SY6L 3D2UA 5C6TL 5GGUB 1T21A 4UT6L 1PLGH 4WW1A 5EBWA 2DI8A 4MJ4A 3BUYA 3DYOA 4KHXH 4PJEB 4JFFB 2QQNL 3ULSA 1N6QH 1P7KA 4PV8B 3VXMA 3SPVA 4DUWA 4OCWL 5KVMC 2N1KA 4ZUSA 2WBJD 5GS3A 3DSFL 5IJKA 3L3OA 2HT2D 5AUMB 5DRWA 2VLLB 3ZL4H 1WAAE 4Y4HC 4PJDE 3IXTA 4X9HA 3DXAB 1F90L 4OT1L 3KPQA 5IHLB 5D5MF 3VE0B 1AGEA 2ZCLL 2IALA 3JXAA 5BQ7A 4R97C 5HBBA 3O41A 3NIDF 5KTEL 4FQQA 2DJ4A 3NABL 3CJJA 4NM4H 4RGMB 4L4TA 4X5LA 3B5TA 4MYWB 1NJ9A 4P49A 5HI5D 3V0WH 3TH4T 4LQ1A 4D0DB 5HVHC 5HHNA 1NCWH 1CTNA 4H88H 2UYLB 4Z78A 3FQTB 1N5AA 2HG5A 3T0EE 2WP3T 5DURD 4BZ1L 1K4DB 5BO1H 1TTFA 1R5VA 4UAOC 1TCRB 5D7SL 3BZ4A 4UTBH 5IVZB 1UADC 1YMMA 1OTTC 2VDKL 1D5IL 3T4AA 1U91A 1MI5E 1DEEA 3QUXD 1X44A 3L5IA 3G5VA 1CK0H 2IGFH 4PGCA 4WV1A 3RHWF 1U36A 3ROOA 4W4NA 1U8KB 5SWSD 2AQ2A 3KPRE 3S3JA 2ZKHL 4ZFZA 1HSBA 4J4PD 5I1IL 2AABH 5J12C 1DQMH 3BPLC 1CGYA 2JJTA 1DSFL 2K9UA 1NMAL 5D7LD 3M1BB 3PHQA 1NBZB 4WW2A 1CFSB 5IT2L 3HZVB 2F54D 2XN9B 3WBDA 3PP4L 1JGUH 4N8VG 1WWBX 1WBZA 3BE1H 1OF2A 5CEZH 2A9NL 1D5ZA 1WIUA 5D96C 3H2WA 4QRQA 4RFEA 5IW1B 2FBJL 4LCCC 4LF3B 4Q9QL 1WC7B 2RR3A 5IOPA 1PKQA 1QUNA 2DQFA 1QFUH 2VERN 2Y72A 4R7DB 1XGYH 1B0RB 1NFDB 2GCYB 5IB4A 3BHBB 4U1LB 1CBVH 1S9WB 5C0CA 5DD0L 4J2XA 5HTSA 1FBIH 1U92B 4JFOA 3OAYH 5HI4D 4PJBE 4R3SA 5IVXB 3DX8B 4NQDD 4ODUB 3BH8B 3MO1A 3BZEB 4WFED 2IH1A 4D3CH 1KENL 3UMTA 5SWZA 3G5ZA 4M00A 3CK0L 1B3JA 3MV01 3VG0H 3W81A 5IJVA 4JY5H 5CUSH 3PWVB 5EZJB 1MUJA 2XIDA 3IDGA 4LCUB 1KTRL 3SDAA 3VFUB 4W70A 4OCLC 1AKJA 1ORSA 1MHHA 3KLHD 1FG9C 3WNOA 1RUPL 1U8QB 1CQKA 1YEDA 4ZG1A 4X7EC 3UTSE 1Y0LB 5DK2A 2ATPA 5C0BB 1A7PH 2YD3A 1B0GB 3KPOB 1BD2E 2ADGB 3DV4B 5ERWA 3RPIB 2I26N 4ODVL 5F1NB 4NQED 3QEQB 1WVZA 4MB5A 2MQ0A 4R96B 2AJZA 4NP4L 1UJ3B 4D9LH 3IXAB 1MCNA 3RGVB 1T7XA 1QNZL 2FX9H 5IG7A 4C83B 5TH2B 4KTDH 3MJ9L 4K7PX 1NCCH 3GB7A 1KC5L 1MHPH 4TSCH 5IBUB 2ERJB 5ICXB 1I1CA 3SGEH 4JHAH 3KPTA 1TETH 3QUYD 5B38B 5FUCC 5HYJD 4BUGA 3TPUB 4C56E 3AM8C 1UWXH 1MIML 1FDLH 4UB0L 2KBGA 3CC5B 4KK8C 4O02L 3BUTA 3T08A 4R6UA 4NKOB 4KAQL 5FYJD 3V52L 3LEVH 1XCQB 4MGXA 3D85D 5E9DE 1ZHKB 2NY5L 3RUGA 3O8XC 3SCMA 2Z35A 1DLFH 4KMTL 8FABA 3HPJB 4U7SA 2WBJB 1A6ZA 1CD0A 4G6MH 2A6DA 1EJOL 3KPLA 3EYOB 5FF6B 5IEKA 5A16B 5E5MB 2VZVA 1G7HA 4JFXB 5DVOA 4LP4A 4MJIA 5L6YH 1MFDL 1TLKA 1S8DA 1FZOA 2ICWJ 2EDLA 2EEBA 3K2MC 4RFOL 3FO1A 2VXUH 2ESVA 5I16B 5BVJB 1MHEA 5IHUH 1VPOH 5DJ2B 2KUTA 1S9YB 1JGDB 3LEXB 4GXUM 5EO1B 4EQ2A 2NW3B 5FOJA 4DK6A 2BVPA 3S5LG 1ZWIB 2VDPL 4PJ8A 2DQUL 2B1HH 3RZWA 1N0XH 3JBG7 4XPAL 4ZUVA 1P2CB 3NACL 1A0QH 5JIKA 4XGZB 2V6HA 4OD3L 4OF0A 5DYOA 5FV2A 3VD4A 3DTXB 3MRRA 3ZT7A 5D70H 2PETA 1A9BA 5DURB 1CFTB 5F6HI 5CJXA 4WW2C 5IB1A 2HJFA 4NNXB 2XG5A 4I13B 4FFYL 5DUPL 1U0QA 1S7WA 3ZSSA 3VFWA 4HH9A 3T77B 2W38A 5AZ2L 3ZKNC 2XZAH 3QIWD 4V2CB 3C8DA 3QNYB 1R3LB 3S36X 2X4NB 1KCSL 1RK0A 2Q7NA 2WSKA 2IBZY 5CJ8A 3AS1A 1IFHH 1T20B 2FD6L 1MF2L 43CAB 1TTGA 4YDLB 3TT1L 2DQDH 1JIBA 4JDVB 3T04D 3BESR 3D0LA 3FN3A 2OZ4A 4ZAKA 3TF7C 2YMXH 4GS7B 2DB8A 3PGFL 5JHLH 1KEGL 5DJAB 1S9XB 3O9WD 3L5XH 4XNUL 2P5EE 3HE7C 4CBPA 4GRMB 4YDKL 3D6GA 4BFIA 3TT3L 2Y7QB 4HGWA 3JTSB 5LGJB 1DN0A 2C26A 4EUPA 4HBQA 1BF8A 3RDTB 3FN0L 3VXNB 4ENEC 2YPLD 1JHKL 4XBEL 3SDAC 4LGSB 2V7HA 3VWJD 3K4ZA 5I1JH 5IQ7L 4RZCB 1RQ5A 2VL4A 3VGBA 1VA9A 4U0RB 4MHHG 2H2SD 4NQDB 2V9TA 5AYUL 2FIKA 2PUQT 4HJJH 5B8CA 4HKZA 1JYXA 1H0DB 2ENSA 2VIRB 1HKLL 1XMWA 3EOAB 4JM2C 2OZ4H 4AG4L 2B4CL 1FLRL 5HD8C 4JFDE 5D6DA 2M1KA 4KROB 1IAIH 2ZCHH 5ADOH 4EDXA 2Q76A 1LQSR 4CL7A 3HHRB 3OB0K 2DI9A 4RMUA 3SJVD 4X4MA 1ZA6A 5CSGA 1OP5H 3SKMB 4EUPH 2CSPA 4CADA 1I1RA 4F3FB 3CZFA 5HGDA 3CXHJ 4XXDB 1AGDA 1CTOA 3VD3A 5CSZB 3OKNA 5ESAB 5DMYA 4HUWB 4HWNA 5I2IB 4XCFH 3UYPA 2FWOB 1P4LA 5F7EL 4P0DA 5D7IA 4NQEB 1KJVA 4NQSB 1URLA 3MTRA 4D0BB 4P2QB 3RNKB 2VAJA 3MV9D 5BXFB 2ZUTA 4HUMB 5DJ6A 4WJ5A 2AK1H 4S1RL 1IT9L 1S7TA 2ED7A 2HVKB 4JFHE 1OOAA 3SDYH 5ANMA 3CDFA 2G75A 4R97B 5D9SA 5HYJB 4JM4L 1A7NH 3QIBD 3I6KB 4MDJB 2D03L 4NRYA 2VLJD 4WU7B 1V7MH 4JGMA 1T1XB 3PJSA 5L2KB 4WW2F 1U8NB 2A83A 5IROC 3RWHA 5SX4I 4F7MA 3EIFA 4UAOB 2NY7L 1VADB 5EOQL 3V4UH 5MENB 4POZC 4OD2A 1F6AB 5C8JB 5CGYD 5DEGB 3ZKXC 1AGCA 3VJ6A 2NX5B 2V5MA 4RFNC 2HKFL 4G8GD 4M4PA 4Y2DA 1K5NB 2H8PA 5J89A 6CGTA 4X6CA 1YEEH 4Y1AA 3BPLB 4PYHA 1EA9C 5DFVC 2Q7YA 1YPZA 1LO2H 4OLVH 1KXQE 3JWOL 3T0ED 1C12A 4Z76A 1SYVB 4JHWH 1HILB 3MA7B 1BF2A 3IKKA 4X7TB 3X14B 1V3MA 2UUDH 3AS2A 1DQJA 3BSZH 4TRPL 4BQBA 3UTTD 4ZAKC 3NCJH 1CFBA 4FXGB 5CP7B 3WKNA 3M17B 5FK9B 5GIRB 1MI5D 2VN4A 6FABH 1MRFH 4WHCA 3ZYOA 3ZE1E 1QSFB 2YD6A 4GXUN 4EI5A 2BZDA 5DDHA 4UT7H 4F7CB 1KPVA 4WUUD 5FKPB 3KPRD 4KHXL 3BJ91 4OF3A 1N6QL 2O5XL 4XPTH 4IS6A 2LAGB 4QNPF 3O6MH 2FNBA 1INEL 4R4FH 4M6MH 1SMAA 3FRPG 2LQRA 3ARBD 3HRPA 5AWNH 2NLJB 4R0LA 3D48R 3ZL4L 4PJEA 1AO7E 4WFHE 1T03H 4QXWA 4G9FD 1N4XH 1FV1B 4RNRA 5FGBA 1EPFA 1CGVA 1M1SA 4PJXF 1JRHL 1KCVH 4O2EA 3CFDA 5BV7H 4JN2A 4UIMB 2VLLA 5D6DC 4NM4L 3L3DA 4TN9A 2YPLB 1A9EB 3V0WL 5T3XE 5EU4B 3VWJB 4H88L 1CF8H 3GUTB 1QRNB 4KJYA 1GC1C 3PHOB 2VLKE 1FSKC 4EVNB 1CIUA 1P4IH 1HQ4B 3RUGF 5B3JE 5CBEB 5D7KE 3PABA 3S4SG 3CFBB 4P2YA 1ND0B 3UPRB 4X9FA 4A2MA 3LPFA 1L0QA 4KKCC 2E9BA 3BP5B 4OFYD 2E7HA 3QO0A 1DBJH 4WNQB 5ENWA 3NPSC 2O61B 2IGFL 2DLIA 2Z31A 3TVMC 5AD0A 4RRPA 2AERT 5CMAB 2BVQB 3GMLB 4OCXH 4WI3A 3AAZB 2AEWA 2VZSA 2AABL 3R0MA 1VACA 1NGYA 3U0WH 1DQML 1KB9J 4M93B 4FS0A 3DVGB 2M2DA 4S11A 2A38A 4NN5B 3O8XB 4RIRB 4TTDD 1IEBA 4OGZA 3QWOB 5C0IB 3BE1L 5ISZA 1OLLA 3ARWA 4K94H 4GKOA 3QUZC 2HJLB 3W0WB 3S37H 5F89B 2UZIH 4I48B 1VFAB 3TWCH 4JZJC 5DO2C 3M1BA 3HZKB 3B3IA 3HZVA 1QFUL 4WI4A 1H8OA 3Q1SH 5J3HD 3WO4C 1XGYL 5DJZA 4C56D 1LD9B 4XTRD 2EIEA 3ZSTA 1ZVSB 4L3AA 4EXPX 1T5XB 1YA5A 2ED9A 1FBIL 4LF3A 2IPUK 1NCAH 4U1SA 1WC7A 4OZHA 3GEWB 1MCFA 3QIBB 1CDGA 4R7DA 1B0RA 4YEEA 2GCYA 1I1FA 1OT2A 3BHBA 5KVDH 4DK3A 5JW3H 4BSJA 1S9WA 2E9WA 1J05A 3VG0L 4JY5L 5HHOA 3D3VE 4ODUA 3BH8A 2YSSA 4HPOH 2C5DC 2GTWB 2VDMH 1IM9A 5ALBL 3S98A 1IE5A 3C5JB 2XQBL 3BIAX 3SO3C 1PG7X 1G7MB 2PXYC 4OFIA 4GRWH 4MD0A 5CD5C 2HLFC 5HDQH 4JY4B 2PR4H 5EZJA 3T0VA 2DYPD 4Z5RA 3DLQR 2DQCH 3JTTB 3VXOB 2NR6C 2XA3A 2EIDA 5EIIB 3AREC 2ICWI 1DVFD 4OQTA 1U8QA 4L3ED 5GHWH 4K3JH 4EI5C 1AXIB 2OM5A 1J7VR 3C60C 4HWBH 3K7UA 4DGVH 5C0BA 1NDMB 1IC4H 2QSCH 2EZ0D 3KPOA 4PJCA 4D9LL 5FYLE 3OGCA 1IILE 1OD9A 3T0EB 3A6BH 3DV4A 3HR5B 4AEHH 1VFMA 4KTDL 1NCCL 4OF5A 1MHPL 4TSCL 2X4OB 3HE7B 5ID1A 3KPSA 4JHAL 4N8VB 1TETL 1XGUA 1YECH 5I8KH 3O4OC 5JOFB 5C0GB 2BNRE 1YY9D 1KXTB 2MKWA 3PXJA 5EB9A 1S9KC 1NSNH 3DBXB 1RUMH 2BSSA 1MI5B 4YHZH 3J7HA 4PY8J 3KXFE 1CDUA 1SEBB 2YKLH 4MVBD 1N64H 5CZVH 4RMQA 4LHUA 3KPRB 5EZOH 2HP4A 1FNFA 3LEVL 5C0AE 1I8KA 1YJDL 3TPUA 4NWTL 4QRPE 4GFTB 3DURA 4OQTH 4I0KA 4XBPB 1DLFL 1QLRB 4G8EA 3JZ7A 3G5XA 4HIJA 1M7IB 5J4MA 1OLZA 4JM2B 3ME0A 5D7IF 2ARJQ 4G6ML 2WQRA 4F80A 1CDCA 4NKOA 2R2BA 5IMMB 2P5ED 1A4KA 2HFTA 4PJ7E 1KGCE 1MCOH 1ZHKA 2YPVH 3WJLA 1XZ0B 3A6CH 5FA3B 3W5MA 2VXUL 4YAQA 3ECBB 3NPZB 4Y4FD 1E6JL 3HUJF 5IHUL 3EYOA 3QJHB 5A16A 1I1AC 3B5HA 3F6LA 3X11B 4JFXA 1LP9B 4Y0GA 5EORL 1EBPA 1GYAA 4Q74A 4CGTA 1N0XL 2Z31C 1SEQH 4H1LA 5B21A 1A0QL 5E56A 3QJFB 2X9XA 1IKNC 3S7GA 3TEUA 4OZIE 4PRHE 3MOQA 4F57H 3GNMH 4KK6D 1S9YA 1JGDA 3LEXA 5D70L 3RBSA 5F96H 1ZWIA 1JL8A 2C1OB 4JFDD 4HS6A 3QXTA 1P2CA 1JPFB 4NUGH 3PIQB 4EI6B 4ZFOA 3C09C 2XZAL 4XP4H 4LPTA 3DTXA 5JA8B 1JGVH 3X13B 4LLVA 3DARA 2DQHH 1Z2KA 1I4FA 1JVKA 1IFHL 1YMHA 4WFFD 1YQ2A 3UTSB 3GI8H 2F9BT 2DWDB 3T77A 2DQDL 3JWDH 1XR9A 3O2WL 1BD2B 3QNYA 1DFBH 4ZNEE 3FQRB 4X6CF 1G7IB 3QUXA 4H1LH 4DOHE 2YMXL 5JHLL 5EG6C 2QV2A 5SWSA 3L5XL 4MLSA 1MCWW 2MNUA 3MRFB 4J4PA 1MNUH 1JZ6A 2MCPH 3TCLB 5T1DH 1QACA 1BIIB 2HVJB 4MJ6B 4ONHA 5D7LA 4LKXA 4JGJA 2IANB 4UILH 2F54A 5IMOB 4LVEA 4M5YL 4TPRH 2ED8A 4PRAB 4NQTA 1E28A 4OKDA 4GRMA 4RFNB 1EFXD 2E7CA 5I1JL 2Q87A 2EH7H 5GGTA 4JO1H 3F65A 3JTSA 4W4OC 4ETQB 3VGGA 1F8TH 3HZMA 4HJJL 1KIRA 3VXNA 4QHNB 4NHUB 1I8LC 4JO3H 4XT1C 1G7JB 1T3FB 3B83A 5E9DB 2OZ4L 1LK2A 1CXHA 2X89D 1MCCA 3LSOA 3GM8A 4K7PH 1GXEA 1S7XB 1NMCC 3U9UB 3M07A 4PJEF 4Q9BA 1IAIL 3MUJA 2ZCHL 4NQDA 3BT2H 5ADOL 1EHAA 5INDA 3B2UC 2DS4A 3NTCH 1F4WH 2VIRA 3EOAA 2F53E 2AQ3A 1YEKH 4LBEA 1X9QA 2WBWB 1CGSL 3ILQC 3IKCB 4MXWH 3OMZA 1W0YT 4POYA 4HAGA 3FT3A 2AVGA 1TQCC 4QY8B 3WS3B 3L3JB 3UTZB 3OF6D 3MXVH 1DVFB 3O81A 5GGTH 4KPHH 4MA3A 5I1GH 4AM0B 2VZUA 4ZXBD 3RJQB 5CD3A 2PKDA 4O5LH 1WCBB 5C3LD 4PUBL 4XXDA 2NY6D 2O5ZH 3FT2B 3VXUD 3WKMH 4YIQA 5ESAA 4ZOAA 1UXWB 3WFZA 5J1AB 3KYKH 4E5XA 5CKGA 5DT1H 3U4BH 2FWOA 4X8JA 3U7YL 1BLNB 3QULA 1PGRB 4NQEA 5FA4B 3QUKA 3CH8A 4XWOD 3SDYL 5JPNA 4HAFA 1A7NL 1A21A 3U4AA 3WJLC 1Z6JT 4GAYA 2HMID 4JQXC 3ZMRA 3QXUA 4GMTH 3RQ3A 4NPYB 4I2XE 3IVKB 4NC1E 1BVLA 1V7ML 1EXUA 4XNXH 2HT2C 3QUYA 1RUQH 2RAMA 2VXVH 3QCVH 5HYJA 1H9VA 1QFHA 2WUBH 3JWDC 5JTWA 1LO4H 1QR4A 4PIRF 1GRWA 3I6KA 4AIXA 4MCYB 2XI9A 1AO7D 5CJQH 4QYOA 3SKUD 2HT4C 2NXYC 4HIIB 3KVQA 5IB3A 25C8H 2HLAA 4HBCH 3W82A 4CJ1A 3V4UL 2P5EB 4GRWF 3D85A 3V4VH 4K7FA 1KJ3H 3WJJA 1U8IA 2F8OA 4FZEH 4F9PA 2XWTB 3ET9F 2R0LH 3RL2B 1WISA 1ZVHA 3TVMB 1PY9A 2NY1D 1JUFB 3GBMH 3FKUS 1HE7A 4Y4FB 1E6OH 4PGEB 3GSXA 4ZD3H 5HHQB 4OZHF 1Z0MA 3MRNB 1YEEL 1QSEE 3N50A 5JMRA 4ZYKA 1LO2L 2ADIA 4OLVL 4YHIB 1CFQA 1FCCA 4JHWL 4NBZB 5D7KD 4NDMA 3VXSE 4JFPB 2G5BA 2GI7A 2V2XB 3QUZB 2X4RB 2C7UB 3P0GB 5TF0A 5ADPH 4POUB 1K5NA 3GMPB 5FDYA 3BSZL 4YHYC 2CO6B 2OBGA 3DI3B 4I18C 3VFVA 4OAWB 5DUMH 3LS4L 2Y5TB 6FABL 1MRFL 5FYJH 3WO4B 2V7NA 4UT7L 2BY0A 4ORGB 4OSUH 4HFUH 5EC1B 1M71B 1MCPH 1NGZA 3OXSB 4GJTB 4QRUB 4FXGA 4TYUA 5CP7A 3BW9A 2OJZH 5E6IC 4XPTL 5FK9A 2EDRA 2FO4B 2GW5A 1ZGLM 2AGJH 3O6ML 4RAVB 3RZCD 4R4FL 4M6ML 1G7QB 1IL1B 3QIWA 2IADB 5AWNL 1ZLWH 3ZE0E 1FG2B 2FLBT 1KEMH 4PJCF 1T03L 5JIPA 1P7HL 1N4XL 1AY1L 2VQ1A 4K71B 3RKPA 4MAYC 2FL5B 3LQAC 4CUCA 2FO1A 1LEIA 2AJ3B 3SO3B 3EYVA 2PXYB 5BV7L 3TFKD 2VAAA 2CKBA 4ZS7H 5JMOC 4LNRB 5J13B 2FH8A 1Q9KB 2XXCB 5AYQA 1PEWA 3O9WA 3IRZA 2IFFH 1GAFH 4AH2A 3AREB 5K9JL 3H7BB 1A7RH 5GGSA 4V1DD 1CF8L 3G08B 3QPXH 4KRNA 4N1HB 4OB5H 1BJ1J 1JE6A 2EYRA 2XZQH 4F9LA 5J11C 5C2BH 1P4IL 2YN5A 3REVB 3C60B 2YPLA 2YD7A 3MRCB 4EZMA 3R8QA 4Y5VC 1W0WA 3VWJA 1OAQH 3C6LC 3WMSA 2YPKA 3PHOA 2JCCA 4OZGE 4UTAL 1LNUB 1DBJL 1HQ4A 5CBEA 4IOIA 4MCZB 3O4OB 1HN1A 1S7QB 2R2HB 1C5DB 4HG4J 1ND0A 5GZND 5EWIL 4CVXB 4DQOH 3HMXA 5MI0C 3UPRA 2H6PA 2CKBH 4OCSH 4OCXL 2GTZB 2H32B 1E4KA 4BKLA 2R0KL 3QDME 4MNGE 3C2SA 3U0WL 2ZOLB 4WNQA 4L5FH 2EH8H 4AEIL 5DMGC 4ONFH 3AMKA 4RA3A 3VMOA 3MLRH 3MOAH 3L7EA 5GS2D 3ESUF 5CMAA 4N0UB 2BVQA 2CK0H 3SJVA 4OF6A 1IGTA 1FL5A 1CS6A 3MLZH 1I9IL 4K94L 1UWGH 5HY9B 3S37L 3KWWB 4PJHA 4CN6A 2UZIL 2LTQB 3QUYC 1ETZB 3BPCA 2Y25A 3DVGA 3TJEH 1KTKE 3T0BA 1LE9A 2VOTA 3Q1SL 3V95A 4RIRA 5C0IA 2BXYA 2Y9RT 2BNRD 3AROA 4BH8A 1HK6A 5F88A 3BMVA 4PBVC 1WZLA 1XGPB 4OI8A 2Z8RA 3KXFD 2C4XA 1ZGLP 3T4YB 2AV1A 1NCAL 2NXZC 2P42B 2B8OT 3HMXH 1TITA 3S9DB 1BFTA 3MV9A 3MQIA 4R2GC 1JYVA 4FQHB 4PY8I 2BP3A 3LCYA 4QRPD 5FCUH 4FQXD 5KVDL 5A2JH 5JW3L 1IGJB 1ZVSA 5M7QA 1MJJA 5T1KD 4Z7VB 4HLZG 2CDGB 1M7DB 3CFCH 3T2QA 1CZ8H 2XXMB 2EE9A 3E8UL 4HPOL 5IB2B 2IQAB 2VDML 4XAKE 3X3GL 4FN0A 1AO7B 1T4KB 1LDPL 2VLJA 3WHE0 4LPCA 3EJZC 1MHCA 5L88L 2WANA 1VGKB 1U42A 2K3TA 5HPMB 1S7RB 1I1YB 4PG2C 2C1PA 4PTTA 3S4SB 3OJMB 1GIGH 2PR4L 4ONOA 4PRBA 3F58H 1PSKH 2DQCL 4YQXL 3VGAB 2GTWA 1UZ6E 1A1MB 3UCRA 35C8H 2XFXB 1N59B 4N9OB 3HMWH 2AW2A 4PJDA 3WUWB 1XR8B 2NY0D 5GHWL 4GW4B 4G5ZH 3TO2A 3O11B 4DGVL 4XCYB 2AXFB 4PRHD 1JN6B 3JTTA 3VXOA 5KS9E 4QRSB 4PRPE 4G9DB 3VI4E 1IC4L 1PZ5B 2QSCL 1EO8H 5EIIA 4JLRA 2JJSC 2VLKB 2X7LB 3A6BL 3NZ8A 4AEHL 3STLB 3BDXA 2VLRE 1MFEH 3QXVA 4G8GA 1OAUH 3MC0A 5I8KL 1FL3A 1W72B 2R1XB 3BKMH 1RUML 2JKXA 4YHZL 3QR2A 2LAAA 3SE8H 1CE6A 1CDBA 2YKLL 2W0PA 1N64L 5CZVL 2R4SH 3RWEA 5AG9A 5FM5O 3PP3H 5DJCB 3UTTA 2HN7A 3LDBC 5C0GA 2BSTB 1GOHA 3NCBB 4OQTL 4E0RB 5EC2B 3C8HA 1EX0A 1MI5A 4Y88A 2HJKA 4JRWA 1SEBA 4NUJA 4XI5C 3TJHC 4WUUA 5IR1B 3KPRA 3EUUA 1T2QH 5E8PB 1NMCB 1MCOL 4JPKH 4LDEB 5E2TH 4AQ1B 3LRHA 5IBLC 4OD1H 3ULUL 2PF6A 1F3DH 4TNVF 3A6CL 5GJSH 4WDIA 2BSED 2YD1A 3D18B 1FAIH 4X6FB 1AC0A 1HI6A 3ARBA 3FB6A 3H0TB 1HHKA 4PR5B 4Y19E 2YOCA 3HFML 3BVNA 2MHAB 1XZ0A 3CLFL 4G9FA 4MWFB 2H9GB 1SEQL 1CDHA 3ECBA 1JZ3A 3ELAT 4ZFFB 3WD5L 4F57L 3GNML 3QJHA 3BXNA 1LO3H 1G9NC 3UPCA 5F96L 2PW1B 1BJ8A 4GKZB 4ZTOL 4PJBA 3S96B 5EUKA 3MROB 2Q1EA 3D3VB 1UCBH 5DQ9B 4NUGL 4PJIE 4H5SA 2DM2A 3BYTA 1XF2A 4ZSOA 4XP4L 1QFWL 1OL0A 1YNLH 4G6JH 1JGVL 3H42H 2DQHL 4P5MB 2C1OA 2AI0L 3LKPB 2B1AH 1NCBH 4U1MA 3TYFA 2Y1VA 3VRJB 3P4MA 3JWDL 2BDNH 2AXGA 3C5ZC 3ALWA 1AQDB 3RIAF 3EYQC 4OFYA 3X13A 4I3GA 3QHFL 1RZIB 4DFIA 2EE6A 2BSRB 4ISVB 3GMRA 2SEBB 2O26U 5FM4A 1DP0A 3ILPB 2DWDA 3FFDB 3SBWA 4OGXL 1J5OH 1PG7H 2MCPL 5T1DL 4LEXL 1RSFA 4IHOB 4JAMA 3EBAA 4M7KH 4DN3H 3DMMB 1OGAA 4YEFA 1FVEB 3LQMA 4ZFOL 1ZLVH 2E8ZA 2YZ8A 4TPRL 2AQ1A 1X5XA 2OTPA 2FB4H 2BNRB 3QG7H 4QT5A 5EO9A 1QO3B 1GH7A 2HVJA 2EH7L 1LO0H 3HLAA 4JO1L 4IJ3C 3MRMB 5C6PB 1F8TL 3C5SA 4S1DD 3K4DA 3GMOA 5E8OA 1JJUA 3CLEH 5F7WC 1FH5H 4JO3L 4MS8D 1WBYB 5C0AB 1CGWA 4C56A 4QRPB 1CL7I 4OKVB 1CXLA 4K7PL 2GAZA 3IFOA 3CXDH 5D7JD 2OL3B 3BT2L 5EBMB 5DC9B 3BQUD 4QHNA 5GSRA 2VQTA 3I6LD 1F4WL 3GKWL 2EDDA 4FZ8H 5TDPB 4PRIE 4Z0XB 3S5LA 1AR1C 1YEKL 3U9UA 3QYCA 3SGDH 4HXBH 1DUZB 3UO1H 4MXWL 2KH2B 3QIUD 1E27B 5DRNB 5DD1H 3BKYH 3MXVL 4ZQKA 1OW0C 3QP3A 5GGTL 5I1GL 1QSED 1WFUA 4QXTA 2EDXA 3PGCB 4LQFH 3O6KH 2NY0B 5MERB 1TVHB 1WT5A 3VXSD 3ZDXE 2O5ZL 2DYPA 4PRHB 5D2NE 1O0VA 1TFHA 1WCQA 4NJ9H 2HFGH 4QY8A 4Y8AA 2D7NA 1DVFA 2IPUG 3EDJA 3KYKL 5DT1L 3U4BL 4MAYB 4AIZB 4OLZH 4AM0A 4FQ1H 1WGOA 2FECI 4L3EA 5H94B 3P77B 2JCCF 2OXGA 5GGRY 5I18H 3AS0A 5F7MC 2VISA 3O45B 5B4MD 4YX2H 4M9OA 1JK8B 3PL6D 1U3HC 3TN0D 4GMTL 2GFBA 4J3XA 2HT3D 5AAWA 5EN2A 1QA9B 1RUQL 1NQBA 5EFIB 3QCVL 2WUBL 1LO4L 4FQIH 4N0RA 2IPTL 5F7KC 1YNTB 3I6GA 1Z9MA 3KLSA 5FXCH 3O2VH 3ZKMC 3BO8B 5CJQL 4C58B 4DOHB 4Y5VB 2DKMA 2DWEA 4PJHF 3C6LB 4QXGL 4WI9A 3ETBF 4HBCL 4MDIB 5KBNC 4HK3J 5C0DA 4YWGL 1U8LA 1RZGA 3S36L 4LAJH 4P57B 4P2OB 5FFLA 1KJ3L 2JB6A 5T5NF 3E6HB 3QDAA 4UINL 4GKSA 2PW2B 2R0LL 3V0VB 5MI0B 1SYSB 2AV7A 1E6OL 5DZLA 3N1GC 1INDH 1DR9A 2P5EA 4ZD3L 4NN6C 1UG9A 4JRYD 4JR9H 1UM5H 1JPTH 1EEQA 3QFJE 1Q9WB 4ZPVB 3BPOC 1HOCA 2A2QT 2XPGB 1JUFA 3RVVD 3KYAA 4Y4FA 3ARZA 1JWMA 1ZT7A 5ADPL 5DQJB 2XTJD 4MX7A 2OI9C 3B2VL 5I15H 1XF3A 4OCYH 5KOMC 4X6DE 1X7QB 2DIBA 5T1MB 5DUML 3GHEH 4F7EB 2HTKC 5FYJL 1GGIH 1NCNA 3GMPA 4OSUL 2F53B 3QI9C 4HFUL 4ODXB 1LWRA 5MHSE 5CLTA 2GJ6E 3B4NA 2V2TA 3V6ZA 3QDMD 2NXZB 3HB3D 1DBMH 4HS3A 4JFDA 3VXRE 5ID0B 4OAWA 3DVNA 1S7VB 5F1SA 4PJDF 4GH7B 2QADD 1Q9LA 3IJYB 2AGJL 1JBJA 4TTDC 2ITDB 3D69B 1UACH 2R2EB 5GRYA 1MCDA 4NKMA 4ORGA 5EC1A 1M71A 3PWNB 3OXSA 3WLWD 4JPIB 5SWQA 4L29B 1IC5H 2VWEE 1KEML 1W0VB 2VB5A 3CPLA 5CBAA 1KCUH 2H1PH 3ALPA 5J3HC 4RAVA 3ZYJA 4KRPD 1G7QA 4XTRC 5HYQA 3DRQB 2IADA 3DYPA 2EDBA 4LLYB 4XVJH 1AXSB 1FG2A 4ZS7L 4J1UA 3TBVB 1A4JA 4UV7L 3GSRB 4X7SH 4R7NA 4MQXD 4XPHH 1GAFL 5TDOA 2FL5A 3L5HA 5LAXB 1A7RL 2ZG3A 1FRGH 2ADJA 3IAQA 1EEZB 2VE6B 1ZHBB 3QPXL 4OB5L 4LSRH 5JIHA 1NEZA 1S78C 2XZQL 4I2XB 5C2BL 4WEUD 5F3BA 2YXMA 4NN7C 3H7BA 5CKAA 5DGRA 1OAQL 1TCMA 1IM3B 3WFBL 1EFXA 4FMKA 1H3PH 1I7TA 1EHXA 2WIIB 2A74B 3MRJB 3GHBH 1IEAB 2Q8BH 2HYMA 4UDUB 2A73B 2DBLH 3ZE2E 5A1AA 4OZ4B 4PLKC 5HDBE 5GQBA 1R3KA 3AY4A 2AAVA 2PCPB 1MSPA 4DQOL 4L8BB 4FTVD 2CKBL 4OCSL 3MOBH 2X89A 5H35B 3TIEB 3I3EA 3WIFB 4XP5H 3S34H 1LK3H 1YUHB 4PJGE 2EH8L 4R4BB 5IP4A 1FYHB 4ONFL 3MLRL 1YN6B 3LDBB 5F9AC 5DMIH 2EZ0C 1MLBA 3VWKC 3MOAL 4Q2ZA 4CVXA 2DQIH 1TZIB 2CK0L 1LVEA 4PY7A 1N8ZA 5MP6H 2H32A 2NTSP 1VCAA 3MLZL 4NQXB 4YLQT 1UWGL 4LARH 5DHVB 1IGFH 2UVEA 2ARJA 1E4JA 3VXSB 3CZJA 2VLRD 1FVDA 3VXTB 3TJEL 5D1ZC 5HHPA 4PJBF 4NQCE 1IGIH 3OF6A 3PDOB 1BFOA 2YA2A 1T1YA 1RUAH 4TSAH 1M05B 2DLEA 4HKBA 1EH9A 4ZXBA 5ALCH 1FZJA 4NC2B 3E1F1 4MVBC 1QR1A 1G7PB 1T04B 4E41D 4KKAD 3V5DB 3VXUA 3OR7A 1T1ZA 3HMXL 3U2SA 5FOBA 5BZDB 5KANI 4J3VA 1MCJA 3SE3A 3LHPL 3AXLA 4ODHH 5FCUL 3PL6B 3QDJE 3MLWH 4U2ZA 1NBVL 3GBLA 1XGPA 5HYIA 5IHZB 2VZOA 1CZ8L 1SBSH 3QZWG 1FIEA 4UV4L 5JLZA 4JDZB 3BFOA 3FTGB 3OX8A 1BFVH 3QNXB 3QEUB 5C0NC 1F45A 1FVCA 4W6YB 4YXHH 2FATL 1ZHLA 3GMMB 5CGMA 2GSGA 1WTGT 1M7DA 1XT5A 3F58L 1PSKL 5DD6B 4DZ8B 1EAJA 3FZUC 4R4NC 2NY4D 4JG1H 4J8RB 1VKXB 1DBBL 35C8L 1AO7A 4WGWB 3HMWL 2P5WB 4FFZH 2K7PA 4DJMA 3CIQA 5HPMA 4JANB 4F58H 4ELME 3C5ZB 4G5ZL 1MPAH 2A0LD 4U6VH 1EO8L 1WBXA 1J11A 2XQYG 1HDMB 1MFEL 4LFHD 4S2SB 4U1KA 4NO0B 2F74B 3GKZA 4P46D 5JXEC 1S5IL 3H3PH 3FO2A 1QG3A 4FXLA 4QRSA 1PZ5A 3MRQB 3W11D 4JDTL 1U93B 2X7LA 3BKML 4OZGB 5DS8A 2A6JB 1EUTA 5JOEA 4FABH 2FZ3A 4ZS6C 3SE8L 4JQVA 4F37F 4K8RC 2ZOKA 1SJEA 3MLVH 4JPWL 1HZHH 4NRZA 3VI3E 2HFEA 3QDMB 2XKUA 4MNGB 4MMZC 1UWEH 1IRAY 4C55A 2HH0H 4KV5F 3VFTB 1T0MB 1DN2A 4ZUTB 3MRBA 2ZSWA 3UYOD 1BIHA 4XH2B 1T2QL 1KTLB 2VH5H 4JPKL 5GSVB 1FYTE 1GZQB 4E0RA 1BMGA 4OD1L 1M7XA 5GJSL 3HAEB 3RZCA 5D93B 4OIBA 4U1NB 5EZLB 4OI9A 4N5UA 1FAIL 4JY6B 4JRXE 2LFGA 3H9ZA 5SX5K 3MLXH 4Q6IC 1YY8B 3KJ4C 3OGOE 3KYNB 3BWAB 3P9WB 4J3SA 1RU9H 5DRZB 3TCXA 3OKEA 3BEVB 3H0TA 2FGWH 2YA1A 3Q5OA 3F5WA 1LO3L 1UZ8A 3NA9H 5KVGH 3HC3H 3TO4C 2GK0A 1JFQH 4MA7L 4IOSD 5K33A 3P9LB 1VFBB 1P6FA 2YRPA 4O51B 1UCBL 3RAJL 4V1DA 5TFSH 4YC2C 1UB6B 4ZFFA 4N1CA 4F7PB 2DIAA 5TF1H 4Z7WF 3PV7A 4MXVF 2PW1A 1KG0A 3H42L 4XRCB 3TLRA 2B1AL 3P4NB 4XC3H 2BHZA 1NCBL 1JNJA 4KKBC 2FJGB 1DLHA 4PREB 3BAEH 3TPKA 2BDNL 2APVA 3MRHA 4ZNCD 1U3HB 4ZXBC 4D9RE 5AZEH 3KR3H 4HJGB 5TQ2H 1U95B 3LKPA 2DKUA 5JOPD 1MFCH 2EDOA 5HVWA 4PRPB 1CE1H 5KS9B 2X1PA 1J5OL 4G8FA 4QHKJ 4JZOB 1AQDA 1MY7A 1PG7L 2L7UA 2J6EA 4APQD 4M7KL 4DN3L 1OM3H 2Z93B 2Q3ZA 4KJWD 4MNQE 2HMIC 4JREC 3N85H 4JG0L 1K8IB 1U8HB 4E42A 2FB4L 1NCUA 4YJZL 3QG7L 4UU9A 4L9LA 4G6FB 1LO0L 2IWGA 4LLMA 4NN6B 4KDWA 2B7DT 1UVQB 3CLEL 5LCVH 3TH2T 4XZUA 2OX5A 5HSFA 2BNRA 3BPOB 5IUSA 5GGVY 4NKQB 4XP9H 4NZJA 4NQUA 1QO3A 3WN5B 3KXFA 4WU5A 3CXDL 2VDLH 3RY4A 2OI9B 5T1LD 2GKIA 5J6HB 5H2BB 1R6VA 2Y6SC 1AHWC 3SDDC 4LAQH 4PJAE 3V6OC 4QRPA 2J6EH 4FZ8L 4FQXA 3TNNA 3FOLA 5T1KA 4JQIH 4KFZC 4HXBL 5GS2H 5IKCA 3UO1L 5EBMA 1DQQB 1P84K 3DUUB 4GW1B 5L8LB 1T6VN 5BRZE 5HYSG 1NH6A 4PJ7A 3BKYL 4RGND 2AJXL 4Y19B 1A1OB 4Z7QE 4Z0XA 1T5WB 3QDGD 3TNMB 4N8CH 4NRXA 4HQQH 3O6KL 4LQFL 4WWKC 4EDWH 4M1CD 2YD9A 1OTUD 5I1DA 1CVSC 4K3DH 2E6PA 1P7QD 2X1OA 2DTMH 3MLYH 1GL4B 1FP5A 4LSPH 5DRNA 4XMPH 1I7RB 1I3RB 1IAMA 5E1AB 2CLRB 3PGCA 4KJPD 4OLZL 3QRGH 4FQ1L 5INCB 5CCKH 1A7OL 2C3XA 4EOWH 4OZIA 4PRHA 1A7QL 2MKLC 1AIFB 4Q7DA 5FUOH 4YX2L 1UJTA 1YDPA 2GJ6D 3CH1B 4U6TA 3Q3GA 3RZCC 4TNWK 3O2DA 3P77A 5DJDB 5CEXA 4MAUH 3S35X 3ARFD 4FQIL 4HIHA 4YDIH 3O2VL 4S1QH 4M61A 2EDEA 3UZQA 4JZNA 4KRLB 4NN7B 5DEZA 1U3ZA 5JNYB 2Y4SA 5FO7B 2W9LA 1SJHB 4L8SC 1K3IA 3U9PH 5A3ID 1RIUH 3MV7E 2HFFA 3BO8A 4PJ5D 5L8KB 2XRAH 1KBGL 1ZS8A 3H3KA 1RK1A 4MDIA 5D6CB 2OR8A 1INDL 5I0ZA 3AB0B 3GSVA 5EU6B 1Q94B 3CVIH 4JR9L 4U4BA 1TMCB 3LKRB 1JPTL 1ES0B 4JKPH 1NUFA 2ICWB 2OTUB 4LSVL 3VG9C 2M26A 3O2DH 1BM3H 5JHDD 2X41A 2X4PA 1WEJH 1SYSA 1ZA3B 4NT6A 4OGAC 5FYKD 3VH8G 3WHXA 1G6RA 3MRLA 4O9HH 3MYJB 5I15L 4OCYL 2W9EH 2A9MH 1X6LA 5ICZB 2H2PC 1XF5A 1Q9WA 3IDMA 3L6FA 4WHYH 4WTZA 2XPGA 3PWLB 4PLJC 5D1ZB 2Z4QA 3GHEL 5FGSA 5GZNC 1GGIL 4HKJB 3QBTB 4IIQB 4K3GA 1J18A 4PRIB 2HTLC 4CVWA 5F9WC 1IZKA 1DBML 3WE6B 2PO6D 4X9BA 4JFQB 1Y6KR 5L2JB 4OCRL 4MMXC 3ARGC 3N06B 4N0CD 3ROLB 4L9LC 1ZTXL 4DKAA 1UA6H 2X4TB 1IC5L 4OJFH 4Q9CA 1MCIA 1F58H 1G6RH 4FRWA 1KCUL 2H1PL 2X40A 5D2NB 2P8MB 2R2EA 2EC8A 1QSVA 3LN5B 4NQCD 1I8MB 4RCAA 2PTUA 3TGXA 4L3CA 3PWNA 4XVJL 4APQB 3VGFA 4L29A 4PJ9D 1V5JA 3U30B 4F8QA 2HRPH 3GBNH 4X7SL 3BDBA 1J0ZA 4H0HB 4KY1H 1SJXA 4XPHL 4UDTA 3FFCE 3G6JF 1KYOJ 3PQYE 3HS0A 1FRGL 1YEGH 3RY6A 1ZGLB 2R9HC 1NFIA 1SQ2N 4LLYA 4LSRL 3QDJD 2EYTA 3UAJC 3TBVA 5EU3B 3U46B 1T89A 4WO4B 4PRNB 1YQVH 5GGRB 2VE6A 1H3PL 32C2B 5I73C 3GHBL 2NYYC 2Q8BL 3KDMB 1C8PA 2DBLL 2J8UA 2VITB 5TDNB 1NC2D 1J1XL 4MXQC 1RZ8B 2BVOB 4CN4A 4RMTA 1YYMH 4Y16C 4JCMA 5DR5H 2ZCKH 5BZWA 3DWTA 3MOBL 4X99A 4XP5L 3S34L 3MRJA 1IEAA 2NY2C 1SM3H 3SEPA 2AJUH 5D7JA 4UDUA 2A73A 3GSQA 4OZ4A 1R3JB 3B9KD 3BQUA 2VXQH 4WVRA 5DMIL 3EGSB 2PCPA 2DQIL 2EIZA 2BFVL 4MA1C 3WIHA 2A77H 5MP6L 4JFFE 2XT1B 3GZKA 3QFJB 4LARL 3WIFA 4A6YB 5C0FB 1YUHA 2ZUYA 4JKKA 1Z9LA 4IRZH 3QIUA 3VFNA 3Q2CA 3L3KA 4DCQA 1IGIL 4RSVA 1LHZA 4IRJC 1RUAL 1CXIA 1Q1JH 1QSEA 1CICD 3BKCH 4G3YH 1D5MB 4NQXA 4X6DB 3VRLF 1DJSA 1HIMH 1K6QH 5DHVA 3IFPA 3HI6H 1DL7H 2XZCH 5DJ0B 1MEXL 5D1XD 4HZLB 3VXTA 1BOGB 4ZO6A 3QXWA 5GS0D 3O6FB 1WWWX 4FP8H 3KJ4B 4FQCH 4QTHA 1H8SA 4KDVA 2GJ6B 4OBRA 3VFSA 1M05A 2PTTB 3MLWL 2RBLA 4HJ0D 1OWRM 3VXRB 5GS1A 3NCFB 1LE5A 1MCQA 3CD4A 4RMRA 3RGHA 1H15B 1T04A 1TZGH 4YBQC 1QLFA 5TQ0H 3WIHH 3RNQB 1TQBB 1ERNA 3FHAA 3VRIB 2YD2A 2X4SB 3MRGA 1BFVL 3PL6A 1FYTD 3TN0A 3MGOA 3P73B 5IFAH 2CKNA 4X6BA 3ISWA 2EDWA 4P48A 4JRXD 3W5NA 3Q6FA 4KK9C 4JG1L 4QHLB 1XH3B 1T66C 3PXHA 1UYWL 4Y4KC 1RAMA 3QEUA 5FYJU 3HNSH 4FFZL 4NNPL 1Q0XH 3KYMA 4OCNC 4S1SH 5E7BA 5I1CH 1RHFA 3GMMA 1X5HA 1SVCP 4F58L 1PBYA 1D5XB 1MPAL 3F7QA 5DD6A 4U6VL 2P24B 2A6KB 1NLBL 1R5WA 2P7TB 1XGQA 3VA2C 3IJHB 4JANA 3K8MA 4Z8FH 4IRSD 1L7TH 5JO5B 1NDGA 3H3PL 3ABZA 2V9RA 4JRYA 4KI5C 3QUMB 3QWRD 5EPMB 5E95B 4OF7A 5I17B 2W91A 5TGBB 4LSQH 4HX1A 5A2FA 2WUCL 4FABL 3BWUC 4JREB 4S2SA 4K9EH 5DLMH 2JIXD 5DZNA 1XF4A 3MLVL 1BPVA 1HZHL 1OAKH 1NFDE 3FQNB 3RVUD 1D6EB 1X5GA 3RWCB 4Z7UA 3MRQA 1RJZB 1U93A 3P40A 1UWEL 4PJ7F 2F8XC 2FEDC 2A6JA 2HH0L 4PJGB 4KKLD 1C5BL 5C6TH 4XPGH 3D25B 3CUPB 1HNFA 2VH5L 4BFGA 4X98B 2QQQA 3L7FB 1Z5LB 3E0GA 3HZYB 4Y7MA 3SDDB 1B90A 4NQCB 5C0RH 4MNQD 2IBBA 3OAZK 3I84A 5F7DA 4OZIF 1KTLA 3MLXL 3WYRA 4LMQI 1UEMA 2FX7H 4I0PC 3E6FA 1DANT 3AMLA 4YNYA 1A1NB 1WZKA 2UWEE 3P0VH 3MFFB 5KG9A 1JF1B 1IQDB 4Y5YB 3MUZ1 2I27N 3WXVL 2DMBA 2FGWL 3EYFB 3WFHB 3QDJB 4LSSH 3LPWA 4JHZA 3NA9L 4CMHB 3KYNA 5KVGL 1W8OA 3HC3L 1JFQL 1JV5B 5L8JB 2YBRB 1QOKA 4H0GA 2VABB 1UC6A 5TF1L 3RTQD 2W60A 4M9PA 3HCVA 4BZ1H 5E94B 3GJFH 3TZVD 3VXQB 5K9KB 4W6XB 1NC4D 4NO5B 4XC3L 1VFBA 3I75B 4NSKB 4X0KA 5D7SH 2RJMA 2GK2A 3G5YA 5D1QC 3HRZB 5EZIH 1UFUA 1U8OB 2EXWD 4F7PA 4GKNA 5HDLA 3OB0H 5SX4H 5AZEL 3KR3L 1REIA 3VGHA 3MRDB 5TQ2L 1FNEB 1HWHB 3DETC 2DLFH 3B9KB 5FKAA 3P4NA 4ELMB 1WWAX 3SKNA 1RV6X 1Q0YH 4FTVA 3EDFA 1MFCL 1CE1L 3SE4A 4QEGA 5I1IH 5EBLB 4X9GA 4HJGA 1DSFH 3LKNB 3RWJA 4KI1A 4HFWB 1OM3L 3BP4B 4L8SB 3PP4H 2G5RA 5B38G 3ARDB 3N85L 3DX9A 1BX2A 2O5YL 5KS9A 5C71A 3S3PA 2A9NH 1KULA 4EIZC 3H3BC 5IMLA 1UH4A 5IQ9A 2FBJH 4F7TB 2D7PA 3K0WA 2FYYB 2VLRA 5D1XB 4M3JA 1BVKB 3HE6D 1CCZA 1AD0A 4K9EC 3FB8A 1KJ2B 1PD6A 5LCVL 1K8IA 1U8HA 2RCSH 3EHBD 3OHXB 5F8RC 3VG9B 2P43B 3IU4H 4XP9L 3ULVD 3VGEA 3EJYC 5I6XC 4KI5F 4E41A 4N5EC 2VDLL 4BSVA 3IDNB 1N26A 1L0XA 5JZ7D 1ROWA 4KJQD 4NFDA 4I5BB 4W68A 2E5EA 2I07B 2IC2A 2XICA 3MA9H 1ACZA 5IF0A 1X5YA 2R1WA 3CVHB 4LAQL 4NO3B 2CDFB 2J6EL 4P3CH 4FFVC 4NZTH 1QYGH 3QQ4A 5I9QB 2YC1A 3MV7D