4HS3B

Crystal structure of h-2kb with a disulfide stabilized f pocket in complex with the lcmv derived peptide gp34
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Peptide-independent stabilization of MHC class I molecules breaches cellular quality control.
pubmed doi rcsb
source organism Mus musculus
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hs3B00
1RJCA 4ISVB 1JRHL 2CIIB 3ULVL 2OK0H 1EGJA 5FO7B 2ZWLT 3LPWA 4RX4A 3HE6B 3H3PL 3LS5L 5DQ9B 1VACB 1R5WB 3T3MF 1IC5H 3I3DA 1U3YA 4KTDL 1GAFL 5DEGA 2GSGA 2C3XA 1A7RH 1IGIL 2NY4D 1WBXB 2VXQH 3SE3A 1PAMA 4OV6F 2CDGA 4LLMB 1AGFB 4ZSOE 1DQDL 3SKJL 2RCSL 3MV7E 4PV9B 1BAFH 4RGOH 4RQQA 4NQDB 3BOVA 4F7PA 1H3TA 5LGKA 1WFNA 1JIBA 5T1KD 3TGXA 5E6IC 5I17B 3U7YL 4ZDHB 4P46B 3RGVD 4LCWD 3MV8B 5AD0B 2A6JB 5B4MC 4TNVF 4W4OA 3P11H 5IESH 2O5YH 2RFXB 2NY5H 3BRFA 1S5HB 5H35B 5DTFA 1IEAA 3AAZA 2NY2C 2CXGA 3U0PA 1BJMA 1MFAL 4Y4HA 2QV2A 1DVFB 1RZKC 1OSPH 1BQHB 3IJSA 2D7TL 2ICWI 4MJ5A 1FJ1B 4HBCL 4D0CB 4OCRL 3WNOA 3V52H 5KJRH 3PHOA 4XPTH 1GJIA 1I4FA 3ARDC 5D2LA 1V7MH 2X10A 4DVBA 3TNNB 1LO4H 2I9LA 3OB0H 3V0VB 3OGCA 3X12B 3NTCL 2GFBB 3VD4A 2FO4A 1BVLA 4P23B 2R2BB 1YEHH 3NACL 3O6FC 2KZ1B 3SQOH 2O5ZH 2YPKB 3TV3H 5INDA 3DUHA 4G5ZH 1AR1C 1FFPA 1D5BB 5C9JA 2BOCA 1KGCD 2ITDA 4ERSH 4I0PB 3GMNB 4LASH 3BKML 1VADB 3UTTD 1CYGA 1M7XA 4YDKL 2RJMA 3EZJB 3RWEA 2GSIA 1FLTX 5F6IB 4BZ2L 5ITBL 1NBQA 3PWNA 1BQUA 1UQSA 1N5AA 1FFRA 4NO0D 4XCEB 1WCQA 3MXWL 2DQTH 1REIA 5F7FA 4PLJC 2EXYD 2K9UA 2KPNA 3HC3H 4N0YH 1UC6A 5E1AB 5TE4L 4YK4C 4YBLB 1I1AB 4Y2DC 2R29H 3DI3B 3IVKA 8CGTA 3QYCA 4KTEH 5IHBA 3T0EE 5B3NA 1T0PB 5IB4A 1OGAD 2XTLA 1G7IB 5IT2L 4X7DC 1HI6B 5D1ZC 2XNAA 2BSTB 5EBLA 4MHHI 4XAWH 3RNKA 2VXTL 2XKUA 1MY5A 4C56A 2EIEA 3F62A 3ZDYF 3RIFK 4R7NA 1KXQE 3O4LD 5C71A 4HWEH 3CFDA 5EOTB 2VLMD 3JWDH 3CVIL 4L4VB 4MJID 5IMKB 3KAAA 4Q9CA 1MRFL 3QEQE 4R26H 2XWTB 1GGBL 2VH5L 5IB2B 5E9DD 2I9TA 2MPAL 4Z7UF 3WKML 1QEWA 1ZLWH 2R2HA 1INQA 3I85A 1NAMH 3GMQA 1ZHLA 1S9XA 2NTFB 3GJFK 3QUMB 2BHZA 1JFQH 4YXLL 3L3KA 5A3IC 3T3PE 2ZCKH 2BFVH 5EC2B 2FH8A 3MZGB 4FZEH 4ORGA 4MQ7A 2X9YA 1GZQB 1KNOA 1KGCE 1B9ZA 1K2DA 5BVJB 3UTTE 1A1MA 3BAEH 3K46A 4MWFB 3U83A 4LBEA 3K80A 2ZNXA 3TPKA 4PJAB 1H5BB 3BP7B 3QFJB 3REVB 2VXVH 3OKMB 2BNRD 2YN5A 5CEYB 1XGYL 4XWOC 5DD0H 4XMKL 4BSVB 3LQZB 1CFTB 5TH2B 2IFFH 3WN5B 4U7MA 3C8KB 3BGAA 5CS7A 3TN0C 1NGWA 4UT9L 2AK4D 2LTQB 4OAWB 4YDIH 1GC1L 4AMKH 2VN4A 4BUHA 2E9BA 1PKOA 4KI5D 4LIQH 4GW1A 4YHLH 1HKLH 4WDIB 2EKSB 5JR1L 4EI5C 1Z3GH 1LO5A 3H9SB 1NC4A 4YZFE 3DXAE 4XCNB 3O4LE 3PGCA 3QO1A 4Y5YC 5HYJE 4Q9RH 1MFBH 4MJIE 3OG6B 5JOFA 5HGDA 3VGDA 3DMMC 4FQXC 5E9DE 5HTSA 3WNPA 3FO2B 3MYJB 1UEYA 1S3KH 3KYMB 4Z5RA 3VRIB 4J8RA 4G43A 3F7VA 5D5MA 3QJHB 5JORB 5FA3A 3TESA 1ADQL 3SKOB 4IOFC 3MJ9A 2ADFL 4EI6A 2CGRL 5CEZD 2HYMA 5TE7L 1FH5L 4YDVB 4X7SH 1OAUL 4IOIB 2NW2B 2YSSA 4N0FB 1MFEH 3HG1B 1FNLA 3IDJB 4NN6B 3DX9A 4YHOL 3QCVL 5IMMB 5I8KH 4AEFA 4PV8A 1TQBB 1EDQA 1JZ4A 1BREA 4NT6B 4NQCB 4Y4FC 5B38G 5FA4A 1IQWL 4KKLD 2ICWA 1QFPA 3MRNA 4PJEF 3BHBB 3V2AR 3ZSTA 4JG1H 4WO4D 3D0LA 4KPHH 4LMQI 1YY8B 4M3KB 4MSWB 4K2UH 3HUJB 4F9LA 1DANT 4RZCB 4YC2C 1GVIA 2DI9A 3Q5TA 5T5FH 4RMUA 5IBUG 3QQ3A 3C6LB 4R0LA 2P24B 5DRWB 2BY1A 4YIQA 4DUXA 4B7IA 2AJYL 5D2NE 1OCWH 2AQ2A 4BK5A 1PZUB 5HYQB 3AROA 1TIUA 2XZZA 4UDTA 1S9KC 3X13B 1MVUB 1BBJB 4XRCB 1U8NA 4ZODA 4AIZB 4G8FA 3MRRB 3EJYC 1AIFB 1I8LC 2BSSB 3AU1B 2Z31B 1S7WB 1L4IA 3B9KA 3L95A 5KAQF 3KYNA 3MLRH 1LP9F 1OQOA 1D6VL 4XAKD 4WI7A 4O2EA 1IAIH 4TVPH 1WCBA 5C07A 2QHRL 3CFIC 3VXQA 4YE4H 5TGBA 3RWGB 1OTTC 5D9SA 2JJUA 3QZWB 1KUMA 1Z6JT 4HSQA 4P4RB 1HWGB 3OXRB 4JFYA 3RPIB 4L8BA 4XBPA 3RKDD 3OKEA 3UJIL 1GCFA 1T1YA 4Q6IB 4KUZL 1KCVH 5AAMA 4LSUH 3CC5A 2VYRE 4TRPL 5EB9A 3LSOA 3MRPB 3FO0H 4BZ1L 4OZFB 4JPIB 3B2UC 2OMNA 3BKJL 4NPYA 4XPGL 3N1FC 3HFMH 4XVSL 1FFOB 3U4BL 4C59B 4P59H 1OTUC 1AGCA 4K3DL 1LE5A 2W9EH 3DUUA 2HJLA 1DR9A 3S35L 5LGHL 1NANH 1ONQB 5JTWA 1GOGA 2FLBT 2BC4A 4UUJB 2VLRB 1YDPB 1D9KB 3IDMA 4WGWB 5GRZA 1UA6H 5CIPH 1ROWA 1IGJA 2VRAA 5EZJB 5HHPB 5I74B 3U79A 3RUGF 2QADD 3GSUB 1WBZA 4WI8A 5AYUH 3I6KB 4WI6A 1T21B 4YLQT 4X9IA 4YHPA 1P6FA 2J6EA 2MQCA 4P5TA 4I18A 3KS0J 4HFUL 5GJTH 1AQKH 3ULSA 5H2BA 4GO6B 1CLZL 5B22A 4XAKE 1BLNB 3MODH 1BQHG 1KLUA 1Q9LB 2XRAL 5IMOA 3I50L 3IXAA 4TUJA 4G3YL 4NHUB 4DK3A 3W2DH 1BF2A 3RDTD 2A38A 1MLBA 4IRZL 4X6CA 1KCLA 5FYKH 2DQCL 1S7XA 4S2SB 4X7CC 4XP6L 3G08A 1F90H 3TBSB 1R3HB 2DTMH 3KNBA 3FQUA 5CP3H 1J1OL 4ZPVA 2DQGL 1IZKA 1NEUA 5E2WL 4F7EA 1MCHA 3CLFL 4MYWB 5GSRA 2YPLD 1CDJA 5EA0L 5E6IB 3M1BA 4OD2B 2FZ3B 1SJXA 4JDTH 5FUOL 2COQA 4H0HB 5D71L 3TH3T 2Q87A 3V5KB 2IBZX 3ESUF 3QIUA 1T6VN 3P40A 4URTB 2OJZL 4GG6E 3EDEA 5J8OA 2DQUL 1WC7A 4R8WL 1KB9J 3HNVL 5I18L 5TQ0H 2NY2B 3P9LB 4PJFF 4MXWH 3VXUA 3HC4H 4WTZG 4L8CB 3JV0A 1XGTB 5D7KE 1ZWIB 4GQ9L 1WGOA 3O9WD 3EDDA 4L8SC 5KSUB 4H0GA 2VAAB 2QR0A 4DW2H 2O5XL 3CU1A 3ARDB 1FDLL 1ODAA 2C1OB 1CN4A 1ORQB 5DMKA 5JIPA 2J8HA 5JMOC 3WO3B 3V5DB 4KI5F 2HFGH 4NM8L 5HGBB 1F3DJ 5F88A 4Z7VE 5ADOH 5KSBA 4G6FD 4MNGA 3O6FB 3EYUH 5C0AE 3D5OF 1N0XH 2VDRL 3WHXB 5BZWB 2FD6H 5HHOB 1LE9A 4ZXBD 1UWGL 3H9HB 5ESVA 5DJ8A 1BWMA 2DQDH 4I9WD 3G04A 5EC1A 1PFCA 4NRYB 5EBGA 3LKRB 4N0CC 4P4KC 3OB8A 3RPKA 2ATKB 4BH7B 1RUAH 3GMLB 1KJVB 1K8IB 4DN3H 1EVTC 4W4NA 1YECH 4YK4B 5D70H 2J5LC 4CBPA 2LAAA 3Q5YA 1R3KA 2VC2L 2AEPL 4Y2DB 1CFSB 4XNZC 1N2RB 2Y4SA 4TVSa 1W72A 1TTFA 2D2OA 4NZRL 3T1FB 2AXFB 4M7JH 5FKPA 1XIWD 4YWGH 2PTVA 1JUFB 5D1ZB 1J11A 2ICES 3B9AA 1CZ8H 2ZNWA 4WY7L 3B9DA 2NW3A 3N1QC 1FZMA 4HULB 5KANG 1QFOA 3GMMA 4S1RL 4EIGB 4TUKH 3U0WL 1PG7W 4KZDH 2IAMC 2X9WA 4LSTH 1FV1B 3QUXD 4QRRB 5A2JH 4NKMB 1FVDB 2ARJA 2B39A 3RVTD 3IFNH 4RRPA 4U49A 1YN6B 3D25B 3VWJD 3EYOB 4XVUC 1JV5B 4JDVA 2CMRH 1C7TA 4DGYL 2ESVB 4PRHE 5B21A 2UVEA 2OCFD 3G6JE 4Z8FH 2AJ3B 3RWCB 1KXTB 1ZSDB 2XTJC 2IPTH 1XCQA 4PJ9C 5HD8D 1WAAF 3K7UA 4KRPC 1BX2B 1MWAA 2X4PA 3T8XB 3RJDA 4OFYA 5E6ZA 3I75B 2DJ4A 1I7TA 4ELMB 4LSQH 3SBWA 4I9WE 2N1KA 1QFWL 4U4BA 2EZ0C 3WUWA 4GRWH 4OF8A 4ODTL 3KPNB 4XB8A 4HKZA 5CCKH 4NKDA 1RIHL 1AE6H 5H37G 1GRWA 1MAMH 35C8L 2DKUA 1I8IA 3G5ZB 2IPKA 3AB0C 4UIMA 4WU5A 4M4PA 1MCNA 1MIML 1JWSA 3T08A 43CAA 4UINH 5C0IA 3RY6A 5E94B 3TN0B 4X0KA 5A1AA 1OGTB 1CIUA 3S36H 3WIIL 2VDOH 5IQ7H 3CNKA 1K8DA 4Y16A 3SDCD 1FZJA 2JIXB 1SEQL 5EBMA 1QACA 1WV7T 1T1ZA 4EI5B 3RI5K 5L2JB 3JTSA 4BSWB 2JK5B 1BD2B 2C3VA 3TBWA 4Y5YB 4EBQL 3HI5H 5CP7A 1GGCH 4M48H 2Y6SC 1I8MA 2Q8BH 5IFJA 4JHWL 2ZUUA 1UJ3A 4KXZH 3HE7C 1YUHB 3DMMB 4FQXB 1MVFA 5JW3H 2GHWB 3S34H 4DWHA 2CO7B 2J8UB 3JV4A 5BMFL 4X9GA 5I0ZA 3BH9B 1CK0L 1HQ4A 1EGJL 3BDYL 3L7FB 3I02B 2VZTA 2P46B 4XNQB 3VRJB 2FX8H 1AH1A 3P0GB 3U7WH 4NUJA 4JJHA 5DC0A 2BRRL 1OAKL 4E5XA 3ARGC 1RJYB 2VITB 3MA7A 3KPQB 3LEVL 4Q74A 3V0AC 1TVBA 2AEWA 3T04D 1Q1JH 1M7IB 5DJ6B 3GMOA 3VGAC 2HFFB 5SWSA 3N1MC 1ED3A 1UH3A 1UWXH 2Y5TB 3QQNA 4HXAH 5JPNB 2OXHA 3MRBB 3NCMA 3NFSL 3D69B 1OOAA 4TUOA 4J7RA 3D2UA 4Y4FB 5HJ3B 2I27N 5BVPH 4J4PC 3FFCE 5T1LB 4QXTA 1KCRL 4ZYKB 1ZLWK 4LSRH 3QQ9C 2R9HD 3ETBF 4F8QA 4P5MA 2FR4B 1KJ2A 3RRQA 1FN4A 1LWRA 5FYKU 5IOPB 1YNKL 1MIEH 3IDXL 3OSKA 3NCJL 4PJHB 1U95B 5GS2H 4YC2B 1X44A 1KIUA 3KYOB 4G7YL 4CDGC 2VLKD 5E8NA 4IHOB 4OZFG 1WUNT 3IDNA 2V5RA 4MAYA 4FMKA 1AO7B 4NNXB 4MQXD 3CDGA 4ENEC 4WNQB 2HTLD 5A16B 3WEXA 1NC2B 1SEBB 1N0LA 1F58L 4OZHB 3DRTB 1BF8A 5FDWB 1LQSR 3RX5A 3PWPB 1EO5A 1X4XA 2H1PL 1VERA 5C0BA 4YX2L 2B20A 4KTYA 2HT4C 2Y7QB 4M6OH 3HRPA 1HHHB 4HHAA 4PRPD 5F1NA 5CEXA 1YEFH 5HSFA 4HUVA 1IKFL 3EGSA 1U8HA 2I5YH 2HKFL 5FK9B 3V0WH 2X1QA 1IMHC 3QNXB 3B8SA 3CSPA 4LRIC 4P57B 4TNWK 5IVXE 1VPOH 1GC1C 4HIJB 3G6JF 4HF5H 3KLDA 5HGGS 3RTQC 1U0QA 1WK0A 4ZD3H 4MNQA 1HZHL 2D03H 5EU4A 4H26A 4X80L 2X4UB 3E6FA 3DX7B 1CQYA 3K4AA 3X11A 1E4KA 2AJZB 3O2DA 4FQ1L 1L9NA 5DJDA 3VXSD 2DL2A 3V5HA 2DWDA 1CDUA 2AQ1A 3BUYA 1KENH 1XR9B 1B4JH 2EIDA 3DBXA 3C87A 4YHZH 1G9NH 5JW4N 4KGJA 2MWCA 3PL6D 1DE4B 4JQXC 3VXRD 3AS3A 4F58L 4B53A 5I1KH 1GPOL 3ALPA 1XF4B 2OZ4H 4NKIH 3CFBB 1BECA 2NY3C 1M05B 5F93C 1G0YR 4L4TA 2MKWA 1L7IL 3FQXB 3EJJX 4FQJH 1KSRA 1ZA6B 2AK1H 2YRLA 4PJXE 1DP0A 1U36A 4PRBB 4UQ3A 2B4CL 4WW1B 5IM7B 1BGXL 5DQJA 2YPVL 5J56B 4RFEA 1VA9A 5CLWA 2A77L 1SM3H 4IJ3C 3KPRB 1BQLL 1A4JB 3K0WA 4WHTB 5EZOL 1E4WH 4OSUH 2MHAB 4G9FA 1CFNB 3CPLB 3QUZD 4YH6A 3TT3L 1IFHL 2FBJH 5F3HB 5D1QC 4ZFZA 5IR1A 2NY1C 4Y5VA 1C12B 4NZUH 2HVJB 1RZJH 2EDTA 2HP4A 3BEWB 4FP8H 3MLVH 1HSAA 5JDSB 3F58L 4ODBD 4ZSOA 1LNUB 1EEYB 1FL5A 1I9RH 4QHKI 1P4BL 2KQMA 3MV7A 5C0DB 1JHKH 5GS1A 4Z9KB 4Y1AA 1JWUB 5E2VL 5GS0D 2Z92B 5JQ6L 2NY6D 3MO1B 1T2JA 3SOBH 3QWRD 3X3FH 5J0BA 1BMGA 5DUBA 4ZNCD 4LHJB 4JHZA 1OD9A 2XN9E 1KIRA 3NIGE 5LQBL 2GITA 1MH5B 3O0RL 4YHML 4CN6A 3VFVA 2VWEC 3HZMA 3LN5A 4G6KH 4RMTA 5HYSA 1QSFA 4NYLA 3I3EA 1XR8A 4HPYL 1RZIA 3FFDA 3I6GB 3GSWB 1QKZH 3WLBB 3LMJL 5FFLA 1CF8H 1KPUB 2IQAB 3QULA 4JR9H 4KFZC 3ZDXF 4JPVH 4DK6A 1MHCB 1EFXB 2BOBB 5MI0C 1AD9A 2WK2A 3VFTA 5DLML 3RVVC 4KJPC 5IB5B 5ENWA 4GRLA 3C60D 4GKOA 1F8TH 1N64L 1JTOA 1I7ZB 3STLA 1QR4A 2W0LA 5F1IB 1CL7I 4ZMAT 2EH8H 2X70B 1IM3B 3WFCL 3BH8B 1NFDE 4XP4H 1TTUA 2YD9A 4M1CD 1AGBA 1EFQA 4U2ZA 3KPSD 2N7BA 4LQFL 1W0VB 1BZ7A 5C0ND 1DQJB 3BZ4A 2NMSA 2RIKA 1T5WB 4PJEA 3T4YB 3LD8C 5JHLH 2BSRB 4D9QD 2ADGB 5J57B 4P4KB 3KWWB 5KVDH 3BRGC 1QBBA 4RIRA 3ARBB 2ZSVB 3MFFB 3S98A 3I84A 4GAJH 3MA9L 5DRZB 2DTSA 2J5LB 3QDGB 5DZLA 3UP1A 1PBYA 1XGRB 5I1IH 1A2YB 4XNZB 4X9FA 4POZD 4WUKH 4X99A 2XKNA 5DJCA 5IK3B 3QNYB 2N7AA 3PWVA 3LQAH 1MHEB 4NBXB 1P7KB 2FX7H 2A9ML 5T1KA 1QBAA 4K8RD 4PGBB 2ZOKA 4PY7A 3S88L 5E08L 3VG0L 3RGVA 1NCUA 4LCWA 4F9PA 3T0EA 3BZFA 1QYGL 5HPMA 3CU7A 3QQ4A 3TZVC 3LQMA 4H20L 4C83B 2IAMB 3MBED 3O3BB 3O6MH 1LP9A 2DBLL 2FBOJ 1J0YA 3DHMA 3CAFA 3SE8L 3BW9B 5DVOA 4PJIF 4DN4L 3UYRL 3QA3B 2DD8H 1HH9A 1U2HA 4O58H 1VGKB 5EU6D 5BV7H 2XXCB 5D7SH 5TDPA 3OAUH 2OQJB 1I9JL 2ZUYA 3LKOB 3BPCB 3PABB 2K1MA 2VDML 2EDXA 2XTJB 4XVTL 3UJJL 4PJ9B 5JW5A 5IHUH 3GRWH 4MA1C 4JDZB 1KIPB 3OJ2C 4HUKB 3RIAK 3CK0L 1YYLL 4KRPB 3BP5A 3PWUB 5IFHH 5FOBB 5DS8B 1FVEA 1T66C 2ICWJ 5E5UB 3FOLA 3L3OB 1H3PH 3NMEA 1HCFX 3EO9L 3V95A 3UTSD 3NH7L 2KQNA 5I1CH 2P5ED 1MCJA 1A5FL 1MHHB 2G75A 4YQXL 5DRNA 4D0DA 1RIVH 1FZKB 2XFXA 3UTTA 3PF2A 2YEZB 1EAJA 1T4KA 1T0MB 3O6LH 1RULH 3Q0HA 1P4LA 1CU4H 3DYMA 4YUEH 3TIDA 3ULUL 3AB0B 3W39A 1IBGH 4IEFB 4NO0A 1KV3A 1CICC 4DKEL 4Z7NE 1U8PA 3QXDB 3RWFB 4MDIB 1G9MH 4MAUH 5D1XD 1PG7H 3VXMB 2PW1A 3L3DA 3STZA 3I6LD 4OI8A 4QOKB 5FUZL 4M1DH 4F7TB 4JFHD 1G7HB 5HHMD 1T2QH 1OGAA 4HIHB 1ITCA 3S5LB 3ZTNH 4MD5A 4G9DA 2EYSA 2NZ9C 3BE1L 5JHDD 5D7LB 3GB7B 4UV7H 4PTUA 1MFCH 1S7UA 2BVQB 1RZ8A 4U1JB 5K9JH 2BDNH 3NIGF 3HE7B 1OWRM 3O4LA 5FYJD 1PX4A 1A7NH 4I77L 4XCFH 3HMXA 4MJIA 3KPPB 2JJTC 3UO1L 2OP4H 1HXYB 4WI9A 5E9DA 2R0WH 3D48R 3SCMA 1BIIB 1HOCA 1VB9A 2YWZA 5DXWA 2DMCA 4PJ7B 3S37H 3Q6GH 2AI0L 4Q6YA 1ZVYA 3ARGB 1QSEB 3EOAB 1ZGLP 1LK3L 1X6NA 3U6RA 3IKCA 4FTVE 4K9EC 4JM2C 3GMPA 4GJTB 2VISB 1WVZA 3VGAB 1ZAGA 1HXMB 3FB8B 4NRXB 1JN6B 1V7NL 3BYTA 1KLGA 2P5EE 5DFVC 2AJXH 3FCTB 4PJFA 1IC4H 3GSRA 1OAYL 1A6TA 3TO4D 3O8XC 2BNRA 1HYSD 1FLRL 3HPJA 3N85H 4K07A 1FNEA 1LGVA 1EEUA 1JPSH 4PG9B 3RZCC 4U1MB 5AUMA 2R1YA 5CJQH 2ZUSA 1P7HL 4WFFE 3I6LE 4IDJH 1M6OA 1ZT1B 4J3TA 4DQOL 1GIGH 5HHME 2AK4A 1UB6A 3H0TB 3GSQA 2FWOA 1X5KA 4Z76A 2DKSA 2YZ8A 1AY1H 4F57H 5B3JF 3SKMB 5JHDE 3E3QE 2FLRT 5CSGA 4V1DD 5L7XH 2RAMA 3BT2H 4LAJH 4MA3A 1TCRA 4WU7A 5H94B 4HK3N 3BMVA 4U0RC 4P5KA 2X05A 5HDBE 1KEGL 3GHEL 4DZ8B 4KVCL 4Y19D 2DDQH 3E2HC 2DM2A 4JFEE 3ECBA 1CT8B 3U1SL 3EFDL 2H2PD 2EYTA 1HWHB 3RTQB 3VFGH 1JF6A 3NFPB 4UIKL 4XPAH 4PJGF 5IEHA 4JANB 1BVKA 2DI7A 3QPXH 3O2WL 1JVKA 4YHIA 2XZAH 5IW6B 5F7HA 4RGNE 2FIKA 1W72L 3T65A 1SMOA 3CFKA 1MPAH 1VGEL 4X4XB 4MS8D 4WO4A 3MSPA 5GZND 1CDHA 2EDJA 4I5BB 1HIML 3RWDA 5IMLB 5JXED 2R23A 4IRJC 1N7MH 4PS4H 2H3NA 5DD3L 2PW2A 5I8EA 4P2RD 4D3CH 1UACL 4BFGA 3KYKL 1T20A 4Z7NF 2NY3B 7FABL 1JZ5A 2GTZA 1DQQB 1UWXK 3ZO0A 5GRVK 1NDMA 1ZMYA 4MD4A 1QTYT 4NGHH 1YEDA 2FX9H 5IBTH 5SWQA 5CJXC 4HZLB 4KROC 5FF6B 3BGMB 3F7QA 4A6YA 2EC9T 4IJ3B 3GI8L 4R4BB 3SKNB 1U2CA 3B2VL 4JY6B 5IIEA 4EN3D 4MZ3A 2VQTA 4LCYA 4EVNB 3ZE0E 1UT9A 5KZCB 1OARL 5D1QB 1MWAL 3HZVA 2NY1B 4NCC2 5D2NC 2E8YA 1JRHH 1K3ZA 3ULVH 2KL6A 4Y0GA 5GGUA 4Y4HC 5TE6L 5C0JB 3H3PH 1TPXC 1DBKL 5MP6L 2WBJC 4X6EB 4PP1D 4MMZC 5F96L 4G8GE 4E41B 1J1PL 4KTDH 1GAFH 4PLKD 1F4HA 4LSSH 1IGIH 2X4NA 1D6EA 5ISZD 4WV1A 3UBXG 1DQDH 3OKNA 3HN3A 4H25A 3SKJH 1HCVA 1LK2B 5I66B 1AQDB 2RCSH 1QHPA 1HHGA 4LSVL 3CDFA 3G6AA 2EDYA 1ZT4A 3WFHA 1URLA 4PGZA 3OX8B 3IF1B 2IANE 4BH8B 3U7YH 4BQ6A 4JKWA 5FO8A 1OAXL 2P5WD 2OI9C 4K23L 3F5WA 4FXKB 1UB5A 5I76A 4L3ED 4O5LL 4LDOB 2H32B 4RFOL 3EFFB 2UV3A 2VIRA 4BZYA 4X6DF 4J6RL 2B1HL 3QXAB 2HLFC 4U6YB 1MFAH 3FKUS 5MI0B 5IWLA 3CVHB 3PQYB 2D7TH 2GKIA 5E2JA 4L29B 2QSCL 1A6WL 4HBCH 3WNKA 4OCRH 4YO0A 2AJUH 1XF2A 5AZ2H 1Y0LA 2F5AL 2E7HA 3LKPA 3HE6D 4JY4B 2D9CA 2YZ1A 3LD8B 3BUTA 3L5XL 4LIQE 4WI5A 3HI6H 4NKOB 2ZKHL 4QXWA 1G7JB 1N59A 5E8PA 4MA7L 2HLAB 2EXWD 1AD0A 5DI8A 3RDTA 3NACH 3RL1A 4L5FL 4IIQC 1I1YB 1K3IA 3EOYG 1JNHA 5C2BL 3BKMH 2VXUL 3HB3D 4YXKH 5ISZE 5F9AC 5AWNL 4NQDD 1GGIL 2YPLA 4YHKL 3RVWC 2B4CC 4BFBD 4BZ2H 5ITBH 4PTTB 3MXWH 4BQ8A 4NOFA 4P46D 4BQCA 5TE4H 3MV8D 1LEIA 3TZVB 4TQEL 4EJ1C 3U9PL 2CK0H 4LSPL 1J88A 4J12A 2P5WE 3TCXA 1GZPA 4R3SB 2F15A 1I9IL 2XQBL 1CGWA 5IT2H 4CMMB 4AT6B 1JHTA 3BXNA 1DVFD 4DOHE 1X9QA 1YZZA 3BSZL 5KTEL 2CSPA 3Q2CA 1YNLL 5IQ9A 3RQ3A 3GSNB 4OGZA 2V5MA 3T77A 1I8KA 3O9WA 3IS1X 4ZUWB 3S5LG 4PRDB 3BMWA 1INDL 3CVIH 2XV6B 4J3WA 5ANME 1UG9A 5ID0A 2D0FA 3G6JA 1CXEA 1FC2D 2VAJA 1GGBH 2F54B 4MA1B 1M71B 5F70A 1NGYA 1U92A 2MPAH 1C7SA 3GM0A 1KULA 1ZHBB 3FOMB 3WKMH 5D96C 5ALCL 3V6OA 2C4XA 2Q86A 4AH2B 1HINL 4P23D 5F71A 3MJ8A 4N8CH 2QKIA 5T3XL 3P0VL 4NIKB 4R4ND 4YXLH 1JMZA 1UJTA 4ZXBA 4XWGL 5AG8A 1L7TL 1SHMA 1IEBA 2G60L 4I0PD 5JLZB 5J6GB 5GRXG 4EDXB 3EJZC 3O2DL 2Z9TA 3DWTA 4U1HB 1YEEL 3OKDB 1UYWL 2DIBA 4N1EA 3RX8A 3G5VB 1CICB 4C58B 4N0UB 3B4NA 2NTSP 1JGEB 3RWJA 2K3TA 1PKQB 1LVEA 2XOTA 2IH1B 5I16A 2Z0BA 3OR6B 4TVPE 1I1AD 3CZJA 2GTWA 5ETUB 1VFMA 3FZUC 5DGQA 3O3EA 1SJEA 5BO1H 5C2UB 1Z5LA 4Z0XB 2AV1B 4K94C 4KK9D 1XIWA 3MV8E 4U1SB 3SO5A 1DEEB 3DV4A 3UTQB 2CDEB 5DK0A 1A7PL 1B6UA 3L3IB 4UT9H 4ONGL 4KRLB 5DD1L 3PWJA 1GC1H 5DRXB 3QEUB 3LS4H 4XTRC 2BSED 32C2B 1N8ZB 4L4VD 3WDJA 3QI9B 5JR1H 5JUEL 3QH3B 1C1EH 1U6AL 4QHNB 4G80B 4PB9L 4WJ5B 1A6ZA 1J8KA 1DUZB 3SN6N 4WW2C 2WIIB 1SY6L 3VWJA 3BPNC 1Q94A 2IFGA 4XC1H 2HFEB 3TIEA 4YNYA 4XI5D 1KYOK 4P0DA 4Z0BL 1MUJA 4CVZA 2W1NA 4Y8AA 1X7QA 5J1TC 3WXWL 4JM2B 3QO0B 5EIVA 3TJHD 3WCYA 4QRSB 4U05A 3QEQB 4RA3A 2WNGA 1ADQH 4HUXA 5KS9E 5ITFB 1OT2A 5J9PB 5EFIB 3KPOA 1ZLUK 4ZG1A 5I0DA 1FH5H 4JEGB 1OF2B 2A74A 2CUHA 2C5DC 2BMKA 4LK4A 3FL7A 4G6JL 3O8XB 1BJ1J 3QFJD 2ZZUT 1A6AB 5DUPL 5HVWA 1XZ0A 4OGAC 4YHOH 1ND0B 1H0DA 1KG0B 3OPZL 2VXQL 3NVQA 2Y1VA 3RZCB 4ZPTB 5BW7A 2X4RB 4JAMA 4HUNB 4XNXH 1IQWH 1SBBA 1D3CA 4JHBA 2D4DA 4LHUB 4NBZB 1P1ZA 1LILA 1INEL 3UDWA 4WCYL 1X5ZA 1Y18A 4XPBL 3HAEB 3SDCA 4E0RB 3NPSC 1S78C 5EO1B 5FYKE 2JJWA 1S7RA 2Q7YA 2AQ3A 3FRPA 3GIZH 3GKWL 4YFEA 3ZTJH 3H9SD 2XY1A 4Z7OE 4F3FA 1U3HC 2AJYH 2VL5B 5T33L 4L4VE 1FNAA 2OL3A 5DFWH 3U2SB 4GLRI 4M62L 1XGPB 4HC1A 4U0RB 1H15B 2CLRB 1DLHA 4LKCA 4X8JA 2V7NB 4NQXB 1GSMA 4ZFFA 1OSPL 3E2HB 5F3BB 4I2XA 2GT9A 4Z95L 3QEHA 1D6VH 4MJ2A 2WINA 2R4RH 3DXAB 4MB3A 3AMLA 2WW8A 1T89A 2YKLL 5KJRL 3MLSH 4NDMA 2L4OA 3FN0H 4KHTL 3Q3GB 1LO4L 3HG1D 4QNPF 3KS0H 5TDOA 1OTSD 3MR9B 4IMLB 3EKCA 4B41A 4LEOB 3TO2B 5K9KB 3P3YA 3UJIH 2Y5EA 2X41A 4NQCD 5HI5D 4E42B 4BA8A 3QFJE 4KGLA 3MRGB 3ZTJG 2AW2A 1WTLA 2VSDA 3P77A 3MRMA 4TRPH 4LASL 3S36X 4YXHL 4HIEB 3C5SB 4JO2H 4X5XB 1Z2KA 3FAXA 1FL3A 4IRJB 4APQC 4XPGH 2DKMA 5JA9A 4XVSH 3U4BH 1JYVA 5KSAC 3HCVA 4K3DH 2DQTL 2H9GA 1S9VB 3Q1SL 4FQPA 5LGHH 3KVQA 4N0YL 1HYRC 2AEIT 3C6LD 2VLKA 1NCAH 1YMME 4LVEA 5GZOD 2XPGB 3QAZC 4PBVC 2DWEA 4KTEL 5ERWB 4G7VL 4KROB 1C5DB 2O61B 2E9IA 1JYXA 3LN4B 1PSKH 5GGSY 1OB1B 4GKSA 3U30C 5ICYA 1SJHB 1R3LA 1QVOA 4KJQD 2D3VA 3EO1B 5BQ7A 2CJUL 1ZTXL 2Z31D 4Q0XL 4NOBA 3AXLB 3VMOA 3IGAA 5EG6C 1XT5A 2LVEA 5CILH 1EEQA 4HWEL 4PRPA 5D2NB 1A7BA 4D94A 1BFOA 3U0PB 2CLVB 1CLZH 4HH9A 1TPXB 2WBJB 4XPFH 4KWUA 1JGLH 2OLDA 2XRAH 4X4MA 4CL7A 2FDBP 3ZKXB 4HGWB 1DN0A 4OFDA 4HKXB 4R2GC 2XWJA 4ELKA 5EIIA 3MMEA 3HG1E 4G3YH 1JFQL 5FKAB 5DJYA 4IRZH 4XH2A 5DD6A 5MEPA 1YN7B 4XP6H 1FVCA 4WHYH 3VXSA 1YMHA 1CD8A 5E2WH 1J1OH 1A9EA 3CLFH 1UXSA 4CVWA 5EA0H 6FABH 3BD3A 3BAEL 5FUOH 2X4SB 5D71H 2OI9B 2P7TB 2QLVB 4GOSA 5DYOB 3HUJE 2VLRD 1L6XA 3PL6A 1D9KD 1FIEA 4G8EB 2DQUH 3VXRA 1ZS8A 4R8WH 1QR1A 4NNPL 3HNVH 1NQBA 1EAPA 5AEAA 4XX1G 2DF3A 2V17L 4HG4J 1U8IA 4DTGH 3QPQD 4FQHB 5T3ZD 1LO0L 4GQ9H 4X6FB 1LDPL 5F8QC 1J0ZA 1EUUA 4CU8A 5ICXA 1IZJA 2C1PB 4LDEB 4MDJA 3MRJA 4QTHB 5CHNA 1MLCA 4RMQA 1FG2A 1WZMA 1I3UA 4H8WL 3UPAA 1FZOB 1F6FB 3AREC 4ODXB 4OZGB 4Q9RL 4JFFE 2XA8H 3QUZA 4M93C 5DHVB 4F2MB 1WWWX 5C9KA 4NM8H 4O51B 2HWZL 1NDGA 1QFUL 1SYSB 2HJKA 3LEXB 4PREB 2EDFA 1LHZA 2ENYA 4IIQB 4HS3A 3U9UB 1R5IA 2JELL 1UWGH 1VCAA 1WT5A 1K4CB 4CKVX 1RD6A 3KLAB 4X6BA 1V05A 1IC1A 3GNMH 1DUYB 4Z7QE 5E6ID 4L1HA 4U3XA 3REWB 3V6ZA 3QWRA 4Y4KC 1MFEL 3R06A 4W6WB 3D18A 4O02L 1NMAH 1W0WB 5EU5A 4RFNC 5CJ5A 5I8KL 2VC2H 2AEPH 2VUOA 1CDYA 3TYFB 1X5XA 3TBTB 4HCRA 3U4AA 5ID1A 1SQ2N 5CBAA 3PHSA 2NY2D 1JZ3A 5I8CB 2V2WA 2CO6B 4QHKJ 5IVZA 2P42B 4K3JH 4PJAF 2VLRE 5ACLA 2JTDA 3O2VL 2BVUA 4O2FB 3IJHA 2ZCLH 3HS0A 1JPGB 3EYQD 4S1RH 4GG6B 2APWA 4K2UL 4OI9A 3U0WH 1HSBB 5L0QC 1PGRB 3BZEA 4OM1L 3SGEH 3RWIA 5LJYH 3OJDA 3ARDD 3IU3B 3LN9A 3GMRB 4MB4A 3B6SB 5DK2A 3FB7B 1R24B 4OM0L 3C60A 4YDLC 4PJGA 1OCWL 3RY6C 4FQLH 4LDLB 4DGYH 5CEZL 3T0BA 3O6FD 3ILPA 4LOUC 5FB8B 3KPSA 4R7DA 5LBSH 3U48A 1AR1D 5C8JB 4K7FB 2DLTA 4L9LA 4ZUSA 3DUSB 1P6AB 1YNTA 2PO6B 3B5HA 5M7QA 1IAIL 1QLFA 3BFOA 3QO1B 2EDLA 1N4XH 4HUUA 3FRUA 4Z7VB 1S5IH 4PLJD 5DJ0A 2R1WA 1QFWH 2A1WL 5EOCJ 4CW1B 5C0AB 2A6DA 4NFDA 4ODTH 2XQYG 3VFPB 4Y2DD 4G43B 4OZIE 1ACZA 2CR3A 5EO9B 4LGSB 3QJFB 35C8H 3VCLB 1S7TA 4NZJA 1MIMH 5D1ZD 3CX2A 4LSUL 2V5YA 3DVNB 4HK3J 5FGRA 5JPMA 5JOEA 4RDQF 2BVPA 1XAUA 3FO0L 2CUIA 2MMXA 3PP3H 1JNNL 1LD9B 1WQVT 5IROC 3IB4A 3CSYB 3MBEA 3MRFB 1WISA 3HNTL 4QRRD 4N8VB 1SEQH 4HWBA 4R97C 2DQHL 4LHUG 1OAQL 1CE6B 1MCFA 4WW2B 5E00B 5EU6A 4OBSA 1HH6B 3BPNB 3MNWB 3HUJF 2D31B 4EBQH 4RBPH 3HAEG 4PYHA 4DGVL 2CLZB 2ESVD 3ROLA 5FCSH 3O3AA 2Q76B 4Q9QH 3WNMA 5IJVA 3QXVA 5DJ2B 4X7FC 4HXBH 5A43C 5BMFH 5L9DH 5A3ID 1CK0H 5AYUL 1EGJH 4QY8A 1IGFH 4QHLA 3JWOC 3VFOA 1R3JB 2AGJH 1QPPA 1P2CB 1F4XL 3WE6B 4LLDA 1CS6A 5HHOE 1OAKH 3PDOB 5GJTL 1AQKL 3UTSA 1E4XI 2FJFB 4PRHB 3LEVH 2P5EA 5L88L 4GXUN 3CSBA 4RAUA 2ZSWB 1EUTA 1C08B 1XGQA 4XWOD 2IADB 3L9RB 4MJ6B 3TVMC 1FORH 4XCYB 3NFSH 3R0MA 2UZYB 4WEBL 3L3HB 1I1RA 2XI9A 5D1XA 2BP3A 3FT3B 3TN0D 5K9OA 1E27B 2GJZA 2JJSC 1F90L 4IS6A 4NBYB 1F11A 3QXWA 1YPZE 2QHLA 4F15C 4ZUVB 3QDAA 4L3CA 1YNKH 2JIXD 3IDXH 2H6PB 4IOSD 4J3SA 4Z7QF 4CU6A 4U6HB 1K85A 2MKLC 4EI5D 4G7YH 3GIVB 1LEGA 3CH1B 3UCRA 5JHDA 2V2XB 1BD2D 4JGMA 1U3HB 4QRRE 3HZKA 3RL2A 4LCCC 5I75C 4LU5L 5IB3A 5C92A 5DURB 5ALBH 4CRPA 3DMMD 4FQXD 5FOJA 1KTLB 5SX4H 3H7LA 5JIIA 1QLEL 1X5IA 4LLUB 2DOCA 2BERA 1IL1B 4MXWL 1TNMA 1FO0B 4P2OC 3EOBA 3PGFL 1U8KB 4DCQA 3DX6B 3HPLB 2H1PH 4DFHA 4IOFD 4DUWA 4AIXA 3MGTB 5C0EB 4L1DA 1P9MC 1EH9A 1IKFH 2P8MA 1PD6A 5ELIA 3NN8B 1ULVA 5GISH 2HKFH 3FQWB 5LGJB 3K8LA 5AAWA 3RNQB 4N90D 1WICA 2ZUVA 1EJOL 4OCMC 5ADOL 4YGAB 3LH2L 2OTWB 1MCRA 3O45B 2X4TB 2VJXA 1NLBL 2EKJA 3G5XB 2DLFL 4Y4FD 5DUML 2FD6L 1PG7X 4LVHC 4G42B 3P4LA 5T1LD 5AG9A 3H7BB 2DQDL 4PPTA 4X80H 4K7PX 3TO4A 3T2OA 5F7KC 3JXAA 1B88A 4FQ1H 5CSZB 4APQB 3MCG1 5EUOE 1X4ZA 3LKNB 4U7SA 4P9HC 5KSAB 2C3GA 1A1OB 3I2CL 1H8OA 2X7LA 4ZOCA 4I0KA 5D70L 4I4WB 2WUCL 4KVNL 4U3HA 3OBAA 3FFCB 1BQSA 2A2QT 3QAZB 3VGFA 3LVEA 1AO7D 4R9HA 4LLQB 4GAYA 3BWAA 3SPVB 3U30B 4ZPVB 4F58H 5L6YL 4LF3B 1GPOH 4YWGL 4BFIA 1NC2D 1LEKA 1B0RB 3M1BB 4F7CA 3JVGC 3MRKA 4V1DA 4JCLA 3S37X 3PWPD 2HG5A 5MEOB 4RMRA 1E28B 2IBBA 3ESVF 2Q8AH 1G6RA 5EZLA 3GI9H 4HFWB 3MCKA 2J8UE 2B4CH 1DLFH 4CJ1A 3K4ZA 2A77H 2CKBA 1U93B 4QRTA 1OTTD 4JZOA 1FYTE 2G5BB 1BQLH 4Y19A 5EZOH 3IT8D 4TSBH 3QUKB 3SGKA 4Z78A 3U36A 1CGYA 3TFKC 2CMRL 1T04A 2XZCL 1IFHH 4OI7A 1P84J 4AIOA 3FONA 5C3TA 3CCHB 4H5SB 4GXVL 1KB5B 2IPTL 1XF3A 3F58H 3GJFB 2G9HB 3B2UD 3F65A 3NCYS 1ITBB 4NHCH 1P4BH 1W0YT 4JQVC 5EU7E 1OTUD 2F19L 4CN1A 5E2VH 2NY5C 4QRUB 4LSQL 4ZUTB 4M61B 1OP3H 5IVXB 4JN2A 5F7YC 3ME0A 3N50A 5GGSA 3CZFB 5FECB 5CCKL 3WS3A 1CG9B 1AGDA 3EOTH 3FT2A 4PJHE 4LNRB 5I1LA 5JXEA 3S3SA 5IJKA 4M43L 1WBYB 5LQBH 4P2RA 2DQFB 3L6FA 2NY4C 3LRHA 4CN4A 5C3LD 4RGNC 5JO5A 1AXSA 3BPLB 1R6VA 1MY7A 4UBDC 3MC0A 4GQPH 5I1DB 1QZ1A 5IQ7L 3IDIA 4HPYH 4FFZH 2OJEA 3FQNB 3LMJH 1KJMA 2K7QA 3H9ZA 5GSVA 3WIFA 3GUTA 2NX5E 3KPRD 2PYFB 4S10A 4EN3A 4WWKC 2G2RA 1RHHA 5B8CC 3AREB 2V6HA 1J5OL 1Q0YL 1ZANL 4JJ5A 3PWLB 4M48L 4M93B 4D8PA 2Q8BL 1YQVL 1N64H 1FC1A 3MJ9H 3WFCH 4NO2A 3OXSA 3TPUB 4LQFH 5DQDL 2C3HA 1DJSA 4JN1H 4DAGL 2YRPA 4P3DA 4QTIL 4OUUA 2EDQA 4ORZC 4M5YH 5E6YA 4QRQA 1KB9K 4ACPA 1IM9B 1F3JA 2VXSH 5ISZA 5LWYL 1RFDH 5F97E 1OM3L 3MA9H 4Y4KB 5E56A 4GG8A 4HIIB 5F7DA 4HLJA 1ZVHA 3FTGA 4RFNB 1S8DB 3OAYK 3GSOB 2ATPB 4ELMF 5KG9B 1MCWW 5CBEB 4HLZG 2I07B 2A9MH 2WLZA 5FYLD 3K1KC 2X42A 3PE9A 4MMXC 3JWDC 1ETZB 3OKKA 2P5WA 1IAIM 3U46B 2ENSA 1KBGL 4LSRL 3VG0H 4L3EA 1XGUA 5A2FA 1QYGH 4YHNB 4ONOA 3R8QA 1QQDB 5EUKA 3L5WB 5C6PB 5BXFB 3IXTB 3OKOA 5D7JC 5L0QB 3FO1A 3MUJA 2PTTA 1ZGLA 2XN9B 3O3UN 3SE8H 4PR5A 4PJBE 3UYRH 1DQLL 1I9EA 1EFXD 5HYIA 5I30L 1FCGA 4NN5C 2KZWA 5ANMA 4YDLB 3IS0X 2OSLA 1AHWA 3D39B 1I9JH 3KPRE 4ISVA 5E8OB 4PJDB 2CIIA 2VDMH 2ERJB 3DTXB 4LPXA 5FO7A 2PXYC 1TFHA 4XVTH 3HE6A 3VXPB 2UYLB 3UJJH 5DQ9A 1VACA 1R5WA 3CK0H 4KKCD 1J12A 1YYLH 1NGXB 4P4KD 2AKRB 4OF0A 1WBXA 3ARBD 3D9AH 3EYFB 4LLMA 1AGFA 3NH7H 4KV5E 1NFDB 3QDGD 4HS8L 4YQXH 3V0WL 3JV4B 4PV9A 4PGDB 2VMFA 2R2EB 2YD7A 4NQDA 4EZMA 5I9QC 1IVLA 3ULUH 4OLEA 2EEBA 5I17A 2IGFL 4ZD3L 4DKEH 4ZDHA 2D03L 2RQ8A 3P9MB 4P46A 2UZXB 2X1XR 1MCPH 1UVQB 4YAQB 3MV8A 2KDGA 2A6JA 5AD0A 3VFUB 4H1LB 2IAMD 1CWVA 3GMOB 2RFXA 3C5ZC 1S5HA 5H35A 5B39B 2AVGA 4YJZL 1BVZA 4R97B 1KENL 5J06A 2O26U 4NJ9L 1DVFA 3BE1H 3VGGA 1BQHA 4EUPB 4XVUD 1FJ1A 4NQSB 2FJHA 4PJHF 4FNLL 4D0CA 3QG6B 1RJLB 5I1KL 5DWUL 1K9TA 2J6EH 2NYYD 4H0IA 4I77H 4NKIL 5LAXB 2FNBA 1F45A 2EIZB 2XG5A 4MHHG 3UO1H 2XTJD 1CLOH 4PJ9D 1I7UB 3TNNA 1WZKA 4P48A 3QCTH 2Z93B 3V0VA 4KRPD 3X12A 4LPUA 2FCBA 5L2KB 2GFBA 1OWWA 5JZ7C 4P23A 4OT1L 2R2BA 5J7CC 4OZHF 4JQIL 1LK3H 2HTKC 2XQYK 2EZ0D 2YPKA 3HLAB 1G7PB 1D5BA 3WYRA 4I0PA 3GMNA 1YY9C 2OM5A 1VADA 4OSUL 2F53E 2FBJL 4XNMB 5IHZB 3V4PL 3RHWK 3TVMB 2HVKB 1IQDB 4XCEA 1KCSL 4FP8L 5D72H 3TT1H 2IBGA 3MRDB 3EGSB 5E1AA 5ABDE 3VXMD 4ODHL 1OAYH 1I1AA 3QDHA 2WAHA 4F15B 5IBLD 1FLRH 1CGUA 3MX0A 3ULVE 1D5MB 4HBQA 2ITCB 3OQ3B 1G7IA 4ZO9A 1HI6A 1DFBH 4GKNB 1EZVX 2YD4A 3ZYJA 1Z9OA 2BSTA 1QBLH 2VLLB 1AXTL 2FO1A 5D7LD 5LVEA 4DQOH 3EZ8A 4LCCB 2Y6SD 5I75B 1A22B 1BFVH 5HHQB 3E1F1 3HE7D 3W9DB 4JZNB 3MRCB 5EOTA 4L4VA 5I2IB 5IMKA 2GCYB 4DFIA 4ODUB 1A7QL 4P2OB 2XWTA 5IB2A 4F37K 5JXAL 3NA9L 5D8JL 1ZOXA 4TN9A 1J9CT 3ARGD 1QSED 3QUMA 1J1XL 3PP3K 2NTFA 4JPVL 1KEGH 4Z7UB 3JSSA 5TPWL 1UZ8B 3ARRA 4FFVD 4KVCH 4K3EL 4FMFA 5EC2A 3KHQA 2D9QB 3U1SH 3EFDH 3ELAT 3FHAA 5F9WC 2CDFB 1FPTL 1GZQA 4KK8C 4OIAA 3LV3B 2J4WL 5BVJA 5GS0L 4J4PD 4LVHB 4OD1H 4MWFA 4RBPK 2EDDA 2GJ6E 4UIKH 3QQ9D 4PJAA 1H5BA 2KKQA 3BP7A 2FH6A 3QFJA 3REVA 4FTVB 3OKMA 5CEYA 3O2WH 2MCPH 1FNGB 4QO1A 4HJ0C 4HCRL 1W72H 3NCFB 4BSVA 3LQZA 3AGVA 4GAJL 1CFTA 3O4OB 1N3NB 4ZS7L 5TH2A 5CINL 3WN5A 3WNNA 1QUNA 1H9VA 1VGEH 3C8KA 3OZ9L 3KPLB 4QOKE 5I1IL 4LFHG 1RI8A 5C0GB 3EDKA 3ZDZE 4OAWA 4UNUA 1HIMH 3LQAL 5DHXB 4MXQC 4GAFB 2VOTA 3DGGB 3SGDI 1F5WA 3ZE2F 4WDIA 1MEXL 3QT2A 2EKSA 1UACH 2H8PB 1G7MB 3KYKH 5CD3B 7FABH 3H9SA 3IDGB 2W60B 1X5FA 4TPRH 4XCNA 3UX9B 1UENA 1MCSA 2D7PA 1I3RB 2HT4D 3LRSB 5CGYC 1BFSA 4NQEE 2NLJB 2W0PA 4CUCA 3FO2A 1CGVA 2EEAA 3MYJA 4O58L 3GI8H 4UV4L 1AP2B 3KYMA 4PJ7E 3B2VH 3VRIA 3A6BL 5BZDB 3DO3A 2R1XB 5BV7L 1QSEE 2FL5B 3QJHA 5JORA 4EOWL 3SKOA 4HZAA 3UZVB 5I73C 3OAUL 4PIRF 4PG2C 4NC0B 1OARH 4ZAKC 1MWAH 2M8XA 4YDVA 5D6DC 3RTQD 1S7VB 2MSPA 2YD6A 4IOIA 2NW2A 4FHBD 2DM7A 3HG1A 5TE6H 3WS6A 4GMTL 3IDJA 3C09C 3IFPB 1DBKH 3PIQB 5MP6H 5IFHL 3C5JB 5F96H 1RUPH 3BIKB 3FQTB 2GAZB 4XGZB 1J1PH 4JFEB 4NT6A 4I48B 3KXFE 3MBXH 4NQCA 5I1CL 5K59E 1DSFL 3B9VA 3BHBA 4LPVA 2CUMA 1OLLA 3CXHK 1S9YB 1T7XA 4LSVH 1YY8A 4QRPE 4U1LB 1Q9WB 2I60L 4MSWA 2WMPA 3HUJA 1MCOL 1IBGL 1S9WB 1NUDA 4RZCA 2HN7B 2NY4B 3TC9A 2NY3D 4HWBL 4RGNB 5AYQA 1OAXH 4K23H 3C6LA 5DRWA 4QHMB 4O5LH 4PBWD 3L3GB 3MLZL 4GW5B 2YWYA 4M1DL 2X9XA 4IRSC 4RGMC 1JPTL 5HYQA 5MENB 3M17B 2E7MA 1O0VA 4J6RH 2B1HH 4WVRA 3X13A 1MVUA 1BBJA 4XRCA 1MSPA 4AIZA 3MRRA 1AIFA 3NABL 4WWKB 5B8CB 2BSSA 2WSKA 3AU1A 2Z31A 3FB5B 4FFYL 5F1OB 1S7WA 3BO8B 3WUWG 5BOPA 1Q9KB 5I8OL 4WI4A 2QSCH 5KZCD 5D1QD 4CADB 1A6WH 4UU9B 1QRNE 1A7NL 2NY1D 4QXUL 5EO0B 5FGBA 1RHFA 3RWGA 2OP4L 2F5AH 5E1HB 3QZWA 4P4RA 1B2WH 3DOSA 4BELD 3OXRA 3RPIA 3L5XH 3OF6A 2BJMH 4E41D 1BWWA 2NPLX 2ZKHH 3QG7L 4Q6IA 3GGWB 5I6XC 4L5FH 4U1KB 5TDNB 2A0LC 1B4RA 3MRPA 4NNYB 3NZHL 1V3LA 5C2BH 4OZFA 2VXUH 3ROOB 4JPIA 3I9GH 1KEML 5AWNH 1FFOA 3A67L 3VDBA 4ZO7A 1GGIH 1KJ2H 3N9GL 4YHKH 5GGTA 4G8GB 1ONQA 3P2TA 4RWYH 4UUJA 4S1QL 2VLRA 1YDPA 1D9KA 4FQ2H 4ZXBC 1I7RB 2QQLH 2J12B 4NM4H 3U9PH 4LSPH 1KN4L 5D7JB 3UTZB 1C8PA 5EZJA 5HHPA 5KVFL 1JHLH 1UZ6F 4KQ3H 1I9IH 5FYJL 1NAMB 5CJQL 5J4MA 2OX5A 3GSUA 3RVVD 2IANB 4NN5B 5DJZB 4KJPD 4H1LG 3I6KA 5KTEH 1A02N 1T21A 3AM8A 1HHJB 1OP3K 3RUGB 3X14B 4Y88A 4F57L 5E8DH 3W5NA 1INDH 1DL7H 1KCKA 4HPOL 2PXYB 3FB6B 4YDJB 1BLNA 5L7XL 4LVOB 1JF1B 1Q9LA 1J0IA 1I3GL 1SYVB 1NBZB 4W6YB 1IAMA 3MUGB 5ALCH 1HINH 2QQNH 1NKOA 4OLVH 4NHUA 3QUXC 4I0CC 1CFVH 3HZYB 3P0VH 4JFXB 5T3XH 2LABA 4XWGH 3RVTC 1L7TH 1MCEA 1U8OB 4PJ7F 4S2SA 3FMGL 3QCUH 3TBSA 1R3HA 5JNYA 3O2DH 5I9QB 1YEEH 1UYWH 1I3VA 5E6IA 4OD2A 2FZ3A 2VL4A 4OTXH 5B38B 4BQ9A 3V5KA 3W0WB 4U1IB 3U6RB 3TZVD 1MQ8A 3F12B 3SDAB 3MOBL 2HT3C 1EX0A 3C5ZB 1YJDL 2VWEE 1BJ1H 1B0GB 3MYZA 3PXHA 3P9LA 3QHZL 1N26A 4TSCH 2EIBA 2ADJB 5F72S 4AEHL 4V2CB 5IBUB 1NMCC 3K4DA 1CD0A 4HDIB 5CUSL 4PJFB 1A7PH 4L8CA 1XGTA 4UNVA 1ZWIA 4ONGH 5GRUH 4L4JA 5DD1H 3BD5A 5IW1B 4ZTOL 5DT1L 4EDWL 4M6NH 3SDDC 3F7YB 3OAZH 4JFDE 5KSUA 2IALB 3PQYE 2VAAA 4S1DC 1DQML 3ARDA 2JB6B 5JUEH 4LGPB 2C1OA 2CKBL 4HX1B 2R1YB 2F54D 4PB9H 5C08E 1ORQA 5HY9B 1JGDB 5IBTL 4NSKB 3V5DA 4ESKA 5HGBA 1T83C 2GJJA 1T66D 5DMYA 2VZ1A 3O6FA 4Z0BH 5CAYB 4Z77B 2P8LB 5JQHC 4M5ZH 5BZWA 3BWUC 4DZBB 3H9HA 3O11B 2VLJE 3KPMB 2FATL 2YBRB 1TITA 5HI4D 4LSDA 5D7IB 4WENB 3SDXE 2X40A 4NRYA 3LKRA 1LO3L 2VQ1B 4OF3A 2ATKA 1UCBH 4BH7A 4L3AA 3GMLA 1KJVA 4JZJC 5E99L 1K8IA 3VI4F 3SDYL 4G6JH 1ZA3B 4LRNL 4WHCA 4Y2DA 5BJTB 1CFSA 5DUPH 1NCBL 3VXNB 1N2RA 1AC6A 3BQUC 3AY4C 4LSSL 4XX1E 4NWUL 3OPZH 3P73B 3WMSA 4F7MB 3T1FA 2AXFA 5AZEH 5HVFB 1OD7A 1JUFA 2VERN 5D1ZA 3CFJB 2NZ9D 1BEYH 1T89C 2EDRA 4S0TD 3C8DA 1INEH 5IEHB 4WCYH 5DSCB 5IUSA 1FV1A 3EBAA 5J11C 15C8H 4XPBH 4QRRA 2X44D 4NKMA 1E4XL 1FVDA 1T6WA 3VGBA 1V3JA 3QI9D 5C1MB 4ZOEA 1OSZB 3GKWH 3T0ED 4XPHH 1YN6A 3D25A 3EYOA 1VFAB 1JV5A 3ARPA 5T33H 3GEWB 2R9HC 4PBXA 2ESVA 4M62H 3VRLF 2F54E 1EERB 3DLQR 1IAOB 2AJ3A 3PP4L 1ZSDA 3RWCA 4LNVA 4JM2D 2R0ZL 3UC0H 3QEQD 4Z95H 5HI3C 3V7MA 1BX2A 3T8XA 5F9WB 1YEDB 3I75A 1QA9B 5DFVD 2AJUL 1C5CL 5FDYA 1KN2L 4ELMA 2YKLH 5AZ2L 1X5LA 3VFNB 2B7DT 2C26A 4M7LL 4JLRB 5HBBA 2NNAB 4KHTH 3KPNA 3O8XD 3QDJB 2E6PA 1G9NC 2H26B 3VA2C 3HI6L 4M03A 3ILQC 1QG3A 4MX7B 1F02I 4KHXL 4N0UE 5CIPB 4WFEE 4MCZB 3G5ZA 3RZCD 3BEVB 1PKQE 1IGCL 5KS9B 4QYOB 4JO3L 4JPWL 2CK2A 5E94A 4R4FL 2APVA 3TN0A 3PHQB 4YXKL 2ICCA 3FO9B 1OGTA 3VWKC 3IKKA 4YXHH 5DZOA 3S6CA 2HFTA 2JIXA 3PJSB 3CMOL 3DROB 4PJCE 3Q1SH 4EI5A 5L2JA 4JRXB 4BSWA 4FQQB 2JK5A 4PLOB 1BD2A 2BZDA 2CK0L 4Y5YA 3TBYB 1CE1H 4EXPX 3C9NB 1HDMB 4PJ5E 1X6LA 4G7VH 1YUHA 3DMMA 4FQXA 4OIBA 4GKZB 5FGCE 1Q0XL 2LU4A 2J8UA 3ARZA 1RZJC 1ZXQA 2CJUH 3BH9A 3L7FA 3I02A 1ZTXH 4XNQA 3VRJA 4Q0XH 4NFBA 4Q9BA 5I73B 3DXAD 4M7ZC 2AP2A 4ZAKB 3PL6C 4PGCB 3ZYIA 3RKPA 5SWZB 1IGTB 3MV9E 5HYJD 3NBNA 1RJYA 2VITA 3KG5A 3KPQA 2YK1L 2BVOB 4FQCL 2R39A 4UDUB 5J89A 3SCMD 3C09B 1M7IA 5DJ6A 5DFTA 2HFFA 2ADIB 5HPOA 1O5DT 2Y5TA 1KOAA 1A6UH 3VA6A 5JPNA 3QISA 3MRBA 3BN9C 3EHBC 5KAQG 3D69A 4N8CL 1HNGA 3A6CH 4Y4FA 2AEQL 1PY4A 5HJ3A 4AL8L 5DHYB 4HIXL 5T1LA 4ZYKA 2Z8SA 1U9KA 1ZHNB 2W0FB 4GRMB 5D93C 2E3VA 5E03A 4M02A 5DDHB 3GRWA 3R8BB 2FR4A 4IRJD 1JPST 1GGUA 2WUBL 1SVCP 1NBVL 5IOPA 2BHUA 2FB4L 4PJHA 1U95A 4PP2B 3F6IA 3G9VA 3KYOA 5E5MB 2JCCE 5E8PB 3UPRB 4IHOA 3D1MC 2NY7L 3QIBC 4LPCA 3OR7B 1WT5C 4IRSB 1AO7A 4RGMB 3BYYA 5BO1L 4NNXA 4KROD 4JFPB 4MLIA 4NNPH 1A9BB 1L6ZA 3VGHA 4WNQA 5A16A 3MRLB 1NBYB 2EICA 3PG2A 2V17H 1NC2A 1J0HA 1SEBA 3R1GH 3HMXH 4OZHA 3DRTA 4EEEA 1I8LA 5FDWA 3PWPA 4HV8B 2RB8A 3LKSB 5E7FA 3LCYA 4P2QB 1E6OL 1E6JL 1LO0H 2FJGB 5EWIL 3LS4L 1LDPH 1HHHA 1YMMB 2ZOLA 1KTKE 2ZG3A 4PJ8B 1C1EL 1KCUL 5F6HI 1R3IH 1UXWB 5FK9A 3SE9L 4YR6B 1EHAA 4H8WH 2WBJD 5IGXL 4XC1L 3QNXA 1Q9OB 1PX3A 4P57A 2FYYB 2V2TB 2HWZH 2I24N 3LQAC 5IFAL 1QFUH 2C9AA 3Q6FB 3D0VB 4HIJA 1IARB 1U58B 4DJMA 5CLTA 5CJBA 5I6XB 3IAGC 2YXMA 3H6JA 2X4UA 4WUUE 3DX7A 2JELH 4U3CA 3UXFA 2AJZA 4OZ4B 3TYGL 1SMAA 1ZVSB 5F9OH 1FG9C 1Y6KR 3DETC 3C2AH 4NCDA 1XR9A 1MF2L 1WZ1L 3OJMB 4O02H 1DE4A 3OHXB 5BV7C 1CL7H 1QLRB 4LLYB 2EEDA 1XF4A 5E2UH 3V8CA 1S7SB 1NEZB 4NN7B 1OW0C 4XNXL 8FABB 3CFBA 5EU7C 1M05A 3O2VH 5E8EB 3TA3C 3FQXA 1O7SA 1ZA6A 1NGZB 4PRBA 1WEJH 2AERT 2WIMA 3R0NA 2NZIA 3DGCR 4WW1A 5IP4A 5IM7A 1RPQA 4OM1H 1MHPL 3HC0B 3GIZL 1F97A 3QUML 4QT5B 4FXLA 3KPRA 1E4JA 1A4JA 4WHTA 4GRWB 3MLXL 2MHAA 4OM0H 4OKVB 1CFNA 3CPLA 5KSVB 5F3HA 4AENB 2DYPB 4X4ZA 2YOCA 5CEZH 4GBXB 3QUXB 1C12A 2HVJA 5FO9B 3WBDA 2CD0A 3BEWA 1G9MC 5JDSA 1LNUA 2Z91B 4J3UA 1EEYA 4QHUB 1AKJB 2R4RL 5CMAB 5FUCC 5C0DA 4QGTA 3RVWD 4HUWB 1JWUA 3MLSL 4JFFB 4QWWC 3PDGA 4JM2F 4LKXB 4IMKC 2Z92A 3FN0L 3MO1A 1KF9B 4C54A 2NXYC 3SY0B 4BFEA 5CZKA 4KK5C 2A1WH 3S7GA 4LP4A 1X3DA 3TWCL 5EBWB 1G0XA 3CSGA 4NO5A 3ALXA 5TFSL 1T1WB 4LPWA 3VH8A 2Z35B 3HRZB 2Q7NA 1CVSC 1MH5A 1F13A 3VFMB 1T3FB 1NMCB 2D7OA 3PV7A 4ZFOB 1A21A 1JNNH 4JO2L 3T3PF 4TNVK 4XP9L 2OR7A 3I6GA 3VFSB 4CU7A 3WLBA 3HNTH 3SDDB 3B43A 1KPUA 2IQAA 1KPVB 2OR8A 2DQHH 2OS7A 4CVXB 1MHCA 1EFXA 1OAQH 2BOBA 2AXGB 1NCAL 4XP1L 4M4RA 2LAGB 5IB5A 3DPBA 5DEFB 3VGEA 5I1GL 1I7ZA 5LCVL 3DRQB 5F1IA 4DGVH 1PSKL 2X70A 5D7KD 1IM3A 3BH8A 5DVKA 2F8XC 1W0VA 4OZGE 5DF0A 2CIKB 1DQJA 3P0YH 4CGTA 4C56E 3WIHA 4KK6C 3T4YA 4F37F 3EJZD 2PO6D 2BSRA 2ADGA 3P4NB 4P4KA 4HW6A 3KWWA 5CILL 5KVGH 4D2NA 1F4XH 2FECL 1ES0B 3BVNA 4DEPC 4JZJB 3ARBA 4RAVB 2ZSVA 3MFFA 4HEME 4JVPA 4KJWD 5DRZA 3AMKA 1JNJA 3VXOB 3QDGA 5C0AD 1QOKA 5L88H 2UWEB 1XGRA 4XPFL 1A2YA 4YZFF 1JGLL 3QIWC 3FZUD 5IK3A 4KC3B 3QNYA 3BQUB 2WANA 1RSFA 1MHEA 4NQVB 1P7KA 3CMGA 1AGEB 4JM4H 4PGBA 4WEBH 3IDYC 1U91B 2EC8A 2BXYA 2XWBB 1FP5A 3VD3A 3WFDL 1B3JA 3GBMH 3GSXA 4C83A 2IAMA 5J11B 2DM3A 3O3BA 3B83A 4FN0A 4ETQB 3DHJA 6FABL 4OZIB 1Q72H 2YD8A 3BW9A 3JTTB 1T7YA 3QA3A 3INUL 4ZUUB 2P45B 2XACC 1VGKA 3ZE1E 3MLTB 4PJIB 2B1AL 5I1AB 3GSVB 4LU5H 2OQJA 3MQIA 3LKOA 4I13B 3BP4B 3BPCA 3PABA 3BKYL 2FSEB 1RMFL 2A6KB 1QLEH 4DTGL 1C5BL 1BP3B 2OTUB 4MD0B 4PJ9A 4U6XB 3PGFH 4JDZA 1KIPA 5F89B 5T5NF 3PWUA 3CFEB 5C09B 5FOBA 5DS8A 2X1WL 3L3OA 4HMDA 1GGTA 4PRHD 4RNRB 1MHHA 3JWNC 4LCUB 4M9OA 4Q2ZB 1FZKA 5T1DL 2XA8L 5T1MB 2YEZA 4OGAD 4EIZC 1T0MA 5F1SA 1EJOH 3LH2H 2X1PA 1JPFB 4LARL 1NLBH 2DLFH 2XZQL 1TLKA 5DUMH 3QXDA 5GGTL 4MDIA 3RWFA 3MRHB 1VKXB 4EQ2A 4NWTL 5D5ME 3VXMA 1FBIL 3VWKB 2DL9A 4HGMA 3IJYA 2EO9A 4F7TA 1FNHA 1YEKL 1G7HA 3CD4A 3GNML 3VFRB 2ZG1A 3DECA 4GUPB 3QR2A 3I2CH 2DLHA 2AAVA 4HIHA 2H2PC 3S5LA 1PY9A 4LEXL 3DX8B 5JDJA 1RIUL 1NMAL 2WUCH 4KDTC 4KVNH 5D7LA 2ICEB 3GB7A 1HHKB 1U3HD 2BVQA 1XF5B 2CR6A 4WTWA 4U1JA 5T3ZL 2E7CA 5DURD 1R5VB 3HE7A 5BS0B 2W9DL 5L6YH 4K3JL 1YPZB 3KPPA 1Z9LA 2DBJA 2IQ9L 3ULVC 4PY8I 3MRQB 5F9DC 1HXYA 5EU3B 1BIIA 2ZCLL 4CJ0A 4MS8C 4RMVA 4PJ7A 4M7ZB 5D4QA 1TJHL 3K8KA 3ARGA 5C0CB 1QSEA 4KI1A 3EOAA 2IG2L 3T2NL 1J8HB 1T0NB 4TYUA 2A9NL 3G6DH 2VISA 1MRCH 1HXMA 3FB8A 4NRXA 3TBVB 4FQLL 1JN6A 2XZCH 5EZIL 4MJ4A 1RZ7L 3EDJA 4S11A 1K4DB 5LBSL 4J4PA 2PNDA 3RAJL 4OZGF 3FCTA 4GXVH 1D5IL 1DZBA 1HHIB 5D93B 1HQRB 3E0GA 3HI1B 2W38A 4FZ8H 3CUPB 4OLUL 4APQD 2Y36L 5C07E 1N4XL 1V5JA 5KSAD 4PG9A 2F19H 4U1MA 1BBDL 3KDMB 1S5IL 3BN3B 3EDFA 4TULL 1ZT1A 3QIBB 2ARWA 4PGEB 3FFCD 3TF7C 3H0TA 1JK8B 4FABL 1FNSL 1WTGT 3DO7B 2VSCA 4JB9L 4M43H 1QPXA 1FCCA 4HKBB 3SKMA 1H8SA 4PLKC 1OLZA 3OB0K 4MGXA 2X6MA 5EUOB 4X7EC 2JJVA 1XH3B 1PYWB 1VENA 2RBLA 4MA8H 3W81A 1IT9H 5CD5C 2BNQB 3ULUE 5H94A 1QRKA 3MNVB 1NEZG 2E5EA 1JZ7A 3CDCA 4TTDC 3E6HB 4DZ8A 4GG6F 1J5OH 1Q0YH 1ZANH 1HILB 4LRIA 5FM8A 2YD3A 3SJVB 1CT8A 1YQVH 4ZOBA 4Q9QL 4O4YH 3RTQA 1HK6A 4HXBL 3CFCL 3MACL 5L9DL 3NFPA 3RVXC 5DQDH 3KGRA 1G1YA 4LPTA 4JANA 1IGFL 4DAGH 2AGJL 2VDPH 4LFHD 4QTIH 2YHGA 1DCLA 1FYTB 4LLVB 2Y07L 5D6CB 5IW6A 4JKKA 1PQZB 2YC1B 3DV6B 3IETB 5LWYH 1OM3H 4X4XA 5EOQL 5IG7B 4H88H 4Y2OA 4I5BA 4JQXA 1KJ3L 5BV7B 5IMLA 2A73B 4OFIA 3HNSH 4Z7VF 1FORL 4Q7DA 1HEZB 3N06B 4X6CE 1IC7L 4XC3L 1DQQA 4X4YB 3D85B 3TA3B 1F4WL 5HHVL 1KBGH 5DJAB 1FGNL 1KT2B 4LAQL 3GDBA 5EN2B 1CD1B 1MCKA 3QEGL 3HB3C 4R96B 3SE4C 4HZLA 5FF6A 1KACB 3A6OA 4GMSH 2OL3H 3BGMA 4YFLF 4HC1H 3K3QA 1IKNC 4HT1L 3SKNA 5I15H 4JY6A 1DQLH 4OFVA 4X5WB 3DI2B 4I3RH 4UAOC 3ARED 5CGMA 4O9HL 5I30H 4EVNA 5IEKB 1U8MB 5D1QA 2E7LA 5ALBL 1V3MA 2MQ3A 1QD0A 1CR9L 4GH7B 5C0JA 1A64A 3MJ6A 2NX5B 1IGML 4X6EA 4L8DB 2IF7A 4E41A 2R69L 5IV2B 2X89D 3AUVA 3LEYL 1IM9D 2IH3B 4ZNEA 5GGVY 3GHBH 1MI5B 1K5NB 2I26N 2NXYB 5GISL 4Y4KD 1B6DA 1LK2A 5I66A 1AQDA 1XMWA 2VE6B 4HS8H 4BKLB 1K6QL 1BFTA 3FN3A 1A6PA 4MNGE 3OX8A 3IF1A 1U8JA 4NRZB 4BH8A 2IGFH 2LV4A 3E8UL 4MCYB 5LXGL 4M7KL 4LMQE 1PJ9A 25C8L 1UH4A 4FXKA 3L7EB 4ALAL 2H32A 5HDOA 3IFOB 3UEZA 1KTDB 3EFFA 3LPFA 4OFPA 1MQKL 2XN9D 4JHAL 3QXAA 1Z9MA 4U6YA 3B5TA 1TMCB 1MJJB 3EYVB 3CVHA 3G5YB 4NJ9H 4X6DB 3DSNA 3PQYA 2PYEB 3D39D 4L29A 1YC8A 4JPKL 2X4OB 3ISWA 4FNLH 1MCLA 2W65B 3TJEL 1IJ9A 4OCSH 1TVDA 5DWUH 2XA3A 4X7TB 5IF0B 4JY4A 4W70A 1BOGB 2EDBA 4PJBB 5CJ8A 2Q8AL 1P4IL 3GI9L 4NKOA 1TZHB 1DLFL 1G7JA 4ODWB 4DEPB 4OT1H 2HLAA 3IFLL 1L9MA 4JQIH 4AY0A 1TCMA 3X3GL 3PV6B 5EORL 1KFAL 1I1YA 4TSBL 3BRDA 3QIWB 1U42A 1D5ZB 3QNZB 3QXTA 3V4PH 1UWEL 3HHRB 3PGDB 1NUGA 1F4YH 5K9QI 1MJ7L 2WP3O 4XZUB 4PTTA 1I1CA 4XI5C 1KCSH 1FAKT 2F74B 3MRIB 5J13C 4ODHH 1JGVH 3TZVA 4NHCL 3TLRA 2BHYA 3CJJA 3EIFA 4UOW0 5ILTH 3T0DA 4R3SA 1LO2L 4KJYB 1I75A 1PZ5B 1PLGL 3ZL4H 4CMMA 4AT6A 4U31A 1RK1B 2J2ZA 2NXZC 5MEQB 1FSKC 1AXTH 3EOTL 4KAQH 1OPGL 4HJJL 3WJLC 3GSNA 3QUYC 5J3HC 2WZPD 3S3PA 1RQ5A 4NCC1 4OV5B 3VI3E 4ZUWA 1OQXA 4PRDA 5DMIL 4S0SD 4XMPL 3RVUC 3D39E 1A7QH 4B5EA 1RVFL 2F54A 5JXAH 1M71A 1AFVL 4M3JA 3NA9H 3LZFL 5D8JH 4PJDE 4FFZL 3MROB 1NKRA 1ZHBA 3FOMA 5L2KD 4AH2A 4L8SB 4ZQKB 4OQTA 4HQQL 1G9EA 1J1XH 4N9GB 4UI2A 1BZQK 5TPWH 5JLZA 5J6GA 4K3EH 3MOAL 4ODSL 4W6XB 4EDXA 5DEZA 4U1HA 3MJ9L 2MNUA 4J2XA 1DDHB 2A83B 3DYOA 3OKDA 3RIFF 3TVMD 5I1EL 1XCTB 1FPTH 3WD5H 3G5VA 1CICA 4PRIB 4N0UA 3T0WA 3M07A 2J4WH 5GS0H 1JGEA 3GJEB 1GXEA 3VFWB 3GBNH 1KIQB 1PKQA 4JN1L 3UBXB 2CKBB 2IH1A 4QRTB 3RWHB 3OR6A 5ETUA 6CGTA 5M94B 4Y19B 4M5YL 1BM3L 2CRZA 4GLRH 2F53B 2DIAA 2FEEI 2VXSL 4Z0XA 2AV1A 4HCRH 1RFDL 4U1SA 4OLXH 2IBZY 4ZS7H 4Y5XC 5CINH 1DEEA 3UTQA 1J86A 5KOVC 2CDEA 3ARUA 3OZ9H 1EHLH 4KMQA 3L3IA 5DRXA 4HWZB 3QEUA 2H2SC 5IVXF 1AR2A 4ZS6D 32C2A 1N8ZA 1MEXH 2AJSL 4YGVB 4NO3B 2JJTA 3QI9A 1A7OL 3QH3A 4QCIB 3C2SA 4QHNA 4P2OD 3K1DA 4G80A 3DJ9A 1T22B 2C7UB 4U6VL 4WJ5A 1DUZA 2WIIA 4YFDB 1GHFL 2HFEA 3MLYH 1QFWM 2GK0B 4MVBC 3JUYA 5E95B 3T1WA 2AV7B 4JKPH 5F9JB 2NR6C 3NOIA 4JM2A 3QO0A 4UV4H 5DJXB 1LMKA 2YXFA 5F1KC 4QRSA 5L2KE 3A6BH 2B2XH 4UOW1 4UTBH 1YEIL 3QEQA 3MJ7B 4EOWH 5C7XH 5ITFA 5J9PA 4YPGB 5EFIA 3WJJC 5DA0B 2SEBB 5EPMB 4HKJB 5GZOC 1OF2A 2DICA 5HHNB 3BI9X 3VJ6B 1F2XK 2OR9L 2VABB 1ORSB 4NQUA 2V9QA 3O8XA 4GMTH 4FTVD 1A6AA 4RAHA 4PJXF 1P7QB 1WZLA 1ND0A 1KG0A 2YUVA 3RZCA 3D9AL 4ZPTA 3JUZA 2X4RA 1A8JH 5FYLL 4O2CB 2VZUA 1DSFH 4K8RH 4LHUA 4NO2B 5C6TH 1F42A 4WFHD 2WP3T 3QBTB 4XT1C 2GY7B 3MGOB 3BIAX 3ARFC 2GJ6B 3NPZB 2I60H 3HAEA 5T3XE 1MCOH 3BD4A 4M6ML 4E0RA 1AI1H 4MNQE 5EO1A 4OGXL 4HUMB 4Q6IC 1F3JB 4HWBH 1MCPL 4FRWA 3DVGB 3MLZH 4P3CH 2VL5A 3B3IB 5FEBA 4WFFD 3ZDYE 4PD4J 1VFUA 3U2SA 1XGPA 1JPTH 1H15A 1P84K 2CLRA 1WIUA 2V7NA 4NQXA 5DMGD 5DR5L 3QWQB 2PR4L 4FQIH 2KH2B 1TZIB 3NABH 4DKFL 5F3BA 4FFYH 1CD9B 4C4KO 3TFKD 2Y25A 3DIFB 5JOPE 5I8OH 1FGVL 2X4QB 3DXAA 1UFUA 4OGYL 4XXDB 1D9KC 4Z7UE 4LLWB 2J6EL 5HYJA 1EXUB 4QXUH 1DEDA 4L4TE 1CLOL 3B5GA 1J87A 4NQEB 5CZVL 3Q3GA 3QCTL 1JYNA 3MR9A 5IB1B 4IMLA 4ZFGH 4LEOA 4PJDF 3TO2A 5K9KA 3K8MA 3WXVL 4JFED 3QG7H 3LHPL 3MLUH 4RISH 4E42A 4KQ4L 4HS6B 3EO0B 3MRGA 1OHQA 1WWCA 4EXKA 4ONHB 1U8LB 2EO1A 2Q3AA 4G9FE 4HIEA 3KR3L 3NZHH 3C5SA 1U8QB 4X5XA 1H3XA 2IC2A 4IRJA 1KEMH 3S4SB 3VD5A 3A67H 4FFWD 3H9YA 1JWMB 1NCDL 3N9GH 1WF5A 1S9VA 1NFDF 3WV0A 4WFHE 5D72L 4RGND 5GPRA 3TT1L 4MLSA 2JB5L 5KN5B 3KXFB 4UBDD 4JGJA 4S1QH 3FN9A 1FAIL 5GIRB 2XPGA 4Y1AE 5ERWA 1KN4H 3UYPA 5CJXA 4J1UB 1C5DA 3DURB 4OCXL 5MEND 2O61A 2E7BA 3LN4A 5KVFH 4QRPB 1OB1A 5DVNA 1SJHA 3HR5B 5FYJH 4Q58C 1DFBL 4NUGH 4NC1E 3EO1A 2AS5M 2VN7A 1QBLL 3ES6B 2R15A 2GEEA 4WWKD 4UAOB 5ESQB 4UILH 3AXLA 4YFLI 3NZ8B 1I85C 1BFVL 3W82A 3H3BC 1MCCA 3WL9A 3QSKB 3IAPA 5D2NA 4HGKC 4C55A 4QGYA 4HAFA 5CFHA 1DBAL 2IEPA 4Z7WB 2CLVA 4HPOH 4KRNA 1P53A 1QSFE 5ADPL 2VQUA 2WBJA 3P9WB 1I3GH 4J3OC 4HGWA 4HKXA 3O6KL 3TNMB 2FJHB 3EYQC 4JFZH 2Q6WB 4F33B 5ACZB 5FKAA 1QRNB 1JI1A 3MREB 3MNZB 1BOYA 4U33A 1YN7A 3FMGH 3U7AA 1G7LB 1WWAX 5F6HJ 4Y7MA 2ZPKH 1CBVL 2DJUA 4G8GD 4M1GL 4XMLL 1PEWA 2BCKB 4OD1L 2X4SA 2D4FA 2P7TA 4OD3L 1J05B 1D5XB 4PJEE 5DYOA 5JIHA 1A4KB 3WFBL 4G8EA 2MCPL 5D7JD 3MOBH 1FQ9C 1CXKA 4HWUA 1YJDH 2J88L 1WJ3A 2ZUQC 4MQSB 3QHZH 2EYRB 2L7UA 3D3VB 1YEJL 4AEHH 2CRMA 4ETYA 1T7ZA 2IAND 5L8LB 4ZOAA 1T7WA 4FQHA 5MENE 5CUSH 1QBML 4LGRB 4NZTL 2YUZA 4X6FA 1G6RH 5DT1H 4ZTOH 4AQ1B 4EDWH 3V7AG 2C1PA 4QTHA 2F8VA 3T4AB 2WWKO 1DQMH 1RURL 3BISA 3SE3C 4LCWE 2PXYD 3G9AB 4E9LA 1YEGL 3BKCH 2CKBH 3P4OB 4JFOB 4TPRL 1FZOA 1VESA 4ODXA 4OZGA 4GW4B 5DHVA 4KDVA 4F2MA 4O51A 1LP9E 1SYSA 3LEXA 4C4KT 4PREA 4WI3A 2UVFA 1RJZB 1X5AA 4LHQB 4IIQA 3U9UA 4RMWA 5HGHB 1BZ9B 1K4CA 4K3GA 2FATH 3KLAA 4OCNC 5CZXC 1LO3H 5DVLA 3VW3H 4W4OC 5BOZG 1DUYA 2BX5A 2B0SL 5E99H 3REWA 3VXTB 3W0WD 1QO3B 3SDYH 5J13B 3BGFC 1W0WA 4LRNH 1FL6B 4D0BB 3BP6B 1RUPL 5MERB 1NCBH 2CKNA 3SDAD 3TYFA 3TBTA 3C5ZD 4NWUH 3MBXL 5IVOA 5I8CA 3C6SB 4AM0B 1U3JA 2YS4A 2NXZB 3O81A 1J7VR 4O2FA 1FSKB 5DA4A 2LQRA 3O41B 5J1AB 2OMBA 1OT1A 1JPGA 3QUYB 1RUML 4GG6A 2E6JA 5IHLB 1HSBA 5INCB 1E4XH 5ECJE 4HD9A 4N5ED 3IU3A 4XVJL 1KC5L 3W11C 3GMRA 4PRNB 3B6SA 3RUGE 3FB7A 1IAKB 1R24A 3KLHC 4EKXA 2VO5A 4M6AA 5JZ7D 43C9B 1NLDL 2R56H 1OGAE 5HVHC 1TZGL 2HTKD 2R0KL 3OG4B 5FB8A 3PP4H 1MFDH 4JFDB 1VFBB 5C8JA 2R0ZH 4K7FA 3ARXA 1YY9D 1ZKAA 3DUSA 1P5VA 2PO6A 3U0TB 5J12C 4JRYB 5C08B 4AEIH 4QF1B 1F6AB 3NIFE 2VDKH 2VLME 1C5CH 5TF0A 1KN2H 4Z7VA 4KKAC 3SKUD 2QQKL 4M7LH 4CW1A 5C0AA 4QEGA 4PRAB 1B2WL 3ZHLA 3VFPA 5TQ2L 2BJML 2HA1A 3FT4B 2V5SA 2VLJB 4KHXH 5EO9A 4GAGH 1A14L 3QJFA 3VCLA 3W0WE 3SDXB 3TM6A 3IU4L 4U1GC 1IGCH 4WIQA 5BRZB 4Y5XB 5HDBF 1W8NA 4JO3H 3DVNA 4HMEA 4JPWH 3MFGB 5HHXL 4OB5L 4R4FH 1LD9A 3I9GL 3KJ6L 3CSYA 3MRFA 4UMGA 3WO4C 1KJ2L 4TVPD 4CNIB 3UZQA 4N8VA 4YBQD 3CMOH 4PJFE 1WWBX 4RWYL 9CGTA 1CE6A 4OLYL 4WW2A 2BNRE 1NFIB 5E00A 2PCPB 4FQ2L 4P99A 1HH6A 3MNWA 5FV1L 2D31A 2QQLL 4NM4L 2FHFA 1QFHA 1CFQB 4XCCH 2CLZA 1JHLL 2QQQA 2Q76A 4KQ3L 3D6GA 5DJ2A 5J6HB 1Q0XH 3S8WA 2AK4E 1I1FB 1B90A 1EHXA 5FYJU 2HJFB 2WWKT 1R3JA 4OFKA 1EIBA 5EIQA 1P2CA 5SV3A 3WE6A 4KI5E 5E8DL 3PDOA 4KK8D 2XY2A 1DL7L 1OAZL 4JVUA 2FJFA 2WWMD 4PRHA 5D7IE 2YK1H 5A40E 4FQCH 5DD5L 4KMTL 5ICZB 3RI5F 1MOEA 3QDJD 2ZSWA 3V9FA 1C08A 3P4MB 5FGSA 3ARTA 2IADA 3L3JB 3L9RA 2ZP0T 4MJ6A 4HJ0D 2QQNL 4OLVL 1ERNA 3V6FB 4XCYA 2A6IB 3ZKMC 2APFA 1CFVL 3QDMB 1C16B 2AEQH 1A3QA 3L3HA 4NQTA 4AL8H 5KW9L 2EDNA 1WIPA 4HIXH 5IKCB 3FT3A 5DK3A 5CJOL 1E27A 2VDLH 3QCUL 1RZGB 3ARFB 1H3GA 3ZE0F 5CEZE 2BY0A 4MXQD 2VTFA 2F58L 1VFOA 2WUBH 4ZUVA 1NBVH 2FB4H 4P2YA 2H6PA 4KUCD 4OTXL 2DB8A 4U6HA 1UM4H 5GGRB 3GIVA 4JRXD 1GYAA 3CH1A 3TCLB 3U4EB 3CVHL 3MXVL 2V2XA 5HGAB 4UZGA 1RUKL 1U3HA 2P44B 2NY7H 1M7DB 3S4SG 5CGYD 1KXVC 1NFKA 4DVRH 1ZEAH 1KTLA 3GK8L 5TF1L 4TSCL 4LLUA 1IL1A 1FO0A 4OCYL 4PJCB 5FYKD 1U8KA 4POUB 2QSTA 3DX6A 3HPLA 5GRUL 3QFDB 2BNUB 3MGTA 4M6NL 4ZAKD 1E6OH 5C0EA 1E6JH 5EWIH 5SWZD 2MFNA 2YRZA 2F9BT 4PJ5B 1RK0B 4KZEL 1KCUH 5CWSB 3NN8A 3FQWA 5LGJA 3SE9H 5FGCB 3MCLL 5DO2C 2W91A 3RNQA 1EA9C 1WAAE 5IGXH 4PY8J 1TETL 2OTWA 3RBSA 3O45A