4HS3B

Crystal structure of h-2kb with a disulfide stabilized f pocket in complex with the lcmv derived peptide gp34
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Peptide-independent stabilization of MHC class I molecules breaches cellular quality control.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hs3B00
2EDOA 1KBGL 3MPCA 4ZOAA 1U3HA 5IMMA 1KTKE 1IMHC 4P4RB 3DO3A 1H8SA 1NFIA 3C87A 3QG7H 3GIZH 3BRDA 1RIVL 1NGPH 5JHLH 3KPOA 2WK2A 3QISA 2DI9A 1XF3A 4RNRA 3VDBA 1CDBA 2NXYC 4YNYB 1D5BB 4GRWF 2F5BH 4Q9CA 5C2UB 1WK0A 4JE4B 3TN0D 2UVEA 1R0AL 4X83A 5CIPH 4RQQA 4ETYA 3PV6A 1AC6A 2UWEF 1ADQH 3OR6A 5D5MB 5BJTB 4HZLA 1YYLH 2HRPL 2XZAL 5LGKA 4M7LT 4MNQE 5CEZH 3V95A 4GSDH 3MLRL 3LV3A 1RU9L 1SJHB 5KJRL 1WBYB 3DGGB 2HFFB 3NACH 4GW4B 4JO4H 4GMSH 4OAWA 1CXEA 4PYGA 4Z0XB 3RA7L 3O4LD 4MZ2A 3NZ8B 2YPKA 4PJ8D 1MRDH 4NYLB 4YXLH 1FNEB 3MBXH 3MRRA 3VFVB 1SJEB 1AR1C 2IBBA 4K7PL 2H6PB 2IALA 4LRNH 1EZVY 1JYNA 1WAAF 2CLVA 5FUCC 3LKRA 2FYYB 5EUOA 2YC1B 2NY5L 4O02H 4KRPD 1T4KB 4ONHB 2ZZUT 3LS4L 5HY9B 3WE6A 1JUFB 3BZDA 5GGTL 3EW3B 5E9DB 2GW5A 5C6TH 1A02N 3HZYB 2HJKA 3MACH 5D1XA 2OK0H 3ZT5A 1FGVH 3IYLW 5FUCE 3D0VB 5DD6B 5I8OH 2BNRB 2HTLD 5E95B 1GGUA 3Q6GH 1AGCA 3JSSA 1JN6B 4KRLB 4ODTL 3H9HA 3O6FB 3N1FC 2GY5A 2P45B 2A6KB 3QI9B 4QEGA 5IW6A 2XN9E 1D3CA 2C4FU 1QHPA 1HOCB 1S8DB 4M1DH 3SDXA 2VZVA 3ULUF 5BZDA 4WO4A 3V7AE 5JIIA 3ULUD 2UZIH 2YD6A 2LAAA 5ICYB 1AR2A 3VFSA 4I2XA 3ZTJH 4D9QD 1FO0A 1N0LA 3V0VB 4FQ1H 1K2DB 4P4KB 2GFBA 4YFEA 3KG5A 3WLWD 4ODVL 5IJKA 1I7RB 1NMCB 2DQJL 4YIQB 1LD9A 5L6YL 4MHHG 2E9BA 5IVOA 1NBVL 4HV8B 2NY4D 3LZFL 3TPKA 1WV7T 1NDMA 2K3TA 4ODXA 1TJHH 3PP4L 1NMAL 4PLJD 1E28B 4OTXH 5IBTL 1IGIH 3U1SL 3OKNA 4PLNC 4OF3A 3TCLA 2D4DA 3SDDD 3F7VB 1Q9KB 4H88H 3DX7B 4NKIL 1S9VB 4NIKB 3DVGA 3SDYH 3FZUD 4GKOA 3THMH 1BBDH 3KPSE 1ZT7B 3R0NA 3HNSH 4V1DA 5F7MC 3VXNA 4MDIB 1KCSL 3FT2B 5INDA 2BZDA 4JEGB 4N5UA 4OZHA 3ZE2F 5IOPB 3Q2CA 1Q1JL 1MWAA 3BDBA 3HI5L 3VI4E 1ONQA 3BT2H 1MVUB 1XH3B 1R24B 5JQHC 4I18A 3OWEA 1MOEA 3QPXL 5EN2A 1OW0C 3SY0A 5E2VH 3VXTA 4QRUB 1LK2B 4ZAKD 1DBBL 4QWWC 4XC3L 1BFVL 3WIHA 1JF1B 4FQIH 2IFFL 3VW3L 4HDIB 2P44B 4YFLF 5C0BA 4EBQH 4TUOB 5T1DL 4PV9B 2BXZA 1JVKA 1N6QH 2YPLA 2YSSB 2JJUA 1IBGH 5GS3A 2X7LB 2W9LA 3PWUB 3UTPE 2X09A 5F1IA 4PJAB 5IB4A 1UWXK 1QBBA 2EE2A 5HDLA 3ORJA 1HINH 2P5EA 3IGAA 1S7SB 1EMTL 2D4FA 3K2MC 4N0UA 5HYJA 2IFGA 2J4WH 2YWYA 5DD3L 1OAYL 1HYRC 4NKOB 5F1NA 1CT8A 2PCPA 5LGHL 4PUBL 4QRRE 4P2RE 1R3KB 4QNPE 2NY3D 2LVEA 1MF2L 2DLFH 4N8CH 3MV9E 5I1LB 4J4PA 3L1OH 5CEYB 2X4PA 1KXQE 4YGVB 4NJ9H 2Z8SA 4A2MA 1G7PA 4LSSL 4DEPC 1FE8H 1I8IA 2B5IC 3MRCB 1M7XA 4LCYA 1LEKB 1MHHA 5JXED 4KHXH 3SGKA 5E8NB 5F3BA 4NQCB 3DYMA 4QHNA 2VLRB 2IBGA 2VL5B 1AI1L 1PY9A 4S0TD 3SKOA 3ZKND 2P8LA 1Y18A 1V7ML 4OUOA 4WWID 5DR5H 4PJGB 5TFSH 4AENA 5JUEH 1EJOH 4NDMA 4J3UA 3R4DA 3QUYC 3H3KA 4HF5L 2IH3A 4MNQD 4LKXA 4MS8C 4ZQKB 4X80H 2RHEA 5C08A 5K59F 2NXYD 4PRHB 3GSXA 4X5XA 2XWTB 4HMDA 4UB0H 12E8H 5L7XL 5HHOB 1VKXA 4JFZL 2O5XH 6FABH 4EI5A 5DD1H 5D1ZC 5I8KH 3MUY1 3TNMA 4K8RL 3G6JA 1JGEA 4GAFB 2J8UE 3MRBA 1J1XL 2N7AA 1NUGA 2DMCA 1SYVA 2FGWL 2VXQL 1NCDH 1J05B 4KK5C 5E4EB 1CFBA 2UY6A 4POYA 3T4AB 3L3IA 5C70A 1Q94A 4MA3A 3QBTB 3T0DA 3G5XA 1OGAA 3RVWC 1FO0L 1KCRH 3GBMH 5TF1H 3GM8A 3VD7A 2ICWB 1OHQA 3O6KL 4L8SC 2YMXL 1FZMB 1HCFX 4E41B 5DA0B 4OF6A 4DN4H 1AHWB 5ID0A 1EAPB 3FO2B 2V5RA 1X5KA 3CFEB 1J9CT 1A9BB 1D9KC 3TVMC 1S7XB 2OS7A 2DS4A 1ORSA 2ADIB 3M17B 1FGNL 1Z0NA 4RWYH 1FDLH 4KPHH 3Q5TA 1P4BH 4HKXA 1E27A 3BESR 3W9DA 1GGTA 1IC5H 2XN9D 5EIIA 3D3VE 3C8KA 5GGUA 2NX5A 4KMTL 4J3XA 4JJ5B 1ZLVH 5KTEL 2QSCL 1MRFL 2ORBL 3LH2H 3WFHA 1I85C 1I8KA 1NCAL 3DMMC 5BVPL 1ZANL 3LQAC 2Z31C 2A9NL 4ZO6A 2JJVA 3BZEB 2AABL 4U1KA 2CDFA 1OAXL 1IM9D 1W8OA 4Y88A 4QKXB 4MMXC 3I75A 4IOFC 4DN3L 4ZUTB 2BVQB 2Y9RT 1KEMH 4PJ7A 4FMFA 3CFBB 3O3EB 1CL7I 1T0PB 1CG9B 4FTVB 2HTKD 4TNVK 1JI2A 4RAHA 3MV8E 5SWSE 1XF2A 1MH5B 1MREL 4I77L 3S36X 1E4WL 1L4IA 1MQ8A 3KPSD 1Z5LB 3ZZ1A 3TF7C 4ZG1A 3V6FB 3QUXA 2D9QB 1OF2B 2KDGA 3VI4F 1S5HA 3HPJA 5LCVH 2PTTB 5DMGC 1KN4H 2GJ6B 5DQJA 5CJ8A 2VLKE 3ULVC 5ACLA 2BOBB 1B0GA 3HS0A 3VD3A 3BH8A 3D2UB 4U1IA 5FUZH 4QT5A 1KENH 3BIKA 4RIRA 3QUMA 3U82B 4JFYA 5L8LB 1MIML 3GSQA 4MA1B 3C08H 2J7LA 5E9DE 1AGFB 4DVRL 2W60B 2GITB 4K94L 3ULVE 2V17H 4R90L 3DHMA 1J87A 5FK9A 5I1AA 5GRZA 3RNKA 1WEJH 1XR9A 2A38A 5C0AA 4JFXA 3UTPD 1YYML 2DDQH 4QWWD 4MNGB 3RZCC 4JRYE 1XGPA 1K6QH 3EYQC 4P23B 5D7LE 1BJ1J 4PBVC 1JPST 2BHZA 2EKSA 5HHNB 1U8HA 3NN8A 5FCUL 2VH5L 4PRDB 1QLEL 3ARBA 3Q6FA 4Y5YB 4NFBA 3U0PA 1LO5B 1YQ2A 5HGAA 2PKDA 4QRRD 4P2RD 1Y6KR 2VDMH 1F90L 3CDYA 3K4DA 1TETH 5E1AA 2OJZL 4XWGL 3MV9D 5CHNB 4WCYL 1FJ1B 3OAYK 5IHUH 4L3EE 2H1PL 5D7IA 5F7WC 5KSVA 3MV7B 4WEBL 3DIFA 4JO2L 4HFWA 1AY1L 1CE1H 1CVRA 4X99B 4HHAB 1A3RH 1EXUA 3CXDH 4MJID 3SJVE 1U8JB 3KR3H 4U1MB 4OIBA 4ZUUB 1J0JA 4LAJH 5D6CA 4ZO7A 5E6IB 5IQ9A 2Z35A 4KROD 1JZ5A 2B7DT 4BZ1L 5I15H 1SMAA 5J9PA 4KKLC 1W72H 1CICA 2CRIA 3UJTH 1OVZA 1UXSA 3LKPA 3QFJB 2DICA 2Y4SA 4JM2C 4NCDA 4TVPH 5I76B 1BOGB 2FSEA 4Z7VA 4LLYA 4NRYA 2YRLA 4K3GA 3WLBA 3EIFA 1S7TB 4G6KH 4GKSA 4MX7A 4S1QH 1YC7A 3I02A 4OD1L 4YPGA 4UOW1 1YMME 3QUYD 3PWPE 4MS8D 4YFLI 1ZHLB 4XAWL 5L2KE 1C08B 3OB8A 4PJEA 1TENA 2EC9U 3QNYB 3EOAA 2WIMA 4I0PC 3NA9H 3QO1A 3O9WA 4P3CH 1LP9F 4UQ3A 1U2HA 5I66A 2C3VA 3R1GH 4GH7B 4PJHB 1JGUH 5DSCB 2F54E 1DLHA 4R2GB 3MREA 5GGRB 3IVKB 3QFDB 5EFIA 1IAKB 4KK5D 1YEIH 4ZFOB 4GBXA 3EOTH 4BZYA 1YECL 4DZBA 1I9JH 4Q9RL 3L6FB 4JFQA 2QQKH 4JQVC 2BSTA 4W6XB 3RVWD 1P4LB 4RA3A 5JZ7C 1BJMA 5T1LB 3D3VD 1M05A 1AD9A 1CD8A 1J8HB 3BQUB 3L7FA 1JZ2A 1VHPA 4LU5L 4NUGL 2NNAB 4UUJB 4P46B 5EO0B 4C58B 4Y19D 2WUBL 1H3XA 4ALAL 1D9KD 2HKHH 2LVCA 4TYUA 4P99A 1HILB 2IH1B 2FR4B 3FCTA 1FNHA 3OJ2C 2EYSA 4PJXE 3WKML 3UAJC 1NL0L 5AUMB 1E6JL 1YEDB 2R4RL 2X4OB 1GGBH 4N68A 3AM8C 2MSPA 1DR9A 3OJMB 2VXTH 4G8FB 3X3FL 1CZ8H 3LN4B 1BQHA 1RUQL 3LN5B 2A9MH 1XCQB 4JLRA 2DJ4A 4UTAH 3QJHB 3DMMD 4X8XA 3H7BA 3KJ4B 3FB8A 2Z31D 3WS3A 4CJ0A 5IB1B 5FO8B 2D7QA 3BP7B 3MV8D 5SWSD 1WFUA 5ALBH 2B8OT 5D1QC 1RJYB 5IV2A 3GMRB 2IADB 1EA9C 3IDXH 4HCRL 3T1WA 4UIMB 2GSIB 3X14B 2DM4A 3W2DL 4JN1H 4H1LB 3TT1L 3TN0A 3HZKB 4IRJC 1EX0A 5DZOA 3O6LL 3QDME 2VLKD 1RZFL 1YQVH 2OTUA 1QRND 1KTLB 2UWEA 3KYKL 1YEJL 1J0ZA 3KXFE 4LIQH 4UT9H 5DJZA 1IQWH 5LG1A 1OSPH 4N8VA 4XVTL 3HE7C 1AFVH 5GGSY 2OMBA 3O4LA 3V0WL 3GJFK 4LLAA 5DMGD 1FYTA 4CRPA 3ULVD 2VLME 2GSGA 2WWKT 2FD6L 2W0FA 2W92A 1BBJB 4AG4L 4HJJL 3GGWA 1J11A 2IF7A 1JTOA 3WNPA 3BKCH 5CJQH 3KLSA 3LEYL 4YC2B 4NO0A 5C0NC 2B2XL 43C9A 1EBAA 1OOAA 4JRYD 5IVXF 4J1UB 5D7LD 1KPRB 1MI5E 4XP5L 3U7YL 3R06A 5TE7H 4NM4L 4WUUB 1QOKA 1PJ9A 1XIWB 5JDJA 1TTFA 3IU3A 4QTHA 5ACMA 3D85A 5K9JH 4PJ5B 3ZYOA 5C09A 4LVHB 5DVNA 1KOAA 2E7BA 2GI7A 1EHLH 1FVDB 3HLAB 3A67H 4LHUD 3RZCD 5JPNB 1R3LA 4KUCF 1N2RB 3BJLA 3EYQD 4OIIL 1VGKB 1C5DA 4L3ED 4KC3B 4Z7OF 3VH8A 4EI6A 4LCUB 4LPCA 4F33A 3IDUA 3SDCA 3NFNA 1NEUA 5EOCL 1U8LA 2JCCE 1VEMA 1YY8B 3SJVD 3ZYZA 4ORGA 3DBXB 5ITBH 5IMOB 1X5AA 3V6OC 4PB0H 1HH9B 4PGDB 4NGHH 4KQ4L 2WQ8A 3TC9A 2IAMD 3U7AA 1H5BC 2I5YH 2V5SA 1GHFL 1MCCA 1C5CL 1BMGA 4OIAA 3RUGE 1BOYA 1L6ZA 1OLLA 2L7UA 4ZNEA 5MI0B 1D5XB 3D6GA 3VFRB 2EDNA 4W6WB 1RUPH 1KJ2A 4LPUA 1GSMA 2AEPH 4JO1L 5J11B 1UB6A 3C6SA 3I6GB 3UEZA 4HUMB 4HJGB 4MA1C 3MRGA 4X6FB 3EYOA 2JJTA 1MLBB 1T2QH 2UVFA 1MUJA 4R8WH 4XBEH 3FQUB 3VFWB 2YN5A 3GMOB 5F6IC 3FOMA 4PRIE 2CLRA 1WCBA 4KY1L 4KKLD 1CGSH 3GJEB 4BA8A 1YMMD 3PWPD 4JM2D 5DQ9A 1PVHA 3L3DA 5L2KD 5IHZA 2BVOA 1MHPH 2ZWLT 3FB5B 3P73A 3U4EA 4FQJL 4GAGH 4HXBH 3GBNL 1EO8H 2Q20A 2ESVE 3MX0A 3DRTA 5IMLB 4NC2B 5HDBF 1YEKH 4NN7B 2DJSA 4QHKI 2CPCA 5T1KB 4CVXB 2F54D 4Q9QH 3DETC 2AV7A 3MA7A 2BHYA 4UAOC 4TSAH 4KH2A 3L3OB 4WI7A 5D93C 1CBVL 2YUVA 5BZWB 5ISZE 2ADGB 5EPMB 4X98B 5DK2B 1KLGB 4I0PD 2JJWA 3TIEA 1F3DJ 3FTGB 5DWUL 2YA2A 2DKMA 5FA4B 3I3DA 4RFNC 2V7NA 3VRLE 5DFVC 1ZA6B 2MPAH 1F13A 5GS2D 1M71B 3KPTA 4KI5C 1JF5A 4DAGL 1ZK9A 1H15B 3NOIA 4Q2ZA 2ZJSH 4WTZG 3NIDF 5IR1A 1DE4A 3G9VA 2Y5TB 1H8NA 3JWNC 4RAVA 4YUEH 5I8EA 2JJSA 5DJCB 3E1F1 3L5XL 1NAML 4KGJA 5JZ7D 4KRMB 1LO3H 4C56E 2E6PA 2DYPD 1TZGL 1ZGLA 4QF1A 3F7QA 3ARXA 5DGQA 1Z9OA 4HSQA 4EVNA 4N8VG 4W4OA 3B2UC 1FZKA 2FJHA 4KI5E 2IG2L 3MGTA 2CD0A 2W0KA 4Y2OA 2CK2A 35C8H 1OL0A 3QEQE 4QOKA 3VXRE 1PGRB 1NGWB 1IGML 2EE3A 1NMBH 3KYMB 2Z93B 3UAJD 1I3RB 2X42A 2Z4QA 5F89B 1MAKA 3NPSC 3RU8H 4U31A 5D96C 1GCFA 1B4JH 2F19L 5IESL 4LHQB 2IC2A 4OGXH 3WS6A 2ZPKL 1I4FB 4R4BB 5E94A 2R1WA 1A1OA 1F8TL 5GZOC 1FNLA 1E4XL 3QDMD 2YR3A 4XAKE 4W68A 1HXYA 3DTXA 3TCXA 5IW3A 1LNUB 4WJ5B 3K80A 3K2UH 3PXJA 1PW3A 1G0XA 2SEBA 3CMOL 3KXFD 4F8TA 4GRLC 2DQCL 3UDWA 3SPVA 5EBWA 4DUWA 4M5ZH 1OM3H 3HRZB 5GSVB 3RNQA 4IRJD 1YNLH 1SJXA 2XY2A 1A6WH 1GAFL 3P9WB 3K46A 3V4VH 2VLMD 2EDEA 1RHFA 4P5TB 5H2BA 3QSKB 1TCRA 5EBLA 4OCYH 4ODSL 3AY4C 1N6VA 3TESA 5L88L 1K4DB 5FF6A 4ENEC 3HC4L 3BW9B 3ULUL 2CLZA 1JHKL 3HE7D 4JAMA 5ALCH 1RIHL 3AB0C 3ABZA 4P2OA 2YBRA 2VE6A 3MODH 5DJ2A 1MI5D 2VDQH 3WFCL 1F45A 1SEBA 4IBLT 4BYHA 2UUDH 1T1WB 4HS8H 2XA8H 5FV1L 4RRPG 1W2KT 2RFXA 1JHLL 5I73C 4XPFL 5J12C 3O3DA 4Y2DC 1HXMA 4HWEH 2ZSVA 5C0ND 3CH8A 5GRUL 3LKQA 3HZMA 5CP7A 2VSCA 4NZRL 4HS6B 1SM3L 1RK0A 1NLDL 3IXAB 1OP5H 4R3SA 4KZDH 4X8JA 1KJVA 3V52H 1OAQL 1FL3B 3MXVL 1NFDF 2AERT 3O4OC 2X70A 1NJ9B 1JJUA 1EGJL 5H37H 1CDUA 4HT1L 4YX2H 1KB9K 3CVIH 1J5OH 4OZIF 3ZHDA 5DC0A 2YA1A 5B39B 1SHMA 1IM9A 2VZOA 4KJQC 5C6WH 4YDIH 2FIRT 5HHVH 2W0PA 3QRGH 2PUQT 3INUH 4ZPVB 1I9EA 2D03L 1S7UB 4BZ2L 2DRUA 5D2NB 4OKVB 4TNWK 1MEXH 3OKMA 4G7YH 4YDLB 3EYVB 1CGWA 4L29A 3WHE0 3H7LA 4J12A 4R26H 5CD3A 4PRID 2Y7QA 4BK4A 4P9ML 2XPGB 5HGHB 3D39B 3H9ZA 4KXZH 4MD5B 2ZCHH 3FONA 2L4OA 4UV7L 4LP5A 3ETBF 5C9JA 4WI8A 4M6MH 3CK0L 3GSOB 3OKOA 1IGJB 1UA6H 3M1BB 3SQOL 2C1PA 2ESVD 4EN3B 1VDGA 2QTEA 3BWAB 3V0AC 1L7IL 1UYWH 4XHJC 4CDHA 5D71L 3F65A 4P9HC 2DTML 4OCLC 3RVTC 1XGYL 1IZJA 1ZEAL 2BVYA 2AJVL 5FKPB 1FYHB 1HHKB 3E2HC 4GOSA 1QYGL 5ISZD 4GQ9H 1S7QB 1PKQE 3ARYA 2M26A 2D0GA 3PL6C 3FRUA 3FO1B 2V2WA 2AJ3B 4MWFA 4ZD3L 1D5IL 2X44D 1AJ7L 1N64H 1WWAX 3DETD 5FXCH 3GSWB 1WC7B 3QRFM 2GTWB 2EDKA 1IEBA 1I75A 1P69B 3O8XB 5FGCE 4LOUC 2QV2A 3S96B 1QSEA 1WLHA 2DQDL 5F70A 1G7JA 4JZOB 4JDZB 2DQGL 4DW2H 1G9ML 2OR9H 2XZQL 2RBLA 4LNRA 5HYSG 5SX4I 4LARH 4S1DC 3H3PL 1X7QA 3H9SA 3RGVB 5LWYH 3QQ9C 1JPFB 4C56D 4WEUD 1T83C 3S35L 4EDWL 1U93B 3QHZH 1S9WA 1OSZA 2PW1B 5DFVD 2DLTA 3BE1H 4KI5D 3W0WB 3WFEH 1U58B 2YUWA 2R1XB 5GS0C 3VRJB 4WDIB 1LDSA 3GSNH 1FL5A 4YAQA 4O58H 1F11B 2D0FA 2GAZA 5IB3B 3QEQD 4PP2B 1E6OL 3VXRD 4O9HH 4BQCA 4OBRA 1I1AA 2VR4A 5SX5H 4MJIA 3T2QA 5IEHA 3T2NH 1EPFA 5A2KH 3B2UD 1YNTA 3E6HA 4K3DH 1M7DB 1IL1B 3RX8A 4K55A 2NCMA 2H45A 3MBEC 4QRSA 1KB9J 2EDHA 4FQCH 3DYOA 5DEFB 4XAKD 2Z8RA 1X5GA 1YPZE 3I6KA 4D0DB 4XBGA 4X7SL 3L3HB 5B3JF 3GSVA 3VXSA 4D0BB 1BEYL 4P2CG 3T65B 5IW1B 1U92A 4Y4KB 2BRQA 3QQ4A 1U8QA 1UEMA 4MD4A 4K2UL 2Z92A 3VD9A 3QEGL 5MERB 3AGVA 5B38G 5GZOD 2FRGP 4YHOL 4H25A 2EH7H 4R7DB 3WSQL 3WL9B 1VFMA 25C8H 3QUZB 2EDQA 3V7AG 4GRLD 1IC7L 3KDMB 3MRKA 4JQXA 1KB5A 5HJ3B 4TSCH 1PEZA 1FFNA 3BEWB 2X4UB 2D3VA 3QIUC 2EH8L 5AZ2H 4Y5XC 1LP9A 3BD5A 1IT9L 1X3DA 1TQBC 2HJLA 2ADJA 4YHZL 2C7UA 1A6ZB 1CD0A 1A7PH 4ENED 1FBIL 5TH2A 2VKXA 3T04D 4J8RA 3CSYB 4FZEH 1TJIH 4HUNB 3IDYB 2R1YB 2F9BT 1DQTA 1Y6MR 3BXNA 2EIZA 1TIUA 2BNQB 1QBAA 5I71C 2HJFA 5F3HA 4XPBH 2H26B 1S7VB 2HKFH 3FN3A 4RGNB 4Y19A 4PJCF 2AKRB 4Y2DD 5HHQB 2VABA 4QHMB 1NKRA 3WIFA 1HI6A 5IVNA 5JW5A 3TA3B 4WNQB 5K9KB 1DBMH 4G3YL 3U2SA 3MRMA 2PR4L 5I1CH 2KKQA 4R9HA 2Z91B 1TQCC 4UDUA 4KUZH 3FKUS 4GS7B 3TIDA 1ZVYA 2Q7NA 4F7MB 5J6HA 2ITDB 5EZOL 3HUJF 3Q5YA 1JWMA 1ZT4A 1A7RH 1FV1A 5GRJL 5CIPA 4Z77B 1U8PA 1ADQA 4TULL 4KJQD 5BS0E 2AEQH 1YUHB 4FXLA 2P5WB 4U6YA 1KJMB 1A14H 3SGDH 4KJWC 5A16A 4OLZH 1LVEA 1N3NB 5T5NF 1FL6B 3C5JB 1B90A 2A6JA 4L4TD 5K9OA 4Z7UE 3E6FB 2XQBH 7CGTA 1P9MC 1QRNA 1CFSB 1MJ7H 4ODWA 4X6DB 3AVEA 4ODUB 5KW9H 4M43H 3X12B 2G9HA 1BM3H 1SY6L 1DP0A 3BDYH 3OL2A 4L8BB 5E7FA 5IFJB 3GSUB 3J7HA 1DLFL 2VUYA 4YHIA 5DRXB 3QJFA 1CLOL 3P0YL 4XHJD 3GKZA 4M6NL 4QXUH 1IE5A 1Q72H 5CMAB 2AJZA 5DURB 1NPUA 3RVTD 3KLAB 5KOVC 1I8MB 1KIQA 3WHXA 5F96L 2PO6C 4Y1AB 4DGVH 1I9RH 4XCFH 1JV5A 2ERJB 4I48B 5JW3L 4QTIL 3JZ7A 1GIGH 2V7HA 3PL6D 3X3GL 3DRQB 4HUWA 4JKPH 5IVXA 4FQXC 2HN7A 4L3CB 2EDXA 4G8EA 4MDJA 3S98A 4JHWH 2Y06H 4NNYB 5EUKA 3MRLB 5HHME 1TLKA 1U8OA 1UJTA 5IFHH 1CFQB 1RD6A 4F2MB 4QXGH 1LEIB 2M2DA 1FLTX 2BVUA 4LCCA 4LOUD 5KTEH 5D2LF 5DF0A 4MB4A 2KL6A 2NY6B 4KV5E 4L3EA 4L9LC 5M7QA 1QRKA 1JZ8A 3T1FB 4IMKA 2WBKA 2NR6C 3HR5B 2MQCA 2CDGB 4OCWL 4S1DD 4O2FA 3FN0H 5GIRA 4R4FH 2ZSWA 5KSUA 2V2TB 1QLFB 3JV4A 3QQ9D 5HGBA 4G6JH 1BQLH 3O2WL 5CP3H 1BQSA 3ME0A 4FXKA 5FYLH 2IAMA 4EN3C 4ERSH 4LSVH 3DVFA 5E8OB 5DVOA 1A7QH 3RWIA 4PLOB 5HHXL 2H32B 3MJ8A 1KB5L 4S2SA 3HC3H 3L3GA 3MRJB 5CILL 3KYNB 2A1WH 1KV3A 2ICEA 4CAGA 4JY5H 1BZ7B 4JO3H 5IWLC 1GZPB 4XPGL 4HX1B 1NUNB 5J13C 1N0XL 3C6LC 1F4XH 2DB8A 2OTPA 4H26A 3CAFA 4O2CA 4NSKA 3F7YB 4ZUSA 5CCKH 5F8QC 3MBED 4LK4A 4Y5VC 1WZKA 1MCWM 5JIHA 3JWDC 3VXMB 2DBLH 3S36L 5A43C 5C2BH 4F8QA 1YEHL 3TJHC 3KPQA 5H35B 1G7QA 1OAZH 3I2CL 4CW1B 3GM0A 5DMKA 1ED3A 1T5XB 3MCLL 4P2QE 1NGZB 1N5AB 5JOPE 1BZQK 32C2B 3GHBH 3N1MC 4H8WC 2BOCA 4F9PA 1WWWX 5D7JC 1IZKA 4NN5B 2CKBB 3BZ4B 5TDNB 1IKFL 4M7ZB 4C83B 1NEZA 3KPMA 4Q74A 1EEYA 4GAJH 4EXKA 3SDAC 3DNKA 3MNWA 2PW2A 3RTQB 1HKLH 5DS8A 1T20A 3QG7L 4X6CA 5FHAL 5T3ZE 1NGPL 2WIIB 3GMNA 4IOSD 3PUCA 3LQAL 1S9XB 4WFHD 4PJFA 4WWKA 4HG4K 3RJDA 3QIUD 4M8QB 2P49B 1W8NA 4J3SA 5SWQB 3BP4B 1BWMA 1BLNB 3PIQB 1YY9C 4XCEA 3VFOB 1W0YT 1P7QB 1JI1A 4D94A 4MJ6B 1P84K 2UYLB 3MYJB 3RKDC 4ELME 4DKEH 1UCBH 4F57H 5IT2H 4G8GA 3IXTA 2QLVB 1A6TA 3BIAX 1I3GH 4RDQF 3VXUA 3FOLA 4YXLL 4LPTA 4K3JH 3MBXL 4CADB 2R2EA 1N8ZA 3G6DL 3GRWL 1FVCA 1KIRB 5JR1H 4D0CB 1MCBA 1ZS8B 3QAZC 4HW6A 2ZOLB 2E7LC 1B6UA 3UPCA 3B6SA 4G6AC 4MA8H 2LAGB 4XP9H 5C07E 3P0VL 3ULVL 2FB4L 2OX5A 2GT9A 4WU7A 5BS0D 5KVFL 1YMHB 5JLZA 4JCLA 3GI9H 5E8DL 3TT3H 5C6TL 4KKBC 2OK0L 1RHHA 5I1HL 3IETB 4N0FA 3L7EB 4LKCB 1AKJD 3CFKA 3JTSA 4BM7A 1ZT1B 2Q7YB 4LLUB 3ECBA 5H8DA 3N1GC 4K7FA 3MLXH 1YJDH 3F62A 1GH7A 2J8HA 4ZSOE 4X7TB 3IJHB 3QULB 4HQQL 1LE9A 3EOBA 4KJWD 3V7MA 4XP6L 4LHUG 2DMBA 2VMFA 3P4NB 4QRPB 2IQAA 3SOBH 3ZTJG 5I1IH 3CLFL 1YEEH 1DBKH 5M94B 2BY3A 3CCHA 2LTQB 1QFWI 4OZGF 4LAQH 3MRIA 2NY1D 4HIXH 1T1XB 3TA3C 3D0LA 1ZA3A 2FH6A 3S88H 1TJHL 4TQEL 1P1ZB 1F4WL 3NCJH 4KVCH 4OTXL 1P4IH 2IANE 4WW1B 1FH5H 1IGIL 1RUKH 3WYRA 2VDNH 3MO1B 4GS7C 3HMWH 1RZJH 2VLJE 3B9KC 3DXAB 3AS2A 5HHMD 4OBSA 3VMPA 5FECB 2ZUUA 3MLPA 2PO6D 4TPRH 2A6IB 1BJ8A 2YN3A 1TPXC 2Z0BA 3HNSL 5DI8B 2BJMH 1K4CA 1TMCB 3MLUL 43CAA 5A1AA 1NC2D 4YDKH 2HMIC 1T04A 3ARPA 4HWBL 5EU5A 4FQXD 4PJDF 4KVNL 3T8XA 1MFDH 1FFQA 3LPFA 4M3KB 4R7NA 5C0GA 3MC0A 1DEDA 4JFPA 4OLUL 4G9FB 1RURL 4PGJA 1NFDA 1P84J 1AQKH 5E2VL 4PJIE 5GZNC 2X40A 3TPUA 1NGYA 5D6DC 4JFOA 3O0RH 3MRNA 2NR6D 4OZIA 5EO1B 3RWEB 1Q9LB 1KG0B 4FQLH 3ZDZE 2AXFA 3BKYH 5SV3A 5ITFA 1Z3GL 3P4MA 5HVFB 3DUSA 2FATH 3RDTC 2NY2D 3A0OA 2Q3AA 4NZTL 3ZKXB 1CK0L 4L4JA 3RWFB 4NJAL 5E5MB 4BH7A 3CXHK 4OD2A 4YO0B 5LBSL 3SCMA 1U8NA 5KAQF 1H8OA 1HINL 2XTLA 1HNGA 3GSRA 5KN5B 5FGSA 1OP3H 3O41B 4M7KL 4U1NA 1BWWA 3I6LE 5JQ6L 4P2QD 3IDMA 5JOPD 2J12B 4L4VE 4APQB 3C6LD 1P7KA 5GISH 3CDCA 3STLA 3U7WL 4XBPA 1LO4H 3QIWC 2OYPA 4NJ9L 2PXYB 4O51B 5I30H 1RZ7L 4LQFL 3OX8A 3V5HB 4F9LA 2WWMC 3PHOA 5T3ZD 2YPKB 4PRNB 3ARGD 3GMPB 2CO6B 3RWHA 2YZ1A 1FRGH 3QYCA 4K3EL 5D7JD 5MP6H 5T3XH 1YEFH 3WXVH 4JDTH 2BCKA 2RIKA 3BPOB 3SDAD 4XXCC 3DVNB 3X13B 2JB5H 1KTDB 4YQXL 4D3CH 1R3HB 2GCYB 4X80L 3ARVA 1FSKC 2XWJA 4YWGH 1GRWA 5DHYA 4RMVA 2XZCH 1CF8L 4Q6IC 4HGKC 2DTSA 4IRSC 4XZUA 1VFBB 2ILLA 4CBPA 5J7CC 1CIUA 4NQUA 3BRFA 3T0VA 1L0XA 5B8CA 1CGTA 2FBJH 1YY9D 3ARDB 3L3KB 3CU1A 1FFOA 4AIZB 3RKDD 3FFCA 1QQDB 2XKNB 1NCDL 2ZUSA 2X4TA 3BUTA 4PY7A 4PY8J 2VDLL 5SWZE 3V4UL 1PG7H 5IK3A 5HXMA 3MGOB 5C07D 2JK5B 1FNFA 1W72A 4NO2A 5D5MF 4KAQL 3K4AA 3QIBB 3ZKMC 3EO9H 1RJZB 4LMQE 1RMFH 2WV3A 1B0WA 2NQCA 4YXHH 2BERA 1FO0B 5DT1H 4DN4L 3BP5A 2R2BA 4KRNA 4H1LH 5K33A 3T0EC 2EDJA 3B8SA 1LE5B 4G6AD 4NOBA 5I1JL 1CE6A 1X5IA 4I13B 4ZPTA 4M1GH 5MEPA 1R3IL 1ACYL 4YHNB 1CDYA 4LRIA 1JK8A 4GG6E 1ES0A 4FG6C 1QSFB 4KKBD 4KTEH 3SE9H 4GLRH 3TZVC 1BD2A 4MAYC 2H9GA 1OAKH 5DD0L 5IBUG 1UADC 3PG2A 3T0EE 1DVFA 2CK0L 2E7MA 1ODAA 1R5IB 3IDNB 3NCFB 4BFIB 3LHPH 3ILPB 5DJ6A 1B2WH 1B0RB 2CIIA 2I9LB 5LAXB 4BKLB 4K3HA 3A6OA 2COQA 5KSBB 3CXHJ 1MWAH 4XNMB 2MNUA 4DOHB 5I75B 1GGIL 4JFDA 2VXVH 2AK1H 4WHDA 4U6XB 5I1GH 2EEAA 3MUGA 3PE9A 4AH2A 4JGMA 5EWIH 1RZGA 4X4XA 1X5HA 4WGVB 2NW2A 3P77A 3U4AA 3QCUH 4JKLA 1U91B 2IAND 3IAQA 3RX7A 2V5MA 4WW2B 2ZUQB 1J10A 5FM5O 4Z7NF 2VLJD 4PBXA 4NWUH 3WFDL 4IIQB 3QEHB 3DV6A 1QHOA 2MJWA 3QI9D 3RY5A 2AK4E 2MCPH 3T77A 5A3IC 5HHPB 1OTUC 1ZWIB 3QDGB 1R5VA 5FYKH 5KOMC 3AREB 3C60B 5DTFA 4RBPH 4XVJH 3TLRA 1NBZB 1C16B 1CLYH 4DUXA 3OXRA 2DQEH 5LCVL 1JGLH 3VD4A 2FJFA 1KN4L 3MA9H 1KN2H 4RX4A 3B9KD 3WO4B 3PQYE 4P4KD 5BRZA 4YBQC 4JANB 4M9PA 4PJIF 4G6FB 3BSZL 4PJCA 2P5EB 5E99H 1QACA 1KENL 4MJ5A 5GHWH 3MZGB 1UJ3C 3WUWG 4RAUA 3ZDZF 4E5XB 5HYJB 5MEQB 2HMID 4OFYD 5I17A 1GOFA 1HH6A 4HJ0C 5EG6C 1DUZA 4MXQD 3ROOB 1HE7A 4C4KT 4M03A 2APBA 2R9HC 3KJ6H 4NOFA 4D8PB 2OXHA 4Z18A 1MCWW 2VWEC 1M6OA 3UBXG 1WEJL 4XPAH 5GZND 5MENE 3Q5OA 4M6OL 3HUJA 3MUHL 4PRPE 3UX9B 3F6LA 2CJUH 2HLFC 1JGDA 3MOAH 4PG2C 4IOIB 3VFMA 5KANG 4LCYB 4HBCL 1JHTA 3Q1SH 4WY7H 2ARWA 1A1MB 3FO0H 5F88A 4M02A 3I6LD 3ULSB 2AW2A 1OPGL 3LRSA 5F7YC 4JB9H 4JFFE 4NQEB 5AG8A 4L4VD 4L4TA 3RDTD 2VLLA 3MRPB 3BHBA 1HHHA 4R6UA 3NAAH 4ZO9A 1DEEA 2VDML 1LHZA 4K7PX 1TETL 3AXLB 2DQUL 4PGZA 4QYOB 4AYFA 4YHYC 3H0TA 1TVBA 4OSUL 5BOPA 2QHLA 4Y4HC 4M48H 1SMOA 2EXWC 1F58L 1XZ0B 1ACZA 3CXDL 4AJ0A 4YZFF 4LP4A 3QHFH 3WIIL 4KHTL 4PJAF 4LSQH 3RWGB 4OGYL 4FP8L 2AQ3A 4M7JH 4Z76A 1JPGA 1U36A 4AEHH 5LVEA 1NDGA 1XGTA 3QIWD 3FMGH 5DJDA 5D72H 3IKCA 1QFWM 4QHKJ 3FQNB 4WFED 3TH2T 1A4KA 3FO9A 3L3IB 4YHKL 5IM7B 1OB1A 1SBSH 5I16A 3KPRE 1I1FB 3WJLA 4JRXE 3CPLB 3ESVF 3LIZL 4ZXBA 5GJTL 1X5JA 1XAUA 3BGAA 1MCIA 3C09B 3PWLB 1CLZH 5ANMA 5L2JB 3JWOH 4S1QL 4R0LA 1HCVA 2HH0H 1KULA 5AYUH 5HVWA 1MHEA 3W9EA 2CXGA 3STZA 3WBDA 1YZZA 1NUFA 4TN9A 2WINA 3RPIB 1EHXA 1U3HC 1J88A 3NIFE 4KXZI 5ICXA 5KVDH 3GBLA 4R4NC 4G80A 3QDJB 5SWZD 3FT4B 4AEIL 5D2LA 1XR8A 4NHCH 4WI5A 1HQ4B 4IRSD 3O45A 4J6RH 1JNLL 4PJGF 3MR9B 2HRLA 5EZIL 5JORA 5EU6B 3R1GL 3MOBL 4PTTA 3GMQB 4QY8B 3VWKA 2AP2A 1MJUH 4N8PA 3RVUC 4O5LH 4LSRH 3G5YA 3IDJA 3B83A 5C0IA 3TWCH 5J4MA 3B9DA 4XCNB 5D8JL 4U1KB 5GRYA 3FQTB 3S8WA 1A22B 3VJ6B 2ED8A 5J1AA 3ARFB 3ZKMD 5AWNH 2G75A 2IPTL 1JNHB 2BVPB 2CR3A 4UOW0 1KEGH 5KBNC 3AROA 4NNXA 4NC1C 3T0ED 1CFTB 4NQSB 4JZJB 1GGYA 3UC0L 4DGYL 1CDGA 2AGJH 1QVOA 3NIGF 4ODBD 1J8KA 1I7ZA 2C5DC 3QO0A 4DCQB 4L1HA 1G9EA 3ZYJA 5EOQH 5FIEA 1G6RB 3HE6B 4FG6D 1AXTL 3TZVD 4MAYD 5D1XC 1CZ8L 1G7MB 2ICCA 4NC1E 1QEWA 4UTAL 5C8JA 3UTSB 4I3GA 2R15A 5EUOE 4XP1H 2ZG3A 1A3LH 4XWOC 3OPZH 3JV5A 1A7BA 5IKCA 2AK4D 4FFVC 4LLVB 5EU4A 2DI7A 4NHUA 3BH9A 4X6BA 4P59L 5SV4A 1HN1A 3EYFA 3ILQC 4LNVA 4JZNB 1NQBA 3ZDYF 2AV1A 4WO4C 4XVSL 1XR9B 3BUYA 2X4SA 2VZSA 5EZLA 2A83A 3PQYD 3RBGA 4FQQA 5DDHA 2PYEB 3IDIA 5IJKC 1XGPB 5A3ID 2BVTA 1OTUD 2H41A 1D5ZB 3SDXE 1OSPL 5IIEA 4S0SD 2NTFB 1BAFL 3FHAA 3ARBB 5DRZA 1P7HL 1RZ8A 5E6ZA 1F4HA 4I2XE 4HS3A 1RZKH 5HVHC 4JM4H 2YD3A 4YBQD 1IARB 5FB8B 3VFGL 3BPCB 5JHDA 2WBJA 4NM8L 4JPWL 5HDQH 2O26U 4PJBA 5MEND 1CFVH 4PRPD 2EDBA 4YK4C 1KFAH 4UINH 4HJ0D 1QR1A 3MLYL 3RL1B 5TE7L 4ZTPH 4P9HL 1JRHI 5FO7B 3O11A 2R9HD 5GGVH 2ZCLL 4CDGC 4NKMA 2Z35B 1ZHNB 1AO7B 2FO1A 5CWSA 1ORQB 1CDIA 1AKJA 4JFFD 1IFHH 4TOYL 2R0WL 5J9PB 4I18C 2OQJB 4Z95L 3AU1B 1MFEH 4X6EA 4IS6B 4V1DE 3DUUB 2HLFD 1H3GA 2XFXB 3OXSA 1BECA 2DKSA 1UWEL 2FECL 3PWVB 4OZHE 4NRYB 2MOVA 4Z78B 1WZLA 3RHWF 3WLBB 5I1KH 5F6HI 1AGEA 4NKDA 5FCSH 4HXAL 1FZJA 3VI3F 5ITBL 4BSVA 1C1EL 2BDNL 4GXVH 5DYOA 4B53A 1AP2A 3OKLA 5JPMA 4FZ8H 4M6AA 1ZTXH 5FM5M 5KG9A 2I60H 1DSFL 4EIGB 2EXWD 5GS1B 1NAKH 4HLZH 1FAIL 3KPRD 3QO1B 4JRXD 5C0BE 3BYTA 1NC4D 4OZGA 3BFOA 1VEPA 2YPLE 2WP3O 3OJVC 5EC2A 1EFXA 2R0LH 3ZTNH 1JGVH 3WN5A 4WV1B 1FNGB 4I0KA 4EZMA 4DZ8A 4J4PC 4K94C 3NIFF 4M62H 2YD2A 1CGSL 4UNUA 3TH4T 4Y4FA 5TF0A 1QKZH 4HWNA 4ZODA 4GW5B 4N0UE 3TO4A 1ETZA 5JW4M 3ZYIA 1K8DB 1MHPL 5FYJE 4ZYKB 5H94B 4IRZL 1J1PH 2F53A 4KDTC 4FQXA 3SGKC 3SGDI 2HVKB 3I50L 1IGFL 2L7JA 5FKAB 4P5MB 3EUUA 3BGFC 4PJDA 4Z5RB 3RJQB 3MLTA 3E3QE 4KKCC 2FHFA 2R29L 5F7EH 3WFZA 2GK0B 4PRBA 5ICZB 3R0MA 2RGSA 1IC4H 3RIAF 2QL1A 2FL5B 1U3HD 3PABB 3LKNA 1G9NH 5CBAA 2YUZA 4R4ND 4JPIA 2ZUYA 3G6AA 2MKLC 3ZL4H 4BELD 2BFVH 1R3JA 5EZJA 1YDPB 4NQDB 4P5KB 4U7SA 3GO1H 1DQQB 2PETA 4I3RH 4YEFA 2A6DB 4DKDC 1KLUA 3C5ZA 1GZQB 4EI5C 3QDHA 3UO1H 2FEDC 3GHEH 1M4KA 2OBGA 5L0QB 2KZWA 1T0NA 3RVUD 2VQUA 2W9DH 3SE8H 2MPAL 4BH8A 4ZDHA 1Q0XH 4ZFFB 3W5MA 4HKZB 3V4PL 3VE0A 3ROLB 3LD8C 5C08E 3RWJB 2DD8L 4JFEA 3VGAB 3DSFL 5GGQL 3VFUB 3FB6A 4XPHH 1G7IA 1FVEA 2YPVL 1F3RB 4NQXA 4YUEL 1Y6NR 4RMQA 4HIJB 1P6AB 3QCTL 1ZHKB 2IQ9H 1UM5L 5EOTA 3G6JE 3UJIL 3O3BA 3T3PE 1A0QL 5LKNA 1NAMB 1V8HA 4QCIA 1CL7H 1ZLVK 4ZS7L 5EULV 1BIIB 1LK3H 4XNXL 1RK1A 1T1ZB 35C8L 1LO2L 2EDTA 1PYWB 2JELH 1P53A 4NRZB 1MFAH 3S5LA 3MNVB 2B39A 4GKNA 4N8VB 2X1WL 1OGAE 1II4E 3VWJC 1A9EB 3BISA 4O4YL 1YNKH 2G5BA 2QQNL 4UT6L 3O4LB 4PJ9A 3RU8L 1A6UL 3ARGA 2HFEA 4PJ8B 5D1XD 2GSGB 2LU4A 5GJSH 2VDPH 4U1LB 4XMLL 2IWGA 4JKWA 3TH3T 4X4MA 4KRPB 4M7LH 4XWOD 4AZ8A 1J86A 4MMZC 3FQRB 2A73B 3DARA 4FFVD 4NO3A 4BQ6A 3MTRA 5TDOB 4ZFGL 2GTZB 5KZCD 2NX5E 4WUKH 2ATKA 5ETUA 3UPRB 4HH9B 3P4OA 2P8MA 3N0PB 2CXKA 2WUCH 3GSNA 3LQMA 4ELKB 3ILQD 3K7UA 4WO4D 2OZ4A 1YNLL 3E8UL 5ESVA 5DUPH 1V5JA 2JIXD 4NRXA 5CZVL 4IDJL 2Y07L 3CX5K 3MLSH 4P4RA 4KTDH 3WJJA 1ZGLP 1KLFA 3GMMB 4OCYL 1C7TA 4YHPB 3SKMB 3OAZK 4DFIA 4E0RA 4YNYA 1D5BA 4M4RA 3EYSL 5DA4A 5C07A 1HQRB 5JOFA 3UZQA 1DN0B 1Z9LA 3QUXC 4XNQB 4PJ7E 1X5ZA 1PSKL 4OT1L 1KELL 4OV5A 5D5MA 5BJTA 3NTCH 4Z0BH 1EO7A 3GNML 1NCWH 2CIKB 1SJHA 1WBYA 3DGGA 1F6AB 2HFFA 1D6VH 4OZHF 4V1DD 4GW4A 3FAWA 2F5AH 4Z0XA 4CMHC 3C6SB 2NY4B 3ARTA 2NXZC 3NZ8A 4BUHA 1IJ9A 4NYLA 1EK3A 1FNEA 3MRGB 4JHZA 3CDGB 4WU5B 3NZHH 3VFVA 3RVXC 4BSWB 2H6PA 1CWVA 4KZDL 4O2EB 1CTOA 2D2OA 5TQ2L 1DDHB 2J6EL 3NCCB 4POZC 3SDDB 3LS5L 2KQMA 4HGMA 5H37G 2W9EH 3QWRA 2FYYA 4LVNB 2IPUG 2YC1A 3NABL 1T4KA 1HK6A 1J5OL 1HZHH 5I1EH 4NUJB 5HY9A 5IHZB 1JUFA 3P73B 1EEUA 3U4EB 4ZMAT 2VC2L 4YDIL 3HZYA 5BV7C 3GUTB 5C0BD 1RJCA 3INUL 3ARBC 2R56L 3B3IA 2YPLD 3D0VA 5DD6A 2BNRA 5FYKD 5C0AE 2NZ9C 1MEXL 3GMLB 3TBVB 1JN6A 4ZAKB 5JW4R 2BSRB 3O6FA 2CH8A 4XCYB 2A6KA 3QI9A 3FRPA 1AXIB 1OGTB 1S8DA 1F4YH 2ZCHL 5D9SB 4KTYA 4OLYH 3L5JA 4OUUB 4BK5A 1FNSL 4D9LL 5FYJD 4UV4L 2W65B 4RISL 5ICYA 2B1AL 3D18B 1T7VA 5CZXC 4PIRF 4XMPL 1GL4B 3V0VA 2WANA 1K2DA 4P4KA 2R23B 4J4PD 1I7RA 3IDGB 5D7IE 2V5TA 3P2TA 4YIQA 3PHQB 1CICC 4PJIA 4AM0B 4HV8A 3OV6A 4XNUL 1U2CA 2H32H 1CR9L 1E28A 1BREA 5KS9B 3JWDL 1HEZB 1UQSB 3S5LG 2NY3B 4EVNB 2NY7L 4QHUB 3DX7A 2Y72A 4KKCD 3QNZB 4MSWB 1S9VA 3VG9B 1NSNL 5JO5B 1ZT7A 5T3ZL 2EXYC 4FXGB 4XRCB 3VCLB 4LEXH 2N56A 4Z7VE 4H8WL 3FT2A 5C08D 5CGYC 5IOPA 4S1SL 4W81A 1BFOB 1FG9C 3O9WC 3ALXA 1WBXB 4LARL 4JQIH 4EI5D 1MVUA 2FEDD 2EEBA 5E94B 4YE4L 4YJZL 2BK8A 2CR6A 7FABH 4QRUA 4NO5B 1LK2A 2NLJB 3BE1L 5HYSB 4KQ3L 3DTXB 1X5FA 3VXOB 5ADPL 4MNQB 1JF1A 4GBXC 5KANI 4PJEE 1EUUA 1FLRH 3IFNH 4N9GB 2CKBH 4HDIA 1WGOA 2NXYB 3CD4A 3P30L 4H20H 4YHMH 2I07B 5F97E 3C8HA 4TUOA 1OGAD 4PV9A 3PGDB 2YSSA 4M8VA 4EOWL 2X7LA 2LE9A 4X7CC 4EQ2A 1KBGH 3PWUA 3HNVL 1PZ5B 1CXHA 3KLHC 4LDEB 4PJAA 1IEHA 4NQVB 3VA2C 2VISB 4WIQA 1S7SA 1MRCL 3B43A 1DFBH 4L8DB 1S7RB 4JHBA 3F8UB 2EIBA 3VWJD 2YBRB 2VE6B 1L7TL 1ZVSA 1ZLUK 1R0AH 4NKOA 4BQBA 1O7VA 2NX5D 1R3KA 5EBMB 2GKIA 3SGJA 2HRPH 2XZAH 5I1LA 5EORL 1A7NL 5CEYA 1G6VK 4YGVA 3MLRH 5F1SA 4RFOL 5I74C 4OCNC 1RU9H 2MQ0A 5E0QA 4AMKL 1KCLA 1WSST 2X1XR 5KJRH 3W39B 3MRCA 3D87B 5CP3A 1LEKA 3LKQB 2H2PC 3IJYA 1AQDB 5E8NA 5B38B 2XN9B 4NQCA 4U0RC 2VLRA 3ARUA 1WBZB 2DQFB 2VL5A 4PTUB 1A1NB 4M5YL 1WQVT 4TSCL 4XGZB 3TN0C 1EHAA 3H42H 4PJGA 1PQZB 3NFSL 1IEAB 5EIQA 2NY5H 3DURB 2FX7L 4ZQKA 4EIZC 3DV4A 1AIFB 1N7MH 5GGTH 4PRHA 1OCWH 2XWTA 2E27L 5HHOA 2FO4B 2CKNA 4GRWE 4MNHB 3IAPA 2HFTA 3BPLC 2Q6WB 4NZUL 3ES6B 2HKFL 2UWEE 5DMJB 1J05A 4ODTH 3PDDA 1DL7H 1WZ1L 4YXKL 4ISVB 3VU2A 3WMSA 4HK0B 3CVHL 2VZTA 3FONB 3DGCR 2NTSP 3KPSB 3EFDL 3KPLB 3C5SB 1T6VN 2NXZD 1DBML 3O4LE 4F7CB 2H8PA 2ICWA 3SKNB 1FYTE 3D5OF 3RVXD 1FCCA 4E41A 1FZMA 4POZD 1AHWA 5IROA 1EAPA 3FO2A 4A6YL 3CFEA 1A9BA 2DQJH 1S7XA 4M1CC 1EZVX 5C0AD 2R2HB 2ADIA 3M17A 4LGRB 1NBVH 4NP4L 5EIVA 1IGTB 3LZFH 2P46B 4MQTB 5A2LH 5LGJB 1IVLA 3PP4H 1NMAH 2J2ZA 5IBTH 3U1SH 1JWUB 4G9DB 4JJ5A 5C09E 2AJYH 1FC2D 3SDCC 4I3SL 5F21B 4UT7L 3UTZB 3LCYA 3MJGX 4NKIH 3QNXB 5F7DB 2NZ9D 5F72S 3D1MC 4MXWL 4OLEA 5KSAD 2BRRL 3BZEA 4HUXA 3N50A 1MY7A 1JPTH 4Q97A 1Q1JH 1V3MA 4LLDA 3LSOB 3HI5H 4ZUTA 1KXTB 3OF6A 5T5FL 1MSPA 5DZLA 4GLRI 4JREC 1PBYA 3CFBA 3O3EA 5CZXD 5KVMC 3QPXH 2DLHA 4FQPA 4P2RB 2JJTC 4QRRB 4FTVA 1CG9A 5E6YA 2OP4L 2AJSL 2LFGA 2OI9C 4QXUL 2OL3B 3MV9B 1MH5A 2CGRH 3VA6A 2IFFH 3VW3H 1CICD 1FC1A 5CJBA 2MMXA 4Z7VF 1Z2KA 1Z5LA 2OJEB 3PGCB 4Z8FL 3S3JA 3V6FA 3S4SG 3LEXB 4MJIB 1OF2A 1J18A 1UZ6F 3HAEG 1JPSH 4OFPA 3B9VA 4G5ZH 2GJ6A 1KJ3H 3EJJX 2BOBA 5I8CB 4P57B 5FFLA 3D2UA 3CIQA 3VD5A 1NLBH 4GAYB 2X4RB 4DEPB 4QXGL 3ARQA 2APVA 2RB8A 1EMTH 4B0MM 2B5IB 1L9NA 5DD3H 1IAIL 1OAYH 5ACZB 4U3HA 4LVEA 5CGYD 1AGFA 1J0HA 1GPOL 4PUBH 2W60A 2GITA 3SE4A 3O9WD 1MF2H 3UMTA 3OB0K 4R4FL 3KPPB 3ZE2E 4LL9A 1T80A 4OKDA 1GVIA 4ZFZB 4JPVL 4LSSH 1F02I 4H25B 4MNGA 3QUYB 2J8UB 5B22A 4X4ZA 4GBXD 4P23A 2YS4A 4HWZB 4S1RL 3QG6B 2D9CA 5FOJA 5IG7B 2GQHA 3QP3A 5HHNA 1KB5B 2G5RA 4PRDA 1AGBB 1AI1H 2JJSC 4Y5YA 3C2AL 1FFNB 2XG4A 1V7MH 1LO5A 1AXSB 1LP9B 4U0QB 3KLHD 5DJYB 1M7IA 1TVHA 4W4OC 4HF5H 5CHNA 1FJ1A 1HHIB 2DBLL 3Q0HA 3MV7A 3P3YA 5D7SL 1JNNL 5FGRA 2DIBA 2D7TL 2WSKA 1MCJA 5L7XH 2XQYK 4JFZH 1U8JA 4JPKL 4U1MA 3WD5L 4I5BA 4ZUUA 2VZ3A 3F6IA 4MCYB 3D3VB 4K8RH 1C12B 5E6IA 4L8SB 3LQZB 3WS6C 3U48A 1J1XH 3UJJL 2VXQH 2BP3A 2FGWH 3R8BB 2ZUXA 4OZFG 1CQYA 1D9KB 1SYSB 4QOKE 5ESQB 3QFJA 5GSRB 4X0KB 3REVB 5I76A 1BOGA 2H2PD 1SVCP 3DHJA 5JTWA 1IAOB 3MLWL 4HC1L 3MLZH 4E42B 3UDWC 5TDPB 2E8ZA 1S7TA 4N1CA 3U36B 3ZT7A 5EU3B 2GJZB 5GGSB 2WLYA 4GW1B 3DMMB 5J6HB 2Z31B 1FGNH 1JWMB 3LPGA 1QP1A 2NW3A 1ZHLA 3MV8B 5SWSB 1C08A 5CIPB 5I19L 3QNYA 3HMXL 5DUML 4IHOB 5I9QC 5J6GB 4U6YB 4OV6F 5IT2L 2QSCH 5IQ7H 1MRFH 4XNZB 3EFFA 4M61B 4P2OC 5K59E 2ORBH 4JRWA 3EO0B 3EJYC 1NCAH 1I3GL 5DSCA 1ZANH 2RCSL 4WHYG 1FYTD 2UV3A 4DK6A 4GXUM 4Q58C 2A9NH 5GGRA 4K3JL 3IVKA 2VLKB 1ZXQA 3QFDA 1HSAB 1IAKA 1OP5K 4ZFOA 2AABH 5JR1L 4YR6B 3BMVA 1OAXH 4U2ZA 2YKLH 3CFJB 3L6FA 4LEOB 3SHSA 2PTUA 4NO0D 4NCC2 4DN3H 1I3VA 3DI2B 2IPUK 3O2VL 2ZUWA 1P4LA 1I1YB 4JG1L 5IVZA 5T1LA 2BNQD 1J8HA 3BQUA 3D85D 3B9AA 3BN3B 5C09D 1F4AA 4NQTA 3GI9L 2NNAA 3G04B 1CXIA 1RJLB 4P46A 4UUJA 5EO0A 5EU7C 1T22B 4M1CD 1MREH 1BQUA 1LO0L 1HILA 2IH1A 3S35X 5TE4L 1E4WH 2FR4A 4PGEB 4LF3B 5CFHA 3F5WB 1XF4B 4JRYB 2DWEB 5DUBA 5AUMA 1S7WB 2XICA 5D7LB 3SKJL 4TSBL 1YEDA 1SEQH 2X4OA 4XP4L 3T08A 3SDCD 3K1DA 4G8FA 1QBLH 4K23H 3GFUA 5EU7E 1BF8A 3LN5A 3ARRA 5FO9B 4KK9C 3QJHA 2JIXA 4G43B 3G9AB 1HHGB 3PGFL 5IB1A 3WEXB 4QXTB 5FO8A 3IFPB 2HTKC 2A74B 3BP7A 5DQDL 4LHUB 1KACB 1MIMH 3RZCB 1UM4H 5ENWB 1DQDL 1RJYA 4M00A 3GMRA 2IADA 4L3EB 2KH2B 4XCCL 4DVRH 4UIMA 1MFCL 2GSIA 3X14A 3TBSB 4H1LA 3O6ML 4R90H 5IB5B 1CN4A 5KSUB 1VSCA 3SJVB 3HZKA 5SX4H 5LXGL 3S3SA 3EDDA 3L5WB 4OFKA 4X6DF 3V2AR 3NCJL 4KVCL 3CUPB 3EDFA 1DANT 1YYMH 2IAMB 5DJ0A 2ITCB 1KTLA 4XHQA 1OARH 3HMWL 1ZHBB 1FG2B 3BO8B 3PXHA 2VH5H 1ZV5A 2ICEB 5FHBL 4UBDC 4X9BA 2B20A 2BJML 4YDKL 1OT1A 4TUJB 2AQ2A 1F90H 2C3XA 2OJZH 4LLMB 1BBJA 5ADOL 1FORH 4NCC1 4WCYH 4ZUSB 3DROB 3BN9D 2H1PH 4P48A 1ZMYA 4WEBH 4JO2H 1YMMB 2MHAB 1AY1H 3PWPB 4JM2B 2NYYC 4LLWA 4J1UA 1KPRA 3O0RL 4CGTA 5L2KB 2VAAB 3GEWB 4WUUA 4HUVB 4WI3A 5J1SC 1XIWA 1FFPB 1PFCA 2FHCA 2X1PA 4N0YL 4PJ5A 1ITBB 2OZ4L 2XWBB 1N26A 3BKYL 2A77L 3KNBB 4BZ1H 5JMRA 1B6DA 3HFML 1YN6B 1FVDA 3HLAA 2VDOL 2F54B 5I0ZA 1S9YB 5JPNA 4MLSA 3RBSA 1N2RA 2BMKB 1QSEE 2YOCA 4JHAL 1VACB 4QLRA 4LCUA 4I0PB 2FCBA 2VXUL 3PF2A 1I1AC 2ZP0T 1YY8A 4JN2A 3H9SE 3DBXA 4OD1H 5IMOA 1HH9A 4PGDA 4CVWA 4R97C 3TYGL 4CNIB 2F74B 4KROC 4JFHD 4HH8A 4XNYL 4XAWH 1MIEL 1NCBL 5CLTA 5DFWH 5HSFA 4QOKD 1D5XA 2FWOA 3LKSB 3VFRA 2W1NA 3QA3B 2X9XA 2WAHA 1WTLA 3IXTB 4HJGA 4MJIE 1KT2B 4PJXB 2B1HL 4KDTA 4X6FA 2AS5M 1A4JB 1MLBA 2DYPB 3KHQA 3OKDB 2X4NB 3FQUA 3VFWA 3GMOA 5I2IB 1WFNA 5AD0B 3E0GA 4X7DC 1YECH 3VXMD 4UOJA 3VXPB 3GJEA 4Q9RH 1J0YA 3RKPA 4K71C 4XPTL 4KI1A 3VG0L 3VXSE 1HHJA 2BSSB 3DPBA 4JQXC 4LU5H 4NUGH 5IMLA 5KVGH 1B3JA 3EKCA 2WUBH 4N0FB 2C26A 4O00A 5T1KA 4CVXA 1Q9OB 3L3OA 1HWHB 3OZ9L 1G6RH 3QDMB 5BZWA 1TNMA 3WKMH 4DVBB 2ADGA 5EPMA 1NL0H 3LB6D 5D1QB 4X98A 5DK2A 1E6JH 5K9QG 2GUOA 2R4RH 3KXFB 5L9DH 3FTGA 3X3FH 4P2OD 1RUQH 3EJYD 5D70L 4EDXB 1JE6A 4IRJB 4B50A 5J56B 3GK8L 3UYOD 3EO9L 1V3LA 4IDLA 4PD4J 1LP9E 3QXWA 1ZA6A 3S7GA 1IGCH 1P7QD 1H15A 1KCUL 4HCRH 5C0FB 1V3JA 3U9PL 3CSBA 2Y5TA 3HE7B 3TT1H 4LSUL 5DJCA 1J1OL 3OHXB 3D0LB 3VWJA 1MI5B 1TITA 3OGOE 3U46B 4LASL 5FA3B 3O6LH 3NFPB 4X5WB 5FDWB 5IEKB 1RZFH 4EEEA 2W0LA 2AJXL 4XH2B 4Y19E 1QLRB 5TGBB 4H5SB 5ID1B 3KYKH 1YEJH 2DQHL 3MRHB 1G7LA 2XV6B 1KF9B 4XVTH 3KYMA 1EHNA 1UT9A 1NFKA 1I3RA 15C8H 1MWAL 1WTGT 4YLQT 3V0WH 2AEWA 5IBUB 4FHBD 5I1GL 4YH6A 1I4FA 4XNZC 4KK9D 4AG4H 4R4BA 2JCCB 4HJJH 2P42B 4U33A 3WIHL 3LEYH 1BX2B 4HPYL 1I8LA 4K9EH 2X89D 1LNUA 4WJ5A 3MROB 5JDSB 2FX8L 4XP5H 3U7YH 4NN6C 2GY7B 3RUGB 2ZCKH 5K93A 5E5RB 2MCPL 4FRWA 5E5UB 1IAMA 4OCRL 3HRZA 2XRAL 3V5DB 5CEZE 5GSVA 4JG0L 5FYKL 1OWWA 4ZS6C 2RQ8A 2QQLL 2QR0B 2E5EA 2DQEL 4P5TA 1AE6L 1H5BB 1QRNE 2CMRL 4XX1E 5HYFA 2XNAA 3QQNA 1VCAA 4BFGA 3D69A 1CD1B 4PRIB 5T33L 3MLVL 4PGCB 3T2OA 4OD2B 1QTYT 3BW9A 3LDBC 5FYJL 4RGMC 5E99L 1OP9A 5EOCH 4UBDD 2P8PB 2HLAB 4WI4A 3T3MF 4KQ4H 1GC1H 2ESVB 2VIRB 4OB5L 3V6BR 1A6VL 2OSLB 1UM6L 5CINH 5F6IB 2AJUL 3WUWB 2FBOJ 1C5CH 3N1PC 4UI2A 5F6HJ 3AS1A 3MQIA 8FABB 4QHLB 2V6HA 4ZUWA 2NYYD 4LCCC 3MFGB 4OCXH 1QSED 3CFCL 5ISZB 3IFLL 3MOAL 4PRAA 5JIKA 4HS6A 3UBXB 5IVXE 4IMKC 3IXAA 5GRWA 3Q1SL 3BGMB 4WY7L 5E08L 1FL3A 1WIOA 3H9SD 2HT4D 4KK6C 3FFDB 5D93B 4UAOB 2IAMC 5GRVL 1J12A 4ZUVB 5KSAA 2AQ1A 3NCYS 2JLLA 1Q38A 4HFUH 5B39A 4FQJH 4R96B 3GBNH 4YDJB 1KNOB 3QDAA 5IP4A 1I1AD 2V2XB 4Z7OE 2Y25A 4ZPVA 1H0DB 1MNUL 4V2CB 1S7UA 4C56B 4RFNB 5D2NA 4OKVA 2R0KL 1EVTC 3EYVA 4QRTB 1CBVH 2AXHA 3JTTB 1N4XL 1WICA 2XPGA 3DX9B 3D39A 5HGHA 2OTWB 4MD5A 1DBJH 3HHRB 4PY7B 3QEQB 3VXRB 4DTGL 1QNZH 2DBJA 4U1SB 3VXSD 3GSOA 1Y0LB 4C55A 1INEH 4LLQB 3M1BA 3HC0B 3BWAA 3UYRL 4DAGH 1CYGA 4OLVL 4F9PC 4WENB 2A2QT 5AYUL 5FKPA 1HHKA 1HDMB 2P47B 4RMRA 3VRIB 4CVZB 2VN7A 3MJ7B 3L5XH 1NAMH 1S7QA 2YA0A 3NPSB 5TE6L 5D96B 1EDQA 3FO1A 2AJ3A 4RZCA 4DQOL 1ES0B 4OF7A 4U1HB 2QBWA 4WWKC 3QCVH 1CFNB 5EC1B 1URLA 1HSBB 1MFNA 5HDBE 3GSWA 1WC7A 1KUMA 2GTWA 1TJGL 1FZOB 3WV0A 3O8XA 3S96A 3EGSB 4JZOA 4JDZA 1H3PL 1A7OL 5LQBL 4X6CE 4GRLB 2YD1A 3WXWL 2F19H 3KWWB 5IESH 2QADC 3OG6B 5I6XC 4PJFE 4F7EB 2YD8A 3RGVA 1EH9A 5MEOA 4OD3H 4TRPL 1U93A 3OKKB 1F8TH 2PW1A 5DK3A 1E4XH 1RQ5A 3O3UN 2MTPA 3PDOB 3W0WA 1JZ6A 2R1XA 3VRJA 4WDIA 5J3HC 4NZDA 1F11A 3CMOH 3MUJA 1FHGA 4OQTH 2Q8AL 5IB3A 4LCWD 2DQCH 4PP2A 3JV0A 5AZEL 4CMMA 4AL8L 5E2UL 3AB0B 5FDYA 5DMIL 4G8GE 1QFWH 1MJ8L 4U6HB 4F15B 1R5VB 1EAJA 2AGJL 3SE3A 3NIDE 1J0KA 3B5GA 5EOQL 3VXUE 5F9JA 5EO9B 1M7DA 1IL1A 4ODSH 3VFPB 1N5YL 5I73B 3AS0A 5KVEH 4UQ2B 3IFOB 3QUML 5J12B 1TZIA 4Y2DB 5L88H 4NC0B 3DO7B 3HC4H 5DEFA 3DJ9A 5F44A 4BFBD 3ULUH 4D0DA 1JHKH 2Y1VA 3L3HA 2GHWB 4MB5A 2YUXA 3TEUA 4ETQB 1DUYB 4LSPL 3DSNA 3OPZL 5CSZB 3T65A 2X9WA 5IW1A 4Y4KA 5CEZD 4C59B 3VGHA 1JHLH 3HZVB 3O4OB 5MERA 4XPFH 1RVFL 5KSBF 4M93C 1LEGB 4R7DA 1PDKA 5GRUH 3WHE1 1A2YB 3F58L 3WL9A 5C7XL 5CEXB 4URTB 3QUZA 5BV7L 3HUJB 4NBXB 2O5YL 2F15A 2VQTA 1MCDA 1MHCB 3KDMA 5IFAL 4NZRH 5TPWH 1SM3H 1NLDH 2OM5A 2R8SL 3L9RB 2ICWJ 5HJ3A 3N85L 2EYRB 4ZS6D 1I9IL 2Q76B 4MGXA 3MXVH 3BEWA 3C9NB 3UZEA 2X4UA 4MQ7B 5DFTA 1F3JB 1XF5B 1EGJH 4HT1H 4L4TB 4GMTH 1XEDA 5IBLC 3VFNB 3NBNA 3BEVB 2J3SA 1A6ZA 1TVBB 3CSYA 2XY1A 1FPTL 5HDQL 3G5VB 2R1YA 1F2XK 3OG4B 1CFVL 3FJTA 2B4CH 5T1MB 3MV11 3QH3B 1ZLSH 3BMWA 3K8MA 5F7UA 4GG8B 1PKQB 4BZ2H 2BNQA 4AIXA 3UYPA 2V5YA 2H26A 1S7VA 4P9MH 5F7NC 5F9WC 5HHQA 5E2JA 1XGTB 4QHMA 3W11C 3N06B 4UV7H 3GI8H 2DL2A 3E2HB 4WNQA 3RIAK 5K9KA 3GB7A 5FGCB 5DHVB 3CK0H 5I16B 3QXAB 4LVOC 1Q9WB 3PL6B 4KUCD 3EBAA 3BPNC 1L7IH 1UVQA 1U8MB 1G0DA 5D71H 4TVSa 4F7MA 3UTQB 1OP3K 2ITDA 4QRQB 2DTMH 4KK6D 1MCPL 1XGYH 1ZEAH 2AJVH 1K85A 1NFDE 5A2FA 3TNNB 3SO5A 3RQ3A 1UACL 4M4PA 4OZIE 1YUHA 2I60L 1IGYB 3SCMC 2P5WA 1XR8B 2DQTL 2VL4A 5D7KD 2MWCA 1D5IH 5F9DC 1AJ7H 4XMKL 1N3NA 1FL6A 1JCKA 3F12B 2OR8A 4JVUA 2E6JA 1A64A 3LPWA 3RGHA 3E6FA 1S3KL 3K1KC 3MRQB 1CFSA 4U2YA 4IJ3B 4X6DA 3TBWB 1DQML 4ODUA 1FIGL 1MCOL 3X12A 4DKFH 2DQGH 3BP6B 4UILL 1G9MH 5CJXA 4FQHB 4MHHI 1LQSR 3MFFB 4G8IB 2XZQH 1YPZB 1JZ3A 1N59B 3H3PH 4L8BA 1AGDB 4F9LC 5IFJA 4PPTA 3N1QC 4TNWF 4EDWH 4NZJA 5DRXA 1QZ1A 4PREA 5HGDB 1FIEA 5C0JB 4HK3J 5CMAA 3HN3A 1VADB 4GKZB 4PGBB 5DJ8B 3MBEB 3KLAA 3NCMA 5J06A 5EB9A 1E6OH 1WZMA 1NCCL 1KC5L 4X6CF 4Y1AA 3OTTA 1BQHG 4UIKL 4I48A 4HK3N 3PNWB 2BFVL 4PJFF 3DRQA 4G7VL 2IMMA 4L3CA 5IMKB 3MCKB 4WWKD 3RVVC 1CXFA 1T7YA 4I9WE 2Q86B 3VGBA 4NNYA 3MRLA 1RIUL 4M3JA 1XGUB 3P9LB 4F2MA 5B8CC 1LEIA 2Z8VC 1EIBA 4U6VH 4HZAA 4OI8A 1KYOJ 4MZ3A 1BEYH 5JXAL 3A6BH 3HR5A 4ZTOH 1WWBX 2QADD 6CGTA 2C4FT 4MCZB 2CDGA 2ICES 4G8GD 3FQXB 1LMKA 2XA3A 2XYCA 3EYUL 2V2TA 1QLFA 2NY0C 4K2UH 3QIUB 3QEGH 2AV1B 4Y5XB 2I24N 2AXGB 3VXUD 4YHOH 1TQBB 5E8OA 2OLDA 5C0DB 3WSQH 2X4SB 4JGJA 5J3HD 2H32A 2R69L 1RZIB 3FFCE 4FQQB 1IC7H 3MRJA 4X4YB 3EO1B 3KYNA 3D9AL 4YBLC 1HIMH 2FIKB 1GZPA 4G42B 2XTJC 4HX1A 1YNKL 2EH8H 1D5MA 1BGXL 4OM0H 5I71B 4LRIC 4TVPE 1DCLA 3F7YA 1P5VA 3VXMA 1FBIH 4KJPC 4OCSH 1DVFC 1GYAA 3O2DH 3P11H 4HBQA 5H35A 5IUSA 4CW1A 2XTJE 1BVLB 5HYQB 4JY6A 3UTOA 1T5XA 3MRFB 5B3JE 1NGZA 1N5AA 5BS0B 1RI8A 1TQCB 32C2A 3NPZB 2H3NB 4F7TB 1BD2E 2F8VA 1K5NB 5A2JH 2CKBA 3BZ4A 5TDNA 2HFGL 1PLGH 1AKJB 3VH8G 4C83A 1QD0A 5FOBB 3UTTE 1YC8A 5E2WL 2FLRT 4Z7UB 1CU4L 4Y16D 1U6AL 3QHTC 3RTQA 2DI8A 2C4XA 1WF5A 2FX9L 4G3YH 4KTDL 4CU8A 2PR4H 4FQ2L 4RMTA 4JFDE 2WIIA 3M45A 4JR9L 3QQ3B 1S9XA 4OLXL 4F15C 5IF0B 1BHGA 4BUGA 4M8QA 1T0MB 5HGGS 5EZOH 2EDDA 5SWQA 1FZJB 3BP4A 3K4ZA 2B0SL 3PDGA 5IBLD 1BLNA 3PIQA 4U1GC 1IAIM 3PJSB 4XI5C 1WUNT 5GRJH 1P7QA 1QA9B 4MJ6A 5DZNA 2UYLA 2P4AB 3MYJA 3DOSA 1KJ2L 3L3JB 4TULH 4XB8A 1SJVA 1NCWL 3FB7A 4NBYB 5HVGB 3CZFB 2NY1B 1QO3B 1D6VL 1H3VA 4JY4B 3V5KB 1FCGA 1GGCH 1INQB 5CJOL 3HCVA 2XACC 4CADA 2VRAA 2IPKB 3Q3GB 1KIRA 5BRZE 5CUSH 1NGXB 1QG3A 1ZS8A 1Q0YL 4PR5B 5HHMB 3W11D 2ZOLA 1SY6H 3BOVA 4PJCE 2PO6B 1KCVL 3TFKC 3VGEA 1T03L 4AT6B 2AAVA 4LCIL 4PS4H 5GRVK 3RWDB 5I1EL 5CLWA 4PB9H 1DLFH 1U95B 2OL3H 3RAJH 1YMHA 4PFEA 1NC2B 4HUKB 4FQXB 3P0YH 1V7NL 4M6NH 1H9VA 4XC1L 3IETA 4YDVA 3L7EA 5GGTA 1C7SA 4LKCA 3LEVL 4WI2A 2G2RB 3MLTB 1ZT1A 1JTPA 5F96H 2Q7YA 4LLUA 3MRDB 4HIEB 2X89A 3ET9F 3HUJE 5BXFA 1MJJB 3DWTA 5F7HA 5CBAB 5JW3H 4QTIH 4TUKL 1XGRB 3LMJL 4L9LB 3X3GH 1TZHB 4X7TA 3IJHA 1MY5A 3SCMD 1F6FB 3QULA 3KAAA 1D6EB 3BKML 3P4NA 4QRPA 4LIQE 3QEUB 4UDTB 3CC5B 4X9HA 2R4SL 4L4TE 3OBAA 2NY2B 1DQLH 5I1DB 1DQJB 4NWTL 1T1XA 4MJ2A 4OCWH 5LJYH 1BVZA 3SO3B 3WJLC 3OQ3B 3EZ8A 2VDRL 4U3XA 3BZFB 4P2QB 3LVEA 4ZXBC 3WNMA 1VFUA 1VPOH 5J13B 4WW1A 3MO1A 5EOTB 3C6LB 2O5ZH 3CZJA 4I9WD 5HHXH 1A21A 3DXAA 4Y5VB 4ONFH 4R0LC 4U6TA 1UENA 4X7FC 5FECA 2E6QA 5CILH 3N9GL 2A6IA 4LBEA 4S11A 4L1DA 3S5LB 3HPLB 4P3WA 4RGOL 2MQ3A 2EYTB 5CGTA 5B4MC 5E1HB 2O61B 1N0XH 3AFLA 2WWKO 5ANME 4LSTL 3RVVD 5C0CD 3TBYB 4AEFA 5D7JB 2VAJA 3S36H 4G9FA 1QFUL 1MAML 1JF6A 1DJSA 3VWKC 3SDAB 3EZJB 4IJ3C 2P24B 3I2CH 3FFCD 3MCLH 3IRPX 2E7HA 2DM2A 1JYXA 3OR7B 4NQDD 4ELMB 5EO1A 3G08B 3RWEA 5D2LE 1Q9LA 1U3ZA 3VXQB 1KG0A 3P4OB 5EA0H 1X6LA 2NY0D 4X7EC 3T0BA 4I4WB 2EO9A 3I9GL 1IKFH 1G0YR 5E8PB 3NA4A 4NRXB 3P9MB 4TVPD 2D31B 4DGIL 3TBTB 3RWFA 5E5MA 1OTTC 5BMFL 3NGBC 1P2CB 5FHAH 4YO0A 4DFHA 4U1JB 5TJWK 3LQAH 4E0RB 5KN5A 2VQ1B 1DFBL 3O41A 5C07B 2XTJD 5DJAA 5JOFB 3HNTL 3TYFB 4APQA 1NANH 2IGFH 1UB5B 4OV5B 1BD2D 4WFFE 5I0DA 2EDWA 2I9TB 3ZE1F 3RL2B 3QAZB 4KJPD 1DVFD 4ONOA 3QXDA 2VSDA 2Y36L 3TP4A 3UTTD 2PXYA 4O51A 1R5WA 3V5HA 3MNZB 1KIPB 3MMEB 2HYMA 5CBEB 4JDVB 1QBML 1BF2A 1DBAL 4JFDD 2DM3A 1KXVC 4PRNA 3T0AA 1MFBH 4ZSOB 1ZSDB 3GMPA 4OJFL 3BAEL 3ZLQC 4Q6YA 3G6DH 1JRHH 3GRWH 4OF8A 2HWZL 2R0ZL 4HPOL 1UXWB 5C0RL 3H42L 4KZEL 3AAZB 3DVNA 1A8JH 3X13A 1KTDA 2AXJA 4WTXA 3P0VH 1R3HA 2FB4H 3ULVH 4HIHB 2BSED 2GCYA 4L5FH 5KVFH 1N7ML 4UMGA 4KWUA 3FL7A 1OCWL 5E8DH 3KLDA 4WFHE 5IGXL 1VFBA 4YPJA 5I1HH 1MQKL 1T5WB 1LDPL 3HG1D 1RV6X 3B3IB 2OR7A 4XI5D 2IANB 3ARDA 1FN4B 3L3KA 3GKWL 4RX4D 5ILTL 5BRZD 4AIZA 2VLJB 2DN7A 1QQDA 4PV8B 2XKNA 4LCWA 1DL7L 2WBJC 1A5FL 1BVKB 5IJVB 4HQQH 3MGOA 4XP6H 2JK5A 3CVHB 3FN9A 3QIBA 3G5ZA 4HEPG 4F37F 5E00B 1RJZA 4E9LA 3CLFH 3HB3C 3B9KB 5JHDE 5DK0B 4NT6B 1LE5A 4LSDA 3O3AA 3TFKD 4PJBE 2BXYA 4A6YB 1TPXB 3NVQA 4PJIB 2DWDB 3HI6L 2FZ3B 4YHNA 4TQEH 1EEZB 2CRMA 5ESAB 1F4WH 4HKJB 1QSFA 2AJYL 3U4BL 1EJ6A 1FNAA 3WNNA 5E2TL 1R5IA 4FOMA 3IDNA 4BFIA 4GRMB 3ILPA 1B0RA 4FNLL 2K7PA 1MCFA 2I9LA 5LAXA 4BKLA 2Q8BL 4JKMA 5DD5L 4MAUL 5KSBA 3CLEL 4XNMA 2DLEA 1C5BL 2YZ8A 3MLUH 2VITB 2EC9T 2C3WA 4HWBH 4U6XA 1VA9A 4H0GA 1ZKAA 3OMZA 1JPTL 3D25B 3I84A 4KVNH 4TTDC 2NY1C 2QHRL 4P0DA 4FFZL 1JFQL 3WFBH 1I7UB 4OLUH 4MYWB 1RURH 1U91A 4L4VB 3RDTB 3U0WH 1KPVB 2MKWA 4WW2A 1CXLA 4IIQA 3QEHA 3WN5C 1RAMA 3IJSB 4DUVA 1PD6A 2CGRL 3KPNB 1B88A 2ZUTA 5HHPA 2P48B 1EERB 1ZWIA 3BYYA 3QDGA 4Y4FC 3X11B 1E4JA 3AREA 3C60A 4OZGE 3TO4C 3B9EA 5BOZG 1Z3GH 1NBZA 1C16A 2BNUB 4ZXBD 3HI1B 5HTSA 4Z6AT 1UFUA 5MHSE 1JPSL 2JB6B 4F58L 4G5ZL 1LGVA 3DYPA 5AYQA 3RZWA 4NZTH 1ZLWH 1KJ3L 5C71A 1A6AB 1CK0H 4P3DB 4JANA 1VEOA 4NJAH 3S4SB 2CUMA 3QIWB 5LBSH 3HAEB 2VXSL 4MA7L 1NLBL 5INCB 4EUPB 2D7PA 5KS9F 4M7KH 1KGCD 4E5XA 4HKBB 5MEQA 5ELIA 5JQ6H 5GS2H 2FNBA 5BO1L 1ZVSB 5B4MD 2HVJB 4CU6A 1W0VB 2F53E 3U9UB 3ROOA 3FT3B 1PY4A 4D8PA 4YHLH 4PJDE 3U7WH 3C5ZC 4OM1L 5JNYB 4J3VA 3VWKD 4HEME 1RZ7H 4LQFH 4NFCA 2NY2C 2CDEB 3LKOB 1RUAL 5E8EB 4IOIA 2JF1A 3IJYB 5SWZB 1FSKB 3CJJA 3CSPA 4HUUB 4Q6IB 3KYAA 5DJXB 5E70A 3NH7L 4IRSB 1A1MA 3SO3C 4K3EH 5FUOH 5TQ0L 3ULSA 3MJ9H 4Z7WE 4NQEA 3L95B 3MRPA 4HD9A 4WFFD 4YQXH 3AXLA 1OTTD 4QYOA 4U7MA 3DV4B 2J5LC 2QKIB 4JFEE 2PN5A 1MPAL 1CF8H 3REWB 1XZ0A 5HPMB 5A40E 4AQ1B 3IU4L 2VR9A 3SQBA 3CNKA 3RY6A 4PJ9C 3RWGA 3ARGC 1PAMA 4GG6B 5BVJB 1XGQB 1AD0B 3TJEL 3KVQA 1X5YA 1INDL 4XT1C 5B21A 3DX6B 3T0EB 2VDLH 5C0EB 2BY2A 3V4UH 3FQNA 4ONGH 2YEZB 5IM7A 1I1FA 4N0RA 5CKGA 3GIVB 3CPLA 4KAQH 3GIZL 4OZFB 4G6MH 5JHLL 1QFPA 3MLZL 2H8PB 3DX8B 4L8CB 3PWLA 1AR1D 2F5BL 3S97C 3TZVB 5DC4B 3H9YA 4MAYB 5L2JA 3HTLX 4CUCA 3U0TB 2EECA 1L0YA 5I18H 1BP3B 1ADQL 1UWGH 5I1JH 4X4ME 1IQDB 3RPIA 4NNPH 1ROWA 1YYLL 1KTRL 3WJJC 1R3IH 5CEZL 3FAXA 3QDJA 4GSDL 1ACYH 2VDKH 1U8IB 3FT4A 2AK4B 1A6PA 5F7KC 1O7SA 1HQ4A 2PNDA 3NACL 3JVGA 1UZ8B 4XX1G 4JO4L 4GMSL 3MR9A 5IQ7L 2DQIH 2ZOKB 5DD0H 4FA8A 5EU6A 2CK0H 4UTBH 1MRDL 4N1EA 3GMQA 4QY8A 4Q7DA 1CDJA 4EXPX 3PQYB 1GJIA 4LRNL 3MJ6A 4HUXB 4PJBF 4XCNA 5JHDD 2WBJD 1GGIH 2X4QA 3FQTA 2YKLL 4P49A 4O02L 4J3TA 3TV3H 4LLDB 3VJ6A 3UCRA 1UKSA 4KJYB 3ARFA 1SVZA 1F97A 1T1YA 1OT2A 4MD0B 1JNHA 3HB3D 2BVPA 5D5ME 3TO2B 1PKOA 4XXDB 3MACL 3WFDH 2P7TB 2BY0A 1CS6A 3CH1B 1CFTA 1UKQA 1FGVL 1HKFA 3KYOB 4JZJA 4NQSA 4GJTB 4HGWA 4IMLB 3EDJA 5I8OL 5J8OA 2UZYB 1W0WA 3Q6GL 5MENB 1UJ3B 1H3TA 4PRPB 3V6ZB 4DCQA 3T2PA 2H2SC 1I7TB 3QT2A 1G6RA 3HE6A 1SEQL 4M1DL 1QBLL 2XT1B 4K23L 1G7MA 3KHOA 1E4XI 1MVFA 3OAZH 3UTSA 2UZIL 4JFFB 2GIYA 3IF1B 5F7LB 3BSZH 1L6XA 5BQ7B 4PG9B 4Y16A 5EBGA 4FQ1L 4RFEB 3U6RB 1UM4L 3O6FC 1ND0B 4LLVA 3QI9C 3JV6B 1T3FB 5DEGB 4TTDD 2Y6SC 3VFTB 2C1OB 1J7VR 5FM4A 5DRNB 4JZNA 4HCRA 1WWCA 2FDBP 5MHSD 2BNRE 1EFXD 4M6OH 4MB3A 2G60H 4WHTB 1G7HB 4P4KC 4H88L 1OARL 4YHYB 4LHJB 2PYEA 1NMCC 4HIIB 4HBCH 1EFQA 5D4QA 4Y4HB 4Z7NE 2YXMA 3SDYL 4U7KA 1D5ZA 4Y4FD 3THML 1BBDL 5DRWB 2NTFA 3TO4D 3KPRB 4JRXB 4UU9B 1NC4B 1QR4A 4QNPF 1OPGH 2F53D 1NBYB 4F7PB 1JWSB 4MXQC 3BD4A 3GJFB 5FB8A 1M7IB 1TVHB 2DQUH 2GYSA 3BT2L 3QWOB 5ERWB 5HDOA 1IKNA 1FORL 3BPCA 4OSUH 1QUNA 1T21B 1S5IH 1F58H 2DF3A 3RL1A 2ZG2A 4FQIL 1NEZG 4I5BB 3WIIH 1YEGH 3OJDB 4OZ4B 4KHTH 5FO7A 1RUMH 4FP8H 4OGYH 3BVNB 1HYSC 4Z7WF 2EC8A 3PWJB 1ZHNA 1XCTB 1AO7A 4EBQL 2HG5B 2XXMB 3C5ZD 4GUPB 1ORQA 1N6QL 4OF0A 1RY7B 3T4YB 3PWNB 1IBGL 2BC4B 2APWA 2OQJA 3AU1A 5CD5C 1EUTA 4YHKH 4IS6A 1U3HB 3DUUA 5IMMB 2ARJA 2XFXA 2E8YA 3LIZH 1NFIB 4CU7A 3PWVA 2V9RA 5FAAA 5GJTH 3KPOB 4JFED 1XF3B