4HS3B

Crystal structure of h-2kb with a disulfide stabilized f pocket in complex with the lcmv derived peptide gp34
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Peptide-independent stabilization of MHC class I molecules breaches cellular quality control.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hs3B00
1KJVB 2P5WA 1P9MA 1NBZA 3U9PH 1U3HA 2VLKD 3O3BA 4OD2A 3RL2A 5SWSE 5E4EB 2E8ZA 4PJBA 1I1FA 1TNNA 1CK0L 1EEYB 1B3JA 4PJ5D 4P46B 3CC5B 4RFNB 4MB4A 1FVCA 2C3VB 3V4VH 1HH9B 2DWEB 4V1DB 4HS3B 1NGQL 4H26B 5DZOA 3VXQA 1G0YR 5IMLB 1IGCH 2NY4B 2ZPKL 4ONHB 1AC6A 3D3VB 5F93C 1KENH 2YXMA 3LQAC 1PSKH 4A2LA 4C4KT 5KVFH 5JW3H 3GO1L 4Z0XA 3MBXL 3RPIB 2Z31A 5HGAA 2DLGA 1IGFL 3WFCH 2FATH 1PY4A 5FXCH 4D0CA 1VGKB 4ZUVA 3T3ME 4OJFH 5D7IE 2KUTA 3ZL4L 3HCVB 1A3QA 1R3HB 4ELKB 3LMJL 1ZEAH 4HC1L 1CGSL 3T2OA 1VSCA 2P1YA 4KI5E 4AM0B 2H26B 4OCRH 5SV4A 1EIBA 1I3RA 3ARFD 4I2XB 3MJ6A 4PGBA 4UIKL 2GJZA 1K8IA 1QA9B 2VAAA 3TWCL 4NQCD 4OLYH 2VC2L 3U83A 3RZCC 1NMAL 5TDPA 43CAA 3QIWD 4UDTB 5LVEA 4AIXA 1Z5LB 4XBGA 1JYNA 3EAKA 4KXZH 1F4WL 1QFUH 5EO9A 2DM3A 3P4MB 2X4NB 3BFOA 2N4IA 2HMID 3ESUF 1TVHA 3DMMC 5SV3A 4OLUH 2Q8BH 1M6OA 2H8PB 3C5ZB 1MCLA 1EXUA 2Y36H 3B9KD 2EDNA 4JM2B 5DT1H 1ZE3C 3HTLX 2WNGA 2F53D 1K9TA 2NR6C 4UB0L 2E7BA 4ZUWB 4P2QE 2DBLL 1XF3B 4K94C 1ORSA 2PUQT 4ODWB 5D7JA 3RVVD 1A7RH 4HUWA 4JPIA 4OZHF 4Z18A 3HNTH 4DQOL 1QUNA 3GMOB 4ZS7L 1UKQA 3A6BH 1N4XH 1MCSA 4TTDC 3IU3A 4U1SA 5ADOL 3UDWC 1QOKA 4XVTH 1T20B 2VXSH 1NCWH 2IMNA 3FOMB 4BQCA 3TT3L 1CQYA 1X3DA 1MWAL 3U0WL 1CLYL 2DM7A 1ADQA 2J8OA 2KDGA 4M7LL 4WFHE 2RQ8A 4M6NH 4GKNA 3CMOH 2FD6H 1G9NL 3CZFA 3LZFH 3O4OB 3V5DA 5DJCB 5EIQA 1SY6H 4TRPL 4G7VL 1IKNC 3O6ML 2H32H 1K8DB 4H1LH 3TBTA 4PRPD 1RIUL 1CFNA 5FO8A 3ARGC 4WJ5B 3U30C 2LU3A 3UTOA 3CFBA 1CTNA 4Y5XA 5B3JF 4ODSH 1RURL 1XGQA 4UNTA 5JPMB 1TFHA 4HH9A 1IGTB 4N1CA 4Y2DB 4CKVX 2QSQA 1GSMA 3ZKMD 5SWZE 4HXAH 4U05A 3HLAB 1J0IA 1HCVA 1MEXL 1ZANL 1MIEL 2Y1VA 5EU5B 5ICZA 5LAXB 2BOCB 4MNGE 1P4LB 1V7NH 5AWNH 3DXAA 2ZCLL 4NUGL 1KCRL 2MHAB 3TF7C 2V5YA 5GRJL 3HC3H 4HCRH 4ZAKB 4YZFE 1ORQB 4XAKE 3JV4B 4RAVB 4CW1B 5TDNA 1JTOA 3VXSE 2VLJE 5GSVB 1FFRA 2FIKA 4OCSL 3T0WA 5MEQA 3CMGA 7CGTA 3GSRB 3I75B 4KK5C 4KKCD 4JFDB 5J12B 2YWZA 4PP1D 4G8GA 2CUIA 3CX5J 1DFBH 4JJHA 5KSBB 5DQDL 3FO2A 3FB7A 3FFCB 3UTSA 3BKML 3GSQB 3BD3A 3HAEH 3EFFB 3BKJL 1WAAE 4WWID 4F9LA 1CDUA 5JW4R 3O8XB 3RWHB 4YHIA 1MCDA 5KVDH 5GRVL 3BN9D 1Q94A 2X1OA 2V2XA 4KJQD 4G43A 4I0PD 3JV5A 4KRMB 1DQMH 1MY5A 4NJAL 1A22B 4RMWA 4X6DF 2FLRT 3TCLB 2QADD 1X5IA 1A6UL 4KKLC 5CSBA 5FOBA 1A47A 2C4FT 3EYVA 4ZUTA 1BOGA 3IKKA 3BIAX 4M6MH 1EJ6A 3LPFA 4K3JL 4X99A 3S3SA 4GJTB 1WTLA 3MGTA 1MPAH 2VDNL 3KS0J 1X4XA 2Z8SA 3MNZA 1RU9H 5BV7H 3QEQE 1MNUH 3MGOB 1MHEB 3QUML 5I71B 3MUGA 3ZTJG 3IJSB 5F9DC 2W9DH 2AABL 2ZWLT 1KLGA 2NY1B 4DN4L 5HGGS 4HWUA 3PABA 4RMRA 4IS6A 4GQ9L 5FYLE 3L5WB 1CL7L 4PR5B 2EDBA 3E8UL 3ZDXE 1OPGH 3P9WB 2GCYB 3MLWL 2X6MA 1BZQK 4UNVA 3K1DA 1RULL 1FFNB 3LEYH 2D7TH 5JORB 2EYRA 3N1FC 4U1LB 3RNQB 4LSUH 4M1GH 3KPRB 5EO1B 4ZFFA 1IAIL 2IH3A 3LB6D 1JPTL 2CO6B 1YY9C 1AI1H 5BVPH 3QDGD 2XACC 1VADA 1OD9A 3UBXA 4X7EC 1EFXD 3GM0A 5IBTL 5BS0D 2HAZA 1ZV5A 4V2CB 4DN3H 4LRNH 3OKOA 1Q0XL 2BZDA 5KSAD 1HWHB 3RTQC 1CICD 3EDDA 5IVXE 5MHSD 1BM3L 1WT5A 1A3RL 1IC4H 5HI3D 4H5SA 1WC7B 4DFHA 2X42A 5DK2B 5F7HA 2GAZA 1JTTA 2R4RH 3HG1A 5ICYA 4PS4L 1G7MB 3LHPL 2O61B 1M05A 1T2XA 2NTSP 4CMMA 1GGYA 5AAWA 1SY6A 1BZ9A 3V0VA 2H32A 1XAUA 4H1LA 2OMBA 5IJKC 4PD4K 3IJYA 1JYXA 3DX8B 5F7MC 3RVTC 3CSBA 4P3CL 4HT1L 4NQVB 1MELA 3WFEH 1FFPB 1CFSB 1DZBA 4JPVL 1VKXA 3TYFB 1I4FB 1JN6A 4MD0B 1G0XA 5FYKE 4BFIA 1S7WA 1JHTB 5IMMB 4FXKA 2EDJA 1RUAH 2GIYA 5DJYB 3KPSE 3WE6B 4FHBD 3EDKA 1P69B 2I9LB 1BVKA 4LRIC 2YA0A 5TE4H 4K23H 5EU4A 1G84A 1UZ6E 1ZA3A 1J9CT 3FFDA 4N5ED 2D0GA 4XPFL 4G6MH 4OCXL 4ERSH 5IM7A 5I2IB 1MJ7H 3ROLA 1MVUA 1U8HA 1X44A 4RFEA 3FRUB 2QTEA 3GMQA 4WO4D 4XX1G 3QAZC 2R2BB 4XP9H 4Y16A 4D9RD 5CMAA 3D0LA 3VFOB 3MJ8A 4PB0L 5JW5B 4KI5C 5CLWA 5A3ID 2XG4A 1Y0LA 3X3FH 2A6DA 4MDJA 4HUNB 1O0VA 1KIQB 2CMRL 1AJ7L 3BRDA 2FX9H 4AT6A 5ICXB 3M45A 3BAEL 4EUPG 2AJ3B 3BZ4B 4IOFC 3SGEH 3SY0A 2R1YA 2A0LC 2LVCA 3C5SB 2WBWB 2YEZA 2FJFB 1XGRB 4UAOC 1ZXQA 4OCMC 1Z9LA 3R0MA 2BMKB 2R2EB 5CUSH 2IAMB 5HI4C 5EIIA 2BRQA 3TO4C 1P2CA 1B4JH 1RJZA 4G42A 1S5IL 5L8KB 1MFCH 1AGCA 3P30L 4MAYB 4AL8H 5DO2D 3C6LD 4WENB 4G8FB 4HX1B 4IRZL 4NQDD 5CILL 5LKNA 3X11A 5KSUB 4MCZB 1HEZA 2APVA 3CLEL 3RVXC 3LEVL 1NUFA 3ZE2E 3B3IA 5B4MD 2DIJA 2APXA 1R6VA 5F1NA 4L4TB 4F7MA 1K2DA 3LH2H 1LK3H 2J1KA 3BKCL 5GGUB 1EBPA 2JIXD 5DJ2B 3CLFH 1UQSB 3MMEA 1MJJA 3TPUB 3L7EA 2Q1EA 3WFZA 5GJSH 3REVA 4HZLB 1WCBA 5BMFH 4M62H 1J5OL 3BMVA 1OSPL 1N59B 2NY5C 4OGXH 2VLLA 3BP5B 4G9FB 1NKOA 4IOIA 2ICWA 4LCUB 3FZUD 1FVEA 3PP3K 3OKKA 1NBYB 2V9QA 3RDTA 5DSCA 4PG2A 2H2SC 2CRZA 3W9EA 1ADQL 2XXCB 2MPAL 4Y4HD 3FB6A 4A2MA 3MX0A 4NBYB 2UZIL 3MRNB 2AAVA 4XP1H 3DV4A 5IW1A 1N3NB 2QSVA 3GMPA 2BSTA 5FEBA 5GGRB 3L5XL 4QOKE 3WFBL 5TQ2L 1KNOB 4Y5YC 1ZOXA 1LMKA 3KYAA 2P8MA 5EZOH 4RGMB 3LKNA 2F9BT 5JXAL 3U46B 2VJXA 4NPYA 3QZWG 3RBSA 2Y4SA 1QSED 5GS1C 2LU7A 2PYFB 3U9PL 4G8IB 4GRWF 1KCLA 3PWPD 1KACB 4QY8B 3ARXA 4JFYA 2FNBA 2VISA 4Y19A 5DMKB 3H2WA 5DUMH 4OBRA 2XWBA 3IS1X 6FABH 1LDPH 2R9HD 4J7RA 2V7HA 1EERB 3V4VL 2IWGA 3TVMC 1IGCL 2M2DA 3O0RH 1KENL 4N0CC 1PSKL 3H3KA 5IVZB 3WUZA 4HIHA 4PJGE 5KVFL 5JW3L 4QRQA 5DJ6B 4F2MA 1U8IB 4JFZH 3BHBB 3WFCL 3V4UH 2FATL 3FT2A 4LBEB 3UJJH 2GSIA 4OJFL 1TZHA 2D4DA 1PKOA 3BPOB 2VDRH 1ZEAL 4JPKH 5C0CD 4X6CE 1KPRB 4ZDHB 4F33A 2EDEA 1I1CA 5L0QB 4ZOAA 3BQUC 4OCRL 4NZJA 4NSKA 5T1LB 1KJ3H 1T21A 3HUJB 2EDRA 1MQ8A 3C8KB 1W0YT 4YK4B 4OLYL 1EHXA 3RGVA 4OFYD 1AKJB 3HZKA 4U1HB 1G0DA 4KU1A 5JOPE 3FQWA 2E6QA 3BW9B 4IOSD 4F9PA 5FKPB 1QFUL 3SDDC 5I1DA 1JK8A 4Z77A 2HN7A 5FUOH 1WWCA 4X6FB 4OLUL 4G6FD 4P2RB 2Q8BL 4YHMH 1AXSA 5F89B 4OV5A 4FQ2H 2BNUB 1BD2B 4DCQA 4D0BB 1R3LA 2Y36L 1AO7D 2A6KA 4GRLC 3EW3B 2J8UF 1T0NA 3NZHH 5DT1L 2DRUA 4M7ZC 4Y1AA 1TQBC 4AEFA 4UQ2A 1I9JH 2X5PA 4X4XB 1FZJB 5A16B 1RZ8A 5E2TH 4PY8I 3IFNH 3TZVC 4YBLB 5AZ2H 1A7RL 1A1NB 3QIUD 2AXGB 2DM2A 1J8HA 3HNTL 2Z35A 3ZKSD 1ZA6B 4OAWB 1T1ZA 4HWEH 4H25B 5C9KA 5FHAH 5EBWA 3QQ3B 3FQRA 5CEZH 4XVTL 2BCKB 3UJIH 2V2TB 2VXSL 4FXGB 3GSUA 1NCWL 5ADPH 2QEJA 1IAOB 1IRAY 5MEPB 4P2OD 3ARDA 4M6NL 5E9DB 3CMOL 5DEGB 5C0IA 1FIGH 2FD6L 4OZHA 5SX4H 3LZFL 5C2UB 1SY6L 4JM2F 5BOZG 4WIQA 5IB4B 3I6GB 1F5WA 2FYYB 2Y72A 2GK2A 1YA5A 2HRPH 5HYJD 1YJDH 4X7DC 4GBXA 4XNQA 5EC1A 3BE1H 5DQJB 3BPCA 3SCMB 2YD9A 4ODSL 1GH7A 2G5RA 3QFDA 3ARBC 4X80H 3S9DB 2Q7NA 3C9NA 5TGBB 1T03H 4HXAL 1V7MH 2MTPA 1V05A 2RHEA 4KRPB 5GGTH 1LD9B 3DI2B 3SDAA 5K33A 4JAMB 3VXMD 3BIKB 4JFEA 1V7NL 5AWNL 2EDTA 2JF1A 5I18H 1L0YA 3BXNA 3HC3L 4HCRL 3VXRB 3SKOB 3QUYD 3H9HA 3LKSB 3D85A 1IEAB 3AS1A 4RQQA 5IFHH 3BWUC 4LNRB 1HSBB 3GMNA 4MA1C 5L2KA 4B50A 1A6PA 5FYJU 2W91A 2W60A 4NZUH 1RZ7H 5K59F 3MCLH 1DFBL 3HI1B 4CU6A 5CAYB 3KYKH 2E7LA 3CDYA 1GAFH 4RGNE 1IEBA 4ZPVA 1PEWA 4M5YH 1KB9J 3D1MC 1MCWW 4L3ED 4E41B 2VXVH 5KVDL 1CLZH 3S37X 1FNEB 3ZDYF 5M94B 1DQML 4WDIA 3MLYH 4PGDA 4CADB 4QHKJ 2P5WE 2IFFH 4P4KB 3LKRB 4M6ML 4PJBE 1D5MA 5MEOA 2RR3A 3QQ4B 3W11C 2PXYC 4K8RH 5TDOB 4UT6H 3TFKD 1MPAL 2JJTA 3LRSB 1RU9L 4UT9H 5E0QA 3WCYA 5BV7L 1MNUL 3VFUB 4XH2A 4Q2ZB 4ZPTA 4C55A 5KSBF 4GG6B 1JL8A 2W9DL 2DMCA 1CFTB 3SE4C 5GS0D 2HTLC 4XXDB 3DRTB 4P5MB 1LVEA 2X4RB 1I85C 3M17A 5D7LD 4HKZB 5DYOB 3TNNB 1ERNA 4P23D 1OPGL 4JN2A 3QH3B 5CEYA 3T0EA 1CE1H 3L95A 5DS8B 1OAXH 3R06A 3LEYL 4IRJC 2D7TL 4OLEA 3SJVA 3TBWA 4TOYH 3ILQD 4LSUL 4M1GL 1NAMB 1PKQE 3LN4A 4NO0D 4IMLA 2YUZA 3G5ZB 4OUUA 5HGDB 3RVWC 3RBGA 1F11A 4XRCB 4PYHA 1MCPH 1MIMH 1AI1L 3QEHB 5BVPL 2F74A 5I1GH 5T3ZH 2FWOA 5L8JB 2IPKA 1HIMH 4WU5A 4IHOB 4DN3L 5LGKA 1LP9F 4LRNL 4N90E 2XFXA 3BVNB 4HGWA 4QHUB 5DXWA 2AP2A 5ERWB 4KUCF 5ESVA 5B39G 1IC4L 2GHWB 1UM6H 4OKDA 2DMKA 4HHAA 1BX2B 5HHMD 3I02A 4PRIB 1VESA 2V2WB 4L3CB 2X4TB 3W0WD 3V0AC 5JZ7D 3WFEL 3UYRH 1ZT1A 4YUEH 2R1WA 5EH1A 1EZVY 1A6WH 1FYTD 1FFQA 4JLRB 2DF3A 4QTHB 3RZCB 1HI6A 4P48A 1BLNA 4KKBD 4P99A 3CPLA 1RUAL 2P43B 2FX8H 3KYOA 4XVSH 1KJ2H 5D1ZA 4JZOB 3DMMB 1CE6B 3FJTA 4FFWC 3O41B 3FB5B 3BP4A 1XCTA 2HT3C 2XWJA 5TE4L 4KMTH 1BVLB 1VEPA 1YEGH 2XKNB 1S7XA 3VXUA 4HIIB 5LGJB 2BSSB 1I1AA 4WV1A 4GAJH 3MV9B 2BVQA 3T0AA 1UXSB 3MRQA 4HPYH 3TH3T 3FL7A 1G9NC 1Z0MA 4NDMA 1H8OA 4G6ML 4GRWH 4ERSL 4MQXC 2KL6A 1MJ7L 2ZUTA 5IMOA 4JRXB 3BGMA 4S2SA 2EDLA 1F90H 4Y4FC 3QFJB 5IHBA 1KXQE 4XP9L 2I9TB 1S9YB 4QGTA 3PXHA 3X13A 5DMYA 2HJLB 5ACMA 2FEEL 5T1MB 3MRDB 1DLFH 3ET9F 5BRZE 1LK2B 3ALXA 3X3FL 1QVOA 1T5XA 2H6PA 5HD8D 5INDA 5FA3B 2GJ6A 4LLVA 2MWCA 2NCMA 5AAMA 1VCAA 3KHOA 4ZTPH 4UDUA 4NNYA 2FX9L 1XT5A 4HGKC 4NFCA 2VDMH 1KSRA 3J7HA 5EUOB 3SOBH 3CVHA 2XN9A 3VGGA 4X4YB 3PE9A 4NCC2 2OLDA 5IV2A 4WWKC 2A73A 2C7UA 1LE9A 5CUSL 5ID1A 1M4KA 2Z0BA 3ARGB 1JGDA 3U30B 2WV3A 4U6HB 2VLRD 1IBGH 2J5LC 2PYED 1B4JL 4HXBH 5C07B 1OGAA 1FGVH 4N8VA 4I48A 1FNGB 1BFTA 5J1AA 1YEHH 1HE7A 4AL8L 5JHDB 3SE9H 2ZG1A 5EO0A 3WUWG 2ED8A 3UXFA 4N0RA 1GZPA 1HQRB 3O45B 2GFBA 4G8GE 3HRZB 3FTGA 3CH1B 2J4WH 3UTSE 2DLIA 3LH2L 1LK3L 1FRGH 1EHAA 3CLFL 1DBKH 1A4JB 5GJSL 3SDYH 4PLKD 2RBLA 4PP2A 1MJ8H 4UOJA 5BMFL 4M62L 3GSXB 4WI8A 2EIZB 1JV5A 4HJGB 4OGXL 3BP6B 3KPOB 3RKPA 1Q9WB 5A2KH 1NFIB 1RHHA 4P3WA 4QEGA 3TA3B 3FQXB 4YHNA 3IDJB 3TN0D 3L7FA 1UJ3C 4PJFA 3Q5TA 5EBLA 4LGPB 1J12A 3MBEA 3TH2T 2NY3C 4XP1L 3BZEB 4EDXB 4JR9H 4YPGA 1T2QL 5K9KB 1E28A 1J87A 2PTTB 5EZOL 5DJ0B 4C56A 1TCRA 4LASH 1V3LA 2Y06H 4Z7VF 1U58B 4Y7MA 3F62A 4GKZB 3NZ8A 5HYFA 4OF3A 4WUUD 4XPHH 3KWWA 5ISZB 1NPUA 1P1ZA 4YC2C 1U8NA 4FFVD 4O02H 5DFVC 3PGCA 3S96A 3OB8A 5BXFB 5HYSB 1MFNA 2XZZA 3IGAA 4HK3N 4FP8H 4W4OA 3T0VA 3DRQB 4I4WB 1D9KA 5DUML 5I0ZA 3VGHA 2YC1B 4MQTB 4LQFH 5ITFA 1A1MA 3MRMB 4PV8A 5F6HJ 1LDPL 6FABL 4NO2B 4Z5RA 3BJLA 2IALA 4ZS6D 5C6PB 4RMVA 3O0RL 4NZRH 3HPLB 4QXGH 1JI2A 1KIRB 2H9GA 3HI6H 4U33A 3KPTA 4MQ7B 1MHCA 4N0FB 4W70A 4RGNC 4KV5F 2VIRA 4JFZL 5EFIA 1D5XB 3V4UL 2A6JB 2WZPD 2ZOKA 4OFVA 3UJJL 2WIIA 4I0PB 1A9EB 3KVQA 1FL6B 2QKIB 3B5HA 3LN9A 4QXTB 1AQKH 2VDRL 3PDDA 3L3DB 4JPKL 2O26U 4S1QH 1WIUA 1HNGA 1N0XH 4OZGB 1U8OB 4HMCA 1P9MC 1U3HC 4TNWF 1KJ3L 3LD8C 5F1KC 1DTUA 3OXRA 1ACYH 3QWRA 2H41A 5H94B 5ILTH 3U7YL 3PV6B 4X9BA 4EN3A 4FOMA 1KJVA 2QR0A 1T0PB 4Y4KA 3V6OA 1GXEA 1CTOA 5BW7A 5F7DB 3SQBA 2VRAA 3OF6A 1JPFA 4WY7H 1EEYA 5I1IH 1KLUA 3BWAB 3Q5YA 1MI5B 5JXED 5H35B 3DETC 2NZ9D 5FUOL 5KBNC 4ZFZB 2Z31C 4WFFE 4L8CB 4YHML 4GSDH 3DUSB 5SWSB 4FQ2L 1AIFA 4HS3A 3ZKQD 3S36H 2NX5D 4M93B 3WIFB 4ONHA 4Z6AT 3T0XA 3NZHL 3RWFA 3UO1H 3KPNA 1I9JL 5C08D 5E2TL 5C8JB 4R3SB 1E27B 1VGKA 3IFNL 1FIEA 4GXVH 5AZ2L 2X05A 4OFKA 2VZTA 1VFAB 2WWKO 4QRRA 4HWEL 3PDGA 15C8H 3FO1A 4Z7NF 5FHAL 1I8LA 3IFPA 5D96B 4MXWH 5IKCA 5GGVY 1XGPB 2FL5A 5CEZL 1KCVH 2XTLA 2DICA 2J8UA 3UJIL 2A74B 5D7IB 5ADPL 3QPXH 5E2UH 2H1PH 1YNTB 3QAZB 1Y6MR 3S5LB 3N1MC 1FG2B 1FIGL 3T8XB 2HFTA 4PGEB 5K9QG 4MXVF 5CBEB 1Z5LA 2HRPL 3AY4A 1YJDL 3BE1L 3KAAA 3P4MA 2EDDA 4JZNB 1J1OH 1L9NA 3IT8D 1U36A 3QUZA 4ZO8A 3T4YB 3QEUB 4X80L 4MJ6B 4PBVC 1AR1C 5GXBB 3CX2A 4UOW0 3C5ZA 4KKAC 5D7JC 1AGEB 4UAOB 1T03L 5ID0B 3MRBB 1V7ML 3MRFB 4PLJC 3TO4B 4LGSB 5GGTL 2VN4A 1IQWH 1A0QH 4O51B 3FCTA 4ZUWA 5I18L 1EVUA 1MVFA 4G9DA 3B9EA 1S9WA 1VDGA 3KYNB 5H37H 4RX4D 2CKNA 1I1YA 3GMOA 5LGHH 1B9ZA 4YPJA 3S34H 5C0EB 4L4VA 4U6YB 5IFHL 1R3KB 3MLZH 5DJXB 3OX8B 2EC9U 4P2QB 1OAQH 1QNZH 3D9AH 4TTDD 5DD1H 4NZUL 1RZ7L 3MCLL 1G7LA 5FCSH 2ZCKH 3KYKL 4Y5XC 1GAFL 5HGBA 5IW6A 4M5YL 4DKDC 2L4OA 2B1HH 5KS9A 3FONA 5KW9H 1TETH 2VXVL 4OIIL 1NDGB 1CLZL 2YK1H 3LEXA 3V8OA 4WJ5A 3CIQA 1QRNA 4RCAA 3MLYL 5BZDA 5JDSB 5D5MA 3M07A 5JPMA 1KCSH 5F7NC 5T3XH 3L3GB 2IFFL 3S8WA 1HDMA 4J2XA 2ADFH 4MD4B 1C8PA 4K8RL 1UEYA 3ARSA 4UT6L 1ZSDB 4OI9A 4Y5YB 1AD0B 3GMMB 2BOCA 1P4LA 2NY7H 3TBSA 5SWZB 4UIMB 3D0VB 5GSRA 4RAUA 4XZUA 1PG7W 4QHMB 1KTLB 1EJOH 5INCB 3JV4A 4RAVA 1NUNB 1UC6A 5HHQB 4MNGB 3LS5H 2DBJA 1YEFH 4WRLA 1LE5A 1Z0NA 4F9LC 3C2SA 2PETA 1CE1L 2IBGA 1C5CH 1OAXL 3SDCA 3DYOA 5E8DH 4TOYL 3BDBA 5CJQH 4KGJA 2V17H 1HZHL 4YDLC 2VLJB 3RAJH 3EFFA 3V2AR 3TVMB 3HMWH 2RAMA 2GQHA 1EZVX 3GJEB 1MCPL 1MIML 3RWHA 3TO2B 5I1GL 5T3ZL 1BFSA 1HIML 2ZG2A 4GG6F 3CFJB 1R5IB 5IGXL 2PF6A 4OT1H 4HK0B 3TCLA 2YN5A 5FKAB 5CWSB 1LEIB 4DGIH 4KVNH 5SWQA 5I8OL 1OP3K 4LLUB 1T89A 1UM6L 3QIBA 4GOSA 4U4BA 3T0DA 2DL2A 2GI7A 1UB5A 1QBLH 4QRPE 2FJHA 1SEQH 3BQUB 1CG9B 3NFPA 3VMOA 1WK0A 4FABH 5D9SA 3UYRL 1CYGA 1GGBH 1LP9A 4YUEL 2PR4H 2WQRA 1A6WL 4Y1AE 1RZKH 1IAIM 4YHLH 3ROOB 2CKBB 4I9WE 1IQDA 3MRPB 3QEQB 3WS3A 1CGYA 5T1KB 1B6DA 2OTPA 1EA9C 3MOQA 1A4KB 3QDMA 1VB9A 1JCKA 1J8HE 1JZ7A 3SDDB 4XVSL 1R5WB 2FX8L 3TP4A 5JORA 1EFQA 2K7QA 1KJ2L 4U1LA 3RNQA 3C60C 1ZWIB 2IBZY 3KPRA 5EO1A 3VMNA 3PL6B 2W1NA 1KGCD 3VG0H 1WT5C 4KMTL 1YEGL 1AH1A 3QCUH 3SE8H 3NIGE 3JBG7 4GRLB 4GAJL 4HPYL 3S3JA 3GNMH 3DV6B 3VXTB 4GS7C 4M7ZB 1TQBB 2BXZA 4HKXB 2Q3ZA 4OM0L 3HZVB 4OZHE 4ODTH 1XH3B 3ARYA 3TZVB 5KAQG 4IIQA 3RTQD 2ITDB 1F90L 1WC7A 4ZOEA 4TUKH 3K80A 3C87A 4OZFB 4OI7A 1DLFL 1SMOA 4L9DA 1S7TB 4EIZC 5IW3A 5IVXB 1IM3B 3DX8A 4O5LH 4ZTPL 3SKNB 2CDFB 1JWMA 3LCYA 2YKLH 2X7LA 2GY5A 3S35H 4I18A 1FFPA 1CFSA 3PIQB 5LQBH 1L4IA 3BUTA 3HC0A 5E8OB 2VDML 3KPQA 1S7VB 3SOBL 3FO0H 3O11A 4F7CA 4NUJB 3K2UH 3TYFA 3I6KB 2LV4A 4JFEE 1T5WB 3OL2A 5I66A 5IF0A 1FO0B 4QT5B 3OHXB 1JHTA 5B3JE 3MCKB 4JFOA 4MLIA 1WFTA 4KDWA 1IBGL 5IG7A 4HXBL 5DJYA 1FGVL 2JJWA 1ND0B 1OF2B 1YEHL 3ARBB 3AREA 1JZ2A 1XF2B 3SE9L 1YY8B 5L2KE 3NMEA 1QYGH 4PRAA 2KZ1B 3GMRB 5C0AA 5MERB 3W5NA 4Y16C 2FHBA 3KPSB 2J4WL 4EJ1C 3CDGA 4KH2A 2HJKA 3F7YB 2QQKH 1FRGL 4Y88A 4CUCA 3QDJB 3MJ7B 5EUOF 1DBKL 1SBSH 2CDEB 1DQDH 3DYMA 3SDYL 2G5BA 3VFOA 3ZHLA 1MJ8L 4FS0A 5F7EH 5E5UB 5JW5A 5ANMA 4F3FB 2DQGH 4MA1B 4HUXB 1K6QH 2VXTH 4E42B 4H8WC 1OHQA 4Y0GA 4HJ0C 3V52H 5BV7C 1FV1B 4S0TD 5D71H 4MXQD 3UTTD 2NY2D 5CZKA 3L3OB 2PO6D 3F7VA 5TH2B 5F9OL 3PWNA 1OB1B 3B6SB 3IF1B 1NCAH 4APQD 1H0DA 4JR9L 4GT7A 2IAMA 1WF5A 2LU4A 4FTVD 5HI4D 4P2YA 8FABB 1GGUA 3U2SB 3GI8H 2DQDH 4QF1B 4LASL 2Y06L 3EOAA 4MAYA 4ZQKA 5GS2D 3OR7B 1Q9OB 4LIQE 1NSNH 2P5ED 4NKQB 4XPHL 1OAZH 4P9HH 3T0EE 4Z7OE 2PXYB 3VXOA 4AMKH 3AAZA 4MCZA 2OMNA 3FN9A 4O02L 1DQJA 3SJVE 1U92A 4QHNB 4H0IA 3RVXD 5D2LA 4FP8L 1C16A 4PJIA 1VA9A 3PWJB 3ULSA 2CXKA 4URTB 2VQ1A 4R96A 4LQFL 2R39A 2W38A 3QULB 3RDTC 3TPUA 3VMPA 3GBMH 4Z7VA 4PG2C 4O2EA 3RPKA 3NFSH 5CEZE 5CD3A 3BP5A 4YEEA 4NZRL 1SYSB 3IDXH 3HZMA 4QXGL 2EO9A 2ZNWA 3HI6L 1QBMH 1I9RH 3V4PH 5FDWB 4WCYH 4XNUH 1DJSA 1XIWD 3VFGH 1OP3H 4Z8FH 5IESH 3CFDA 4PJCA 3MRNA 1AQKL 4S1QL 1N3NA 2PNDA 1N0XL 2JE8A 2Z8WC 1F3RB 3NH7H 4BSWB 4YDIH 5CBAB 5CEXA 5AYUH 1ACYL 1U8LA 5DMJB 5ILTL 1OTSC 3Q6GH 3IAGC 1S9KC 1EO7A 4QOKB 4EVNA 1U8PA 4OLZH 5C70A 1J10A 4FNLH 4TNVF 4XP4H 4QY8A 1M1SA 3UPCA 4WY7L 3I6LD 3VXUE 5I1IL 5M7QA 5DMKA 1CDBA 1INDH 5HJ3B 1A14H 3VFMB 3DUUA 3L5IA 5BO1H 2ZSVB 4JFPB 3VXSD 4GSDL 3S36L 1ODAA 4OIBA 5FFLA 3U7WH 1X5JA 2GY7B 5IVZA 1R0AH 1NC2B 4PRHD 3ZYOA 1T22B 1SEBA 5DJ6A 3UO1L 3K46A 3BUYB 1IFHH 2X10A 1U8IA 4R6UA 4JRYD 5EUKB 2GJ6E 2YS4A 4GXVL 1RQ5A 2XZAH 3HZYB 2DQUH 4DVRH 4TUOB 4PJGB 1QSZA 4YIQA 4HDIA 15C8L 3SBWA 3RGVC 2MJWA 4ZDHA 2XN9E 1KCVL 4BZ1H 5I1JH 1P7KB 3QPXL 5E2UL 4IEFB 2H1PL 4MZ3A 3UZQA 4F9PC 4Y4FB 4ESKA 1T04A 4X6CB 3KLSA 1P7QB 4L8DA 4IJ3C 4U1HA 1RJLB 5EZJB 1BQHB 4PTTB 4I77H 1AQDB 2BOBA 1T66D 3P4OB 1KTRL 4PB9H 1TJIH 2NW2A 4JFHE 2IGFH 1J1OL 3P9LA 3RVUD 1CDCA 2EXYD 5C1MB 4X6FA 4P2RA 3LOWA 1PX4A 4RAHA 3VWKA 5F89A 4CMHC 3C6SA 1RK0B 2BNUA 2A38A 3CDCA 1NUDA 1NEZG 4LVEA 2Q76B 4GRMB 4MNQD 3FOLA 3T3MF 5D7IF 2HWZH 5I1CH 1IQWL 1NFDB 4QWWD 1A0QL 4X4XA 1A9BA 2BNRE 4OZ4B 1NAMH 4YEFA 2R0WH 4KI5F 2AXGA 1HINH 1OGTB 3V7AE 2CR3A 3B9DA 4OAWA 5LGHL 3LQAH 3S34L 2YZ8A 5EN2B 5EU6B 2W0FB 3MLZL 4PJFE 5F9WB 4U7KA 1OAQL 1QNZL 3GI9H 3D9AL 2BCKA 2V2TA 4TNVK 1H8NA 5DD1L 4ZO9A 3AC0A 4GBXC 2ZCKL 5DK3A 3DX7B 4MS8D 4GG8B 1KXTB 2B1HL 3BH8B 1CT8A 3ZKNC 1QR4A 3MPCA 4C56E 5KW9L 3I6GA 5I30H 1TETL 5DI8B 1F6LL 5C09D 3DO7B 2YK1L 3MO1B 2YD5A 3MA7A 3FB8B 3NACH 2D7NA 5KOMC 5DQJA 3SCMA 1UA6H 3SDAC 5TF0A 5A2LH 1UJ3B 4CRPA 2VZVA 5T3XL 3WIIH 3A6OA 2NY3B 2ADFL 1GRWA 1F4AA 3OKYA 4ODXB 4HFWB 2X2YA 4JAMA 3RKDC 2R2HA 3WYRA 3SKJH 3MA9H 1KF9B 3AU1A 3H9YA 2NY7L 3M8OH 3CDFA 4MX7B 3EUUA 1FBIH 3D39E 1SYVB 3KDMB 1EJOL 2E7LC 5D6CA 5JPNA 1SJEB 3LS5L 1YEFL 1ZK9A 1HSBA 2P24A 3G9AB 3GRWH 3TH4T 1F2QA 3AXLA 4YWGH 4OSUH 1C5CL 1HHHB 5DVLA 4AYFA 3F8UB 4JO1H 5E8DL 5CJQL 2V17L 4FQXD 4M3JA 3OR6B 4HG4K 2X1QA 5J11C 3DBXB 3RAJL 5AZEH 4ZD3H 2D4FA 5FM5M 3HMWL 2NW3B 2EO1A 5A43C 3QXDB 4E41A 1J8KA 2CRYA 1ZHBA 4EXPX 3U0TB 2V7NB 4OT1L 4RGNB 2JJTC 5HDQH 5DVMA 3KNBB 4MMZC 3T65A 5IBUB 1AGBB 4DGIL 1SVZA 2H45A 3I85A 5EOCH 5C0GB 3V6OE 2EDOA 4KVNL 1GVIA 3DIFA 4I3RH 2W65A 2DQTH 1W72B 2IBZX 4PJ8A 1QBLL 1WEJH 4P5TD 1SEQL 2P5WB 2NTFA 1NBZB 1U3HB 4XB7A 3RL2B 4YZFF 5C0BD 4PJBB 1I1FB 4FABL 3BH9A 2OZ4H 2XTJD 1GGBL 3T0EC 4D8PA 1UCBH 2PR4L 3IDMA 1MCEA 1CFTA 2WM0A 3MZGB 1RZKL 4XXDA 4YHLL 1FVCB 2HTLD 3DRTA 3VDAA 4HKZA 3VWJD 1XR9B 4YE4H 3VXQB 2BERA 2M1KA 4WGVB 2YD1A 1WAAF 4QRRE 4Z0XB 3UTPD 1ZS8A 5F7UA 2GTZA 1NAMA 1JZ4A 3KLDA 2HP4A 4D0CB 4ZUVB 2J8UE 3G5ZA 1K3ZA 5F88B 5HGDA 3VG0L 4QLRA 4LCYA 2YD7A 3QCUL 3SE8L 2Y23A 3QEHA 1UCTA 3GSVA 3GNML 3CSGA 1AGFA 4GFTB 1PKQB 2E9JA 4IHOA 3MCG1 3MLRH 1I3RB 4WHYH 1YJDC 1X6LA 4PGBB 4ODTL 1NGPH 5ERWA 1E4XI 2VOTA 3FT3B 2DKMA 1NC4D 1K8IB 4TUKL 2VAAB 3MV01 4Z76B 4RMUA 5HXMA 2V2WA 4U1NB 5TDPB 1PZ5A 1ZLWK 4EBQH 1HILB 1RUPH 2X4TA 4O5LL 4BFEA 3NAAH 2YKLL 3S35L 3ZDXF 1EUTA 5LQBL 5EO9B 2VLKA 4DJMA 2WLZA 5D1ZC 4QTHA 3K2UL 3NPSB 4PJ5A 1S78D 1J11A 2BHYA 3VI4F 1TZIB 1R5VA 2YA1A 3RWEB 1I1AC 4WV1C 5DZNA 4K3HA 1I7UA 4OF6A 1Q9KA 1YNLH 1NGXA 4L4VE 3O41A 3FB5A 1MLCB 3ZTJH 1ORSB 1YC8A 1QYGL 1BVLA 2XKNA 5D7JB 5ITBH 4JHAH 2ATKB 3QNXB 4HIIA 2BSSA 4JPIB 5ACZA 1IGJB 5IROA 4ONFH 2ZSWA 3MV9A 1UXSA 3QUXD 5IB2B 2EICA 3GRWA 2WINA 2QQKL 1U42A 5KS9E 4MQXD 4JRXA 3UROR 1EUUA 3EO0A 3P40A 4M1DH 1SBSL 4NFDA 4HUUB 1DQDL 3QFJA 4AIZA 1QRNE 3ARFA 4GUPA 1QSFB 2HJLA 5F7EL 4GKNB 5D5ME 2XQYG 1LK2A 4TVPH 3CZFB 3V5DB 1KPUB 2DAVA 2DQGL 5K59E 4K8RC 4QYOB 3DVGA 1K6QL 3ZTNH 1CFNB 2VXTL 4RNRB 5FO8B 4K9EC 4LLYB 3V52L 2P44B 3CFBB 1NCDH 1BEYH 4L4JA 5D71L 1XF5A 5BRZB 1HHKB 1XGQB 2MKLC 5IFAH 4HH9B 4QRTA 2AV1B 4N0YH 5HHNB 3P11H 3H42H 4UOW1 3D25B 1NCAL 4WWKD 3O2DH 4L9LA 2BXYA 5ACLA 3RHWF 4LAQH 1QLRA 3EYSH 4NP4H 4XHJC 3GI8L 2DQDL 1WGOA 1ZAGA 4ODUA 2X4UA 1UZ6F 2OZ4A 5DA4A 3ULVE 4QKXB 2ESVD 1G7QA 1NSNL 3H7BA 1HYRC 3O9WD 4X4ZA 1OAZL 4P9HL 2F53A 4AMKL 4O58H 3O45A 4M3KB 3GSNH 5TDNB 2EH8H 2FIKB 3E2HB 4NC1E 2P8LB 5E99H 4FRWA 3ECBA 5MEQB 1RK1A 4G8GB 5DC4B 3GBML 3WKMH 3FO2B 3NFSL 3FB7B 4WFEE 1I1RA 3GSXA 2VQUA 4RBPK 1TPXC 2EIZA 3TBYB 4DOHB 3MBEC 5AUMA 3CFEB 4LHUD 2K1MA 2I26N 3IDXL 4YHIB 4XTRD 4EQ2A 4PREA 1Q94B 4R90H 1QBML 2V2XB 1IJ9A 1Q9WA 4G43B 3ZYZA 1I9RL 3V4PL 4WCYL 4WEMB 3MLPA 3JZ7A 4XNUL 5DF0A 3TA3A 3VFGL 4YDLB 2AEWA 4Z8FL 4PRPA 5FOBB 3EYVB 5IESL 2JCCF 1BOGB 2IAND 5TQ0H 1YQVH 2RCSH 4X5WB 1LP9E 4X99B 1N7MH 2PTTA 3NH7L 3K1KC 3MNZB 4YDIL 4X9IA 3QR2A 3NCFB 4W4OC 5AYUL 3ZE2F 2VDLH 3MUGB 1PLGH 5DGQA 3HPJA 3VI3F 1D9KC 3Q6GL 3QDME 4FQQA 3PABB 3QCTH 4IS6B 4FNLL 4XP4L 1FC2D 4LHUG 2FDBP 1IL1A 1SJXA 3ARZA 4G80A 1ZLUH 5EDXA 1INDL 3HS0A 2NNAA 3TJHC 3IU4H 1A14L 1NMCC 4FZEH 3WIHH 4PRDB 5BO1L 4FFYH 2NXZD 4J4PA 4M6OH 5KN5A 4MGXA 1WITA 3D6GA 3EDJA 1KLFA 1IM9B 3TEUA 5EA0H 1I8MA 2OI9B 3OZ9H 3U7WL 1U91A 1R0AL 1RMFH 5HI5D 1VADB 3UBXB 4MQ7A 3QXUA 3B8SA 3QCVH 4XGZA 4N0FA 3MFFB 1ED3A 3C60B 3NGBC 3OKOB 1D5XA 4PJ7A 2A6JA 4ELMF 4U0RC 3L3IB 2CIIB 3QI9D 4I0PA 1G6RB 2XZAL 1KXVC 2DQUL 4DVRL 1UM4H 3O3EA 3L3DA 2GAZB 5ICYB 1PAMA 3TJEH 4EN3C 1HXMA 4GS7B 1ZLWH 1M05B 5T3XE 4CMMB 3V0VB 2H32B 3LKQB 4Y4KC 3MUY1 4H1LB 3V6OC 4BZ1L 5BW7C 3IJYB 5E4EC 5I1JL 3NIFE 2VR4A 1ZT7A 4GKSB 2XWTA 4RFNC 1MCNA 2LQRA 1VKXB 2GITA 1JN6B 4I77L 3O2DA 3U36A 4BFIB 1S7WB 1BFVH 3MLSH 4PB9L 1TJIL 1MI5A 5C0AE 4OGAC 2EC8A 4FXKB 1EAJA 2IGFL 1T4KA 4PJGF 4KFZC 2Q6WA 2VXQH 3D2UD 1BVKB 4D9QE 5SWSA 2Z31D 4CVZB 2GEEA 4YDVB 5HHOD 3WIFA 3GSNA 5J8OA 5EU4B 1JPGA 4JZJA 3FFDB 5DMGD 2HWZL 5I1CL 1I8LC 3WHE0 5C8JA 5IM7B 2AKRB 5ANME 3QDGA 1NAML 1E27A 4N5UA 2R0WL 1RY7B 3R8BB 1TENA 1UEMA 2HLFD 1BREA 1EFXA 5I76A 1OT2A 4P57A 1HINL 1F13A 5EB9A 5BS0A 1VFAA 3GMQB 4Y16B 1X5XA 5KSAA 5CMAB 3LQAL 3MJ8B 1CICA 1NANI 4DVBA 3PHOB 3LSOA 4KK6C 1XGPA 1Y0LB 1EGJH 3GI9L 2XKUA 4MDJB 2LAAA 5D7IA 3P9MA 2DQEH 1PFCA 32C2A 5JOFA 1YYMH 4AT6B 4OQTA 3S6CA 1NGWA 3HE6D 1FG2A 2HJFA 3QUZC 4UNUA 5J3HC 3T8XA 5A1AA 5LJYH 3OB0K 2R1YB 4BKLA 5I30L 1NFDF 3QNYA 5GQBA 4WEUD 3NACL 2Y5TA 1AE6H 1P2CB 1UA6L 1RJZB 4G42B 4JZNA 4GAYA 4WI7A 2C1PA 2JJSA 3H9SD 3WIIL 4R2GD 1AGCB 5D2LE 4MJ6A 4DEPC 4R97C 4PJIE 2DYPD 2XA8H 2H3NA 4JG0H 3MRBA 5GS3A 3MRFA 5DRZA 3T77A 4F80A 1UGNA 1HEZB 3BESR 4LLQA 4LLAA 3BEVB 4Z7VE 5CGTA 4P0DA 4O51A 5F1NB 2XG5A 4F7MB 2VNCA 1K2DB 2RIKA 3MA9L 3SKJL 3PNWB 3M8OL 2EEDA 5F3HA 1FBIL 3WIHA 3MLXH 3MMEB 1MJJB 5DD6A 3KYNA 4RBPH 3L7EB 3REVB 2WBJD 1WCBB 3IFLH 1MQKH 4U6YA 4HW6A 1M71A 5FUZH 3L9RB 1NBQA 3GRWL 4PJCE 4WO4A 4IOIB 2AXHA 1JJUA 2ICWB 3C09C 2DQFB 4YWGL 4OSUL 1IC7H 4F8QA 1OP9A 3OKKB 4JO1L 5JW4M 1MCKA 1OSZA 4GAGH 2JB6B 5AZEL 1TVBB 4ZD3L 3W9EB 1U6AH 1DEEB 4OZFH 3OKEA 4ODVH 2YPKB 3S4SG 1SM3H 3DV4B 1NDGA 3SGKA 5IW1B 3MV8D 2BSTB 4PLOB 3LS4H 5HDQL 2CD0A 2BC4A 3N50A 2P8MB 5DC0A 3VFWB 3VH8G 5EOCL 3LKNB 3WJJA 3EHBC 1ROWA 2Y6SD 4PD4J 5FYJE 4Z7QE 3IDIA 4I3RL 4NPYB 4MD4A 3QXTA 2DQTL 3DXAD 2BVOA 3T3PF 3VGEA 2FEDD 5D6DA 1K85A 1WEJL 1HHGA 2F5BH 3SEPA 2EE3A 5E08H 3G5YA 1CD8A 3C5JA 4XWOD 4NQDA 3GSOA 4S0SD 2OZ4L 4JFYB 2VISB 1WBXA 3CJJA 1UCBL 5SWZA 4UIMA 4PBWD 5FYKH 5ENWA 2IPUK 4O2CA 3SDCC 4AK1A 2XWBB 3SKMA 2ADGA 5I74B 5KZCD 2V7HB 3LDBC 2JIXA 4NC1C 3QZWA 5E1AA 1D3CA 3UTSD 1T1XB 2Q86A 5HHQA 4YE4L 5L88H 4K71B 4B53A 4NIKB 4XBEH 4QRQB 2IEPA 2PKDA 2D0FA 3WBDA 2EXWD 3VGDA 3BMWA 2F54D 2B0SH 3EGSB 5FGSA 4XCFH 3FT2B 2B7DT 2GSIB 4MYWB 4DKFH 5FO7B 3GJEA 2OX5A 3O4LD 1T89C 3QIBC 4K55A 2DWDA 4Y4HA 5J13C 4LPCA 3CFJA 5D7KD 3EYQC 1F00I 1JRHI 5GRVK 3MLRL 4Z7WF 4NSKB 3BRGC 1LEIA 1NGPL 1MCJA 4L1DA 1NFKA 4Z7NE 5EC2B 3HB3D 3HNSH 3Q48A 1GGCH 3ZE1E 3HZKB 5F71A 1CG9A 3D48R 4MZ2A 3FAXA 4EBQL 1RUPL 3KXFD 4P2RE 5E2WH 3FQWB 3NAAL 3UBXI 3NCEB 4LK4A 1KCUH 5EZLA 1JK8B 2W0LA 3PWPA 4QRPB 4Z77B 4IJ3B 4MXVE 3ROOA 1LHZA 5D1QD 4OV5B 1DUYB 1R3LB 2Q8AH 1GC1H 2HVKA 2A6KB 1T0NB 2VWEE 4LEXH 3RP1A 3GO1H 4Y1AB 3SO5A 1YNLL 4A6YA 4UQ2B 1UKSA 3UCRA 1EVTC 2QHLA 1NBVH 5FF6A 1B0RA 3ZSSA 1CDYA 3PL6A 3V95A 1RZJC 4CMHB 4IIQC 1AFVH 4JHAL 4U1KB 5ITBL 1IZJA 5IBLC 3RJQB 2ADJB 1J8HB 4ONFL 4WFGD 4GRLA 2Z35B 3DUHA 5IEHA 1T1ZB 1REIA 3G5XA 1CGSH 2FB4H 3DV6A 3NOIA 2A9NH 3HG1D 5EBWB 5IB3A 3ARPA 5C0CA 4BH8A 4M1DL 2WWMC 4P4RA 3IXTA 4JEGB 4I18C 2DLEA 3FN0H 4OKVB 4BZ2H 5JUEH 4EI5B 4LLDA 1EEQA 3OB0H 3F12B 1JF6A 5HY9A 1S7TA 4TVPL 4OZHB 1GCFA 5JIKA 3PG2A 1QD0A 3ZTNL 4AJ0A 1HYSD 2E7MA 3PIQA 4GBXB 4XNQB 2HH0H 5EC1B 5JIPA 5F7FA 1NCDL 5E8OA 1YN7B 1A7BA 2ARJQ 3RJDA 4NUJA 5IFAL 3EDEA 3UC0H 3AREC 4N0YL 3I6KA 3P11L 3OXSB 3C9NB 3H42L 4YXKH 4QT5A 3O2DL 5L2JA 4W6XB 5FCUH 3QG6B 5GS0H 4LAQL 4CU7A 1OY3B 3EYSL 4NP4L 1IAKA 3UAJC 3SDAB 1E4XH 1AO7A 5J6HA 3BXNB 1UADC 2BVTA 5ESAA 4O58L 5MERA 4NN5C 3GSNL 3H9HB 1MRCH 3D85B 1EH9A 3S98A 1WJ3A 5E95B 1JZ5A 4RQQB 2EH8L 2OL3H 5F96H 2NY0C 4EQ3A 5E99L 3GMNB 5L2KB 3KS0H 1F3JB 3QDJA 1INQA 5GPRA 1WFOA 2Y5EA 4OD3H 4YGAB 1CFQA 2AJZA 2W60B 4E41E 1HQ4A 3WKML 4OD1H 2W59A 2HA1A 4LCCA 3CSYA 5C9JB 4XPAH 1IEBB 2IH1A 4ZPVB 2IPTH 3FMGH 4XWGH 4P2OA 3ULUE 5DQ9A 4R90L 3S36X 5FA4A 4QXUH 1EO8H 3G6JF 1MH5A 2WW8A 3IFOA 1G7IA 3TIDA 4LOUC 5J11B 3NIDE 3VXNA 4PGDB 2A9MH 1RURH 4OQTL 2XZCH 2VL5A 3L3OA 4MAYC 5TQ0L 1OB1A 1YQVL 2RCSL 4W6YB 2BNQB 4IRSD 2GKIA 1RZKC 1L7IH 2VXUH 1N7ML 1ETZA 3HAEG 2ICWI 1X5LA 4XHQA 4QF1A 4XH2B 4ZPTB 2VDLL 1ZHLA 1PLGL 3ZZ1A 5B8CA 4RFOH 1IGYA 1RI8A 2VO5A 3VXMA 2JCCA 3QCTL 2VABA 2YUXA 3MRJB 4QHNA 5CINH 2VZOA 3M17B 5B38A 5B3NA 1F42A 3QUYA 4JN2B 1IGIH 5CEYB 3T0EB 5E4IA 3SE4A 3IU4L 3WIHL 4FZEL 2J12B 3G5VA 4KMLB 4FFYL 2BVPB 4X0KA 4M6OL 3RDTD 3TBWB 5DQDH 2RB8A 1MUJA 3QA3B 4IMLB 4KK9D 5EA0L 3O3UN 1KEMH 3OZ9L 4JO2H 4FQJH 3HI5H 2F74B 1RMFL 5EWIH 2IQ9H 4FN0A 2FWOB 4XVUD 1JIBA 2IPKB 3QQ9D 3QCVL 5FDWA 1LWRA 1I3UA 4PJEB 4L3EA 1CGTA 4RGMC 4J3OC 4HGWB 5DVKA 1VFOA 2FZ3B 4QHLA 1JHKH 1UM4L 1BVZA 4DFIA 4HHAB 2VLKE 3TJEL 3HC4H 4NGHH 3I02B 4OQ1A 4BSWA 1MHPH 5CP7B 2CUHA 4PJ5E 4D0DA 4OBSA 4DK3A 1LILA 4WVRA 5DJ8B 3NN8A 2EEBA 1ZT1B 4Y19D 5C2BH 5E6ID 5FUCE 4ELMA 2R1WB 4CVXB 1HCFX 4L3AA 1HI6B 1K4CA 2DKSA 1BLNB 3DARA 1BFOA 1FDLH 3MLSL 3VD7A 2EEAA 5CZXD 1JE6A 1KELH 5D7LA 5JW4N 5HJ3A 3KYOB 4NRXA 4JFPA 5D1ZB 3HE7D 2VXQL 2FBJH 2DTMH 1L0XA 1XCTB 3BP4B 1DE4B 2XWJB 3VXUB 1S7XB 5GZND 1WFNA 4GO6B 5F6HI 2NYYC 3SGEI 1NC2A 3QFJE 3DI3B 4WV1B 4ZOBA 3SBWC 2OL3A 4JDZA 5FV2A 4BK5A 2OTWA 3BUYA 4NDMB 5L0QC 4RMSA 1CGVA 5IMOB 5H2BA 5C7XH 2DI8A 3BGMB 3GKWH 3HZYA 4NQCE 3QYCA 2D7MA 1DVFB 4PJGA 4KHXH 3X13B 4YK4C 2AK4D 1S5HB 4H0GA 4NJ9H 4RMTA 4DW2H 2APTA 3RGVD 3LIZH 2OTUA 4UTBH 1QVOB 4HPOH 1T5XB 5INDB 2GJ6B 1P7KA 5I1AA 2DQEL 4JGUA 1JUFB 2B5IB 4UDUB 1FN4A 4NNYB 2YR3A 4PUBH 1YYML 4YHPB 3W0WA 1W72H 4S1DD 3CVHB 3EJZC 1NCUA 2XN9B 3KPLA 1BQHA 3WEXB 4P9HC 4PTTA 3SQOH 3VWKC 2A73B 1AQDA 4KUZH 1MRDH 1RAMA 2C7UB 1LE9B 4OLXH 1FYTA 3P4OA 5ID1B 1BBJA 2F53E 1AE6L 2JK5A 5CGMA 4N8VB 4I48B 3RX8A 2OSLB 5J1AB 2JJVA 2FH6A 4NO3A 1RK0A 4YBLC 5EO0B 2XA8L 4JG0L 3RI5F 1HNFA 4EI6A 1GZPB 5AD0A 2Q76A 1VFBB 3MUZ1 4GRMA 2VWEC 3SO3C 1KB9K 3FTGB 3WD5H 1KCKA 4H20H 1NFDA 3GJFH 4XI5D 4UILH 4MA3A 3U0PB 4YQXH 1T3FB 2ORBH 4KZEL 1RJYA 5FHBH 3MLXL 5K9OB 3MOAH 1QQDB 4PP2B 5EU6A 2W0FA 1MQKL 3IFLL 3AMKA 5DGRA 3ARDD 5CJOH 2BNRB 4B7IA 4PRPE 5FUZL 1FC1A 2KPNA 3EOBB 4KROD 3BO8B 4PGJA 1IC7L 1HHIA 1QKZH 3MC0A 1FP5A 4JB9H 4TUJB 1RHHB 3LQMA 3DX7A 3SCMC 1UH2A 3PGFH 4GAGL 4YHNB 3L7FB 5CD5D 4PJFB 5IP4A 4GG8A 1U6AL 2GSGA 3BH8A 2NY6C 3U4EA 1BJ8A 4ODVL 5HHVH 3ZKND 2DQHH 4JRWA 1SM3L 5D72H 3FB8A 4YPGB 3LS4L 1E28B 4UQ3A 2I25N 4NRYA 4LCWD 2JTDA 4C56B 2A1WH 1TCRB 5DFWH 4FZ8H 2PYEA 4JFED 4YR6B 4PG9B 1NANH 1P1ZB 4J8RB 3S96B 3PGCB 2F5BL 2M8XA 5E08L 4ODXA 1G9MC 4LDLB 1OWWA 2IQAA 2EDHA 3IS0X 4N8CH 5ESQA 2CGRH 3FQNA 5FYKL 1D9KB 5IB5B 1SYVA 5DEZA 2X09A 1JZ6A 3S35X 2V5TA 2CDGA 4Z5RB 1SJEA 2IALB 1YMMD 4PJ7E 4RSVA 2X70A 3MGAA 1X4YA 2C3HA 3GB7A 1CS6A 5L88L 3D39B 2HT4C 3RX7A 4NKOB 2H9GB 4KK8C 3B83A 4CDGC 3CXHJ 1NMCB 1MHCB 5TF1H 4MSWB 5IFJA 2VIRB 2LABA 2B0SL 5EFIB 5IQ7H 4DGVH 4XCFL 1Q8MA 2ZOKB 4ZYKB 4UBDC 2WIIB 4DKFL 3ULUC 2FCBA 1FAIH 1CFVH 4M61B 3TN0A 3P0YH 3RI5K 3RY4A 4PJ8C 4UUJA 5JNYA 1JTPA 3KNBA 2YZ1A 3NGBB 3QT2A 1YPZF 4U0RB 3MZTA 4GKOA 5C0JA 3HNSL 4ENED 1GGCL 4HGMA 4EN3B 3L3JA 3CU7A 2QR0B 5F44A 1CXFA 4Y4KB 5E2WL 2ERJC 5EPMA 2W07A 2WIMA 3EJYC 3OG6B 4JFFD 1KCUL 1JPFB 2YPLD 4XNZC 3T4AB 2FO1A 1KLUB 4Z7WA 4LSPH 4LLWA 2QJDA 1AGDB 1A6TB 1TZGH 1AXTH 1PBYA 4NRZA 3QDGE 1AIFB 1XR9A 4MA8H 5SX4I 2Q8AL 1GC1L 5BS0E 3VD3A 3GJFA 1MCBA 4FMFA 4LEXL 3RWFB 3KPNB 5MHSE 3EYOB 4XCEB 1NBVL 4RWHA 1C12A 5F88A 1AFVL 2VTFA 4XNXH 2HTKD 4CDHA 4XMKH 1CI5A 2D7PA 3CFKA 4QRRB 2FB4L 4IDJH 2A9NL 3FO1B 3IFPB 1PKQA 2EIBA 5FDYA 5HDLA 5IKCB 2B8OT 5GHWH 2DJUA 2FL5B 2J8UB 4XX1E 1YC7A 3FT3A 4POYA 3FN0L 4BELD 4I8DA 1F3DJ 4BZ2L 5JUEL 4N9GA 1FZKB 1OAKH 3WHXA 4Z76A 4U1NA 1HILA 5MEND 2DL9A 4NOFA 4TULH 1I9EA 5FUCC 2HFFA 4OGYH 1IMHC 2HH0L 4KQ4H 4M8QA 4FQHB 5HVHC 1NGZB 2VZUA 3QUZB 3UC0L 1QEWA 2O5XH 5E56A 4YXKL 2MOVA 1TZIA 5JXEA 1S3KH 5FCUL 5KTEH 5IROC 3RWEA 5GS0L 1JRHH 4X9FA 2NQCA 1PJ9A 5HPMB 4PJ9D 1I1AD 3DSNA 3NIGF 4WU7B 3U4BH 1E4XL 3K8MA 4MAUH 2Q87A 3WHE1 3FCTB 4DEPB 4R97B 1X4ZA 1MLCA 4AEHH 4Y5VB 4G9DB 2ATKA 3QNXA 4XMLH 5SX5K 1IGJA 1S9WB 5C08A 1MRCL 3ARFC 1I1YB 1GIGH 2ZJSH 3RWJB 4L4VB 5IB2A 2OL3L 5F96L 1XEDA 5GRXG 3WN5B 2F8VA 5D8JH 3WO4B 2EYTB 4OD3L 4X9HA 4HUUA 1G6RH 1OQOA 1G7LB 2L0DA 3BD5A 3QIWC 4OD1L 1QSFA 4XPAL 5HGBB 1NUGA 5IW6B 3AROA 4F7TB 5KS9B 1KPUA 3FONB 2IPTL 4LSDA 3FMGL 4XWGL 4FQ1H 4CN4A 2XV6B 3C09B 5GGVH 4QYOA 4L9LC 4K8RD 3LEXB 4RNRA 2HMIC 4QXUL 1EO8L 4LLYA 1QRNB 4Y2OA 4OLWH 3OAYH 5BZDB 1T1WA 5DURB 2A9ML 1OP5K 5D5MB 5BRZA 1HHKA 1OGAD 2XZCL 2YMXH 5HHNA 1HDMB 2AV1A 4NQDE 1UACH 3B9KC 4PJAE 3D25A 1LDSA 4NN7C 1NCNA 2XY2A 1L7IL 2XRAH 3WXVH 2VXUL 2F58H 2VZSA 3PWVB 3RVVC 1RUMH 3G6JA 4RFOL 2N1KA 2AQ2A 4ZXBD 3RUGF 3TBSB 1VHPA 3K4AA 5GSRB 4RAUB 4XZUB 4GW5B 5J1SC 4LDOB 5CINL 1LO3H 2WBKA 4CJ0A 1FVDA 4CN1A 2CUMA 4J6RH 1GYAA 1I3VA 2P8LA 1LE5B 1IGIL 2DLFH 4RX4A 1ZGLA 3Q6FA 3PGDB 5T3ZD 3MJGX 4EXKA 3SDCB 2IJ0C 1OQXA 1RUKH 4HKJA 3TA3C 1JYVA 2DI7A 3LDBB 3TBYA 3CFEA 1KEML 4JO2L 5JO5B 3MBED 1P4IH 1VFMA 4FQJL 4IMKA 5JIIA 3HI5L 5EWIL 2IQ9L 4U3CA 1U93A 3WLWC 1KN4H 5DLMH 2A83B 3MV7D 1RUQH 3ZKMC 3TC9A 4MJ5B 1ZMYA 3W2DH 4Q9CA 4D94A 5SWQB 4YHYB 1JHKL 3QIBB 4X5WA 4NQXA 4KTYA 1YUHA 1P84K 1UB5B 3HC4L 5J13B 4NGHL 3PWPE 4H8WH 2FJHB 1C1EH 4Z7OF 1MHPL 2BDNH 3NFPB 2NMSA 4JO3H 1WZLA 2EE6A 3WNKA 5D9SB 1KG0B 1XGTA 1LP9B 5C2BL 4X7SH 3O6FD 3B9AA 1DEDA 2K9UA 3V7AG 3LKOA 4PV9B 4YHOH 4YHZH 4J4PC 5TE6H 4KKCC 1IQDB 3WS3B 2UYLB 4POZD 2VMFA 2V5SA 1X5GA 3G04A 4ACPA 4G6KL 2QL1A 1FDLL 2C1OA 4PJEF 4HMDA 2VN7A 1B6UA 1KELL 3QDMB 4NQED 2XPGA 4X8JB 3JV0A 3SGDI 4PRDA 1A6AA 5HPOA 5HDBF 5CZVH 3VI4E 2BK8A 5J6GB 2FBJL 2DTML 3BN9C 4KJQC 1IM9A 1PGRB 4I0PC 2AV7A 2I5YH 4Q0XH 5C0CE 4Z78A 1LO5B 3CUPA 5C3LD 1PYWA 1A7OH 1F4HA 3MFFA 3QXWA 3C60A 4ZFGH 2WWKT 3O4LB 5I8CA 5C7XL 1FNLA 3L3IA 2CIIA 5B22A 1G6RA 3GKWL 2E27H 1JBJA 3VFRB 4IIQB 2ATPA 5IR1A 2QQLH 4KHXL 4NJ9L 4DW2L 2ZUXA 3WNLA 3LIZL 4UTBL 3LKQA 4HPOL 1JWMB 3LRGA 2X7LB 4GKSA 4I18B 4PUBL 3HC0B 3L1OH 1NH6A 4P46D 3KPQB 3E6FA 4RISH 1W72L 3O11B 4F7CB 3O2VH 4P2CG 1F6AA 1PW3A 5GS2H 5L8LB 3SQOL 1AO7E 3PXJA 4KUZL 1MRDL 5I66B 5IF0B 4M93C 3BRFA 1KULA 4OLXL 4V1DD 2NY4D 3D3VD 4JFOB 4JZJC 1WBYB 4JHZA 5IG7B 3LB6C 3WNOA 3AREB 5SX5H 1T7ZA 3ILPA 4CVZA 1P5UA 1KT2B 2VERN 3QDJE 4YDVA 4WI5A 2YD4A 4PRAB 1MFEH 3WSQH 5C0AB 3ZLQC 5KSAC 3WD5L 1CICC 3HRPA 3I2CH 4H20L 3SPVA 3MQIA 5D96C 1MF2H 4UILL 3CDGB 5HI3C 4X4MA 2HJKB 4C54A 2FECI 3QISA 2AKRA 4UT7H 4YQXL 2ORBL 3O2WH 4L8SA 1T2JA 5FHBL 4BYHA 3L3KA 1Q1JH 2WLYA 4NN5B 3MOAL 2G5BB 3MROB 2ILLA 5CJOL 3PHOA 3TV3H 5ANMB 2NY0B 1NGYA 2C4FU 3TNMA 4KK6D 3BKYH 1LGVA 1QKZL 1UXWA 1OP5H 4JB9L 1J05A 4NM4L 3ES6A 1BOYA 3PGFL 1VGEH 1XF4A 3F7PC 1FZMA 3ZHKA 4Q58C 3KR3H 2JJSC 1UM5H 3F7VB 5E8EA 3PWNB 5HHVL 2DQHL 3MLUH 1ES0B 2LAGB 3VA6A 3C5ZD 1H0DB 1GOGA 3FO9A 4NYLA 5D72L 3WDIA 5FM8A 3VRIA 3VXME 2JCCE 1ZVHA 3MRCB 2H2PD 5CJXA 2P8PB 4JM2D 1EBAA 2ENSA 1MCFA 2A1WL 3VGBA 3EOAB 5IMKA 4ZQKB 4FZ8L 4WTZA 4N5EC 3MLVH 3VXOB 3AAZB 2UV3A 1DQJB 3BEVA 1U92B 4KRLB 2IADB 5D2LB 5FOJA 3VI3E 4LAJH 1C16B 4WO4C 4PJIB 5ALCH 5CJ5A 3PNWA 4N8CL 3ULSB 4NC0B 2CGRL 4PJFF 3PUCA 2VQ1B 4K3DH 4R96B 5A3IC 2Y7QA 1CD0A 4Z7VB 4LHJB 4O2EB 4L3EE 5CD3B 3MRGA 3L9RA 4XVJH 3T04D 4ZSOA 2VLMD 3WLBA 1ONQA 1DANT 1CQKA 2DQFA 3HZMB 4P3DB 3BD4A 5FK9A 3SGKC 1IZKA 1S7RA 3DYPA 1UVQA 5TF1L 4HWZB 3BEWA 1W8NA 1T0MA 2JB6A 1TVBA 4Q7DA 4I3GA 4CNIA 4DGVL 5IQ7L 5IWLA 4JQIH 1DEEA 2MCPH 3CFDB 4PJCB 3VGFA 2YPKA 3WJJC 4KTDH 1FAIL 3RWDA 1CFVL 3P0YL 4Y2DD 3UTTA 3RFZC 5JLZB 4ELME 2PO6A 5D6DC 1T2QH 5HBBA 4HFUH 5DO2C 4HEPG 3VFTA 3P0GB 1OM3H 1YEKH 3VFWA 4APQA 2GTWB 3ARUA 5CEXB 3OV6A 1OVZA 2XXMB 4FTVA 2ZZUT 1U8LB 4R4ND 1RZIA 4QCIB 2X9YA 1N8ZB 5D7LE 4ZAKD 4EVNB 1U8PB 2P5EA 4R8WH 1BHGA 5I17B 1NKRA 2QQQA 4YBQD 3KGRA 2A6IA 3CNKA 5DVOA 1FL5A 5F3BA 2EYSB 4LSPL 1JWSA 2FX7H 3GEWB 4JFDD 3MRIA 1YPZA 2X9WA 3DUUB 1SHMA 1IC5H 1TZGL 4HKBA 1AXTL 3FZUC 1DBMH 3FFCD 1T1XA 1JNHA 4MA8L 5IT2H 1HOCA 1P5VA 4OV6F 2V5RA 1CCZA 2Z4QA 5E70A 3O8XD 1SEBB 4Y4HC 3RWGA 4S1RH 3EGSA 5FO7A 1JI1A 2EDYA 4XNXL 4XMKL 3RU8H 5HHME 1XIWA 4YIQB 3LN5A 1MFAH 4HDIB 4IDJL 4NQUA 3OKNA 3AS0A 3H3BC 3W0WE 4HS6A 4PJHE 5GHWL 2J88H 2PTUA 5IEKA 1FYTE 5EC2A 1Q9LB 1T04B 3U7YH 3ALPA 3KPMB 2NY1D 5GRUH 1OAKL 4L8DB 1A2YA 3EOYG 4LSVH 4FQIH 4KUCD 5LBSH 3DJ9A 4QRSA 1FH5H 3BT2H 2BOBB 4TULL 4OGYL 2NW2B 4KQ4L 4YFDB 1XGUA 4PJXB 3PQYB 4QRPA 3P9LB 5C0DA 3T2PA 1NFDE 3K4ZA 1I7TA 2O5XL 3VD5A 4JHBA 3PL6C 3KPRD 3VWKB 3C6SB 2XYCA 1DUYA 1S3KL 1WVZA 5KTEL 4LSSH 1JRHL 3DVNA 4LIQH 4YFEA 1FL3A 4OF8A 3FOLB 4RGOH 4NO5A 5EU6E 3U4BL 1A9BB 4MAUL 5C0ND 4FA8A 4AEHL 4U1KA 4XMLL 1L9MA 2ADJA 2W92A 4JRYA 1GIGL 2ZJSL 3SO3B 1YDPA 3BZDA 1ULVA 3JWNC 1NEZA 3RY5A 2NXYD 5D8JL 1WTGT 1G6RL 3QXVA 4OKVA 4EI5A 3WFHA 3F12A 5K93A 3AUVA 1CT8B 1Q72H 1FNHA 4FQ1L 3VJ6A 5GGVL 1J1PH 2PYEE 1KYOJ 3MA7B 5H37G 3IKCB 4HWBA 4OLWL 4R7NB 3HHRB 1P4BH 4PJDF 1YN7A 1DQQB 2YMXL 2NY6B 5GISH 1UACL 4B7LA 3UJTH 3OXSA 3VRLE 4MVBD 5CJBA 4MJIB 2XRAL 1UH4A 3QG6A 3WXVL 1CXKA 2F58L 1RVFH 1QHOA 2AXFA 4TN9A 1RUML 2OM5A 4YLQT 1QP1A 2R2HB 3T3PE 4ZMAT 4MNQA 3AU1B 1G1CA 1IKFH 4YJZL 5KS9F 4M1CD 1AD9A 1UFUA 5D1XB 3JTSA 2R0LH 4E0RA 3QO0A 4KQ3H 4LCCC 1LO3L 5D6CB 4UV7H 5JPNB 3K81A 1KTDA 1CVSC 5IHUH 4J6RL 3SDXB 1A6VH 4JG1H 3X12B 2P24B 2DLFL 1CDGA 1F3JA 3CU1A 4P2OC 4PGCA 3AXLB 4GW4A 1R3JA 4HH8A 5D5MF 4XCCH 3ARWA 1YEDA 1RUKL 4XP6H 2I07B 3RUGA 5C9JA 1P4IL 3IDYC 3UTZA 3GFUA 4OIIH 1ZHBB 2BVYA 2IAMD 1KN4L 5DLML 4LOUD 1RFDH 1RUQL 5C09A 3T65B 3W2DL 4AENB 1WIPA 5B8CC 4LP5A 3CVHH 4MAYD 4OF7A 2JJUA 3DIFB 2BNQA 2W65B 3ULVF 4Z7WE 3OGCA 5JW4Q 4NM8H 3LV3A 4PJ8B 1U3ZA 5C92A 4H8WL 1C1EL 4K9EH 2NTFB 2BDNL 2B2XH 5AEAA 4JO3L 3QUYC 1GC1C 4ZFOB 4L4TD 2Z8RA 5ETUB 3BH9B 3LY6A 4D8PB 3IDMB 4X7SL 4MNHA 1I3GH 4YHOL 4YHZL 1Z3GH 2FSEA 4P5KB 3MRJA 2I24N 5TE6L 3QPQD 4XPBH 1X6NA 2ERJB 3TM6A 5FECA 4EKXA 4G9FD 4XNZB 1CD1A 4TVSa 4G6AC 1ZS8B 2BVPA 2GTZB 5CZVL 2N7BA 1HZHH 1S9VB 4NN6B 4WI3A 5CP3H 3D18B 3QA3A 3LKPA 1UT9A 4NCC1 2I5YL 4Q0XL 4U1IB 5GGSB 4LCYB 2YD8A 1BQUA 1A7OL 3GSVB 1FQ9C 3GUTA 1AGFB 3ZE0E 3MLTB 5IGXH 4PJEA 2BSRA 4ZFGL 4KWUA 1B0GA 4MJ4A 3TFKC 2CRIA 1YZZA 2FZ3A 2E27L 5I8OH 2QQLL 3VCLA 1CGUA 2E9WA 3PHQA 4IDLA 1PZ5B 5CP7A 4BK4A 1S8DA 5E7FA 5DJ8A 5GS0C 4P5TA 1WFUA 2VLKB 3L1OL 3MV11 4RISL 5C0BA 1H3TA 2LVEA 2YA2A 3HR6A 4CVXA 4F15C 3O2VL 4JDVA 4HK3J 4PJ5B 4X5XA 2OQJA 3KG5A 1DQTA 1R5VB 2HT2D 3ILQC 3RL1A 5J9PB 3V5HA 4AG4H 5C08E 5HVHB 1I7UB 3DTXA 1Q9KB 1NGXB 1L7TH 1IGMH 1UH3A 1A6ZA 1DE4A 4QTIH 4LSRH 1MFEL 4WW2C 2WK2A 3WSQL 5ACZB 2DKUA 2UZXB 2ZSWB 1U3YA 2EE2A 2NYYD 2V6HA 1J88A 3I2CL 1QSFE 5CS7A 3IXAA 1MF2L 1JGVH 4OM0H 2WINB 4UT7L 3DROA 3O2WL 1C08B 5T1LD 3MRRB 4WW1A 3EO0B 1Q1JL 1DVFA 4KY1H 2X44D 3D69A 4AIZB 3NIFF 3ARFB 4GUPB 3EO1A 5I8EB 1S5HA 1BJ1H 2NLJA 2XOTA 4F58H 4HG4J 1TQCB 3TV3L 1AKJD 3X14A 3ZKXB 1NC4A 2E9IA 3BKYL 4WI2A 2FRGP 4G5ZH 4NQCB 3DVGB 3SGDH 1JUFA 1RHFA 4K7PH 4YHPA 1VGEL 1DN0A 3QIWB 1JPSH 1XF5B 3KR3L 4KKBC 5FGRA 1UM5L 3WEXA 4QRTB 3MLUL 3G6JE 3AM8A 5AYQA 5I19H 4LPWA 3QXAA 4L9LB 5E5MA 1BD2D 4MB5A 5I75B 1QLRB 3UZEA 2V5MA 4Z7UE 2Y9RT 5CKGA 2X4QA 4ODUB 2OSLA 2X4UB 1K4DB 1WV7T 3B9KB 1G7QB 3H7BB 1OAUH 4FQCH 4RRPG 4F8TA 3MLVL 4KTEH 2F53B 4NN7B 1PVHA 5BVJB 1EHLL 1VFBA 2UVFA 4JGJA 3QUKA 4OZIA 3THMH 3VE0A 2QHRH 3JV6A 3RWCB 5F9WC 4WGWB 4TPRH 5ALCL 3U0PA 4DOHE 3BYYA 1T3FA 2W9LA 3MNVA 1DUZA 4LKXA 3ECBB 4YDKH 1BQLH 1RK1B 3QUXA 5K9OA 1U8KA 3MR9A 4K3DL 3BZFB 3P2TA 2D9QB 5CP3A 3DGGA 1QQDA 5HD8C 3ETBF 2BNRA 4HAFA 5E9DD 4XVJL 5IK3A 5AUMB 3N0PB 5KJRH 2ENYA 1XFPA 3EOBA 3STLA 3BO8A 4PREB 3EDFA 3EZJB 4TUJA 3F6IA 3B2UD 4WHCA 3SCMD 4JQIL 4PRPB 2MCPL 5F9OH 1G7HA 4KTDL 1CGWA 3OAUH 4M43H 3Q5OA 4HQQH 5D2LF 1RZFH 1GGIH 1UJTA 1TITA 4PJIF 4M5ZH 4HFUL 2QSCH 4KRPD 4U1GC 5I16A 5DJZA 1OM3L 2P46B 1YEKL 2P48B 2HFGH 1OARH 3HMXH 4JKKA 2EIDA 3OJDB 4CJ1A 2C26A 3HPJB 4YR6A 4JY5H 4PG9A 3MRKA 4FQQB 4J8RA 4KAQH 5DTFA 1NEUA 3VXRD 2ESVA 4KZDH 4R8WL 3O9WA 2OP4H 3WV0A 5F9JB 1VEMA 5DHVH 4PLKC 1IL1B 4NNPL 4G80B 2DTSA 4LU5H 5IB5A 3HS0B 2FX7L 2NNAB 4PJCF 1CN4A 1IC5L 5KN5B 1XZ0A 1DBML 3EYFB 4KJWC 5IT2L 4JGMA 1I8MB 3TN0C 4PIRF 1U91B 3D39A 4NKOA 3N1GC 5DUBA 4FXLA 4XGZB 2X4PA 4MSWA 4LHUA 1ED3B 4S1RL 4PJ7B 5HHPA 2CLRA 4ZYKA 3BI9X 3BP7A 2IF7A 4P4KD 1LO2H 3RU8L 4M61A 4U7MA 2QADB 3O3EB 1TTUA 4R4FH 3N9GH 4P49A 1MFAL 3S7GA 4Z7QF 5J89A 2IANA 1HXMB 1OTTD 4F7PA 2J88L 4KJPD 1E6JH 2Z92A 3DVIA 4FFVC 1HK6A 1ZT7B 4EOWH 2BHZA 2HG5A 2XWTB 2BVEA 3V6ZA 5GRUL 1JVKA 4LSVL 5FGCE 4FQIL 5CLTA 4LLMB 5LBSL 1EX0A 2GITB 3AB0C 1FH5L 3U36B 3BT2L 2VE6B 1MY7A 3OSKA 1PG7H 3T4AA 1P53A 2J7LA 4ZS6C 3JTTA 1S7QA 3GM8A 1T4KB 1AGDA 2UUDK 4FQLH 4L29A 1A6TA 1DQLH 1KGCE 3O3AA 3P3YA 2YN3A 4PRNA 4EEEA 2Q6WB 1WLHA 4NZDA 4X4ME 3ESVF 2PN5A 4PBXA 1YMHA 1UG9A 4LSSL 3ULVH 3GSNB 1UB6A 4LIQL 2XKSA 1JPGB 3NA9H 3IETB 4JZJB 4RGOL 2I27N 3G08B 3TESA 4YXLH 5I6XC 5EIVA 1CBVH 2AJSH 4O2FA 3T1FA 3EYOA 4XCEA 3QDGB 1EFXB 5I76B 5HYIA 4P57B 1BMGA 5BS0B 1PQZA 1WQVT 3RX5A 5F1OB 5KSAB 4U2YA 1CICB 3QI9A 1X5YA 5DWUH 5F8RC 4DVBB 3ARQA 1OCWH 3LSOB 4PRID 3ZE1F 4PJXF 1INEH 1F8TH 1A7QL 3P9MB 2YBRA 1XF1A 3EO9H 32C2B 5JOFB 1FZKA 2BX5A 1NGWB 2HJFB 4R9HA 1FLTX 3U9UB 3NPSC 5DEFA 1Q72L 5F1IA 3TT1H 3RZCD 4BKLB 1J1PL 3QNYB 4OCLC 3H9ZA 5JXEC 1I7ZA 1KB5H 2NZ9C 2Y5TB 4R7DA 4WHTB 2EKJA 3HMXA 4FQHA 1NGZA 1P4BL 3GIVA 4GAYB 2C1PB 1IARB 1P7HL 5GISL 3V0WH 3DMMD 3UJTL 1JPST 2H3NB 5IB1B 5DRZB 3T77B 1RVFL 2NZIA 4EUPB 4LLQB 3D2UA 3B43A 3OJ2C 3U6RA 5HPMA 2DJ4A 3MV9D 5DHVA 5HHOA 4WU7A 2KQMA 1NCCH 2NR6D 3STBA 4TNWK 3WS6C 4ZSOE 1IKFL 4U1MA 5F3HB 4JRXD 4Y5VA 2ICEA 4PJDA 3G6DH 5F7WC 5DD6B 2R0LL 3QFJD 4KQ3L 3RWJA 4UV7L 5IHUL 1A6VL 4JG1L 1M71B 4WO4B 3WN5A 2R2CA 4XCCL 3WKNA 2EYTA 3P0VH 1VACA 3NCMA 4N68A 3OBAA 3UTTE 1RZJH 3AS3A 1QR1B 3VDBA 4XP6L 1OSZB 2YWYA 4F7TA 2B4CH 1D5BB 3OKEB 4DZBB 1PX3A 4FTVE 1AXIB 1ZHKA 2RJMA 3HE6A 3PWLB 5E24E 3ARGD 1Z9OA 3STZB 3KLHC 4MDIB 2BC4B 5C07D 1RFDL 3L6FA 5IHZB 2P5EE 3UTQB 4P9MH 1FFOA 4X6EA 3CVHL 2VDKH 4JN1H 3IDIB 3EZ8A 5JHDD 5I1LA 3ZT6A 3SDXF 2BVOB 4X98A 1ZGLP 1ZLSH 4NM8L 3RNKB 3H9SA 1YPZE 3PWVA 1HHGB 4K9EL 5L9DH 3C6LB 4DK6A 1YYLH 2B2XL 3G5YB 2DYPA 3PDOA 4HV8A 1WICA 3C5JB 3E2HC 3S4SA 4NQDB 4L8BB 4ETQA 4N0UE 3GSOB 4PJAB 2Y25A 2BFVL 1WBXB 3TLRA 5ENWB 1I3GL 5F6IC 3VH8A 4GW5A 4O2CB 1Z3GL 3SKMB 2ADGB 3S97C 2JIXB 1FYHB 3QZWB 4XPBL 5E1AB 3IJHA 2Q86B 3CZJA 4LP4A 4IMKC 2GT9A 3CXDH 2LFGA 2WBJA 3PGDA 1J1XH 3L5JA 4KK5D 1IEHA 3ULUF 3TA3D 2QBWA 1JNNH 6CGTA 4XCNB 1N2RA 2ICES 5IOPB 3NIDF 5JO5A 5EBGA 2VDPH 5CIPH 4Q6IA 3TCXA 3MREA 2DWDB 4Y4HB 3WLWD 2A83A 1LO4H 4MJ5A 2ZKHH 3OKDA 3MV8A 4KKLD 3AGVA 2GK0B 3U4AA 4YAQA 5ISZD 5ELIA 3I6LE 5JQHC 1A7PH 1H15A 3IDNB 1N5AB 3CH8A 1KB5A 3BGFC 1QSEB 5EZLB 1KG0A 2UUDH 4HJJH 2ED9A 2ZUYA 4RZCA 1NJ9B 5L7XL 4PV9A 3PWPB 4YDJB 1LEGB 1W0VA 3JWDH 4WHYG 4J4PD 4TSBH 2UYLA 2ZUVA 4PRHE 2OI9C 3CCHB 2V9TA 4D9LH 2YD3A 1KBGH 2HVKB 1NCBH 4AG4L 1U8QB 4JRYE 4X8JA 4A6YB 1L7TL 5J6GA 1IGML 4NCDA 5FF6B 1B0RB 1DLHA 4QTIL 4LSRL 1LO5A 3U79A 3C2AH 2F54A 4O00A 3UZVB 2YHGA 5IEHB 1YY9D 3G5XB 1LO0H 3EYUH 4TVPD 1JGVL 3O4LA 4HULB 5IB3B 4WI6A 5HYSG 5C0CB 4BH8B 3VFRA 4P4RB 4HF5H 3IXTB 2FO4A 4KY1L 3QNZA 3V79C 4LLDB 4U3HA 4F58L 1WBZA 3NCCB 4BZYA 5HY9B 2HFEB 4G5ZL 1R24A 4YNYA 3RVTD 1CDIA 4LCIH 5FIEA 5C6TH 4K7PL 3F5WB 5HGHA 4KJYA 3L5HA 1JPSL 1MI5D 3KXFA 1WISA 3GK8H 5I19L 4MNQE 5SWSD 2VL4A 5L2JB 2YD2A 5FYJH 1T6VN 1A3LH 3BGAA 1WBYA 2WQ8A 4G6FB 5D1QA 1IAKB 1FG9C 3SGJA 5I0DA 1AO7B 5J6HB 4L8SC 1OAUL 3DHMA 4L5FH 1KT2A 4FQCL 4KTEL 3IB4A 3ARTA 3VFVA 2LTQC 4Q9RH 4MD5A 5ESAB 3EBAA 4YH6A 1DDHA 4JM4H 4O4YH 5CCKH 3THML 3MUHL 2QHRL 3BDYH 4J3SA 2ZOLA 3RUGE 2GUOA 3QIUB 4TPRL 3UYPA 4C83B 4AH2A 4YDKL 5DR5H 4ETYA 1INQB 1BQLL 3VRJA 1CFQB 2AJZB 1HQ4B 3WL9A 5A2FA 1TJGH 1MREH 2NXYB 3MROA 4LCCB 5M95B 3CSYB 1NLBH 2IH1B 5C09E 5I1EH 3DWTA 4KI5D 1CWVA 5KJRL 5CIPA 1S7UA 4LKCA 4PFEA 4P2OB 4BQ8A 5DQ9B 4LMQI 2BNQE 3N1PC 3A6CH 5FA4B 1PY9A 1MH5B 3IFOB 5C6WH 1G7IB 3TIDB 5KSVB 5CJXC 4P59H 4LVOC 3VXNB 1OL0A 2G75B 2VL5B 5HYJB 2VUOA 4PY7A 3MUJA 3OAUL 1ES0A 3G6AB 3IDYB 4M43L 4HQQL 4IOFD 1N6QH 2A0LD 1RZFL 4XPGH 1GGIL 4TYUA 4M5ZL 4M9OA 2QSCL 2FECL 1IE5A 3MRCA 3TO4D 3FRPA 1ETZB 2HFGL 1OARL 2FIRT 2P8PA 3HMXL 4GW1A 2F15A 4HCRA 5JHLH 4JQXA 2D2OA 2G2RA 2J6EH 1B4RA 2KQNA 1ZHLB 3RY6A 5B8CB 4JY5L 1H3XA 1IGYB 3REWA 5MI0C 4KAQL 2AJYH 3VXMB 2JCCB 1X7QA 2ZUWA 2VABB 4KZDL 2OP4L 5TE7H 5DJAA 2IADA 3S5LG 5B38B 2N56A 3QUYB 2Z93A 1MSPA 4P2QD 2R1XA 1W0WA 4LU5L 5IQ9A 1ZLVK 3HAEA 1PZUB 3G5VB 4X0KB 4PJEE 1MUJB 1NDMA 5IWLC 3TYGH 4U6VH 4P3DA 5HDBE 4MXQC 5KANI 2NY2C 3BJ91 1T80A 3QP3A 5E6YA 2PO6C 3H6JA 4HWZA 3VW3H 1Y18A 5CHNA 3H0TB 3R8QA 4L3EB 4WFHD 4APQC 2FJGA 2H2SD 2DOCA 4R4BA 2SEBA 3JXAA 2C9AA 4QHLB 1MAKA 1LO2L 5HVGB 4R4FL 3N9GL 5C0FB 5JLZA 4JANA 2X4OB 5H8DA 3UPAA 5C0BE 2PW1A 2XTJE 4IRSA 4JE4B 2GTWA 2OXGA 4D0DB 1E6JL 3ARVA 3QDHA 3NN8B 1EPFA 5HSFA 4EOWL 4QCIA 5GRYA 4ORGA 4O9HH 1DR9A 1N8ZA 4S10A 2Q20A 1M7IA 4FG6C 5SWZD 4ELMB 4CL7A 5I74C 1GJIA 5B39B 5I17A 1K4CB 1ZGLM 4QRUA 1BFOB 1PG7L 3UTPE 2EYSA 4NZTH 4K71C 4TSCH 4PJ7F 4WNQA 4OCWH 5D7LB 4HUVA 3B8YA 4P23B 2Q7YB 4FQLL 4NRXB 1DQLL 1I8KB 3OJVC 2VDOH 5CKAA 1CDHA 4F15B 4XAKD 2YSSA 2VLJD 1YN6A 1G9MH 1JMZA 3ULVL 1GL4B 3AFLA 3TVMD 2VITA