1HCFX

Crystal structure of trkb-d5 bound to neurotrophin-4/5
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
SHMAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity in Trk-Receptor:Neurotrophin Interaction: The Crystal Structure of Trkb-D5 in Complex with Neurotrophin-4/5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/hormone
molecule keywords NEUROTROPHIN-4
total genus 17
structure length 101
sequence length 101
chains with identical sequence Y
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2001-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hcfX00
2VSCA 3P4OB 3RKPA 3NFPB 4F3FB 1EO5A 2DLTA 3BQUD 4GW5B 2NY6B 4ORGB 4MA3B 1CDGA 2J1KA 2B8OT 3BKCL 4KKCC 3SKOA 2MJWA 1F3DJ 4NZJA 1NEUA 4E41A 4RAUA 4DQOH 1MREH 2ZPKL 5C9KA 3QUYA 1OAZH 3V5DB 1HEZA 4UOW1 2DI7A 2EIBA 1GXEA 2BSRA 4EOWH 3S36X 3LEVH 3RUGB 2B4CC 2D2OA 1SEBA 1MLCA 4C59B 4PRPA 1TETH 1LEKA 5I1EL 3GB7B 2VLMD 1WV7T 4PJCF 3P40A 5C0NC 1NFKA 5E9DD 4C58B 5BZDB 5D9SA 1CLYL 2YEZA 3ARDC 3I50L 4J3TA 3QDMA 3QNZA 5DQ9B 4JR9H 4JFZH 2NY6C 5T1LB 1D7FA 5DXWA 2AJYH 4KHTH 3ARFB 3QUMB 1D9KB 3T0VA 4LASH 2AI0H 4RNRB 1WISA 3EBAA 1B2WL 3QUYC 2XWJB 3PWPE 1TXKA 3MR9A 3BGMB 1N64H 4JQVC 1XIWA 4QT5B 5IVXE 2G5BA 2CUMA 2FJHB 2CLRA 3MRBB 3ARBA 3ARGA 4P59L 4U6VH 5F72S 5IBLC 4PJCA 5GGVL 1AE6H 1NJ9A 3P0GB 2ESVA 3C60C 4Y2DB 1E4WL 3S88H 3K1KC 1P84K 5HHQA 1MCOL 3D69B 3SJVB 3BN9D 4XWOD 3QUXD 5JZ7D 1FGVH 5IB3A 3O3AA 3B9DA 3O4LA 1RD6A 2HFFB 2A77H 3CK0L 5F7UA 5H8DA 5DI8A 2DJUA 5TFSL 3KPQB 4JRYB 3K2UL 1UWGL 1Q0YH 4LL9A 3MFGB 1BJ1J 5KVEH 3ZYJA 2AJZB 3QXVA 1G7HA 1V7ML 4TNWF 2XN9E 4KXZI 4OFIA 3FT2B 3L95B 5CBAA 3E1F1 5I18L 4GRWE 1XGRB 4NRXA 4F33A 1U8LA 2H45A 3OHXA 3VFSB 4KKLD 1X4YA 4AMKL 2Y9RT 3FFCA 3UPRA 5F3HA 4OKVB 4NQEA 4L3CB 3HI6L 4QGYA 3VD7A 1NUNB 5D2NC 3QHZH 3UTZB 4RA0C 4CVXA 2YWZA 4GW4A 3P77B 4JHZA 1YEGH 1BD2A 5L9DL 4Z76B 4XAKE 1FIEA 5ICYB 3CFKB 1NSNH 3TCLB 5GQBA 5J56B 1CFVH 2R2BB 3VA2C 4HIXL 1JPFA 5KVFL 4GLRH 1LP9A 2X4NB 3K80A 3OB0K 4L8DB 1UB5B 1DQLL 2AGJH 5E70A 3KPRD 1YEHH 3VG9C 2OTUB 3MACH 4IRZH 4ONHB 4EDXA 3ULUE 1N4XL 1RVFH 4RWYH 5EZOH 2V6HA 5FGSA 3QIBD 1NGQL 2CR6A 2R9HC 1NGYA 4P48A 2F54D 5D8JH 2X1OA 5DURD 2E9IA 1ZLUH 3QDJB 4U6HA 4WW2F 1MELA 4QHNB 1J1XL 1I1CA 1PG7W 4FQLL 1RK0A 4U1JA 3N1GC 4JCLA 3V0AC 1MCWM 2NW3B 3VW3H 3TO2B 4KKAD 1OLZA 3R0MA 3TO4D 1WK0A 3DVGB 2CDGA 2IH1B 1BGXL 1KNOB 1NANH 3MV01 1T21A 3AM8A 4PJ9D 4PRNB 5L7XH 4U7SA 3QEGL 2YZ1A 2X1PA 3QQNA 5F96L 4WV1A 3NCMA 3ZMRA 5JQ6H 6CGTA 3OKNB 4PJIA 5DUBA 5I0ZA 3OBAA 4O2FA 1QSFD 3WNMA 3SE4C 5D5MB 4JFEA 5C9JB 1G6RH 3LN9A 3ZL4H 1U8MA 1VFAA 3O6KH 2P45B 5J0BA 2PKDA 4TULH 4X6FA 2XT1B 1TFHA 1S9WB 3CMGA 4MWFA 2R8SL 4AIZB 4RIRB 4J3XA 3KR3H 3MUJA 4MXWL 4Q2ZB 4K2UL 2B5IB 3EDKA 4KTYA 2W65A 1WBXB 5D6CB 1Q94A 3OR7A 5F88B 4GW5A 3RIAK 4BQ6A 3C6LD 5JW5A 1UXWA 1B6DA 4YHKL 2E7CA 4RCAA 3TJEL 3IVKB 4BYHA 1V7NL 4E42A 4YDKH 1S8DB 5C09A 1VCAA 3QFJD 2DKMA 2EICA 5CBEA 4MLSA 3I75B 1FGNH 5LQBL 4MXVF 4NQCA 5KSAC 3RVVC 1Y0LB 4J3VA 1P6AB 5ILTL 3E8UH 2MCPL 4OZIE 4KDTA 3DMMB 3P30H 3EYQC 1AP2B 1G7PB 1AQDA 1MCWW 2C1PA 1II4E 5CGMA 1DCLA 5C0FB 1W0WB 1PZ5A 1W72L 1NGZA 2HT4D 2WANA 3NGBC 4FFVD 4HHAB 1A6WL 3QUXC 5JZ7C 2ZG3A 1KCRH 4ODXA 3N50A 1F3RB 4Y16A 12E8L 4AT6B 5C0JB 1VGKB 4QHUA 1MREL 2OQJB 1J05B 4KTEL 4X6DB 5DMGD 4JFPB 3LH2L 4MQXD 3BWAA 4X4MA 3MJ7B 4PY7B 4CKVX 1KTLB 2CKBB 3BH9A 4JGJA 4O00A 4Y4FA 1F4AA 3OJDA 4H26B 4BH7A 5HI3D 4JO1H 3O3EB 3LY6A 5C0CE 4BFIA 4AEFA 4JLRA 1CLCA 4OFYD 1OTTD 2FX7H 3OHXB 2XQYK 3Q5YA 3B9AA 4ZS6D 4CVUA 3IB4A 2AXGA 4Y5VC 2BNUA 1S9YB 4YIQA 1S7RB 1DLFL 3LKPA 5C0EA 4MJ5B 1S3KH 2YPKB 4NQDB 3X13B 4GMSH 1CGTA 1YECH 3S37L 3TIEB 2EDEA 2AQ2A 4QHKJ 5EO1B 3O4LB 5EU3B 1W0VB 3EFDL 2PW2B 3KXFD 4HUVB 4JPIA 3EJZD 1CGXA 2Q3ZA 3IDYC 2RCSH 1W72H 1OT1A 1YUHB 4Y88A 5D5MF 3SBWC 2YD7A 3UTSB 1QSED 3U9UB 5GXBB 3MA9H 4JRWA 1ND0B 2VNCA 3CU7A 4PBXA 2NY7H 2Z9TA 4KY1L 4K94H 2EDXA 2BK8A 3ARED 4NDMA 3V52L 2X9XA 1H5BB 3IFOB 4NQED 3KYOA 1XGPA 1G7MB 4L3EB 3H7BB 4POUB 1G7LB 3C6LB 1VHPA 2F53A 3O0RH 5ICYA 1SJEB 3L3GA 1M05A 1MRDL 4X80H 1WT5A 1X5KA 1P4BH 4OF6A 3MLPA 5F1SA 3PQYB 1DBJH 3NABL 4UT6L 3MREB 3VWJB 3QUYB 4JKWA 5CIPB 2VRAA 4FQJL 3SKJH 5T5FH 3RDTA 4PREA 4I0KA 1KLGA 3V6FB 5C2BL 4XPGH 4FQQB 4J3SA 4GKSB 1P69B 5F7YC 3BDBA 1I1YB 2R8SH 2HVKA 3QUYD 1K2DB 1C16A 1X6NA 4J7RA 4OZHF 3P11H 5EORH 1OB1B 4ONGL 2A83A 1N5YH 4WU7B 2YEZB 2N7BA 4XNYL 1OD7A 1ZHNB 1RHFA 5LAXB 2BSSA 4K23H 3MA9L 4G6ML 3O6FC 3RJDA 1JPTH 4P2CG 4N0FA 4WCYH 1I7RB 3QIBA 3SCMA 1NGQH 3LEXA 3LB6D 3IU4L 5KSAD 3HFMH 1P1ZA 1I7ZB 3PG2A 1DQDH 2MCPH 3RY6C 1RUML 5DJCB 3VXME 3V5HA 4CU6A 2R39A 1IEBB 4X6CB 4KHTL 1B0GA 3ULVE 4OCMC 5C09E 4QXGH 1Y6KR 4Y19E 1A7NH 1JF1A 2HT4C 4ZO8A 5KS9F 3UTSE 1WQVT 3FZUC 3O9WC 4KRPD 1XH3A 2WIIB 4GBXD 2Z31B 3QQ9D 1ZGLA 1WAAF 3NZ8A 3JWOL 1CFSA 2A6IB 4AH2B 1F00I 4K3GA 2XXMB 3F7YA 3QNYA 4KHXH 3G5VA 4F7EA 5I1CH 1KFAH 3ZL4L 2R9HD 4H1LG 1YY8B 3FQNA 4PGZA 4HUNB 1INQB 4CNIA 3KWWB 2H8PA 2Q76B 5CILH 5KOMC 5JXAH 3F62A 1WIUA 4V1DA 3BDYL 5KVEL 4U1SB 4PJDB 1OSZB 1OP9A 4LRIA 2R0ZL 4PGDB 1LE9B 3KJ6L 2EC8A 3LDBC 4JKPH 4MVBD 5HHOB 5EC1B 1TETL 4BK4A 5J11B 2HH0H 1MFDH 3EIFA 4XHQA 1M7IB 4QNPF 3OWEA 1T7WA 2XTJB 1E6OH 1OOAA 1C1EH 5IWLA 3BUYA 4PRDA 1X6LA 2FJHA 3V6OE 4CDGC 5CEZH 1U91A 3SJVD 2CKBA 3BH9B 4K7FB 4QTIL 1S5HB 2NY6D 2VLRD 4X5WA 2GK0B 1A02N 1CDIA 3OAUH 4NBZB 3HE7A 3BMWA 3IDNB 3MLRL 5E1AA 3TT1H 3DBXA 2FCBA 3SGKA 3WIIL 4Q74A 2IGFL 3LN4B 3LZFH 3DHJA 3ILQC 3QFJA 4DOHE 2MHAA 1MI5B 3IFNH 3C6LC 4UMGA 5JUEL 3UO1H 5FO8B 4IRZL 1EO8L 5BJTA 4PP1C 5EO9A 3VXMD 5EIIB 2F19H 1CICB 2P8MA 3UXFA 1E4WH 3S88L 4OZIF 4PRID 4FG6D 1FZJB 2VOTA 2XY1A 3UCRA 3VJ6B 3O2VH 1XGQA 4J1UB 4YDJA 3RVTD 1IGIL 4NUGH 3MRBA 3G6JF 3ARBC 1B4RA 3H3BC 1IAOA 1BIIB 3Q1SL 5I73B 3O6LH 5LWYH 4O2EA 1UM6L 1OWWA 2IADA 1EXUB 1HH9A 1WUNT 1ETZA 1JPSL 1LO2L 3MRDB 2BFVL 1I1FA 1A2YB 3GZKA 4Q9BA 1MH5B 4XNXH 2EKJA 5J1AA 1DBAL 1NMBH 1QVOB 3HR5A 3O2DA 4MJ6B 4M6OH 3NFNA 1JZ6A 3QUKB 5TPWH 2FYYB 5J9PB 2EXYD 5I71C 1JGUL 3P4MB 4PV9A 2ADGA 1QLEL 3P2TA 3RVVD 4WU7A 4HK3J 1DE4B 1A21A 3LQAC 4PJGF 4KJYB 4U1GC 2YC1B 4MJIB 3D0VB 1KYOK 2AXFB 1PSKL 3TYFB 3IDJA 1HIMH 2HFGL 1RZFH 3TT1L 3W39A 4HAFA 1TVDA 2GJZB 1LE5A 3QIUB 3KPRE 4NZRL 5BS0D 5HDQH 3L3KB 2BJMH 4HUMB 4KDVA 5AWNL 3AROA 2OL3B 3ARGC 2VLRE 3EZ8A 2BRQA 2R23A 4XAWH 1WZMA 2E9WA 3T4YB 3WLBA 3OKEB 3JSSA 3DMMA 1V7NH 1DEDA 4PLNC 1FG9C 3TYGH 2NY5L 3GBML 4XMLL 3CFDB 1RURH 2XWJA 3HB3D 4LEOB 4TSBL 4PJ8A 1LP9E 2FJGB 5LXGH 3KHOA 4UT6H 3PQYD 1T3FA 1ZVYA 3L7EB 4KHXL 4LMQI 1A6WH 1FLRH 3O11B 1ORSB 4R8WH 3QEGH 3BZEA 1U8OA 5JDJA 4PGEA 5JQ6L 4RX4A 5GGSY 2GEEA 1MLBB 4ISVB 2BY1A 4M61B 4UOW0 4Z7VA 1KG0B 1IQWH 4OGYH 3AM8C 4WDIA 4HWUA 3QQ3A 4FXLA 4OTXL 5ICXA 5AD0A 4CJ0A 1KULA 3F6LA 1Z5LB 4G9FA 5IOPB 3OKNA 4PJIB 2JIXD 3M8OL 3V9FA 4P3DB 1C1EL 4I0PC 5EBMA 4BSWA 3ES6B 2BX5A 4PLKC 3PE9A 4TSCH 1ZVSA 4I77H 2V9RA 4GRWF 3RL1B 1DQDL 2XA8H 1AIFB 1R3IH 1ZT4A 4M62L 4FQHA 4APQA 5CP3A 1YEFH 3UYPA 2WINA 1F58L 3KDMA 4PV8B 2VQTA 3HAEH 3N1PC 4QYOA 3T8XB 3ULVL 1Z3GL 3H42H 1QBMH 3KPTA 2NY5C 2JB5L 1NH6A 2KZWA 5KAQF 3U4EA 5KZCD 3UTSA 1E6JH 2VLJB 3WHXB 4RSVA 4HWBL 5DYOA 2IAMC 4B7LA 5J6GB 5IW3A 3LZFL 3VDAA 5ANMA 3TT3L 5I76B 5DT1H 1EEZB 1CICC 2QQKL 4OCRL 1MQKL 3HB3C 5ID1B 4ZS7L 3EYSH 4Z8FH 1FL5A 4IDJH 3GIZL 1TCMA 4F2MA 5AZEH 3H2WA 3O9WA 5JPNB 3T2NH 1P4IH 5SWZE 1BOGA 4NQVB 1AHWA 2NY7L 3SGJA 3U30B 2HG5A 5EB9A 5FOJA 4LCCB 2EEDA 2D0FA 1E28A 1KTDA 4RQQA 2LVEA 2AXGB 4NQDD 4UINL 2EDRA 4JDTL 5IW1A 1YYLL 1AI1H 5EBLB 4G42A 4Z9KB 1UCTA 4WTZA 1CLOH 4KRNA 2B2XH 3UPCA 2XOTA 3RP1A 2H2PD 2AVGA 4JG1H 4ODSL 4OM0L 3PNWA 1MRCL 3VFVB 2Y1VA 1MFDL 3FZUD 3A6BH 1U8QA 4FQIH 5L2JB 2LQRA 4M4RA 3UPAA 1OARL 3CVHB 3FJTA 3KG5A 1U6AL 4PUBH 4POZC 4K3JH 2PW1B 4PP2B 1JGUH 5E4EB 2XKSA 3OKMB 2H41A 4FQJH 3SKJL 4WU5B 3MGOB 4LGPB 2XPGB 3SY0B 2Q86A 5CKGA 1E4JA 1FDLH 4UQ3B 2ICEB 2BSSB 2Y06L 4YPJA 3T0AA 4OBRA 5EC2B 5GGTL 1H15B 4J3OC 3QIUA 4P2RA 5ETUA 1D5BA 5B4MC 5D72L 4P46B 1YNTA 2YD9A 4XXCA 1PZUB 5C71A 4GS7B 5IW6B 3GIZH 4PRPD 3RKDD 1HNGA 2XICA 3C8DA 1HHKA 4QNPE 4YHIB 4Y8DC 1EFQA 1ORQA 4NOFA 3O45B 2Q8BH 4DUXA 3WE6B 4D8PA 2VXVL 4QRPA 5L0QB 3EO9L 5HD8D 3AAZB 4YBLC 3MRJA 3K8MA 5EPMB 4DUVA 3K2UH 5I19L 4IOFD 5GSVB 1LD9A 3DECA 1H0DB 2IG2H 1XH3B 2WIIA 3TZVC 5K9JH 4PS4L 3FO0H 1QBAA 4G8GE 4P5TD 4EN3A 1VPOL 5CGYD 4PJFF 2JE8A 5F8RC 3QIUC 5JW4M 3TO4B 1AKJB 1LE5B 4JRXD 4I5BB 1QR4A 3QUZC 5CEZE 3KS0H 3VXUA 2FATL 4ODWA 1JGEB 5C1MB 4R26L 4AG4H 4G7VL 1BF2A 2H32A 5DHYA 1GGCL 1MLCB 4LVOB 4OGYL 4XP4L 1ZEAH 1GZPB 4Y7MA 1OSZA 3A6CL 5GGTH 5EU4B 2GITB 3U0PA 3CFBA 1M7IA 2JELH 3RI5F 5D1ZD 5JXAL 1IAII 1ZANL 1YEHL 3OAYH 1AR2A 3CSYB 2BXYA 4O58L 1OAQL 1Z3GH 3EFFB 3DVNA 5IBUB 4K9EL 4K7FA 5EFIA 2AABL 2JB5H 2XV6B 2OTWA 4D9LH 2VAAA 2NY5H 1HKFA 4HPYL 5C07B 4O2FB 1D6EB 1JTOA 3GSXA 4U33A 3PDOA 2HVJB 1N6QL 1NLDH 1JNNL 4QTIH 1OHQA 3QZWA 4J12A 4ZODA 3QJFA 4N0RA 1L4IA 1R5WB 4P4RA 2BNQB 3SQBA 3FQRB 4P9ML 5T3ZL 3DX8A 1P7QD 4QXGL 5GRWA 4CBPA 1BVLA 5ISZA 1R0AL 3NH7H 4OD3H 3QHFH 4APQC 5MERA 5HGHA 3KWWA 1KJ2H 2DWDA 2UWEA 3K3QA 1Q94B 4Y5XA 4W6XB 1R3KA 4UB0L 4IMLA 4EI5D 3TBWA 4QHMB 1ZSDB 4LVHB 3L6FB 2R4RH 4Z7WF 3ARVA 2CRZA 3IFOA 3VI3F 4QOKB 5FB8B 5CBAB 4Y4HB 2NLJB 1OAZL 1HZHH 1TMCB 4HH8A 1IARB 5DJ8A 2YZ8A 1NEZA 3M17A 4O58H 3BPNC 5MEQA 3MRCA 1MY7A 4I2XE 3BXNB 1HXMA 1X5FA 3B9EA 1R3IL 4PJEA 3O8XD 4FP8H 4LNVA 5F6HI 1BP3B 4KI5E 4XP1L 4CNIB 4ZFOL 2Y06H 3VFTA 1PFCA 1N6UA 1CDUA 1ZAGA 3EZJB 1O7VA 3KPPA 4JFZL 2GJZA 3JVGC 2ED8A 2R56L 2VLJD 3SGDI 4JM2D 1WEJH 4G42B 2AJXH 1ZV5A 2WP3O 1KJMA 4NHCL 2R1XB 4LKCA 5JHDE 3VFVA 4YHIA 2C3GA 3W9EB 1MJJB 3P9LB 4KK6D 3UTPD 3TFKD 2YRZA 4L4VD 4OUUA 3GEWB 1V3LA 2BNRB 2DQDL 4OFKA 2HRPH 5JHDA 3VXPB 4XNZB 5I19H 1EEYB 3BP6A 4NKIL 3PQYA 2FX9H 2P24A 4U1NA 2JB6A 4NN7B 3F58H 4X6BB 1R3LA 4U1KA 3QULA 4CU7A 3JTTA 4OGXH 4OUOA 1YYLH 1HYSC 2J88L 1ULVA 4LEOA 2X41A 5LVEA 1A3LL 5EO1A 1NL0H 5ELIA 5DRXA 2WIMA 3BSZL 1FLTX 3C8HA 3FRUB 1AHWC 3SGJC 4HSQA 3OB8A 3GSUB 1GGBH 1HXYA 1WFUA 3WXVL 4IIQA 4KMTH 1JHTB 1EGJA 3T65B 4KV5E 4PJEE 1LO3H 2NY4D 2RFXA 3VFPA 2ARJQ 3BX7C 1CICA 1NLBL 2P8MB 5IIEB 1KPRB 3WYRA 5GGRB 3PWNB 1CFSB 5IM7A 3O45A 1K4CB 5E94A 2FX8L 5B21A 2YXMA 4X5LA 5DD1H 3AAZA 4XVSL 4F7PA 4FQXB 1OW0A 4KU1A 2R0WL 4DK3A 1HCVA 4BFBD 2F8OA 4YDIL 2H1PH 2FGWL 4PRHD 1QLEH 5D2LA 1J0HA 3GJFH 3FN9A 5JW5B 1NAMH 43CAA 2R29L 2XXCB 2P5ED 4RWHA 3KPRB 4JM2A 5ALCL 5DWUL 4Q6IC 1MH5A 4MDJA 5J1AB 5E5UB 4KI5F 2MQCA 4K94L 3UX9B 1JF5A 5CAYB 3VXRD 2JKXA 2CIIA 1DVFB 1J0IA 4JREC 1JZ8A 4MJ2A 2HVJA 3LS4L 1IGCL 1OAKL 3LHPL 5KN5A 1ZTXH 4G3YH 5K9KB 1RY7B 1ERNA 5EU7E 3DGGA 1DEEA 2VR5A 1D9KA 2DN7A 5IVXB 4DGYL 2CK0H 4L4TA 4F2MB 3HS0A 5D7LE 4XPTL 1NBYA 3CH1A 4F8QA 3CFCH 1SMOA 3QJHB 3S5LG 2GUOB 4G7YH 3UTOA 4LCCA 5TE4H 1I3RA 1J11A 4QKXB 1ZLSL 3DVNB 5JHLH 4WV1C 5AD0B 2A9NL 1W2KT 3WL9A 2F54A 1BZ9B 1TTUA 5EBLA 2YKLL 1M7XA 5DRZB 4ODUA 5C8JB 5T1DL 1DUZA 2XA3A 4WW2A 5GPRA 4X9HA 3BDXA 4XPFH 4DN3L 1QEWA 4IOFC 4PRAA 2ZUQB 3DSFH 2KBGA 3BVNA 1YNKL 4I48A 5DI8B 3MOAL 1RJCA 2HYMA 2ZSWA 3A67L 4LSVH 3UTQB 1JYXA 5CGYC 1ORSA 1XR8A 1KTRL 3W2DH 3MO1B 3DTXB 2NZIA 4TPRH 1TVHA 1OARH 4DKFL 2E9BA 4GAYB 4IMLB 5DK0A 4NQDE 4K3JL 4QHLB 4D9QE 2OS7A 3BW9B 25C8H 4LVHC 4QY8B 4DFHA 2Z35B 3U2SB 4RDQG 5GS1A 1FZOB 4H5SB 1AFVL 2DQGH 5AUMA 3ARTA 4G9FB 4QHKI 5IOPA 5IF0B 2V17L 4GKOA 5C0BA 1A6VH 1U8KA 5HJ3B 1D5MB 2P5WA 1HHIA 2HJKB 5FYKH 1RIUL 3CUPB 1ACYL 3UAJD 3HCVB 1A7OL 5D72H 3KPOA 1CD1B 2I27N 3RWCA 4KTDL 1I4FB 4P23D 2VLKB 1E4XL 3UBXB 1HYSD 5I1CL 4OCRH 1OGTA 4OCWL 4WWKD 3REWB 2BHZA 5T1DH 2EXWD 3J8F7 3PHOA 5FA3B 3U48A 4HV8B 4XPFL 4DN3H 2ITCA 1AO7B 4X4XB 2NX5D 4GOSA 4WI2A 2VUOA 1HXYB 2JCCE 1HZHL 1MHCA 4U1IB 3HI5H 1XT5A 2EDJA 3MRPB 3KLSA 5EU6E 4QF1B 1LILA 1QACA 2RFXB 1PLGL 4DOHB 3FN3A 4K3DL 4M7LH 2VR4A 5TGBA 4LSSH 3S5LB 4FP8L 4I18C 4QTHA 3LDBB 4NBYB 2NNAB 1MRCH 1W72A 1MOEA 4LU5L 5IP4A 4KXZH 4D9QD 1GZQA 3L1OL 3W9DB 4LSUH 4LLMB 3ZTNL 3TPUA 1T1WA 2SEBB 1JYNA 1DQQB 3HUJA 3EO1B 3O3BB 1KGCD 3QULB 2CJUH 2DLEA 3GHEH 4IBLT 1KIQA 2AJXL 1G7JB 4LPUA 1XGQB 2M1KA 3LEYH 1UKTA 4PJGB 5D4QA 2WUBH 3WIIH 5D1ZA 5F1KC 4WHTA 4YLQT 4FTVA 4AEHH 1FL3A 4LAJH 1HH9B 5AYQA 4PYGA 3O4OC 4M7JH 3RRQA 4L3AA 5IT2H 1G0YR 1KPRA 2EH8H 4XH2A 1L9NA 4KRPB 3QIWB 1OAQH 3LHPH 1OAKH 3OR7B 2DLHA 4LIQE 1SEBB 5KSBB 2BHYA 1CIDA 2HFEB 1EO7A 1LO4L 1NC4A 4OLZL 4DGVH 1FNEA 4OV6F 2VXVH 3PIQB 3TPKA 2HTLC 4I3SL 3BD3A 4W4OC 3DV6B 5E24E 5KVGH 2B7DT 3PGCA 3RGVB 1RV6X 1QSZA 4OGZA 3HMXH 2VDKL 2G9HA 3CFJA 4LPCA 4X8JB 4I2XA 4F57L 4Q6IB 4WHYH 4I9WE 3KXFE 4QHMA 5TDOB 3RIAF 1AGCA 1ED3B 1P4BL 3CIQA 1IKFH 1IJ9A 4L8SC 1ZT1A 2J8UF 5I2IA 2IF7A 2WWKT 5D2NA 1F90H 1MCNA 1SY6L 5BOZG 2EDLA 4JQIL 1BHGA 5FYKD 3IXAA 1FFOA 4YR6A 4B50A 3CXHK 1LO0H 3QDMD 3WEXA 3P73A 1TENA 4FTVD 4HKBA 1FNHA 1IBGH 5DC9B 1S7SA 1EK3A 1FBIL 3M1BA 5CD5C 3D85B 1TVHB 4AEHL 3ME0A 4LIQL 3T0EE 4XGZB 1UH2A 1NBYB 4ZO6A 4XNYH 4JB9H 5JMRA 2BSTB 1AGFB 1LHZA 1R5IA 4PRIB 1QRND 4LVNC 2O5YL 4WO4C 3RA7H 3TN0D 3MODH 1H3WM 1XGTB 2BCKB 2AS5M 4QRUA 3B83A 2WZPD 2CKBH 4RMSA 3V6BR 2RHEA 1U8JB 5KSAB 3VXOB 2EO9A 5FDWA 2NW2B 3CLEH 4X0KB 4XZUB 3O3DA 1BECA 1TPXC 5JHDB 4U1HA 3S6CA 3V0VA 1JNHB 2EDFA 3QXTA 4ZNEA 1G6RA 5ANME 2AK1L 3C08L 3FFCE 1DLHB 1ZHKB 2HKHH 5IEKA 1RHHB 1ND0A 1Y6NR 4LRNL 1CFNA 4XNQA 3VWKA 3TM6A 5GGSB 1KEGH 4YPGA 3AU1A 1MAKA 5DZOA 1VEOA 5FYJD 1YEKH 3F65A 3VXSB 5F9OL 5HHVL 4OZHE 3T65A 2R69H 2NTSP 2QKIB 4LF3A 2OR8A 1T20A 3MGTB 5GGRA 2NY0B 1JGDA 4AK1A 3UC0H 4QRSB 2NY1D 4J2XA 4MJ6A 1R5VB 2KQNA 5FUZH 2EDOA 2CIKB 4DZBB 5D7IF 4OLXH 1RK0B 4P57A 4L9LA 5HPMA 5JW4N 1DE4A 4FZEL 4C55A 2ZUWA 4NC0B 4XBEH 4C83A 2WWMD 4EI6B 5AAMA 5L88H 2H6PA 5SWZD 1LNUB 2CH8A 3QPQD 5DC4B 1I1AC 4F9PC 1GZPA 4XVSH 1DANU 1CF8L 3D3VB 3V4PH 3ZO0A 1PG7L 1CYGA 3DUUB 1A1NB 4RGMC 5IB2A 4X6BA 5D6DA 3IDYB 5SV4A 2R56H 1RK1A 5DD3H 3TO4C 1FVCB 2XWBA 4LCIL 4Y1AB 4EN3D 4NO0A 4PJ9C 1MFEL 3MNWA 4N5UA 1ZHNA 4NO5B 2BNRE 5LAXA 3T4YA 4U6TA 1P4IL 1MUJB 5A43C 1NCWH 3BRDA 3LQZB 4MNQD 5KVMC 3U0WL 1O0VA 3DIFB 2CR3A 3OKOB 4NO2A 3NPSC 3TO4A 5C0IA 1UACL 5IV2A 5BZDA 5JTWA 3ZSSA 4BUGA 4MCZB 2XPGA 4JDTH 4LARH 2FLBT 2FBJH 4NM4L 5IJVB 3ZDYF 1XF2A 4JO2H 4UUJB 1PKOA 5DVMA 2DMCA 1JYWA 1CFQA 3TVMD 5M7QA 2WUCL 3G5YA 5KBNC 5GHWL 4FFYL 2VLLA 3QT2A 3VFOB 3GI9H 5DK2B 3AMKA 2QL1A 2RQ8A 1ED3A 1U6AH 3QWRA 3WUWG 3RVXC 3PWUA 1KCSH 3F6IA 1UENA 3FONB 3GMQA 5E9DB 4HDIB 4BM7A 1NEZG 4UU9A 4K3EH 4DCQB 5INCA 1QFUL 1QSEE 3ARGB 1WZ1L 1MEXL 1JWUB 1QQDA 2J6EL 4OZ4A 4XNXL 3JBG7 4FNLH 3PGFH 2R15A 1MHPL 4N1HB 3M1BB 2CIIB 1WCBA 1MSPA 2AXJA 3DTXA 1ITCA 2N7AA 1GOGA 3SGEI 1VGKA 5B8CC 1XAUA 1OF2B 2ADIB 4X6DA 3UAJC 2M8XA 5BO1H 4WWID 4YXLL 3SBWA 1YDPB 4G6FD 5DHVA 2DMBA 1NCWL 3RNQB 3WLWC 3DYMA 5GIRA 3U0WH 5DK3A 1IM3A 2MPAH 4JFYB 5HVGB 5JMOC 4JAMB 1Q9LB 3U1SL 3OKDA 4P0DA 3H3KA 1REIA 1M71A 3QO1B 1SEQL 3L3IA 2BJML 5DSCA 4EEEA 1ZGLP 4NJ9L 1WZKA 3MRQA 5HGDA 2Y07L 3VXMA 3TBWB 3KPNB 1QR1A 5I1LA 4RGNE 1WFOA 5GS2H 1ZTXL 3OGCA 4G3YL 3TYGL 4XMLH 1Q9WB 1SBSH 3O9WB 3TIEA 4GSDL 4X6DF 3TLRA 3MLSH 4W4NA 4PRAB 5MI0C 2GJ6D 2RJMA 1FG2B 1A7OH 1QP1A 5HY9A 3H6JA 3WXWL 5H35B 2AK4E 2P8LA 1EEYA 3BP6B 4WFEE 3CMOH 4FZ8H 2PXYC 4XHJC 4U6YA 3OQ3B 1LEGB 4J3UA 3ULUD 4PJ7E 5FGRA 4MA7H 4X9GA 3SQOL 1D6EA 4BFIB 5T3XH 2DM2A 4I3GA 3EJZC 2IPUK 1FFQA 5IJKC 3RWFB 2Q8AH 2N1KA 1FBIH 5E8NB 3I6KA 1ZT7A 5I75B 1E4XI 3G04B 5FGBC 4K94C 5LG1A 4HUUB 1PLGH 3STBA 1JZ4A 4QHNA 4WJ5B 3MRIA 2WBJC 5LKNA 4OQTH 4KJPC 2P48B 2VITA 2FD6L 3FB6A 4JY6A 5ENWB 2FJFA 2XZCH 3VFSA 4HAGA 4EI6A 1SEQH 2Y7QB 4LDLB 4RX4D 2OCFD 2VDQL 3V8OA 1MHHA 1XZ0B 4WWKB 4M62H 1U36A 1FZMB 3KJ4C 2DOCA 4PJ9B 3SKUD 4PJHB 4Z7VF 2W9DH 2X7LB 1JN6A 2K1MA 2AJYL 5FK9A 2XN9D 4NT6A 5I1JH 1RK1B 3KPSE 1J8HB 1T22B 1P7HL 2AV7B 1TJGL 4HLJA 2WQ8A 4JFEB 5C9JA 2OYPA 1MIMH 5IFHL 1S7XB 3HMWH 3SKOB 3ZHLA 3EOTL 3SDCC 4G80B 3IJYA 4NFDA 5HYFA 4M5YL 2EH8L 3I6LE 3QR2A 4UAOC 3KYOB 1CE6B 1CU4L 4ZTOL 1RZIB 2YUZA 3STLA 2DDQH 3VGAB 3AREA 4NNXA 3T1FA 4A6YB 4M7ZB 3ARYA 1P2CB 5T3ZE 2OMNA 2Q7YB 4PY8I 5DS8A 1LWRA 1NFDF 1QFPA 4FFZL 1KPVA 3HI5L 2NY0D 5KOVC 4I9WD 4LPXA 1HHJB 1T7XA 4YEEA 3R4DA 5D2LB 3MUY1 1VFBA 3EGSB 3IETB 4IS6A 4G6AD 35C8L 4Y4KD 3NAAL 2GFBB 2OL3H 3O41A 5ICZA 1VENA 3F7VA 1RAMA 2P24B 4U1NB 5I1HH 3QXWA 1AD9A 3WUZA 3VWKC 4PB9L 2AJVH 1OAYL 2PO6C 3HI6H 1HHGA 4ZG1A 3KLDA 2I9TA 5GRZA 2KL6A 4QHUB 4XGZA 4KZDH 5E2TL 4ETYA 3PJSA 1FDLL 2IH3B 4CW1B 1UEYA 4HMEA 1NGYB 3B5TA 3RNQA 3W9DA 1DBBL 3UTSD 5FKAA 3U1SH 3CH8A 4HIXH 5HHQB 3U6RB 4CADA 2VKWA 1RSFA 4ZAKA 4KWUA 4MD5A 1KJVA 2ZG2A 3FONA 3GMQB 3MBXL 5JIKA 4EI5B 3SDAC 5DEFA 1S7UB 4BQ8A 4UIKH 4ETQA 4LPVA 3NPZB 4TVPH 4GH7B 1R3JB 5ID0A 3QEUA 1L9MA 2I9LB 4PLOB 1HINL 1EPFA 3U9PH 4DW2L 4Z7VE 4XB7A 4NO3A 4L5FH 1NCAH 1UZ6F 5EBWB 3E3QE 3V4VL 2APWA 1DBKL 4LCWA 4PJ5D 4MNQB 3RVWD 4D0DB 5LGKA 2OZ4H 4M8QA 5EU6B 3WXWH 4IRSA 1XCQA 4PRHE 4PS4H 1FFOB 3RX8A 3RIFK 5F3HB 2DD8H 5DC0A 3W81A 4L9DA 3WNPA 2N4IA 4XMKH 1F02I 4RFOL 5IHBA 1YMHA 4AENA 2HKHL 4X98A 3IDNA 1CL7I 5E1AB 2CLVA 4P23A 1YPZF 4EUPB 2QEJA 1LDSA 4ZFOB 2HG5B 4XI5C 3SDDC 3JZ7A 3REVB 4XX1G 1T7VA 4JRYA 4L8DA 1OD9A 1W8OA 2F53E 1WC7A 3VRJB 4PJEB 3LKOB 3A6CH 4PJFA 1H5BA 3Q5OA 1T2QH 2F5AL 4LCYB 1D6VH 3CX5K 3EYUL 2B39A 1KN2H 5JO5A 4XZUA 4LLVA 4TQEL 4Z0BL 4HWZB 4NN6B 3VXTB 1EFXA 3G5ZA 4OKVA 3FQWA 2HT3D 3L3JB 4Y16D 3CC5B 1OPGH 4PJIF 4Q0XH 2SEBA 3TGXA 3VH8B 5IMOB 3B9KC 4JKLA 5DA0B 4U6YB 3H9SD 2Y5EA 4XCFL 3P77A 4RMRA 1J8HA 1U92B 1S7SB 3BQUC 3LPFA 5FOBB 3S4SB 2NQCA 5FA3A 1C08B 4LDEB 4DGIL 1YEDB 3ILPB 4G6KH 5E8PB 4HUVA 4P5KA 2ZUYA 1UCBL 2VXTH 1FQ9C 1G6VK 2JCCF 4HMCA 3HNTH 5F9JA 4OBSA 4KK8C 5C0IB 4NQXB 4F15B 1BEYL 3IDGA 1FHGA 3MRIB 3LRSB 1HILB 4G9DA 4OD3L 4NZUL 3HRZA 1LDPL 5IK3B 3UBXG 1FZJA 3RL2A 2JJTC 3PHQA 1A7QH 3ZSTA 3GSUA 1JCKA 4Z78B 4QRPB 1YNKH 3SGDH 3V0VB 3ECBB 4LARL 3DYOA 1RZKH 1T1ZA 1DQQA 3HUJB 1EHNA 1QPPA 4ZOBA 5E5MB 1WSST 4XI5D 2OL3A 3H7BA 3BWUC 5KW9L 3NIGE 1CDYA 4R96A 5DJCA 2UZIL 3TVMA 2W65B 1XMWA 4DKEH 1HHIB 4TOYH 3IRZA 5BCAA 4JPIB 4DCQA 2HT2D 1QYGL 4W68A 5DJDB 2X4PB 3MNVB 1HH6A 3G9VA 2ARWA 1F4WL 1ADQL 3C87A 2K7QA 1EJOL 2NY3D 3QCTL 2H9GB 5FM8A 4LK4A 2YK1L 3FT4A 3SDYL 4S1SL 1EFXD 4XP1H 4E5XB 5EU5A 1DFBL 2HT3C 5KSBA 1M7DB 2EZ0C 3FKUS 4G6KL 1B6UA 5L88L 1CI5A 5DRWB 1R5VA 2UUDK 1KACB 3D2UB 3RWHB 2HWZH 4HCRH 3NN8B 1BBDH 3ZE0E 3IU3A 4D2NA 1WAAE 1SJHA 4NZUH 4KKCD 2H6PB 1A1MA 1RZ8A 3BWAB 3QRGH 1KG0A 43C9B 1CBVH 1ZOXA 4O51B 4XHJD 4YWGL 1YN7B 4OFPA 4TUKH 5JLZB 2HRPL 1IT9L 1DANT 1AGDB 4WHCA 3R06A 4L8BA 4XCNB 3O6FB 4XP9H 4MQXC 5KSAA 1GPOL 2OZ4L 5IB1A 4Z7WE 5DQ9A 3BGAA 4R2GB 2Y07H 3CSGA 4RFEA 3GUTB 4P2QB 4S10A 1BBJB 2XY2A 1AXSA 5KANI 1L7TH 3ULUL 3MLZL 5DQDH 1OTUD 3SGKC 2C4XA 1FORH 2G75A 2BVOB 1FE8L 1IE5A 2FWOA 3KXFA 3RBSA 1LO3L 1PY9A 2QTEA 1ZA3A 2C3HA 1RJYA 2X89A 1AO7E 3BVNB 3MNZA 4MB4A 3K46A 1QLFA 3TNMA 3NCEB 1C5BL 1FNEB 3UTTE 1GYAA 2ESVB 4Y2DA 5ICXB 1FFPB 2OI9B 3MZTA 3OJMB 3FQNB 5ALBL 5T3XL 3FO1A 3OKDB 5CUSH 1DTUA 2ARJB 2J6EH 3D6GA 1SBBA 5GS0C 5MEPA 1GGTA 1CICD 5CEYA 4Z7NF 3UTPE 4CMMB 4OZGA 5D93C 2XN9A 2OXHA 3VGAC 1XCQB 4MMXC 4Y16C 4BSVA 5J4MA 2ZKHL 1NAML 2BVUA 5IHUH 4NDMB 1UVQB 2VXUL 3MRCB 3AS2A 3IGAA 3NTCH 2Y6SD 4PRHB 1FAKT 3QG7L 5JXEA 4IJ3B 4KKAC 4WCYL 1BQSA 4HJGA 1MJ8H 3H3PL 4O4YL 2BNQD 4M6MH 4P2QE 4PD4K 3KHQA 4XVJH 3QUXA 4N9OB 5DFVD 4RGNB 2GTWA 4XNZC 2DTSA 4JE4B 2IC2A 3GSQA 3KPSA 3FTGA 5ID1A 2RBLA 1I7TB 4GW4B 4K9EC 3MJ9A 4PJ7F 3VH8G 4HFUL 3IDXL 3C5ZA 1NUFA 5CZKA 3AFLA 1FORL 2E6PA 4NN6C 3MLUL 1FNLA 4QRSA 2XKNB 1E27B 5I1LB 5MENE 1CE1H 1N59B 4QRQB 2OTUA 4ONHA 15C8L 4UV7L 4EDWL 1KELL 5KVDH 1BZQK 1Z9SA 3FB5B 3EYVB 5CUSL 5EZJB 3TF7C 4JZJB 4DTGL 3FB6B 4JY6B 5ENWA 5B38G 1J18A 4EJ1C 3L3GB 5F21B 4G8GA 4LLMA 1F6AA 1HH6B 1T1WB 4P2OD 4WVRA 3HNVH 3H9ZA 2VXUH 1G6RB 2FSEA 3SY0A 4X5XB 4O5LH 3FOMB 4XB8A 3D18B 2B1HL 2BC4B 5KTEH 4R0LC 4FFVC 1BQHA 4Q9QH 3VXRA 1NCCL 4P4KD 4P2RB 4PB9H 4NQSA 1MFAL 2DWEB 4JFDB 2O5ZH 2QBWA 5FYLH 3MCKA 1OB1A 5DUPL 1P7KA 3Q0HA 3D1MC 5F3BB 2W9DL 1JV5A 4HGMA 5CJOH 4XH2B 5DFVC 6FABL 2OLDA 1J5OL 3W0WD 1DBBH 4B41A 4XPAL 3LKRB 4YWGH 3A6OA 3CDGA 5ACLA 1EUUA 4Y19D 2F54E 4WY7H 4CU8A 1E4KC 3VCLA 3TEUA 1U3HB 4PD4J 4HUXA 4X4ME 3MX0A 2IGFH 1I1RA 4L8BB 1JN6B 2J12B 1RIHL 1MFCL 1G0DA 3VGHA 3B8SA 3D5OF 3VFWB 3ZYIA 3QCUL 3UTTA 1WT5C 3C2AH 2PETA 3I02B 5IROC 1PVHA 2UZIH 1BVKB 5HYSA 1FN4A 3QRFM 1S8DA 5ECJE 3SKNA 3JTSA 3PL6C 1SM3L 1RJZB 3U4EB 1A7PL 1WIPA 4X98B 3CJJA 2NY0C 4YE4L 1N6VA 2JIXB 2NY1C 4HS8L 4HIIB 1OGAE 4G8FA 1JGLH 2MCG1 3VRJA 4D9RD 4NRZA 5LCVL 1T5WA 3LKOA 1YMMA 4OZIA 2QSQA 5GS0H 3SEPA 2Q76A 2OQJA 5ABDE 1QEWB 2LTQB 3VA6A 4WEBH 2CLRB 5HGDB 1N0XH 4KAQL 5I66A 2ORBH 2ZCHH 5MI0B 1KGCE 1T0NB 3GMPA 1DL7H 1IM9B 1YNLL 1C12B 1KT2A 5E6YA 1ZLWK 3BYYA 4KQ4H 4HZAA 3WKML 2FWOB 3KXFB 2I9TB 4JREB 3HUJF 4LCWB 5DMGC 4M8QB 5HHXL 4AM0A 3HN3A 4O2CB 4QRRD 1TQCC 4PTUB 4Q7DA 5ADPH 2JTDA 2XYCA 3KPQA 4F37F 4HZLA 1T1YB 4L4VE 4PP1D 3H9SA 4DGVL 1IFHH 3QG6A 1A6AA 2MWCA 2NXYD 5IVNA 3S36H 1I7UA 3U9PL 3B6SB 4WFHE 4XCYB 1KB5L 2VLJE 2HJKA 1QFHA 5E8NA 2ID5A 4F7CB 1M1SA 1J1PH 2X4QB 2Z0BA 4R7DA 5TE7L 4YNYA 4JAMA 3JUYA 1TJIH 4YDLB 2DD8L 4NC2B 5B3JE 2NY2B 3QUZD 4K3HA 3LEVL 3OTTA 5C0GB 3NFPA 5IFAL 3E6FA 5ALBH 3PWJB 4HWZA 4IRSB 4KROB 4LCUB 1U3HD 2Q7YA 3KPNA 1IGJA 4Y8AA 4P2OC 1AC0A 1NUDA 3QEQD 3CVIL 3J7HA 4Z95H 1TPXB 3JTTB 3BN3B 3MXWH 3LPGA 1HHHA 3SE3A 1EGJH 3Q2CA 4MJIE 1VFBB 2BC4A 4UAOB 2XACC 3FMGH 4ZUSB 2J8OA 2OX5A 3F7VB 4LSTH 1KCUL 3VMNA 1PKQE 2W59A 4GG6F 4FN0A 3RTQC 4GXVH 2HJLB 5F9DC 3KVQA 2H2SC 2JLLA 3G08B 1RZIA 4PJBE 3U7YL 4N8VB 1URLA 1HDMB 4HIEB 1F5WA 4WTXA 3OL2A 1EHLH 3V0WL 1V3JA 3CXDL 1WTGT 3V79C 3DX9B 1CLZH 4OB5L 2AEQL 2VDLH 5MP6L 2IEPA 3CMOL 1RUPH 1X5JA 3ARFD 3U4BL 1S9KC 3V7AG 5BVJB 5JXEC 2QHRH 2EE2A 4O02H 2PXYD 4CMHB 4Z7WB 3MNVA 2YD8A 1UH4A 5HSFA 4WTZG 1I1AB 3DV4B 1H0DA 2O61B 5HI3C 1S5IL 5F9OH 5HHVH 4X7TA 2AV7A 1C5DA 1I85A 3WFBL 2W60A 1J10A 4U4BA 3MROB 2B4CH 4LLWB 2FO4B 2FD6H 2Y23A 4HIJB 5F71A 3GB7A 4HBCH 3UC0L 5T3ZD 4R4FL 3D2UA 5IQ9A 2BVTA 3DVIA 2AJZA 1QYGH 3K7UA 1KCUH 4GUPA 3MCLH 3RHWF 2Q1EA 4R6UA 5HI4C 5L2KB 4PJBF 4B53A 3RWIB 4XWGH 3X11B 4BKLB 3WIFA 4Z0XB 4OZHA 4XXDA 5F7LB 4KMQA 5GIRB 3T0WA 4D0CA 3CXDH 3O9WD 1Z9LA 4V1DE 1OAUL 4KQ3L 4PRHA 4YFLI 4UTAL 4FG6C 1UB6B 2J5LC 5HHME 4LCYA 2H9GA 5ERWB 4EXPX 2BSRB 2MKWA 2PUQT 5GGQL 1YQVH 4G8IA 2W9EH 3QUML 3JWDC 3QG7H 4LEXH 1K6QH 2FL5B 2BDNH 4X83A 5D1XB 1AGEB 4KI5D 2DM7A 3GO1H 3ZE2F 2B1AL 1ZA6A 3HS0B 5DQJA 5TE6H 1S5IH 1BF8A 4XCYA 2P1YA 1SJHB 3QDMB 3QNZB 3MNZB 4YQXH 1K4DB 4PGCB 1I3RB 4YHNA 3FQRA 2OMBA 2L7UA 3IFPA 4YEFA 5GHWH 4UT7L 1YN6B 2ZUSA 3GMPB 3ZE2E 1MCEA 4PLJD 5I74C 2FB4L 3MJGX 3QCVL 1DLHA 4MD5B 5CZXC 3PWJA 2XN9B 1KCSL 1UYWH 5BRZE 4N0UA 3RWDB 4H88L 4XNQB 3VWKB 4HFWA 5D7JA 2AK4D 5JIPA 4M3KB 3L6FA 4JFFB 4P5TA 5BZWB 3INUL 5AYUH 5DJXB 3QP3A 5FOBA 4KVCL 3VJ6A 2H26B 4HV8A 1NMCB 3MA7A 4JFOA 3VMOA 5BXFA 5E08H 1ZANH 3F12A 2W0KA 1BIIA 4H8WH 1L0YA 1JK8A 2XZZA 3DX8B 4JG0L 4ZO9A 1R3HA 2NTFB 3EO0B 5I17A 1UZ8A 3QXAB 4HEPG 2DKUA 3SDAB 5F1OB 3IDGB 4PG9B 4BJLA 4S1QL 3HMXA 3E8UL 2GSGA 1KLFA 1X7QB 5TH2B 1P9MA 2A6KA 4S1DD 5DFTA 3V5DA 1XGRA 3T0BA 2QJDA 5ESAA 2DQTH 2NPLX 1UXSB 3RL2B 4L5FL 4E5XA 4Q9QL 1JI1A 1BFOA 3MXVL 2UZXB 4LASL 4N90E 3V4VH 4BSVB 5DRWA 5E5RB 5C0BE 4PJAE 1U3HA 5FO7B 12E8H 3SE4A 5C09B 5CJOL 2YUVA 5E95B 4NJAH 2NW3A 4R7NA 1RZJL 3VXNA 4HQQL 1FIGL 3ZDXF 1ZLWH 5DHYB 1A1MB 3W11C 2Z8RA 5J3HD 1U95B 1VESA 4OQTA 1YEEH 1UYWL 2EYSA 2VLRA 2GTWB 1ZHBA 5IVOA 5K9OB 4E0RB 4H25B 4WV1B 4ONFH 2X4UB 3HE7D 1GVIA 1A6ZA 1AR1C 4MCYA 1O5DT 2KH2B 1RPQA 3AC0A 3QEQA 3G6JA 1F3JA 3KJ4B 3LQAL 4EDWH 3CSYA 4PB0L 1J05A 4LHQB 4L4TE 1CFQB 4I8DA 4JFPA 4ENEC 1LEIA 3W5MA 3NMEA 3QIBB 4TVPD 4CVWA 2JK5B 5IMMA 4LCCC 4M9OA 1KJMB 4KDTC 3DURB 2DQFA 2UWEF 4DZ8A 5IB5B 4JY4B 1N3NB 2ATPB 5I1GH 3X11A 5I8KL 3QJHA 4GXVL 2XQBH 4UU9B 2XZCL 4I1NB 1A6UH 2AERT 4Z7WA 1YA5A 1CK0H 4JZOB 5EO0A 1B3JA 1N26A 3CVHL 1CFBA 3HNTL 3LKPB 4Z7UB 5CBEB 3GBNH 4OF0A 3L95A 1ZGLB 1KCLA 2PYFA 5A2LH 4JGMA 5HGGS 2NCMA 2FR4B 1LO5A 5C0RL 4MDIB 4NHCH 2MKLC 2EDHA 1F11B 4LEXL 4XNUH 1ZSDA 3JWDH 1MIML 4JFED 3QO0B 3LCYA 3RDTD 3TBSA 1NMAL 4ODXB 2VXQL 3MO1A 1DQJB 5C7XH 1NDMA 5GRVK 1G9EA 2ICWA 1RJLA 4WO4B 5JOFA 3BH8B 3BAEL 4OZHB 3LKRA 4XXDB 1OAXH 4CRPA 3C2AL 3SDDA 1I9JH 1MRFL 3OJDB 3Q3GB 1QR1B 3DXAD 1T03L 5CD5D 4PY8J 1JUFB 1D9KD 1ZT1B 1OP5K 1T89C 1Z9OA 1OP3K 5F1NA 5IMKA 4TRPH 5D7LB 1L7IH 3HZMA 2QSTA 5F9AC 3FFCB 3REVA 2IMMA 2NMSA 3O8XC 5DLML 4S11A 5JXED 3INUH 5AYUL 2DBLL 3NFSH 3NCBB 3JTSB 4PJ8D 5HYIA 2EKSA 3VD3A 2UVFA 3SDXE 1RUQH 1NFDA 4KK5C 1RUAH 1U8HA 1OAYH 1OAUH 1FCCA 3D3VE 2VAJA 2Z92A 4MX7B 4PJ5E 3MV9E 3BYTA 1JF6A 4H8WL 4I0PA 1BJMA 4JY5L 2VZUA 3BO8B 3GMNA 4WEBL 2VXSL 4PJGE 1JZ3A 1NCTA 2X09A 5HHOE 1CS6A 3B6SA 1I9EA 4L4VA 2CLZB 3CH1B 3GO1L 4MD0B 1RZGA 2VDRL 4QHLA 3WFEH 5GGRY 1CXIA 1BQHB 1H3UA 4JQXA 4R4BB 3TBTB 1BFTA 4HEME 3RJQB 1Y18B 1KN4L 2IAMB 3FRPG 4GXUM 2DRUA 3H8NA 1A3QA 3VI3E 3D87B 4U1JB 5EWIL 3L5WB 4V2BA 4R2GC 1CDBA 1T80A 3UPRB 4POZD 4XPTH 3SKMB 3ECBA 1QSEA 4JN2A 1OTUC 1XCTB 2X4UA 4H88H 2JB6B 3KPLA 3PWVB 2Q20A 2FSEB 3S9DB 3VWJA 1KOAA 32C2A 5C3TA 4KRMB 2V2WA 4KI5C 3W5NA 3VFUB 3WFHA 3IDJB 4X7SL 1NCNA 3BPLB 4U3CA 3Q6GH 2FNBA 5B4MD 1N2RB 2O5XH 3IAQA 5GS1B 2F53D 3DROB 4ZUTB 4WI6A 2CKNA 5CCKL 1PY4A 2APTA 1T04B 3NTCL 3WJLC 4A2LA 3VU2A 4AY0A 1KBGL 2FZ3B 1S78D 5AAWA 3BKYL 1QSFE 1SJEA 5I1KL 5F7EH 1RU9H 3RGVD 3TBYB 3T0EB 5JPMA 5HYQA 1ZGLM 1WLHA 4ZAKD 3MRLA 4NRZB 2OR9L 4MAUL 4LSQH 5EN2A 3WV0A 2P46B 3VWJC 2XZAL 1GOHA 4Q0XL 5I74B 4YC2C 2HKFL 1I9IL 3P4NA 4N68A 4UNVA 1Q72L 4P5TC 5MHSE 5GGVH 5FYJL 4S1RH 4P3WA 3BKJH 2B0SL 2RCSL 4BUHA 1JWUA 3EJJX 2YWYA 1UCBH 2VXTL 4LLUB 3RVXD 2OJZH 5IFJB 1GRWA 5T33L 1KYOJ 5DVNA 1C7SA 2HJLA 3O2VL 4OB5H 2CXKA 4YBLB 3NZ8B 4JFXA 1JTPA 2BP3A 3DBXB 3R8QA 5KVDL 1LDPH 5BS0B 4ISVA 4M61A 1WBZB 3F7YB 3QNYB 1R3JA 2VLLB 5CIPH 3QFJB 4CGTA 1IEAB 1YN6A 1EBAA 1D9KC 3MYJA 3MV11 4IOSD 2FIKB 2OM5A 2G75B 4X9FA 4C4KT 5I8EA 3BUTA 4JANA 1IAIM 1XF4B 2VDML 1RI8A 2E27L 5KSUB 1QLFB 4RGOH 5TQ0H 4GRLD 4I2XB 4J3WA 1MWAA 4W4OA 3AXLA 2VKXA 4PJDE 5FO9B 1OT2A 2VR9A 3OGCB 1XR9A 2FB4H 5BZWA 1JHKH 1NBQA 5EUOB 1BX2A 1JRHI 2VISA 5MERB 4ZSOE 1CGUA 4D3CL 3VXSD 3LD8C 3RZWA 1D5IL 1Q72H 1HQ4B 1Q0XH 4AM0B 5HY9B 1JGVL 1PEZA 3CFEB 3WKNA 5I1IL 4HKBB 3SDXA 4F7EB 5AG9A 4PJAF 3UTQA 3RWCB 2RGSA 3SKNB 3TH3T 1Q9LA 2V7NB 3BQUB 4HKXA 5EZOL 1QO3B 5F7WC 4RWYL 1MCOH 4OD2B 2GSGB 4G6MH 4MSWA 2VH5H 5JR1H 4Z5RA 1N8ZA 5B38A 4JVWA 2I25N 4EI5C 2I07A 3GSVB 2ITCB 3PDDA 1V3KA 1RURL 1KF9B 2KKQA 4KKBD 2F58H 3AY4C 2CRYA 1GGYA 2FGZA 5JA9A 3QSKB 5IMOA 3VH8A 5HGBB 1UM4L 4DVRL 4JLRB 1T03H 4GKZB 1FH5L 2YBRA 4OD1H 4TTGA 4E9LA 3LD8B 3B2VH 2VDMH 4AEIH 4HFWB 2VE6B 4PJAA 2P8LB 1BQHG 4XPHH 2APVA 3X17A 2IADB 3MREA 3MOQA 1JHKL 1ZHKA 4TUJA 2A6DB 5T1LD 3VXUD 2AK4A 4J8RA 4ERSH 1YEEL 1GAFH 3NBNA 4OCYH 3SO3C 2YD2A 5I75C 1RUAL 1BVZA 4GG6A 2CSPA 2QSVA 4NNYB 3GI8H 2P4AB 2R4SL 1OM3H 5I1IH 4JKMA 4LHJB 2P5EA 4HS6A 2VZVA 1PGRB 4X8XA 4YUEL 3QI9C 3L7FB 4I77L 5D7LD 3K4AA 5IJVA 3FFDA 2DJ4A 5E99L 4JFQA 4AIOA 3MROA 4G9FE 3X14B 3MUZ1 4PJEF 4ZAKC 4D8PB 5GSRA 2QHLA 3QQ3B 4YFDB 5D8JL 2XZQL 5ADPL 1OQXA 4JB9L 5GS3A 1OLLA 3IFLL 4RBPK 4KFZC 4N0UE 4JG0H 3RHWK 3GKZA 2JJVA 3MOBL 1A4JA 4ODVL 1T2JA 4LSRL 1JZ7A 3RZCC 5HGAA 4JDZA 4Q9RH 2DQEH 1CK0L 1KB5H 2V5MA 3SDCB 3JV6B 5K33A 4RGND 2X4OB 3GMLA 4F15C 4XPHL 1UB6A 1MCPL 4JKKA 4MZ2A 5DVKA 4KJYA 2HJFA 5FV1L 2OK0L 4MLIA 1J88A 1G9NH 3V6FA 4IMKC 4TTDC 4NKMB 5TFSH 5KS9A 3S35H 1LEIB 4FS0A 3GK8L 1FIGH 4MA1C 3WJJC 3TBYA 4PGBA 3W11D 1PZ5B 1DSFH 4ODSH 4U49A 5IKCB 1AGBA 1GC1L 3AMLA 4P57B 5HPMB 5F1IA 3CVIH 3GSWB 1K9TA 4Z95L 1IQDA 4R7NB 4O9HL 4W81A 3ULVD 2Z4QA 1K8IA 5CLWA 3MSPA 1HDMA 4DFIA 1VGEL 1LNUA 1IC1A 2P5WD 2VWEE 3FB8A 1ZLVH 4YHKH 2ATKA 1SHMA 5EFIB 3QB7C 4U1LA 4I0CC 1XGTA 2BCKA 5HYEA 3MLVH 1T0MA 5C0DB 4NQCB 4OLXL 2X70A 1DBAH 1NMBL 4Q6YA 5TF0A 1T3FB 4LAQL 1KB9J 4M8VA 5TPWL 3QJFB 3CFEA 2BNUB 3D25A 5DDHB 5KTEL 3GSOA 1IM9A 4I18B 5EOCH 2V7NA 2BVPA 2JK5A 4NUJA 5D2LF 3DX6A 4XXCC 1MPAH 5HHPA 4JM2C 4C56B 4PBVC 3V4UL 1ETZB 4AT6A 4M6NL 5T33H 5B39G 1F3DH 2G5BB 1JE6A 3NCJH 5E2VH 3BH8A 1UGNA 3DETD 3F12B 3CCHB 4PRIA 5CSZA 1UM4H 1T6VN 2KQMA 3BZFA 1XR9B 2K3TA 4WI4A 4FQ2H 4WY7L 4JO1L 5D71L 2GY7B 5HHMD 3VI4F 3AUVA 4G9FD 3UJIH 5JO5B 1J12A 5E9DA 1NMAH 2FEEI 4OLVL 1MCSA 3RL1A 1UKQA 1KN4H 3WFBH 2IQ9L 1HK6A 2E27H 5GGUA 1I9JL 1MRFH 2LTQC 1S7TB 4JGUA 4LHUD 32C2B 3I9GL 4TUJB 1D5MA 3S37H 3BGFB 3UZQA 4PJHF 3UZEA 2JF1A 3NOIA 2F8VA 4ACPA 1DDHB 4DQOL 2ZPKH 4JFYA 2VZ3A 4LHUB 5LBSL 1LEGA 4HS6B 4HXBH 1VKXA 1RMFL 3MV9A 1IKNC 5CINH 4JCMA 2VL5A 4YHLL 4JRXB 4GKZA 4FMKA 3MJ8B 3VE0B 5FCUL 2FZ3A 4OZFH 3V4UH 2ICEA 1TZHB 3FN0H 3N85H 4OUUB 4FRWA 5C0AD 3HRPA 4L8SB 2MFNA 3FQWB 5TDNA 3WO3B 4GRLC 1F2XK 5TQ2L 5LGHH 3IJHB 2ORBL 3WUWA 5EN2B 5E8EB 2A83B 2YMXH 1LK2B 1JMXA 4TYUA 4M43H 1YJDH 3VFGL 1U3YA 5TF1L 1U8QB 4Q9RL 3D2UD 3QUZA 1U95A 5T3ZH 3OKEA 2EIZB 1KEML 3L5IA 3BPOC 5HHXH 1SVCP 4RGNC 2VDRH 4JN2B 4GBXA 5FK9B 3PWPD 4BA8A 4PJHE 1D5XB 3VFPB 2Q86B 1XF1A 2ZUXA 3BT2H 3BKJL 1HKLL 2R2EB 3IDIB 2V5RA 5INCB 1F11A 4UTBL 3PGDA 5EZIH 2ITDB 2NXYB 3E6HB 4NQCD 5ETUB 1HNFA 4MAYB 4G5ZL 1J0JA 4OLEA 1SJXA 2R4SH 3P11L 4U0RB 5EORL 5I8EB 2A77L 3OXRA 5IG7A 2ZOKB 4NFBA 1ZKAA 1P2CA 5I71B 2GAZA 4K23L 3SDDB 3MRNB 3Q3GA 3WMSA 1T1XB 3QEUB 4ODBD 1JPTL 5EU6D 2QQLL 1DLFH 1QSEB 5IQ9B 4LSPH 3WFCH 3Q6GL 5C0CB 4PR5B 4UQ2B 5I18H 5HPOA 2O5XL 5LGHL 1NGWB 2V5TA 4P3DA 5HXMA 2IAMD 1HHJA 3L5XL 4Z0XA 2AJUH 1VFOA 3ALXA 2W07A 5EUOF 2VO5A 5JNYB 1ZHBB 3QHZL 3PWPA 5F7EL 1I8KA 2R0LH 1KPUA 5DTFA 1S7QB 2VAAB 1EAPA 1FYTA 1NFDB 4H8WC 3IU3B 1HSAB 1FZKB 5E6IB 1I9IH 2A9MH 4KY1H 3HA0A 1BMGA 4YZFF 3JWOC 1P5VA 2R1WA 4DKAA 1KJ2A 2C1OA 1JRHL 4CVZB 3GMNB 1UWEH 3N06B 5DHXB 1FFPA 3BZFB 3VG0H 1AGEA 4WU5A 3BKMH 3CFBB 1N3NA 2ATPA 3BJLA 3TA3D 2IFFL 3BGMA 4QT5A 4ETQB 2IQ9H 3GHBL 4JHAL 1CVSC 4S2SB 3V2AR 1DN0B 3BOVA 5D7JC 1J1OH 3RZCA 1LO2H 3ZZ1A 3HNSL 3DX6B 1XR8B 3FT3A 1VA9A 1KENH 4EQ3A 4XPGL 3T2OA 1Q8MA 4OCLC 5CSBA 2HFFA 5L7XL 4Z6AT 5EZLA 4YJZL 1JZ5A 3VI4E 3D39A 4Y4FC 3C60A 2LU4A 2R0WH 4RGOL 3TN0C 3TV3L 5D7KE 2VTFA 1YYMH 5J12C 3S7GA 3PWLA 4UDUA 2ZG1A 4A6YH 4F37K 5DZLA 5GSVA 4ERSL 2VL5B 1XGUB 4ELKA 2VERN 4JPKL 3MV8A 2ICWB 4WFGE 3E6FB 3NGBB 1DQML 2EDYA 4OZGB 2IANB 4H0GA 3UEZA 1A2YA 2C9AA 2GSIA 3ARDA 2E7HA 4ODTL 5TQ2H 3LS5L 3VFRA 1T5XA 4X4ZA 2IPKA 4KZDL 1QG3A 5AZ2H 3QUKA 1EAJA 2A0LC 4XAWL 4FQCH 5J13C 2D0GA 2QKIA 2KPNA 1T83A 2VB5A 3VG0L 1MVFA 5TH2A 3KPSD 3WD5H 3LS4H 4EUPG 5I16B 2PXYA 1AC6A 2NLJA 3HZMB 1NKRA 5I30L 3AREB 2VXQH 2YS4A 5C7XL 4IRJA 3CDCA 3QIUD 2KUTA 1R24A 4LFHD 1I8LC 4JN1H 5GGQH 3RWGB 5A1AA 4OLUL 5HYQB 3G6JE 3GSQB 1KCKA 4ZOAA 4TVPL 1F6LL 1UQSA 1K8DA 4KKBC 4NT6B 3NCCB 3MLXH 3P4NB 4JRXA 5TGBB 4DVRH 2WSKA 4WI8A 5J7CC 3MLYL 4HIEA 1I1FB 1YQ2A 1FJ1A 1GZQB 3BISA 4C56D 5SWQB 3RVUC 5DLMH 3FAWA 4HX1B 4P5MB 2CK2A 4A6YL 4LLQA 2DM4A 4KRPC 3PDOB 3PHQB 1SYVB 3X14A 2NZ9C 4FQQA 2IH3A 4NNXB 4HH9A 1Q38A 5FCUH 3DIFA 1GC1H 4BQBA 2CXGA 1K2DA 3HLAA 3JV5A 4MNGA 3FQTA 4NP4L 1C8PA 3VGDA 1TTGA 3TNNB 5AWNH 4OZGF 2AJUL 4W6YB 1ZHLA 1H3XA 1A6PA 1AKJD 4RFEB 4M43L 3WS3B 1EHXA 3SO5A 2Z8SA 3S37X 4N0FB 5ID0B 2A0LD 3T2QA 1QFOA 3BRFA 5EOQL 4APQD 4RAUB 1WGOA 3GIVA 3O81A 4KRLB 4NKOA 1P7KB 2X89D 1YPZA 2J8UA 1MCIA 4AIXA 2XG4A 4AJ0A 1XGYH 2YRLA 5J1SC 2G9HB 4M1CC 3MLYH 5EG6C 2W92A 4K71C 4M48H 4GJTB 1CD9B 1T1ZB 4JJHA 5D9SB 2FIKA 4I13B 1WAAA 2YD5A 1MJUH 1Y0LA 2YPLD 2FDBP 4L29A 4QOKE 2I07B 2VC2H 3GSVA 3MV8D 5F7NC 2EDBA 1YDPA 1HOCA 4XBPB 1A3RL 3ZKXB 4X7SH 1G9NL 2E7BA 2ATKB 1RFDL 3JUZA 4KJPD 4MJID 5C07D 4GRLB 3GK8H 4EBQL 1KT2B 4HUWA 1KPUB 1FAIL 3LRGA 5DTFB 5JPNA 4X99B 1DUZB 2OTPA 4Y4HA 4AMKH 4GG8B 4JZJC 4Y0GA 1N7ML 3BD4A 3N9GL 5GS1C 4H0IA 2ADFL 1NEZB 1PD6A 2VE6A 1DBJL 2G2RB 4TOYL 2WINB 1UB5A 2BY3A 2JJUA 5EC1A 2YXFA 3NA4A 1AO7D 3DGCR 3MRPA 2BERA 1C5CH 3H42L 5IUSA 3KAAA 2R0LL 1IAIH 2DQIH 4HWEH 3FQXB 1U8PA 3DRTA 3MYZA 4MGXA 1WTLA 3RGVC 4N0UB 5T1LA 4KJQD 5J13B 3B9KD 4NNYA 5FF6A 3JXAA 4LRIC 1KLUB 3U82B 2NXYC 5D1XD 2FH8A 3DXAE 2NYYC 3DI2B 3DJ9A 4Y1AD 4U05A 1EMTL 4HS3A 4QWWD 4BFEA 4UILL 1CIUA 3EAKA 5I30H 3VD4A 1U93A 5ALCH 3B9KB 4OLZH 2E7LA 5C08A 5KG9A 5DJZB 3HZVB 5HI5D 2BOCB 3O4LD 4GKNA 1EERB 3BP4A 3DETC 3H9YA 3ZHDA 1FO0A 3QWQB 1YNTB 5EO9B 2WV3A 4MHHI 4WHTB 3FQUA 1CLOL 5LXGL 5TF1H 3BI9X 4OM0H 1KXVC 3WHE1 4XP9L 1N7MH 3N9GH 3K74B 1WWWX 1BAFH 4FABL 5BW7A 2X4OA 3GMLB 1I7TA 1EXUA 4K55A 1GGCH 3JWOH 1HEZB 1YYML 5HHOD 4M03A 3V7MA 1ZEAL 2PXYB 3X12B 3VGBA 1WFNA 2BNRD 2IBBA 4UQ3A 1WBXA 2DQIL 4OCNC 5MEND 4IRSC 1TZHA 2XWTA 2C3XA 2J6EA 2I60L 5D2NE 1Q0XL 4YXHH 3KR3L 1PAMA 5I1DA 3RWHA 4OJFH 3OSKA 1V3MA 2PYEA 4NP4H 4L4TB 3ISWA 5D7JD 3MLWL 4K7PX 4RFNB 2YD1A 1UA6H 3U36A 2AXFA 1G7JA 4BQCA 4J4PD 4ELMF 1BZ7B 5I1EH 2CDGB 2GK2A 3ZTJH 2OXGA 3Q6FB 1F6FB 4Y5YB 4GBXB 3ARFC 1NDGA 3H9HB 3X3FH 1KPVB 4C57C 1MHEB 3WLWD 1FL3B 4DKFH 4ZTPH 4JEGB 4MA1B 4HWBH 1YPZB 4LVNB 4NHUB 2C4FT 1BLNA 1HSAA 5ITBH 3G08A 2W60B 3EGSA 4WUUD 4LLWA 3TWCL 1QRNE 3NH7L 2WLZA 5F7FA 5EU7C 5HTSA 3B2VL 4LLUA 3RY6A 4XBGA 4AEIL 5TDNB 1JHTA 3QNXB 3LEXB 3NA9H 4XC1H 3L3HA 3F7PC 2YSSB 4X6CE 4P4KA 3ZT6A 5IKCA 3VD9A 5HHPB 4P99A 3H7LA 3KLAA 2ZOKA 4JFQB 1Q9KB 3PJSB 4G7VH 1B0GB 1JRHH 3WS3A 1KIPA 2BNQA 4PRNA 1T1XA 2BXZA 2CDFA 4WGVB 3ARFA 4X6CF 1I9RL 1IC7H 1ONQA 4YXHL 4RGMB 4TULL 3TH4T 1IGFL 3I75A 4GLRI 1FO0L 4JANB 2XFXA 3A6BL 1IGML 3NCYP 1XF4A 4K07A 1UWGH 2IBZY 3IXAB 3Q1SH 2FO4A 3HCVA 4Y89A 1I8KB 1S3KL 3FB7A 1HI6A 2OSLA 3IS0X 4FZEH 3UTZA 5SX4H 4N0YL 4E41B 1KENL 1VERA 2D3VA 2H3NB 3T4AB 2IBGA 3RVUD 4ZTPL 3VGEA 1RZ7H 4Y2OA 2Y36L 4NSKA 3DPBA 2HMIC 2AJSL 3T0XA 3CFJB 4W6WB 1JNNH 4YHNB 3BKYH 3CDGB 4YZFE 5JW3H 3SDXB 1MHCB 2V5YA 1DBMH 2CRMA 1AGCB 5D96B 3C9NA 1CG9B 5IF0A 1NGWA 5KSBE 3RWJB 3S4SG 2VLKE 2VLJA 3WHXA 4YHOH 5T1KB 3QHFL 1JHLL 1N5AB 2KZ1B 2WUBL 5B38B 4KMLB 3EO9H 4PRBA 2WBKA 3OZ9H 4OV5B 4IIQC 4KTEH 2A9ML 1QBLH 1ZK9A 1GOFA 3WL9B 5C0FA 4P59H 5IT2L 1CWVA 3ET9F 3CU1A 4JO2L 4MJ5A 5T1KD 2DLGA 2E6JA 3S97C 3B2UD 1RFDH 5F44A 2VN4A 3CX5J 3PQYE 4L4VB 2HT2C 2WBWB 5C0JA 4EBQH 4GG6E 3P0VL 4JPWH 3LQMA 1CQKA 1S7VB 2JIXA 1FGVL 3HE6B 4BK5A 4FABH 4GKSA 4G8GB 1ZT7B 1AGFA 3E0GA 3IRPX 3DMMD 3BIAX 3CDYA 3IFPB 1G7IB 2NTFA 1YUHA 4WJ5A 4N0YH 4FXGB 1J1OL 5DVLA 1IC5L 4JDVB 2DF3A 3BEVA 5F6IB 3HZKA 1QFUH 2FJFB 5E8PA 3WNNA 3BPLC 1J87A 5KG9B 4XP5H 3BP5A 4GG6B 4N8CH 5E2WL 2X4QA 4LAQH 3VFOA 1OL0A 3C6SB 4HUKB 2BSED 4G6AC 3T09A 5FHBL 2YPLB 5CJBA 1DBML 1WEJL 1U8IB 4J4PC 1SY6A 5BO1L 1U8KB 1LO0L 2B5IC 3QPQC 3MLTA 3KYMA 4NCC1 1X4XA 2LAAA 3MRKB 4UZGA 4D3CH 4ELMB 5HBBA 4JPKH 1IAKB 2PYEE 1NSNL 4K7PY 3LSOA 4WTWA 2D4DA 3C8KA 3VCLB 5KVFH 1I85C 1R3HB 5I17B 4HPYH 2FYYA 1OGTB 4IRJD 2GQHA 5J9PA 1MCQA 2GJ6A 5DHVH 1YC8A 1EX0A 4MAYC 4C56E 4ONOA 3WD5L 3W39B 4XP6L 3HE7C 1SJVA 3X3GH 2NY3B 4ZSOA 3WJJA 5EPMA 1H8NA 3MRLB 1MRDH 2GW5A 5DUMH 4AIZA 3PIQA 1UFUA 2IPUG 4G7YL 4DZ8B 1J1XH 1G7LA 3C6LA 2DB8A 3HG1D 5E8DL 5DSCB 1TTFA 4OSUH 1P7QA 2MOVA 1BFVH 3DUHA 3ESUF 4I4WB 3QISA 5GRJL 1TVBA 3MCG1 3GMRA 3LAFA 3BE1H 2V9QA 4U6HB 4MQ7B 5SWZB 3ULVF 5HI5C 4HK3N 5DMIH 5IB2B 1LK3L 2Y72A 5IGXH 5F96H 3TCXA 5I2IB 1DVFC 1RMFH 1FRGL 2QSCH 4NO0B 2IQAB 1BOYA 4LKXA 3PL6B 1HWHB 3DVGA 3IAGC 4XCCH 4UNUA 5IFAH 5BMFL 3MRMB 1YMMD 2NYYD 2NZ9D 5KZCB 5DJAA 3QHTC 3R0NA 4QWWC 3GIVB 5I8CA 1OM3L 1OQOA 2DI9A 2DQFB 1E4KA 2HMID 2J8HA 4ZFGH 4LSDA 4NSKB 1BD2D 25C8L 3NIFF 3B3IB 4XT1C 1ZE3C 4YK4B 3PGDB 3C5JB 3VFGH 3DX7B 3HI1B 3RDTC 3H9SB 3GSNA 3MC0A 3SE8L 3SPVB 3D0LA 4LBEA 1YECL 4H1LH 2BOBB 4KUCF 4Q58C 1A6VL 1JWSB 2EE6A 1H3GA 3PWLB 3QWOA 3WFDL 2IMNA 4YDKL 2EIDA 2GCYB 1I8IB 3W0WB 3B5HA 5FYJU 1MI5E 5D7LA 5GISH 4BKLA 1ZHLB 3B9KA 2D31A 4LQ1A 3QZWB 4ODVH 1E4XH 3QDJE 5FM5M 2V2TB 4NYLB 3P30L 2C3VB 3EOYG 4RAHA 2PN5A 3MV7A 4OGAD 4UILH 2ZOLA 4KUCD 1YC7A 5C0BB 1T7YA 1F8TH 5B8CB 1CD0A 1W8NA 1KCRL 3B8YA 1FRGH 4MMZC 4OIIH 5LWYL 1MJ7L 1IGJB 1UJTA 4PJ8C 3BJ91 4Y4HD 3QPXL 4Y5YC 3DUUA 5DGQA 5L2KE 5ITFB 1OGAB 3S34H 1S7WB 4JKPL 2HH0L 2WWMC 3DOSA 4ALAH 3STZB 4LLAA 3ESVF 3QFDB 4P4KC 3WIFB 2ENSA 4KKNA 3O8XB 3GBLA 4XBPA 1XF3B 4YAQB 2Y36H 2MHAB 3DVFA 1BJ8A 4R90L 2ADFH 2HVKB 5CEZL 3KYNA 5K59E 4TSAH 8FABA 1F45A 2XTJC 4LLQB 1L0QA 4K3EL 3D39E 2V17H 1EEQA 1MCDA 2R29H 5C08B 2Y7QA 3GMMB 3IETA 3LOWA 4IS6B 1YMME 1N64L 3G5YB 4HWEL 3M45A 1H8SA 5F9JB 1WWAX 1XEDA 1MQ8A 1MCFA 1SQ2N 2PTTB 4BZ1H 1V05A 5D1XA 3WNKA 1MHEA 2X4TB 3HE7B 1QBLL 2F5BH 2GI7A 2BHUA 4UV4H 1LO4H 1CT8B 4GRWH 3LKQA 1RHHA 3VRLE 1A0QL 2BNQE 4PTTB 3X3GL 2IFFH 4F7MA 3F7RA 5EC2A 2EDKA 4MJ4A 2W0PA 2XTLA 3ZDZE 3DRQB 5LJYH 1C16B 2IALA 1WCBB 5BRZB 4CN4A 5C6TL 2JJSA 4N5ED 4TNWK 2BDNL 1CZ8H 5EOTA 5INDB 3IDIA 2VDPL 3EUUA 2VQ1A 4P9MH 3VDBA 3VFRB 4L4TD 3LV3A 3G5VB 4JFFA 4P5TB 1LK3H 1KJ3H 2BFVH 4WFGD 1F90L 2MNUA 3TJHC 4EVNB 3HC3L 1U3JA 3MLSL 2X7LA 1S78C 4G43B 1MFNA 2ZWLT 4P2OA 2V2WB 3I9GH 1ZLUK 4PJIE 5T5FL 1CVRA 3VRIB 2CPCA 2VN7A 4X7EC 1I9RH 3VWJD 3TN0B 3GRWL 5EH1A 3ARGD 3W2DL 3LS5H 2NXZC 4TPRL 5C70A 1DQLH 1A9BB 3GSNH 4NZRH 5DEZA 1N5YL 2EDQA 2F5BL 1XIWC 4HIHA 4I4WA 1GH7A 2VLKD 2X1WL 1AXTH 1FVEB 1B0RA 5JPMB 1WC7B 3RY5A 4N0CC 3CLFL 1EEUA 1QRNA 2E6QA 4XCNA 2VDQH 1A6TB 2OR7A 3PGCB 2A74B 2J4WH 2J5LB 2J2ZA 3L5JA 2EYTB 1MWAB 3DMMC 3KPMB 1BEYH 4M93B 4Q6IA 4FHBD 2DQTL 3K8KA 4OV5A 1TZGL 4ZPTB 3ULUC 4D0CB 5IW1B 4NZDA 2R1YA 5DD0H 5AZEL 5IFJA 3RU8L 4DVBA 4QRUB 2OTWB 5EBMB 4BSWB 2ZSVA 2V7HB 3DXAB 4UIMB 4EXKA 1HHGB 4HDIA 4OAWB 1G7QB 4OIIL 4IDLA 3GSRA 3HZVA 4JQIH 4MNQE 1S9XB 1AI1L 3UDWA 5C0ND 4WWKA 2B2XL 2Z31D 3O6KL 5DJYA 5EZIL 1V5JA 5DRZA 1G7IA 1C12A 5K9QI 4PLKD 1A3LH 3DURA 2ARJA 2DMKA 5DQJB 1GGIL 5A2KH 4EUPA 4MNGE 4P46C 1IL1B 3T77B 3D3VD 5I6XB 3ROOB 2DM3A 3OF6A 4FTVE 1UM6H 4CJ1A 3ARWA 4PB0H 1AXTL 5H37H 4FFWD 4TSAL 1D5BB 2DIJA 3QCTH 3G9AB 2R0ZH 3C9NB 3NCFB 4JO3L 3MRRB 4LLYB 2VISB 1J8KA 1OSPH 2XFXB 2BRRH 3L5WA 1J8HE 3WFDH 3OMZA 4NQCE 3JV4B 4YBQC 4GAYA 5DK0B 3WSQL 5B39B 4JR9L 1CGSL 2Y5TA 1UM5L 5ISZD 1CL7H 2V9TA 3PV6A 3ARQA 5JW4Q 1LP9B 5E56A 4BZ1L 4TUOB 3MBEA 1NC4D 2PTTA 3MRGA 4XWOC 4K8RD 4R97B 2H1PL 1PSKH 4PRPE 1YMHB 3MV9B 3FO9A 1QPXA 4M48L 5DD0L 4ZQKB 1RZFL 3RU8H 4YC2B 1NDMB 1A5FL 1CD8A 3RIFF 5DYOB 2Z92B 3I2CL 5J89A 3MLRH 3GMOA 2K7PA 2PNDA 5B3JF 4QRRE 5EA0L 2P44B 2GFBA 5HDQL 3BO8A 4ZSOB 1YY9C 2QQQA 1ZMYA 1EH9A 2MMXA 3DROA 3JWDL 3QI9A 5FYKE 5LGJB 2Z8WC 2R69L 3FFDB 3BKML 1HHHB 2DQCL 3MGTA 1P5UA 3HMXL 5M95B 1S9VB 3GBMH 5BV7C 1PKQB 1BFOB 3FHAA 4YK4C 4RFNC 2EIZA 5FF6B 3MV7D 2DIBA 1X5GA 2PYED 3VXPA 2E8YA 2IAMA 3OPZH 4N9GB 4L3EE 4B0MM 3PP3K 1DBKH 1KXQE 3BZEB 4NGHL 1BWMA 3EHBC 1T6WA 4R96B 3TVMB 4GMSL 1OSPL 5TE4L 2BRRL 3L3OB 1J8HD 3QDHA 4HPOL 4PTTA 1FC1A 4AEEA 5ESQB 1K5NB 2OP4L 3OAZH 2UV3A 2JELL 3QH3B 2P7TA 3MZGB 4TVPE 4F7TB 3BIKB 4MWFB 4MNGB 1Z9MA 4YXLH 1EHAA 4EOWL 1QFWI 1YEGL 2GT9B 2PYFB 3FFCD 3QIBC 5KANG 1EMTH 3H0TA 2EZ0D 1LO5B 5BMFH 1RJYB 4KJQC 4XCEB 4NKMA 4EIGB 7CGTA 1MFEH 3ZKQD 4K9EH 5D1QC 2GAZB 2DIAA 1R5WA 1A7RL 4P4RB 1FNAA 1OP5H 4DUWA 1OWRM 2FEDD 1CXKA 3DV4A 2O61A 5I8OL 1UZ6E 4HKZA 1TITA 2YC1A 4M93C 4MJIA 4G6JH 5H94B 4HG4K 5MEOA 1YEFL 4M00A 5CEYB 2IG2L 1Q9KA 5FXCH 5FUCC 1BM3H 3FO0L 2R0KH 2O26U 4ZMAT 3P9MA 2AK1H 1FL5B 3C08H 3GI9L 5MHSD 4OLUH 3ULVC 5CZVL 5DZNA 4HGWA 1KJ3L 1QD0A 1RIUH 2AEPL 3E2HC 1IAMA 1XIWB 4LKXB 5HYJE 4MDIA 4TSBH 4U6VL 4WI3A 5KS9B 1AIFA 1ZT4B 4PJDA 3G5ZB 2HLFD 4F8TA 4NRYA 5A40E 3QO0A 4BH7B 1BPVA 4MS8C 5DD6B 4K8RH 3HR6A 4OLWH 2CLVB 3KNBB 4IRSD 4S0TD 4N1CA 4QOKD 4UINH 2CQVA 1FNSL 1DVFD 3GSNL 1EVUA 4FFWC 3T0EA 1Z0NA 1S5HA 4NQXA 5ESVB 1T0NA 5JLZA 2YSSA 1N59A 1U8OB 5C8JA 4PJXA 3EDFA 4FQIL 4X4YA 8FABB 3X3FL 1YEJH 2VQUA 1VFMA 4JZNB 2DWDB 2UWEB 3HFML 5D1QD 4G6JL 2UVEA 1CL7L 3KYKL 3GMMA 4PPTA 4TSCL 5GGVY 4PJ5B 2CDFB 2J4WL 3L3JA 2RB8A 4WFFD 3BGFC 4UI2A 1TJGH 4YDVA 4ZOCA 4LCIH 1LGVA 4HJGB 4GS7C 2CGRH 1QBML 2Z8VC 3U0TB 5IFHH 2PR4H 1FVDA 4Y5VA 4GAFB 5A3ID 1ZS8A 2DQDH 2HKFH 2WK2A 1NGPL 4OFYA 4CL7A 3C5JA 3FAXA 4NKIH 2HWZL 1UACH 4U1HB 1TDQA 5IMLA 1TIUA 2QQKH 1OGAA 1KV3A 2DDQL 5HVHB 3S8WA 3C5ZB 1A0QH 4M7LT 4NCDA 4P23B 1IGFH 5EOTB 4G8EA 1FO0H 4L9LC 5ANMB 5CILL 3RKDC 1FL6A 3G04A 3TBTA 4DKDC 3S96A 3LV3B 2YN3A 3ULSA 4NGHH 5GGUB 1NAMA 2ADGB 1X4ZA 5KVGL 5HYJB 4Y4HC 5KSVB 2ZJSH 3SOBH 2QLVB 3VFWA 4OT1L 2XNAB 3NAAH 1BGXH 1JGLL 3VFMB 1RZ7L 2EDNA 3G6DL 4JVPA 1H3VA 1EV2E 3EOBB 3DYPA 4OIAA 5D70L 1ROWA 5DQDL 4AZ8A 3HC3H 1DZBA 3AS1A 3SKMA 3WSQH 1IKFL 3IKCB 4FNLL 1MHPH 3UYOD 5CD3A 1A7BA 3AVEA 3VXQA 4R90H 2A6DA 4JO4L 1BREA 3GKWL 2X6MA 1FYTE 3I3BA 4UBDC 1N8ZB 2AV1B 3MUGA 2AKRA 5FV2A 3O8XA 1FNGB 3MRMA 1NGXA 3EFDH 3HHRB 5FM5O 4V2CB 3JVGA 4AQOA 2FEDC 3OKLB 1JL8A 2VIRB 5D96C 3PF2A 5I8OH 1U0QA 4X6DE 4FXGA 3MRHA 2AGJL 4M5YH 3IS1X 4WNQA 3QDGE 3RX7A 2F19L 1X5XA 5D1ZC 2H32B 1H3TA 3I6LD 2P42B 1HINH 2DYPB 4HWBA 3HC4L 2Z93A 1B4JH 5E8OA 1QNZH 5JOPE 1A47A 2ZUUA 1SBSL 4MCZA 5JORB 3O6LL 1NLDL 3O6FA 4JY4A 2GCYA 4R4ND 3RI5K 4X7TB 3CLEL 3LKNB 4Y5XC 2ZJSL 3FOMA 3MJ6A 5K9JL 1ZLSH 2APFA 1FH5H 1PW3A 1FFRA 4PFEA 5IESL 3CZFA 4UT9L 5ISZE 4A2MA 2L4OA 1KSRA 2ZP0T 5I15L 2W1NA 1OCWH 4D9RE 3MCKB 4MB5A 5FHBH 3OXRB 4Z7OE 5H94A 5CJQL 4MNQA 4D0DA 4J6RH 3M17B 1HIML 2HFGH 1KTLA 4EIZC 1GAFL 4PV8A 5D7SH 5DD5L 4LBEB 5J57B 5TDPA 5ITFA 1IEHA 2EE3A