1HCFX

Crystal structure of trkb-d5 bound to neurotrophin-4/5
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
SHMAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROTROPHIN-4
publication title Specificity in Trk-Receptor:Neurotrophin Interaction: The Crystal Structure of Trkb-D5 in Complex with Neurotrophin-4/5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/hormone
total genus 17
structure length 101
sequence length 101
chains with identical sequence Y
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2001-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hcfX00
5FB8B 1WBXB 1T2JA 2A77L 1ZHBB 4Y4KC 3GNMH 1QSFD 3MV8A 3EDDA 3QXWA 4DGVL 1DVFD 4IOSD 3BO8B 1I1AB 1TVHB 4XCCH 3PGFL 5EOQL 1YMMA 1UH3A 4DKEL 4DAGH 4L5FL 3MJ7A 4CU6A 5IB2A 3D2UD 3KNBB 4WO4D 1AGDA 5CJQL 1SQ2N 4E0RA 3M1BB 1WAAE 3BOVA 2I26N 4JDZB 4KAQH 5CIPH 3O6FC 2F58H 1MVFA 4ALAH 5HI4D 1QR1A 3QR2A 4PJXF 2DMKA 3DWTA 4U31A 2BVUA 3IB4A 3WFCH 4KH2A 4AM0A 3QI9A 3NAAH 4I3GA 4MHHI 3JTTA 4P5TD 5EO9A 1KFAH 1U3ZA 4KUZH 1YEGL 1DBML 3CFIC 3CPLB 3QIWA 4PB0H 3DX6B 4R4NC 5DGQA 3V6ZB 5JR1H 1X5ZA 3NH7L 5LGJB 5C07A 3L5XL 3MUJA 1ERNA 4I2XE 2D7TH 1LEIB 3UTTB 2FL5B 1MFBH 1KEMH 4EI5D 3GHBL 4UILH 5DUPL 3NN8B 2BVTA 4Y16D 3ZHKA 1TJIH 3C6LB 4DFIA 2GJZA 4YZFE 2R2HB 3D0VB 1OAKL 1S9KC 2EEAA 4PGDB 3SJVD 5F7MC 1JZ5A 4ZSOB 1HKFA 1C1EL 5JHDA 1EK3A 1FGNL 1OAZH 2XKUA 3FQWA 3U48A 5LXGL 4YQXL 4X6DA 1XIWA 4KUCD 4RAVB 2AAVA 1J0KA 4KHTH 3LAFA 3S96B 1ZA3A 3WLWC 2OTUA 3W5MA 4UNUA 1DUZB 4LCWA 3MBED 1QACA 4X99B 1YJDC 1YC7A 4MAYC 1MHPL 2DQGH 3X12A 2I5YH 1BECA 4BFGA 1RHHA 1F4YL 4U7KA 1YY9D 4CL7A 4YDIL 5EZLB 1I7ZA 3K7UA 4OGXL 4M5YL 5GRYA 1I7UA 3PIQB 4G6AC 4N9GB 4OI9A 5ECJE 4BH7A 3TT1H 1KLFA 3C9NA 4LNVA 2RB8A 4XWGL 1QG3A 2ZUTA 1WWBX 4PJAE 2DQJH 1BM3L 4P2QA 4YBQC 4A6YB 5HYSG 3LQAL 3STZA 5DD3H 5DMJB 4P2OA 5I8OL 2JCCB 4UT9H 2GK2A 3RTQA 1Q9WA 1MCDA 4Q6IA 3JXAA 2VDNH 3PWNB 1MJUL 4LCYA 3V2AR 3VI3F 4NWTH 2DM3A 3HNTL 5EC1A 4CDHA 1DBKL 2XY2A 1IQWH 1IKNC 4X80L 2CRMA 5D7JB 3WNOA 1F3RB 3X3GH 5IKCB 4D0DA 3OJDB 4KJWC 5C0EB 1F4XL 3NIDE 2VL5A 3NIFE 5D7IA 1WC7B 4QHUA 4F7MA 1G7HB 5KOVC 3QUXB 4EI6B 1FL6B 3MODH 5F7UA 2J4WH 1A1NB 3MRLB 3QQ4A 3TFKC 5J89A 4I77L 5B38B 4YAQB 4NC2B 5CILH 4KTEH 4UAOB 5E6IC 1LO0H 1UWGL 2VRAA 3U9UB 3D39A 3L5JA 3IT8D 4FQXC 4F2MA 1Y0LA 2Y7QB 5JNYA 3EJZD 2R29L 4MJ4A 1UYWL 2WBJB 3WIHL 4Z18A 4OF7A 1JNLL 5KS9A 2GAZA 2JKXA 3EYFA 2NY5L 3U82B 3QDHA 1DVFB 4ODTL 4YFLF 1G7LA 1JYXA 3SQOL 1QLEL 3MLZH 1CXEA 5AWNH 5FYKE 3F6LA 2ICWA 3VG9C 5C0AD 4GRMA 3O2WL 2VXUH 5I71C 2J8UF 3BEWB 4XI5C 1RUPH 3KJ6H 1WWWX 4ODWA 3U83A 1JZ4A 4QXTB 2B1AH 1C5CH 4JM4H 1OM3L 4F7PB 4P5TB 4G3YH 3CAFA 2ZG3A 4DQOL 2AJVH 1ZLUK 4H1LB 4DOHE 4CKVX 2XQBL 4KTDH 5IMOB 3ZDXF 3DIFA 4JR9L 1IM9A 3MXVH 2MSPA 3NACH 2GQHA 2O5ZH 1HQ4A 4EI5B 2C9AA 5C08E 5IHUH 1XZ0B 3CUPA 4KK5C 1S7RB 5DS8B 3JVGC 1S7TB 5IQ7L 4Y16B 5CIPB 1IC7H 1LDPH 4Z0XA 2R9HC 3QRGH 5ANME 1BOGA 4X7CC 5L8KB 1MLBB 2LV4A 1HHGB 1IM3B 1JNNH 3QJHA 4D9LL 2PETA 3UDWA 3B3IA 4LNRB 4JG1H 1T7ZA 4KXZI 4NRXB 5J11C 4KMQA 4HKBB 3BUTA 1YYLL 4WI5A 4YEFA 4NQCA 1EO7A 2XY1A 3I6LD 1YEJL 1JF6A 1W0YT 2F5BL 3VDAA 3EJJX 4IMLB 3MGOB 2VDQH 3T77A 3OAYK 3T0XA 2UWEE 3MBEB 1BVKA 1TTGA 3JUZA 1WVZA 2Y6SC 3QISA 5L88L 1N4XH 1SM3H 4HWEH 3SE9L 3TT3L 1JWSA 4JO1H 1KN2L 1DQLL 4KZEL 4PGCB 2OMNA 3DROB 1AKJB 5F7DA 3RVWC 5IJKA 4HEME 4P4KA 4PB9L 4J2XA 2A2QT 1U3JA 3D25B 3RUGE 4JGUA 5ESVB 1CGWA 4WU5B 3PABB 1FSKC 3RX5A 1INDL 3VFUA 3GB7A 4YXLH 1CLOH 2F54D 4PRIE 3SPVA 1KN4H 4LKCB 4Z78B 1T04B 5T5FH 1EMTH 2NY0C 2DLHA 1CG9A 1G7QA 2R8SL 5AYUL 1S9WB 4D9RE 1GC1C 2IC2A 4OT1L 1RJLA 3BP7B 4ZXBB 5ETUA 3T4AA 3OB0H 2P7TB 4X5XA 4Y89A 4F3FA 3VFTA 3WS3B 4OCYL 1A7QH 4ZOBA 3CFKB 2AXGB 1Y6NR 4ZOCA 2ZSWA 5E00A 2P8PA 4Z7VF 1I3RB 5JLZA 4WHTB 3ZE0F 4YLQT 1IQDB 4H0GA 2J88H 3QAZC 4LK4A 2CKBL 2R0KH 5DQ9A 1CD1A 1CFBA 3BP6A 4KQ4H 3AB0C 4K3JH 1JI2A 4KQ3L 1DE4B 2WWMC 3CFDB 4YUEH 1VFBA 3MV8D 3U0WL 1QPXA 1QVOB 1B4JL 1XGQA 4FQ2H 4LCIL 1EO8L 2FATL 2X4TB 1YMMD 1XF3A 3GMPA 1A9EB 5C0NC 3GSUA 5CMAA 2HKFH 2IH1A 2N4IA 4L8SC 5BVJB 2X44D 2X4UB 1MH5B 5LGKA 4O4YL 1UZ6F 4XC3H 1P84J 1MHEB 4NOBA 1RAMA 2E7BA 5GS0L 5EBWB 1IGCL 3RWFB 4FFVC 3I02A 3A6BL 2EDQA 4G8IA 3QCVH 4QRQA 1A47A 2V7HA 4E5XB 4ZUTA 3FFDB 1JCKA 2QQLL 3MUHL 4ZUVB 3QBTB 4B7LA 2O26U 5IMLB 5FUOH 1QFWL 1HHKB 2Q3ZA 3FQXA 4LLWB 5I1DA 5KSAA 1RZFH 4UT7L 4OZ4B 3FMGH 2KUTA 3A6CL 4GXVH 2ZUQC 3QIWD 2R2BB 3AREB 1D6EB 3NIGF 4IBLT 4HHAA 1CLYH 4ZPTA 1WFOA 3MLYL 4NRZA 4TUOB 1QBBA 1MCIA 3GKWL 3QCUL 1I9JH 3TA3A 1I4FB 4HCRA 2IPUG 1CU4L 5C07D 2LQRA 1KIPA 1NCDH 3DV6A 4D3CH 1FE8L 4HGWB 5AD0A 4OKVB 3CXHK 2AW2A 3BP4A 4OZIA 3BJLA 5F96L 3VGDA 4NZTL 4MDJA 2X4RB 1H3PH 2RCSH 4WV1B 1HSAB 4R4BA 2UZIH 4FQLH 3MGAA 1HCFX 4XGZB 5F1KC 1J1OL 3SGDH 3QHFH 4PLNC 2VAAB 5JHDD 1MIMH 3PP3K 1FFOA 3BZ4A 4J6RH 4POUB 3BPLB 3S4SB 1E4WL 1O0VA 2BSSA 5J1SC 2Q86A 4YDJA 4JFED 4XXDA 4NFDA 3CD4A 5A1AA 4OUUA 3RWIA 5FGBA 3EYQC 4FQIL 4EEEA 3U2SB 4TUKL 1G9NH 1UCBH 2NW2B 5E6ZA 4GRWE 1P53A 2R0ZH 1BF2A 1OHQA 3I84A 3MYJB 3LS4H 4G7YH 5HXMA 1DQQB 4H5SA 4U1KB 1YQ2A 2LU7A 2CXKA 2XTJE 4XPFH 1MI5A 1M6OA 5I16B 3MLRL 4U1HA 4JHBA 3W0WA 4YXHH 1W72L 1AO7E 2Q7NA 1ZT7B 5KJRH 8CGTA 2ZUSA 1EXUB 2V17H 4RFOH 4XBPA 2X70A 5F9OH 3BMWA 1A02N 4P2QD 3A67H 1KYOJ 5EZJA 1TMCB 1DEEA 3DI2B 3LRSA 4GJTB 4XPBH 5D7KD 5FYJH 2HFEA 2V2XA 3VWKA 4HBCH 3QO0A 2D7NA 3SDXA 2AVGA 1BD2E 1A7BA 4KFZC 1ZLWK 5FGCE 1SYVB 5KW9H 1T1XB 4KDWA 1FLTX 2O5YH 2XTLA 1NC4A 4I9WD 5LG1A 4GW1A 4NKIL 2VLRD 1NBVL 4LIQH 4P23B 3L3HB 2XQYG 3GDBA 2MPAH 4M6NL 5FYKL 1E4JA 4JKPL 3IDGA 2J1KA 5ICZA 3TLRA 3DVIA 4L3EE 4MD0B 4OCSH 4MB4A 3W5NA 1ZGLB 1VHPA 4Y19D 4F8TA 1QBLL 1T4KA 3THMH 1CDHA 1JGDB 5FM4A 1AC6A 3D39D 1DSFH 1JL8A 4YPJA 5JDSA 5E1HB 1S7SA 3DSFH 1JGEA 1GVIA 4WWKB 5IFHH 1XFPA 2H8PB 3ULUF 4MD4B 3GMLB 5FKAA 5FYJD 3NZ8A 3BP5B 5MERB 1ZS8A 5HHNB 4CNIB 2FX7L 2ZPKL 5IB2B 1OCWH 2UY7A 2W60A 4YX2H 4LDLB 4D0BB 1GGIL 1YJDL 1VGEH 4U6XB 1QR1B 1WWAX 1KB5L 3FB5B 5DJ8B 3U4EB 1MCEA 5JW5A 5D7LA 4YE4L 2P4AB 5I1LA 4L8CA 3BSZH 1AXTH 1LILA 4F9PC 1IZJA 2ZG1A 2BNUB 3DX7A 3LKRA 4QRTB 3MV9E 5AAMA 1NAKH 4PTTB 1NKOA 1UWXH 3HNVH 5L9DH 2X4SA 1KTLA 4JY5L 2ZCHH 4PJ8A 4KI5D 3EYVA 5IB1A 4JFFD 5C1MB 5K59E 5E99L 5C07B 4N0YH 1YUHA 2XZCH 1FZJB 4GW4B 3UC0H 3E8UH 1NFDE 1AFVL 1T1ZB 1CGUA 1QSFE 1LD9A 5GZOC 5EU6E 1OSZA 1FL5B 1AGCA 5CJXA 1A1OA 5ENWA 4Y5YB 5C2BL 1YEFH 4XCYB 3U7AA 3T4YA 3OSKA 4LPUA 3DECA 2G60L 25C8H 2VE6A 32C2B 1IGIH 1OAXH 4NQCD 3LPWA 4YHIB 2YD9A 3MJ9L 5DJAA 4JFEB 1DLHA 4ZUSB 2CDEA 4FXKB 4MNGA 1JNHB 1CL7I 4XCNA 3QDMB 3OXRA 4I3RH 1ED3B 1M71A 3FO2A 4KJQC 1OP5H 3AU1A 4TNWF 5C2UB 5DGRA 5KG9B 2BDNL 2DBLL 2R1XB 4K7FA 1GIGL 5I1IH 2ZCLL 4P4KD 2FR4B 4O02H 1PBYA 1ZEAH 1EHXA 4RAUA 1PKQA 2BOCA 2VLJE 2D9CA 2I27N 3RWCB 3LEVL 2NQCA 4CU8A 4JVPA 3WIIL 3AC0A 1G0DA 1U8LA 3I6KB 2LVCA 3E6FA 2R2EA 2H9GB 1OPGH 3QZWB 4JFHE 4TOYH 3SJVE 3MLWL 1Q9WB 1IGYA 1P2CB 4YWGL 3VFNB 5IB3B 4FQCL 4OGAC 1HK6A 5EC1B 1FQ9C 2A9ML 1UB6B 1M05A 3TBSA 1Z2KA 5LJYH 3S34L 2OK0L 4QHUB 5CLTA 2NYYD 2VLRB 5F72S 1BWWA 3KLHC 2YPKB 1HDMB 2P8LB 2EDFA 2EZ0D 4KJYB 1MVUB 1BIHA 4PG2A 4KVCL 5HJ3A 2Z8SA 4M8QA 3QIBC 2EKSB 3FO1A 4LVOC 1U8KA 2BY3A 4P59L 6CGTA 3ULSB 4Y19B 5EUOF 3FZUD 2YD3A 5L6YL 2C1OA 1Y0LB 3SCMA 4G8GA 5IGXL 4NZUH 1ZAGA 1MRFH 2HTLD 4F15C 2ZCKH 1XAUA 3ARSA 4POYA 5BVPH 4DJMA 4XX1G 3QPXL 1S9YA 4HCRH 3MQIA 2JJVA 4TNWK 2R69H 2DMBA 1JZ6A 1OLZA 2CR6A 2M2DA 4XHJD 1D7FA 1QNZH 5FAAA 2FJHB 1CFTA 2WNGA 4MQXD 3L3DB 3V5HA 3P77A 1MCOH 2BVQB 2X1XR 4H26A 3FO9B 5J0BA 2I25N 1KIUA 1JTOA 4QOKE 2F53A 2IAMB 4PJBE 4YBLB 4PGBB 3EYOA 3MOQA 3T04D 3CZFB 2B8OT 5KSAD 2C3VB 2ERJB 3QEHA 4R4FH 4U1NA 1CT8B 3L5IA 3QUKA 4JFFB 3TA3D 3C6SA 5C0IB 4BZYA 1WIUA 4HXAL 1C12A 1QEWB 5D1QC 3SOBL 2HFGH 1JI1A 1FHGA 1F58L 5IJVB 3QEGL 3S36L 4MD5A 4JB9L 3DJ9A 4GT7A 4LP5A 3T09A 1H8SA 2DD8L 3CUPB 4HQQL 3VXSB 4ODVH 1Q8MA 4OF3A 2JIXD 1CGYA 1MCRA 2G5BA 4UMGA 5D2NA 2JB6B 4NJ9L 1EX0A 3WHE1 3GSQB 2Z92A 5B4MC 3WO3B 5T5NG 1J05A 5EG6C 5DO2C 1A3QA 4XXCC 3QXAA 4NQCB 5TQ2H 4U7SA 3ZL4L 4XP1L 4OB5H 1OL0A 3HFMH 2E27H 4BSWA 1CICA 4GSDH 1IGTA 4ORGB 4MGXA 3VRLF 1U41A 1J12A 5F3HB 5TH2A 3RWGA 5JQ6L 3RVXC 1XCTA 4M5ZH 1T6VN 1HH6B 2Z8VC 5F7DB 4NC1C 4EUPH 3H9SA 4MZ2A 4R7NB 2HLAA 3WFEL 2VZTA 2QSCL 1FLRH 4FP8H 1R0AL 3EFFB 1NCUA 1QTYT 1RIHL 2JELL 3B5TA 5DD6A 3W0WD 1TZHA 2CDGB 4OD3H 1NGPL 2DB8A 4OM1L 1G7IB 5MEPB 4EQ2A 3QDJB 5DI8B 4XX1E 1LWRA 1UJ3C 4MXQC 3VD3A 4TTGA 1C7SA 2BRRH 1A4KB 4BQBA 3QI9C 1CFSB 4Q58C 3H0TB 4NQDB 1MAKA 4JZNB 4KZDL 1DBAL 2X41A 3KPOB 3T4AB 4E42A 2NXZD 2Z4QB 4E41E 3VWKD 3F8UB 1ZANH 5M95B 2NW3A 3WNPA 2WUCH 1BZ7A 4DN4H 3I6LE 3RKDC 4WW2A 4OGYH 1FVEB 2J7LA 3V6BR 4G9FE 2RHEA 2P8PB 3OQ3B 2W1NA 1GCFA 2ITCA 5E2UH 1W0WA 4HPYL 2DLTA 3D3VA 4ELKB 4F58H 1KCUL 4K2UH 4XT1C 5C0RH 1S5IH 1XGTA 3O2VL 4DKAA 4HK0B 3FHAA 5ESQB 1CD1B 1ZKAA 4G8FA 4LHUA 2IPKA 5DC0A 4PRBA 4AIZA 2HKHH 2FD6L 3TZVC 1NANH 3UJIL 4AEHH 3B83A 4HWBL 1CGSH 1MQKL 3PGCB 1I8KB 4JDTL 4RNRA 3H2WA 2W0LA 2F54E 3MROA 1YPZB 4UTBH 5FM8A 2HAZA 4DK3A 1XIWC 4X6BA 4Y8AA 4HDIB 1Q9KB 2JLLA 5EBMB 2HJLB 5A16A 2YD8A 5E8EB 5I76B 5FO8A 1F11A 5DDHA 3KS0J 4MVBD 4B7IA 4XTRC 4CVZA 2BVEA 4EVNB 1VEOA 4OLYL 4NKDB 2EH8L 2A6JA 3NZHH 1N26A 5A2LH 4OZGA 5D7LD 3IU4H 4UIKH 3KPSA 3N50A 4PJHF 4DK6A 2EIEA 3HNSH 4LSRH 4P2RD 4YFEA 5JXAL 3HKFA 3QIUA 1A6UH 3T65B 4CBPA 1AGEA 5C0FA 4MXVE 4N0CD 4K3EH 4JFZL 5DHYB 1EH9A 2WINB 3P30L 1WF5A 4OCWH 5K9JL 2VIRB 2X4OA 1D5ZB 1CS6A 1ODAA 2R23A 1IGMH 2H2PC 3OXSA 3Q1SH 4P2OC 3RTQC 4Q6IC 3VGAB 1NUNB 1JPGA 4J4PA 4PRHA 1P4BH 4P49A 3H3PH 3LH2H 1IT9L 3MV8E 4RGNC 1UXWA 2VISA 4G80B 1IC5H 2JJWA 2AV7B 1DP0A 2EIDA 2ITDA 2JIXB 5IEHA 3GNML 1T0NB 4TPRH 3VGEA 4GUPB 4DAGL 4X0KB 1NJ9A 4KV5E 3MZTA 1IGJA 1N3NA 4LLDA 4Y2OA 4PTUB 1C16A 5K93A 1NGXA 3WE6B 2FECL 4ALAL 1OGAA 4C55A 5CGMA 1ZVHA 2AV1A 4RCAA 1LO4H 3RWIB 3KPQB 4XP9H 5EO0B 3NFNA 3WFCL 5INCA 3EHBC 3WL9A 4H8WC 3TWCH 4KUZL 1NCTA 1S7UB 1JNJA 4KJPC 5DK0A 1FJ1B 4HC1H 3FB7A 3C60C 5DHVH 3IDJA 4Q97A 2AEPH 4NZRH 5IF0A 3WXVH 2VXTH 2DN7A 3CCHB 5A3IC 1BQHB 4EXPX 1RUAH 3TNMA 1A21A 3G6AB 4ZAKA 5J4MA 3FAWA 1AP2B 4MB3A 4Z7QF 4LSPH 5DYOA 2D7TL 1HN1A 1CXHA 5IROA 2R1WA 1K4CB 2BVPA 3ETBF 1MFBL 3KPRE 3KPNA 1TJHL 3OF6D 1IVLA 4P0DA 5B21A 4D0CB 3RP1A 1TJIL 3IDUA 4LVNB 4PR5A 5JHDE 3V5DA 3VWKB 1SJEB 5EU5B 4O00A 1L9NA 4P5KB 4NN5B 4X6DE 2WMPA 3C09C 4MCZB 4WU7A 4NT6A 5C8JB 3F12B 3RY5A 4LAJH 3QEQA 5CWSA 4LCWE 1IEAA 1LO3H 4HUUB 4XNQB 4GFTB 4EUPB 4M6OH 1WCBA 5FA3B 4NHUA 1JWUB 3KYKL 4X7EC 5L7XL 5GRZA 1ACZA 4GKSB 2PTVA 5HGHB 3Q5OA 4X7TA 4PD4J 3V4VH 3SCMD 2R1YB 1EAJA 1DLFH 43CAB 2J8UA 2FNBA 1QKZH 3SHSA 2C1PB 5DD5H 2ED9A 1AGBB 1FNSH 1AHWB 3EYSH 4LLAA 2CIKA 4PJ9B 1X9QA 3L7EA 4P2QE 2MWCA 3HC0A 1S7XB 2DQJL 1XR8B 3QH3A 4M93C 2CUHA 4S1SL 2VQUA 4OLWL 1OF2B 4I13B 4NQSA 1F90H 5BRZB 3CGTA 2HTKD 5DD3L 3NCEB 5EUKB 2QQNL 4UINH 4PJGB 1JPTH 4UT9L 3V4UH 5J12C 1NMCB 1ZHNB 3I50H 5C86A 4Y88A 1CFNA 4HWZA 4PJAF 5D7LB 5JW4R 5IJKC 5D7IE 5I1GH 3GSNB 4I9WE 3LKQA 2XNAA 2F53D 4GS7B 1I1FB 4P2RB 4I0CC 2JJTA 4I4WA 3VXOA 4JHWH 2VLLB 4R3SB 1V7MH 1N8ZB 3ARWA 1IAOB 3EOAA 4P4RB 1BIIB 5KSUB 1UXSB 1P7KA 3MODL 1FVCA 1HXMA 2J4WL 2UYLB 3DBXA 4XP6H 1Q1JH 5EFIB 4JJHA 5CILL 1NUGA 4KTEL 2OJEB 4URTB 1LO0L 2IF7A 5I8EA 3TF7C 5HHOA 3NIDF 1HWHB 3BUYA 4YGVB 3PWJB 1ZGLM 1WZ1H 5KS9E 3NFPB 1YN6A 2NY1D 1JHKH 3DETD 4WEBL 1KACB 4RFEA 4KKLD 4M43L 1NCCH 3HE7B 2HN7B 5DK2A 3F65A 3UBXB 3TV3H 2DF3A 1N5YH 1FZKA 3HR6A 2ADFH 3B2UD 4Z7UF 4ZOAA 1A5FH 3DVNB 4U0QB 4NBXB 4L4VD 1DUYA 2FJGA 2VE6B 3MLZL 1U92B 4GAFB 5H37G 1KSRA 2VXUL 2V2TA 3GM0A 1RUPL 1UVQB 3KJ6L 1CICD 3SGEH 2CDEB 4Z7WE 1HXYA 1NMAH 5F9AC 2B1AL 3QJFA 1YEIL 1IL1B 3Q3GA 1NCBH 3HE6A 1KJVA 4P2YA 4NN6B 3AU1B 4Z5RA 5TDPA 2FO4B 2R56H 4POZD 5I74B 1CLZL 5FGRA 4PJIF 2IGFL 3VG0H 1FDLL 3CK0H 4KTDL 3TBYA 2JB5L 2CH8A 3QUZA 1U8HA 1UA6H 3FOMA 5HYJE 3GFUA 5E2TH 4C83B 3FRPA 2BOCB 3WJLC 1IEHA 3MXVL 4PG9A 3NACL 4MXWH 1BQUA 1B4RA 5TE7L 1DN0B 5A2JH 3C5JB 3ALPA 5J9PA 4AT6A 2R2EB 2QLVB 1BJMA 4YHOH 1AY1H 1SMAA 1T22A 1IC7L 1X4YA 2YA1A 3ZYOA 4QRSA 1JUFA 3BWAA 1YEKH 3KXFA 1FRGH 1YECH 2HH0H 5EDXA 4FNLH 1UJTA 4OD2B 3JWOC 2ORBH 3FCTB 3UCRA 3V6FB 4DCQA 4S0TD 1H0DA 3Q6FA 4S0SD 2VDQL 5HYQB 1FGVH 5DHVB 3HLAA 2IBZX 3FQRB 4YHML 5FDYA 2G9HB 4OZHF 1N4XL 1SM3L 1N7MH 1V7NL 3CLFL 4JO1L 1T21A 4JY6B 2GIYA 5FXCH 4QYOA 2JJSC 43C9A 1A7PH 1JPFA 2UWEF 3KPLB 5BW7A 3STBA 2EYSA 1UKTA 3J8F7 5BOZG 1DQDH 2Z93B 3DMMC 4GKZA 1LE5A 2P45B 3LS5H 2VYRE 1MJ7L 3G08A 5HVWA 3ZDZE 4YO0B 4PBXA 1PG7H 4LLYB 1KN4L 4JY4A 4YDVA 5T5FL 1EMTL 4V1DA 1IAIM 5E8OB 5FGBC 3X3FH 3BHBB 4JQXC 2G2RA 2PYEA 3MREA 5I1AA 2V7NA 4MQSB 4XZUB 3CZJA 4XMLL 4GG8A 3VWJC 3KPSD 1KJ2H 2MHAA 1I8IA 5DJ0A 5F7WC 3REWA 1ZLSH 4K3DL 3DXAB 1EEYB 4F7CA 2EICA 2APVA 1CD0A 2BY1A 4XVTL 1FZMA 4HT1H 2GITA 5IR1A 3QNYA 1C12B 1T5XB 5I0DA 5EU7C 4LSQL 3G5ZA 4KQ4L 1S3KL 4J4PD 4X4XB 4PRHD 2D03H 2NY1B 3ROLA 1MFDH 4G8EA 1ZLUH 2P5WB 2WP3O 3IFNL 1U8JB 1QRNA 1B0RB 1F6AB 1TENA 5D6CA 1I8MB 2EYTA 1S9XA 3FT2B 1K5NA 3O6KH 3L7FB 2C3WA 3C5ZD 4CJ1A 5CSBA 4KKCD 1H5BC 5IHZB 2EDHA 4L4VB 1U8QA 2C4XA 2HKFL 3U30C 5TDNA 5TDOA 3RPIB 3ARGD 5SWSB 3CDFA 5GJSL 4BFIB 4HG4J 4XC3L 1D5MB 1XCQB 5E24E 5IV2A 1NBZA 1RUMH 3QCVL 3B9KA 2VZOA 4MX7B 5TH2B 1G9MC 1XCTB 5E8DH 5FUOL 3HA0A 3F7RA 3FQNB 4GXVL 4XVJH 1KLGB 4TN9A 2NY4C 1ACYH 4M7KH 1X5XA 2LVEA 1I9JL 1K8IA 3WN5B 3OAYH 3W9EA 5L2JB 2GT9B 1QLRB 4NWUH 4OZIE 1NCDL 4D3CL 4HH9B 4ZAKD 3MRMA 3NGBC 1YQVH 4WNQB 5CBEA 2DAVA 2XWBA 4HAFA 3L6FA 4Q9RL 1X5LA 1XR9B 2NY7H 3QNZA 2VJXA 3WUWB 2Z35A 1EZVX 5INDB 1P9MA 3S37L 1R5WA 1WBZB 2RCSL 2ESVA 3FFCA 3VFVB 1NFIB 5F97E 4C54A 2W9LA 4PJ8C 3QHFL 1TCRA 2AXFB 2XWTA 1MIML 1TPXC 3QEQD 2WAHA 2GSIA 4KVNH 4JQVC 2PW1B 3QEUB 1BLNB 5MENB 1UG9A 3LKSB 4QXUL 3OBAA 3NBNA 1JRHH 2FWOA 4P57B 1OTSD 1H3XA 1B2WL 4ONHB 3OKMA 1INQA 5CJXC 4LU5H 3DVGB 2PO6D 5MEQA 3K81A 3R0MA 3UJJL 1MI5E 3MRNA 2AI0H 2VDOH 4HKJA 3SE8H 2BJML 2DLFH 2R0ZL 4JRYB 4G7YL 5CD5C 4LARH 3LS4L 5EULV 4PJXB 2EO9A 5DJXB 5JPMB 3U9PL 4MJ6B 1Q94A 4JJ5A 1SY6H 1K3ZA 2DQIH 5C0CA 3IGAA 2H32B 4YXHL 3O8XA 3G04B 4X6EB 5M7QA 1FC2D 5F70A 1KPRA 1YMHA 4P46A 1HIMH 3PGDA 4JHZA 2V17L 4JFOA 1E6OH 5HI3D 5EU7E 3GGWA 5F9OL 5DDHB 4YEEA 1MFAH 4DEPC 4BZ1H 4GAGL 1S7WA 2GTZB 1NUFA 1VADB 4CVZB 5D72H 3SDXE 4UZGA 4XPBL 2DWDA 4H8WL 2XKNA 5E1AB 2NY6D 5FYJL 2WSKA 3OAZK 4LASH 4HBCL 4HJGB 3K8MA 3KPSB 4XB7A 4NC0B 3PDDA 1J5OH 3VXPA 1FG2A 4RMWA 4MSWA 2OL3A 2H41A 5C09A 3CU7A 1SJHA 3ILPA 2H26A 2MPAL 4KY1L 2Q6WB 3PHQB 4PRNB 4ZS6C 5DFVD 2VLME 3TCXA 3TNNA 3THML 5HHOD 5DMGD 4PRHB 1TXKA 5KSBB 1U3HA 3U0TB 1LNUA 1FFNB 5K9KA 3VCLB 1VGKA 3DRQB 4ELMF 4HJJH 3IF1A 1GGTA 3BH9A 2YRLA 3DSFL 3O45B 3H3KA 4KKBC 4R26L 3S35X 5IFHL 2OCFD 5GHWL 4PJ7A 3C5ZB 2HRPH 3B4NA 1KJ2B 3GI9L 2J8OA 3C8KA 1P6AB 3REVA 3VDBA 1OCWL 2Y72A 3T0DA 2OTWB 3ARGB 5GRWA 1Z5LB 2WV3A 3OG4B 4AQOA 1LDSA 4D9QD 1NAMH 2NY3B 4MQ7B 4XP5H 5JZ7C 1PW3A 2VUOA 3O3BA 4XPAH 3HE6D 4NKOA 1AXTL 3QULB 3QUXC 4LDOB 1NAKL 2Y25A 1YY8B 5JW3L 2CIIA 3QUZD 4R7DA 1A3LH 2YD5A 3WEXA 5HY9B 2XFXA 2ZCHL 2B39A 4QLRA 5FOBA 2DI8A 4YDKL 4UB0H 1R3HA 3EJYC 5DF0A 3EOBA 4FABH 4N0YL 2ICWJ 1PG7W 3O4LB 2XZCL 5DZLA 3QXUA 4ZAKB 3UC0L 1NEZA 2WBJC 3VE0B 1FORL 5C0DA 4PJ5A 3C8HA 5ITFA 5K59F 4NHCL 3V5DB 4ZFZA 5I8KH 4ZO7A 3UZQA 4MLIA 4QRRD 4AYFA 3CSYB 1YEFL 2UY6A 3ZHLA 3HC3L 4U3XA 3MRKB 3P4NA 25C8L 4M1DH 5T3XE 1IGIL 4MNGE 1OAXL 3GK8L 5T1LB 5C0BD 1CI5A 5JPNB 2CLZA 2IPUK 3FT3A 4Z7NE 4U1GC 3DV4A 2QR0A 1BQLH 1JPST 4I3RL 2F15A 4N5ED 5HGAA 2FIKB 2PO6B 5DJYB 1X5KA 1ZLWH 3ARFB 1QD0A 1PKQE 3JSSA 3RDTB 1UQSA 2HMID 5D1ZA 3PWLA 2VMFA 3PP4L 4PJDB 3HG1A 3KLAA 5CP7A 5I1IL 2FDBP 4KPHH 4PJFB 3WHXA 4NUGH 4H1LG 4M7LT 3KPTA 4HUWA 5TF1H 2GJ6A 3E3QC 2D7OA 3HZMB 3RHWF 3VRIA 3I6GA 2DICA 2XN9A 4GRLA 3TJEH 1HSBA 2MOVA 4PRPD 4V1DD 3O9WB 3WLBA 4MCYB 2HG5A 1OPGL 3LRHA 1MREL 4M7ZC 2NY6B 3EOTL 4JFDD 2DOCA 4HWZB 2VXVH 5HHXL 2BNRA 3DLQR 3LKQB 3MUGB 1AQKH 5GRVK 5GS1B 1MCFA 4NGHH 4LEOB 4WI7A 3EOAB 3V0VB 4YHNB 1LMKA 5FA4B 1A6TA 3NMEA 4G8GE 1RULL 3U36B 1A7OH 1BZ9A 2BVOB 2KBGA 3U1SL 4ENEC 3GJFK 2YPLA 4FQPA 4PY8J 4GLRI 2FLBT 3BUYB 4JFQB 1XMWA 4WW2C 5IBTH 4ODSH 4AG4H 2SEBA 1MRFL 4C56D 3ZKMC 3GSOB 3ESVF 1QRND 4LMQE 5BVPL 2K7PA 1NSNL 2VZUA 4HCRL 3LSOA 1P4LB 4UUJA 3HI6H 2R69L 3IFLH 3RVTC 5FF6A 1I7RB 1VACA 1MLCB 5ID1B 4ZXBC 4DVBB 4XPHH 4NQEE 1QNZL 1G1CA 3RHWK 2F53E 3MRIB 1Y18B 5I30H 1HYSC 1A3RL 1CXLA 1CCZA 3ZDYE 2Y1VA 1MCOL 2YC1B 3QG6B 1HILB 1RI8A 4LHUG 5J6GA 4OCMC 4MQTB 3TYGH 3GEWB 2W92A 3HMXA 3UZEA 4RMVA 2CLRB 2AABL 3ULUH 2XXMB 3QUZB 4QT5A 5I66B 4R4FL 4Y4FD 5DZNA 4PJBF 2J12B 1PQZB 3IJYB 3OKDB 2HFGL 3QUMA 2M26A 4FTVA 4LPCA 1CIDA 2NTFA 3K2UH 4Z7VB 4UNTA 4LOUC 3UZVB 3SDDB 1FNHA 5D2NE 1RIVH 2Z31D 1ZVYA 1U93A 3QIUC 2COQA 1T1WB 4QRPB 4ODVL 5H35A 1NAMB 4QRRB 5I17B 2ESVD 3FFCD 2QKIB 4MA1B 5IM7A 4NNYA 1CGXA 1AR1C 3E3QE 4RSVA 3IETB 1FO0A 3CLEL 3MV7B 5TQ2L 5C0BB 1ZHLA 4ZUUA 1T0MB 5KVDH 3WBDA 3NCCB 4Z7OE 5CEXA 1XF4B 2V5MA 3ULUD 2HFFB 3PWPB 1F02I 4GSDL 1I1YA 4K3GA 1CF8H 1FVDB 1T66D 4QNPF 4UBDD 1KBGH 3AS0A 4ONFL 4WJ5A 1AD0B 1J9CT 4QXWA 3H9SE 4H20H 3AREC 3Q0HA 3ABZA 4RQQA 1TFHA 4O51B 4M5ZL 2EH7H 3QT2A 4TUJA 1JPFB 2CD0A 3QQ3A 3VD5A 1EFQA 3V52H 1TDQA 2EYSB 5DTFB 4FP8L 3X13B 4NZJA 4LFHD 3DYOA 4RZCB 4JFXB 3MRFB 4PJHA 1GXEA 5IB4A 1MCHA 3DHJA 4OD3L 3B9AA 3QA3A 2YA2A 4WW1B 1WIOA 4PRPB 3FO0H 5B39B 1D9KA 4I18C 2C26A 2EXYD 2HLFC 4RBPK 4WV1C 4JO3L 2ZJSL 2W0PA 3VXUB 4W6YB 4JFDB 1E27A 3KDMB 1G9ML 1VFMA 4JGMA 2HT2C 4XNZB 1ZANL 4G43A 4DN4L 4JN2A 2APFA 3D3VE 4OGYL 5IFAH 4WUUA 4IRZL 4LLVA 4MZ3A 3TVMA 2YK1L 4F33A 4LPVA 2W9EH 2P46B 1JGLH 1I3VA 5ISZE 5E2UL 1GZQB 1OSPH 4WHDA 3RGHA 5D70L 2OJZH 4F58L 3VXMA 5C0RL 3ZT7A 1S5IL 2GITB 2Y5TA 2A77H 3ARDA 3MJGX 1YDPB 3MRBA 2OX5A 3CX2A 4DGVH 1J8HE 1N59A 2J2ZA 3V9FA 2HKHL 5IFJA 1L7TH 4FQHB 4YHKH 4C56B 1CGSL 2D7PA 4QGTA 4GXUM 3QDGB 3H42H 4UTBL 3MRQB 3IKCA 1A22B 1TZGL 1KCRL 3HPLA 4DZ8A 3K3QA 5IMKA 5F9JA 1U8QB 2NY2D 2YXFA 4OZGE 3WFHA 1OARH 3GSXA 3ZMRA 2OXGA 1A8JH 4PYGA 3BIKB 1F8TL 1M7DA 5MEOB 2FYYA 1FV1A 1UKSA 1NBZB 12E8H 4UIKL 1R5IB 3CVHA 1IKFH 5I1JL 3FRUA 5DUBB 3HNSL 3L5XH 4LSRL 4P23C 5BZWB 1HKLL 1RIUL 3LKNA 3SQBA 1A6UL 5T5NF 4O2FA 4F8QA 3GBNL 5E7FA 3VFPB 1X7QA 4K3EL 3GHBH 1GGCL 4Y4FB 4LLQB 4I2XA 3W9EB 3Q1SL 4TVPH 1IGML 3FB6A 3HZYB 1ADQA 1EPFA 1OAKH 3HR5A 3LOWA 5F9DC 4BKLA 1P4BL 1A4JA 1KLUB 4WWKC 1FGNH 2GY5A 4PJ5D 3I75A 5H2BB 3QFJB 4W70A 4XPGL 5LXGH 1IILE 3QNZB 2JJTC 5KVMC 2Z31B 5D2LF 4OM0H 4N68A 4X98A 3UTPE 4JO4L 4Y4HA 2ESVB 3WDJA 1MRCH 3FFCB 1GPOH 4ONGH 2Q76A 1S7VB 3ZHDA 2OLDA 5JOFB 1FAKT 3VFWA 2VNCA 4LGSB 1OGAE 3AFLA 4PGEA 4JANB 4CVUA 2AEIT 3PNWB 3E2HB 1S78D 3IYLW 4M5YH 3VXRD 5DMYA 1N6UA 3RL2B 4OAWB 2NCMA 1LO4L 2XXCB 1RD6A 2ENSA 4XP9L 4TVPD 2J5LC 3VGHA 3MX0A 1FN4B 1ND0A 1RMFH 1U8MB 4XWGH 4LSTH 1BM3H 4XVUD 3TWCL 3MRNB 3TEUA 4HKJB 3UTZA 5FCSH 4JDVA 4WEMB 5F1NA 5D1ZD 4AK1A 3LQAH 3HG1D 4UOW1 4PJAA 2AEPL 2BHYA 3HRZA 1Q94B 2YD4A 4M4PA 2NNAB 2VXTL 5CP3A 2GJ6D 3TPUA 5F9WB 1KPRB 4YC2B 5JIIA 2B2XL 4GRLD 2D4FA 3IDIA 4LSPL 4FZEH 2NMSA 5CBAB 1RURH 2Y5EA 3OGOE 3UTSD 1F4XH 3R06A 1WV7T 4Y4KA 4ZYKA 4GKNA 4YIQB 2PTTA 1NPUA 5BS0A 4YHPB 3QCTH 3OPZL 1OQOA 4I77H 4XCEB 2BNRD 1I9RL 1FL3A 4WDIB 2E9WA 4XBEH 3RGVD 3T2PA 2X4QB 3MCKB 1NGYB 5EN2A 4NKMA 1LO3L 2R29H 3VFRB 3IRPX 1UYWH 1JV5B 4Z7UA 2A9NL 4QO1A 3MRPA 3B6SA 3FRPG 4J1UB 3BN3B 4ODTH 1H3VA 1S8DA 4GO6B 1IJ9A 1RFDH 3KHOA 3WDHA 1LNUB 3V4VL 4LDEB 1DLFL 2YMXH 3SQOH 1QLEH 1T89A 3SO3B 1CR9H 1QKZL 3U46A 4QHLA 1S5HB 1FNSL 1VESA 3G5XB 3TBTB 1RSFA 4PRDA 3MLVH 1IGFH 3IRZA 4IOFD 1NBYB 2VDRH 2WIIA 4L1DA 2YUWA 2DQHH 4HIHA 4PJIA 1OM3H 5F6IB 2FX8H 4V2CB 4WFHD 4P3DB 3KYNA 3O3AB 1Z9OA 4P9HC 3S6CA 2JK5B 1JPTL 3G5YA 3TCLA 5IG7A 2DQTH 3I50L 1NDGA 2BC4B 3WCYA 4JR9H 2DIJA 3K4DA 5BW7C 1GAFH 3DRTB 3LQMA 4G5ZH 3QO1A 3BKJL 4XNUH 1V7ML 2YUXA 3LN4B 4HD9A 4H25B 3LDBB 5DMKA 2R0LH 3RZCA 3L1OL 3L3IB 5F21B 2XFXB 3ZYIA 5D7IF 1KXVC 5IQ7H 1RK1A 1R3HB 1U6AL 3VD9A 2H1PH 4HXBH 3U0PB 2MFNA 1KV3A 1QR4A 1Z9LA 1W8OA 2HT4C 1NEZB 3H8NA 4FTVD 1QO3B 3HZKB 3VFSA 4D9LH 2CR3A 3RBGA 1JHKL 1GRWA 1YN7B 5E2VH 1NCCL 4HS8H 1YYLH 5BV7H 3L3OA 3LN9A 1YEJH 2F5BH 3TV3L 3S8WA 3E6HA 1N5YL 3AY4C 3BPCA 5EUOB 4PJCB 4OZHA 2ADFL 1A5FL 3QXVA 2DTSA 3MMEA 4PLOB 3P4MB 5L88H 1LP9F 3NCMA 3TT3H 2W9DL 2UWEA 2O61A 4IS6B 5GGRA 1KN2H 1DQLH 2W07A 3ECBA 1F3JB 4RX4A 3BZEA 2HT3C 3OX8B 3VXRB 4MDIB 2IAMC 1WZMA 4YBLC 3VW3L 1QHOA 1D3CA 1MF2H 2CUMA 3P73A 1NMAL 1IKNA 3OKKB 2A73A 3V6OC 1ORQB 5I8CB 4XAKE 4GBXA 1J0IA 4PYHA 4HIXH 2IEPA 2AK4E 2FGWL 2PNDA 4ISVB 4WCYH 5F88A 3VG0L 1MCNA 3CK0L 3T1FB 1KJ3L 3KLAB 5CZXC 4Z7WF 1UA6L 3TO4A 5J13B 2HVKA 5E2TL 4OT1H 5EORH 3PWVB 2I9LB 2GJ6B 2AXJA 1GYAA 1U8NA 4MXWL 3ZE0E 4FQXA 1R3JA 5HDQH 1UH4A 3B9KC 4Y1AA 4Y5XB 4OIIH 4X6CA 3UTSB 1OWWA 2HG5B 3KXFE 2NX5D 3DSNA 4G6JH 3MYZA 3O41B 4MA7L 5IMMA 4YHOL 1PFCA 1OY3B 3OR7A 4NUJA 1NDMA 2IMNA 4HS6A 1Q0XH 1AGFA 2ADJA 3RGVB 1YECL 4HFWB 1CE6A 4WUUD 4QF1B 4U1SB 1LK2A 2AS5M 3TVMD 5FGSA 5L2KA 3WMSA 2R39A 3V5KB 3V7AG 2VITB 4OQ1A 4ZUWB 1P7QA 3W11D 3QUYC 4NNXA 3VXMD 5JUEL 1FGVL 3FTGB 4B50A 3FQTA 1MCPL 1PGRB 3RIAF 2ZOKB 5SV3A 3CVHH 4QXGH 1T5WA 3ARDD 3NCYS 2DYPA 2X09A 3W2DH 1IAII 2FATH 2X6MA 1LGVA 3QPQD 3F7QA 4JZOA 3OGCA 3LKOA 3VU2A 1I9IL 3HMWH 1NGZA 4K9EH 4O4YH 3QWOA 3MNWA 1ADQH 4DGIL 4V1DE 1G6RA 2DQFA 5FUZH 5GS0H 1U2HA 3LS5L 3NIGE 3PWUA 5FF6B 3TIEB 3A6BH 3C5SA 3EYUL 4MNQA 2PYEE 4XNMB 4D2NA 1PG7L 3ZKSD 1ZLVK 4K3HA 2C7UA 2P5EA 3ZT6A 4RA0C 4L8BA 3X3FL 1JFQL 3A6CH 3GSRA 1WUNT 3D18A 3BE1L 1FNEA 4JM2B 2Y36L 3G5VA 3G6JE 4RMTA 1MUJA 1KJMB 1UT9A 3X14A 1CU4H 2F74B 3O8XC 3GI8H 2V6HA 1FE8H 2R4RH 5A40E 4GW5A 4P46C 1VFAA 4RDQG 1E4KC 3IXAA 1LEKA 4CMHB 1A64A 3R8BB 4NZTH 3ALWA 4HT1L 5FK9A 4KROB 3FL7A 5IEKA 4HMEA 1TQBB 5B3JF 3U6RB 3W82A 1U8PB 1NGQL 4YPGA 3DX8A 1VEMA 5GS0D 4D94A 2DDQL 3TO2A 3GSVB 1J1OH 2DKSA 3B9EA 3F7VB 4IRSA 4HSQA 3V6OE 4Y5VB 3PE9A 5F1IB 5MP6H 1CQYA 1MFDL 4PFEA 1YEDA 5DRZB 3QXDA 1A2YA 3RIAK 2X7LA 4BZ2L 1MQ8A 4LRNH 5ICYB 5A2FA 1E4WH 2J6EA 2E7LA 4Y4HD 3O6KL 3O3DA 5GIRA 4I0KA 2ARWA 5BOPA 4PV8B 4LF3A 3S3JA 2NZIA 4C4KT 2C4FT 1HHHB 5ICXA 4TUKH 5DJ6A 4IRJA 3UP1A 3TH3T 2Z8RA 1ZHLB 1AQDB 1U3HC 1Q9LA 3H9HA 1E28A 5IW3A 3NCJL 5BZDB 3MLRH 3V7AE 5L8JB 1T3FB 4JPVL 2QADC 2EC8A 3RIFF 3RKPA 3QQ3B 1AO7A 2HWZH 3VGAC 1ES0B 5DR5H 1MY5A 1SBSH 3HUJF 4CN4A 5JOEA 1MEXL 1WZLA 4U6YB 3RNKB 2Q7YA 4NWUL 1HZHH 5DVOA 4CAGA 1YQVL 3TYFA 2EXWD 4M9OA 5IQ9B 1EO5A 2VZ3A 2NX5B 5J1AA 4HIJB 1OB1B 1E27B 1BD2A 1JHLH 1NBVH 4Y4KD 1BGXH 4EBQH 1H15B 5IB5A 1EERB 4NM4L 4JKPH 5DUML 3RL1A 5LAXB 1XGPB 4GAYA 4K7PX 3ULUE 2BCKB 5GGVL 4ELMA 4KVNL 3O6FD 1ZHKA 3QXTA 3VXMB 2WLZA 3GIVA 2IADA 1I85A 5HVHB 4J12A 2ADIA 4WFFE 3IVKA 1JRHL 2H6PA 2XYCA 5FHBH 4BQCA 3HCVB 2W0FB 1HEZB 4LHJB 5IVXA 3ES6A 4LU5L 5J6HB 3GMNA 3AROA 4KXZH 2AI0L 2VDOL 5C0CE 5AAWA 4MS8C 1KOAA 4R4ND 1X5JA 5MHSD 1YJDH 3DYPA 5GGSA 1KB5H 1KG0A 3RIFK 3U4AA 2ZOLB 4Q2ZA 2BY2A 3BVNB 1HIML 2ARJB 5F9JB 4UU9B 1E6OL 2CKBB 2OR7A 3OL2A 1L7IL 1OP3H 5I1CH 1K4DA 1MFAL 4U05A 1BJ1J 3ISWA 4NN5C 3ESUF 4YGAB 1R24B 2GJJA 1YEHL 1KC5H 1TZIB 4JY5H 4LASL 2VZVA 5CGYC 4Q6YA 3STLB 4IMKA 4B5EA 1W0VA 5E99H 3AAZA 5C09E 1MJJB 4PV9A 1AFVH 1QBAA 2EYRA 1BBJA 4Z0BH 4G9DB 2VQTA 2VSCA 1UWEL 1ORSB 2F8OA 3TJHC 3WLWD 4I2XB 4FXGA 3IFPB 2GK0A 4MAYD 1HHIB 1AXIB 4N0FB 3OKLA 5C08D 5C2BH 3WUZA 1RZKC 5EU6A 5IBLC 4OZFB 5DJ2B 1TVBA 5D6DC 4PJ7E 4PREB 4QRUA 3MFFB 2G60H 4PJ9C 2XWJA 1FC1A 1PKOA 4G6AD 3MJ9H 4MWFA 4PJEA 4BQ6A 1DEDA 2C3HA 3MO1A 8FABA 2HRPL 3WKMH 4KK8C 1FNGA 3LEXA 1SEBB 2B7DT 3KYMB 2C5DC 1U91B 1SVCP 4YBQD 4PGEB 2BDNH 4NPYB 2DBLH 3WHE0 5JMOC 5FO7A 2YN3A 3FN9A 4ZDHB 1GIGH 4AIOA 4KK6C 4ODHL 1T7YA 1G1YA 1WISA 3WSQH 3UAJC 1ZVSB 3BN9C 4XPAL 1CZ8H 2RFXB 3MV01 4KJWD 1KIQB 2BSRB 3ARYA 5CKGA 3O6LH 5F1NB 3OAUH 5HHME 4NM8H 3TFKD 1S9VA 3MRHB 4PRID 2CK2A 3MLWH 4UB0L 3ARZA 2W65B 3BYYA 5E6ID 2F8VA 4FABL 3PHOA 3MR9A 5C0GA 5I75B 3HE7C 1P6FA 4P9HL 4LVHC 4FQXD 5D93B 3QFDA 2DS4A 1DDHA 3PQYE 4R2GC 3TBWA 4Y1AD 3X11A 1U58B 3S34H 4APQB 5FM5M 3VH8A 2V9TA 4ZYKB 4KVCH 4LHQB 3RA7H 2P47B 3DTXB 4UV7H 4L3AA 4P59H 4Z77B 5FECB 1A6AB 4ETYA 1CVSC 1W72B 2UV3A 5IVZA 3DNKA 2VO5A 1AXSB 3O6FB 4PRAB 2XV6B 4J7RA 3ZKXC 4TVPE 4XI5D 1P7QD 1CIUA 4NN6C 2VR9A 3B6SB 3TBVA 1BMGA 2AQ2A 3BD5A 4PIRF 2CDFB 3HG1E 2DYPD 3T0EC 5AZEH 1VENA 1KNOB 3BQUA 5F7KC 2KDGA 4N1CA 5FYKU 1HHJB 1I3GH 4QHNB 1BREA 4S1DC 2XN9E 4Z7NF 3IDNA 4KPHL 5H94B 4NUGL 3MGTA 5TF1L 3U79A 3OKNB 2EEBA 4FN0A 2WIIB 3V8OA 3CFJA 3MRGA 4MNQD 2ATPA 4U2ZA 3TJEL 4EN3B 5C6TH 1XF5A 3AMLA 4Z76B 2YXMA 2O5XH 4KK5D 5E5MB 2BNRE 2XKSA 1BQSA 4Q9QL 2J6EH 3BKMH 2L4OA 3G5YB 3P11L 2R9HD 3LD8B 1K8DA 3SBWC 5SWQA 3O0RL 2VKWA 5BXFA 4I1NB 4DOHB 1G7JA 4HXAH 5EPMB 4JPIA 3PHSA 5HHPB 3SDCA 4L4TA 5TE6L 4JLRB 1GC1H 5FDWA 4OF0A 1HQRB 4NGHL 3S36H 3SKMB 1HOCA 3SY0A 5CSZA 3VRJB 2EIZB 1C08B 2AQ1A 1D9KC 2YPLE 3OR6A 2HYMA 1CDCA 4L3CA 3RWJA 4GRWH 2RJMA 4MAYB 2IALB 5CJOH 1A7RL 1KB5B 2Y6SD 3L9RB 5C08B 1EEZA 1PZ5A 5D9SB 4I48A 4Z8FH 4ZFGL 5HI5C 4NJ9H 3Q6GH 2AJ3B 5AEAA 3RY6C 4M48L 3RVWD 4ODSL 5ANMB 4HUXB 4U1LB 5HYSB 1I7TB 1BBDH 2P8MB 3CSBA 4N8CH 2ZSVB 3OKOA 3N06B 3K0WA 3ZL4H 2EDRA 1GHFH 2FJFA 3HPJB 1X5FA 3IFLL 4HMCA 4QY8A 1J0YA 3JV6B 3PF2A 2HTKC 1WCQA 3MMEB 4NSKB 1HNFA 1N2RA 2NY0D 1FZOB 1CBVH 3QYCA 1OGTB 4XPHL 2A1WL 2XG5A 3MLTA 4UTAL 4JO2H 1MWAA 1RZ8B 5KOMC 2A83B 1NANI 5I30L 4JPWL 3T3PF 3WFEH 4M3KB 1EFXD 3BKYL 1R0AH 1SVZA 2JELH 1X5HA 1BX2A 3L3JA 3EGSB 4WVRA 2V2WA 2VZ1A 2OYPA 3BZFA 3MXWH 3TYGL 4NYLA 4KRPB 3MLSH 4AL8L 3RUGB 5CUSH 2WZPD 4NO2B 4XMPL 1D5XA 3WNKA 3ULUL 3IAGC 1B0GB 4MHHG 3QIBA 1AO7D 3P9MB 2VDLH 4FTVE 4PRIB 4P5MB 3UBXI 3N1FC 5E6IB 1QA9A 3GMRA 2NR6C 2X4NB 3KPPA 2P24B 4C59B 3KWWB 4JFPA 3R8QA 4AEIH 2Y06H 2WWMD 5KTEL 4FHBD 4HW6A 3T0EE 1J10A 4ZS7L 3MCLH 5F6HI 3GSWB 15C8H 2VTFA 4HPYH 4NDMB 4NO3A 3AGVA 1BD2D 4X9IA 1KCUH 1SEQH 1MHCA 2M8XA 1NDMB 3DURB 3K80A 5JA8B 3O2VH 2I07B 3WD5H 1CFQA 5C0ND 3LCYA 1LK2B 1ZWIA 2KKQA 4L8DA 5DRXA 4HKZB 3VFGL 1C7TA 5I71B 3UJIH 2ZP0T 5KVDL 4KMLB 1QLFB 3DPBA 4GXUN 1WBYB 4FFVD 4FFWC 4KRLB 3FQTB 1X6LA 1KBGL 2OSLB 3C87A 4WY7H 4N0RA 2OL3L 2GHWB 2XPGA 5D5MA 4PJHE 5EH1A 5CEYA 3UPRB 3V52L 1JE6A 4YNYA 2BOBB 4YHYB 2EDYA 4IDLA 1CL7H 1KPVA 1MHHB 3GJFH 3FO0L 1UM6H 4ODXA 1SHMA 4TSCL 2DIAA 1WIPA 4XAWH 3IFOB 2YWYA 3FONA 4JFZH 5SWZA 3LMJH 1OOAA 1QP1A 5K9JH 4P2CG 1KTDA 3ARTA 5D4QA 4IIQB 3X14B 5I2IA 5J11B 2QHRH 5HVFB 5IFAL 4XXCA 3UEZA 1PVHA 4X7DC 1XF2A 1JHTB 2I24N 2W9EL 3PDOA 1JGLL 3H7BB 5D2LA 1IT9H 1DL7L 5C0JB 4H0HB 2BFVH 1FFPA 2NLJA 5FK9B 2PXYA 3CC5B 4MJIA 1CFVL 3EYQD 5CD3A 1KEGL 2L0DA 3DHMA 1DTUA 1ZA6B 2JE8A 5EU6D 1YA5A 5JOPE 1N6VA 3LB6C 2E8ZA 4EIZC 5E03A 2L7UA 4K94C 4G6ML 1L7TL 4MMZC 4YHKL 4X9GA 2B4CC 1XGUA 1RZJC 5LBSL 1TETH 3EO1A 3JV4B 5F7HA 3H42L 3GHEL 1X5YA 1FSKB 5CHNB 2GTWA 1JF1A 4JRXA 1FYTA 2NY0B 1UJ3A 1MFEH 4AENA 1JPSH 5F7YC 1EDQA 1XGRB 2GCYB 3GMQB 1OARL 3ARBA 4Z7QE 2FCBA 2CPCA 4EDXB 5F7LB 4XP4L 3VGGA 1HI6B 1EFXB 1R3KA 3MNVA 12E8L 1T89C 4GRWB 1BVZA 3GJEA 5IK3B 4M7LH 1IKFL 4OZGF 4O2CA 2XTJB 5ESAB 5T1DH 5DHXB 2VLJD 4U1JB 1AO7B 3IDXL 4L4JA 1TJHH 2Z91B 4XC1L 1KF9B 4ZPVB 1H9VA 1E4XI 5EA0H 2A6KA 4TVPL 5EOTB 1ZT1B 1UM4L 3F7YA 1VB9A 4F7EB 2VN4A 3KPRA 1R3LB 5MI0B 4JFHD 3TZVA 1FPTL 1Q0YH 2Z9TA 1U36A 3PJSA 3PV6A 1JTPA 1R5VB 2VQ1A 5IIEA 2A6IA 1XH3B 5LQBH 4OM0L 3SDYH 3UJTL 5FGCB 4L29B 2MNUA 3RZCC 1MRCL 5J3HC 1GPOL 3OMZA 4LRIC 5D1XA 4ONGL 3KYKH 5L7XH 5J8OA 4L8SB 4N8PA 3AMKA 4F7TB 5T1MB 1T1YB 1T20B 2BSED 2NY3C 4ZFOA 1A6ZB 1OTUC 5F3BB 4L3EB 4X7FC 4RBPH 2NXYC 3GIVB 5IW6A 4HUVB 5CFHA 3ROOA 5E8NB 1RZKL 2ADIB 1NC2A 4M61B 4HIIA 4I0PB 2IQ9H 4CW1A 3MRRB 4J3UA 2V5SA 3Q2CA 2PTUA 1RMFL 2HJFA 4O2EA 4LSTL 4S1SH 4OLWH 4I3SH 3DI3B 3KHQA 4N5UA 4UNVA 3RVVC 1GOFA 1MFCH 1UC6A 5DRWB 1EUTA 2QQNH 1RZGA 1L9MA 4DWHA 4NN7C 1QSEB 2HJKA 1AD9A 3CDGA 3M17B 1WQVT 4BSVA 4FZEL 2LABA 3QB7C 3EDEA 5GZOD 1RURL 5BS0E 1EVTC 1T2QH 2BX5A 3RWHA 3EO9L 5HGBB 4GBXC 1PYWB 2DQDL 2A74A 5E9DE 1LEGA 4LLUB 3LQZA 4QOKD 3VFOA 2PCPB 3BW9B 3DX9B 3QCTL 3T0VA 3MV9B 2BXZA 2OQJA 3TO4C 2R4SL 2OP4H 4XBEL 4PV9B 3PL6B 4JQIH 2CQVA 1X4XA 1C5DB 4Z7UE 1DN2A 1TITA 2BK8A 4WEBH 3S5LA 2DTML 4F80A 2GEEA 4M43H 2HP4A 2YD2A 4KMTL 1RU9L 1NFDB 5ERWA 3OHXA 5JORA 3ARFC 1QSVA 4NP4L 5FEBA 3ZKNC 2VABA 1QSFB 2DL2A 1RUKH 3RDTC 1LP9A 1P1ZB 4JE4B 4KJQD 4X8JB 5MHSE 2Q1EA 4X5WB 3DUUA 1RFDL 3HMXL 3RAJH 3GJFB 4KK9C 3D2UB 3ARXA 4WO4B 3C60A 2YMXL 1NCAH 4HLJA 1CR9L 2LFGA 1X5IA 2ICEB 2FX9H 5GSVA 4PJIE 4QHKJ 1VDGA 4U6VH 3ZO0A 3QUML 3WDIA 2YRZA 3O9WC 3MLVL 1IGFL 2DKMA 3LEXB 4GG6E 2VDRL 4XHQA 3FOLB 5HD8C 2FBJL 2DQHL 1YEIH 4HFUL 5F89B 1DQJA 2UVEA 2FX8L 1Q9OA 4WTZA 4OLZH 4QTHB 2W91A 1CLZH 4R90H 4Z7WA 2IGFH 4ODBD 1BVLA 1FDLH 1IEBA 5DWUH 2DQTL 2JB5H 2DRUA 3MA9L 3WIFB 4OGAD 2YBRA 4LPTA 4CDGC 3BIBX 3MA7A 5GS1C 1GAFL 4X7SH 5E70A 4HZLA 4G5ZL 1FO0L 2GSGB 4XNUL 5HYJA 5TE7H 2Q3AA 2CUIA 2XA3A 3DGGA 3DVFA 5DVLA 5CLWA 3KLHD 2VLJB 4JPKH 4HGKC 2R0LL 3N85H 4UDTB 3QIBD 3BEVA 3HZVA 1CK0H 2H1PL 4M3JA 1QFPA 4HXBL 3ARRA 3D85A 3EKCA 3SJVB 4JZJA 1A6WL 4LCUB 5DJDB 2GUOA 4E41D 4OZHE 5E2VL 4FQQA 4HS8L 3VXNB 5BV7L 2EDWA 3OJ2C 1OAUL 2BZDA 1QFWM 3JV5A 4G9FD 1T7XA 1EEUA 4UQ2A 3T8XB 2X4PB 3GO1L 4YHMH 1OT2A 4TTDC 1QQDA 3V95A 1G0XA 4ZG1A 2E8YA 1V7NH 3CLFH 5BJTA 5E94A 1YNLL 4IRSC 1P5VA 1JWMB 3B5GA 1MF2L 1KPUB 3BH8A 1YNKL 1U95A 4LLMB 2E7LC 4LKXA 5EU4A 1DFBH 2FHFA 1INEH 2B5IC 1MJ7H 1RY7B 4IJ3C 4HG4K 4FG6C 1IAKA 4V2BA 3VJ6A 4HIXL 3BGMB 4WCYL 3CH1A 1RJZB 4CADB 4BH8A 4NO5A 4IRJC 5EORL 3L3KA 2X10A 3GIZH 3MFGB 5D1QD 4Y1AE 2YEZB 4F37F 3SDDC 4X6CE 4XMLH 1TTUA 1VFOA 2IQAA 3CFJB 5C9KA 2KQNA 2LU3A 3O2DA 4QHMA 4UV4H 3KYAA 2V9RA 5HDQL 1FNFA 4K3DH 4OIIL 4J8RA 3LV3B 4X4ZA 4UQ3B 4G6JL 4LAQH 4QOKB 4PJBB 4E9LA 2LTQC 4XVTH 5SWZD 3BRGC 1G7MA 3BXNB 1NLBL 4X4YA 5L2KE 3VGBA 4LBEB 1Q0XL 4OQTA 5B4MD 4LSQH 5DO2D 4IHOB 2Y07H 1S3KH 1YNTB 2OR9H 3EDFA 3IFNH 5BQ7B 2FBOJ 2EDOA 2A38A 3SKNA 1BP3B 1LE9A 3CVHL 4QXGL 5HPOA 3RVXD 5K9OA 1ZSDA 3W2DL 3CX5K 3GMMB 1QOKA 3P9LA 5I6XC 3S98A 2VH5H 1PX3A 3HMWL 4K9EL 5GJSH 5C0AB 3WJLA 4MNQE 5DEGA 1ADQL 5I1HH 3W39A 5FUZL 3KPMB 3SKOA 2P5EE 4JRXD 5JTWA 1I85C 4MXQD 5JO5A 3UYPA 3QI9D 3LZFH 2VDMH 4XNZC 1WLHA 4LPWA 3IDMB 4F37K 3HUJA 4LCCA 7FABH 2JF1A 1ZT4B 3MNZA 5KSVB 5F7FA 4Q7DA 3HAEA 3RKDD 4R96A 2V2WB 2WIMA 4XH2A 4N0UA 1BAFL 4RIRA 3GI8L 3OKEA 3OWEA 2R4RL 1EAPA 4QCIA 4ZFFB 5EIIA 2BSTA 1Z6JT 4Q9RH 4Q9BA 5BO1H 2VDPL 3G6JF 5B22A 3CVIL 5FO9B 3GMRB 1RZIA 4OGZA 3M07A 4OSUH 3S37H 1M7IB 3LN5B 3I3EA 5C71A 3KPRD 4UIMB 5EU3B 2FZ3B 4IMKC 3TZVD 3RNQA 2JJSA 4ETQA 3JTSB 4E41B 4F15B 4L9LA 5MP6L 2YSSB 5AUMB 1RV6X 1U8OA 5T1KA 3O3EA 4LRNL 1NKRA 1XIWD 5JW4M 1JMZA 1U9KA 5DEFA 3MJ8B 3DMMA 5B8CA 3UX9B 1PSKL 4G9FB 4QXUH 3MRDA 1RJYB 3FT4B 3Q5TA 3MLUH 1NGWB 2BMKA 4LCWD 4XWOC 1RK0B 5TGBB 1B2WH 5EO1A 1M1SA 5DFTA 4KI5F 4JQXA 2OR8A 1GH7A 3UJJH 4NO0A 4XTRD 1BEYL 4X83A 1WT5A 2BJMH 3L95A 4QRPE 1PDKA 2H3NA 4FA8A 4PP2B 5DD1H 5TF0A 3VWJA 3U9PH 1NC2D 4K94L 4AJ0A 4JKKA 2B4CL 4M6MH 3C08H 1K2DB 1LO5B 1RZJL 5GGUA 2F54B 3MV7E 4MNHB 2XPGB 3QWQB 2FEEI 3KYOA 3G6DH 1FG9C 5HHQA 2HWZL 3BDYH 4GAGH 4P2OD 2H2PD 5DR5L 5D1QB 1SBSL 3RTQD 4H8WH 1NMBL 3F5WB 3JWDC 1CXKA 1RHFA 1HZHL 4Y2DA 1L6ZA 3LRGA 5CS7A 1J1XL 3Q5YA 3FB8A 5KN5A 1JHLL 1AIFB 1BGXL 4EBQL 3AXLA 4KY1H 2JJUA 1TNNA 2VAJA 3MRCB 1H5BA 5FKPB 4ELME 3ULVC 2D31B 3IU3B 3L5WA 5I2IB 4FMFA 1ONQA 4IOIA 1A9BB 4OLVL 1FNAA 3E2HC 4G42B 5DSCA 1H3GA 1X5GA 3O11B 4X6FA 5HGDB 1AC0A 3TIDB 1KGCE 1DBBL 1KULA 4NQXB 5DJZA 1OD9A 2PYFA 5IVXE 3DO3A 4KU1A 4R26H 3FQUA 5FHBL 3EHBD 5GHWH 3MV8B 3D69A 2AJZA 2BHZA 1YMMB 3HI1A 5C92A 3GI9H 3F58L 2KZ1B 3MJ7B 4KJPD 2P43B 2X1QA 3RY4A 5D8JH 1AGDB 3C60D 2QL1A 3TN0A 4E0RB 5ELIA 2N56A 3VH8G 4YC2C 3HN3A 4N8VA 4RDQF 5E0QA 3GUTA 2GTWB 5A3ID 4PY7A 4HK3J 4S1RL 3CJJA 4XBGA 1SYSA 1VSCA 1UJ3B 5FB8A 4ZO9A 1WBXA 4X5LA 4AM0B 1ZHBA 3QI9B 1EBPA 3JTTB 4OV5A 5I1CL 5EO9B 3QDGE 1MJ8H 3BO8A 1I1AA 1TVHA 2ZZUT 3BQUC 3QIWB 2WBKA 5JW3H 1WTGT 1KC5L 1UWXK 2PR4H 3KNBA 1V3KA 3M1BA 2Q8BH 4YDKH 1IM9D 1KCVH 4JDZA 3ZTNH 1IBGH 1YZZA 4K7PL 2OI9B 5HYJD 1DQMH 4JQVA 1FORH 4Z0BL 4JHAL 4TVSa 2GJZB 4NHCH 3CPLA 1A6PA 3DX6A 2GKIA 3V4PL 3V6ZA 4DKFH 3D85D 2IANE 5JHDB 1FFRA 4PJEE 5E5RB 5LGJA 3FQWB 3HC3H 3SDCC 4X6DB 1XIWB 3GK8H 2ED8A 1LEIA 3UTTA 4K8RC 1ZA3B 2FL5A 2OTUB 2J8HA 2QEJA 4LCWB 3WKML 3RJDA 3NN8A 4PJ7F 3C6LA 2R2HA 3X12B 3D0VA 3QFJE 1NCNA 1RHHB 4PGDA 3WJJA 5H37H 1MCCA 1D5BA 2DQEH 4ZSOA 2E3VA 1I7ZB 4EQ3A 3PP4H 1AI1H 1I7UB 1VA9A 4BH7B 4OQTH 4RAVA 3WSQL 3LDBC 3C9NB 3S96A 1CZ8L 3ULVE 4LSSL 3O6LL 4P2QB 4OBSA 3OAUL 3STZB 2V9QA 3NA9L 1TQCB 2VSDA 1MREH 4NM8L 4P2OB 3RTQB 4Q6IB 3EOTH 5EZLA 4LCYB 2ZNXA 3VA6A 4ZNEA 5HHXH 3PIQA 2G5RA 4N9GA 1NQBA 2OS7A 4D0DB 1UM5H 2A74B 5D7IB 2VL5B 2NTSP 1J18A 4F7MB 3LEYL 3PXJA 1G6RL 2EE6A 4A6YA 3UYOD 3RA7L 1HE7A 1UKQA 3QQ4B 2OQJB 5ITBH 1RULH 2JCCA 4UV7L 5I15L 1JZ2A 3U1SH 3PWNA 3VA2C 5DD0L 3D39B 2DM2A 5FYJU 4F2MB 5JNYB 3BJ91 5D7JA 4RGOL 5IKCA 4X9FA 3OJDA 3HAEH 5ERWB 4AMKL 5KS9B 5C0EA 2GAZB 1NSNH 6FABH 4MAUH 1WC7A 1JJUA 3EYFB 1G7HA 3QUXA 4EI6A 3V8CA 1FL6A 3CSGA 1A1NA 3MRLA 3JWOH 5AZEL 1G7LB 5E2WH 5B38A 4YAQA 5J13C 1ETZA 5JXEC 3D0LA 1V8HA 3AS1A 1I3GL 3U9UA 1B9ZA 4M03A 2ICWB 4GRMB 5CZVH 3M8OL 2Y7QA 1A3RH 2VXSL 1BZQK 1D6VH 4Y5XC 2EDEA 4NQEA 4ODWB 4R97C 2WBJA 2YA0A 1M7XA 1ZMYA 4FMKA 5C6TL 1WK0A 2O5XL 4OUOA 2APTA 4FFZH 2IFFL 3N0PB 2J6EL 3BKML 2AABH 4L4TE 3DIFB 3C09B 1IM9B 3JV0A 3NABL 3BEWA 5HYJB 1J88A 1GC1L 4TULL 4KDTA 1HQ4B 1OAQL 4F7PA 2UVFA 3HB3C 4P5TA 4WGVB 4H1LA 2VR4A 5CJOL 4Z0XB 2X89A 1BOGB 4NQTA 5IMOA 4N1EA 2DI7A 4Z8FL 3MUZ1 3QJHB 2B20A 3Q6GL 4PJGF 3L5HA 3K1DA 1JVKA 2EDTA 3B3IB 4QNPE 3ZTJG 4N8CL 1BBDL 3CLEH 3SDAC 5T1KD 2LAGB 1GHFL 3DMMD 4RGMC 5D96C 3T77B 5HGGS 4AIXA 1XZ0A 1BVKB 4M93B 1S7RA 3IXTA 2PXYC 5DS8A 1S7TA 4Y16A 5CIPA 4J3SA 4ONFH 4NCC2 1I8LC 4ODUA 1CBVL 3SEPA 4MB5A 1MIEL 1JWSB 1MLBA 1HHGA 1IM3A 2CRIA 2PKDA 4JO2L 4JM2C 4NO0D 4LNRA 2NY5C 4NRXA 4P4KB 4PP1C 4HKBA 3VWJD 3KGRA 1MI5D 2YKLL 2ZUYA 5EU4B 4P9MH 1K6QH 5LCVL 4IMLA 3VFUB 3GB7B 4CMHC 3MXWL 1HNGA 3MBEA 3MLSL 3QQNA 3SPVB 5CUSL 5GZNC 1CG9B 1PLGL 1G7QB 4KROC 1TQBC 4QWWC 4XNXH 2AJXL 2N7BA 3S36X 2VDLL 4JO3H 2ZJSH 1RJLB 4PGCA 3DROA 1AKJA 3ARBC 3D9AL 5ETUB 1G9MH 5F93C 2FGZA 4Y5VC 2J3SA 3P0GB 4X5XB 4F3FB 3VFTB 4UOW0 4AEIL 3D25A 5ESVA 2Y06L 4IRZH 4WU5A 3PABA 2ZSWB 5E00B 2YK1H 4HIEA 1WJ3A 5JLZB 3MCLL 3B8SA 1NC4D 4LKCA 5D70H 15C8L 4Z78A 1EHLL 4JEGB 1SEQL 2DBJA 3LHPH 2CMRH 2YS4A 1S9WA 5ISZA 3WD5L 4RISH 3BP7A 4ZXBA 5M94B 5DQ9B 4J23A 2P7TA 3BP6B 1I3UA 1B0WA 2Z0BA 3WS3A 2VLMD 4N90D 4HJ0C 3CFKA 2AXGA 1Y6KR 1J8HA 4X4MA 3SKNB 1VFBB 4WRLA 1I3RA 4JRWA 1GGBL 4WHTA 5D5ME 4HUKB 1TZGH 4WY7L 1H3WM 1KCRH 1J0ZA 1XGQB 2QQQA 2HFTA 5A2IH 5D1XC 5GRVL 1XF3B 3GMPB 3GSUB 5CMAB 2IH1B 2NY4D 5F8RC 2VLKE 5TPWL 1L6XA 1F8TH 3WNNA 2LU4A 1DE4A 1T7WA 3SKOB 3CFDA 2R2CA 5HYFA 3I02B 4M1CC 1CL7L 4OLXH 4G8IB 4QRQB 2DMCA 4R0LC 2V7HB 5I1JH 4ZUTB 4WTXA 4LPXA 1UM6L 5SWZE 1QBML 3EAKA 3GBML 1HKLH 1RIUH 1QVOA 3FQXB 4XAWL 4ACPA 5I1DB 5KSAB 4NJAH 1A7NL 2X4TA 3GBNH 5IHBA 4HHAB 1A9EA 4ZPTB 4NRZB 3LMJL 2X4UA 1GGCH 1MH5A 5T3XH 3TA3B 1MCWW 4PJ8D 4R96B 5F8QC 5D2LE 5HTSA 1MHEA 2QHRL 1KIPB 3DV6B 5EBWA 4HPOL 3MV11 5AD0B 2MQCA 3RWFA 2BSTB 3SKJH 2EO1A 4MJIE 3ILQC 2YHGA 4E5XA 3BP4B 3JWDL 4OZIB 4XPGH 3FFDA 4M7JL 3ZKQD 2BFVL 4ZUVA 3WS6A 4MDJB 4DGYH 5JA9A 2K3TA 1HHKA 4LLWA 1FAIH 1NL0L 4JO4H 4OZ4A 4NC1E 2R2BA 3AREA 1D6EA 4R4BB 5DA4A 3ZE2F 4TUOA 4R8WH 5ID0A 4UOJA 4RWHA 3GMOA 1I4FA 5CD5D 4JRXE 3ULVL 1EVUA 1FFOB 3BZ4B 1FYTE 1TETL 1TJGL 4HGWA 2BSSB 4OKVA 2Q86B 4YDJB 5DVMA 4XXDB 3KJ4B 3UTTD 2HA1A 5T3XD 4OUUB 4MYWB 2X4RA 4I18A 4K71C 1MFEL 2RAMA 5EO1B 4GLRH 4WV1A 1JPSL 1HSAA 2MMXA 5CJ5A 1ZK9A 3MLXH 1V5JA 4XGZA 3S5LG 2B1HH 4PLJC 3ZSTA 1N0XH 1ITBB 4H5SB 4WFGD 3E0GA 35C8L 1MI5B 5CINL 1M6OB 4HGMA 4IDJH 5HDBF 4U1HB 3S4SA 3W0WB 4M7LL 2F19H 2E7HA 4P3CH 2B2XH 5T1DL 3ZE1E 4HAGA 4XBPB 2X70B 5EZJB 4ZS6D 1DEEB 4M4RA 3LRSB 2NW2A 1QPPA 2NXZB 2W0KA 3O4OB 5E08H 5EA0L 4BYHA 2AK1H 2HFEB 2V2XB 1Z3GH 3OPZH 1DQQA 3DOSA 4U1KA 3QO0B 1I9RH 3SDXB 3RU8L 1Q0YL 4HLZH 5I16A 4CRPA 4WTZG 4KKBD 1NC4B 4OZFG 4GW1B 1EXUA 2K9UA 5KN5B 5LQBL 4KGLA 3SDYL 3UTQA 1OTTC 2A9NH 3IDGB 5ICZB 2IBGA 1GGYA 3U30B 4H0IA 5JQHC 3RX8A 1T4KB 3I85A 4LVEA 4G8GD 4JZJC 3MBXH 2F8XC 3EBAA 4I5BA 5DMIL 2KL6A 5JDSB 2GY7B 3KVQA 1S7SB 1T1XA 5JZ7D 1JGEB 3FQUB 2IQ9L 1I75A 5FKAB 3NZ8B 4P23A 3QUXD 5JMRA 3L3HA 3QQ9C 2H2SC 1ZS8B 4I3SL 4K8RL 5GXBB 4MD0A 1G6VK 2W60B 4A2LA 1ZGLA 2DQCH 1DZBA 1MFCL 4YK4C 2VERN 1JGDA 3U7YH 5D93C 4H1LH 3EJYD 4HWUA 4RGNE 5JW5B 2ADGA 1SYSB 4NQED 2WBJD 4IM8A 4APQC 4GQPH 4WWKA 4FOMA 1ZV5A 2H8PA 5I1LB 5TQ0H 4L8CB 4MD4A 2VL4A 3BKJH 3GMLA 3LKRB 3DX7B 4OV5B 4BJLA 1T2QL 1MCSA 3T2NL 3BP5A 5MERA 3I2CH 5HHNA 3L1OH 2YUZA 4CNIA 2X4SB 5E4EC 1KTLB 4D0BA 4PJ8B 1HCVA 3EYVB 5IB1B 3UYRL 4U6XA 5L0QB 1U6AH 2OP4L 1TPXB 1YUHB 3FB5A 5DJ8A 3U4EA 4JQIL 2XZZA 3BD4A 3BD3A 1MWAL 1JN6A 1UACH 1LD9B 1LP9E 2BNUA 4QRTA 1OSZB 3BKCL 1AGCB 4PTTA 2MCPH 2CJUH 4FQJL 3MLPA 2X89D 1A1OB 1RUKL 2XG4A 5ENWB 3R4DA 1WFNA 2BNQE 5GRJH 3RAJL 3T4YB 5ALBH 5DLMH 2OMBA 2W9DH 4LSVL 1NCAL 1FZJA 1WFTA 4ZTPH 4GW4A 4KC3B 2FX9L 2XACC 1T1ZA 5DJAB 4EN3C 1NLDH 4U6VL 3VW3H 1DLHB 4MNGB 4XCNB 1N6QH 1FL5A 3OXRB 1M71B 3FO2B 4DEPB 3LD8C 4Y5YA 4OLZL 3BPNB 4R90L 4K23H 4X9BA 3T3MF 1D5BB 2FGWH 4XCYA 1JTTA 4K7FB 5DWUL 3W9DA 4OFPA 1KJ3H 3H9SD 4FFYL 1CYGA 4GG6F 2WQRA 5KSBF 32C2A 1NUDA 4RAUB 4YHIA 1PKQB 2AK4A 3RWEA 3MRJA 4PLKC 2YPVL 4X7SL 4NBZB 4JFEA 3BX7C 2AQ3A 2RR3A 4ZUSA 1U8LB 3HHRB 5DZOA 4FXKA 1JNHA 4L9DA 4JPKL 3E6FB 3QDMA 5A43C 5SX5K 3N85L 1ED3A 4MA7H 2OZ4A 1QFWI 1IGYB 1CK0L 4C57C 5KG9A 1AKJD 5IWLA 4ENED 2R1XA 4LCCC 4CN1A 2FR4A 3EZ8A 1M05B 3TBSB 2BRQA 3RWCA 3ZKMD 4BQ9A 1FP5A 3HS0A 3I6KA 4HK3N 3D3VD 3RVTD 1K85A 4XCFH 5HJ3B 1PEZA 4M8QB 5JUEH 2H9GA 3FO1B 4G7VH 1IE5A 3HAEG 3QZWA 1U8KB 4OCRL 5I9QC 1MCPH 5ISZD 1F6LL 4HF5L 3VFNA 5IB3A 1P2CA 4ZXBD 3BGFB 4LHUD 1VKXA 1RPQA 2C1OB 3O6ML 3SCMB 4G8GB 2Q20A 5TFSH 1UB6A 1VEPA 1HYSD 2WM0A 2IBZY 4L9LC 1I9IH 5IESL 1J8HD 3U7WL 5HBBA 1XF1A 4KRPC 2VLRA 3IJHA 1S9YB 4DGIH 4O5LH 2YPKA 5JHLH 1HDMA 5B8CC 2P8LA 1DFBL 4KJYA 1INEL 1F5WA 1MVUA 3D6GA 4XNYH 2EKSA 3EYUH 1ETZB 3D0LB 1XGYH 3ULSA 4Y19A 1BFOA 2EDKA 1UADC 3RVUC 1CFTB 3OB8A 4Q0XH 1JFQH 3V5HB 3P77B 4KRNA 3GIZL 3NA4A 1WT5C 1A1MA 3BE1H 4NQEB 4H26B 4CU7A 2Y36H 4KKAC 5GS3A 5D7SL 5FFLA 2F53B 4LOUD 2DI9A 3BZDA 4XMKH 2OTPA 4UV4L 5B3JE 3EYOB 1A6VL 2Y23A 2CGRH 3G6JA 3QIUD 1UH2A 4LAQL 2EC9U 2F5AL 3AY4A 4WI4A 4EIGB 5IT2H 4X6CF 3QEHB 4U1NB 3QUKB 1JP5A 2FJHA 3C6SB 5F44A 1AR1D 4M8VA 3SE3A 3L3DA 1NGQH 4PJDF 4QGYA 3EDJA 2DDQH 2BVQA 3QNXA 2Y07L 4MD5B 4PJFF 3FO9A 2A6DA 2OR9L 4Y2DC 2IAMA 4PGBA 4PGZA 4BZ2H 5JW4N 3CZFA 4U1GB 1KTRL 3V6OA 2BERA 2C3VA 2G5BB 1HINH 3ARED 5ILTL 5D2NB 4F57L 1CT8A 4JFFA 5F7EH 2Z92B 3UTPD 5C0IA 1J05B 1L0XA 1QEWA 1U0QA 4YHYC 3QXAB 2VH5L 5IJVA 3QSKB 3TH4T 4BSWB 5I1HL 3IJSA 4Y8DC 1CICB 3CXDL 1IGTB 1OGAD 5C7XH 3IXTB 3NCJH 4B41A 4ODUB 5GGVY 3VXSA 3HUJE 4M00A 3RWGB 4JPVH 2HLFD 4DZBA 3LZFL 2VDML 2X1WL 2JB6A 4M7ZB 3S7GA 5LGHH 3GSQA 2DLIA 3H9SB 4IIQC 7FABL 2HT2D 1A0QL 4N0UE 2HLAB 4OTXH 3TN0C 1KELL 4RMUA 5DD6B 1MEXH 5C70A 2E6PA 1TZHB 3GRWA 1KT2A 1TIUA 4BSJA 4ORGA 4ZFOL 3MSPA 3S3SA 1PZUB 3QUYA 2RQ8A 5F3HA 4UDUA 5BO1L 4WENB 4P3WA 1QRKA 1HH6A 1I1AC 4N8VG 4E42B 4OSUL 2NW3B 4R7NA 5HPMA 1BZ7B 4NM4H 5DUMH 4DKDC 4WW2B 2NZ9C 3T08A 3EFFA 1MCJA 4XVSL 2CDGA 1UENA 1BFVH 1EZVY 5GGVH 2ITCB 4HIEB 4JAMA 1W0WB 1G7IA 5MEPA 3QDJA 5DI8A 3D3VB 4PS4H 4TSAH 1XGTB 1A4KA 3VFMA 4Z6AT 1CFSA 1RZ7H 3H0TA 3MLUL 5ISZB 4NQDA 4JZNA 3KPOA 4G8FB 2Z4QA 4LHUB 2IPKB 4PRBB 4AIZB 1N0LA 1KB9K 2W38A 2XOTA 3RRQA 1FVEA 4DVRH 4RNRB 1J8HB 1E0OB 5DD1L 2XTJC 3NPSB 3MROB 5C6WH 4X6BB 4ELKA 1H8OA 5HYIA 3P0YH 4P23D 4M6ML 3C08L 4AH2A 2D0FA 3JBG7 3RQ3A 3RJQB 5F1OB 4HK0A 5A16B 4YHZH 3UMTA 1E4KA 5ESQA 5FO8B 1L7IH 3C6LC 3G6DL 1ZXQA 1F11B 3BDYL 4U1MA 5MI0C 3WJJC 2WUBL 5DC9B 1YEHH 2A6JB 4OZGB 3PGCA 4WHYH 1I8KA 1MOEA 1V05A 4GMSL 5EOCH 5CEZE 1YPZA 5IBUB 4WWKD 3S37X 2X5PA 4JKMA 4S1QH 4HDIA 1Q9KA 5EBMA 3OJVC 3QIUB 2HJLA 3R1GL 4WI9A 1AGEB 5E8EA 5C0FB 1UWEH 5I76A 1JF5A 4WFEE 4ZO6A 2X4OB 2R23B 2X9YA 3OXSB 4EVNA 4BELD 4N90E 2X2YA 4NKDA 1JPGB 1MCWM 4I0PC 3K46A 1UXWB 2VISB 4N9OB 5KZCD 3BPOB 2ITDB 2ZKHL 3D5OF 3T65A 4TQEH 5IEHB 2EKJA 5DHYA 5ID0B 2WINA 3GMOB 2VIRA 4Q74A 1D5ZA 3WKNA 1NJ9B 5IVXF 5D8JL 1IGJB 1N3NB 4HKXA 4LLDB 2VB5A 3WFDH 1F4AA 1FIGL 2OZ4H 1C16B 1NGXB 1J0JA 1OGAB 2A0LC 1N64L 5D7JC 1B90A 2FEDC 4ODHH 4C4KO 2AV1B 1HWGB 1L4IA 4G80A 2AV7A 3EDKA 3NFNB 4I18B 5F1SA 5INCB 2JIXA 1T03H 1DR9A 1E6JH 3WL9B 3NFSH 1QFHA 4OD1L 4AEEA 2FO1A 1IAIH 1P7HL 1B6UA 1T0NA 1MJ8L 3PP3H 4GUPA 5DK0B 5FUCC 4X0KA 3FB7B 2UZYB 4XAKD 4UAOC 3IDJB 3PL6C 2PR4L 5IF0B 4PTUA 2Q8BL 2AK4D 4ZTOL 1KCVL 4LEXH 3WE6A 3ZTNL 1IBGL 5A2KH 3TNMB 4P9HH 2E6QA 3Q48A 1DQML 4JG0L 5B38G 5DYOB 3KPQA 5EO0A 3QDMD 4HLZG 5ABDE 2R1WB 2BVPB 3KPNB 1DJSA 1DVFC 3VMPA 3S35H 1S7UA 3PQYA 4PR5B 5HDLA 3V0WH 1BJ8A 1FJ1A 4WO4C 1BPVA 3KXFD 3N1QC 4DKFL 4WU7B 3LIZH 4NT6B 5GSRA 2AKRA 5HI4C 3QEQB 3UTTE 3CCHA 5CWSB 1BQHA 2EDXA 2VC2L 3G6AA 1AE6H 1AP2A 1IEAB 3UTQB 4KDVA 1WCBB 4KDTC 3I3BA 1K4CA 1KCSL 4NHUB 4P5TC 4PJEF 4W6XB 4LGPB 2PW2A 3O2DL