1HCFX

Crystal structure of trkb-d5 bound to neurotrophin-4/5
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
SHMAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/hormone
molecule keywords NEUROTROPHIN-4
publication title Specificity in Trk-Receptor:Neurotrophin Interaction: The Crystal Structure of Trkb-D5 in Complex with Neurotrophin-4/5
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 101
sequence length 101
chains with identical sequence Y
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2001-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hcfX00
4KUZH 4M43H 3OF6D 5K33A 3WFBL 5GRWA 1Q9KB 1EMTL 2X4RB 1FG9C 4GW4B 4Y4HA 5IMOA 2YKLH 5FF6B 2PW2A 1QBBA 3WO4C 2OR8A 3T08A 1QEWB 5EG6C 3VXRB 5CSZB 2OTUB 3P0GB 2OM5A 2ITDA 3QDME 1FDLH 3VI3F 1FZOA 4PJGA 2O93L 4L8CA 4G8GE 2CUHA 4LLDB 1QTYT 4JGJA 1RZGA 4K71C 4KTYA 2SEBB 1DVFA 3C5ZB 2FWOA 2XXMB 2OSLA 1VFBB 5D70H 3SPVA 1KIQB 2WK2A 4OZGA 2VZ3A 5F7HA 3GJFA 4CRPA 2VL5A 1H3XA 3OKMB 1S9XB 3SDAB 3DETD 3WFZA 1YEHH 5BS0B 4JR9L 4NKIH 1HI6B 1XGTA 3QIBA 2HN7A 2QJDA 1ZANH 2A9ML 1ZLUH 4V2CB 1JRHH 3QULA 5EN2B 4HWBL 1FL3A 4E41E 4YHIA 1PQZB 2PXYC 1DN2A 4KRLB 1UJTA 4ZOEA 1OF2A 5GS0D 2CMRH 2NTFA 3V0WH 4Y1AB 4ZFZA 3T0ED 2GYSA 4MA7L 4YFLF 5K9OA 2RFXB 3OSKA 2BNQA 5E9DB 3EOYG 4FTVB 4N0FA 1CTNA 4JHBA 4RBPH 1KB5A 3RWJA 1RULH 4XRCA 5HGGS 5FYLL 4JREC 4S2SB 2VLRA 3STBA 2NW2B 1GC1H 4IIQC 2YPVL 4Z95L 1P7QB 3OV6A 5DRXB 1YY9D 1Z0NA 1ZVSA 4X9BA 3ZHLA 3MBXH 5IP4A 5C0EA 5C0CB 5C09A 3VWKC 5SWZB 5EORL 5KG9A 3IAGC 1BFOA 4N8CL 1HXYB 3PXHA 3O9WD 1QLFB 4QHNB 1LGVA 4G9FB 1KJVB 9CGTA 4POYA 4UU9B 4JB9L 3H7BA 2EEBA 3TZVA 4ZFFB 5ELIA 4F57H 4F33B 5CGMA 5JOPD 2ICWI 3MOBH 3Q5OA 4PJXB 5HDQH 1RJZA 3O2DL 3GMMA 3AM8A 1JPFA 4QXUL 2AABL 3C6LB 4OJFH 1KCLA 4W6WB 4YFDB 2VLJA 4JRYE 5CJQH 2MWCA 1FZMB 5DD5L 4NP4H 5FOBA 3IJYA 4OFYA 3SDXF 4PJHA 1RVFH 5DC4B 5DUML 1EEQA 3TV3H 3QDAA 2MCG1 4KK5D 1J88A 1EXUB 5I15L 4HS6A 1LDPH 2UV3A 1UACL 4JY4B 4P4KA 3B3IB 5IR1B 1J5OH 1NEZB 2X1PA 3P3YA 3OTTA 1H3PH 4WFGE 1X4XA 3O4LA 3HS0B 3MV8D 1UM4L 1WUNT 4R4ND 4PRAA 2DQCL 1A22B 4RAUA 3AS0A 2EYSB 1D5BA 1LO0L 4DCQA 5KSUB 4JFEA 1TJGL 3FHAA 3GHEH 3GRWA 5EPMA 1P7HL 3HUJE 4HJ0D 5D9SA 5CJBA 1IC7L 1KYOJ 4GKZB 2P24B 4XNZC 3DX6B 1DFBL 5DJXB 4XP9H 4ZPTB 5FFLA 1ZXQA 1B2WL 1NMAH 1UXWB 4HUUA 3DO7B 2EC8A 4I5BA 5ALCL 5D8JH 1NC2D 4YHOH 4Z5RA 1T0PB 3BN3B 1JHKH 4XNXH 4B53A 4U05A 3TVMB 4PB9H 3KGRA 3SKMB 1KLUA 1WZKA 4OIBA 3C60C 4DKEH 4WFEE 4LASH 1Q0XL 4IRSA 5DEFA 1WICA 1F11B 5CD5C 4M9OA 5GSVB 2NY1D 1F4YH 2BFVL 3FRUA 3EAKA 3KPQB 5IVNA 4XP1L 5CIPH 1AR2A 2BJML 1S7WA 1MHCB 1J0JA 2HJKA 4IOSD 3NA4A 3A6CL 1MFBL 3FOMA 5DRWA 1FZMA 3QQNA 3S35X 1MHPL 4LVOC 3WKMH 3KJ4C 3ULVD 3RPIA 3L1OH 1FGNL 2AGJH 3TH2T 3MZTA 3MSPA 4LU5L 4NZUH 3H9SA 2AJXH 3G9AB 1I9IH 4U3XA 3W0WE 4MJ6B 4MDIB 4O2EA 5DURD 3C2AL 3F8UB 3DETC 3OBAA 3N9GH 1HXMB 2NPLX 3VXNB 1RURH 3SKJL 5AWNL 5D1QC 1VADA 4UAOB 3SDCD 1MJ8H 5IW3A 2FL5A 2VIRA 5CD3A 1F58L 4M7ZB 5DK2B 2RR3A 5A16B 5T3XH 4KI5D 2WINA 5I75C 5DDHB 3VRJB 3CU7A 3O2VH 3RVUC 1VGEL 4Q6IC 3GJFH 5GS0C 4XC1H 3OZ9L 3A6BL 4BQ6A 4APQC 1OT2A 3T0EC 4QRRB 1HH9B 2V5YA 3D18A 5JPNA 1KN2H 4NHUB 3MV8E 2G60L 1PKQA 4GT7A 1UJ3C 1WJ3A 4PY8I 2NY5H 1ZLSL 2A6IA 5MEOB 4OBSA 2VDPL 4HCRA 3S34L 4A6YL 2GJ6D 3GM8A 1NC4B 5EZLB 2PN5A 2X4TA 4GBXC 4RFNB 5JLZA 5K9KA 3CPLB 3T09A 4BSWB 3PWNB 4DN4L 4FQXA 2X4NA 5CEZD 1AHWC 1CDUA 1GIGL 1IGIH 4IRZL 5CMAA 4ZUSB 5DJYA 4YHPB 1GRWA 3EJZC 4N9GB 2GTWA 3HC0B 1RZIA 1U58B 3CVHA 4OI7A 3TCLB 2R0ZH 5I66B 3DIFB 1JYNA 1U92A 1OTUD 4ZSOA 5C2UB 2V2XB 4OTXL 2W07A 2GK2A 3ZE1E 1JZ8A 4D0DA 3BP6A 4OF8A 2ADFL 3MLSL 4MNGA 4M5ZL 1ZTXL 4I48A 4I77H 2P5WE 1A7OL 4Y4FD 4PJIB 2IMMA 3DSNA 4JCMA 4NM4H 3ZKQD 1DQJA 1A4JB 1FFOA 4NM8L 5C0IB 5I1LB 5I16A 4RFOH 5TFSH 1YNTB 3TF7C 2A6DA 1J7VR 2EECA 3SKOA 4RA0C 3OKNB 5C9KA 3TIEB 2DQEL 3WLBB 1U8IB 4QXGH 4PV8A 4ZXBC 4EDWH 2C3XA 1KXVC 5GJSL 4OV5B 5HGDB 4I18B 2AEPL 3EO1A 4CVXA 1T5XB 1TQBB 1WGOA 4HJ0C 5DHXB 5E2WH 2J6EH 3UBXA 3WDJA 1LMKA 3VXMB 2HRPH 2PW1B 2P8MB 2YD2A 5KVFH 4W68A 4LQ1A 3MLRL 2IEPA 1MH5A 1P7KA 3MGTB 1RUQH 4ZFOB 3OR6A 1IAOB 4PRPA 4I13B 2JJVA 5D1XA 1J12A 1G84A 1GVIA 3SE8H 3MYJB 4PG9B 4EJ1C 5F8RC 1D9KC 3IDMB 3WUWA 3QIWD 1F00I 3GRWH 4D9RE 2DQJL 1VGKB 2FJFA 3F7QA 3QG6A 4WWKB 5IB1A 3THML 1M7IA 1JMZA 1XZ0A 1MAML 1ORSB 1JN6B 3CPLA 3PWNA 1BLNB 2C1OB 3DUUA 3FQTA 4Y5YC 1AI1H 3S35H 5DMJB 4X5WA 3HZMA 4G6ML 5DJ6B 3MA7B 2K3TA 3GSXB 5E8OA 4C58B 1WAAE 3I3BA 4HJGA 2FDBP 2XPGB 1YYML 3P40A 4KQ3H 2GSGA 3DIFA 3EDEA 1NCCH 2AJ3A 4HT1L 1FFPA 5IJKC 5MI0B 1CI5A 4Q2ZA 5F1NA 4BKLB 3KVQA 4PRBA 3KHQA 5I8KL 4HZLB 3EFDL 4KRNA 3JWNC 3L5WA 3MBED 4OGYL 5EU5A 5FM8A 4ESKA 1FE8H 3WS3B 1CD0A 4P23B 2Z31C 2HVKA 2ARJB 5A2KH 4YGVA 1MCCA 2PTUA 1JNNH 2FLBT 2PO6B 3TP4A 3BKCL 5GGRA 4KVNL 2Q7YA 3T65A 5KVEL 2Y07L 4YFLI 2WWMC 5I1LA 5DHVA 4ODBD 5T3ZL 3FTGA 5E99H 3HC4L 5SV3A 4L4TB 4N5EC 2V5SA 5E00B 3VGAC 5F7MC 2QL1A 1MWAB 2EXWC 2NMSA 1AGDA 2CK0L 4LPWA 1U3HD 1X5LA 4Z7WB 5HGDA 4KMQA 4N8VA 4LGSB 3BDYL 4M6NH 3ARVA 3GO1H 2ZG1A 1U8NB 4NO2B 4Z76B 2VABA 5EO0A 1TCMA 2MCPL 2GFBB 3GK8L 2JK5B 3KR3L 4Q58C 4POZD 3O0RL 1FAKT 1OP3H 1LE9A 1GZQA 5A3IC 1G7MA 3OPZL 4U0QB 2B1HL 2WBJD 1WCQA 3JV6B 3HMXA 2LU3A 4J3TA 4Y4KA 4MQ7B 5D2NA 3BZ4A 3O8XD 5DEGB 1G7QA 4H8WH 4XVUC 3B83A 3D25B 1BLNA 1HHJB 1NKRA 1OTSC 3QNYB 4PJFF 3NGBB 3ARDB 5F6HJ 3SGJA 3QUZB 3QG7L 4PYGA 1LQSR 1I4FA 4UTBH 5BO1H 3IDXH 3UZVB 1BQLH 4ONHA 1OTUC 5D1ZB 1KB9J 1NBZB 5M7QA 3KPSE 1NCWH 4LHUG 2AJYL 4U1GB 3UAJD 3OKLB 4K3DH 2OR9L 2EDQA 3D3VB 2BMKB 3HLAA 2EDKA 4U7SA 5BZWB 5I0DA 1R3IH 2R4RL 1BGXL 3LKRA 3QZWA 4Y4FC 2FB4H 4YXHL 4NN6C 4B7LA 1YEGL 5DQJB 3CSGA 4B7IA 8CGTA 2A0LD 2B5IC 3DUSA 4GAYB 1J9CT 4M93B 1BECA 5AAMA 3D39A 4YZFF 1U93A 3CJJA 3B9VA 1DE4B 4L4TA 3ALXA 4P2QB 4PS4H 1YN7B 5EOCJ 1N6VA 2A9NH 4GSDL 5BVJA 4JKLA 3CFIC 1MWAA 3TPUB 2D4DA 3D2UB 5HDLA 3RX5A 4HKXA 2EDYA 3BVNA 1M71B 2ZPKH 3HA0A 1RK1B 4PPTA 4J3OC 3SDYH 3L3IA 4HXBH 4NO2A 4NO3B 1ZLVK 4PJAB 2CDEA 3OKEB 3ARFB 2AEWA 4AENB 2GK0A 4JG1L 3RWGA 2R0LL 1UM5H 3RVVD 2WIIB 5FHBH 2WMPA 4HJJL 4NO5B 4S1SH 2C3GA 2VUOA 3CFCL 2JB6B 3WIHL 4ZNEE 3CK0H 5DQ9B 3BXNB 4OQTL 5AZ2L 3WFHA 1S7QA 5JTWA 3FB8B 4R6UA 1N59A 1WT5A 5CCKH 4HXAH 5JHLH 5MEPB 3TO4D 2ITCA 3G5VA 4PLNC 3OGOE 4I1NB 4L3CA 5CILH 1TENA 2MHAB 2IPTH 4KJYA 2HTLD 3T4AB 3ALWA 3HTLX 1EO8L 4NRXB 3MV7E 2QQKL 4XMKH 1IAKB 3QQ3B 3TNNB 1JZ5A 1KT2A 1R5IA 1T21B 1S5IH 4NNYB 2K9UA 4Y16C 1BD2B 1LO4H 4XCEB 5KTEL 4GKNA 4YPGB 2HT2C 3GKZA 3UTQA 4L5FH 2HFEA 4WWID 4GG6E 3LH2H 4AIZA 2VAAA 1B6UA 3I6LE 3IXAA 4KJQD 1TNMA 4XP5L 4WFHD 1ND0B 1T2JA 3WIFA 5HHVH 5TH2A 2F5BL 2HT4D 4LAJH 4PFEA 3MRJB 4BFGA 1ACYL 2H32B 1D5MB 1XF4A 4HIXH 4PB0H 3AB0B 1ZEAL 1LDSA 4HHAB 4DUXA 4NYLB 5MENA 3G5YA 1L7TL 3MLWL 4Y2DD 2HG5B 3STLA 5DHVH 1XF2A 1Z2KA 2ADJB 4YXKL 1U8PA 4YHMH 4AIOA 5TQ0L 3GBLA 3RVTD 2EDHA 3INUL 2LE9A 2WBJC 3FFCE 3ULSB 5JQ6H 4Z7UB 4G7YH 1EPFA 4DFHA 3PHQB 3W11C 2N4IA 1NKOA 3UTSE 3N1PC 3RA7L 5IV2A 4U6HB 2F8VA 1A7NL 4WU7B 4OKVB 3DVNB 1U8QB 3PGDA 4OT1L 1F02I 2IF7A 4KTDL 5GS1B 1JMXA 3RGVB 1MAJA 5ALBL 5GS0L 5EZOH 1NFDB 4BSVA 1QA9B 1Y6NR 5CJOL 3UTTE 5INDA 4TVPD 3RWCA 3L3GB 4LCUA 2CR3A 3HG1A 1EFXA 1S7TB 4FMKA 1ZT4B 2A2QT 3MGOB 4WRLA 3HR5B 2BY0A 4G7VH 4RISL 4FABL 1I3UA 1I75A 4CU7A 3LPWA 1HDMB 2WUBL 1BJMA 3VFSA 4PTUA 3DSFL 5C8JA 4PRHD 4GQ9L 1UQSB 5C0DA 4QO1A 1L7IH 5D2LE 1RZFH 4HK3N 4OLWL 3I50L 5HVWA 1BFTA 4R2GC 1MVUA 4FZ8H 4AG4H 1ITCA 1BZQK 1CWVA 4YDVA 5DWUL 1WTLA 4GAJH 1GGIH 3L6FA 2Z8RA 5T1KD 3SJVD 4Z0BL 3BQUD 5GRUH 3EYSH 5KZCB 4NDMA 2AK4E 3HE7A 3O11A 4UT6L 3MRGA 3ZKXC 1NCDH 2XZCL 2DQFA 2E7BA 4LGRB 3QH3B 1U36A 2HG5A 1E0OB 1KJ2B 4GJTB 5K93A 3MXVL 1G7PB 5HHOD 3MV11 4HAFA 5KS9B 4MX7A 1R6VA 4MGXA 4KK8C 4NKOB 4MD0A 3MPCA 3QDJE 2OK0L 3QUKB 4RFEA 2JE8A 3KLDA 4Y5VC 1T3FB 4I3SH 2ORBH 1B9ZA 3HE6B 4YO0A 1ZGLP 1F3DH 4K7PX 2Y5TB 2F9BT 3QEUB 5HGHA 2L0DA 1FHGA 1GPOH 2X2YA 3CH8A 4WU7A 1AQKL 1JGVH 2YPKB 4NQCB 1I8MB 3PGCB 1AY1L 4WDIA 2DLIA 3MLUH 3TO4C 1TJHH 3H3PH 1AKJB 4LARH 2DQDH 3NZHL 3MXWH 2BVOA 5HTSA 4YC2B 3D87B 3RKDD 5JORA 2H9GB 1OWWA 4EN3D 1D7FA 3FONA 2H6PB 1JGUH 5HHPA 4YDIL 4NIKB 1AP2A 3UJJH 3P0VL 4M1GH 3GNML 4ZFGH 3MGOA 3BT2L 4LHUB 3CFDB 1G1CA 1IGYA 3U9UB 2C4FT 5C0NC 5EU6D 4X6CF 4DKFH 4UT9H 4Z0XA 1N7ML 3PQYB 3GSQA 3QPQD 4Z18A 4TNVK 3ARZA 2ED7A 5DVLA 2G5BA 2YBRA 1GH7A 5D7JA 5FO9A 2CK2A 3HMWH 4DJMA 2P46B 2NR6D 3CMOH 4DAGH 2P49B 5CINL 4ZODA 1ZK9A 4M48H 3VXRD 4ZUUB 2BNUB 1JNLL 1MI5A 4NQSB 3P0YL 2DQGL 3IFLL 4LKCA 4P5TD 4DZ8B 4WUUA 2I9LA 4JKWA 3HHRB 1IFHH 4L1DA 3JTSB 3P2TA 4CVUA 1N5AB 4JRXB 4HW6A 3DO3A 2IAMC 4XXDA 1DEDA 4J23A 3QUML 4JFZH 1CE6A 5CBEB 4FHBD 4XPHH 1INQB 1E4KA 1MCJA 4XNMB 3TBTA 5I76A 1KEMH 3B9KA 5I73B 2XTJE 2ZUQB 5D5MB 3MOAL 3MRLB 1ZT1B 4QGYA 5EC1B 4OZ4A 3ROOA 4WFFD 3LY6A 4OZGE 4F7EA 5EIQA 2E6JA 3ZE1F 2O5YL 4QOKD 5GGVH 2X1QA 5ESQB 3F58L 3DX8A 5CP7B 2PYFA 5IW6B 2YWYA 3QXAB 1RJCA 4C83B 5DS8B 1DSFH 3U9PL 4TRPH 3LRSA 3BEVB 3TESA 3PGCA 1CCZA 2FX9H 4BFEA 4ODWA 3WNKA 2E5EA 5MEQB 4XWOD 3ARGC 5D71L 1MF2L 5T1DL 4G5ZH 2LFGA 2AW2A 5IWLC 2XTLA 4MA3B 1ZHKA 3ULVF 4YBHA 1ZOXA 3UDWC 1T66D 3CXHK 4LFHD 2VLRE 5IVXB 3MLXH 5I1GL 2VDLL 5IBTH 2YD7A 1U9KA 4NN7B 5CKGA 4P2OD 4P2RA 5FCUL 3KPRA 1IL1A 1C16A 1S7RB 5F9OH 2H26B 4WI8A 3WDIA 3NAAL 2BOBB 1W72H 4MA8H 4F7CB 4CVWA 4XBPB 5DLMH 5HGBB 4X7FC 1NCBL 4KI5F 4AMKH 4PJ9B 1JWMB 4D2NA 3NPSB 2XTJC 1RUMH 2ED9A 4MNHB 4FQHB 4FZEL 4ZDHA 1AQDA 3RDTD 2DMCA 1GHFL 1H0DA 1FPTL 3F6IA 5EBWB 1YY8B 3H3KA 2R2CA 5GJTH 4RQQA 2XA3A 4K7PH 1T0NB 4CJ0A 3VXRE 1MLCB 2VDOH 4HK0A 1OAYL 4KGLA 1UXSA 4H20H 3CFKB 4Y0GA 1LK3H 3PJSB 4ZUVA 4HC1A 2P47B 4HMCA 1WAAF 4YHNB 1AJ7H 2V2WB 4FFWC 3R8BB 2I24N 3E6HA 1T20A 2E9IA 4LSUH 3S37X 3HPJA 1X5XA 2IQAA 4PP1D 5ID1B 1RHFA 2X7LB 1OW0A 3O45B 2NX5A 5JIPA 2VE6B 5BS0E 1MCLA 1LD9B 2BK8A 4ELMA 4H5SB 5IEHB 5E0QA 1A4KB 4GUPA 3RZCD 2P43B 4KJWD 2X1OA 2VZUA 3OXSA 3OMZA 4MAYC 4WFFE 25C8L 3DV4A 1CR9L 3MNWA 1LO3H 4QF1B 1ZLVH 4HLZH 4I0PC 5DA0B 4EN3C 1HWGB 5T1MA 3TBYB 4JJ5A 2XQYK 3M17B 4Y1AE 4RAHA 3TBSA 3MFGB 5E9DE 4N0UB 4FTVE 3VRLE 1CDYA 2DI8A 3DRTB 3MACH 1QBLH 5JW5A 2P48B 3L5IA 1ULVA 3MLZL 1N3NA 3L3KA 1PZ5A 2BSTB 3GSWB 4XBGB 1YN6A 5KANG 5DO2C 2J2ZA 4XP6L 5C0CE 1OAUL 5IB5B 5SWZE 2P8PB 5TGBA 3R1GH 1X9QA 1S7VB 2PYEB 4Y7MA 5F96H 5BRZD 3O6FA 4TSCH 1A8JH 3QSKB 1R24B 2AXGA 4G9FE 1JCKA 4PJ9A 1HZHH 1AFVL 3C5ZC 4Y19A 3HZVB 5ITFA 2VQ1B 2X5PA 2DM4A 1YDPB 4PJXE 2FX7L 1HKLL 3SDAC 2W60A 1T1ZA 4PJBB 5I1AA 1MY7A 1I3GL 4YE4L 4MSWB 5TQ2L 4G8IB 3WUWG 5FM5M 3FO1A 3X3GH 1N5YH 4L9LA 3AREB 1YPZB 3IETA 2Z8VC 1S7XA 1CLZL 5L6YL 12E8H 3B6SB 4FRWA 4JFOA 5C3TA 4K8RD 1IQDB 4KPHL 1R0AH 5ID1A 1YMMB 4Z7NE 4QRRD 1C12A 3ZYOA 3I9GL 1FNHA 1E6JL 1PSKH 3EOTL 2X42A 1KIRB 5GS2H 4YDJB 4LOUD 1AE6L 1F90L 3VW3H 4KDTA 5IB2A 1KIPA 1IGJB 4HPYL 2YD3A 2BXZA 4IRJA 1CLYL 3Q6GH 1IC4L 5F3BB 4XWOC 1KXQE 4MAUL 2DDQL 2X4QB 3FQRA 5DI8A 1MFAL 5TF1L 1FL5B 1P4BH 3KG5A 4ONOA 4C56A 1AIFA 3HB3D 1QFWM 3IJSA 1F4XH 1IAIL 5C08D 2ICWA 1B90A 2XZAH 4X8JB 1SYSA 4JY6B 2YC1A 4MZ3A 1ODAA 3U1SH 4Y5XB 3BISA 1HHKB 4TUKH 2BRRH 4L8BA 1IC1A 1LVEA 1KPUB 4CW1B 2XRAH 5SWSB 4C55A 3TFKC 2CXGA 4OLVL 1KCVH 2CUMA 5F1OB 1JPGB 1DQQB 5EULV 4HIHB 4DGVL 2BSED 3QQ9D 1A2YB 4MD5A 3ZHKA 3LSOA 4OSUH 1ORQB 3C6LC 5EA0L 5EZIL 5I1IL 4LL9A 4NRZB 4JFHE 1J1XL 3N1FC 5IGXH 4PJCB 3V0VA 2CLVB 5L7XH 4YIQB 2QQNH 1JE6A 4JM2D 3SE4C 4N8VG 3VFVA 3LRHA 1XGPB 1FV1B 1SYVB 2R0KH 5EU4A 3S37H 2JIXA 3X17A 4TTGA 1H8NA 3I2CH 4WEMB 1LK2A 5KSAA 3DGGA 3MREB 1T6VN 1XGQA 1JJUA 2VL4A 2AI0H 3LMJL 5GGSB 2APXA 1XIWD 3ETBF 3ZE0E 2P7TA 2ZUSA 5K59F 4NOBA 1BF2A 4PRNA 3CH1A 1EJOL 1B0GA 2XN9A 1CDCA 5CZXD 1MCWW 2APWA 4LPUA 4X6EB 4XMLL 4K94C 1JP5A 1GCFA 1S3KH 5A2LH 3RJDA 1UCBH 2FZ3A 3KNBA 1DUYA 3B6SA 2GTZA 1BJ1J 4DN3H 1N6QH 3LEYH 5ANMB 3CVIH 1IQDA 4KFZC 4LRNL 1PVHA 3V5KA 3MUGB 1XF3A 5BVPH 4XC3L 1E4XH 4KJWC 4QXTB 1LEGA 3O6KH 3FO2A 1K8DB 1XR8B 2G2RB 3GJEB 4XNQA 3MUY1 3QUYB 1CQYA 4RMUA 2Y25A 3UZQA 4WWKD 1RJLA 3QZWG 4NBZB 4QRRE 5LG1A 3GB7B 1DN0A 5TPWL 1U91B 4PGZA 3TVMC 1J8HA 4WEBL 4C57C 2UWEF 5HSFA 5HHNA 1QRNA 2F8OA 1RY7B 3LN5B 2EDJA 4QRQB 3TYGL 4E0RB 3DXAA 5D7KD 1QR1A 1FH5L 3RGHA 3LS5L 1EIBA 1F4AA 3F7RA 1TZGH 1A7PH 3V52H 2PCPA 5F7KC 1C5BL 1P4IH 2YN5A 3WFCL 4NRZA 1V3KA 2ZUUA 1KCSH 3PP3K 1TQCB 5FYJH 2FO1A 4QTHB 5KSBB 4PLJC 3QCTL 1BOYA 2X4OB 3PUCA 4L8DB 5D7SL 1XGPA 4XXCC 4LVEA 1HINH 4V1DD 2XKNB 2NTSP 3JUZA 1Z9MA 1WFOA 4E5XA 5J6HB 3T3PE 5IHZA 3ZSSA 3S97C 5B3JE 1Q72L 2E6PA 1I7TA 1A6TA 1X5AA 3H9HA 3WBDA 1EZVX 4UAOC 3QUXD 4FG6D 3IXTA 4YX2H 3ZLQC 4M7ZC 4PJIE 3U79A 2HFGH 2DWDB 5HI4D 1HH6B 1OWRM 3P11H 4AEEA 5DVKA 1DQDH 5E5UB 1W2KT 2FGWH 4OF3A 4Z77B 1OAQH 3TGXA 3QDGB 3HI5H 1FNGA 3GSUA 3NACL 1MJJA 2VNCA 4XBEH 4ETQB 1J0ZA 4MJID 1JZ7A 2F19L 3VFMB 3QWQB 3TT3L 4HUWB 2VDMH 3HI1A 3LHPL 5ILTH 2ARJQ 5DFVD 4YK4B 1A14H 1I1CA 1OD7A 2MOVA 2IG2H 1LP9F 5D2LF 1DQTA 4RFNC 2CD0A 3VXME 1FYTB 4OLZL 4ORZC 3MUJA 4J2XA 4ZUTB 3QNXB 5EH1A 4LLYB 4WW2A 4KZDH 1KCUL 4XHJC 3QIUA 2QR0B 4WHCA 4LLUB 1ZWIB 2ZKHH 2R9HD 2CGRL 3TNMB 3QUZD 1C08B 4U1NA 2DI7A 4QRPB 4X6DB 2EEAA 4GRMB 3WFDL 1I1YB 1FRGH 3RP1A 3OB0H 1VACA 5E4IA 4NQXB 5L8KB 1F97A 4KDVA 4YR6B 3VXUB 3LKQB 2N7AA 1U8KA 3ARUA 3W81A 2VKWA 1EHAA 1UYWH 3OX8A 1URLA 3DARA 3S96A 4PJ7B 5ISZD 4L8DA 1CFVL 2DMBA 4M61B 4PP2B 2CRYA 2IFFL 2NXZB 2DQIH 4G80A 2AV7A 2M8XA 3KXFB 4G42A 2F58H 1MCHA 2XT1B 4JPWL 2OP4H 1XGYL 2YA1A 4CVZB 4OCSH 1F13A 4BUGA 4KKCD 3N06B 1M4KA 3K4DA 2H41A 3E2HB 3D2UD 5F89A 3TO2A 5DMGC 4JQVC 4I18C 4OM0H 3VD7A 4ZOCA 1TQBC 1BVKA 4R4FH 1QO3A 1S8DA 1XEDA 1S9KC 3CD4A 4L4TE 3QO0B 1BFSA 5HHMB 3RX7A 1TXKA 4GG8A 1H9VA 2WBWB 3BWAB 1R5WB 1NSNH 3VFNA 3ARBB 3FQXA 3BKML 4WY7L 3SDXB 3LKPA 3PWUB 1W0WB 4Z7WE 1W8OA 1RZJH 1FAIH 1SY6A 4M6MH 5HJ3A 2Y6SD 4KK9D 2NNAA 4WWKC 4PV9A 3P73B 2AJSH 4I3RH 2ZOLB 2LABA 2EE6A 1N64H 2Q76B 1NGYB 5B8CA 1HILB 4OCWL 4U6XA 3L3DB 1RUAL 4O58H 2YUXA 5AG9A 2I26N 3IFOA 1ZA3B 2IH3B 1MQKH 2EDOA 4WNQA 4MB4A 1GOGA 3QWOB 4FQCH 3MQIA 3IVKA 1IT9H 5MI0C 1FZKB 1NBVL 3B5HA 1U8MA 2F74A 3LS4H 4NUGL 4QHUB 2FLRT 2VXSH 3VXOA 4MHHI 3WIIL 1J1OH 5I8EA 4K23H 1NLDH 4LSRL 3IDIA 1TZIB 5F1IB 4U1KA 4P23C 3TN0A 1HSBB 2R1YA 3MJ8A 4P9ML 4JO1L 3I6GA 1W0VA 1CQKA 2R39A 1VSCA 3K2UL 3GSOB 3HPLB 2VXQL 4M00A 2PO6C 1M05A 3QXVA 4RWYL 3GBNL 4M6AA 1RZKH 2CIIB 3FQUB 1YEDB 5FA4B 2A6JA 2J1KA 2OL3B 3QI9D 3D3VE 5BQ7B 2DQHH 3G6JB 1I7RB 5JW3H 4KAQH 2VDQL 4U6VL 3F7PC 5ADPH 5CZVH 4HLZG 1EO5A 3EOBA 3REWB 1KB9K 4AEFA 3TA3D 4NT6A 2FH8A 3SCMA 4JRWA 3VDCA 1KTDB 4J12A 4QWWC 3JV4A 2OJZL 5KVGH 2YEZB 4X7DC 1VB9A 1FBIH 1BBDL 5CEZH 3IYLW 4JLRB 3RTQA 2H45A 5KSVB 3L95B 2G75B 4J3SA 4P2QE 4ODHH 4PRIA 3Q48A 1F42A 4BJLA 1C5CL 4KKLD 4DVBA 2ADIB 1CXLA 4QHKI 1JGLH 4X4YB 3MCLL 5I1EH 4PJDB 4K07A 5HYJD 2WWKT 3ALPA 4GMSH 4RNRA 2W91A 1AO7D 3T4YA 4WVRA 4PJEA 2I60H 1JWSA 4TULL 5BXFB 4PJAE 1WVZA 3KPLA 3PNWA 1PYWA 5E8DL 2R0WL 3NGBC 4EOWL 3ARDC 4NWUL 4ZAKD 1P84J 3RGVD 3QUZC 3DBXA 3L3DA 4DW2H 3LIZL 4LPTA 3EFFA 5CZKA 4RGMB 5D1ZC 2VZVA 3QEHA 4U1GC 4X5XB 3GSNH 3QPXH 3T1FA 1BPVA 4X6BA 1IAII 3VD5A 4ORGA 4QGTA 3CC5A 3O2DA 3RNKA 4JHWH 3EO0A 3C87A 3MZGB 1HSBA 4NJ9H 1JGEA 4BH8B 3O6LH 1NCUA 4O4YH 1OSPL 2NY3B 3CIQA 4R7DB 2DLFL 3RL1B 4M93C 1QSED 1NL0H 4R26H 1PD6A 2CIIA 1YEDA 4JY5L 3QXDB 3JWDC 1NEUA 5ESAB 4ZNCD 1KPRB 3VXPB 4B5EA 3QEQB 3VXSB 2PKDA 3ZKMC 3OKKA 2ZNWA 3RUGA 3FT4B 2Y36L 2BX5A 1SJEA 3MRNA 2HJLA 4XGZB 1BD2E 5IESL 4OAWA 1I7UB 3D69A 1KTDA 4JZOA 4PR5A 3SBWC 1RHHB 3BUTA 3Q1SL 4XCFH 3IRZA 1YEIL 2F54B 2HMIC 3VRLF 3CSPA 4ODVL 4GLRI 5L88L 3WHE0 5C1MB 4OD3L 3OAUL 3DHJA 3ARFC 5JUEH 3EDDA 3G5ZA 3NCJL 4XCNA 1A7QL 3BI9X 4JDZA 1MCPH 2JCCA 4HS8L 3MODL 4UBDC 3VE0B 2OMBA 3DURA 2Y6SC 4DGIH 1A6ZB 3VFRA 4XH2A 3UZEA 4B50A 3D6GA 1ZV5A 3O3AB 4NQEB 1MJUH 4K94L 4LCYA 1KLGA 3GBMH 5F71A 1BEYL 1CLCA 2NYYD 4JDVA 1FNEB 4OQ1A 1T6WA 3MLVL 4G8FB 3CDCA 5J7CC 2XNAA 4TPRH 3LKOB 2PR4L 1AXSB 1SY6H 4Z7UE 1JV5A 3HRZA 4CADA 2YD8A 3PDOB 1XCTA 5I8OH 1FVEA 3CCHA 3JXAA 4OFIA 4KROB 5I0ZA 3SDDA 1E6OH 1CD9B 4X5XA 3BP4A 2IANA 1BZ7B 4Q7DA 3VI4F 3AXLB 4YAQB 1N4XL 4KXZH 2FBJH 4FNLH 4N68A 4PJ5B 5LWYL 1NFDE 4ZO8A 5CBAA 5DMKB 1SEBB 5C0FA 3GMRB 5MERB 4HFUL 5DRZA 1EMTH 4MQXC 5EU3A 4TSBH 3U7YL 4OUOA 3CVHL 4LRIA 1MEXL 3QHFL 3WJJA 5B39B 2ATPB 4CDHA 3CX2A 3AB0C 2DL2A 1HEZA 1I3VA 2W92A 3NFNB 5C07A 4J1UA 3PP3H 5IFHL 5ITBL 4BYHA 1JGDB 2A73B 5E24E 3BUYA 1S9VA 3PL6D 2JJUA 4OCLC 1WC7B 1AR1C 1YMHB 5D7LD 4JR9H 1FVCB 3V4PL 1T5WB 1XR9A 2VLKA 4D94A 2BP3A 2A9MH 1B88A 4LP4A 2KH2B 3CLFH 4A6YA 4HWBH 1P2CA 3NPZB 1CFSA 1P6FA 3FB5A 3QXTA 4G8EA 3U0WH 4D8PA 1G1YA 1W72B 4LBEA 5KS9E 5IT2H 4S1QL 2VXVL 5DJAB 4MA7H 5GS1C 3RGVC 2O5XL 4QEGA 4H26B 4JAMB 5FYLH 2IPUK 3F12A 4BH7A 1RFDL 2VXTH 3HZKA 3SO3B 3V7AG 4Z95H 4K7FA 5CHNB 5JR1L 1ZVHA 1S9WA 2NY7L 4NQCE 4L4VB 5EORH 4EUPA 3ULUE 3NN8A 2BXYA 2MQ0A 4N8CH 2EKSA 3G5XB 1F4WL 4JQXA 1UENA 2P5EA 3MCKB 1G6RH 1Q0YH 5D93B 4P9HL 4RZCB 3ORJA 3F62A 4XB7A 4JFDB 5GGUB 4DVRL 2P1YA 3O2DH 1TVHA 1CLOL 2AABH 1CFNB 1G7JA 1JZ6A 2AJUL 1U6AL 2A77L 3PQYE 5LJYH 4PJFB 5F6HI 2O61B 2K7QA 4M7KL 5CLWA 3ZYZA 3C5SB 1U2HA 4X4XB 4PYHA 5DUMH 3GGWB 2W65B 2YPLB 1K2DA 1E4KC 4LMQE 3NFPA 1JNHA 2ESVB 5I15H 3ZE2E 1UACH 2D03L 4PJ8D 4JPVL 1G7HA 2H2SD 2V17L 1EEYA 1DANU 1QSFB 1UM4H 1T5WA 1PX4A 5E6IA 3MRPA 4JRXE 3LV3A 3BH8B 1KOAA 2HKFL 2RCSL 5DZNA 3HE6C 1LO0H 1GAFL 3MRCA 4OZHF 3KPOA 4LLMA 1TJGH 1S7SB 4RX4A 5L0QB 1WQVT 1G9MC 3W9DB 3V6ZA 4S1DC 1BQSA 4Y8DC 1EH9A 3MV9D 4LLQB 1NGPH 3DMMB 2HFTA 5D5ME 1BBJB 3S5LG 2Z4QA 3ULUC 5ESVA 5GRVL 5IVZB 1DFBH 3CDGA 1MELA 4WO4B 4PTTB 3SGEI 2MNUA 4YC2C 3S4SB 1KPVA 1Y18A 2L7UA 3I02A 4HH9A 3P4NB 4Y4HD 4JPIA 4R0LA 4ZFOL 1MIEL 5JOFA 5JO5A 5ALCH 4U1JA 4JVWA 5FO7B 3ECBB 4UDUB 4JM2F 5HHQA 1I85C 2F53A 5I1KL 3LPFA 1CICB 1Z0MA 4WJ5A 4H1LH 3L7EB 5C7XL 1IKFL 1DVFD 5T3XD 1QUNA 2H2PC 2V6HA 3D0LB 2CO6B 1IBGL 4L3EA 2BFVH 3FB7A 4BQBA 5FM5O 4RZCA 3N1GC 1KUMA 4MJ5B 5EOQL 2BJMH 1BVLB 3QFJB 2V9RA 2ZOKB 3A6CH 3QIBD 5IVXE 2RAMA 1MFBH 2E27L 3DTXB 3VA6A 4G43B 5FKPA 3TJEH 4MNQA 2D7MA 1MHPH 3MLYL 2QSQA 5IB4A 1VKXB 1GOFA 1FGNH 4FXGB 3RBGA 2ZJSL 1CDBA 4HZAA 4LU5H 2VQTA 4P46B 5E5MB 3HFML 4UQ3B 4HBCL 5J57B 3HNVL 1LNUA 1AGFA 3C2AH 2BNQD 2LV4A 5GGTL 5I73C 4KY1L 4F37F 3SKJH 2VSCA 2ZUQC 5AWNH 2W59A 3MR9B 3WL9B 4JFPA 4F2MA 3C8HA 4UTAL 4GW5A 3IGAB 1XCQB 1ZHBA 2A74B 1RD6A 4M9PA 3QJFB 1CXEA 1OSZB 4OLUL 4PBXA 1VGEH 2BNRB 3PWPD 4UIKL 5C09D 1MWAL 1S7SA 2XQYG 4Y89A 3OZ9H 1FYHB 1HWHB 4LLQA 2FEDC 4LF3A 1PAMA 2AVGA 1QYGL 2G60H 4RMWA 1ADQL 1NAKH 3BZDA 5C0AB 4YXLL 3LKNA 3E6FA 3WHXB 2YK1H 1FJ1A 2DYPB 2FIRT 5EWIL 3WNNA 2PXYA 1ZLSH 2ADGA 1WWCA 2VDPH 4A6YH 2V5MA 1DBKL 3S8WA 3BO8A 3NCBB 2VLJD 1A1OA 1Y0LB 2VDKL 1BAFL 4H0GA 5IBUB 1MY5A 1A0QL 4UT7L 3V5DB 4DN4H 3FZUC 1LEKB 4OFYD 4QRSA 5C0GB 1GIGH 1OGAA 4NN7C 4IIQA 4JFFB 5FGSA 1P1ZB 5JMRA 5L2KB 2Q8BL 4F37K 3BD5A 4JZNB 4PLKD 5HI5D 4N0UE 3DROA 3EYOB 1JK8A 1I3RA 1FO0B 2NY0D 3HC3L 3VWKA 1ZMYA 4OTXH 3O4LD 1WBZB 4K55A 4NKDA 2ADFH 1XGRB 5ICXB 3D85A 2FJGB 4PJ9C 4EUPH 5JA9A 4X7SL 3MLSH 3NPSC 4G8GA 2V7NA 4G43A 4OF6A 1ZTXH 4P59H 4NZRH 4HGMA 1A7OH 3L3HB 4JFED 1C7TA 3TWCH 1CZ8L 4FFVD 3MMEB 4NM8H 2H1PH 2PYEE 2XZZA 4PGJA 4LCWB 1ZHLA 4J8RA 1QQDB 5FYKD 3U6RB 1HHHB 4NQTA 1P53A 4NN5B 1ONQB 2DQEH 5H94B 5DK0A 4E41A 2Z91B 2ICCA 1A9BA 3JWDL 2CJUH 4PJBE 3ESVF 4ISVB 4X7TA 2ZG2A 2AEPH 2XN9E 3I75B 2BCKB 3WIHA 2L7JA 3O2WH 4XCYB 3BH9A 3BPCB 1YPZE 4OQTA 4IRSD 2X70A 5T1LA 4PGDB 3WHXA 1UB5B 3UC0H 4YHKL 4L29B 4BFIB 4HFWB 1YMME 1BQHA 2B39A 2DQJH 2C3HA 3THMH 3G6DH 1NH6A 4M7LL 1B0WA 1TTFA 3GI9L 2CRIA 3B2UC 3U7WL 4X0KB 4G6MH 4MDJB 1UKTA 1U8OB 3PHSA 4L8SB 4CNIB 3H9SD 5L2KA 3MO1B 2I07A 1A7BA 1YYMH 2R2HB 3DVGA 1X7QB 4LLWA 1U95B 4JO4L 4JRYA 3RI5K 1CT8B 3O9WB 5DJZA 3C60A 6FABL 3UPRA 3EFDH 4OGYH 2PTTA 2NY5C 4RMQA 1YEFL 43CAB 4OCNC 5SWSE 4N0CD 2QSTA 4TOYL 1CXIA 5BOPA 5I18L 4TNWF 5DJ8B 3P9MA 4H25A 3VFTB 2H3NA 4IJ3B 4NGHH 5BJTA 3BKCH 1PY4A 1JPTL 3B43A 4PJCE 3EUUA 2Y07H 3X14A 3FQWA 2DM3A 3CSYA 5T3ZH 4D9QD 3ZDZE 3HC4H 4JVPA 1EGJH 5ICYA 3AREC 5C3LD 4YBQD 4PRDA 1D5IL 5LQBL 1U3JA 4X6CB 5FDYA 1ED3A 3BIKB 5FKAB 4HV8A 5DD1L 3V95A 1KNOA 2CK0H 5F97E 1JL8A 3G6AB 1UZ6E 3HUJA 3BX7C 3T0DA 4DKDC 2P4AB 3QHZL 2OTWB 5KN5B 3BDYH 5D1QA 5ID0B 4PGEB 4EI5B 1MIML 1PEWA 2MCPH 2E7CA 3GK8H 5IOPB 2HTKC 3W9EB 5E94A 3CFJA 3KR3H 5J9PA 5IG7B 4PGBA 3O0RH 4XNUL 3X13A 5FGRA 4Q6IA 3S5LB 3VFOA 5ANME 2CDFA 3OPZH 4NHCL 2Z35B 4APQA 5EUOB 3T0EA 2GITA 5E8NB 1UA6L 4TNWK 1MCFA 4YGAB 3R8QA 2HJFB 4Y5XC 1OQOA 1UJ3A 3BEWA 4LHQB 3FO0L 2VITB 5ENWB 2DS4A 1HYSD 4F3FA 2C1PA 4X9GA 2ICEB 3VFPA 3PWLA 4AK1A 1NC2B 2W0PA 3QG7H 4GBXA 1RK0A 1HQRB 4QRTB 1F6AA 1Z5LB 3G08A 3UCRA 2DAVA 1AHWA 2OR9H 2CRMA 5DMIL 2E7LC 2NY1B 3IF1A 4K3EL 2R4RH 4OD2B 4JZJB 1BGXH 3I3EA 4JQIH 1F3DJ 1FIGL 4JM4L 1YNLH 4YXHH 3CFBB 1MLBA 1YEGH 4HDIB 2NXZD 1UG9A 4AH2A 3W0WA 4P0DA 2APVA 3ZTJH 3IKCA 2FRGP 5KSBE 1MHHB 2X4UB 4PRPD 1FFRA 3T3MF 4OM1L 4Z7UF 1LE5B 1EUUA 4GSDH 1BX2B 4IMKC 4EDXB 2NZ9C 1BWWA 4XWGL 5DURB 4N90E 1WBXB 2YMXL 3LN4A 1JUFA 3MUZ1 1C1EL 4Z8FL 1MRCL 3VFUB 2VUYA 1N2RA 2VC2H 4G3YL 4U1IB 3MJ9L 2BVQB 2DN7A 5HHMD 3QFDB 3SDCB 3MV8A 1UVQA 1AXTL 5MHSE 4S0TD 5DJCB 5EU7E 1T89C 4ZXBA 1I9RL 5J12B 5C9JB 3RWDB 4U1SB 3QUYC 1BIHA 1KJ2L 3PWJB 4JG1H 1IGFL 5F7DB 3QDGE 5LXGL 3KYMB 4IDJL 4R96B 4HJJH 3GSVB 3TYFA 3VXTA 5FECA 3BGFB 4B41A 5EO9A 3CFCH 4JN2A 4JFYA 3WIHH 1NLBH 3VI3E 1UWXK 3BKJL 4OUUB 4OQTH 1U0QA 1WCBA 5AZ2H 4HS3A 1IQWL 2GJ6B 1PLGL 4NZTL 3D48R 1D9KA 1OP9A 5J3HC 2YSSA 4QCIA 4FXLA 5BV7L 5JXED 4XPGH 1FYTE 1G9ML 1NCTA 1AGBA 4HH8A 1FDLL 3PV6A 1T04A 3QO1B 1QLEL 5FDWB 4HWEL 3OR7B 2OX5A 1A6AA 4Y5YA 3ULUL 1N8ZB 1TQCC 4KMTL 3D9AH 4OF7A 4LIQL 4KKAC 1E28B 3BJLA 2E9WA 3JV0A 2P5WA 4QRPE 4X6DE 3UTZA 4RIRB 1HN1A 4W4NA 3H42H 3BP7A 4MJ4A 3BRFA 3OKOB 4NRYA 2FR4B 3QR2A 5F8QC 3LQZB 2W0KA 4WU5B 1XGUA 5J1AA 3CXDL 2ZCHL 4NKIL 2E7MA 2CXKA 3RL2A 5HYSB 3MJ7B 5IM7A 5F9JA 3MRIA 3VXUE 1ZANL 5IKCA 3Q6FB 2WUCL 4JFQB 1JRHL 3QUMA 3V5HB 4XP5H 2Y7QB 2Z31A 4PJ7E 5EU7C 1I1RA 3WEXA 5I17A 3FFDB 1REIA 2F5BH 1NBQA 2GCYA 4Z7QE 1ACYH 5F3HA 2C3VB 3V0WL 3O3BA 3W2DL 3KXFE 3HNTL 1K5NB 1ZEAH 3FO9B 3GSNB 2C5DC 4H1LG 1KG0A 4LSPL 3MLWH 1AXIB 1KBGL 5E8PB 4UQ2B 3REVB 4K9EL 1Q9WB 4RMVA 4HIIA 3K3QA 1WFTA 2NW3A 3PIQA 4POUB 4FQJL 4MXQD 4YXKH 1UEYA 2WLYA 4F8TA 4YK4C 3VXQB 5TQ0H 2ZCKL 3MUHL 1OB1B 3BMVA 3WSQL 1NMBL 3IDYB 4O2CA 3INUH 3CUPB 1XF5B 4HC1L 3TJHC 5HHME 4Q9QH 1S5HB 4LCCB 1S7UA 3RA7H 2J5LB 5GRJL 1JF1B 3G04A 4OUUA 3SDXE 1A7NH 2YOCA 3VGBA 3QIWB 5HDQL 2OZ4A 4OT1H 2CH8A 5EIIB 1WAAA 2V7HB 1YJDC 3CZFA 4KTDH 3MFFA 4XVJL 5ALBH 5CJQL 3D39D 3U46A 5CJOH 3WD5L 4LEOB 2J8UB 5ACLA 2Z9TA 4LEXL 4KK6D 2VISA 2QADD 3DRQB 1X4ZA 2WWKO 2APFA 4YWGL 3MNVB 5B38B 2GSIB 4NKMA 1G7LA 4RISH 3ZDXF 4FABH 4ZS6C 3GMOB 3U0TA 3QCUL 4JN1L 5EUKB 5DJ2A 3OKOA 3SO5A 1U8HB 3OHXA 4D0CA 2NXZC 5E56A 5HVFB 4OZFA 3DSFH 1I8LC 4GQ9H 4NFCA 5F7LB 5T5FL 1IEAB 3MBEB 1B4JH 3QEQD 1DBMH 2VLLB 2XIDA 1CL7I 3MRMB 1FVDB 4Y4FA 3E2HC 4S0SD 3GHEL 2VAJA 3E0GA 2QTEA 4RWHA 1OLZA 4OLXH 5KOMC 1SJHB 4KI1A 4Z0BH 5DYOA 3ZTNL 2CLZB 4UILH 5ACZB 4UT6H 3IKKA 1XFPA 3G6JE 5EBMA 1BF8A 4EKXA 2XZCH 4O02L 3ARWA 3B4NA 2EDNA 4ENEC 3ZZ1A 1QFUH 3PHOB 4MMXC 4DZBB 3ARBC 2NXYD 1U3HB 2RIKA 2HA1A 5A40E 4YHOL 2MJWA 4XNXL 1I8KA 1T22B 2OK0H 1PY9A 3C8KB 3IDGA 3KDMB 4D0BA 3QA3A 4EUPG 3FCTA 3RWFA 1CXFA 3HAEH 3T2PA 4DKEL 4LASL 4NQED 4DOHB 1BZ9A 4HIJA 2FECI 3NA9L 5ETUA 2XV6B 3GMNB 4EVNA 1JFQL 4Z7VF 1JWUA 1AQKH 4PJDE 3F5WA 3KPSA 5CWSA 3O8XB 3RWEA 3WKML 5F6IB 3OJVC 1HQ4B 1FP5A 2JLLA 3ZL4H 3BHBA 4P48A 3QHTC 3QJHA 2N1KA 2V2TB 3K8MA 1CF8L 3P0VH 3GNMH 4EXPX 3U0PB 3BT2H 3G9VA 4J4PC 3K0WA 3RWHB 1N7MH 5MEND 2R2EB 3CFEB 1QVOA 2MTPA 1D6EA 3NH7L 1MHEB 2W38A 4XAKE 4KRPD 1MRFL 4JFXB 1QHPA 4IMLB 2UWEB 5CINH 3T2NL 4KC3B 5CGYD 1JNLH 2EDRA 4IHOA 2XFXA 3P0YH 2DQGH 1ZVYA 1X5JA 4Y16A 3RNQA 1M7DB 5DTFB 1KN2L 4NQVB 4JO2L 5IW1A 4OD1L 5JDSA 4GOSA 2GJZB 1HCVA 3DV6A 2CLZA 3KYOB 2WV3A 3F7YB 3KPNB 3LOWA 3OKYA 4KUCD 3VDAA 5E5RB 3QEQE 3VXSE 1A3QA 3VCLB 1L0XA 4R8WL 3LDBB 3BGMB 3GUTB 5IFJA 4LLAA 1PBYA 4BZ1H 1HOCB 5BZDB 3MOAH 1KJ3H 1BM3L 4ZQKB 3DPBA 1G6RB 2F54E 2YN3A 3PE9A 1NGXA 1DP0A 3OJMB 4WW1B 3HG1D 4PJGF 3SGDH 1EFXD 1RUPL 2EIDA 4ZNEA 2O5YH 1ZGLA 3BE1H 1HSAA 3OXRB 3F58H 3O41A 2EZ0C 1NFIA 2B4CH 3EDJA 2IALB 4OFPA 1U8JB 3NCEB 4WV1B 1SM3H 3LKSB 1HHGA 2D9CA 1CE1L 2HLAB 4HKZB 4RGMC 1IARB 5AYUL 2WBJA 5ADOH 1RZ8A 3KWWA 1P4LB 1GZPA 2E9BA 1ZHNB 2FYYB 5HD8D 5I1DA 3V0AC 5D71H 3ILPB 4I77L 4F7PB 5AZEL 3MV7A 1HQ4A 2AXHA 5LGJA 4NM4L 4WENB 3FB6B 4GFTB 2V2TA 3M8OL 3WFEL 3EZJB 4Z78A 2NY3C 4AYFA 4LP5A 1T1WA 1NDGB 4RFOL 5I1GH 2VDLH 4PJBF 5TFSL 3EO9L 1MFDL 3HE7D 1DEEB 1JHTB 4U6YA 1OY3B 1LP9B 4X83A 5FCUH 4FMFA 4F8QA 3FQNB 4GG6A 1X5KA 5JPMB 3CZJA 1QZ1A 4E42A 2F5AH 2ZP0T 5DFTA 1YPZF 2DF3A 3NAAH 4XX1G 5IMLB 4UUJB 4PJ5E 5HHXH 5IQ9B 1D5XA 5E2VL 2X4PA 3KYNA 1NCBH 2EO1A 5E2WL 4HKJA 4P49A 5C0RL 1B3JA 1K6QL 2J6EL 1DQML 2YD1A 4W81A 1IM9A 2P42B 4HULB 2HH0L 4QT5B 1H3UA 3FL7A 2EDWA 2GT9B 1T7VA 3K8LA 2ARWA 3A67L 2DTML 3GJFK 1ZS8A 32C2B 1CGSL 1FL6B 1OAYH 3EYVB 1Z3GL 2NY6D 5FB8A 1A9EB 4H1LB 1L6XA 3U36B 3A0OA 3PP4L 4V2BA 2WP3T 5HY9A 4JANA 4Y2DB 3I6KA 3FFCA 1NGWA 1VEOA 2AJZA 3NCYP 2IPUG 1E27B 5INCB 1OARL 4R4BA 5C86A 3P4OB 3Q3GB 5L2JA 5CUSL 4XZUB 4JEGB 3UTSA 3T8XB 3OJDB 43C9A 2XY2A 4PJHF 4LDLB 3VD9A 4O2FB 3U4EA 5TDOB 4LQFH 1K8IB 2R23B 4KQ3L 1WF5A 2YRPA 1FNAA 1YYLL 5IUSA 8FABB 4AEHH 2Y72A 2XWBA 2GEEA 2KBGA 4Y5VA 25C8H 4GAFB 2Q86B 3ZTJG 3UTTA 5I8CB 3OG6B 4KROC 2R1WB 5D7JD 4PJCF 4NSKA 4ONFH 1LO5A 3ES6A 2UYLB 3VWJB 1MI5D 1CICD 2MQ3A 4WUUD 2GUOB 1G6VK 4P5KB 3WHE1 4QXWA 3TO4A 5SX4H 5EFIB 5E8EA 1O0VA 3PWVA 4GRLB 1LEIA 4K3JH 3L5XL 3AAZA 4EBQH 1KCRL 4PY7B 1UWXH 4UIMB 1QPPA 5AD0A 3IDJB 5D2LA 1R3LA 3MRFB 4MA1B 3LN9A 2J7LA 1ZT7A 2AJVL 4L4VE 5HYQA 1Q9LB 1WSST 5GS2D 2Q6WA 3TIDB 3JV5A 5A2JH 5I19L 1UCTA 4PRHB 5IBLD 2FH6A 2IBZY 4OGXH 1TVBA 1AFVH 5CJXC 3IS1X 5FUZH 2FNBA 4JFDE 1QPXA 1AGEB 4DFIA 1HKLH 1JRHI 3KLAA 4IOFD 1I3GH 4WCYL 4YE4H 2AEQL 5TQ2H 2XWJA 4YNYA 1IGTB 4PJFE 5T1KB 3SJVB 1EHLL 3BQUB 1BQHG 3QDJA 4YLQT 3LAFA 1LWRA 3BZFA 4MMZC 2IAMA 2YPLE 3PABA 1CLZH 5L6YH 1EERB 5AAWA 5LBSL 5J6GA 2ESVE 2CO7B 3O3EB 5HHOB 2DKMA 4KPHH 3L3JA 3IFNL 1EBPA 5EBGA 4XMPL 4O2FA 1E6JH 1YQ2A 5C0JA 1CDJA 3KLHC 1QSFE 3TM6A 5C0AD 1NCWL 4LSSL 2QKIB 3EOTH 2DOCA 1BFVH 1AE6H 1F90H 2BVPB 4P2RD 4K3DL 4K2UL 5C2BL 2PTVA 2X9XA 4HPYH 1QFOA 3B5TA 3SO3C 4AEIH 5FO8A 5HD8C 1IC4H 1ZGLM 5JW4N 4YZFE 1BOGB 4MAUH 2DDQH 3M07A 1IRAY 1MFAH 1J05B 3QCVL 1IAIM 4M7JL 4ODSL 2IFGA 1S9YA 3GI8H 3MJGX 3P77A 1M1SA 1TTUA 3C6SB 1U8LA 3KPPA 4NPYA 2EDTA 4AQ1B 5D93C 1S78D 2CKBH 3ARGA 1DL7L 4JE4B 4OLVH 1AGCB 2BSSB 4HF5H 4DGVH 5IWLA 4U7KA 3K1DA 5I1IH 3UDWA 2VN4A 4R90L 1NAMH 5EU6B 2ZWLT 4P3CL 1OGAE 4IBLT 3MLTA 1J1XH 1YJDL 4N0YL 4G6AC 2Z93A 1SBBA 3BPLB 3IFPB 3UYRL 3SDYL 1WIUA 4NO0A 4ERSH 4WI7A 2OS7A 2NX5D 2FEEL 2GW5A 1QP1A 5IEKB 5DJ0A 3QFJE 4R3SA 4LCWD 4IM8A 4P5TB 4ZG1A 1N0LA 5T5NG 1IGMH 1QBML 3DX7A 4M6OH 4XTRC 4GRWH 4DQOL 4EZMA 2COQA 4S1RL 2VZ1A 5SX5K 2YUVA 2NY4D 1FIEA 4MD4A 3T77B 5GIRA 4PG2C 1OP3K 3FAWA 5L0QC 5IFAH 5GZND 4C59B 2AV1A 4ODUA 3HZYB 3L3OB 3DMMC 1VEPA 4HGKC 4LRNH 4M8QB 4QYOB 5CCKL 4JG0L 3QP3A 5FYJD 3WLWD 4OCYL 4X6DF 4I4WA 4QHLB 2IPTL 2WQRA 4WO4C 3L7FA 4QOKB 3WV0A 2CDGB 3LQAC 3P4MB 3GMQA 2BNRE 5JZ7C 4XMKL 4P3WA 5H35B 2YR3A 1R3JA 3RVWC 5I71B 3O6FD 5TPWH 1CICC 1S5IL 2OJEA 4PJ7F 4WEBH 3VH8A 3BP5B 5E08L 5C0AE 4MS8C 4Z7QF 4MAYA 4EQ2A 1JZ2A 2BERA 3TYGH 4Y19D 3MRBA 4L5FL 4MCYB 1DCLA 3JSSA 4I0PA 1K4CA 4EN3A 1TJIL 5KBNC 2V5TA 2A6KB 5FK9A 3OKDB 3RIAK 1YC8A 3EOAA 3MA9H 4TUJA 4G6FD 4OFDA 1C5BH 3RIFK 2UY7A 4PY8J 3WFCH 2BOCB 3FKUS 4P2OB 4JFFE 3HAEG 4X80L 2FD6L 5L2KE 3QCTH 1Q9KA 2X4RA 4GW4A 3LEXB 5FF6A 3VA2C 1JF6A 4URTB 4HX1B 4P46C 1UFUA 1QEWA 3VFGH 3VXRA 5CSZA 3GMPB 2OTUA 4IOFC 4U1HB 1Q72H 4LLDA 3MLPA 3EIFA 5JQ6L 3RDTB 4G7YL 2SEBA 3C5ZA 1VFBA 4IRJD 2OL3L 2XG5A 3QXUA 3K81A 1NCNA 2X1XR 1KIQA 3H7LA 2A83B 4HEPG 5FGBC 3OKMA 2YS4A 4RGOL 1S9XA 3SDAA 4P99A 5DRNB 4C56D 1CG9B 4NZJA 4LCWE 5BS0A 3VMOA 1F3JB 1HI6A 4M8QA 5EZOL 4EI5D 4M5YL 3NACH 1MJ7L 2DIAA 4WUKH 4YH6A 2BY2A 5EN2A 2FATL 2DICA 4BZ2L 5I1JL 1PQZA 3LD8B 3RX8A 3TT3H 5F1SA 5LAXB 4Y1AA 1V8HA 2YUZA 3GHBL 5E1HB 1VFAB 2RFXA 3RZCB 5E9DA 4FTVA 3VGGA 3ESUF 5HPMB 2FX8L 4PREB 3HN3A 3ET9F 4S2SA 1KCUH 2EKJA 2NW2A 3S36L 2CLRB 5EOTB 4HBQA 1P7QA 5DRXA 2JIXD 5KSAD 2CGRH 3STZB 5HYFA 1BIIB 1DANT 3T0EE 3G6JF 4FZ8L 5C0CA 3HCVB 2G9HB 4ZUWB 2D7TL 3WFDH 3BPOB 5SWZA 4GAJL 5BCAA 3JTTB 3V7AE 1HXYA 1PKOA 4OZIF 1QLFA 4QHNA 2BC4B 3UYOD 4YBLB 4G9FA 1KJVA 2BOCA 4UU9A 4X5LA 5A1AA 4XVSL 1KTLB 2FJHB 2BZDA 4ZFFA 4F33A 5JHDB 4PJXA 2BSRB 1CFVH 4N9OB 3RQ3A 3C6LA 4HX1A 5DR5L 1EK3A 4NFBA 2IFFH 5BRZB 3GMPA 3MRRB 1RIUH 4JPWH 2J8OA 1KV3A 4NN5C 3SE4A 2VZSA 1ACZA 1XGYH 2R1XB 1X5IA 4PJDF 5D96B 2W9DL 1TZHB 3UMTA 5JOPE 2VR4A 3DX9B 4GXUM 1EXUA 4KV5F 1KFAL 1NDMB 4JY4A 3B3IA 5FEBA 5IR1A 1NEZA 1QG3A 1WZMA 3HS0A 2DIJA 1QRND 5J4MA 3U2SB 3H3PL 3C9NB 4LARL 1KLFA 2XY1A 5DHYB 5JNYB 3DXAD 2OI9B 2EYSA 4X6CE 1AD0B 3UPAA 2I9TB 4DUWA 5KSUA 5FA3B 4WY7H 4GKSB 4FQQB 2YHGA 4ZFGL 5HI3D 2E3VA 4GKZA 1Y6MR 2P24A 4FOMA 1RZ7H 3WE6B 3DX6A 5DJXA 1EEZB 4ZPTA 3WO3B 1F8TL 1UB6B 4HKBB 1UXWA 1YY9C 4FQLL 3DO7A 1NBYB 4L8SC 3RVXD 3VFWB 2PNDA 4UOW0 1OGTB 5EUOE 5C08B 3VG0L 3V6FB 3WJLC 3TVMA 4KVCL 4OZHB 3SKMA 1MQ8A 1NBVH 1KB5H 2CPCA 1V3JA 3O9WC 1T03H 1IFHL 4NUGH 4ZS7L 3WIIH 3IJHB 1F11A 5DA4A 5HGAB 5GSVA 1WZ1L 2C7UB 1FGVL 2EYTB 4Q0XL 3KPQA 4ZTOL 4P9MH 4JO1H 4YDLB 2QHRL 4IJ3C 5GGVY 1MHCA 3K2UH 4ZPVB 2RHEA 3WNOA 2VXQH 1MCSA 3E3QE 4TUOB 4RWYH 3FMGL 2R29L 3GBNH 1T0MB 4JM2B 2Y4SA 3T04D 4LPCA 4O51B 4U6VH 4TN9A 3QBTB 4XXCA 5IJVB 1KGCD 3EYFB 1JNJA 2YZ1A 4KK5C 5GGVL 4HWZB 5F72S 1EDQA 4M1CD 4MJ6A 1CFQB 4MDIA 1P6AB 2OJZH 2EO9A 1HXMA 1XIWB 3VXNA 4F15B 1FCCA 4ONGL 2V9TA 3ULVE 4TRPL 1BBDH 4R4NC 5ECJE 1A1MB 1WWWX 4EI5C 3M1BB 1CK0L 5DK2A 5A16A 1X6LA 4DTGL 1OLLA 3AU1B 3OAYK 1AD0A 4P3DB 5DDHA 3VRJA 4HSQA 5LKNA 2RQ8A 1C5CH 5H2BB 1F6LL 3IAPA 3S6CA 4HPOL 2LU7A 4QRRA 1HH9A 4NHUA 4P5MB 2QLVB 3MLXL 1UKSA 1RJYB 2OXGA 1LO2L 1YEJL 1GGBL 5F7UA 3EBAA 4TULH 4KI5E 5MEOA 3BKYL 5E8DH 1NC4A 1AD9B 4NWUH 3KAAA 2W9EL 4KTEH 1VPOH 4MLIA 4K7PY 5EZLA 3LIZH 3E8UL 1W72L 4AM0B 4BSWA 2O26U 3E3QC 3O4OB 5DSCB 1I1AB 3GSRB 1RUML 5FYKH 1XT5A 5EO1B 4ZUSA 4HGWB 4YHPA 5F70A 3H8NA 4N9GA 2GJ6E 2JTDA 2NY1C 2WBKA 3HC0A 1U58A 2HYMA 4JZJC 1WIOA 5GJTL 3TCLA 4K7PL 5I66A 4NKQB 1RZJC 1FG2B 1OSPH 4KUCF 2V2XA 1EAPB 1YC7A 2DLFH 3UTOA 5CEZE 1Q8MA 1X5YA 3HAEB 5IIEB 3ULVC 3RWIB 4JY5H 1SQ2N 4CN6A 4UI2A 3AY4C 3VJ6B 4X4ZA 4PJIA 3SE3C 4I9WD 1F4HA 1UEMA 1A4JA 5F7WC 2H8PB 3WXVH 2Y36H 4V1DB 4HWZA 5KANI 5C0IA 1KTRL 5IESH 2FEEI 3EYQD 1YNTA 2ZNXA 3Q1SH 4HAGA 2JJSC 2MKWA 3QUXB 5FV2A 3SDCC 5I6XB 3R06B 2KQMA 3OKNA 1YEIH 3TIEA 3WLBA 4G9DB 1U8IA 4KMLB 4ODVH 5L88H 1CU4L 2DMKA 4OD3H 2FSEB 1QHOA 3OAUH 4KI5C 5J12C 4H88L 3H0TB 2JJTC 4OV5A 1T4KB 4UV4L 4JQVA 4I18A 1T5XA 3DYOA 4HUXB 4NQDB 4HS8H 3MODH 1RZKC 3MACL 3VXMA 3BGFC 3X11B 2PW1A 2P8MA 5DK3A 5SX5H 2X4SB 3MGTA 1D6VH 4ZFOA 2W0FB 4MJIB 1IAOA 5ERWB 3TN0D 1GGTA 3MYJA 4PG9A 2ZSWB 3IDMA 5DMYA 1BEYH 1KEGL 3MLVH 1AD9A 1R3KB 1VGKA 2PR4H 1W8NA 4WWKA 2XKSA 2Z8WC 2DLEA 2HKHL 4FQPA 1MCNA 5CEYB 1ORSA 1JN6A 3F7VB 4NBYB 4OF0A 2C1OA 1C5DB 4AL8L 2R2BB 5DJ6A 3MA7A 4HCRH 1UM6L 1FFQA 4CU6A 2GJJA 3GSXA 4L9DA 4EI6B 3ILQD 3LQAL 3SCMD 1N4XH 2XPGA 1DBAL 5LWYH 2E9JA 4PGCB 3BW9B 2J8UE 5SWQB 4BKLA 4KH2A 3RY6C 5KVMC 4HZLA 5D7IB 1N5YL 4HFUH 4QNPE 3U30B 1QOKA 4LCIL 5HDOA 3WS3A 4P23A 4PRID 3CVHH 5ISZB 1MCKA 2ARJA 5GGTA 3AC0A 1OVZA 1OTTD 2GIYA 4DWHA 2XXCB 1R0AL 3WNMA 2KPNA 2PO6A 5FYLD 3I85A 3RHWK 3DI2B 5DVOA 2R8SL 2FO4B 4X8XA 5IFHH 4JCLA 4GW1B 3VW3L 1FZJB 5E00A 3C09B 4MWFB 4P2CG 2XWTB 2P44B 1V7ML 3GIVB 3MROB 1DBJL 1ZSDB 3V4PH 1OM3L 4Z7WA 4RMTA 4CU8A 1ADQA 3DVFA 3IDYC 4H0IA 4M03A 5FOJA 3WN5B 4MQSB 4Z76A 1U8NA 3WNPA 3QQ4B 2OQJB 2UZIH 3LZFL 4QY8B 2VXUL 4LCCC 2GFBA 2JK5A 1CD1B 3AROA 2J5LC 1GSMA 3P9LB 5ERWA 4M1DL 4S1QH 2VXVH 3QIWC 1WEJL 4OCXL 4ZTPL 3JV6A 2O5XH 5C0BB 4MQ7A 1IM3B 5DT1L 4FP8L 1DBBH 4LPVA 2O5ZL 4DOHE 1RFDH 1WISA 5DEGA 3D25A 1HHJA 5K59E 3TBVB 2CUIA 3OJ2C 1A21A 3QNYA 5JR1H 1T83C 3ARDA 3S37L 4Q9RH 4ODXB 3QUZA 2NY7H 1GGUA 1MCBA 5D1ZA 1NBZA 2ZCLH 1IGCL 4NCDA 2AK1L 1F4WH 3OKLA 2EDLA 1B0RB 3MBEC 3D3VA 2BMKA 2N56A 1QACA 4P9HH 3JWOC 5BZWA 1INEL 1S3KL 3UYPA 4DVRH 1J18A 5IQ7L 3ARRA 1CLOH 1ETZB 1UCBL 3MGAA 3BN9D 3NZ8B 5DQJA 3O3DB 4OV6F 4DN3L 2AJUH 1N6QL 1U6AH 2A77H 3HNSL 1ES0B 3RU8L 3CVIL 1CIDA 4GAYA 1MREL 1FO0L 1YQVL 4K3GA 2EDBA 5CJ8A 4YQXL 2AQ1A 3QI9B 4NUJB 3MRKB 4M7KH 1E4XL 1E4WH 1MSPA 4QRUB 1CTOA 1CGYA 4ODTL 4H0HB 1DE4A 1D5ZB 2UWEE 1K9TA 4LNRB 2EDFA 4P2QA 3MRDB 5IMMB 1YN7A 4X99B 2D03H 5L8JB 3TA3B 1NUNB 3TPUA 2P8LB 1U3HC 3D0VB 3D2UA 4JPVH 4TSAL 1MFEL 5E1AB 2V17H 5LCVL 1M71A 3SBWA 4HIEB 1RK1A 3SDDD 3TBWB 3L9RB 1H3TA 2HKFH 2IAND 4NO3A 1RIHL 3CX5K 1GAFH 4PJAA 3OKEA 1C7SA 3ARFA 4AENA 4POZC 2R4SL 1A1NB 5KW9H 1T7YA 4QHMB 2WIIA 5HYJB 4NO5A 1Q94B 1AO7B 1KJMB 4U1MB 2JB6A 2EXYD 1H5BB 1JPSL 1OP5K 2D7QA 3O8XC 5F9WB 2WP3O 5DQ9A 5F6IC 3BXNA 1MIEH 2BHYA 3VWJD 1CD8A 2KZWA 4ZAKB 3FB8A 4JHAL 2IH1B 1R3HB 1NGQL 2YZ8A 5MEPA 1WV7T 3HMXH 5C7XH 4GRLD 3QT2A 5C07D 3UAJC 3NIDE 2MHAA 1IKFH 4IOIB 4LK4A 4ELMF 2E7HA 3T4AA 5TDPB 1MUJB 1IBGH 4M3JA 4NRXA 2A1WL 4F7TB 1HK6A 2HFGL 1IAKA 2JELL 3QQ3A 3SY0B 3TNNA 5EOQH 4P4RB 5LVEA 2CIKB 1T21A 4HMDA 2A0LC 1DQDL 4NNXB 4NNYA 2E27H 4F7MB 4XPAL 2VLKD 1BD2A 2CSPA 1QSEB 4XCEA 1T1XB 4YPGA 3MLYH 1LP9E 5E7BA 4XBEL 2C4FU 1NGZB 2ZJSH 2ATKB 1ND0A 1CFTB 4KJPD 2KL6A 3LDBC 2NY2D 1M6OB 2JJWA 3HFMH 3MRJA 3HNVH 5DD6B 2XQBL 5GGTH 2H32A 1A14L 1D5MA 4KKNA 5AUMB 2IG2L 4KY1H 2IADB 4HHAA 3UO1L 4NYLA 2AAVA 2CKBB 4WFHE 2QQQA 4KZDL 4TNVF 2ZUYA 4HG4K 4NJAL 2ADJA 5E6ZA 4UIKH 2ENYA 2DBJA 1MWAH 1NAMB 4N8PA 1FNSL 2DIBA 2NLJB 2CKNA 4OF5A 4WV1C 4CMHB 1ZE3C 3RVVC 5L9DL 4B0MM 1QYGH 4F9LC 1JHLL 1IVLA 3ULSA 4Z7UA 2P5ED 3QNZB 4W6YB 3PHQA 5EWIH 4YHLL 3OAYH 2XACC 2BDNH 5GHWL 1DBKH 4U6HA 3S88L 2HFFB 4OKVA 3DVNA 1U8QA 1DLHB 1FN4B 2VDKH 5GS1A 1BAFH 2ZSVB 4GRWB 3RGVA 4OI8A 1R3HA 1A0QH 4UT7H 5IROC 1NFDA 4MXWH 2DQIL 4MJ2A 1QA9A 2EH8L 2F58L 3B9EA 2HTLC 3L3GA 3OGCB 4GAGH 1S7TA 4LKXB 2Q8BH 1DLFL 1ZT4A 3HR5A 1QBAA 4Y2OA 5HYEA 5GSRB 3HC3H 1ZA6B 4MQTB 4FQ1L 3ARSA 4OM0L 2CRZA 5FUOL 1HDMA 4M7LT 4TVPE 4D3CH 4X7SH 5E6ID 3IU3B 4F7MA 3EGSB 5CLTA 5L8LB 3MNZB 1UQSA 4LSQL 3BZEB 4KJQC 2L4OA 4RX4D 5IK3B 5I1HL 1CZ8H 3ZYJA 2VKXA 2HT4C 1EFQA 4ELKB 2Z92B 2DBLL 3UX9B 3MJ9A 1RZJL 2HT3D 3IS0X 5DD6A 3C5JB 4PRHE 4I3RL 4IS6B 4Y2DC 1A7RL 5J11B 5EUOF 5IMKB 3QH3A 2XICA 3ULVL 3SKNB 1I1FB 1EZVY 1KJ2A 3X12B 3PL6B 3JWDH 1G7PA 4M62L 2E8YA 2F53D 5KS9A 5D7LB 3KPMB 1DDHB 3SJVE 1MRDL 1XH3B 4NKOA 4XI5D 3ROLB 3RVTC 4EXKA 3C08L 1II4E 1CGWA 2Q1EA 3QUKA 4I2XB 1UH3A 3IDNB 1UZ8B 1T2QH 3CDYA 1T3FA 5EC2B 3LS4L 2DLHA 4HUVB 3HE6A 4L3ED 2Y5TA 3QEUA 5HHOE 2J88L 3CDFA 5A43C 4YHKH 5K9QG 3VWJC 3OB0K 1YEEL 2HFFA 5T3ZD 5DJDB 5I2IB 4JO3H 4ZO7A 2YPKA 4NQCA 1I8MA 2IPKB 3GI9H 1AKJA 3LVEA 1HNGA 1RZKL 2CR6A 1R5VB 2D0GA 4GRLC 2DQUL 2QV2A 2H9GA 4JHZA 1DR9A 3PDGA 2H6PA 1IEBB 5JW3L 4MA1C 1BP3B 5ADPL 5F88B 5CEXB 1INDH 1I85A 3MRQB 2OZ4L 4LHUA 3CFDA 3U9UA 4F9PC 1TPXB 4JO4H 2FIKB 3PQYA 3SQOL 1SBSL 1NEZG 3HI6L 1YEFH 4Z7VB 5CEZL 1FFNB 1I8IB 3NVQA 5LGHL 4TOYH 4LLVB 5I18H 3IU4H 1G7IB 3KPTA 2LAGB 4ODHL 4J3WA 5AG8A 3KS0H 4ZUUA 2BNUA 5DUBB 5TDNB 1I9EA 4NQSA 5EU6E 5JIKA 2DB8A 4DZ8A 3V2AR 5CFHA 3BQUC 3JTSA 5C6TL 1N5AA 2PXYD 4JRXA 3CLEH 2BHZA 3ZYIA 5LQBH 1L0YA 5JXAL 5DD1H 5CBEA 1INQA 4PJ8B 4XNMA 3WXWL 4XAWH 3VRIB 2EIBA 4R7NB 5EBLB 4DW2L 3QHZH 5D7LA 5H37H 5D5MA 2H32H 3MRLA 1XH3A 1ZT1A 4C4KT 5EC1A 1HHIB 3R0MA 5HDBF 2FBOJ 1MIMH 1T7ZA 1UZ8A 1N0XH 1I7ZB 5CIPB 5JW4Q 4KHXL 4ZOAA 2DRUA 5GRZA 5ESQA 4X6FB 5CP7A 3NBNA 3VWKD 1WBYB 3MV9B 5IW6A 4NHCH 3QXAA 5ACMA 4C83A 1OAKH 5DS8A 3QDMD 3D85D 1UA6H 4G8GD 4JKKA 3H2WA 3BEVA 4NOFA 1NL0L 2UZXB 4R26L 3RKDC 3FO0H 5DZOA 4QOKE 5MEQA 4TQEL 4Y4HB 5IMOB 3IAQA 2PW2B 1OT1A 3FT3B 1QR4A 4ALAL 1ROWA 4MA3A 4WI5A 3DUHA 2ITDB 1FZOB 4PJGB 5F88A 4CGTA 4L8CB 4D9LL 3DYMA 5CEXA 4OKDA 4Z7OF 5IVXA 3MOQA 2VDNL 2WLZA 1RZGB 3QPQC 1MNUL 5EDXA 1DVFB 2FWOB 2XOTA 2OSLB 3BPLC 3K8KA 4WIQA 3P30L 2VDRH 3SPVB 4K3EH 4DK6A 4E41D 3GJFB 1G9NC 1S7RA 2VL5B 5JHDD 1OCWL 2H26A 1FIGH 2NR6C 4JM4H 4BSJA 4WW2F 2BOBA 4F7CA 1A3RH 4XBPA 1XGTB 3QIBB 4P5TC 5HGBA 2HN7B 2XZQH 1JWMA 3UBXG 3QULB 4MNHA 4FQHA 1SMAA 5T1LD 3VG9B 1FL3B 4YHIB 5EBWA 1F6FB 1YY8A 1OF2B 1MJUL 3JWOL 4EIGB 1E4XI 1T0NA 2NTFB 2QHLA 4GMTH 4ZFZB 1MLCA 5K9OB 1V3LA 2BNQB 3VI4E 4M4PA 3CFKA 1KB5B 1C1EH 4TPRL 3RWJB 1MRCH 4XRCB 3PJSA 4G3YH 3MJ9H 1CN4A 4YHNA 1AXTH 2V2WA 5I8OL 1ZVSB 1I9RH 2J8UF 1JYVA 1J1PL 2LVEA 5C0EB 2X7LA 3O45A 3PWPB 5C09B 1KJ2H 1TETL 1IE5A 2VE6A 1RSFA 4QNPF 5KG9B 1LD9A 4AJ0A 4H5SA 5IEHA 5I71C 1A4KA 1BFOB 4IDJH 1LHZA 4JRYD 4LDEB 5FCSH 2VN7A 3C60D 5B22A 1YA5A 5CD5D 1OAZH 3H7BB 3EW3B 3BKJH 3TZVB 1FORH 4QF1A 1IQWH 1PLGH 4TSBL 1RJZB 2MQCA 3GMMB 4NZTH 1JPFB 3TBYA 3FT3A 3M17A 3MV01 2VLJB 5BV7H 2X89A 2D0HA 1G9MH 4N0UA 1T66C 2RBLA 3DRTA 1QFWH 4WFGD 5I9QB 4BA8A 5FOBB 1QLEH 3IJYB 4HWEH 4PJHB 4Q9CA 1A47A 1OP5H 3ULUH 2UUDK 4P2OC 3ABZA 2BSTA 4KMTH 3GSWA 3MRHB 4XBGA 4LIQH 4HS6B 4P4KB 3RPKA 2IMNA 1FNFA 2NY0B 5IB5A 4NC2B 2P8PA 5IVOA 2R69L 3O4LB 4UINL 1Q1JL 1S7VA 2PYEA 2ZCHH 3CXDH 5D1QD 1R24A 4PRAB 3JVGC 4FFYH 4RAUB 4LVNB 4MVBD 3RDTC 1D5BB 2WUCH 3CLFL 4W6XB 3HZVA 2VQ1A 4DCQB 4JFEB 5EPMB 5JHDE 1YDPA 3U0WL 3V4VH 3RVUD 3ZMRA 1V7NH 4LPXA 1OPGH 5D9SB 4PJBA 5IT2L 5BRZE 4APQD 4MSWA 3W2DH 4G8IA 5K9JH 3HNTH 1WFNA 4LSPH 1KBGH 3MJ6A 3UTPD 3AREA 4WFED 1YPZA 2WW8A 4K9EH 2VXTL 2GI7A 4HUUB 4YEFA 1I9JL 4I5BB 3LD8C 4FQJH 4PP1C 4W4OC 3LEVL 2QSCH 4AT6B 4Z5RB 1DTUA 4GBXD 4WGVB 2ZCKH 3PWPA 1YMMA 1KLUB 3RZCC 3WSQH 1NMBH 4KZEL 2AP2A 5F7YC 4HC1H 3EJYD 1CDGA 4JKPL 4DUVA 1KIRA 5DEFB 4IRSB 4YDJA 3V4UL 5E2UL 3EJZD 5DFWH 4U0RB 1T80A 1G6RL 1Q0YL 3FRUB 1IGJA 2DJ4A 5GRJH 5F3BA 1QNZH 2X4QA 1S7WB 2HJKB 4FQIL 1FL5A 6CGTA 3W0WD 4S10A 4XVJH 2YD9A 4LGPB 3FOMB 3BPOC 4HUNB 1I1AD 5DRWB 4X8JA 3NFSH 4JY6A 3WD5H 3I84A 4MXVF 4ZD3H 4LEXH 4Y5XA 3RPIB 1HHKA 4YBLC 1SVZA 1NMCB 4OBRA 1KPUA 4CW1A 4YWGH 5SWSA 3MRHA 3H9SB 1JPGA 1DQQA 4PJEF 4HIHA 3X3FH 1A2YA 4O2EB 3S3PA 5C08E 2J6EA 1ORQA 2DI9A 3UJTL 3ZKND 3QCUH 4JN1H 4OZHE 3HR6A 1VADB 4PJCA 2FL5B 2VIRB 5T5FH 2CLVA 5CD3B 1EX0A 4YIQA 1UWEL 2XKUA 5I30L 2E7LA 4ZXBD 5D96C 1FV1A 2WINB 3FT2B 5HVHB 1SYVA 1UKQA 2VYRE 4UB0L 2QQLL 3BAEL 3MREA 2ZZUT 2XYCA 5GGSA 3D18B 1NGPL 5JPNB 3EHBD 4WI9A 1PKQB 5I1CL 4YPJA 3ZTNH 2A6IB 1KCKA 4O02H 4X6EA 2OI9C 3S3JA 3NOIA 3ZKSD 3KYAA 5F9AC 1D9KD 3NIDF 4K8RC 4IMKA 2XG4A 2X4TB 1OQXA 4NQDD 3RZWA 1IEHA 4AT6A 5JLZB 5K9KB 5ANMA 4FQXB 3MUGA 2X4NB 3U4BL 1IAMA 4QXTA 1JF5A 5CMAB 3RUGF 4YHZL 2FHBA 1KELL 4LOUC 5DJYB 3UTPE 1K8DA 1T89A 1XR8A 2GTWB 1RIVL 1RZIB 3CVHB 3DGCR 2AEIT 3N0PB 4NBXB 2G2RA 2P5WD 2EC9U 3NA9H 5HPOA 3GJEA 1HIML 1MCRA 1U92B 1ZKAA 4OCRL 3QUYA 4ZSOB 1JFQH 3MX0A 3HB3C 4D0DB 3BP6B 3GB7A 2WANA 1U91A 3BOVA 3J7HA 4MNGB 4FS0A 3K46A 3TJEL 2DM7A 4UV7L 4I48B 3P4LA 3ZT5A 3LN5A 4QRQA 5FHAL 1WITA 2JCCF 4E0RA 2Z31D 1TMCB 1IC5L 1DQJB 1FFOB 5J1SC 4QHKJ 1CF8H 3QQ9C 3OQ3B 3SGKC 4YDLC 4X98B 5BOZG 5I16B 2A6DB 2OLDA 2A38A 2WWMD 4XB8A 3SKOB 3FN3A 1ZLWK 4N5ED 3NH7H 5D7KE 4JM2C 4UMGA 4QTHA 4MVBC 1MRFH 3BGAA 4N1CA 4PV8B 4TVPL 5KSBA 2X4OA 2EXWD 2QSVA 3T2NH 4RDQG 3V79C 3FT2A 3JBG7 3EO1B 4CVXB 1TIUA 4U33A 2XKNA 3UBXB 4I0KA 3U82B 4D9RD 4FQ2L 3TT1L 1XIWC 5J6HA 4F15C 4BZYA 1MH5B 1P7KB 4JO2H 4OD1H 5ABDE 1NAKL 5CZXC 4X4ME 3OR6B 2B0SL 4PRPB 2YK1L 3KYKL 4UOW1 5D1XB 2DWDA 4R8WH 1WZLA 3WUWB 1BREA 3UPCA 4V1DE 4XPTL 1HH6A 1EV2E 5A3ID 2FJFB 3QG6B 5IB1B 4Z77A 1M7IB 1XZ0B 3QDGA 1BM3H 3NTCH 3DUUB 1TTGA 2I5YL 3FQTB 1YEKL 2VLMD 4XVUD 4FFZH 3EJYC 4ETQA 1DQLL 4X5WB 3HZMB 3ARTA 5EOCL 1OTSD 1MCQA 1RUPH 2VJXA 3VFMA 5E8OB 1SHMA 5JDJA 4HUWA 5DC9B 4HJGB 1DUZB 2GSGB 3UROR 4NQDE 2IBZX 2AJ3B 5C0BD 1CE1H 1FFPB 3SHSA 4Q2ZB 5AYUH 1FYTA 5F1NB 4PRBB 3O4OC 4ZUTA 1I1AC 3DYPA 3L5WB 5EU5B 3QNXA 4O5LL 2EYRB 4LLYA 4MJIE 3B8SA 1BHGA 4P59L 1ERNA 4NZRL 1KN4H 2QR0A 2HVKB 4LLUA 4OI9A 1ZWIA 5AZEH 4YGVB 3TNMA 1C08A 4QRPA 4X6DA 3TWCL 3M8OH 3WFEH 4LDOB 5GGRB 2Q7YB 4GRMA 1I1YA 2WSKA 3T65B 5C71A 4OIAA 2H1PL 4X98A 3ZKNC 4JDTL 4NQXA 5DHVB 3FTGB 5H37G 4R97B 2LU4A 3MC0A 3EO9H 1MFDH 4YR6A 3VXUA 3LKQA 1XF1A 1FLRH 2XI9A 3EYUL 5J13B 1AGDB 2VH5L 1AC0A 1EHXA 4PJ7A 1D3CA 3O6MH 2CJUL 2EICA 4M61A 4PUBL 3WS6C 5E2VH 4OB5L 4PP2A 4N8VB 5C0RH 1K6QH 3KXFA 1I8LA 1DQMH 1EJ6A 3EHBC 3O2WL 2VABB 5D7IE 5I74B 3QUXC 5EO0B 2HH0H 5I6XC 4FG6C 4CVZA 4CDGC 2UVEA 1U42A 5ISZE 3A67H 2DTMH 1U41A 4JGMA 1LE9B 5HI4C 4OZIB 1G9NL 3UC0L 1CGSH 1GZQB 1G7MB 1Z3GH 2BVEA 4Y4KB 3PP4H 1UWGL 5D2NB 3KPSD 3G6DL 3BZ4B 1G7QB 3QO0A 1Q9OB 1OARH 4HK3J 2BVUA 3UEZA 5CUSH 3BWAA 1R5WA 1F5WA 4LVHB 2Y06L 3ARBA 4F80A 5DFVC 1I4FB 3PWUA 3SDXA 1W0WA 4ONHB 1DUZA 1YYLH 3P73A 1QKZL 3T2OA 4DGYL 1CBVL 2ZOLA 3D5OF 3NCYS 5TE4L 2HWZL 4EIZC 3HLAB 2VLME 3TEUA 1SEQL 1GGCL 4KXZI 2VR9A 2DTSA 2EYRA 3K4AA 2Q76A 1T7WA 3LKRB 3Q5TA 1NGYA 5B3NA 3QZWB 1SMOA 3EDKA 2R9HC 1NCAL 1HILA 3QRGL 1HKFA 3DUSB 4GS7B 4NGHL 1ZA3A 2IH3A 4Y16D 5C0BE 5TJWK 5JXEA 2HT2D 3D39B 3QWOA 1U93B 3AVEA 1FZKA 2BY1A