4PLJC

Hepatitis e virus e2s domain (genotype iv) in complex with a neutralizing antibody 8g12
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
211
structure length
201
Chain Sequence
DIQMTQSPASLSVSVGETVTITCRASENIYSNLVWYQQKQGKSPQVLVYAATNLPDGVPSRFSGSGSGTQYSLKINSLQSEDSGSYYCQHFWETPFTFGSGTKLEIKRADAAPTVSIFPPSSEKVLSGGASVVCFLNNFYPKDINVKWKIDGSVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immume system
molecule keywords Capsid protein
publication title Structural basis for the neutralization of hepatitis E virus by a cross-genotype antibody
pubmed doi rcsb
source organism Hepatitis e virus
total genus 43
structure length 201
sequence length 211
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pljC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pljC01
1LO2L 3BEWB 4MD4B 4MX7A 3BPNB 2CLZB 3U30C 1IAIH 4J4PD 3ZDYF 5D96C 4Z5RA 1M7IB 1MFDH 3WFHB 2WBJD 4Y5XA 3STZA 4NKDB 9CGTA 2QQNL 2A83B 1P1ZB 1T5WB 4X6CA 5IR1A 3RTQB 4EUPG 3R0NA 5AYUH 1D5MA 5C0JA 3D18B 3QULA 1BBDH 5DRZA 5ID1A 3EO0B 3TLRA 4WUUE 1YEDB 2BRRL 3QNZB 1OGAE 3ESVF 4U3HA 1R5VA 3DX9B 5D7JB 1K6QL 2B1HH 4PV9B 1OCWL 3OKLA 4DN4H 1ITCA 4OLWL 1HI6A 5IEHA 5C0IB 3QEQB 1KUMA 3C8HA 3QIBD 5HI4D 2VL4A 5AAWA 4KY1H 1JPSL 4NN5C 4UAOC 5ICZA 1I1AD 4PJ5D 4R3SB 4WWKB 3IU4H 1AE6H 3FFDB 5J11C 3BYYA 3KXFD 1C5CH 2BSTB 1JGLH 1K3ZA 3ILPA 4OLZH 1NMBH 4LBEA 4U1GC 4Y2DC 5F89B 4ZUVA 3SJVE 2UZIH 3FOMB 1SMAA 5D7LB 4M8QA 5JOFB 3QDJB 3UZQA 1JGVH 5T1LD 3B9VA 1JHLH 4PJGE 4PBXA 3KLHC 3FMGH 4TSCL 3PWPD 4G6FB 1FIGH 3S37X 4IHOB 1NJ9A 3IF1B 1IT9H 2F8VA 4OZGA 1QSFD 3ZE2E 3IDIB 5CILL 1F2QA 4OZIA 1OHQA 1AGFB 1ZLSH 4D3CH 4PY8I 1BFVL 3UTSD 4G6JH 2R2HB 1SJHB 1J10A 4PJ7F 2IQAA 1U8HA 2HG5B 3MLYH 5HY9A 5HGAA 5T33H 4F3FB 1G1CA 3MV7D 3BP4A 3D85D 4HLJA 4X6BB 1A6ZA 2YMXH 1DQQB 3NACH 1VEPA 3L7FB 3LS5H 4XT1C 2YD1A 2AK1H 4KKLD 4KVCH 3F12A 2ZUUA 1W0WA 2GJZB 4O2EB 5HYJE 2FL5A 1QTYT 3UJIH 5EOQH 5IB2B 4OLYH 5FGCB 4Y19D 1C1EH 1IAIL 3PWUB 2NLJB 1F6AB 4NGHH 4FA8A 2Y7QA 1FNEA 2IADA 1WT5A 1MFDL 1X9QA 2LTQB 3FO9A 2GUOB 4QXWA 3IJHB 2NW2A 3JUZA 4DK6A 2NY6C 3QEUB 5HGBA 1MFBH 5AYUL 5IM7B 3VXNB 4M48H 4GKNB 4YNYA 2HTLC 1MREH 1CL7I 2HJLA 1FNFA 1L7TH 4OD3H 3MROA 5IEKB 4XTRC 2B1HL 4JM2C 4DN4L 5BV7B 4Z7WE 4ZUUB 5F1KC 3KPRE 5IMOB 2DQHH 2EYTB 3HG1D 1UB6B 3ULUF 3GMLA 4KY1L 2IANB 4MXVE 3EJYD 3U2SA 4YHNB 5I2IB 3IU4L 1AE6L 4OCSH 3ZTJH 4NFCA 1QBAA 4M6MH 4L9DA 1WZKA 3PDOA 4PJHE 1LGVA 1C5CL 2YD7A 3TO4A 1JGLL 3ARFB 2GW5A 3MYJA 4OLZL 1NMBL 1MQKH 2IH1B 5J6HA 5C0EA 3KJ4C 4KK8C 2DYPD 2IAMB 2IF7A 4HUVB 2UZIL 4JFEB 3JVGA 1FL5B 5D72H 1JGVL 1K5NB 2XTJC 3C60C 4DFHA 3PXHA 4I3RH 1JHLL 2OMBA 3FMGL 4U1IA 4GJTB 1VDGA 1FIGL 5E94B 1IT9L 4XC1H 5E9DD 1T7ZA 4IIQB 2Z8RA 5HGGS 4P2OD 3WO3B 4ISVB 4JO4H 1H3GA 3MNWA 4JZJA 4D3CL 2VWEC 3N1FC 1FVDA 5C0DA 1J05B 1FYTB 2VMFA 4G6JL 5C07E 5IT2H 4WO4B 3GMPB 1LO5B 3BT2H 3V6OA 5IKCA 3RY6C 4MYWB 4EBQH 5T33L 3MLYL 4PJAB 2GJ6D 1KJ3H 2YMXL 4MDJA 3NACL 4NKMA 4QF1B 3LS5L 3KYMB 4ZFOA 5E8EA 3BN3B 5E5MB 4JY5H 2AK1L 1T4KB 2J3SA 3QPQC 4KI5E 1PX3A 4APQB 3O3BB 4U6HB 3HFMH 1XIWC 3DYOA 4K7FA 3UJIL 4OIIH 3WN5C 3ARGD 2I25N 4G8GA 4ONHB 4HS3A 4JANB 4OLYL 4D9QE 5JPNB 1YMMB 1C1EL 2BVYA 4NGHL 1FYHB 3GSRA 1MI5B 3BJ91 3FO1B 1J0YA 1DLHB 4O51A 4QY8B 3T77B 3MPCA 4KDTA 3QUYD 3RHWK 1ACZA 1WZLA 4YHIB 3BRFA 1A14H 2DKMA 4M48L 3DWTA 1K3IA 3EOAB 2HN7B 1MREL 4NQCB 5IW1B 2Y5TA 3MGAA 1ORQB 1L7TL 4OD3L 1AO7E 4OF3A 3TP4A 1AGCA 4ZG1A 1WF5A 5C1MB 1MWAB 2D0HA 2DQHL 3BDBA 5TGBB 2W0LA 1QQDB 3S37H 3BH8A 3RUGF 5GHWH 3RP1A 4OCSL 3FQRB 4M6ML 1F58L 3HNSL 4Y1AB 1S9KC 1QSZA 4XGZB 4BQ8A 1MQKL 3SKMB 5F7HA 2QKIA 4M9PA 4GRWH 4CUCA 4H88H 1IFHH 5D72L 4L9LC 1I1CA 4MQTB 4PJDA 2ICEB 2XQYG 1RZGA 2K3TA 3LDBC 2VXUH 1AI1H 2DAVA 1UKQA 4WV1B 4XC1L 2VXSH 4JFDD 4YFEA 4QOKB 5L2KE 2BX5A 5JIHA 4JO4L 3DPBA 4PV8B 1LE9B 3ARBA 4MJ6A 3DYMA 2AXGB 3SDDA 3CLEH 4LIQH 5IT2L 3BT2L 5J4MA 2UV3A 4TVPH 4EBQL 5ADOH 2EICA 4P46A 1KJ3L 1URLA 4KJPC 3VGAC 2WWMD 5E99H 3DGGB 2VZ1A 4YHMH 1S78D 1CE1H 3VRJA 3CUPA 4TUJA 1IGJA 2N7BA 3K7UA 3DVNA 3HFML 4UTBH 5EG6C 4QRQA 3OG4B 5A3ID 1J11A 1U8QA 3BP7A 3GMMB 3L3KB 1P84K 3UXFA 4U1LA 5LAXB 3L5WB 3EHBD 4PLNC 3CH1B 3WNOA 4ZYKA 2MQ0A 3ULVE 3RZCA 1QR1A 1NC2B 1BZ9B 1LDSA 5GS0C 2PCPB 1GSMA 1IGFH 4RAUA 3CVHH 3RTQC 2W65B 2Y6SD 2X6MA 4CVXA 1NKOA 2J8UB 2ZG1A 3DOSA 4M6OH 2BXZA 1GJIA 1A14L 2AQ2A 3O2WH 1BZ7B 5DQDH 2H32A 4GS7B 4XPTH 5J12B 5CP3A 4NWUH 1FDLH 5DJZA 4D94A 4OB5H 1N7MH 5D7JC 4LU5H 4JVPA 3UTPD 4K8RH 2YN5A 5D2NE 2ZUTA 1B88A 4DZ8B 3D2UD 3PHOB 1K8IA 2WWKT 4QXTB 4HJ0C 4ELMA 1YMHA 4G6AD 3S37L 5I1LA 1H8SA 4WWKC 5FKPA 5GHWL 1A7NH 3HKFA 1T7VA 1S7QA 2P8MB 5ITBL 5I1HH 4RRPG 3V5HB 3QI9C 1J18A 3U9UA 1I9RL 2YPLE 3K4ZA 2JJSA 4PGDA 1EZVY 4BKLA 4RA3A 4H88L 1XZ0B 2GCYA 5EORH 5DVNA 4Y5VC 5DUMH 2VXUL 3FT2A 1JZ6A 1AI1L 5F7YC 3JV6B 1JZ8A 3O6FC 2VXSL 4GAGH 3WD5H 4FQQA 4OQ1A 3PGDA 4ONGH 1IBGH 1OD9A 2ADJA 3BW9B 4ZPVA 1PY4A 4F33A 3MJ7B 3CLEL 4LIQL 2VDLH 2ZSVA 4LARH 3VFPA 3WO4B 3B8SA 4TVPL 5ADOL 2E9WA 4JN2B 5KS9B 4X9IA 4BSWA 1PJ9A 4BA8A 4AEHH 4U1SA 2VR4A 4XVUD 3F62A 5E99L 4LEXH 4EZMA 4F8TA 4QRPA 3SDXB 3M45A 1IGYA 4PR5B 1CE1L 3WS3A 2APXA 5D7IB 1MLBB 1F3DH 4UTBL 4NJ9H 1E27B 4WFFD 1QFPA 1BREA 3WIFA 4OCXH 4QHUA 4PTUB 4RFEA 2AW2A 4UNTA 3LPFA 1CI5A 5FK9B 1D5BB 2LTQC 3L3DA 3OHXB 4YZFE 1UZ8B 3KPOA 1IGFL 5F9JB 5FO9A 3CVHL 4EUPH 1A9BA 4RFNC 2YWYA 3FQTA 4M6OL 1WZMA 4NPYB 3O2WL 3PG2A 3I85A 2O26U 3K2MC 5DQDL 4XPTL 1D5ZB 1R0AH 4NO0B 1V3LA 4K3HA 1F42A 4XCEB 1HHJA 4XNQA 2YA0A 4NWUL 1FDLL 4OB5L 2PXYA 1N7ML 4LU5L 4N0UB 3F7YB 4K8RL 2DQFA 1UXSA 3BGFB 4P23A 4HJJH 5CZXC 1T7XA 2EE9A 4F2MA 2QV2A 4JFXB 5DRWB 1A7NL 5MENB 4OV6F 3HUJA 3FZUD 5EC2B 1HYSD 2VISB 4H25B 3L3IA 5E6ID 4KTYA 3GMRA 4PG9B 3BQUD 3QFDB 1JJUA 1NUNB 4KVNH 3PHQA 2IAMC 2V5SA 4Z7OF 3D39B 3FB7A 3QHTC 3OAYK 4M8VA 2X4OA 5EORL 3TPUA 3CLFH 1LK2B 4WU7B 3ZE0E 5DUML 2FD6H 1A9EA 2ICCA 1E4XH 3GRWH 5SV3A 1UH3A 2DWDA 4GAGL 3WD5L 4EN3A 1DE4A 1XGYL 3TM6A 5F9DC 3B2VH 2B7DT 4I0KA 4X98B 4TUOA 4ONGL 1IBGL 3QBTB 3NCEB 4WO4C 4PJIE 4LARL 1BBJA 3VMNA 3BWUC 5FGBA 1IEHA 1CTOA 4RNRB 3MRDA 5KANI 4AEHL 4XPBH 4X7CC 2YBRA 4LEXL 5H94A 2WWKO 1EJOH 1QLRB 4APQC 1AR1C 4LP4A 4NJ9L 3ULUL 5EOTB 2E3VA 1ETZA 4Z7UF 3MRGA 1XCTA 4FABH 4C56D 4EDWH 3VGBA 4LOUC 4QRUA 5CWSB 2XWBB 5IB4B 3VXTB 5HGHB 3MBED 5ETUB 3CDGA 1GGIH 2Q3ZA 4GO6B 4RBPH 3TCLB 4N8VA 3OB0K 2R1XB 3O41A 5BMFH 3O4OC 5BO1L 1R0AL 3SKJH 3WS6C 3SBWA 4NZDA 1KIQB 2QTEA 1L9NA 4HJJL 1A3LL 3D3VE 1YN6B 5C0AE 3FQXA 4K07A 4L8SB 5HHOE 3T1FA 5BRZA 5DSCA 1OP5H 4LCCB 1UB5A 4OFKA 4P2QD 5GISH 4PGZA 3S4SB 3V52H 1C5DA 1HWHB 3GMNB 2OP4H 3IDXH 1G7PB 3W0WB 2XG4A 1A1OA 1I7RA 5BCAA 2XV6B 5C8JA 1ZT1A 4M1GH 4IRJA 2DQDL 5EZLA 4MCYA 3QQ3B 4KVNL 4PP1C 4POYA 4HQQH 3H3KA 3OKKB 1I9IH 5D1ZA 5SX4I 1YPZB 3RL1B 1Y6MR 5BQ7A 3CLFL 1D6EB 1ZHKA 4PRHD 2FD6L 4Z7NE 4D0BA 1HSBB 2Q3AA 3DETD 3GRWL 2HKHH 5FYKH 3RY5A 2HLAB 2VLKD 2BSRB 3FAXA 3WJJC 5JDSB 1J8HB 2Z31D 1KJMA 4WU5A 3B2VL 1Q9LB 4KXZH 3V7MA 3M07A 3KHOA 2FHCA 4E42A 1AGBA 3RPKA 3VCLA 3NIDE 3GK8H 4JZOB 5MEQA 4JFFA 1Q0YH 2DMBA 2CLVA 2CO6B 3P4MB 1GZPA 4K2UH 4XPBL 4X9GA 4YIQB 1MEXH 4PTTB 3K4DA 3HE7D 5HYQB 3JWDC 1OTTD 5B4MC 1UM4H 4PJXA 2FNBA 2XQYK 2OSLA 4R97B 4HH9B 1JNLH 1JN6A 4RGOH 4ZUWA 5HI3C 2YKLH 3TH4T 1JWUB 3OKNB 3EZ8A 1NAMA 4FABL 4EDWL 1DZBA 5B8CA 4HXBH 1JPGB 5CUSH 3ETBF 5E00A 1T2QH 1Z0MA 2F5AH 3VXUB 3T3ME 3W9EB 4Z77A 2GK2A 1GGIL 3LKRB 2BVQB 3NGBC 4JFPA 5J1SC 3U6RA 1UCTA 1KB5A 3JTSB 4LF3A 4FTVE 5FA4B 4GS7C 3DO7A 3O8XA 2G2RA 2NMSA 3GBNH 2MHAA 1RPQA 1UVQB 3QULB 4HKJA 2X4SA 4L4VA 2X1XR 3KPSA 2MKWA 1QVOB 5D5MB 4HEME 2VYRE 1SVCP 4P4RA 3S5LA 3F6IA 3BPOB 1XF5A 3TBSA 1MIMH 3G6JE 2AJ3B 2DIBA 1G7IA 2AI0H 1P5UA 4X6DE 4NZTH 3V52L 2OP4L 3IDXL 4XVTH 2ICES 4ZODA 3IGAB 1MFAH 1E6JH 5IBLD 4NQEA 4PJ8A 2F53E 4M1GL 4Y8AA 5DC4B 2EKJA 4BQBA 5CGYD 3OKDB 2H2SC 2EDXA 3WSQL 3DIFA 4HFWA 2CUIA 1F4AA 4HQQL 4A6YA 5J3HC 1N6UA 2ADGB 1I9IL 3T0DA 2NYYD 3ZT5A 1CIDA 3H7BB 3QNYB 4MJIB 2WUBH 2HKHL 5FYKL 3R06B 1WV7T 5B21A 4OTXH 4NQDA 3U0WH 1EJ6A 3RVUD 5GS1C 1HXMA 2YD2A 2DDQL 3BDXA 3I6LD 1UQSB 3BXNA 1Q1JH 5F3BA 2J5LC 1AC0A 5T3XE 3UPRB 3GK8L 4GXUM 3WO4C 2VC2H 4C57C 5I8EA 1Q0YL 3IJSB 4UBDD 2GITB 4KZEH 3GKWL 4WIQA 5EIIA 2AK4E 2YD6A 4K2UL 2LQRA 3CSYB 3PNWA 3K74B 3I75A 1MEXL 3VFUA 3N1PC 4JDTH 3TVMB 4Z8FH 1S7XA 5JHDA 1IM3A 4GAYB 35C8H 3T2PA 5DK2B 4ODSH 1BECA 1UM4L 2C1PA 4BQ6A 4YFDB 2YPVH 3NOIA 2RR3A 1II4E 5EO9B 1JNLL 3ECBB 4RGOL 5H2BA 1CF8H 3U0PB 3ZDZF 2YKLL 2F8OA 4J4PA 3R8QA 3MRPB 4HS6B 1F5WA 3L3GA 4HXBL 2WBJA 2WLZA 5CUSL 4WJ5A 2F5AL 5ITFA 3VWJD 1FNGA 5FOBB 1M7DA 4O2FA 2OJEB 4NKQB 5C08D 2GSGB 3U9PH 1PEWA 5D6CB 5DTFA 3WE6B 3MZGB 1AP2A 4KJQC 1RZ8B 3K8MA 5EU6B 5EU7E 5KSUA 3GBNL 5DI8B 4WI7A 1TJGH 4YHZH 2DKSA 2G5RA 3RWDB 5BS0E 5E8NA 4ZS6C 2PR4L 3BGFC 4LNRB 3ZKQD 5HYFA 4PLKC 3V95A 4JKWA 2ICWJ 1DUZB 3CNKA 1MIML 1CYGA 1I1AA 4PJ5A 2OTUB 3EW3B 4JPIB 1O0VA 5I73B 5ELIA 1QBMH 3EYSH 4YPJA 3KXFA 4FN0A 3JV4B 4JM2F 2EEAA 1MFAL 1E6JL 3F58L 1KCUH 4NOFA 1H3XA 3NIGF 5HDLA 4J2XA 5CMAB 3DHJA 4DOHE 5JNYB 4G5ZH 3TO4B 3ABZA 3MYJB 2CRYA 5DMKA 1ADQL 1FGNH 3PWPA 3GSOB 3SE3C 3U1SH 2WUBL 3BPLC 1QSFA 1WCQA 2F5BH 5ICYB 4KKBC 1NGQH 4OTXL 3U0WL 5MP6H 4IRSD 1HH9A 5ACZB 3IVKB 4RMQA 1VFAA 1RURH 3UTSA 5F9OH 1IVLA 2YUWA 5A2KH 1Q1JL 3DSNA 4EOWH 2X4RA 2ZOKA 4MNQE 5T1MA 3IJYB 2W9DL 4LLMB 3QUXB 1MJUH 4WW2F 5B3NA 2VC2L 3TA3D 3MV7A 3D85A 3D0VA 4FXGB 4KZEL 1TFHA 3P3YA 1ZE3C 2UYLA 1NCBH 1WWWX 2NY4B 5KJRH 3E6FB 3QFJE 4ORGB 1WBZB 4JCMA 1EXUA 4JDTL 1OM3H 4Z8FL 1G7HA 1NBVH 5KSBB 35C8L 4BFGA 3TN0B 4ODSL 4ZQKB 2YPVL 3DUUA 3RWIB 5IJKA 4LCWB 4G6MH 4DGIH 5CIPB 1CF8L 4Y19A 3PGFH 4OZIE 3SGKA 2XOTA 4MJ2A 4HZLB 4HJGA 1JTOA 2VXTH 4XXCA 4Q9RH 4MMZC 3WEXA 1WAAA 4RCAA 5F3HA 4PRID 4Y2DD 2OQJA 2W9EH 1CDYA 2FH6A 3LMJH 3U9PL 2DM4A 4YDVA 3ZZ1A 4ODXA 3X13A 4Z7VA 1RJYA 3QDMD 5DJ2B 2CR6A 4LSDA 3QUMB 4XWOD 1TJGL 1O5DT 4YBQC 5ESQA 5A40E 3HAEB 3MO1A 2FBOJ 4RGNC 2D7TL 2W59A 3HG1A 1AQDB 2B4CC 1KJVB 4N1HB 1I7UA 3CD4A 3LKOA 4LCCC 4LRNH 1F11A 2VABB 1SHMA 1G9NC 1QBML 3EYSL 1K8DA 5DHYB 1EBPA 4IOIB 3LN5A 1KCUL 3AXLA 1JF6A 1QFWI 4WNQA 2FYYB 5CCKL 2KUTA 2DYPA 1KPUA 4WFED 1JYWA 5C0BE 3HR5A 1KCSL 4RQQA 4LLYA 3QQ9C 1FGNL 3MA9H 1FIEA 2BY2A 5BZDB 2NZ9D 4YHYB 3BHBA 1JMXA 3U1SL 3O2DH 2F5BL 1NGQL 3MOBH 4P2OA 5MP6L 4PJFE 15C8H 3LS4H 4PJGB 3CZFB 1VKXB 5DD6A 1QG3A 1BQHB 1RURL 4KTDH 1YN7A 1NGXA 3OSKA 1ED3B 3HLAA 4YC2B 5D6DC 5JW5A 1BIIB 5E70A 3MYZA 2GJ6A 2QR0A 4MJ6B 2Q87A 3N9GH 4MA1C 5IFJB 5BW7C 1CN4A 5CEZH 5KJRL 4ETQB 3CFBB 4NO2A 3GNMH 1OM3L 2H26A 1NBVL 3MBXH 1R3KB 1J5OH 1EEZB 2OZ4A 3ARGA 5EPMB 4E41E 4R97C 4R4BB 4DGIL 4G6ML 3DTXB 5IV2B 2X5PA 2EKSA 4TUJB 5I9QC 2XY2A 1HHIA 4QRQB 1U8QB 3BP7B 3S98A 3QXAB 1ES0B 2YUVA 2VR9A 4U6XB 4OGAC 2ADIA 4ZDHA 5T5NF 3QUYA 3NN8A 4XZUA 4Q9RL 1W0VB 1P2CB 4N68A 4AIZA 4K3EH 2EDYA 2R39A 4UI2A 4LHUG 2I60H 2EYRB 2W9EL 4GW1A 4MNHA 5FYJH 1T0MB 1XGUA 3AS2A 4KK8D 4KROB 2HFEB 4M7LH 1LVEA 3L3JB 1QEWB 3C60D 3LKQA 3PWVA 1MSPA 4PJ7A 2H32B 1XAUA 3S3SA 3F7QA 1Z9MA 1XEDA 4G8GE 2PKDA 3DX6B 5F96H 3BVNA 5L9DH 1S9VB 5J13B 2RIKA 3BPOC 5IW3A 4OV5B 4HGWA 4M1CC 3QJFA 1SYVA 3L95A 5SWZD 3MR9A 1QFUH 4M02A 5IQ9A 4XBPA 4LRNL 4Z7WB 4NC0B 4CVUA 1K8IB 1CFTB 3ZKXB 5DS8B 3P73A 3KPRB 2R29H 4XNMB 5DJAA 2IALA 4LLVB 4IRZH 4OQTH 5FKPB 4J3XA 4OGXH 4P9HH 3MRMA 2YSSB 4Y8DC 3DLQR 2I07A 3QPQD 1FP5A 2ZUVA 3MA9L 4DK3A 4WUKH 4DUVA 4R7NB 2E5EA 5GGTH 3MODH 5DMYA 2X7LA 1XIWD 3O2DL 5ID0B 1R3IH 4JFDA 3MOBL 4ZPTA 1H3WM 1TCRB 3IDMA 15C8L 2FECI 3UAJC 5I71B 4PGBA 3LS4L 1DDHA 1X5XA 3X17A 5I16B 3T0VA 4MSWA 4JFOB 5KVGL 1HOCA 5GRYA 1KIRB 6CGTA 1H15A 3I02A 4D9RE 3CFCL 3RI5K 3GO1H 3N9GL 1RZFH 4ZPVB 1CR9H 1G1YA 1MHPH 3LV3B 2APFA 1YEKH 4Y5YB 2ZG3A 1LQSR 1I8MB 4AENB 3VFSB 4PRDB 3L3HB 3GNML 5DEGA 3I6KA 3VRIA 4PJDE 3MBXL 4FFWC 5HGDA 1J5OL 5CEYB 1JGEA 1BAFH 3ES6A 5DRXA 4XCFL 2YC1A 1J1PH 3FHAA 3J7HA 3RJDA 2BY3A 5IJVB 2DWEA 3HZYB 4CBPA 3DXAE 3UTTD 4HDIA 2NY3D 2DM7A 4LPCA 1YDPB 4HUMB 1IGMH 3QIWD 1HSAA 1S7VB 3FT4A 4YO0A 4K3EL 4FZEH 4YDKH 2I60L 5FYJL 3CXHK 1E4KA 3FN3A 5KOMC 2YPKA 1X5AA 4M7LL 3VXRB 5EUKB 5J9PB 1DVFB 2GY7B 3O3EB 4F7CA 3TBWA 3D2UA 3MFGB 8CGTA 3SPVB 1EAJA 1FAIL 5F96L 1H9VA 4J7RA 3TH2T 1MLCB 4HGKC 4G9FD 1QFUL 1AGEA 2NXYC 5I73C 4LDEB 5CIPH 3HPLA 1ZKAA 2R29L 5I74C 2B8OT 5AZEH 4YXKH 4X7SH 3CMGA 4HIEB 2P1YA 4IRZL 4OQTL 3LEXB 2XWTB 4OGXL 4P9HL 4KJPD 3IAGC 1CD1A 1U8MA 3TO4C 2VLLA 4ZFGH 5DFTA 1EFXB 1U3HB 1MCJA 3PDGA 4WUKL 3ZDXE 4Y0GA 4CDGC 1YEFL 3MODL 1Z5LA 2KKQA 2X4OB 4G8EA 1DANT 3WFEH 3QUMH 4EDXB 4PLOB 2HRLA 3ZKMD 3BKCH 1Y0LB 2OL3A 3Q3GA 5GS0D 3QIUB 2BCKA 3ROLB 5GGSA 3TNNB 5J7CC 1WIOA 3S35L 4JZJC 1QA9A 2NCMA 3PGCA 3GO1L 1N5AB 1RZFL 5ENWB 5CHNB 1CR9L 1MAKA 5D71H 2N4IA 2X4QA 3V6OC 3C5JB 1NDMB 3RUGA 2DN7A 1FFPB 3MRNA 2XKNB 5D7JD 1JYNA 3GSXA 3UZVB 1WWCA 2BOCB 3TN0C 4PJCE 5KAQF 1BAFL 3QZWA 4PJAF 2G5BA 1EA9C 2X9WA 1KT2B 1J1PL 3QEQD 4MD0A 1C7SA 5FUCE 1R24A 5ISZE 1RZKH 1S3KH 4OM0H 4NHUA 4WWKD 2NTFA 1CGTA 2COQA 1EX0A 1AD9A 1X4YA 5IG7A 3ARDB 3P9LA 5IVOA 2CDFA 3T3PE 5KW9H 4N5EC 4FZEL 3QJHA 4YDKL 1FLTX 3MNZA 3VXOB 2UWEA 3Q6GH 2D9QB 5D7LD 4KDTC 4QRPE 3V8CA 3QDJD 5DJ0A 4LPWA 3VFOA 1L7IH 1X44A 1D7FA 1A02N 5FA3A 4NUJB 3TYFA 4G6KH 4G6FD 4WTZG 3RIAF 4YDLB 1A4JB 3PV6B 4NQSB 1ZHNA 2F9BT 3ZMRA 2HT4C 2FIKA 2H45A 4I18B 4LPVA 2EIZB 5D2NB 5J0BA 3PABB 4HHAB 1I8LC 3OGOE 3DUSA 1MAJA 1CGYA 3IDYB 2P5WE 3OKMB 5E6IA 3OG6B 2QHRH 5DYOA 5AZEL 4X7SL 1HXYA 3BQUA 5KBNC 3PJSA 3WJLA 1AHWA 1I7RB 4HKBB 2ZSWB 1SY6H 2MQ3A 4ZFGL 3HI6H 4LCUA 3FQWA 2YPLB 4YHYC 1Y18B 1IZJA 2D03H 1H5BB 3EFFA 2LU4A 1X4ZA 3WFEL 1UKSA 3V7AE 1RJCA 5C0NC 1DQLH 2Z91A 2R69H 3BKCL 3MRRB 2XXMB 2PO6D 4Q74A 1TQBB 2UVFA 3CIQA 4YC2C 3H42H 2Q7YA 4LKCB 5B39A 3QUKB 4L3EE 2V2TA 2VAAB 5D71L 1KG0A 5MEQB 2RCSH 3OV6A 5MEPA 4M7ZB 2X4PB 3EIFA 2JB6A 1X6LA 4H0IA 2ZUQC 3DROB 5L2JB 43CAA 4C56A 3TGXA 4P3CL 1RZKL 2DLGA 5I18H 2ZOLA 1S3KL 5DD3H 4OM0L 3MBEA 4D0DB 1PKQB 4UU9B 4HULB 3RBSA 5I6XB 7FABH 3CAFA 1V5JA 5M7QA 4LVHB 3E6HB 3ARFD 5E00B 1YEHH 3P30H 5TDOB 5BVJA 5E8PB 2VDMH 3MLUH 4KROC 1F6FB 2IAMD 3FO0H 3WCYA 3C5ZB 3Q6GL 4JFED 3HCVA 1C12A 3OGCB 2Y23A 5GGRA 2WV3A 1IGIH 1I1FB 5E1AB 5FECA 4GG6A 4NO5A 4G6KL 4X7EC 4Z7QE 4BQ9A 1UCBH 2J8UF 1XGRB 4OFPA 5J13C 1KYOJ 4LVNB 4QRRE 4DWHA 4MWFB 3FB8B 1FGVL 4P2QA 3STLA 3IS1X 1FYTD 3ZKXC 5HHMD 3MRBA 3G6AA 3B5HA 4WO4D 4XHQA 3SO3B 3TBSB 2QHRL 3OR7B 1DEDA 2HFFA 4AK1A 4NZUH 5ILTH 4YH6A 2R1WA 1SY6L 3JTTB 2P5EE 2ESVE 3W11C 4GAJH 3M1BA 3HI6L 2I26N 2G9HA 4PBWD 4APQD 2JJSC 4PRHA 1F3JA 4NC1E 1MCPH 5KG9A 1EVTC 2PN5A 1R3JA 3B6SB 3FRPA 2VLKA 2D03L 1TNMA 1HEZA 1S7WA 2Z9TA 2VDRH 3PWJA 2I5YH 1HIMH 2Z31A 2VSCA 5I71C 1YMMD 2VUOA 2NW3B 2V9RA 4LOUD 2VZUA 2Y06H 2F19H 3DRTA 4XAKD 3OAUH 1DQLL 2R69L 5DF0A 2V17H 4NNYB 1KC5L 1LE5B 1P53A 1NANI 4KK5D 2WBWB 3H42L 5E1HB 3RVWC 4WHTB 1GVIA 3RWHA 2VDNL 2NY0B 4Y5YC 3ZLQC 1DN0A 4ZXBB 1OB1A 3MJ9H 2EO1A 4PJIB 3GSNH 2RCSL 3L3OB 4NQCD 5F7LB 4LSVH 3HE7A 5C0GB 1U3JA 2DJSA 3QWQB 2VLJD 1CFQA 3IKCA 5EO1A 2WINB 3SHSA 5JXAH 4X0KA 5KS9F 5JHDB 3GMOB 3T4YA 4ODUB 1G7QA 1NEZA 5I18L 3CFKA 5DD3L 3SDXF 5H2BB 5IMKB 1WUNT 5D7IF 4KK9C 7FABL 4FQCH 3BKJH 1KPRA 3L3GB 4Y1AD 1YNLH 2WBJB 4L8DB 1IAMA 1YEHL 3P30L 2XRAH 5JXED 1V3JA 5CGTA 5HSFA 1TENA 2VDML 3MLUL 3FO0L 4YBLB 3RWFA 2BMKA 4QNPE 4UQ3B 3SE9H 4F7MA 3NCYP 1E28B 3FFCB 1IGIL 4F9LA 1JWSB 2EDDA 2FEEI 4PJXE 4P5MA 5DTFB 2XN9E 2EZ0D 3C9NB 3TIEA 4HKZB 1KXTB 1UCBL 3K0WA 2PXYC 5E8NB 4WDIB 3RY4A 4P23C 4OD2B 5I19L 1JWMA 3KPQA 1FV1B 3DX7A 3QIBB 4PJBE 4P2RE 5C0AB 4HIIA 3EDEA 1T20B 1CXEA 4PGEB 4DEPC 1A6WH 3LVEA 1ND0A 5BJTB 4Z7UA 3MRIA 4NZUL 3E8UH 5EC1B 5ILTL 1ZLUK 4PJ9B 4GKZA 3H0TB 2MOVA 2CDGA 4GAJL 1U3HC 4Q9QH 5GGVY 3ULVH 3QEHA 1FZMA 5I30L 2ERJC 3WDHA 1MCPL 5L7XH 1ZLVK 5T1LB 3T2OA 3QDGB 3WYRA 3MNVA 2VDRL 2I5YL 1HIML 4X4MA 5LXGH 3DECA 4XHJC 2BVOA 2HTKC 2Y06L 2F19L 1T89C 2V17L 1NC2D 5E2TH 4EN3C 1YC7A 3LKSA 5CKAA 4MQSB 4NQEE 2PETA 5JW4M 4L3AA 5TF0A 1OP3H 4CMMB 1G6RH 1ZSDA 2ZOKB 3WUWA 3MJ9L 1WCBB 4UT7L 1UFUA 3GSNL 4HX1A 3HZVB 4LSVL 4JPVH 4Y4KD 4I4WA 3CDYA 2EH8H 2APVA 2DICA 3G5YA 4I48B 1XF3B 2YWZA 5JXAL 1OPGH 3G9AB 2QJDA 3LQZB 3BRDA 2GIYA 1J8KA 1NFDE 3GSUA 1FO0A 1A6AA 4JFQA 4U33A 4MQ7B 3VWJA 2AKRB 3KYKH 1GH7A 3ARDC 3BKJL 5GRUH 3I9GH 1YNLL 5C08A 2Z93B 2JTDA 2EECA 5HHXL 2Y9RT 2XRAL 1FRGH 3X12B 1ORSB 1TTUA 1KCLA 4HW6A 4UNVA 1VB9A 5DJDA 3GJEA 3SE9L 3DI3B 2EEDA 4FTVB 3X13B 3UTQB 3H9SB 5GJSL 5HPMA 2WBKA 3OJDA 4MHHI 4YDLC 3SBWC 1HZHH 4GG8A 5CP7B 1DQJB 1CQYA 5ESQB 2A6JB 4AL8H 4OKVA 3MO1B 1CFVH 5I1EH 1P7KB 4N0YH 1U95A 4XPHH 5JLZB 3GB7B 3VFVB 5HHPA 3FAWA 1A6WL 3G6JB 5HJ3B 1HILA 1CD9B 4JAMB 1FAKT 4C83B 4X6DB 1T1XA 3E8UL 4NQXB 1XMWA 3OWEA 3KYOB 1QFOA 2E27H 2F53B 1OSPH 3G5VB 4Q9QL 5GSVB 4OD1H 1RHHA 5CJXA 5L7XL 5I1AB 3M17A 4R7DA 5LJYH 1T5XA 3FTGB 2D31A 2HA1A 1H5BC 4IRSA 5LXGL 3O11B 2DOCA 3JWDH 4C54A 2J4WH 4PJ5E 5E9DB 3E1F1 1HQ4B 5J89A 4P2OB 1TQBC 1YPZF 2FJFA 2ZUYA 3N0PB 1U8PA 2BNQD 4GKOA 2E6QA 1YN7B 4Z76B 2BSSA 2V2XA 1G7JA 1G6RL 3V2AR 4TVSa 4KJQD 4NO0D 4M7ZC 4M7KL 4JPVL 1BWMA 1P69B 1RV6X 4TUKH 3BX7C 3LOWA 2EH8L 1KTLA 3PWPE 3DURA 1TZHA 1MCCA 2FR4B 1N3NA 2EC9T 2YRPA 1OPGL 3IU3A 3RWEA 2HVJA 1OW0C 2BVPA 1WIPA 3DVFA 4U1NB 1J12A 4ZSOA 4CW1A 3OJ2C 3UTSE 5DURD 4YHPB 3F7RA 4XI5C 1QD0A 4QT5A 3KYKL 5I6XC 3V6FA 4XWGH 1B6UA 4X4YB 4NKOB 3I9GL 5B8CC 4LVHC 2JK5A 4PRIA 4Y2DA 2GFBB 4NDMA 1FRGL 1WFNA 2UZXB 2AERT 4ZDHB 3NN8B 5F6HJ 3C5ZC 3D39D 4K94H 3WXVH 2ITCB 5J8OA 1FE8L 1JI1A 5DT1L 3DUHA 4GQ9H 4MD5B 4J8RA 4G9DA 2X1QA 2VITB 4OF5A 2FRGP 2DTSA 1PX4A 4HUKB 4OCNC 3UO1L 1QSEE 4GT7A 1O7SA 4KKBD 3OXRB 4Y19E 1HZHL 1WFTA 1K4CA 4LVNC 3AGVA 3QAZB 3ZYIA 4AL8L 1AGDB 5BS0B 1CFVL 1XGQB 5FDWB 2NY1C 4DZBA 3RKDC 5I1EL 4N0YL 1IQDB 4RZCA 4F58H 3QJFB 3SO3C 3C6LD 3MR9B 1S8DB 4HC1H 4XBPB 5D5MF 5AG8A 1WAAE 1CBVH 5SWQB 3BUYB 4BSVA 4XNXH 4PJ8C 2E27L 3WDJA 5F72S 2AP2A 5MHSE 1B0GB 4OD1L 3D69A 3HRZA 2X4NA 3CPLA 3MRMB 3GFUA 3JZ7A 4M9OA 4AT6A 5DO2D 1SEQH 3D0LA 4DOHB 1XR9A 2I07B 2PW1A 1N0XH 3GHBH 4XP1H 2DQTH 5T3ZH 1A21A 4PRNB 2FWOA 3JWDL 1Z9SA 3HRPA 5IF0A 4JKMA 1RUKH 4HGMA 3CH8A 1A7QL 1TTFA 1BF8A 3JUYA 4GRWE 5ANME 4PGBB 1EK3A 4U3CA 3DV6B 3RQ3A 4BELD 4EXPX 2AEPH 1LEGB 3MLTA 4XMLH 5KN5B 5F7FA 5HDQH 1YYLH 1YEGH 2NY0C 3T8XA 3QNXA 1VFOA 1PYWA 1BQSA 2UUDH 1JZ5A 2E9BA 4QWWC 4LLDA 4G42A 3MA7B 3VH8B 4TUKL 1D5XA 4UUJB 1IAOB 5MI0B 2ARJB 4YBQD 3JWOH 2R9HC 5EZJB 3QFJB 2IH3A 4LIQE 1S7UB 2ADFL 1T66C 3OJMB 5F7DB 1U58A 3S96B 4X6EB 1I7ZB 2DIAA 4YGVB 4J4PC 4XWGL 2DWEB 3W0WD 2ZKHH 3QO1A 3VFWA 2WBJC 4OGYH 3MGOB 3S6CA 2HWZH 4Z0BH 1PLGH 4IBLT 4YBLC 4BH7B 3V4PH 5IVNA 4K94L 3WXVL 2NR6D 3C60A 1ZVSB 3QQ9D 2JCCE 4GQ9L 4WW2A 1SBBA 3MXWH 5IVXB 4MDIA 5SWZA 1J8HD 4KQ3L 3BFOA 3LY6A 4OBSA 4XBGA 2J6EA 1WTGT 1U3YA 3KPPB 3QIBC 5HI4C 4F58L 1V3MA 4PY8J 3RY6A 3LCYA 4UILH 4HC1L 2CK2A 2GK0A 2VUYA 1WBXB 1F3RB 3I3EA 1CBVL 2P44B 2MNUA 3L7EB 2DQCH 3D25A 1RJLB 3TNMB 4H8WC 3T0EB 5DD5H 2L7UA 3M8OL 4J3WA 1DBBH 3BZ4B 3PF2A 5FV1L 1JF5A 1ZT7A 4IJ3B 3BO8A 3WNNA 4QYOA 4PJ7E 1XIWA 5FHAH 3ULSB 3WN5A 1SEQL 1EEYA 3FB5A 3BIKA 4NC2B 5DD1H 3KPMB 1N0XL 1UYWL 1WQVT 3GHBL 2O5XL 4XP1L 2D7OA 2DQTL 5T3ZL 5TE6H 2EC9U 1AKJB 3P9MB 1RUKL 5IB3B 2RJMA 4WI8A 1K85A 3VXUD 4OGAD 2XZQH 4S1DD 3A0OA 4PJFB 1RMFH 2AEPL 4XMLL 1I1RA 2M26A 5HDQL 1T22B 1U41A 1YYLL 1YEGL 1ZGLM 4O2CB 5EZOL 5GGSB 3N1QC 1G7MB 3LZFH 2C9AA 2Q86A 1H3PH 5FKAA 3PGCB 3G04B 2WP3T 1HWGB 1IAII 1FVEB 4UOW0 1JRHI 4J1UA 3MV11 2MCPH 2EC8A 3JWOL 1MRFL 4M7LT 4ODWA 4DFIA 3VFRA 4GFTB 4R4NC 5DLMH 3Q48A 4PY7A 1JGUH 4JG1L 3UTTA 2BNUA 2IPTH 3DV4A 1V05A 2OM5A 4X8XA 4E41B 1CK0H 1R24B 2X4TA 5CEZD 4QCIB 3QIWA 5KSBF 2ZKHL 3OKEA 4LQFH 2B4CH 4OGYL 5INDB 1LNUB 1IGTA 1N59A 4Q0XH 2A6KA 4K23H 1JTTA 3GSQA 5EA0H 2PYEA 5IG7B 3ULUE 4Z0BL 1PLGL 4XXCC 5KVDH 2GI7A 3SGEI 3V4PL 1ITBB 3TFKC 4ERSH 4LGSB 3RPIA 5JIIA 1X3DA 2VL5B 4O02H 5T3XH 4MJID 4MVBD 2ITDA 3MXWL 2HLFC 3P40A 4WW1B 3ZKSD 4RMRA 5K9JL 3GBMH 1SJEB 4FQXB 5AYQA 2ZP0T 3GI8H 1CICB 1CL7H 1MJ8H 2YEZB 5FYJD 4I2XA 3BUTA 5CBAA 5LGJA 1I8KA 3EJYC 4UILL 3CFEB 2DQCL 5CJOL 5DD5L 2HP4A 1DBBL 3MRFA 1S5IH 5FXCH 3TVMD 3W81A 3O3UN 2P42B 3D6GA 1NBYA 3BGMA 5FHAL 3WNLA 5L6YH 3BEWA 2X70B 4MD4A 5DD1L 2CLZA 1QLFB 2ZUWA 3E3QC 2F54E 4L1DA 1CFNA 4X4XA 5SV4A 3KPTA 5TE6L 3PL6B 1J0IA 1M7XA 1M7IA 3X14A 3WFHA 4QXGH 5L8LB 1F02I 3NFSH 4NKDA 4P2OC 2A83A 1P1ZA 2XZQL 1T5WA 3QYCA 3Q5TA 1RMFL 3RTQA 4X6FB 1GXEA 4RWYH 2B39A 3MCG1 2RGSA 4N9GB 3D18A 3RRQA 2SEBB 1YNKL 5C7XH 3EO0A 4ZOEA 5FB8A 3HMWH 1YEDA 4PJGF 3QNZA 5INCA 3LZFL 2Q7YB 1H3PL 5EU6D 5ALCH 4YBHA 3DX9A 5D7JA 3MV9B 1CT8B 4UDUB 5ECJE 3ZE2F 2MCPL 1L4IA 1FSKB 2AJXH 2JELL 5C0IA 3QEQA 4FNLH 4R0LB 2FGZA 4GLRH 5CSGA 4DGVH 1U42A 1JGUL 2IPTL 1IILE 4R3SA 4WWKA 3VFNB 3FFDA 1CK0L 4R26H 1G0DA 1MCNA 2BSTA 3OR6B 4WTWA 3FCTB 4LQFL 4ZNEA 2B4CL 3DXAB 1QYGH 3VXMB 5JUEH 2D2OA 1J1XL 4DW2L 5F89A 5JMOC 4Y4FD 1MHHB 5TH2B 3LSOB 4GKSB 3FOMA 1G9NL 5D7LA 3GHEH 3QUYC 4V2BA 1ZS8B 3QDJA 5JOFA 5KVDL 1AXTH 1NCUA 3V7AG 4ERSL 2BSED 1YY9D 5I1KH 2ZPKH 1G0YR 4O02L 4IHOA 1CTNA 3IF1A 4IMKA 2VZTA 4LFHG 5EU7C 1BFOB 3IDIA 1DR9A 2FZ3B 3GBML 4GG6B 4ZUTA 3DYPA 1AGFA 1DBKH 3GI8L 3QAZC 2G60H 3OX8B 1CL7L 1MJ8L 2R2HA 1SJHA 2RAMA 4UIMB 3LAFA 1MCOH 2HG5A 3QUXD 4BZ1H 4F3FA 4J3SA 4L8CB 4S0TD 1LK3H 4X6BA 5DVLA 1DQQA 3MRBB 3L7FA 3NFNB 2NY4D 3SDCB 2X4UB 4AZ8A 1KXVC 1K2DB 2HFFB 1S5IL 4Z7WF 5K59F 2GJZA 1JCKA 1T7YA 5LGHH 1NCAH 5CZVH 3TN0D 1EERB 1HN1A 4R9HA 5L6YL 1A3QA 2W92A 5IB2A 5FYJU 4MNGB 4LCWD 2EDQA 3HN3A 3VA6A 1A7PH 5C3LD 1IAIM 3IT8D 3PWUA 2NLJA 4Z78B 1A0QL 5KG9B 1F6AA 2BY0A 2NPLX 1EIBA 3ZYOA 1R3JB 5IOPB 1VFUA 4QXGL 2PO6A 1SYSB 3IETB 3NFSL 1S7WB 1MRDH 1T83A 4FZ8L 4W70A 2A74B 3PP3K 2HJKA 3IJHA 1RZJC 4RWYL 4QXUH 3QEUA 3GSVB 3RWGB 2NX5E 4IMLA 2W0KA 5L0QB 4N5ED 3VXNA 5IM7A 4GKNA 5C7XL 1UACH 3HMWL 5FYKE 3BKYH 4JQIH 2EIBA 5ALCL 2AQ1A 3QP3A 4I3SH 3KGRA 4LP5A 5MI0C 3RWJB 2X1OA 4HK0A 4WUUD 1S78C 2AJXL 4ZUUA 5IMOA 2FO1A 4FNLL 2EYTA 3EYQD 4LLWB 1UB6A 2HT4D 2QBWA 3LH2H 3MXVH 1BLNB 1T3FB 4DGVL 5A3IC 4N8VG 4PJCB 4YHNA 5IQ7H 5I2IA 4N0FB 4JHWH 3EHBC 3T4YB 4U2ZA 3ARFA 1G9MH 2A6DB 5CSBA 4GUPB 4MCZB 1QO3B 1QYGL 3CVIH 2IH1A 4F37K 4KI5F 2IAMA 4DN3H 1QRNB 4HUVA 4KU1A 5CINH 4JFEA 2Y6SC 3GHEL 4W81A 1AXTL 3LKPB 1K5NA 5EZIH 2DLEA 2XZCL 4CADB 3ZHDA 1T1YB 2ZPKL 3WIIH 5FV2A 5HHQB 5E94A 5DA4A 2FEDD 4M3JA 1BIHA 1PW3A 4IIQA 4S11A 1VFMA 4V1DB 4C56E 4G8FB 4ISVA 4P5MB 3FL7A 1DBKL 3PP3H 3EJZD 4GW4B 2G60L 1J05A 1FYTA 1MFCL 3MV8E 5TE7L 3AY4A 2VZOA 4WO4A 3GMPA 1LO5A 1LEIA 4G6AC 1E4JA 1MCOL 4PJAA 1CU4H 2DTMH 3L1OH 3LB6C 4BUGA 3B5GA 2AS5M 1LK3L 4QF1A 3T0EC 3KYMA 2P5WB 5EIVA 1HQRB 4ZOAA 5E5MA 1W72B 4NO3A 4APQA 4IJ3C 3O3BA 2CKBB 1RZIB 4U6HA 5LGHL 1NCAL 5IROC 5CZVL 2DF3A 1UWGH 4JEGB 1T6VN 4ONHA 4JANA 5ADPL 3VJ6B 5JPNA 4XBEH 1YMMA 3CXHJ 1MCQA 2FJHA 4P2QE 1MI5A 3QQ4B 4P5KB 3FO1A 1MRDL 2F58H 1HHKA 1DLHA 1A3RH 2M8XA 3O3AB 3T77A 5AAMA 3NMEA 1WC7B 4U31A 1NCNA 3EOAA 2HN7A 4KROD 3BKYL 4JQIL 4NQCA 1DQMH 4F80A 1TMCB 5IW1A 2R0LH 4IEFB 1ORQA 3V0AC 1KV3A 2DQUH 4G8IB 2VLJA 4I3SL 3EOTH 2V5TA 4QHNA 2FDBP 1KTRL 2VLKE 43C9B 4CVZB 1H0DB 1MWAA 2V2WA 5HVHB 1GCFA 4RIRA 2WIIB 2AV7A 3TO2B 3TT1H 3LH2L 3MXVL 1QQDA 1JP5A 3U7YL 1KELH 2J2ZA 5IQ7L 3AMKA 4JHWL 1F90H 5HHVH 2IG2H 3FQRA 3KPRD 4RMUA 4F7PB 4Y1AA 4M5YH 4HPYH 4YHKL 1G9ML 2KQNA 4L1HA 2ENSA 4LKXB 3SKMA 3CVIL 1V7MH 5JXEA 5C0CE 4YHOH 5C09B 4DN3L 4YXLH 5CINL 1JGDB 3S5LG 2X05A 3BP5B 3W11D 2R4RH 5EZIL 5D93B 3X3GH 4D0CB 2EXWD 3WIIL 1CFSB 1DSFH 3MRHB 4WV1A 4ZFFA 3Q1SH 5F21B 3ULVF 4L5FH 4Z7OE 4FQXC 4PV8A 1LE9A 1YNTB 1CICC 2AXGA 2ZUSA 5HPMB 3OJDB 4TNVK 4PP2A 2R15A 3L9RB 1FFOB 4QRRB 5IHBA 3LN9A 1CU4L 3L1OL 1X7QB 2DTML 3CCHB 3QCVH 4BFIB 3FZUC 1V8HA 1HYSC 4DGYH 2E8ZA 5C07D 3TCXA 5A2JH 3DGGA 3BQUC 3WJLC 4PRAA 5HD8D 4KH2A 4MLIA 3VXSE 3GMMA 3L3KA 2P5EB 3CMOH 1NKRA 2ESVB 2OXGA 4U7SA 5LAXA 3L5WA 4KI5D 4XBEL 4K7PY 3CH1A 3UX9B 1WWBX 4R7DB 4ZFOL 1NC2A 3MTRA 1BZ9A 2R1YB 4O5LH 2PCPA 4HUXB 5F7UA 2F58L 2GEEA 4PRBB 4D9QD 4NM8H 2W65A 4LGRB 5MERB 2J8UA 5IHUL 4FQHB 1AD0A 3BD4A 1BZ7A 1DFBH 4J6RL 3TA3B 4F9PA 1DQML 2XACC 4Y4KA 1YEJH 4HWUA 3VXRD 2DQUL 2BSSB 1DVFD 1OL0A 4RSVA 3EOTL 3H3BC 1BD2B 3QXVA 4KRMB 2DD8L 1FSKC 4DZ8A 3OJVC 3PHOA 4GXVH 2JF1A 2A0LD 1HKFA 4QXTA 4R0LC 5F1NA 1NGYB 4X4ME 1FL6B 2LABA 5JW3H 3TT1L 1HHHB 3H9HB 4LVOC 8FABB 1KELL 1F90L 2C3WA 2P8MA 2BVPB 5CP3H 5DDHB 5JOEA 3T08A 4M5YL 3V5HA 1QLEH 3MBEC 3Q5OA 1V7ML 2W0FB 4BM7A 2A9NH 4YHOL 4YXLL 4P48A 3IFNH 2R4RL 3ARSA 1EFXD 4W6XB 1U3HD 5CJXC 3X3GL 2HH0H 1DSFL 2CRMA 3JV6A 3QDMB 3QRGH 3Q1SL 1B4RA 1MCSA 4L5FL 4G9DB 4P57B 2HTKD 3STBA 4LHUD 5JIPA 3BW9A 5I17B 3LQAC 3MJ7A 4MB4A 3QIUD 1AIFB 5TDNA 1G9EA 1MY7A 5LCVL 3UBXG 1FZOB 5KS9A 3Q2CA 1HNGA 1B90A 1P7QB 5KTEH 5EBMB 1I4FB 4PJBB 4P2RB 1Q9KB 4WHCA 1E4XI 2WMPA 2Q8BH 3RVVD 5D7IA 1MLBA 1OT1A 3KPNB 4K71C 4YE4L 1E27A 3CMOL 4PTUA 4KZDH 4OCYH 5F93C 3RNKB 4MZ3A 2F74B 3DETC 5FK9A 1D5BA 5EBWB 1R3LB 4O5LL 3OHXA 3WKMH 4PPTA 4ZTOH 1CXIA 4MAYB 3ARDD 2BNQA 4NM8L 1NMCB 2K7PA 1DBAH 4NPYA 3ULVD 3GIVB 3O2VH 3VXQB 1BX2B 1FFQA 3MJ6A 3QXTA 1UT9A 2B5IB 1D5ZA 4NO0A 4XCEA 1L6ZA 1YEJL 3T65B 4N0UA 3CSPA 3F7YA 3QNXB 2E6PA 1U93B 5IB1B 1N8ZB 3HE7C 4GXVL 2GTZB 2HT3D 5EOCH 1FFRA 4U0RB 4JFXA 5JW3L 4PJIF 5I66B 2VERN 5DRWA 4WI5A 1ZT4A 2VR5A 5MENA 4FG6C 1RJZB 4XP9H 5EC2A 2VISA 1MFNA 1U58B 5F97E 4H25A 1NFDB 4PJEE 3AUVA 4PG9A 1QLEL 3AU1A 2W9LA 5DC9B 1OTSD 3D39A 1XR8B 1PGRB 3VFWB 3B9EA 3HC3H 3LQMA 2YUXA 4D8PB 1LK2A 4WU7A 2HH0L 2YPLD 5GGUB 3SE3A 4HIHB 3TZVB 3MUZ1 2UVEA 1BJ1H 3QRGL 4X5WB 3NBNA 1QOKA 5DHXB 1BVKB 4NBYB 4MAUH 5ALBH 1KSRA 4WFGE 2YXMA 1KBGH 4OZFG 3ZHLA 3U46B 5MEOB 1TJHL 2YK1H 3C6LA 4H5SA 3MX0A 1KCVH 4HF5H 4XBGB 4KRPB 3V4VH 2PUQT 4PRIE 4RNRA 4Z0XA 2VH5H 5KTEL 3U4BL 5J06A 3DSFH 4LASH 3RWCB 3DX8B 5IBLC 1QLRA 1ZANH 4HZAA 4GRLB 2Q8BL 1TLKA 3UJTH 4KPHH 4KXZI 4LSSL 3CDFA 5EOTA 5GSRB 4MJ5B 4RX4D 4O4YH 4KZDL 4OCYL 5D2LA 3SOBH 5CWSA 2XWBA 3O4LB 5IB4A 5HGHA 5ETUA 2IPKB 3WKML 4ZTOL 1DBAL 1KPVB 3ZDZE 5GS3A 3TCLA 4JRYE 3O2VL 2R1XA 5A16B 1SEBB 2XWJB 3C5ZD 1CD8A 3BISA 4UBDC 4AMKH 1X5LA 2NY5C 1KIQA 1GC1C 2UY7A 2YOCA 5GRJH 1NFIB 1S7SB 2X2YA 4XH2B 3NA4A 2Y07L 5FKAB 2EDKA 1YN6A 4LNVA 5HVHC 4L8SA 5EOCL 4XNZC 1OCWH 3NIDF 4AQ1B 3S4SA 4LK4A 3RKDD 3WHE0 4RISH 3GMNA 1N4XH 1F2XK 4XP9L 1G7PA 3W0WA 4C4KT 4JRWA 1Z9LA 4I5BA 2NY3B 1T7WA 4J3UA 1ONQA 4NN6B 3V6ZA 2VZ3A 3LKNB 4CU6A 3OKKA 5F6HI 1YPZA 3HC3L 1VGKB 3NCFB 3RL1A 2DLTA 1N59B 3FOLB 1KACB 3MSPA 1HSBA 4AIXA 1VACB 2HLAA 3NIGE 2BSRA 5JDSA 1RUPH 1MH5B 5JQHC 1J8HA 3QG7L 4U1KA 5ALBL 4MAUL 3RA7H 4P5TB 5D7KE 5SX5K 1KBGL 1QSEB 4FXLA 4LMQI 5C9JB 5L8KB 2YK1L 5DA0B 4G9FB 4JZOA 5CAYB 4LL9A 1KCVL 2W1NA 4HF5L 1BPVA 5DVKA 3V4VL 5I1IH 5JO5A 2VH5L 3P4MA 5BW7A 3S9DB 2NY0D 3DSFL 4LASL 4YIQA 4ZXBD 5LGJB 4NRYB 4PTTA 2AJYH 1ZANL 4QWWD 2XTJE 4ETYA 5HYQA 5FM8A 1OT2A 2H8PB 4KPHL 3WDIA 2R9HD 3G6JF 4XP4H 4HH9A 1KJ2H 1D9KB 1JWUA 1JI2A 1WK0A 4O4YL 4X6DF 4YFLI 4MS8D 4NRZB 5SWZE 4ACPA 4KK6C 3EYUL 4OFIA 3K3QA 3SOBL 2VWEE 1JPGA 4X4XB 1PDKA 3VXUA 1CFNB 4NHCH 1M6OB 4IRSC 4ODBD 4KGJA 3W9EA 5L8JB 4OCRH 3SO5A 3LKRA 3X14B 2BVQA 1OAYL 5D9SB 2VQ1B 5FM4A 4KV5E 3JTSA 4GRWB 2DMKA 3LRSA 5FA4A 3RBGA 3TA3C 4U1MB 1NAMH 3SCMB 1OGTB 1H3VA 2ZCKL 1UVQA 3L5XL 4AMKL 1IJ9A 1VHPA 1PQZB 3FFCD 5K9KA 5FB8B 5KVEL 1FNHA 1QVOA 2C7UB 4OZFB 5D5MA 5GRJL 5INCB 3B43A 4XNYH 3W5NA 4WI9A 3IKKA 3KDMB 5CEXB 5SX5H 1KB5H 2AJ3A 1LP9B 1J0HA 2CUHA 3T4AB 3B83A 4RISL 1N4XL 4LLUB 5C0AD 3IGAA 4U1HB 3OKDA 1A7OH 1U8IB 4PJ9D 1I9JH 2P45B 4ZOBA 3B2UD 2ADGA 2CUMA 4JRXE 4HEPG 3DBXA 3RL2B 3ARZA 3H7BA 3QNYA 4MJIA 1K4DB 32C2B 3R06A 1M1SA 1MFEH 3QDGD 1RUPL 4YDJB 1LO0H 4XWOC 4BUHA 2JCCB 3RA7L 1TZIB 1Z2KA 2X42A 1RIHH 1UQSA 2MWCA 3CVHB 3UPRA 4ZUTB 3GI9H 4U1JB 2E7CA 3GEWB 2VXVH 1FQ9C 3IJSA 2GITA 4NM4H 5I1IL 1RD6A 5E2UL 3CSYA 2PYEE 4ONOA 2AJYL 3TVMA 1DQTA 2VKWA 4AG4H 1G7LB 4GAYA 2APBA 3WMSA 5ESAB 5DK2A 3G5ZB 1S9WB 5C6WH 1QFHA 4XP4L 1BWWA 5EO9A 4R4ND 3ECBA 4C4KO 1KJ2L 3U0PA 2NZ9C 1QFWH 1A7RH 3MRPA 4HS6A 4P2CG 4Y89A 4KFZC 1SBSH 3L5IA 4NHCL 4I2XE 1UJ3B 4I1NB 4MAYC 5FOBA 4EI5B 3QG6B 4OCRL 3WUZA 2OJEA 3V5DB 2PO6B 2P46B 3P9WB 2GSGA 5GGTA 1UEMA 2HJKB 5D6CA 3WE6A 2B5IC 1NAML 1RZ8A 5EU6A 3OL2A 4IMLB 2N1KA 3TFKD 5DI8A 3SGJA 4OCLC 3MLVH 3WLWD 3O9WD 1X5FA 3ARUA 2IPUG 3RWDA 4NWTH 3HHRB 4FTVD 4XNYL 2BNRE 4LNRA 3H9SD 2BC4A 3FT3B 2HLFD 2C3XA 1DUZA 4U0RC 1KB5L 5IBTH 3MUJA 4HK0B 5BVPH 2MTPA 1WTLA 2OTUA 4JPIA 1KXQE 4M1DH 1XCQA 2LE9A 2VAJA 3JV4A 3VG0H 4JQVA 4POUB 4XCYB 5GGQH 4L29B 1F58H 1YJDH 5CMAA 5GS2H 1A7OL 3HNSH 2NZIA 1I9JL 5JNYA 5JOPD 3TPKA 5HXMA 3UYRH 2F53D 1T1WB 1TETH 3GSOA 2AEQH 3BH9B 4PB0H 1U0QA 3P0VH 3TZVC 5ICYA 1MFEL 4PB9H 1LO0L 4L4JA 5ACZA 3IVKA 4WW2C 1SM3H 2XNAA 5B38G 1RIHL 4A6YL 1DQDL 4EUPB 3IJYA 4LLMA 3GI9L 3QUXA 2V7HB 2VXVL 4KRPC 1I3GH 4FXGA 1Q72H 4NM4L 5HHMB 5IVXF 1J9CT 1A6UH 4BH8B 3BEVA 2E7HA 1LEIB 5DVMA 3E6FA 3C08H 5T3XD 4ORGA 1WBZA 2R56L 4X7FC 4GRMB 1DBJH 4AG4L 4NIKB 5KSBA 3VU2A 1JPFB 3WLBA 3TN0A 2AJZB 2OYPA 4ZQKA 4R90H 4OUUB 3RWIA 4LCWA 4NO3B 5CIPA 4R96B 1JK8B 1QFWL 1A7RL 5DJ6B 4PLJD 1SBSL 5I75B 3HR6A 4HZLA 2BHUA 4X5LA 5EU5A 2F54B 2FJGB 3HPJB 4LAJH 2FJHB 4FFZH 5J1AB 4I0PB 4UDTB 3MJ8B 4Z95H 1CLZH 1EO8H 1HHKB 1NGZB 3C8DA 4NYLB 1EFQA 1VCAA 2L0DA 1OAXH 5DJ2A 5I1DB 4XCNB 3MLVL 4B0MM 2VQTA 4X4ZA 3QUMA 1I8IB 1PZUB 3HAEA 4NWTL 1UJTA 4PJFF 4WUUA 2V6HA 5FGCE 4CU7A 2VLJB 1TVBB 4JDZB 3DMMB 1AQDA 4JJ5A 3QT2A 1KJVA 4QHNB 3ET9F 5IBTL 5BVPL 2G75B 1HCVA 2VKXA 3GSWA 1VA9A 5BS0D 1I8LA 2VABA 3PP4H 2V2WB 4RIRB 4M1DL 5FYLD 2AV7B 5DHYA 2R2CA 1OAQH 2XIDA 5EU3B 3VG0L 4IOIA 4C59B 4HUUB 5HDBF 1T80A 5GGQL 2NY3C 2OR8A 2X10A 4Y4HB 1ZHLA 2FYYA 1MJ7H 5ITBH 1YJDL 3QIWC 4F8QA 4PS4H 2CO7B 4NN6C 1J87A 2D4FA 5F71A 2B1AH 3IXAB 1I9RH 4WFHE 3UYRL 3X11B 1FN4B 5BZDA 4WI2A 1YUHB 1TETL 2HT2C 3TBVB 2AEQL 2OTWB 4PB0L 3P0VL 4PB9L 4PJGA 2AAVA 3CZFA 4DUXA 1VKXA 1EDQA 2IANE 1BQHA 4OZFH 1SM3L 1WIUA 4ZFFB 1GL4B 1ZOXA 3NZ8B 5C86A 4BSJA 4GSDH 1AXIB 1ED3A 3D1MC 3TJHC 3CX5K 1GOHA 5DQ9A 1BIIA 2Z35B 2UWEF 1QBLH 3VDAA 1I3GL 2VNCA 5IFJA 1Q72L 3WIHA 4PP2B 1A6UL 3FRPG 5FUZH 4F37F 4ETQA 3C08L 4JFEE 2YZ8A 4K9EC 4MNQD 4YUEH 3NFPB 2FHBA 3CFBA 5GGSY 5GIRB 1DBJL 5EUOB 2YRZA 1IAKA 2VB5A 1R3KA 1EEZA 1EH9A 4R90L 5EPMA 4R4BA 3QFJD 3DTXA 5D1QB 5IV2A 4DTGH 4PRAB 2MFNA 1RI8A 2P48B 4LCIH 3QXAA 1ES0A 1FYTE 3QHZH 3BPNC 4U6XA 4HUWB 2GT9B 3L5HA 5DJ8A 1W0VA 3ZKMC 1CDGA 1P2CA 4FFZL 2FLBT 3QXUA 4Z95L 1CLZL 2EYRA 1EO8L 5KVMC 2R2BB 1T0MA 4S0SD 1RY7B 2BVTA 2HFEA 4X7TB 3SCMC 3L3JA 3K81A 1NEZG 1QEWA 1OAXL 2NX5B 4K55A 1AD0B 4JB9H 4OFYD 4Y4KB 3DX6A 1S9VA 3QWOB 4OV5A 4BFEA 3BZFB 1MCIA 2YD3A 1T04B 4OIBA 3LEVH 1TDQA 1MI5E 3PP4L 4Z7WA 1CFTA 3NCYS 5F1NB 5DS8A 3CFJB 3KPRA 4XNMA 1OAQL 3CXDH 4LLVA 1KFAH 2XT1B 2CJUH 3LB6D 4BZYA 3W2DH 5F6IB 1MJ7L 4PIRF 2CLRB 1FG2B 2P4AB 4PS4L 2YSSA 3MRKB 4PJHA 5EBLA 3T0ED 4NQCE 3WFBH 2XFXB 3NPSB 4OI8A 2B1AL 3ALPA 4R7NA 1IEAA 4GBXD 3C2SA 5C0BD 5ID0A 1EHNA 1G84A 2EYSB 1TCRA 5BXFB 4QRSB 4TRPH 1AKJD 4IMKC 1ULVA 1OTUD 5IMMB 1NUGA 4P4KB 2CR3A 5I16A 5H37G 4JFOA 4Z6AT 1XGYH 5CLTA 4GSDL 1KIRA 4JKKA 3BE1L 4Y1AE 3OQ3B 5LGKA 1QBLL 1V7NL 2KDGA 1GGBH 2JKXA 3MV8B 3LV3A 3EYVB 4P9ML 4Y5YA 5C07A 5FUZL 5TDNB 3KYAA 4GG6F 3S36X 2N7AA 1I8MA 3HC0B 1CLCA 2GKIA 4YUEL 3SKNB 4AENA 3VFSA 4NCC1 4PRDA 3L3HA 4OFDA 4RA0C 2BJMH 1EZVX 2WUCH 3ZKNC 5CEYA 4LRIA 3N1GC 2PW2B 2IBZY 5DGQA 1CDIA 4DTGL 1Q9WB 1S5HB 3UMTA 3S34H 4QOKE 4PD4K 4UINH 5IJVA 3HZYA 3RDTB 4F7TA 5L88H 3ULUH 4LCIL 3WUWG 1BJMA 3QHZL 1WGOA 4E41D 4OLVH 4DUWA 1U92B 5FIEA 1YDPA 1BVLA 1UJ3C 2Q6WB 5TPWH 1S7VA 4EI5C 2C4XA 2Y72A 2ZZUT 2PO6C 2OZ4L 5JORB 1T83C 3CU7A 3UP1A 4KKAC 3E2HB 4P59H 2BNQB 3ZDXF 3VXRA 5EUKA 4NSKB 1DVFA 5J9PA 2JJWA 1MCHA 3O3EA 4N0CC 5BO1H 2EDBA 3KYNB 4JB9L 5DVOA 3L5JA 5LG1A 3SPVA 5B3JF 2KH2B 3HMXA 1MLCA 4J3VA 4LCYB 4FQXD 5GGRY 4F7EA 1KCRH 3FQNB 2M2DA 5BV7C 4XRCA 2I9LB 3LEVL 1A3LH 1CICD 4YJZL 1KLGB 3GGWB 3BSZH 2Z8VC 5DURB 3CXDL 4HIEA 1VEOA 1KFAL 2DI9A 2J8UE 1ZT4B 2LAGB 2CJUL 3LEXA 2XWTA 3GM0A 3W2DL 2H9GB 1MCWW 1FNAA 3GMQB 4JLRB 5KSVB 1M05A 2DLHA 3ARFC 3H6JA 3WFBL 2DQDH 4PJCF 1EFXA 1U3HA 4QHMB 3AU1B 2A77H 2XQBH 3PQYE 4LSRH 5C0CB 4BK5A 1JUFB 3DRQB 1ZA3B 2IFFH 3K2UH 1I75A 4RBPK 4QKXB 5J56B 5DZNA 4LPXA 2JIXB 4N9OB 1QHPA 1ZMYA 3PL6D 4EDXA 4TRPL 1T89A 4LHUA 1Y0LA 1IC1A 4IIQC 3T3PF 1N2RA 3QIUA 3TNNA 3ROLA 1KLUB 1N5AA 5ENWA 1GGBL 5CHNA 3AY4C 1OP5K 4WEBH 3C6LB 4H5SB 3K1DA 3C5JA 4AY0A 1NDMA 1EHLH 5TE4H 1ERNA 1FFPA 5FGRA 4D9RD 2XKNA 4Z0XB 3IS0X 2BJML 3AS1A 3MV9D 4KMTH 2WUCL 1CWVA 2OL3H 4I77H 2BOCA 2Z0BA 3FO2B 2CXKA 4HWZB 3ZSTA 1KT2A 2OBGA 4MXWL 1S7RA 2MCG1 3S34L 1MCLA 4UINL 2DBLL 1ZA6B 1GGUA 5L88L 2H6PB 3VXSB 5C0FA 5I75C 3WL9B 4OLVL 4EI6B 5D2LB 1U8JA 3ARDA 3EDJA 5TPWL 1INDL 3AREB 5F88B 1GZQB 3DXAD 4WEUD 3VXMD 4KK5C 4EIGB 4P59L 3VXOA 1FLRH 5JW4N 3SDXE 1SQ2N 5T3ZE 5KZCD 4NUJA 1A6TA 5JQ6H 3T2NH 4G7VH 4G43B 3JBG7 4QTHB 1A4JA 3PV6A 4NQSA 3VWKB 3DMMC 3KNBB 2O5YH 3SKOB 3UTOA 4MXQD 1VSCA 1KCRL 4I18A 2EIZA 4WENB 5D2NA 3PABA 4HHAA 1RULH 1G6RA 5K9OB 4L4TE 1HDMB 4UOW1 3OKMA 3MJGX 3MACH 2BFVH 5J6GB 3BSZL 5DZLA 4Y4HC 1ZLWK 1UM6H 2D7PA 4HKBA 2ZSWA 3SDCD 4HKXB 1XGPB 3TBYB 1N6QH 1NUDA 4H26B 4I5BB 4TULH 4TOYH 5AD0B 5JXEC 3T04D 1ONQB 2A77L 2XQBL 4LSRL 3WSQH 4OZHE 1IM9B 2YPLA 3EOBB 4MZ2A 3V6ZB 4HK3N 2P49B 3S36H 1Y18A 3SQOH 3CK0H 2IFFL 3K2UL 4CN1A 1H5BA 4UMGA 3PWLB 1MAMH 4PRPE 3ROOB 2H41A 1Q9OB 4KRNA 4WV1C 2EZ0C 3MRRA 2JJTA 3UDWC 3RVXC 5MENE 4U1KB 5JHLH 5H35A 1U8OB 1B2WL 2DDQH 4LKCA 2BK8A 3QUKA 4YAQB 5EB9A 2VAAA 4JKLA 4WEBL 3SE4A 1EHLL 5TE4L 2X4PA 4G3YH 2JJVA 1DLFH 2X41A 3GKWH 5JO5B 1AXSA 3LHPH 4KMTL 2OL3L 4I77L 5FO8A 3DROA 2E9JA 1SJXA 5L2JA 5SWSB 4RX4A 4EEEA 1OW0A 1GGCL 3MRLB 4YDIH 2R0WH 1F8TH 4D0DA 1PKQA 3G08B 4FG6D 4UU9A 4XC3L 3V6BR 5CJQH 3HZKA 1ZLWH 5ISZD 3E6HA 4JVUA 3GJFK 4JO2H 5TDOA 1MCRA 5E8PA 3RGVB 1QRND 1ZVYA 3C5ZA 3CFDB 1FLRL 3OGCA 3O45B 5CGMA 2NY2B 3KLAB 1CGVA 4B5EA 1I1FA 3LRSB 5E1AA 5JQ6L 1NGWB 3T2NL 3OAZH 5J12C 4F9PC 4G7VL 4ZOCA 5I15H 4Y4KC 3HZMB 4QRPD 1XGRA 3UZEA 3HI5H 3TEUA 5GZOC 2EEBA 1TQCB 3BKMH 4V1DD 5K9KB 4MWFA 5K33A 2HMIC 2O5YL 1VFBB 3FB8A 1GOGA 5GXBB 1YYMH 2PR4H 2FX9H 1RULL 1NSNL 3U30B 3MACL 2BFVL 4OCMC 3ZSSA 4ESKA 3OR7A 3GDBA 4U2YA 1GHFH 3ZHKA 2GY5A 1UM6L 1PFCA 4JFHE 4RMVA 2P5WD 3F58H 3VGGA 3JTTA 2J88H 3NPSC 4PJEB 1N6QL 4TULL 1NDGB 3LPGA 4TOYL 3LRGA 1IRAY 2P7TB 2BY1A 3S36L 3B6SA 3SQOL 3CK0L 4RGNE 1ADQH 1JZ4A 2Q1EA 1OLZA 3DBXB 1MAML 2NW3A 1SMOA 2VLRE 3MLZL 4JY4B 4P4KC 4NNYA 3RVTC 1LE5A 3GJFH 2APWA 5JHLL 4JPKH 1LO4H 4M61B 4WHTA 1IKNC 2FEEL 3ZTNH 3FHQA 2YRLA 4ZXBA 2W9DH 1OQXA 4PJIA 3L3OA 3T09A 4G3YL 5C0GA 1DLFL 4U1GB 3LHPL 4L3ED 2PTTB 3CJJA 2WINA 3A6BH 3BESR 3CDCA 3GMOA 3IXTA 1CVSC 2IBBA 1J8HE 4XPGH 4ODUA 5TFSL 4YDIL 2R0WL 1F8TL 4LLQA 4PJBF 3REVA 1S7TA 4M5ZH 3RDTC 3TBTB 5IMKA 3BWAB 4WTXA 2CD0A 1K9TA 5CJQL 4O9HH 5LBSH 1X6NA 3LIZH 4L8DA 4JO2L 2W60B 3HC4H 3T0WA 5C09D 2O93L 3RIFF 3ZE1E 1WZ1H 1NC4D 4UQ3A 1E28A 3FFCA 4JRYB 2N56A 1JWSA 3PXJA 5DMJB 1R5IB 2GAZA 5I15L 5E2VH 3C9NA 4HKZA 4NP4H 2BP3A 3HI5L 3BKML 4P3WA 4WDIA 1RK0B 1YYML 2FX9L 4OD2A 2BC4B 3MUGA 2D7TH 4S2SB 1FV1A 3QIBA 1FNSH 5C0AA 1T20A 5F8RC 3N06B 1CG9B 4PGEA 4QRRD 5GZNC 5BJTA 4XXDB 1GHFL 1TCMA 5EC1A 1W8NA 1WLHA 1XCQB 4PJ9A 4X6CE 3H0TA 4LPTA 2J88L 5FO7B 1B0WA 4Y4FB 5CCKH 4YWGH 2HRPL 4DKFH 4OLXH 3IFOB 1KCSH 2QQLH 4M03A 5D5ME 1NFDF 5T1LA 3QDGA 2P5ED 2ESVD 5FF6B 5D1XB 1BOGB 1A4KA 2IJ0C 5DK3A 5DRNB 2VLME 4KK6D 1F00I 3TYGH 3ARVA 3F5WB 4KJYB 4ZAKB 3E0GA 5H37H 2OK0H 4XB8A 1UADC 3EO1B 3D9AH 2D3VA 3IFLH 4JPKL 1LO4L 1S9YB 2XNAB 5T5NG 4AIOA 3ZTNL 2V9TA 4U0QB 1TNNA 4CMMA 3VD7A 3C6LC 1WCBA 4IOSD 1EEUA 1TIUA 1JNHB 3HZVA 1MY5A 2NQCA 4NRXB 2IQ9H 3BEVB 4CN4A 3FONB 1BD2D 4M7JH 4I48A 2WK2A 4MJIE 1XF3A 3A6BL 2PNDA 2HJFB 2XTJB 1ACYL 3LQZA 4XPGL 3WLBB 2NY5H 4P0DA 1F4XH 1GC1H 4M5ZL 5DO2C 4XX1E 4OZGE 4Q97A 4IS6B 3NPZB 4NZJA 4MQ7A 2AKRA 1JV5B 3OTTA 3S35X 3VMOA 4MMXC 4O9HL 5LBSL 2Z93A 1X5YA 2DMCA 3AREC 3LIZL 2OMNA 3HC4L 5EU5B 3X12A 3UPAA 1ORSA 4HV8B 1WZ1L 1FO0H 3UYPA 3O9WA 4XPFH 4RAVB 4JG0H 5GRXG 5KSAD 1KGCD 1MUJB 2OR7A 4FTVA 1DL7H 3UTQA 3H9SA 3DI2B 5E2VL 4NP4L 2Q8AH 3RU8H 5CP7A 1DQJA 1N0LA 2K7QA 2A6JA 4WUUB 3H3PL 1OGAB 1JE6A 1P7KA 2XN9D 3FN9A 5ERWB 1I3VA 3GB7A 1FNSL 3VFVA 4L8SC 5JLZA 4AM0B 4JJ5B 5E4IA 3G6JA 5HJ3A 3GSWB 4JAMA 1NH6A 4C83A 2UZYB 4X6DA 1P7QD 4NFDA 4NQXA 4UTAH 5I8CB 1IGCH 1DEEB 3KYOA 3MREB 4P2RD 5IESH 3WFZA 1KNOB 4N1CA 2A73A 2F53A 1V3KA 3G5VA 5GSVA 1ZHLB 4YWGL 3BZEB 4DKFL 4OLXL 2EO9A 5JA9A 5IHZB 5I1AA 2QQLL 1BGXH 2NR6C 1XF4A 3FTGA 3O8XD 4LDOB 2VIRB 1W2KT 4JRXB 1NUFA 3O11A 1AJ7L 3TYGL 4HCRA 3SDYH 3SJVB 5E9DA 5DEFB 5C2BH 1HQ4A 1P9MA 5GRVL 2OK0L 2P8LA 1U6AH 4MAYD 3D9AL 3IFLL 4Z76A 2DRUA 2CKNA 5KVGH 1D6VH 1AFVH 5DQ9B 3CFCH 1U8KB 4XB7A 2VRAA 2XY1A 2IQ9L 3KVQA 2WQRA 4M7JL 4BZ2H 2FR4A 4N5UA 1IAKB 4L9LB 4XP5H 4CJ1A 2NY5L 1F4XL 4U1NA 1GC1L 4XCFH 1FPTH 4YHPA 5BOZG 3PV7A 1U8LB 3QR2A 2CSPA 2A9MH 4X4YA 2DM3A 5HYJB 4NKOA 3MV01 2GFBA 4S1DC 5DR5H 3V6OE 1A22B 3PIQA 3RGVC 2YZ1A 5DJ8B 5DGRA 4X8JB 2ITCA 4Q6IB 2NY2C 3PWNB 1FO0L 4XPFL 4MD5A 4L3CB 4JG0L 1X5JA 2VITA 1EAPB 1DL7L 4LCWE 1VADB 5I76A 1CE6B 3TZVD 3OXRA 2Q8AL 3RU8L 2EXYC 4GRWF 1TJIH 1JZ3A 3O3DB 5BS0A 1AGDA 4O00A 1XGQA 5FDWA 1FAIH 2BNRB 4JHZA 1IQDA 2IGFH 3U4AA 3ELAT 1S8DA 1JRHH 4HWBA 1KB9J 3H9YA 2E9IA 4KRPD 3NZHH 5SWQA 4UTAL 3BUYA 1IGCL 3QQNA 2QLVB 1LP9F 5IESL 5K9QG 3RHWF 4GRLD 1ZV5A 1B0GA 1ZGLP 4PJHB 2H1PH 5EBLB 4JCLA 4M6AA 1BGXL 4JFYA 5EH1A 5KAQG 3EDDA 5EO0B 4KMLB 1YEFH 1IEAB 1NBQA 1NCTA 4PRNA 5I1JH 4B41A 3SDYL 4MVBC 4JY6B 3O4LD 2PF6A 4HLZG 5C2BL 3SGEH 1OSZA 5GS2D 5IMLB 3QUZB 3DV6A 1U6AL 1LEGA 5KN5A 1MQ8A 2QSQA 1RZ7H 4X80L 1D6VL 1NCWH 3S35H 4MNQA 5DMIH 2R23B 1AFVL 1QRKA 2JCCF 1FFNA 1CS6A 4HAFA 1UZ6F 3CC5B 3QI9B 3VH8A 3MA7A 4UUJA 5C07B 2DBJA 1IAOA 4J3OC 2ARJA 5CD3B 4BZ2L 5EZJA 2VXQH 3QFJA 4NKIH 3HB3D 3TVMC 5DQJB 1S7UA 4DQOH 1CDBA 5F7DA 4XP5L 1RUAH 3S96A 4Y5VB 4X6EA 2IFGA 1FPTL 1I7ZA 4ZUSB 3O6FB 4I3GA 1B0RB 4YGVA 1EGJA 2A9ML 4F7TB 1U2CA 3EUUA 2C3HA 3KWWB 2DQJH 1HE7A 3MGOA 4P9HC 2FO4B 5DR5L 1BVLB 4H0HB 1QKZH 3AM8C 4BH7A 1ZVSA 1RUQH 3ALWA 1HHGB 1OAZH 4QTIL 1TZGH 3V0VB 2HT2D 4OFYA 2FATH 2ATKB 1OF2B 5IVXA 3K46A 3SGJC 2YN3A 4KI1A 4LDLB 1TJIL 1I1YB 4AH2B 4P5TD 2EDHA 4FFYL 3TIDB 3VMPA 3H7LA 3WXWH 1XT5A 3KPPA 1UXWB 1AO7B 1QSED 2IGFL 3TJHD 3VFMA 3OXSB 1B6DA 5KOVC 1JRHL 4F7EB 1WBXA 1NEUA 4XRCB 3U4EB 2W07A 3NZHL 4IM8A 3L7EA 1RJLA 1CQKA 3TNMA 3EYFB 3T0EA 3BMWA 3GSNB 4JQVC 3BZ4A 4RFNB 2H2PC 2JB5H 4Y4FC 2J6EH 1KN4H 1BBDL 4GBXA 1I3UA 5IROA 3EZJB 3V5KB 2QADB 2H1PL 3ULSA 5C0BA 1M05B 4XVSH 1UWEH 5T1KD 3KPMA 1YY9C 3NCCB 5D1XC 1U9KA 1D9KD 5MHSD 1C16B 3HNTH 1AKJA 5I1JL 1KIUA 3P9MA 4V2CB 3IDGB 3UROR 5IB3A 5K59E 4ZAKC 3VG9B 4N90E 4ELME 4POZC 3BPCB 4PJFA 4RDQF 1MF2H 1WSST 3I84A 1ZWIA 4LHUB 3UJJH 1RZ7L 1T22A 3VI3E 4XMPH 1N2RB 3P0YH 5F8QC 1T1ZB 4O2CA 2CH8A 1NCWL 3QUXC 5DMIL 5L2KB 1G7MA 4U7MA 1GIGH 3MFFB 4JKPH 3SCMD 3G04A 3T0AA 2XXCB 1FVEA 2R8SH 5F1OB 5DJCB 1BHGA 3LPWA 2NY4C 4JJHA 5DFVC 4OGZA 1F4HA 2VXQL 4NKIL 2J8HA 3K4AA 4DQOL 1Y6NR 3NIFF 1CVRA 1RUAL 1TXKA 4Q2ZB 2GQHA 3VRLE 2GSIB 4WCYH 4E41A 1S7RB 3RZWA 4ENED 4LPYA 4A2MA 4QCIA 4P3CH 1U8NB 4TVPD 4UQ2B 2DQJL 5C0FB 4HMDA 1ZLSL 5INDA 4H1LG 4FXKA 1LNUA 4L8BA 5EU4B 1U8JB 1QKZL 4UT9H 2QL1A 2AV1B 3B8YA 4GLRI 2MQCA 4BJLA 1RUQL 2VL5A 4KQ4H 2I24N 1OAZL 2P43B 1TZGL 2PYFB 1FJ1B 2FATL 3C6SB 2V7NB 4KVCL 4WW1A 2EDRA 1SJEA 1O7VA 1A6TB 4FQXA 3L6FB 3CFIC 1CICA 3WXWL 5EOQL 4BQCA 4ZO7A 4N1EA 5IVZB 2YEZA 1L0XA 3EYQC 4RWHA 3EGSB 2ARJQ 1PKOA 1FGVH 2VOTA 3P4OB 3CFEA 1G6RB 3OF6D 4QRTB 1D5IH 3MCLH 4KKNA 4NNPH 2PTVA 4OJFH 5DHVH 4HWNA 4OF6A 3VXRE 3EKCA 1DUYB 2JB5L 3P2TA 1MFBL 5IWLC 3WHE1 2J6EL 3ZKND 1KN4L 4K8RD 2DB8A 4Y88A 3JV0A 3O4OB 4XVSL 2X70A 4MA8H 1UWEL 3EO9H 4K9EH 1QLFA 3VXPB 1RZKC 3PL6A 4U05A 3HNTL 5TDPB 2FEDC 2AJSH 2FBJH 4OIAA 1J0JA 4X6FA 1MF2L 3GIZH 4EI5D 3EJZC 2WZPD 1AQKH 3UJJL 3LD8B 4N9GA 4XMPL 1TVDA 5EFIB 2SEBA 1KC5H 3HUJE 2FB4H 3P0YL 4KKAD 4HBQA 4P3DB 5HYSG 5H35B 1GIGL 4JKPL 3QA3B 2VDNH 3MV9A 2MKLC 1BEYH 2R8SL 1CT8A 4N0CD 1HCFX 1LMKA 4UDUA 4X99B 5GS0H 3B3IB 1SJVA 5JW4Q 2AXFB 4OZ4B 3OKOB 1R5WA 4R0LA 1AXSB 4I3RL 5FO8B 2E8YA 1VPOH 4FQ1H 1RK1B 3VFNA 2CMRH 4WCYL 1Y6KR 3HE6B 1S9XB 5IGXH 1XGTB 3MQIA 5EUOF 1I85A 3OR6A 1F13A 3FCTA 2A2QT 3V0WH 3DXAA 4YGAB 3VXMA 1MHHA 5TH2A 3LSOA 2W38A 4GKSA 3HZKB 1ZS8A 3FJTA 2ATPA 3NCBB 4UT9L 4Q6IC 3CX5J 3QB7C 2FLRT 2JE8A 4KQ4L 1KYOK 4GH7B 3ULUD 5E6ZA 1TVHA 4KUZH 4AEEA 3LN4B 4JY5L 1BFOA 3SDAB 2FZ3A 5EBGA 4HT1H 2WAHA 3OX8A 4OIIL 5AUMA 3AAZB 4JHAH 4MB3A 2LFGA 4UIMA 4PYHA 2KBGA 2X9YA 5DUBB 5I19H 3UTZB 4L8CA 1DANU 1FZKB 1D5IL 3MCLL 3NFNA 4MGXA 4NNPL 3SDCA 3UPCA 4OJFL 2X4UA 1FZJB 4UV4H 1K2DA 1P84J 4X9FA 3NGBB 3SKUD 5IW6B 2FSEB 4YEFA 3WFDH 1C7TA 3WNPA 4MA8L 4MNGA 3EO9L 4K9EL 1IZKA 3WHXB 4JO1H 5I30H 2I9TB 3FRUA 2EXWC 4Z78A 3PQYB 1C08A 5JPMB 5IOPA 4H1LB 2DKUA 4JQXC 2AJSL 1SYSA 3IETA 2FBJL 1UKTA 4LEOB 2P8PB 3QUZC 2F54D 2A74A 5BRZE 2Q76B 3GIZL 1AQKL 4NQVB 3GSVA 3RWGA 1KENH 1D3CA 5HI5D 4I0PD 2FB4L 1CLOH 1N64H 4F15B 5F44A 2JJUA 2DL9A 1F3DJ 1WITA 4EVNB 4HIJB 1BEYL 2VDKH 5GS0L 3RWJA 4UT7H 3F7VB 1DBMH 3NCJH 1A1MA 1ZEAH 4QGTA 5HD8C 1IFHL 4ZNCD 4CGTA 4LLWA 3DMMD 4NT6B 1BLNA 1T3FA 4LRIC 1VPOL 4FQ1L 4PJCA 3ZYJA 4N0FA 4FHBD 3HTLX 2CMRL 2Z8SA 3IXTB 4U4BA 3VE0B 5IGXL 4KI5C 3NA9H 1U91B 4LLQB 3REVB 3MMEB 5GS1B 1S7TB 5ISZA 3I6GB 5CSZB 3V0WL 2A6DA 2GTWB 4GUPA 4MCZA 1QO3A 4YPGB 5BV7H 3IDNA 4FS0A 4Y4HD 1ZXQA 2J5LB 1QRNA