4PLJC

Hepatitis e virus e2s domain (genotype iv) in complex with a neutralizing antibody 8g12
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
211
structure length
201
Chain Sequence
b'DIQMTQSPASLSVSVGETVTITCRASENIYSNLVWYQQKQGKSPQVLVYAATNLPDGVPSRFSGSGSGTQYSLKINSLQSEDSGSYYCQHFWETPFTFGSGTKLEIKRADAAPTVSIFPPSSEKVLSGGASVVCFLNNFYPKDINVKWKIDGSVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Structural basis for the neutralization of hepatitis E virus by a cross-genotype antibody
pubmed doi rcsb
source organism Hepatitis e virus
molecule tags Viral protein/immume system
total genus 43
structure length 201
sequence length 211
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pljC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pljC01
4FRWA 4QLRA 1IM9D 3EZJB 1RZKC 4PP2B 4G9FE 4MNGA 2ADJA 3STLA 4JFED 1MHPL 4FQCL 4NQXB 1CGSH 1F58L 4J3SA 5BZWA 4KK6C 4IM8A 1A6UL 1J0KA 4G6FD 4IRJD 4NCC1 4MXQD 1V3LA 2YSSA 4MNGB 2ADJB 3NPSB 1MCJA 2Z0BA 3STLB 2D31B 2ENSA 2EXYD 4OCLC 5ISZE 1F4HA 5KN5A 4JO2L 5BZWB 4UNVA 4HS3A 5LCVH 4DCQA 3CCHB 5B4MC 2YSSB 4JFFE 2Y6SC 5AD0A 1HZHL 2J8UE 3D3VA 4G7YL 4WWKD 5E2TL 1YN7A 3IFNH 5KN5B 3R0NA 4LU5H 4HF5H 1CG9A 1FIGH 3CXDL 4HS3B 4EOWL 4XAWL 4YBQC 1MCDA 4DCQB 3WD5H 5EWIL 2CO6B 5AD0B 3D3VB 4FQ1H 1KENL 1GZQA 5GRJH 4QXWA 1YN7B 5TJWK 1BWMA 4QNPF 4HIXL 1CG9B 4KV5F 4L8SA 4JM2C 1CZ8H 4KZDL 1ITCA 4X7SL 3WDJA 4C58B 4QXUH 2A77H 2DOCA 4OZ4A 1CLOH 4OM1H 4NZRH 4PJIE 2CK0H 1GZQB 2AJUL 3ULVH 4L8SB 1AHWA 5DVOA 3IFLL 5GRVL 2OZ4H 5GRVK 3HI5H 1ZVSA 3DHMA 4OZ4B 5TE4L 1KN2L 2QQKH 1GC1L 3DGCR 1VKXA 4TVSa 3X12A 2VDML 4CN6A 5J0BA 5GS2D 4MDJA 4RX4A 3JWDC 1AHWB 1JRHI 4M6MH 1YMME 1KXTB 1SHMA 2MCPH 3O4LE 5HDBF 2A9MH 1ZVSB 1PAMA 1MSPA 4BFIA 1R5VA 3KAAA 1VKXB 3RIAK 1MF2L 1G7IA 2YD8A 2OXGA 4MDJB 4R0LC 1HNFA 5DQ9A 1CS6A 5CSZA 1D6VL 3ZE1E 1RJYA 1EDQA 1VEPA 5LGKA 4JFXA 5I15H 1QSEA 2ITDA 5BOPA 3UC0H 4M03A 1R5VB 3O3DB 5A16A 4IRZH 1G7IB 4GAGH 1HEZA 1E28A 3S5LA 4XPGL 4H8WL 5CSZB 1DBAH 4LOUC 4M5YL 2ESVE 4U0QB 4Z78A 3AGVA 3V6FA 1PKOA 1MCPL 1QSEB 2ITDB 5ANMA 4P46B 4WFGD 3NVQA 2F19H 1HEZB 1E28B 1BZ9A 3S5LB 5IQ9A 1AC0A 3KJ4C 1AFVH 3L5WA 3LPWA 1IT9H 5GGUA 4Z78B 3BESR 1RVFH 3V6FB 1TPXC 3FFCD 5C2BH 5ANMB 2OTPA 3HFML 4JQVA 4UQ2A 4P4RB 1RUKH 2EDWA 3Q1SL 1BZ9B 4NRXA 5IQ9B 3N1GC 2JJUA 5D4QA 2BVQA 3L5WB 5GGUB 1J5OH 1YEDA 2Y5EA 4KRPC 5E5MA 4UV4H 4UQ2B 2OS7A 4F8QA 2R9HD 4NRXB 1NUDA 2BVQB 4PRPE 4N0CD 3TZVA 3THMH 2H32H 3BEWA 3O6FC 3HC3L 5E5MB 4LGPB 2ATKA 2WUCH 2VDNH 1MQKL 5FHBH 1HQRA 32C2A 2JJVA 3FN0L 4ZS6C 1OAQL 4P2QE 3B9KC 5IWLA 3TZVB 1S9VA 5LCVL 1PD6A 2RJMA 1TJHH 2C3XA 3BEWB 4K3EH 1LD9A 2OTWA 3QUYD 1NCBL 1EPFA 1MCQA 5EFIA 4OLEA 2ATKB 3MLWL 5KSBE 4YHPA 1HQRB 1SVZA 3HZVA 32C2B 4NNXA 3VXTA 1QTYT 3IFNL 4LU5L 4XBGA 4HF5L 3TN0D 1FIGL 3BGAA 2IADA 1P1ZA 1EK3A 1LD9B 2OTWB 5DRNB 1RMFL 4DN3H 5EFIB 3LCYA 3WD5L 4LFHG 4YHPB 1XF2A 4FQ1L 2R1YA 4H0IA 4NNXB 3VXTB 4XBGB 5D1QC 4AEEA 5J11C 3L5IA 4WI4A 2IADB 4E41A 1CZ8L 4HMCA 1NKRA 1P1ZB 4Z5RA 1MAJA 3PQYA 5CJOH 4TQEL 1XF2B 1FN4A 1CFSB 4OM1L 4NZRL 2R1YB 2CK0L 5IGXH 3ULVL 3AU1A 4D0DA 4QWWD 4XVSL 4E41B 4JGUA 2OZ4L 3HI5L 1Z9SA 5SX5K 4Z5RB 2BHYA 2RAMA 3PQYB 1BFVL 4MNQE 1CGUA 5FHAL 1CD8A 2H2SC 1FN4B 2QQKL 5C09D 5E8DL 3V6BR 5DJ0A 2NW3A 1N64H 5C0ND 3AU1B 4L4VE 4D0DB 4JRYA 2MCPL 5IEKA 2A9ML 3NZHH 3BMWA 3WFCL 3L7FA 2C3GA 5TQ0H 4N8VA 1CQKA 1C8PA 3RZCC 2VXSH 5DJ0B 4XCCH 3U48A 2NW3B 1FL3A 4ZTOH 3ETBF 4LCCA 1N26A 4JRYB 2CDFA 1FFOB 5IEKB 1HN1A 4Y5XC 3ULUD 4OB5H 5H35A 2OR9H 5I15L 3L7FB 3TFKC 5HPOA 3BISA 4N8VB 3UC0L 3ZDZE 1OAYL 3NCCB 1N0XH 4IRZL 1NJ9A 4GAGL 2PO6C 3VXUD 4JB9H 4Z7UA 3CXHK 2HP4A 1FL3B 3EHBD 1EXUA 4WHDA 5ICXA 4LCCB 2AQ2A 2CDFB 1DBAL 4ZO6A 1D5ZA 1BM3H 5H35B 1X5HA 4PGJA 4GAFB 4U3XA 1S7QA 1RFDH 4E0RA 5E94A 3P11H 3UYPA 3RWJA 4Z7UB 1RZJC 1IAMA 3S37X 1EXUB 1AFVL 2OJZH 5ICXB 1D5ZB 1XEDA 1JL8A 3T04D 1J88A 2EKSA 4BK5A 2GKIA 2NYYD 5BV7H 1FO0A 4G9DA 5E94B 3V5KB 5C2BL 5CKGA 1RUKL 3RWJB 2PW1A 2RGSA 5IM7A 3AAZB 5E99H 4ZMAT 1XF3A 2EKSB 1J5OL 1OD9A 3LKNA 4O02L 4YK4C 1UZ6F 1MEXH 1Q72L 1FO0B 4G9DB 3SE4C 3T0XA 4UV4L 4WO4D 4YXLL 1JPST 4AEHL 4Z8FL 1NAKL 3ARXA 3TA3A 6FABL 4YO0A 5IM7B 4PY8I 3MJ9H 3FT3A 5K9OA 3VD3A 1ZLVH 2BY1A 3OB8A 3THML 1XF3B 3H9SE 3GBMH 1S78D 4WDIA 3LKNB 4K55A 4F57H 2I9LB 2YBRA 1F97A 2VDNL 4TSCL 5DHVA 4K71B 4NN6B 4JQIH 3TA3B 4YO0B 3S97C 3FT3B 5K9OB 4X80H 2YD3A 1TTUA 2AJXL 2CUIA 3FZUD 3GBLA 3SDXA 4K3EL 1TJHL 1UGNA 4X5LA 4WDIB 2Y1VA 4NC1E 1CBVH 3WIHA 2VIRA 2YBRB 5GS0C 5DHVB 1RZGA 3S98A 3DJ9A 3BRDA 4P3WA 2OXHA 3BRFA 2ZUSA 4P2OA 2Z31A 5EBGA 4UUJA 5F9OH 1HHJA 4DN3L 4NQEE 2VIRB 1LO4H 3V6OC 1RZGB 5JO5A 4TVPL 3CK0L 2R0WH 4M4PA 3FKUS 4HWZA 5GGTA 3VGBA 2R0ZH 3HZKA 4WFFD 4P2OB 4UUJB 1HHJB 4PRNB 1ZWIA 1TQBC 5CJOL 2X4PA 3SDYH 1EO5A 3V5DA 2R0LL 3PGDA 5IGXL 4JCMA 4HWZB 1IQWH 4GLRI 3BX7C 3HZKB 1YNKL 1DVFC 3T0ED 2X4PB 2YD7A 3GIVB 1ACYH 1GSMA 3TJHC 1KSRA 5D2NE 2V2XA 3V5DB 2GY7B 4KKLD 4KTDL 3JVGA 3ABZA 1D6EA 2F15A 2ICWA 1G7MA 1N64L 3MOBH 2CKBH 2D0HA 4OKVB 4ELKA 4UNUA 4I18A 3NZHL 4XMPH 5HJ3A 5BRZA 3FQWA 3ORJA 1N6VA 3RUGE 2V2XB 4X5XA 4ELMF 5DJ2A 4P0DA 1A6TA 2A2QT 2VXSL 2ICWB 3OGCA 5FM8A 4BZ2H 5HYSA 1G7MB 4LK4A 2B1AL 4ZTOL 2P48B 4ELKB 2O5XH 4I18B 4PJHF 2E6JA 3BPNB 1CTNA 4OB5L 5HJ3B 5BRZB 3FQWB 5E4EB 3FO2B 1B88A 3KYKH 3MLYH 5DVMA 1N0XL 4TTGA 4HWNA 4X5XB 3PDOA 5DJ2B 1A6TB 3OGCB 4JB9L 5HYSB 3B6SA 3BRGC 3JWOL 3QIBA 3CDFA 2X1WL 2I9TB 3FB8B 4N68A 1BM3L 3EJJX 4YHZH 2KZ1B 4GJTB 2K7PA 3B2VH 3QXAA 2EC9U 3I3DA 3FRPG 1RFDL 3P11L 3PDOB 1JGEA 4KFZC 4U2YA 1LEIA 1QD0A 3B6SB 2VXVH 2L0DA 3QIBB 1BQLH 4C83A 3MRDA 1G6VK 3RWGA 1H3PH 3H42H 5F1KC 2J8HA 3X14A 4R97C 4JREB 5E6IA 3QXAB 2EE9A 3I50L 5ESAA 1JGEB 1PYWA 5JA8B 1LEIB 5KSUA 3KHOA 3U1SL 5C08B 3GMLA 4C83B 3MRDB 5E99L 3RWGB 4YXHH 3GBNL 3X14B 2F74A 3BWAA 2FX8L 5E6IB 1FQ9C 1YY9D 4PFEA 3PIQA 2Q8AL 5ESAB 4PV8A 4OIBA 3QEQA 5KSUB 3D3VD 5GGSA 2AGJH 1QBMH 3GMLB 5BZDA 4JQXC 1Q1JH 2NY0B 3G9AB 2F74B 3BWAB 5DLMH 1RJZA 1YY8A 3PIQB 1I85C 4FFVD 3S36X 1Z3GL 3L1OL 3QEQB 4JQIL 3I6GA 5GGSB 2UY6A 1DSFL 1NBQA 3WNLA 4X80L 1GOFA 5BZDB 1MFBL 1DQMH 2BY0A 5E5RB 1B6DA 1WZMA 3SGDI 1CGWA 1J1PH 1RJZB 1YY8B 4WV1A 1LDPH 2NX5E 15C8H 4LAJH 3I6GB 3ARWA 5DK2A 3QUKA 5B22A 3VGDA 1GGIL 2P45B 4OV5A 3EOBA 3VXRE 1NGQH 4PBWD 3QPQC 4HQQH 3UTQA 1BZ7B 4WY7L 2CPCA 4CMMA 5IVNA 4U6XB 2DF3A 4ZSOE 4PLNC 3GK8H 4WV1B 2X4TA 4EI5C 2P43B 5I6XB 5DK2B 3ZKXC 3FAXA 2R0WL 3QUKB 4H25A 4OV5B 1Q0XH 3EOBB 1YEFH 1KULA 5FA4A 2R0ZL 4U0RB 4RX4D 1FCGA 5DR5H 3UTQB 5I76A 3VXNA 5SWQA 3C5ZA 4PS4H 4M7ZC 1JFQH 1SY6A 3RTQC 3U7WH 4HZLA 3LN4A 3LZFH 1RUQH 4JJHA 3O2DA 4H25B 4N5EC 4ODWA 1IQWL 4Y4KA 1U3ZA 1QFHA 5FA4B 1C5DA 5I76B 4QNPE 3VXNB 5SWQB 4KV5E 1HDMA 3C5ZB 3MRLA 4HZLB 4MHHG 5HHNA 1GIGL 3LN4B 3SQOH 3FB5B 2J2ZA 5DF0A 4OLVH 1S8DB 4ODWB 4OLWL 1TNNA 4P46D 2NY3B 4Y4KB 3D0VA 3MOBL 1C5DB 3FO0H 4H88H 1TZIA 2R4SL 3MGOA 5CGYD 3UBXI 4PYGA 5GGRA 2E7LC 4XMPL 3PWVA 4OTXH 1HDMB 3U9PL 3L3HA 1WJ3A 4KU1A 5HHNB 4RMSA 3F5WA 4K94C 3QI9B 1A7RL 3D0VB 3Q5YA 3RJQB 5L2KD 1DTUA 1TZIB 2O5XL 3MGOB 5J89A 3LRGA 5GGRB 1FVDA 3PWVB 2VDOL 1MFCL 3L3HB 5ERWA 3KYKL 5HDBE 1AXTL 4NNPH 4Y16C 3F5WB 1ZAGA 4NYLA 4HAFA 4PJ5A 4D9QD 3MV9E 2ZKHL 4PJEF 2NZIA 3VWKC 1RK1A 4I2XE 3B2VL 5ERWB 5IBTL 4TSBH 4I0PC 1CFBA 4NYLB 4PJ5B 2O5YL 3KLSA 2VXVL 1A5FH 5T5FH 1ZOXA 1BQLL 2X4OA 5J9PA 4HMDA 4W4OA 4Z7VA 1H3PL 3TZVD 2CDEA 5IB2A 2AK1H 3WXVL 4LRNH 5FECA 1HIML 3CFKA 3UPRA 3PGFH 1W0WA 2QL1A 2W9EL 4MQ7B 3UBXA 5J9PB 3LIZH 5FO9A 5DD1H 4YXHL 2XZAL 2CDEB 4M93B 4KVNH 1MRCH 5IB2B 2RCSH 5FECB 3CFKB 3OKLA 3E3QC 2NQCA 2AGJL 1W0WB 3UPRB 2JE8A 1QBML 3UBXB 5ECJE 5FO9B 1UCTA 2H26A 1LO2H 3AXLA 1J8HE 4NBXB 3GO1L 2VERN 3OKLB 3DSNA 3MODH 5H37H 5C0AA 1FNFA 2B0SL 4J7RA 4GFTB 1DQML 3K7UA 1KGCD 2DI7A 4J3VA 4ZO7A 4E41D 4JN1L 1SQ2N 1AQKH 2H26B 3W0WE 3PQYD 1EEZA 1LDPL 2QTEA 3AXLB 3QQ4A 3VCLA 3VH8A 5C0AB 3T2NH 1NGQL 2HMIC 4HQQL 1TCRA 4HJJL 1UM6H 5I74C 5EB9A 1BBJA 5DA0B 2ARJQ 5FCSH 3IDMB 1EEZB 5HGHA 1UACH 3TWCH 3QQ4B 1BQUA 4L9DA 3BJ91 3VCLB 3VH8B 1Q0XL 2YD5A 3VFUB 1YEFL 2O5ZL 4U4BA 4I5BA 5DR5L 1TCRB 1XR8A 4JRYD 1BBJB 4PS4L 5K9JL 1JFQL 1KCRH 3VWJC 3U7WL 5HGHB 1RUQL 4Q97A 4HAGA 2OBGA 3BKJH 4NO0A 4I5BB 2WWMD 1T5XA 5TPWL 5I1CH 4F58H 1XR8B 3QHZL 2EDKA 2HJLA 5EORH 2B39A 5FGBC 4UB0H 2P8LA 4OLVL 4NO0B 1NSNH 1UEMA 2ZCLL 3FO0L 1Q0YH 5FYKU 1N7ML 4OTXL 1K8IB 3C87A 3CSYA 5JHDA 1T83C 4HCRL 5EBMA 4OQTH 2P8LB 2HTKC 3JV6A 2B2XL 2NXYB 1FORL 3U30B 4XP9H 1EO8H 3CSYB 5FKPA 5I1DA 2QHLA 4JY4A 5EBMB 2RFXA 3BYTA 3JV6B 1NAMH 1MY7A 3O2WH 1ES0A 2Z93A 1FNEA 3H3BC 3V4VL 2ITCA 4I48A 4D9RE 5I1DB 4KUCD 2CR3A 4JY4B 1K3ZA 2EDJA 1E4KC 2RFXB 3FQNA 2EKJA 1F3DH 5HDQL 1CXFA 3BKYH 3CFBA 3NIGF 4QOKA 1A5FL 5T5FL 3TA3D 4RRPA 3GSNL 1ES0B 1S7RA 2Z93B 1FNEB 1R6VA 2ITCB 4I48B 3DO7A 4I0CC 3HC4H 3NCJH 4OF6A 4LRNL 2VR4A 3FQNB 3NPZB 4U7MA 4RWYL 3P73A 2OZ4A 3CFBB 2CRIA 3PGFL 4QOKB 4B0MM 1JGDA 4DVBB 1S7RB 5I1GH 5DD1L 2BSSA 5FYJU 1EEYB 3V8CA 1FSKC 1DEEA 3DO7B 2RCSL 1C5CH 2EDQA 4DN4H 3P73B 5E9DE 4ZFOL 3SPVB 3ZKMD 4JY6A 2AV1A 1JGDB 3IAQA 1DUZA 4POZD 2BSSB 3DMMC 3T1FA 4CU6A 1DEEB 2WQRA 3B9AA 4Y8DC 1T0NA 1NCUA 3QCUH 4XPAH 4ONHA 1MFDH 1UZ6E 3MODL 2R15A 4NQTA 1ETZA 2AV1B 4FABL 1DUZB 4S2SA 3T1FB 3GI9H 3C5JA 4W6WB 4BQCA 1AQKL 2KBGA 2DKUA 2DLTA 5KVFH 3SKJH 1T0NB 3VD4A 4HZAA 4KTYA 3HMWH 4AZ8A 4Q9RH 3T2NL 3UXFA 1ETZB 1UG9A 4S2SB 5HTSA 1UM6L 3C5JB 3KJ6H 3IDIA 1HH6A 4XP4L 4I4WA 4HLZH 4FMFA 4QY8A 3MNZA 3ARBC 1UACL 3PHQA 1X5GA 4WU7A 4XT1C 4N9OB 2J88H 4MJIE 3DNKA 1MELA 3IDIB 1HH6B 1QPXA 4I4WB 1ORSB 1KCRL 4QY8B 4MLSA 4UAOB 4WWKC 5DS8A 5BRZD 3MNZB 1ZSDA 3CMOH 1LE5A 3PHQB 5E8OA 4WU7B 3V4UL 4WFHE 3BKJL 3RGHA 4PJFA 1I3UA 3NGBC 5D70H 5DS8B 2R1XA 1CDBA 5EORL 1WZLA 1ZSDB 2E7HA 2NY2C 4UB0L 1LE5B 1A1OA 4P2CG 3MRRB 4LVNC 4PJ9A 3VRJA 2APVA 4PJFB 1FPTL 1NSNL 3WHE1 1Q0YL 3QIBD 1E4XL 4TUOA 1IKNC 2MHAA 4JDVA 1KV3A 3MLTA 3SGJC 3KPQA 2EO9A 2HVKA 3ZHLA 1A1OB 3VRJB 4UINL 2H32B 2VLRA 5HGDA 4DUVA 4TUOB 5C08D 2MHAB 1EGJH 4JDVB 1XF4A 3MLTB 2J3SA 2XTLA 3KPQB 1N6QL 2HVKB 3LHPH 5E6ID 1HK6A 1U58A 4HHAA 1NAML 1OT1A 2VLRB 4ELME 3O2WL 4NHCH 4EQ3A 3UAJD 3OTTA 1XF4B 2C3VA 3BW9A 2NY0D 4YFDB 4PJHE 4JRXE 2C26A 1U58B 4HHAB 2AXFA 3W9DA 1HINH 3BKYL 3QEQD 3UMTA 3N1PC 2YK1H 4OSUH 3WJLA 1PW3A 1RK0A 2YRLA 3BW9B 2C3VB 3BEVA 3IAPA 3HC4L 2ZPKL 3RBSA 3FOMA 4U6VH 3U6RA 1MCKA 4JPIB 3B3IA 2YUVA 1C5BH 5BW7C 1AQDA 2MFNA 1NLBH 3PG2A 4Z95L 5I1GL 1M71A 2HWZH 5FUZL 1JHLH 1CR9H 3BEVB 4LCWE 4AENA 5JPNA 1IARB 3S88L 3FOMB 3U6RB 3MRIA 5EC2A 2EEAA 4KY1L 3B3IB 1JIBA 4M6NH 1ZLSH 5EU6E 1MCNA 2X9WA 4MA7H 1AQDB 4XC3L 2MCG1 2E7BA 1M71B 3L3IA 3P9LA 1RZFH 3O4OB 3C09B 3FT2A 2MSPA 2W9DH 3O6MH 2FX7H 4AENB 5JPNB 3KYNA 4ZXBC 3QCUL 1MFDL 4ZQKA 3MRIB 5EC2B 2M26A 3DX7A 3L3IB 3GI9L 3RVWD 4K9EL 3P9LB 5F72S 5CJ8A 4KHXH 3RL1A 5KVFL 3GHEH 2IQ9H 4OUUA 1EAPA 3C5ZD 3FRUA 1L6ZA 4ZQKB 3EYUH 3DX7B 4N0UA 4KI5C 4RGNB 5DD3H 4G6AD 2NY3D 1RUAL 4Y4KD 4NRZA 5CMAA 3A6BH 3KJ6L 3RL1B 4D3CH 1C08A 1HHKA 4EN3A 2F53A 4OUUB 1EAPB 4Y4HA 3FRUB 2VLKA 3P77A 3VMNA 2DQIH 4N0UB 3ULUF 3QI9D 4RDQF 2J88L 3QUYC 4LDOB 1IGFH 4NRZB 5CMAB 3Q5TA 4MGXA 1C08B 1HHKB 4EN3B 2VRAA 1UA6L 4Y4HB 3Q6GH 2VLKB 3P77B 5J3HC 3VG9C 3TN0C 3RRQA 3FQXA 3SY0A 1DBKL 5F6HJ 5C71A 2GJ6A 3MXVH 4LPTA 2AJSL 2FEDD 4AMKL 5BV7B 2SEBA 1UFUA 2NXZB 1QSFE 5D70L 1HHGA 3MJ9A 1MCEA 1T1XA 3IJHA 2LVCA 3FQXB 3STBA 3SY0B 5DC9B 2GJ6B 1XF1A 4PJ5D 2IJ0C 2SEBB 3IETB 3RNQA 1HHGB 3OG6B 1T1XB 3IJHB 1NCDL 2A6KA 2FCBA 3LS4H 5E95B 1EGJL 1E4WH 2J8OA 3AMLA 3RNQB 4CN1A 2BCKA 5DZOA 3RL2A 3LHPL 1NQBA 3CJJA 4R4FH 3T0BA 5C0NC 2A6KB 3SJVE 3VD5A 1OB1A 2AABL 3WHXB 5LXGH 1GGBH 2VN4A 5EZIL 5I1HL 2BCKB 1EVTC 3RL2B 3QRGH 4IIQA 4G42A 1P4BH 1J18A 1HINL 5I1IH 1OB1B 3C08H 2G60H 4U1JA 1SBBA 1A6AA 4YGVA 3SE9H 3GSXA 4PJEE 4GRLC 4V1DA 4OZHA 5GZND 4OCYH 5DGRA 4D2NA 4PB0H 5AG9A 3EHBC 3KG5A 2ESVB 4G42B 2VLJE 4IIQB 4U6VL 2Q3ZA 4DW2H 5J1SC 4Z7WA 3ZHKA 5H94A 5A2IH 4PRIA 1QPPA 4U1JB 5DJAA 5C0AD 4YGVB 1A6AB 3TESA 1JHLL 1BJ1J 2IBBA 3GSXB 3CUPA 4V1DB 3JWNC 4OZHB 3T8XB 2BNRA 4CDGC 3MA9H 2CKBA 4OFYA 1FAIL 3KLAB 4M6NL 2A73B 4BA8A 1JNLL 4Z7WB 5H94B 4MA7L 4PRIB 1CDGA 5IESH 2NYYC 1RZFL 2J4WL 3CUPB 3O6ML 2BNRB 5AWNL 1ZA3A 2CKBB 4HEPG 3BPOC 2FZ3A 4MA1C 2OMNA 5B3NA 1ZGLP 3GMPA 3V79C 2FH6A 3IDXH 4BK4A 5DFWH 1U3HA 5L0QB 2CR6A 4KHXL 5CWSA 5MENE 2IQ9L 3HG1E 2CGRH 1MY5A 1ZA3B 4YHML 4GG6F 3MYZA 5HGAA 3EYUL 2FZ3B 1JN6A 4BZYA 1MJ7L 2VR9A 4M43L 4RFEA 4UDTA 5DD3L 1TITA 1S78C 2P49B 1KIPA 4NO0D 3A6BL 1U3HB 4IMLA 2WP3O 5CWSB 2IF7A 5L8KB 5HGAB 1JN6B 5CFHA 4RFEB 3E8UH 4UDTB 2JJSA 5KSBB 1KIPB 2NXYD 3U2SA 4WWID 2E9WA 2UY7A 4TUKH 2WAHA 2Y7QB 2EIZA 3UEZA 4RFNC 4E42A 3Q6GL 1KFAL 4FQJH 3ZTJG 3AUVA 3ILPA 3MXVL 3BQUA 5BQ7A 3D6GA 2CQVA 2VL4A 3DARA 3U2SB 4S1SL 3TVMC 1U95A 1JHTA 1G7PA 5DTFA 2EIZB 2WP3T 5CEXA 3BVNA 4E42B 4GAJH 4X4MA 3VU2A 1TTGA 4Y5YA 3GHBH 5BQ7B 3BQUB 5F7NC 4E5XA 1U95B 1JHTB 1G7PB 1G9NL 3H8NA 5DTFB 3TBTA 5J12B 2DTMH 5CEXB 4LEXH 3BVNB 4R4ND 5JW4R 4W6YB 2OCFD 4QRRE 5CSGA 1RY7B 4G8GA 2R2BA 5J13C 5EIQA 4Y5YB 1HCVA 1NFDE 1QSZA 4QOKD 4E5XB 5T3ZH 4E9LA 3D87B 3TBTB 4DZBA 1E4WL 5C0EA 1AGEA 3IGAA 4KKLC 4MXVF 1XGTA 2IAMA 5TDNA 2R2BB 3ULVD 1UM5H 5E1HB 4DKDC 4Y19A 5DK3A 1OLLA 4ERSH 3RI5F 4DZBB 5CILH 3P4NA 5C0EB 2RHEA 5IV2A 4JFZH 5CP3H 4JFEE 1XGTB 2IAMB 1FH5L 3ZTNH 5TDNB 1P4BL 4G7VH 1RUMH 4Y19B 3KPRA 4XAKD 1S3KH 5I1IL 3EOYG 3C08L 3SE9L 4G8FA 1PZ5A 3P4NB 4O2FA 4X4XA 5IV2B 1MI5A 5DEZA 3KPNB 4KK8D 4F9LA 3RY6A 3KPRB 4DW2L 3U4AA 4G5ZH 1EFQA 1CF8H 4G8FB 1PZ5B 1QYGH 3NIGE 4O2FB 2COQA 1NDGA 4I9WE 2WIIA 4G3YH 1MI5B 3QRFM 2F5AH 2CXKA 2ZCKL 3ME0A 4HK3N 2CMRH 4BFGA 5IB1B 1FFPA 4NO2A 3EGSA 2ICES 2BMKA 4PREA 4QRSA 4RDQG 1NDGB 1IGYA 2WIIB 3VFPA 1JTPA 2D9CA 5DMYA 3RKDD 1FNHA 2Y06H 4JG0H 1NL0L 3ZO0A 2HA1A 5DMGC 1FFPB 4NO2B 3QIWA 3EGSB 3FO9A 2APTA 2BMKB 4PREB 4QRSB 3HAEG 4LF3A 1BHGA 1JYWA 1IGYB 1OSPH 3VFPB 5EU7E 2FNBA 2CGRL 3GMQA 4JHWH 4WI9A 5ADPH 3LQAC 3H9SB 3QIWB 4Q6IA 3FO9B 3GEWB 3V6ZA 5IJKA 5I8EA 4LF3B 1ND0A 5DZNA 1OGAE 4HBCH 3GMQB 4EQ2A 2DQGL 3K4ZA 1I9IH 3ROLA 1TJGL 4B53A 4YDKL 1YEIH 3GRWH 3E8UL 1DQDH 4WVRA 4ZFGH 2ARJA 4Q6IB 5HVWA 1GAFH 3V6ZB 5I8EB 5T33L 1ND0B 1ZHNA 1J0YA 2JKXA 3HE7A 4MVBC 1JTTA 3DOSA 4FQJL 4OLZL 4GW1A 4HGWA 3ROLB 1V5JA 4YDLC 5IOPA 3ES6A 4NJ9H 3PWNA 2FHCA 2VLRD 1G9MH 1T0PB 1ZHNB 3HE7B 4XP1H 4GAJL 1OP5H 3P9MA 4GW1B 4HGWB 4QRPE 4ZUTA 3NACH 3BHBA 5IOPB 3C9NB 3ES6B 4X6DF 4TPRL 4YWGH 2DTML 5EZJA 4OD3H 1JV5A 2X1PA 3DVNA 4NOFA 3RVXD 4WFGE 4NZTL 4GBXA 4HWBH 4ZUTB 2ZSWA 3ZDXF 1E4XI 2FDBP 2YS4A 3C5SB 5F96H 4YUEH 5T3ZL 1UC6A 3IDNA 3DWTA 2B5IC 5EZJB 1JV5B 1NCCL 3FFCE 3DVNB 4YDIL 5TE6H 4S1QH 4P46C 3HCVA 1LP9E 3ISWA 4GBXB 2PYEA 2X6MA 2ZSWB 2WZPD 1PSKH 3CLEL 2HFGH 1KCUH 2QHRH 4QHUA 3RQ3A 2C1PB 4M7LL 4JZNA 4ERSL 1NEUA 3IDNB 5E8PA 3W82A 5CILL 5ELIA 2X41A 1RPQA 4JFZL 1CCZA 2A1WL 3HCVB 3O6LL 2PYEB 2YRZA 4UNTA 5E4IA 4QHUB 4JZNB 1VADA 2OL3H 1X9QA 2EDFA 5E8PB 2W38A 1I3RA 2BC4A 3QQ3A 4KTEH 4NQUA 2NY5L 2FSEA 4LP5A 3EYSL 1F45A 1WTLA 1CF8L 1OAXH 4RGND 1VADB 1PX3A 1QA9A 5AZ2H 2HTLD 2GTZA 1I3RB 4G3YL 2BC4B 2ZCHH 2F5AL 3QQ3B 1HYSD 1JZ5A 5E5UB 2NY6C 4LKCA 2CMRL 4CW1A 2ZJSH 3ZDYF 4ZUSA 4NBZB 1QA9B 2GTZB 1YYMH 4OQTA 5HHOE 4V2CB 3SGEH 4EN3D 4Y4HD 2FLRT 5DRXA 2Y06L 4WUKH 4JG0L 4LKCB 2VLKD 4XI5C 2EDHA 1DJSA 3LDBB 3WIIL 4NJAL 3ARDC 2X10A 4ZUSB 1FLTX 2R1WA 1I4FA 2CJUH 1YPZF 1MCSA 1OAKL 2NXZD 1OSPL 1NAMA 3MCG1 4JHWL 5L6YH 1T89C 2XKSA 4C59B 1YNLL 5DRXB 5IG7A 3CU7A 3K4DA 4RGMC 4UOJA 2DS4A 2R1WB 2GJ6D 1I4FB 3EOTH 4YHYC 1MCRA 1UM4H 2CRZA 4MD0A 4L9LA 1Z0NA 3AM8A 1NAMB 4HBCL 4NO5A 1JPGA 3CH1A 2FO1A 4A2LA 5IG7B 1I9IL 1YEIL 3GRWL 2EE3A 3O0RH 3OB0K 2E6QA 3MLVH 1GAFL 5EPMA 3H9HB 2KH2B 4JFYA 4MD0B 4L9LB 3BP6A 3EYOA 2JTDA 1SJVA 4X7DC 1GGUA 1OLZA 4N0FA 4NO5B 1CL7H 1JPGB 1UADC 2XWJA 3CH1B 5CEYB 5IBLD 3BYYA 2DI9A 3DX8A 1F00I 5JNYB 2X2YA 1KT2A 5EPMB 4HUUA 3ULUE 2YXFA 4F15B 4JFYB 2XTJB 4Y4FA 5D7SL 3EYOB 4OFIA 4DKEH 4N0FB 1OP5K 2XWJB 3W81A 3VXUE 3VG0H 3DX8B 1OTTD 3OBAA 3UYOD 4ZYKA 1KT2B 5KTEH 4HUUB 4LCIH 1J1OH 5C86A 1F4AA 3QUML 4OLYL 4Y4FB 5SV3A 2H45A 1LK3H 5E8NA 4LNRA 1Y6MR 4X8JA 5C70A 1RIVH 2WWMC 2ESVD 3O9WA 4ZYKB 3SDXF 4O9HH 5JZ7D 4YUEL 1UB5B 2YUXA 4OFVA 4NN5B 2C5DC 1MHCB 3EDEA 1HKLH 5TE6L 4LNRB 4V1DD 3BDBA 1NEZA 5JXEC 1OD7A 4F2MA 4X8JB 1KJ2H 4XHJD 2QHRL 4FQ2H 4RZCA 4XPHL 4HC1L 5CJBA 1P9MC 4PRID 1NKOA 3RU8H 2GJJA 1NEZB 4LSPH 3RWHA 2BNRD 4F2MB 1NLDL 5T1DH 4OFYD 1T1ZA 4RZCB 4LSRL 2OL3L 1YYLH 2UUDK 4BSWA 5FEBA 1H3VA 3MV9B 3AY4A 3RWHB 4KTEL 1ZVHA 3S5LG 2N4IA 3MLSH 1AD0A 1ZGLB 1T1ZB 3T09A 9CGTA 5AZ2L 2DIJA 1U3HD 3PE9A 1KIUA 4NN6C 4ODVH 1XAUA 3KS0J 3EFFA 2ZJSL 4PJAA 2ZOLA 1YYML 3RVUD 4WEBH 3VFTA 1FC1A 1TDQA 4P3CH 1FVCA 1EHAA 1EGJA 2YUZA 4P5KA 3EFFB 4PJAB 4EJ1C 2ZOLB 4X7CC 2CJUL 2BVPA 3NFPA 4P9HC 2CLZA 4QRUA 2DQJH 2JJTC 3FB7B 4ZO8A 1A9BA 1YQVL 3VFTB 1RAMA 3MRHA 1FVCB 3BZ4A 4P5KB 2X89A 5CGTA 3KLHC 3BQUD 3NFPB 2BVPB 3FRPA 2CLZB 1U93A 4QRUB 3T0EE 1R3JA 4KXZH 3PF2A 1A9BB 2ADFL 4PG2C 4OFKA 3G6DH 1UKSA 3D18A 3E1F1 3BZ4B 3MBEC 3K8KA 4GG6E 2Y5TA 4Z76A 1ZGLM 1WGOA 1VENA 4LLVA 1AKJA 1U93B 1UWEH 4UT9L 1R3JB 2ED7A 2V7NA 3K1DA 5CBEB 1PY4A 1WISA 2ERJB 3I6KB 3BN3B 3MLUH 1CL7L 3BDYH 3SCMA 1K5NA 5CJXA 4PJCE 2Y5TB 5IHLB 1MREH 4Z76B 2NR6D 4LLVB 1AKJB 2OX5A 5D1XB 4OIIH 2J6EL 3TYGL 4DKEL 5DJ6A 3SCMB 1K5NB 2IAMD 4PB9H 5KTEL 3OPZL 4Y19D 2HH0H 4LCIL 1JF5A 2B1HL 4F9PA 2BNUA 4PUBL 5D96B 3KGRA 1EZVY 5DJ6B 4NN7C 4UZGA 4MNGE 3H6JA 4XNZB 2X1OA 3QUZC 4J3WA 3IDYC 3KPRD 2Y07H 2BNUB 4FZEH 4QTIL 3MSPA 4LIQH 1HKLL 2X7LB 1S7XA 1RHHA 5IIEB 3NCYS 1YN6B 2EH7H 3LQZA 4FQ2L 1CWVA 1RZKH 1YJDH 3SE8H 5MHSD 3LV3A 3RU8L 3VXPA 3P30L 4N8VG 4K7FA 4LHQB 1CFTA 1D9KD 1U8LA 1RHHB 3D3VE 3NBNA 5T1DL 4MXVE 3FQTA 3RDTA 3LQZB 5DJCA 2O26U 4UTBH 1B4JL 3LV3B 4ZAKC 1YYLL 4Y88A 1F6LL 4K7FB 1CFTB 2NY1B 3LKOA 1U8LB 1Y6NR 2W0KA 4J4PA 1UCBL 4M7JL 1KCLA 3MLSL 3FQTB 2Z8VC 3H9SD 4LSQH 5DJCB 1JZ8A 1IAIH 4XRCA 3QIWD 4RAVB 2A83A 3KPPA 4P5TC 4X9IA 3LKOB 4ODVL 3S37L 4Y2DA 2NW2A 3BZFB 4OGYH 1GH7A 2X70A 4KK5C 4XRCB 5BVPH 1OHQA 2HKHH 4H26B 1V7MH 2A83B 4WEBL 3KPPB 2PTVA 1S9WA 2VJXA 4TULH 4Y2DB 2NW2B 5B39A 1IZKA 4PBXA 1FZJA 3RGVB 5KS9A 2X70B 3HE6C 1SEBA 3MV01 1FAKT 1CDJA 4KROB 4MDIA 4KRLB 3HAEH 1X6LA 2DQJL 1TETH 1TFHA 1WFNA 2KPNA 2AJ3A 3WSQH 2WWKT 3HE7D 1S9WB 3ARZA 5B39B 4HKBA 1FZJB 5KS9B 3LN5A 1SEBB 5J1AA 4MDIB 2E5EA 2KL6A 4GXVH 1QSEE 2AJ3B 3ZT7A 3QXDA 3UO1H 4KJQD 4DVRH 3G6DL 3JWDH 2GIYA 3KPTA 2MWCA 3G08A 1NMCC 1R5IB 1KTDA 4HKBB 4CVWA 3LN5B 4Z7VF 5D7KD 2VDPH 1B0WA 1L9MA 1MAKA 5E24E 1WT5A 3MLUL 1J05A 3BDYL 3QXDB 5JQHC 5ANME 3F7QA 3G08B 5C2UB 4FQXA 1Z2KA 3T08A 1YC8A 1KTDB 3BZEA 4WW2A 4G6AC 3CFCL 5E2UH 2JIXA 4GBXD 1MREL 4DFHA 1U3JA 3GKWL 3OMZA 5D2LA 3X13B 5DJDA 4PR5B 4OF3A 1J05B 3MGTA 3GJFK 1I9JL 4FHBD 4FQXB 4D9QE 3QI9C 4W68A 3BZEB 1M7IA 4JY5H 2JIXB 1QG3A 4O5LL 4M48H 2PYED 4PTTA 4AT6A 3CFJB 4WI3A 3QJFA 5D2LB 5FUCC 5DJDB 1XR9A 4KVCL 4IDLA 3RZWA 5CLTA 1XGRA 5DFTA 2BXYA 5DURB 5JW4Q 1MFEL 1OT2A 3BUTA 2FH8A 3MGTB 4X5WA 4YQXH 4K2UH 1M7IB 4OFPA 1JNJA 4FFWD 4AT6B 4PTTB 2NY7H 3I84A 3QJFB 2P24A 1ODAA 4X9FA 1XR9B 4OLUL 4ZD3H 1XGRB 2VWEE 2D9QB 5DRWA 4X5WB 1WBXA 1N5YH 1WSST 4IOFC 1DP0A 2EH7L 4HS8H 2FBJL 3P4MA 1RZKL 1YJDL 5IFHH 2QR0A 5HI3C 2P24B 3SBWC 3T4YA 2BZDA 4JKWA 1M4KA 1ZMYA 1WBXB 1U91A 4LAQH 1U41A 3LD8B 1XIWA 5HYSG 3P4MB 3TLRA 2W0PA 2QR0B 4LHUA 3T4YB 5FK9A 4QTHA 3L5JA 3QNXA 1KN4H 4DZ8A 1U91B 3BD3A 4OD1H 3WV0A 2P7TA 1XIWB 4JFQB 1L4IA 1IZJA 1IAIL 1GC1C 1ZLWH 1KGCE 5IB3A 4LHUB 4E41E 5FK9B 4QTHB 1NMBH 3QEHA 1KCKA 4DZ8B 2P7TB 3Q3GA 4OGYL 1MCFA 2IPTL 2WIMA 4OIAA 2VLME 5GGVH 1MCWW 5IB3B 5BVPL 1FLRH 3ESVF 1V7ML 1OP3H 3D9AH 4M1GL 3QEHB 2VQ1A 1A3RH 4X98A 3SKOA 1B0GA 1H3XA 1QZ1A 3BGFC 3BSZL 3U0WH 2DQUH 2K3TA 4LCWB 2R8SL 1CYGA 5GHWH 4JRYE 3PP3K 3ZDYE 1HE7A 3JZ7A 5LGHL 1A7PL 3REWA 2XTJD 4ONOA 4R96A 3TH2T 4BH7A 5A43C 1ZS8A 4X98B 3SKOB 1B0GB 2GSGA 2D03H 3EJZC 4NUGH 1EH9A 4ODTH 5CP3A 4ZUWA 1CK0H 2VXUH 4R26H 1MCOL 4MAYD 5FGRA 1OL0A 1RIUL 3REWB 4Y4FD 4R96B 1BLNA 4BH7B 4DVRL 1ZS8B 1KCVH 2GSGB 3DIFA 2ARWA 5DUBA 1PX4A 4ZUWB 2VDPL 4JVWA 4YHKL 3F6IA 1MIML 1BLNB 3FJTA 3VXMA 5HYFA 5JOEA 2OMBA 2EYTA 3DIFB 2ZUYA 5DUBB 5F9WC 3HNTH 3CX5K 3F6LA 5JUEH 2ZG2A 1QFUH 1H5BA 4JY5L 2NXYC 1CLYH 3ZT6A 4P3DB 4DGVH 4HXBH 5LKNA 1G0YR 4O51A 5LBSL 4AY0A 1KBGL 1RZJH 3WFBL 4YQXL 1Q8MA 3MV9D 4Z0BH 1H5BB 4S0TD 7FABH 1KJMA 3ZE0F 2R23A 2WLZA 4M1DH 1P7HL 1G7QA 1U3YA 4OZFH 4M9PA 4O51B 3CZJA 1F13A 2P46B 1N5YL 1KJMB 3OAZH 3QWOA 4HS8L 2R23B 2VOTA 5MI0C 3UDWC 4GRMA 1CU4H 1G7QB 3PP4L 5L88H 3SDXE 4C4KT 5IFAH 2EYRA 2V2TA 4LRIA 1T66D 3NFSL 5CKAA 3OR6A 2NY4C 1JYVA 3QWOB 1HOCA 4DJMA 2V9TA 5KSAC 4D0BA 2EYRB 3ULVC 2V2TB 4KKBC 4NZDA 2X05A 4OD1L 4LEOA 3OR6B 4U6TA 1HOCB 1LNUA 4XVUC 4W4NA 1ZLWK 1BAFL 1QRKA 2VLJA 3HPLA 1ZLUH 4D0BB 1J12A 3Q6FA 5FV2A 3BOVA 4X7TA 4LEOB 5B8CC 1VFAA 4IMKA 4PJEB 4XTRC 5DMIH 3LEYH 1LNUB 2I5YH 1ZANH 2NZ9D 2X89D 4X99A 4QGTA 3HPLB 2VLJB 3JTTA 4IJ3B 3F8UB 3Q6FB 4HWBA 1OP3K 4WCYH 3D9AL 4KK8C 4X7TB 1A3RL 3NOIA 1VFAB 3U0WL 2ZUQB 1I7TA 4PJDA 2DQUL 3UBXG 5EOCJ 4KRMB 3C6LB 4X99B 1KLFA 3JTTB 5HD8D 1AKJD 3SGEI 3QQNA 5D1XD 1JPSL 3RVVC 5BRZE 4QRTA 3K2MC 3BE1L 5I1EH 2EIDA 4RSVA 5GISL 3SCMD 2D03L 3DSFL 1I7TB 4PJDB 4NUGL 4ODTL 2YPVH 5JIKA 4M02A 4HH8A 1Y0LB 4R26L 2I24N 3C60C 3TBYA 2BJMH 4QRTB 4BKLA 3X3FH 2OL3A 2OJEA 1FBIH 3TNMA 2V5MA 3TBYB 3ARFC 4BKLB 4F7EA 3LKSA 3CSPA 3QNYB 4DTGH 4KJYA 3QCTH 4EVNA 3G9VA 2OL3B 2XT1B 4DKFH 1F5WA 2OJEB 3VH8G 1MVFA 3TNMB 4HT1H 2AVGA 4DQOH 3SDAA 1G7HA 3A6CL 4HWEH 4OZIF 3QQ9D 1CL7I 3MPCA 5B21A 2ICEA 3RI5K 1AD9B 3LKSB 4KJYB 5L7XH 4EVNB 4YPJA 1WBZA 1CLYL 2Q3AA 3SDAB 4DGVL 1G7HB 4HXBL 5AYUH 4XXCC 2ICEB 3K46A 5F3HA 4W81A 1RZJL 2QQLH 5EBLA 4OF0A 3QEQE 1WBZB 2NY1D 1KXVC 5IMMA 4M1DL 1T7YA 4L3EA 1W72A 3D39A 4MJ4A 1NGXA 5F3HB 3VI3F 3E2HC 1XZ0A 1HNGA 4FMKA 2AJYH 5EBLB 1S9YA 2EE2A 3NFNA 1JP5A 5TF1H 5IMMB 1DFBH 3OAZK 3SKNA 1XGUA 1A21A 4LLQA 2DICA 5J6HA 3F7VA 5L88L 4L3EB 4M3KB 1QUNA 4KUZL 5DVLA 5IFAL 1NGXB 6CGTA 1CDHA 4PGZA 1XZ0B 1NFIB 3DRQA 1S9YB 3NFNB 5EO1A 5DDHA 3LH2H 3C8DA 3AREC 4CVXA 1ERNA 4XPTH 4Y2DD 5F9DC 3QFDA 3SKNB 1RV6X 1XGUB 4LLQB 2FGZA 3RGVD 3F7VB 5J6HB 4PD4K 2JCCA 3NA9H 3AB0B 4KROD 4WTWA 1I7ZA 4JKLA 1I1AB 1IC7H 3DRQB 1HSBA 3SO3B 4OBSA 5EO1B 5DDHB 4CVXB 4EXKA 4OCMC 3T3MF 3FQUA 1Z6JT 5ITBH 2H8PA 5EUKB 1JBJA 5BMFH 2JCCB 1VSCA 1ZLUK 1I7ZB 3TYFA 2FL5A 1HSBB 4OM0H 4M1CC 5DMIL 5CD5D 3LEYL 3WO4C 4ETYA 3VRLF 4RRPG 3FQUB 2H8PB 2W59A 1DANT 5CAYB 5M95B 3IKKA 1X5XA 3PWPA 4WCYL 3TYFB 1CTOA 2FL5B 4BJLA 4D0CA 1E0OB 5GJSH 1XGPA 1J9CT 2DI8A 5HVFB 5FXCH 1WEJL 2V5SA 1DE4A 2D2OA 3PWPB 2H1PH 5DT1H 2YWZA 3V8OA 3JWOC 1KJ2A 3HZYA 5IB4A 4HH9B 4D0CB 5I1EL 1XGPB 2P5EA 2VISA 4KJPD 2PXYB 1ZKAA 2HRLA 4FQXD 4APQA 4HXAH 1ZV5A 4JZJC 2YPVL 3MRFA 2JIXD 5EIIA 1E27A 1DE4B 2QV2A 2F58H 5D1ZC 3U83A 4M6OH 1M1SA 2IC2A 1KJ2B 3HZYB 5IB4B 5HBBA 3X3FL 2HJFA 3R1GL 2A38A 5DURD 4PGCA 2P5EB 4Q9BA 5FM4A 1QKZH 2VZ1A 1IFHH 4PJ5E 1FBIL 4APQB 1NMAH 3MRFB 1E4JA 2DQCH 1E27B 5EIIB 5IEHA 3L6FA 4KXZI 1DBJH 2HYMA 2OR7A 3MJ7A 5D93C 4OZHF 3QXUA 2EDLA 1DQQA 4K94H 1B0RA 4LVOC 3CH8A 4MA3A 4XPFL 1EFXA 2HJFB 3RX5A 1CI5A 3IU4L 4DTGL 3QCTL 4Z7WF 4S1RH 2NTFA 3RPKA 3BAEL 1EZVX 2B7DT 5ACLA 4PLKD 3V0AC 1OGAB 3GMNA 4HT1L 5IEHB 3L6FB 4FA8A 4HWEL 3RIFF 1FDLL 3MJ7B 4OGAD 2V7HA 4Z7VE 1DQQB 1B0RB 1G7JA 3EDKA 1ROWA 3TPUA 1UJ3C 4UBDC 5CCKL 5JQ6H 1OAZH 2NTFB 1YNTA 3G5ZA 1SEQH 5DA4A 3G5VA 2NPLX 1RHFA 3BP7B 3GMNB 1OTUD 4UU9A 4AEIH 2MKWA 2V7HB 5ADOL 4KDTA 5HHPA 1G7JB 3FHQA 3TPUB 3LRHA 1I1FA 1KPUA 2QQLL 4PD4J 3OSKA 3ALPA 1NCAH 1YNTB 3G5ZB 1XIWD 3G5VB 4UU9B 4LDEB 3H2WA 3QXWA 4N0YH 4PJXA 4QRPB 5HHPB 3OJVC 4NCC2 4LHUD 5FYKH 3W5MA 1KPUB 5GRXG 2AJYL 4FQQB 35C8H 1BVZA 3S7GA 1OTSC 4M8QA 1P69B 5TF1L 1HHIA 4L8BA 5C0AE 4NM4H 4PJXB 5DFVD 3AS3A 5ACZA 2ZOKA 2IH1A 2FRGP 2BFVL 4M8QB 5IHUH 3LH2L 4XPTL 1HHIB 3R8QA 1NC2A 4LCWD 3GMRA 4EEEA 3WLWC 5ACZB 1CVSC 2ZOKB 2HN7A 1PEWA 2IH1B 4QGYA 1A14H 4RQQA 1UH2A 2A0LC 1I7UA 5T3ZD 2VZVA 3BD5A 5ITBL 4X7EC 1NC2B 5BMFL 1QBLH 1A7BA 3GMRB 3FHAA 4Y2OA 5J57B 3SDDA 1IJ9A 3BD4A 2HN7B 2DL9A 4OM0L 3JBG7 5C0DA 5E08H 5MEPA 3TGXA 3ARRA 4RQQB 5HHXL 5I75B 1IAII 4X8XA 4J8RA 1I7UB 1NGWA 4P23C 1AO7E 1EJOL 4IRSC 2PF6A 3BGMA 5L0QC 4QRQA 5KVEH 3QIUA 3BIAX 3SDDB 2C3WA 2VDQH 1V3KA 1FO0L 5FYJH 4B5EA 1OGTA 5C0DB 3LQMA 3K81A 5GJSL 5MEPB 1KEGL 2DMKA 1I8LC 4J8RB 1MPAH 4AJ0A 1NGWB 2Z8SA 2CUMA 2H1PL 3BGMB 5DT1L 4NZUL 1PY9A 4QRQB 3QIUB 2UZYB 5EA0H 5JHDE 1OGTB 2A6DA 5I2IB 1YEKH 5BO1L 4PP1C 1BIIA 1FYTA 5D9SA 4MJ5A 4HXAL 3I2CH 4PJGA 3RVUC 4PLJD 4HUKB 1H8NA 2O61A 2FIRT 2F58L 4M6OL 4JLRA 4J2XA 2A6DB 4XP6H 3OL2A 3MROA 1BIIB 1C16A 5D9SB 4MJ5B 4PJGB 2O61B 3OR7A 1DBJL 3ZSSA 4K7PY 5JW4N 4JLRB 4JFHD 3LAFA 3WDHA 2IWGA 2LV4A 1CE1L 4PJ8C 3MROB 5DD0H 2WINA 1C16B 5JDJA 1KPVA 2WUBH 2R69H 1A6ZA 3GDBA 4QOKE 4YHOH 2BHZA 3RY4A 3QHFH 1U92A 2X4QA 1OAZL 3OAYH 4KKAC 3UTTA 4L4TA 2UWEA 2WINB 4KKCD 5JHLL 1SEQL 1KELH 1KPVB 1A6ZB 5SWZA 4HJ0D 4YC2C 2E6PA 3S96A 1U92B 4JM2A 5DWUL 2X4QB 5CJ5A 5CUSH 3BO8A 2BRQA 2CRYA 1NCAL 4K3JH 3UTTB 4L4TB 2UWEB 2NR6C 3HAEA 2F8OA 3OG4B 5SWZB 4YXKH 4OI7A 5JR1H 1C1EH 3H3KA 4FNLH 3S96B 4JM2B 4PJBA 2EZ0D 3BO8B 4JANA 4UT6H 1VFOA 35C8L 5IROC 3HAEB 5EULV 5FO8A 4NM4L 3OKYA 3ZE0E 2D0GA 2VLJD 5I1LA 4JANB 4JHBA 3GB7A 2OK0H 5JMRA 2FATH 1J87A 1VGKA 3KNBA 5A2FA 5FO8B 3ROOB 5TE7L 5JDSA 4FG6C 4R0LA 3B9DA 3NIDF 3WKMH 3C6LD 3VE0A 5GZOD 5I1LB 1HQ4A 3VXOA 2XNAA 4P48A 4P4KC 2G75A 5GXBB 4JDZA 5F88A 4CJ1A 1WCBA 3QAZC 4MAUL 3UROR 1VGKB 3KNBB 1IAIM 4GMSL 3VXSA 2G2RA 4KI1A 2IGFH 4L5FH 5JDSB 4R0LB 1I1RA 4U1LA 5CS7A 3VE0B 1D9KC 3MV7A 4Z77A 1GGCH 4WNQA 1HQ4B 2XNAB 5F88B 3O3UN 3QZWA 5DGQA 1WCBB 3NAAH 2DQFA 3VXSB 2G2RB 1BEYL 1WLHA 1W0VB 3WUWA 4PJFE 2DJ4A 3W39A 4ENEC 4U1LB 4J6RH 3D69A 3MV7B 4Z77B 4WNQB 2D4DA 5FYJL 5C0FA 4K8RC 2HT4C 4Q58C 1XCTA 3QZWB 4XBEL 2DQFB 3WUWB 2DLIA 3DVIA 1T5WA 2WBJC 3W39B 3K8LA 1HKFA 2VH5L 3KJ4B 4RMQA 3D69B 2DM3A 2YD2A 1A3QA 3B43A 5CHNA 5C0FB 3NCFB 5E2JA 4DGIH 1XCTB 1IGCL 5DXWA 1W8NA 1YEKL 1TPXB 2O93L 1NBVH 4NC1C 2DQHH 4MSWA 1F8TH 1T5WB 4ALAH 4Y1AA 2VLRE 3FMGH 2MKLC 3SDAD 4GUPA 4YAQA 3CLFL 5CHNB 1TIUA 4BQ8A 5MP6L 5HHVH 3O6FA 4HLJA 4M61A 4KRPB 3MGAA 1DN2A 1JGUL 2R56H 2BNQA 2YD4A 4MSWB 4LSTH 4Y1AB 4PY8J 2VR5A 4GUPB 3HE7C 4YAQB 3B9KA 1AXSA 4FFZH 3N0PB 3O6FB 3MRJA 5DD0L 2RQ8A 2BNQB 4QO1A 2WUBL 3S35H 3TP4A 5TH2A 2R69L 3ZKQD 2EDBA 5C8JA 4XWGH 4BQBA 3QHFL 2ICWJ 1S7TA 4OKDA 1TMCB 3IT8D 3B9KB 2HLFC 4L3ED 1AXSB 4QCIA 5F3BA 4GG6B 1MFAH 3MRKB 4TOYH 3W5NA 4X6EA 5TH2B 4JPWH 2Z8RA 5D2NC 3I9GL 2XY1A 5C8JB 4N1HB 4HPYH 4ZTPH 1S7TB 5D1QA 1VFBA 1R0AH 1FFNA 4QCIB 5F3BB 3TT1H 5CUSL 3MNWB 3VGEA 12E8H 5EO0A 3KYMA 4HUXA 3OJDA 4K3JL 2EE6A 1I1AD 4X6EB 4O2EA 3O2DL 1DLHA 2D7TL 5DJ8A 5DVNA 2ZUWA 5C0BA 5JR1L 1C1EL 1KB5H 1VFBB 2G5RA 4FNLL 1FFNB 5D1QB 5TQ2H 5DC0A 4JG1H 3UTPD 5GGVY 4DEPB 4UT6L 5EO0B 1KYOJ 3KYMB 1QO3A 3OJDB 4O2EB 1DLHB 5DJ8B 4RGNE 1J10A 3IVKA 5C0BB 1YMHA 2DWEA 5F89A 3BN9D 2OK0L 4N1EA 1QO3B 5CZXD 3TNNA 4C57C 1P6FA 3H3PH 4FFWC 3VI3E 2FATL 4FZ8H 1INDL 2E8YA 3AC0A 4N0UE 3KPOA 3CGTA 4I9WD 4ODSL 4OCNC 3IVKB 3RZCA 3VGHA 5IR1A 3WKML 3VGAC 1YMHB 3PWPD 4WFED 3RWEA 2DWEB 4HG4K 5F89B 4Y5XA 2F53E 3TNNB 5C1MB 1JZ2A 2VLKE 1F90H 4KQ3H 1I1CA 3KPOB 2PXYD 4B50A 2PO6A 2IGFL 4JPKH 3RZCB 3SOBL 5KBNC 5IR1B 4KKNA 1UQSA 1R3KA 1ZT4A 5E8EA 4MJ6A 3D5OF 3RWEB 1GGCL 4Y5XB 1KEML 4CJ0A 2P5ED 4Z7NF 4M5ZH 4OGZA 2GJ6E 4APQD 1UQSB 1R3KB 1ZT4B 1CGTA 4J6RL 3T3ME 3IB4A 1P84K 1BQSA 1TVHA 5KW9H 1NCWL 4OZFA 2XXMB 1NC4A 1W2KT 4GRWH 4XMKL 2DB8A 1BOGA 2AJVL 1LO0L 3VA2C 1OGAD 3IJYA 3L7EA 43C9A 1EBPA 3SKMA 4GQ9H 1LILA 5A3IC 4GW5A 4DGIL 2ID5A 1TVHB 4J3OC 3CC5A 2CRMA 4OCRL 1DCLA 4OZFB 1NC4B 4XVTH 1F8TL 3OX8A 4ALAL 1A4KA 2DQEH 3IJYB 4TNVF 3CFDA 3L7EB 43C9B 5I1KH 3X12B 3SKMB 2DDQH 1T2JA 4GW5B 4WW1A 5C0CA 1BD2E 2XZZA 5HHVL 5H2BA 3CC5B 3P0YH 4M7KH 4I77H 4BSJA 4BFIB 1A4KB 1NANH 4A6YH 5I30H 2AEIT 3WJJC 4FFZL 4QRPD 4WW1B 5C0CB 5DQ9B 4NM8H 1RJYB 5E6YA 4JFXB 3ALXA 4X83A 4MAYC 3QUXC 3BT2H 5FYLE 4XWGL 5D6CA 5A16B 1NCNA 1I9RH 4H1LH 4V1DE 4OZHE 4MZ2A 4TOYL 2VYRE 4PJAF 3V6OA 1OARL 4JPWL 5DEGA 2GQHA 4Z7WE 2DRUA 5I8KH 4PRIE 5D7IA 5D6CB 3VRIA 5KAQG 1FL6A 2YKLL 4FQLH 4WI8A 2BNRE 12E8L 3IS0X 3Q48A 4K9EC 5F7LB 4U49A 2P5WA 4OCWH 5DEGB 2C7UA 5D7IB 5DUPH 1NC2D 3W2DH 4P2RA 5INDA 4JG1L 2EECA 1CGSL 1FL6B 3L3KA 1IBGH 1DVFA 4XP5H 1TQBB 4FN0A 4NT6A 2P5WB 4AQ1B 3HNSH 1YEDB 2C7UB 4X6DA 3MUGA 3MZTA 4JHAH 3ARGA 4P2RB 5M7QA 5INDB 4WRLA 3L3KB 5DHYA 5H37G 1DVFB 2H2PC 5E7BA 3SDDD 5CGMA 3H3PL 3TJEH 3EYQD 3SDCC 3TO4C 4MS8C 4NT6B 1P84J 3LKRA 1RULH 4X6DB 3MUGB 3ARGB 4LQFH 3P0VH 4R8WH 2R29H 3QIUD 2W07A 1SJEA 1S9VB 1F90L 3LKRB 4P2YA 5HHOD 4JPKL 2EXWD 1MCWM 3HZVB 1T66C 1L9NA 5GRJL 1S7SA 2WLYA 1Q9KA 4YIQA 2R2EA 1SJEB 5FGSA 5D5MF 3BH9A 3QJHA 4POUB 4M5ZL 4QXUL 3CU1A 4R4BA 4DAGH 2A77L 1CLOL 2FJHA 5ALCH 2FJFA 1S7SB 3Q5OA 3JUYA 5T5NF 1Q9KB 2R2EB 4X4ME 1M6OA 3BH9B 3PHOA 3QJHB 4R4BB 1ULVA 1ZEAH 2FJHB 4XVJH 2FJFB 4NFDA 3KR3H 4GQ9L 4WEMB 4BM7A 1PEZA 5I19H 3OJMB 4M6ML 3MR9A 5CJQH 1RSFA 4G8GE 1M6OB 3PHOB 3DXAA 3N50A 5B4MD 2IBZY 2Y6SD 3WS3A 5MERA 4X6CF 1TVDA 3UTZA 2DQEL 2XY2A 3MZGB 3WFZA 2BSTA 1A7QH 4JQXA 2DDQL 3MR9B 1II4E 5I17A 1I85A 3UTTD 4L4TD 4Y19E 4B41A 1YPZA 4M7KL 5HD8C 3WS3B 5MERB 5D1XC 4OQ1A 3UTZB 1LVEA 3BKMH 1FNLA 2BSTB 3OKNA 3OXSA 3T2OA 1LO3H 3N9GH 1JNNH 2VXQH 4NM8L 3ZSTA 1ZT7A 5I17B 3KPRE 1YPZB 5EOQH 3BT2L 1NJ9B 3OKNB 2F19L 3U7YH 1I9RL 3OXSB 4LHJB 4X9HA 4CMHC 7CGTA 1MI5E 3RBGA 1IT9L 4XNZC 3GSRA 3SQBA 1V3JA 5FUOH 1ZT7B 1RVFL 1KB9K 1TQCC 4ZOBA 4EI5A 2YN5A 1S7QB 5MHSE 4E0RB 3PUCA 2ORBH 3RHWF 5K93A 3UTSA 1Z9LA 3RWDA 3GSRB 2YHGA 3AROA 5KS9F 3RTQA 1VGEH 4RCAA 4OCWL 2I27N 3QQ9C 1I3GH 4EI5B 1H3UA 1C7SA 5DUPL 3CAFA 5MEOA 3UTSB 2PW1B 2PW2A 4N90D 3RWDB 4XP5L 4M7ZB 3FT4A 3RTQB 4GXUN 1OQXA 2YA2A 3VXSD 4HGKC 2WUCL 4JHAL 5FHBL 5MEOB 4MCZA 2PW2B 1DEDA 5B38A 2X1XR 3MV7D 2E7LA 2ICWI 4LOUD 2GEEA 3TJEL 3FT4B 3O41A 3OKEA 2RB8A 1RULL 3GSOA 4LQFL 4MCZB 3P0VL 4UDUA 2R29L 5B38B 1NEZG 4HBQA 4JO3H 5M94B 4WW2F 5IUSA 1N5AA 3TF7C 2MQ3A 3SDXB 3O41B 1T2QH 3UYRH 3OKEB 3MCLH 3HNVH 4Y16A 5HVGB 1UYWH 4URTB 4HLZG 5D2LF 3GSOB 5F7FA 1V7NH 3RJDA 4UDUB 4G80A 3LQAH 3T2QA 3E6HA 3MYJA 3NIDE 3VWKA 1GJIA 2IBGA 1N5AB 2HFEA 4Y2DC 1G9NC 2Z31B 3QHTC 2BP3A 3RGVC 4KRPD 4I0PA 2X9XA 4Y16B 4CDHA 4DAGL 4CU8A 5FYLH 2VDRH 4Q74A 1X5FA 5ALCL 5JO5B 4Y1AD 4GKZA 4G80B 1UJTA 3VFVA 2VTFA 3E6HB 3MYJB 3VWKB 2EDXA 3BIKA 2HFEB 5ICYA 1IEHA 3O6FD 1K4CA 2P47B 3CXHJ 4LNVA 4YE4H 5D7KE 2GSIA 1ZWIB 2BNQD 1F11A 1GOHA 3A0OA 4XVJL 2DLEA 2BOCA 5C0RH 1N6UA 1SJXA 3PGDB 3IAGC 2WNGA 4ZS6D 3B9KD 4L1HA 5CD5C 3BIKB 4K7PX 4NUJA 2WK2A 2D0FA 5CJQL 5ICYB 4HGMA 1K4CB 3X11A 5D6DC 2GSIB 1IGJA 5EUOF 5TQ0L 1F11B 4MLIA 5EC1A 2ZP0T 2BOCB 4RA0C 1D6EB 1KB9J 4XCCL 5IT2H 1X7QA 4WTZA 4NUJB 2OR9L 2PYEE 3X11B 1IGJB 2YUWA 1S7VA 5EC1B 4RIRA 2EDTA 1E6OH 2APWA 2I26N 5CZKA 5D1QD 1LO3L 1KTLA 1X7QB 2EC9T 1TLKA 3N9GL 1RZIA 1CFNA 2BOBA 1JNNL 2VXQL 3FN9A 4U3CA 3M1BA 1CGVA 3EAKA 4NC0B 2VSCA 4CVZA 1S7VB 5GPRA 5EOQL 3T77A 3QDMA 4RIRB 1P5VA 5C0BD 4Q9CA 3HHRB 1KTLB 1L7IH 5BXFA 1CD9B 2OJZL 1RZIB 2BOBB 1GYAA 3M1BB 2QSTA 3G6AA 4OLXH 4PG9A 5EU5A 1U36A 4CVZB 2C4FU 3T77B 5BV7L 3QDMB 3V5HA 1QRNA 1A6WH 2JF1A 1JI2A 4LBEA 5BXFB 1UKQA 5I74B 4PLKC 3NABH 5HVHC 3VWJA 3G6AB 1VGEL 4PG9B 5EU5B 5HXMA 4OGAC 1I3GL 5E2WH 3T4AA 1MEXL 2WM0A 4LSSH 3V5HB 1PYWB 2B20A 4LBEB 3MJ9L 3WS6C 1RD6A 1WWAX 3MFFA 1ZLVK 1Q38A 1OTUC 3VWJB 3TFKD 2EDEA 5FGBA 3GBML 3MNVA 4UI2A 3T4AB 4F57L 2Z92A 4PV8B 5JW5A 2VXTH 5JIIA 1LK2A 3M45A 3K4AA 2MTPA 4B7LA 3MFFB 1XIWC 4LSUH 1K3IA 1J0ZA 5T5NG 2FX9H 1T83A 3TPKA 3MNVB 1CBVL 5CSBA 1T04A 3O11A 5JW5B 1X5IA 3CFIC 3ZYJA 4X9BA 1LK2B 2AQ1A 4JO3L 2AEQH 1IGTA 1YZZA 1K6QH 1T2QL 3UYRL 1CDIA 5F9OL 3MCLL 5HI5C 3HNVL 2LU4A 4FXLA 4MXWH 1K9TA 1NC4D 1LO4L 1T04B 3O11B 2XTJE 3VMPA 3LB6C 1IGTB 1T03H 4I1NB 3OKOA 2ATPA 4FQPA 4CMMB 1E4KA 5FYLL 2XACC 3W9EA 2VDRL 2GFBA 3SDYL 5D7JC 4UIMA 2X4TB 3L95A 1HYRC 3O2VH 4OJFH 4J1UA 5JMOC 3BWUC 5C0CD 4U1SA 4EUPH 2PTTA 3OKOB 2ATPB 3C2SA 4YE4L 2R2HA 1KG0A 3W9EB 1T2XA 1ACYL 4NWUH 1QSED 1F02I 2GFBB 2E9BA 3DETC 4Z7NE 4UIMB 5FA3A 5C0RL 4XBPA 3RIFK 1WIOA 4KPHH 2WANA 4J1UB 2CKBL 2YA1A 2PTTB 2R2HB 3MRLB 1KG0B 3Q0HA 1J7VR 2Q1EA 3SE3C 1ZHLA 5FA3B 4QT5A 4XBPB 4BZ2L 3TBSA 5IT2L 1RIHH 3DMMA 4TRPH 4X4ZA 1FSKB 1N4XH 5B39G 3X3GH 3VGFA 5DC4B 4C54A 8FABA 3F7YA 3MLYL 4NP4H 2M8XA 1ZHLB 2LAGB 1E6OL 2NY5C 2DN7A 1CGXA 3TBSB 5F70A 2F8VA 3DMMB 4NWTH 5EU3A 1DBBH 4U6HA 1FVDB 4YHZL 2YMXH 2P5WD 3D85A 4ZNEA 3N1FC 4P2RD 1L7IL 4XWOD 5AYQA 1INEH 4U1HA 1PQZA 5EU3B 2LTQC 2OSLA 1DVFD 4U6HB 3PWLA 3H42L 5I71C 4OLXL 1RK1B 4CADA 3ARBA 3TJHD 1U2CA 1DN0A 5ITFA 3HMXH 3D85B 3UJTH 4LVHB 1A6WL 1FFRA 1H15A 3MV11 3T65A 5IHZA 1R24A 3ARGD 4G6FB 4U1HB 5CEZE 1EJ6A 1HHHA 1PQZB 1A3LH 1KCSH 2X4OB 3HB3D 2OSLB 1EAJA 4PJDF 3NABL 4Z7VB 3PWLB 4WWKA 4CADB 3DX9A 4UV7H 3UJJH 3ARBB 3IXAA 4ONGH 1MJ8H 5IBUB 1DN0B 5ITFB 1K85A 4PJAE 4ZFZA 3MJ8A 1GRWA 1H15B 3B5TA 3T65B 5IHZB 1R24B 1CLZH 1P4IH 1OWRM 2V5YA 4HJ0C 1Q1JL 5HGGS 4RISH 2XWBA 3DX9B 4I8DA 4UILH 3IXAB 1CXIA 5DLML 2PETA 4ZFZB 3ZE1F 3MJ8B 1U8MA 2VXTL 5EG6C 5MEQA 3O3EA 5DVKA 4U1NA 4HFWA 1IKNA 4LSUL 1T0MA 4O58H 1BJMA 3NGBB 5HYJE 3SGJA 4YHIA 1I9EA 2FX9L 2V17H 2NY2B 2XWBB 1J1PL 4LVNB 5IB5A 2E27H 4ODBD 1CE6A 3QWRA 2EZ0C 1AGCA 5MEQB 15C8L 3O3EB 4U1NB 4HFWB 1T0MB 2AEQL 2V6HA 2Y72A 4YHIB 1K6QL 2VLMD 4GS7C 5IB5B 1SVCP 1AR1C 4MXWL 1QFWH 1CE6B 3GK8L 4IJ3C 2P1YA 3EZ8A 4PIRF 1YECH 4FP8H 1AGCB 3N06B 1I8MA 1ZXQA 3WMSA 1TZHA 1JGLH 2ZUQC 3CDYA 5ENWA 3EBAA 4L3CA 1EUTA 3KWWA 2XZCH 3C6LC 5D7LA 4LHUG 3LZFL 2F5BH 3IRPX 2FEEL 4NRYA 1I8MB 4DKAA 3QB7C 3O2VL 1FZKA 4OJFL 1TZHB 1JZ3A 1AO7A 5GRWA 1FG2A 5ENWB 4L3CB 3KWWB 4KK9D 1KB5A 5D7LB 4BUGA 3K74B 5JPMA 5HHQA 3SQOL 3RKPA 1WV7T 1VEOA 5BW7A 4NRYB 5DUMH 1MCLA 3UJIH 4KPHL 1FZKB 1AO7B 5JIHA 1T5XB 1FG2B 5F7HA 4H88L 2D7PA 5FF6A 1KB5B 2HJLB 5JPMB 4BZ1H 5LWYH 4QHLA 2FGWH 2XFXA 2DQDH 2KDGA 4NQSA 1RIHL 1N4XL 1G9EA 3TIDA 1JZ7A 5E6ZA 4ZXBA 5FF6B 4AYFA 2JCCF 3ARTA 5JHDB 5KVDH 1ACZA 4NNPL 2QSCH 4EI5D 4QHLB 1P7QA 2XFXB 4CKVX 3RPIA 4NQSB 1P53A 3WFEH 4NWTL 3UTSD 1DBBL 5F7KC 1N3NA 3TIDB 4ZXBB 3RVTC 1H9VA 2YMXL 3B2UC 3RTQD 5FKPB 4TSBL 1P7QB 4N5ED 2BERA 4MWFA 3RPIB 4F7CA 4MMXC 2Z35A 2IMNA 1INEL 4Y5VC 5C3LD 5I8CA 5GGQH 5KOMC 1N3NB 1XGYH 2LFGA 3F58H 3GNMH 1CIDA 2AK1L 1FNSH 1X5LA 2HKFH 4HJGA 2QADC 1A7OH 3H9YA 3QUYA 4MWFB 2GI7A 4F7CB 5F44A 4HKZA 2Z35B 4R2GC 5I8CB 2BVYA 1KCSL 3LKPA 1L0XA 3LIZL 5AG8A 3J8F7 4UV7L 3SGKC 4ONGL 4KVNL 3UJJL 1MRCL 1MJ8L 4X6BA 1QFOA 3ZZ1A 4EDXA 3TN0A 4HJGB 2E7CA 2DM2A 3QUYB 4AG4H 1ADQA 4U1GC 4HKZB 2VITA 4GRWB 1CLZL 1P4IL 2HAZA 1KC5H 3LKPB 3D2UA 4RMTA 4LLWA 4P2OD 2Z31D 4EDXB 4X6BB 1GXEA 3VG9B 4Y16D 5KS9E 3TN0B 1RJCA 1F2XK 4S1DC 3AB0C 1LO2L 4I3GA 4UTAH 1AGDA 3ZDZF 2VITB 5F6IC 1I1AC 2EEDA 4JY6B 5GS1C 3VWKD 2YPLA 3D2UB 5DI8A 2V17L 4A6YA 4LLWB 2H6PA 2AS5M 3JXAA 3ECBA 2E27L 4OZGA 4OF8A 1UKTA 4ONHB 5IW3A 1AGDB 5I9QC 1AP2A 3BH8A 5C09A 2YPLB 4IRJC 5DI8B 4A6YB 2VAJA 4MXQC 1U8PA 3N1QC 2H6PB 2VL5A 3ECBB 2EXYC 4H1LA 1QFWL 4OZGB 4KH2A 5FYKD 3BN9C 5I8OH 3TWCL 3PDDA 1I75A 1TXKA 4M8VA 2EIEA 1AP2B 3QDGA 3DUHA 3BH8B 5C09B 3MLRH 1U8PB 2VL5B 2XZCL 4H1LB 4UMGA 4AM0A 2CKNA 4O00A 1JF1A 2F5BL 2UYLA 3C6SA 4F80A 5LG1A 2V9RA 5D2LE 4F7MA 2W60A 4XCFH 3TV3H 3QDGB 2L4OA 4GRLA 2A6JA 2PXYC 5I1CL 4F58L 1Q94A 4JJ5A 3EO9H 1MCBA 4PJXF 2JB5H 4ZOAA 4IOSD 4AM0B 1JF1B 4IEFB 5I73C 4NKQB 3C6SB 5E8OB 4F7MB 2W60B 2FD6H 2YRPA 1S5IH 3UJIL 2GT9A 5CEZH 1P2CA 4MZ3A 4GRLB 2A6JB 1Q94B 3B4NA 5A2JH 4JJ5B 2PTUA 3R4DA 5EU7C 2GAZA 4NSKA 2R1XB 1NUGA 4BZ1L 3QDMD 4OQTL 2FGWL 4PJ9B 2DQDL 4W70A 1A6UH 2GT9B 1A0QH 1P2CB 2HMID 4XP9L 1EO8L 2N7BA 4NSKB 5KVDL 1FP5A 1J0HA 2QSCL 3DECA 5FYJD 4HMEA 5IQ7H 1TENA 3WFEL 5HGDB 5DZLA 2VUYA 4WHYG 4G7YH 3VWJD 3BPOB 1BZQK 4KDWA 2QJDA 1G0XA 3CXDH 4XAWH 5GGQL 4YR6A 5EOTA 2VZOA 1V8HA 5FO7A 4XH2A 3QDAA 1KENH 4HX1A 1ITBB 2MNUA 3PL6A 2WQ8A 3NCJL 3VFOA 4HIXH 3MLXH 1A7OL 2AXFB 3W9DB 4KZDH 1G0DA 4MJ2A 1RK0B 4G8EA 3B8SA 4XH2B 5FO7B 2W0FA 3L5HA 4HX1B 4OZIA 3PL6B 2AJUH 3VFOB 1C5CL 4PRHE 4Y0GA 5FKAA 4DN4L 4AG4L 3IFLH 3TVMA 1KN2H 4G8EB 4PJGF 1KACB 2JELH 5C07A 2W0FB 5T3ZE 2GK2A 2VDMH 4ODHH 2ZUVA 4OZIB 3ET9F 3MV8A 1FV1A 2ED8A 3DUSA 1C12A 4XPAL 5FKAB 3SN6N 4WI2A 5LVEA 4U33A 3TVMB 3WE6A 3WNOA 5JOFA 5C07B 1MF2H 3PV7A 1MWAA 3FT2B 2R9HC 5F7EH 3KYNB 5IF0A 3MV8B 3SKJL 1FV1B 3DUSB 1C12B 3HMWL 4LASH 5F9AC 1D6VH 3OF6A 4Q9RL 4N0CC 1BECA 3WE6B 4JN2A 5JOFB 5J13B 4XPGH 1S7UA 5I8OL 2IPUG 4M5YH 4TNVK 3EYQC 3LRSA 2GCYA 4JN2B 2MOVA 2UWEF 1MCPH 3VXME 4HULB 3MLRL 3I02A 2FWOA 2F53B 4JM2F 4CGTA 1BVKA 1S7UB 3CMOL 3QO1A 3NH7H 3OKMA 2F54A 1JWSA 2ZNXA 3MRBA 3LRSB 3EJYD 2GCYB 5I16A 2VKXA 4PP2A 3I02B 3DMMD 4HUVA 3SKUD 3EO9L 1GOGA 2JB5L 3Q1SH 4OD2A 4F7TA 1BMGA 2Q8BH 1BVKB 4JFHE 3QO1B 4PJBF 4DWHA 2F54B 3HTLX 1JWSB 2FD6L 3MRBB 1S5IL 5CEZL 5I16B 1B9ZA 4KMQA 1YJDC 4HUVB 3BP5A 5LQBH 1F3DJ 2D31A 3AVEA 4P5MA 3DBXA 4OD2B 4F7TB 2Y23A 1MRFH 2LU7A 3D85D 4QWWC 4AK1A 1A0QL 3HC3H 3CCHA 4Z6AT 3BP5B 4LQ1A 1MQKH 1JZ4A 2UVFA 3ALWA 4P5MB 5GJTH 2G5BA 5F21B 3DBXB 2GJZA 3LS5H 3FN0H 1BD2A 3ARBD 1OAQH 4G6KH 5IQ7L 4PJ7F 1FC2D 1NCBH 4KC3B 4N0RA 3S4SA 4NHCL 4C56A 4R7DA 3MLWH 5IMLA 4H0HB 3BXNA 2CLRA 5SX4H 2G5BB 4PLOB 3WBDA 2GJZB 1BD2B 2DBJA 5DJZA 3UX9B 1RMFH 3ULUC 2YK1L 4OSUL 3S4SB 5IMLB 4C56B 4R7DB 4NNYA 3BXNB 1G6RA 1UVQA 5DD5H 2CLRB 5FDWA 2NY2D 1J11A 5HDOA 3WL9A 2Z8WC 3WN5C 3MLXL 5DJZB 1NGZA 1C5BL 1JVKA 1RZ7H 4NNYB 4TQEH 1NLBL 1R5WA 2HWZL 1G6RB 1UVQB 5LJYH 5FDWB 3AFLA 1V3MA 5BJTA 1CR9L 3WL9B 2FHBA 2VABA 1CQYA 1DBMH 1NGZB 3QWRD 4XVSH 1A22B 5SX5H 1ZLSL 5DJAB 1BFVH 1R5WB 5FHAH 5JLZA 2AK4A 2JELL 5E8DH 5BJTB 4ODHL 4PJDE 2W9DL 2FLBT 2FX7L 4YDLB 2VABB 4JO4H 1KIRA 2RBLA 5KVGH 2AEPH 3WFCH 3NMEA 1K8DA 5JLZB 2AK4B 3O3DA 1X5AA 4WO4C 2VDKH 1NPUA 3GHEL 5F7EL 1U8HA 1JPTH 5D7LD 1KIRB 4LASL 3SEPA 2X42A 3VI4F 2CK2A 3GMPB 4YBHA 4P49A 3ZLQC 2R0KH 1WZKA 1K8DB 3EDFA 1OAYH 2E8ZA 5C0IA 1AO7D 4Z7OF 1WC7A 4P46A 4D3CL 4U7KA 2FO4A 1CVRA 1U8HB 4BQ9A 3MRCA 1SJHA 2DQIL 2NCMA 3FZUC 2B5IB 3CMGA 1MVUA 1IGFL 1R3IH 5C6PB 5C0IB 1WC7B 4P4RA 4IMLB 2FO4B 5L2KA 5JHDD 3MRCB 3NH7L 1SJHB 1OOAA 3D25A 5HHMB 3QG7H 4P99A 2DIAA 4G8IA 1MVUB 3ARSA 3JUZA 4ZXBD 2FEEI 3ILQD 5L2KB 2Q8BL 1H3TA 4NO3A 3ILPB 3D25B 1O7SA 1P7QD 1UWXH 4QXGH 4O02H 4G8IB 1Q72H 3QO0A 4YXLH 5LQBL 1KLUA 4AEHH 4Z8FH 1T4KA 1NAKH 5DEFA 6FABH 2DIBA 2OI9C 4L3EE 1MRFL 2HLAA 4KI5D 4NO3B 4LPYA 3D39E 2QBWA 3RHWK 1F4WH 3QR2A 3T0EC 3LS4L 2VO5A 3QO0B 1LEKA 4TSCH 2W9LA 1KLUB 3J7HA 1T4KB 5GJTL 5DEFB 3LS5L 2Y9RT 2NY6B 4R4FL 3OAUH 4QKXB 3ARDA 2ENYA 1MH5A 2AJXH 1QOKA 2HLAB 2VMFA 4G6KL 3G6JA 4G8GB 5DRNA 3DO3A 1LEKB 5LXGL 1GGBL 4YBLC 1T89A 1AGEB 3IGAB 3QRGL 2V5TA 3HA0A 5J3HD 3ARDB 2JCCE 5I1AA 1MH5B 3UTPE 1BFOA 3G6JB 2KUTA 4N5UA 4QHKI 3PDGA 2G60L 4YHLH 1CFSA 5DD5L 2GHWB 3D2UD 4TVPH 2VLLA 3CK0H 1WBYA 4OCYL 4R3SA 4PB0L 4RGMB 5I1AB 1MUJA 4LPCA 4O2CA 1BFOB 4YHYB 4EUPA 3BPLB 3UZQA 4DEPC 3CDGA 1P7KA 1RZ7L 3F12A 2R0LH 2YPLD 4X4XB 2VLLB 1WBYB 2APFA 5CLWA 3NPSC 3MA9L 4R3SB 4CBPA 1MUJB 4O2CB 1DBML 3PWPE 4WFEE 1YNKH 2R39A 4EUPB 3CDGB 1P7KB 4FTVA 4Z18A 3F12B 5IESL 1I7RA 1I8KA 4KTDH 5I18H 1IEAA 4LPWA 2VAAA 4F7PA 4JO4L 3WNNA 2J1KA 1FFOA 3DV4A 4WI7A 5KVGL 2AEPL 4ORZC 3CFEA 4FTVB 4PV9A 2DQTH 3GI8H 3QDGD 5I0DA 1YY9C 1I7RB 1I8KB 3IDXL 2P5EE 5KANI 1IEAB 2VDKL 2BRRH 3PXJA 1X3DA 3QXVA 2VAAB 4F7PB 4CRPA 2B1AH 1JPTL 3MTRA 2YWYA 2BXZA 3DV4B 3MRMA 3CFEB 2R0KL 4PV9B 4YGAB 1UB6A 2NNAA 3S35X 4D9LH 2WW8A 3WYRA 4GRLD 5IMKA 5JXEA 2LQRA 3EFDH 4FFVC 3JWOH 2DAVA 4OBRA 1A6VH 3O3AA 2AI0H 1DR9A 3MRMB 4PJ9D 1P9MA 4L8SC 4YJZL 1UB6B 2NNAB 3HMXA 2MPAH 3DYPA 4YPGA 4HWUA 5F1IA 1R3IL 3V5KA 1QFWI 4TUKL 5IMKB 1BWWA 1T7VA 5D7IF 1VESA 1EO7A 4HKJA 3O3AB 3AAZA 1D5MA 4HIHA 4WGWB 3QG7L 3WHE0 1AHWC 2ARJB 3O3BA 5F1IB 4YPGB 3I50H 5GSRA 1Z9MA 3CX2A 4HKJB 3RNKA 3U1SH 3HS0A 5JOPE 3ZKND 1D5MB 4HIHB 1WAAA 4AEFA 3GHBL 1UWXK 3GBNH 4QXGL 4RNRA 2FX8H 5A2LH 3QZWG 3O3BB 3BPCA 5TDOA 3PWNB 2I9LA 5GSRB 3CSGA 4CUCA 2Q8AH 1ZE3C 1BF8A 4NCDA 3WUWG 4B7IA 1JPFA 4LEXL 2X40A 4OI9A 5FFLA 3RNKB 3L9RA 3HS0B 4PJXE 3P9MB 1OCWH 1T6WA 1KUMA 3HC0A 3BHBB 2K9UA 3I3BA 4RNRB 3TM6A 1F4WL 3BPCB 5TDOB 1AH1A 3MXWH 4J12A 1Z3GH 1JPFB 2N56A 3L1OH 1S9KC 3OQ3B 1DSFH 3OAUL 2CLVA 3L9RB 3PL6D 3IXTA 1MFBH 4OV6F 1LGVA 1UM5L 3HC0B 2LAAA 5CGYC 1J0IA 1BFSA 2JJTA 1T6VN 1PKQA 5IVXA 4WHYH 2DKMA 1GGIH 1T7ZA 1KOAA 2CLVB 1AE6H 3QBTB 1IILE 1T3FA 3IXTB 3ZTNL 4BSVA 4G7VL 1ORQA 1RUML 1VEMA 3GIZH 4PRNA 4WY7H 1S3KL 4LSVH 4PYHA 1WWCA 3TVMD 4DK6A 4YHLL 1SYVA 1B6UA 4PG2A 1PKQB 1CDCA 4G43A 5IVXB 1DUYA 5C07D 1L6XA 1GPOH 2P8MA 3MBEA 4IS6A 4JQVC 1T3FB 4BSVB 1MHEA 3MV8D 5ALBH 1ORQB 4G5ZL 5B3JF 4NKMA 3GIVA 1SYVB 1QYGL 4G43B 1DUYB 1F4XH 4P57A 2P8MB 3MBEB 4IS6B 3ZYIA 4XWOC 1MHEB 1UEYA 3S9DB 4OKVA 2FSEB 3EO0A 5CZVH 3OF6D 2FR4A 3PXHA 4NKMB 3TZVC 4NQCA 1D5XA 1GIGH 2VWEC 2J12B 5I18L 4LIQE 4P57B 4WI5A 4OLWH 3ARGC 2F53D 3I6LD 3HB3C 2R4SH 3EO0B 4PTUA 4CW1B 2DLHA 4ZOEA 5A40E 2FR4B 2DQTL 1QHOA 3FO2A 3GI8L 3U9PH 3TBWA 5IWLC 2VZTA 4NQCB 1XT5A 1D5XB 1FYTE 2BRRL 4PJGE 1OWWA 2AAVA 3QUZA 1A7RH 2I9TA 1MIEH 1W72H 5ADPL 3FB8A 4PTUB 2UV3A 2VDOH 2F54D 1MFCH 5F97E 4IDJH 3TBWB 4D9LL 3HR5A 3WNMA 3QEUA 1AXTH 1QFWM 4NN7B 3EFDL 1CXHA 3I3EA 5SWSA 4TNWF 3QUZB 1S9XA 2ZKHH 3IDYB 1A6VL 1T1YA 2AI0L 4PRAA 3B83A 1DQDL 2BX5A 4ZFGL 4U31A 4NQDA 1KPRA 3A67H 1IE5A 5IBTH 1FJ1A 2MPAL