1IGTB

Structure of immunoglobulin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
444
structure length
444
Chain Sequence
EVKLQESGGGLVQPGGSLKLSCATSGFTFSDYYMYWVRQTPEKRLEWVAYISNGGGSTYYPDTVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCARHGGYYAMDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of an intact IgG2a monoclonal antibody.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IGG2A INTACT ANTIBODY - MAB231
total genus 65
structure length 444
sequence length 444
chains with identical sequence D
ec nomenclature
pdb deposition date 1996-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igtB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igtB04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igtB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igtB03
2FDBP 3NCJL 2NW3A 3OG6B 5D7SH 4B0MM 4U3CA 1NMCB 1QTYT 1MAKA 1TZIB 1ONQA 5CIPA 1VEOA 5JNYA 1X5HA 4N68A 3ZYIA 5EU6A 3M17B 3S5LB 2R2BB 3G5VB 4PRPD 5DUPH 4TOYL 1IJ9A 5F88B 2AJUH 4LPXA 1N8ZB 1C5CL 4MA3B 1NLBL 5GIRA 1FO0H 5J11C 4OLXL 1QYGH 4J8RA 1QVOA 5I2IA 1LO3H 3FT4B 3BW9B 4JFDD 4NQDE 2HJLA 3KPMA 5IB3B 2H41A 3RWCB 5EUOA 2HLFC 2BY0A 1FL6A 4P5TC 1IAKA 4L3CA 4U6HA 4UNUA 4WW2A 3NAAL 4G9FA 3DV4B 2ESVD 2EKSB 1JE6A 2A9ML 1N8ZA 3QG7L 4P23B 1HSBB 1NUNB 3BFOA 4HS8L 2DL9A 5H37G 1T83C 4NHUA 5E2WH 1QVOB 5C0RH 5I2IB 4ZUTA 1MCPH 4M8VA 2EYSB 1R3HB 1MCWW 4HIXL 1HCFX 4I3SH 4LEOA 3MRNB 3V6BR 2X09A 5IV2A 1KG0B 4L3CB 4PJXF 1IGJA 1NBZB 3PWJB 3T0EE 1YEFH 3HAEB 3D39E 1TDQA 4XNYL 4XAWH 4NO0B 2ED8A 3EUUA 3GRWL 1R24A 4OKVA 4ZUSA 2EDDA 2X05A 5ALCH 1HSBA 4NQTA 1X5KA 3RQ3A 3KXFD 1ADQL 5IBLC 3PUCA 2A9NL 5C09E 3G5XA 1S9YB 3MRCA 4KQ4H 5HYQB 4NSKA 4XXDB 4HUWB 2AERT 3N1FC 3T0EC 4X4XB 1RSFA 3G6JF 3BAEL 4LRNL 3OG4B 1R24B 4Y2DC 5BRZE 4W6XB 5J57B 1O7SA 1P84J 2OX5A 3TJEL 1CD9B 1LE9B 2M2DA 1EH9A 1KN4L 5EN2A 2OJEA 2XWJA 5LBSH 3QQ4B 4C55A 3X11B 2Q8AH 1P5VA 4ZMAT 1H5BA 5HHOA 1IAIH 3ZLQC 2A2QT 4CKVX 2N1KA 2I24N 4C57C 4HUWA 4YIQB 2FB4L 4WEMB 4FXLA 4HPOH 5I1AA 1MIMH 4KJQD 1YEKL 5INCA 1WBXA 3GSNL 2Q86A 1A8JH 3WJLA 3O3EB 4GQPH 4ZUUB 3QNYA 4OZGB 1FL5A 1HHHB 3SGJA 2W0LA 5IB4B 5KSUB 4LL9A 2VDML 3IT8D 3MJGX 4Z7WF 2IBBA 3KYOB 1XR8B 2RHEA 1FGNL 1CGXA 3MRBB 4OF6A 4UQ3A 1CZ8H 4WTZG 4ZAKC 5IJKA 2LFGA 4TSCH 4XHJD 4Z78A 4NT6B 5C0AB 2KZWA 5EUKB 3O3EA 4GW5B 4YBHA 3Q5YA 1NCBH 2L4OA 5IJKC 2NY1C 4KKBD 4WV1B 1NEZG 2FLRT 5IWLC 4RFNC 1MCPL 1F6LL 1PEWA 4JG0H 4QXTA 3OF6D 2VRAA 4LLYB 5EOCL 1L7TH 1ZKAA 5IGXH 3OJDB 1HYRC 5D8JH 3R06A 3HN3A 5HHOD 1L9NA 1M6OA 1X9QA 2CPCA 3EDFA 2P8MA 3EZ8A 5EZLA 3WD5L 3C5ZB 4OZHB 5KSAD 1OB1B 2D7TL 1LO0L 1ZVHA 2BVTA 2XRAL 2AJXL 3BXNA 4KGJA 5DQJB 3QDJA 5EO9B 5EU5B 4GFTB 3O0RH 2Y5TA 3REWA 2RCSL 4DOHE 3ARTA 1B2WL 2X1PA 4JPIA 1FORH 5BJTA 2F8XC 3C60A 3QO1A 2ARWA 1U8KB 1GAFL 4FP8L 1IGML 1IQDB 2HT4C 4A6YL 1ZLSL 1VEMA 1QSEB 4ZFFB 4JRXA 1BOGA 4HUUA 2P8MB 5KAQG 3GSVA 1GC1L 1L7IH 1XGPB 3LEVL 1DR9A 1S9VA 4P2RA 5IESL 1I9EA 5DJZB 2JJSA 4Z76B 5DEGB 1G1CA 1T1ZA 4PGJA 3U2SA 2VXVH 1CGWA 3HI1B 1I1AA 1TETH 4ZO9A 1WFTA 2IMMA 3C60B 4MJIA 4PJCE 4P48A 4XNZC 3B9AA 4XNXH 4LPYA 1TQCB 2VXTH 5K9QG 5MP6H 4JN1H 3BZEB 1F3DH 1OAYH 5DMKA 4JR9L 1QSEA 4JY5L 3EYQC 4ZFFA 5H35A 5EO0A 1BOGB 4HUUB 1IGCH 1ZTXH 2X2YA 3TH4T 4BKLA 1JYXA 1DVFC 3SDAD 4C4KT 4LSSL 1R5WA 3O6MH 4MLSA 3T77A 5SWQB 4Y16D 4X8XA 4JFXA 3RVXC 2ZSVB 3RPIA 3TM6A 3BYTA 1E4JA 4BYHA 4I4WB 3DX7A 3WHXB 1RUPL 3MODL 1TTFA 1ZA3A 1Y6NR 4X4ME 1N2RA 4MNHA 4Y5VC 2D9CA 3ROOB 3CVIL 4OZHE 2B1HH 1T5WA 3T1WA 4TSCL 3EO9H 1ONQB 1JYNA 3HRZB 1RZKC 2XKNB 4IRSD 4TQEH 5IKCA 1CU4H 4KUZH 1R5WB 3QEUB 4U3HA 4BQ9A 2EDEA 1MFDH 4Z7NE 3GJEA 3MRRA 5JTWA 3BUYB 4UV4H 4QXUH 2J5LC 1NC4B 1HZHL 4UIMB 5J3HD 1B6UA 5FAAA 5EFIB 2ZCLH 3KPMB 3RWDB 5FYLE 3RWCA 43C9A 1NFDB 3A6OA 4TUOB 1A7BA 3EIFA 1PG7W 4Y5YA 2OYPA 4XCYB 5EDXA 1NC2D 4H25A 4XNZB 1L0YA 5JZ7D 4MXQD 2NW2B 5C0CD 3O9WA 3HG1B 4NZTH 3GJEB 1ZAGA 1NC4D 4IRJC 5T3XH 3D18A 4RAUA 3MACL 2R2CA 1UXWB 5D1ZA 4K7FB 1AFVL 3NFSL 5TFSL 5AZ2H 3ZTNL 1Y6KR 2DD8H 3K81A 4IRZL 5E7BA 2DLGA 3ALXA 3ARPA 1CE1H 4Y5YB 3QUZB 4PJEB 1TJIL 4H25B 4RBPK 4EIZC 3TYGH 5ADPH 5BCAA 1NSNL 5GISL 5ETUA 1J05A 2DOCA 3ESUF 1WF5A 2P47B 4S0SD 3GBNL 1RIUH 3QA3A 1KPRB 2HKFL 1YN6B 3GMOA 4XPBH 4PJFA 1R3JB 4R4NC 4M61A 4MB3A 1DLHB 1N5AB 2CDEB 3GK8L 4HCRA 4ODHH 3RWHB 1EJOL 4U3XA 3O8XA 1PDKA 1JPFA 3O41B 1OAZH 2Z92A 3T0VA 1Q9WB 3ZMRA 3U9PL 1BBDH 5L2KA 3L3GB 3DHMA 3DURA 1JGEB 1IGTA 4LEXL 5DT1L 5I66A 3FT2A 2ITCA 4ZFZB 2OJEB 2OTPA 2AJ3B 1JPSH 4TYUA 5E6IA 1OD7A 2VDOH 2IANA 3CSPA 1DUZA 4LVHB 5EC2B 3MPCA 4H5SB 4EI5B 3MFFA 1F3JB 3RFZC 2OL3B 3BH9B 1N5AA 1K8DA 1BJMA 2FRGP 5F93C 3ZKSD 3GSOB 2I60L 2D7PA 3PQYD 2H32A 3S37L 3S6CA 4KHXL 5GSVB 4OCSH 1FFRA 3L3GA 4NFCA 4Z9KB 5JXAL 3OHXB 4LLVA 1CGVA 3IRPX 1DQLH 3TVMB 1E6JL 1AXIB 4PJ7F 4ZUUA 1FNEB 1I7RB 1XT5A 4KI5E 3VWKD 5E94A 5FECB 2QSTA 4ODUB 3AY4C 4G6FD 4OSUL 3WYRA 3QO0B 2DLFL 2J88H 2IAMA 2VNCA 3BDYL 3TBSB 4Z7OE 3RVWD 3D25A 1MUJB 3DETC 4S2SB 4XP6L 4ELKB 4NRZA 4XNUH 2KBGA 4TOYH 5DR5L 4IS6B 3BD5A 2JLLA 3MRBA 4UQ3B 4X0KA 4AJ0A 4PV9A 2H26A 5LJYH 4UQ2B 4FA8A 5SX5K 4L3EA 1TTUA 3TP4A 3TVMA 3DMMD 1CN4A 1BX2A 4NKIH 2CK0L 2ITDA 1YZZA 4R4FH 1HH9B 1CLCA 3T65A 2IADA 5GS2H 4P9HC 3SBWC 2VZSA 3PHOB 5LQBL 5B8CC 4QXTB 2E27L 4GKNB 3D25B 4RMTA 5FYKU 1AP2A 3UJTH 5EOTB 3E8UL 4Z5RB 4U1JA 1KACB 2QHLA 3H7LA 5E6YA 2IPTH 4P49A 1PEZA 3ZDZF 4LLWA 3C5ZA 1KJ3H 4OZHA 1AXTH 2IADB 4K94L 3PHOA 5EO9A 5EU5A 2EDKA 4WEBH 3QNZA 5INDA 3UZQA 3REWB 4X6DA 3CIQA 1EGJL 3F6LA 5B39B 5F3BB 5EBMA 4LDOB 4IEFB 4IBLT 4CBPA 5D70L 3VXSD 3T0ED 2LVCA 3F12B 5IM7A 1GOHA 4NNXA 3TN0D 1KYOJ 5DRWB 3C6LB 1GVIA 3EFDL 5D7LD 5KBNC 4DUWA 5ENWA 4JO3H 5IMKB 2DDQL 2R0LH 1JPST 4FABL 1KYOK 2UYLB 2X41A 2B5IB 5FOBA 2Y06H 2LU7A 2FGWL 2GIYA 5F21B 2EE9A 3ARBC 2J8OA 1JZ8A 3VXRB 1T1ZB 4UIKH 4F15C 3VFVB 2VLKB 2OQJA 4FQ2L 3EJZC 3TIEA 4UTBH 3X3FL 5C07B 3BIKB 4RRPA 3BEWA 4LMQE 4DKFL 4NUGH 2BSED 4JZJC 2GSGA 3GJFA 4Q6IB 3VRLE 3DX9A 5F7HA 2VL5A 2PW1A 4BZ2H 3MNWB 4EQ2A 3QNXA 1TJGL 1KEGH 5KSBA 1W0VA 4M7LT 4OZ4A 2MSPA 5E2UL 1NCUA 4YFEA 1U8JB 5CHNB 5GJSH 3AROA 4JN2B 3DOSA 1J8HB 3KLHC 1W0WA 3OR6B 3VGGA 5T3ZD 5JQ6H 1NGYB 3SHSA 2VDKL 3KPLA 4I48B 4PD4K 4R96B 2VDNH 4Z7QF 5HHQA 1LGVA 4O2EA 4YHLH 3VG0L 2COQA 3VA2C 1R3KA 4BH7B 4KRPD 2XKNA 3EZJB 4IOFC 5IKCB 2CKNA 3ZDXE 3O2WH 2RGSA 4F7EB 2XACC 2ID5A 4H20L 2AJYL 1KN2L 1NC4A 3LH2H 2BOBA 4LHUD 4UIMA 4PGCA 1D9KA 1C8PA 4I3GA 4X5XB 1INDH 4F58H 4WHDA 4UT6H 1Z3GL 4RDQG 3SOBL 3W0WD 1JK8A 4Y5VA 4EKXA 2E7HA 4BH7A 3OB0H 4Z77B 3NIFE 2W9DL 4Z7UB 3ARED 1OSZA 4Y1AE 1AGFA 5EUOE 1FAKT 1UM4H 3AM8A 2CO7B 2W0FA 1FVEA 1INDL 5CEXA 2ARJA 4OKDA 5DK2B 1ETZB 3ZDYF 1A7OL 1I4FA 1SQ2N 4UINL 4CU6A 2A6KB 2E9BA 1A02N 3PWLA 4KFZC 3P11L 3V4UL 4LLQB 1BIIA 5CEYA 1XCTA 2NX5D 4LK4A 2OP4L 3IDJB 4PB9H 3VFMB 4XVUD 3K4DA 2C1PA 4X7SL 4R0LA 5ETUB 2QR0B 4Z7UA 3QWRA 1QHOA 2QKIA 2RR3A 5HPMB 1TVBA 5JQ6L 3BP7A 2VDQL 5CGYD 4IMKA 4ZTOL 4LSTL 2BNUB 3RY4A 1G0XA 4MX7B 1YNLH 2VLRB 3VGAC 5KOVC 4YK4B 5CEZH 3QPQC 4LIQE 1B0GB 2R2HA 3BISA 3BPCA 1JGLH 2V2TB 5FKPA 1XCTB 5HGBA 1PLGH 2J6EA 5L7XL 5F9WB 1QSED 3NCMA 5EZIH 1GH7A 4OF0A 3QUXB 3NCBB 5CP7A 2BC4B 1NAKH 3JTSA 5JR1L 4KKLD 1CDBA 4NRXB 3QCTH 1Q1JH 3MLRL 3DROB 1KJMB 2R4SL 2Y6SD 4CN6A 1XZ0B 3MA7B 3L5JA 1S3KL 5GGRB 4P2RD 4E5XA 5CZKA 1HOCA 4HJ0D 2VAAA 4YHMH 3HC4L 3BH9A 3MBXH 1ORQA 1ZLSH 3B5GA 3E0GA 2EDYA 1YEDA 3WCYA 1CLYH 5GSVA 3KJ6H 5DD6B 2CRMA 4KMQA 2JCCA 1G7LB 2HVJA 5MHSE 2OTWB 4V1DB 1Z9MA 1LO5A 2JTDA 3BP6B 3WXVH 3ZE0E 3QI9A 3QRFM 5EOCJ 1KB5L 3MA7A 1X4ZA 3O4LD 5DEFB 3ULUL 4PJCF 3WJJC 1QFOA 4E5XB 1FPTL 3PNWB 4DQOH 4J3UA 2IAMB 1YPZA 2DQTH 3LN5A 5E8OA 3ZE1F 4R26H 1AR1C 3UC0H 5D6CA 2J1KA 4XP6H 3AXLA 4M5ZH 2WW8A 4PG9A 4N8VG 3TBVB 3O4LE 1YY8B 2EC9U 2OTWA 4L3EB 3SDAC 3U36B 4XT1C 1NL0L 5FUZH 4QRPE 2R1WA 1C08A 2JJWA 2LVEA 1YY9D 2NLJA 1DQJA 1A4KB 4RZCB 1LEIA 3O45B 3LN5B 5LQBH 5ID0A 2X70B 3O3UN 3UTZB 5CSGA 4HV8A 2OP4H 4O2CA 3AXLB 3IVKA 2I5YH 1S7SA 4FTVE 4CADA 3LEYH 4JKLA 1YA5A 2HN7B 4WHTA 5AUMB 5C0AD 4LLWB 2UY7A 3LQZB 2CIKA 4FNLL 3M8OH 1O5DT 2P7TA 2VC2L 5DZNA 1A4KA 3RGVC 5I1DA 3WFDL 3V9FA 1T89A 3BDXA 1DSFH 5EBMB 3C8DA 3OB8A 1RJLB 2X70A 5JXED 3V79C 2AEWA 1MHEA 3PF2A 5KSVA 3UTZA 1AGDB 4F7CA 5FM5M 3F12A 1IM3A 1UKSA 2NXYB 3C6LA 3MV7D 5ENWB 4DN4H 4WHTB 5J4MA 3B9KB 5IFAH 2IFGA 2FBOJ 3E8UH 5LBSL 2P7TB 2V2WB 1DBKL 4PRPE 3AU1B 3PQYB 4U1GC 3VXRA 3MRDB 1IAOB 2WWMD 3I50H 3FB6A 3MR9B 5EOQL 1T22A 4UV7L 2BERA 2G9HB 4FOMA 4YC2C 1IM3B 5GRUH 1DQML 4D9LH 1T1WB 1ES0A 4LCCC 3VWKA 2F5BH 3MXWH 2QQNH 3CXDH 5ISZE 4S1DD 1R5IB 5GGTL 1WT5A 5KSBE 1AQDA 3QULB 3TCLA 1HWGB 2ZOLB 5I15L 2A0LC 4P9ML 1S7RA 5EO1A 3PQYA 1IC4H 2QSVA 1A1NB 3Q6FA 1FJ1B 3CDGB 4LSQH 5D2LB 3B6SB 3MJ7B 5I8KH 4HKBA 3SKJL 3TT1L 2XXCB 2XTJD 5IK3A 1W0WB 2ZG3A 3QJHB 4Z8FH 1NGYA 3H3KA 1SM3L 1T20B 2MNUA 1NCDL 1Y6MR 2XZAH 3GMNB 3LS5H 4KVCH 1JHTA 4UNVA 4HXAL 3V0AC 2R1YA 1XEDA 1R3KB 4DK6A 4HDIB 3ULSB 2X7LA 4YPGA 5KOMC 2VDRL 1DANT 1MF2H 4MD4A 4WUKL 1WVZA 3VD7A 2XXMB 3O2WL 1WSST 4OCWH 4Y1AA 4QYOB 1T6VN 2BP3A 4WUUE 4HKBB 5B21A 5FYKD 2EYRA 1HXYB 4X5XA 3UPCA 5T3ZE 2PF6A 1U8OB 1WTLA 5DUBA 1J86A 2CIIB 1MF2L 4NO5B 3MYZA 3V5HB 1YEIL 3MNZA 1KF9B 1TITA 5DJCA 3RY6A 4K23H 2AABL 4CL7A 4NN7C 3RJQB 3I9GL 2PO6B 4UZGA 1CFQA 1A5FH 3PP3H 2W0FB 4OGZA 2P5EE 3U48A 3GJFH 3CDFA 2ZCLL 1ETZA 1MFAL 4MA8L 2VITB 2QADC 3PHQA 3TA3A 5IW6A 5IF0B 1I9RL 4JY4A 2DMKA 2X4RB 3MNZB 3QAZC 2Z91B 4WV1C 4Z7UE 1S7WB 1EX0A 1JF1A 3KS0H 2F8OA 4RA3A 3EO9L 3RA7L 3J8F7 3U7WH 2QR0A 1MJJB 4RFEB 4PG2C 2O93L 2X5PA 5D2NB 4DFIA 1MCOL 4QRUB 3QIBC 2VDPH 3TEUA 2P46B 3HCVA 4RAVB 3D48R 5CJQL 2NY3C 4PBWD 1FVCB 3ZKMC 2VDLH 4X4YA 1FHGA 4RMQA 2R9HC 3UXFA 2XFXB 1MJUL 1S7WA 2H8PB 1T0MB 4GAGL 3N1MC 3ILQD 1XIWA 3OAYH 1HSAA 3RI5K 1YYLL 3ARDC 4E0RB 5KG9B 4KMTL 5TH2B 4UT7H 2XV6B 2EDJA 4ESKA 4BFIB 4XTRC 3SDXA 4ORGA 4K94C 4KTEH 3HCVB 4ONHB 1YEGL 4CRPA 2QSCH 2VAAB 3HNSL 2B5IC 1URLA 3CUPA 2PYEA 8CGTA 3U4BL 3G5YA 4BQCA 1WC7B 2YRPA 1HSAB 2HT2C 4MJIE 4P4KB 4AIZB 4X8JA 5KG9A 3I3EA 2LTQC 3V5KB 4RIRB 4BFIA 4OUUB 2R0LL 2M8XA 5I1LB 3RZCD 4LCCA 1NANH 1NANI 1OGAE 3NCYS 1SYSB 1RFDL 4HGWA 5C71A 4S1SL 3ARRA 3ARGC 4O2FA 1IBGH 4L3AA 1F2QA 2PYEB 1X5FA 4XNUL 5KS9F 5FDYA 4XNQA 5D6CB 5EULV 1KPUB 3V7AG 2XWBB 1IGYA 3STLB 1KEML 4ODWA 1XF2A 3BMWA 4PV8B 5HDBF 1QBBA 4M5ZL 1G7HA 4KI5D 1N7ML 3S7GA 3ROLA 3STZB 5ISZA 4K3GA 5D1QB 4M9PA 4HIIB 3NMEA 4I0PA 1I7TA 3IDUA 1OTTC 1B0RA 5MEQB 4M4PA 2DWDA 5B8CB 3VE0B 3PQYE 4HKXB 3MROB 3DETD 1S7TB 1UKTA 3KYAA 2DKSA 4P5KB 4ZQKA 3ULVL 1XGQB 1KN4H 1U8QA 2HRPH 1EEYA 1U8NB 3LCYA 3VG9C 3N50A 4NP4L 1IGMH 4LLDA 4NO2A 4W4OC 1RD6A 2Q8AL 4XBEL 1KCSH 1AO7B 1G9NC 4O5LL 3MLPA 3VXSB 4OZHF 4P4KC 1ERNA 4I0PB 4OCYH 1WTGT 2HMIC 3G08A 5CGTA 1AJ7H 1EA9C 3C6LD 4M1DH 2DWDB 1BGXH 5B8CA 1WT5C 5E8DL 1G6VK 4P3CL 2DF3A 4NC0B 1RUAH 3A6BH 4ZUVB 3BPOC 3I02A 3HLAB 4KK8C 4D0CA 3GSRB 4WU5A 2B8OT 5JW3L 3MX0A 5T3ZL 3B9KA 2VXUL 1BFOA 3QISA 3FMGL 5E4EB 5F1KC 1CFBA 4EUPH 1JMXA 1MREH 1JGLL 3ILPA 3DSNA 2CLVB 3MMEA 5GGQL 4EDXA 4D94A 4R2GB 2AV7A 3BMVA 3S96A 4LASH 5KVDH 1IILE 5ACMA 5ICZA 4L8CB 5T1LD 1U8HB 1TZGL 2BVEA 5MEPA 3VJ6A 2Y07L 4LAQL 5AZ2L 3RAJL 3QULA 1OAZL 4HGMA 2RQ8A 4ZFOB 4GRMB 2FX9L 2HTKD 4ZPVB 3DRQB 2JK5A 4IRJA 1U91B 1A6UH 1WAAF 3RJDA 3SDCD 2BOCA 5I8OL 1NDGA 3U0TB 4L8SC 1VADA 4LPCA 1FYTE 3QEQA 1T1YA 4V2BA 2NY6D 1MPAH 4PJHA 4V1DE 8FABA 2DKMA 5MI0C 4LP5A 1LHZA 3SCMB 4QLRA 4DZBB 1MCHA 2G2RB 3FHQA 4HDIA 1ZVSA 4TPRH 2VR9A 1FFNB 4M62H 5L9DH 5I71C 1U91A 2K3TA 4H0HB 1MFDL 2FO4A 4LPUA 5I15H 4NQCB 3KPQB 4NZJA 4P46B 4HFWA 4KU1A 3VFWB 2NQCA 1F58H 4NZTL 2F53D 2F5BL 3QHZL 4PRDB 3ZSSA 5L0QB 1KNOB 4R2GC 1LP9A 3WFBL 2GTZA 2AEQL 4XMKL 2BVPA 4R7DA 5DDHB 4WUUB 1KTLB 4G9DB 3NFPB 4PJ5D 4KY1H 1ZWIB 3O81A 4HX1A 4JAMB 2YD5A 3KPPB 2AEPL 3H3PH 4ONFH 3TIDB 2HWZL 1Z5LA 3LVEA 4W6YB 4GRWE 3FOMB 3DX8B 3KYMB 4QHKJ 4UV4L 3RNKA 2YK1L 4NRYA 1A3RL 5IF0A 2M26A 2V2XB 4N9GB 4KK5D 3BO8A 2DM2A 1LP9B 5A2JH 3ZT7A 4PB0H 5F88A 5T1KA 1RZ7L 4YX2L 1I1YB 3T2PA 3MJ8A 1FBIL 2A83A 1YEFL 3H8NA 4JJHA 4Z95L 1S5IL 3OJMB 3WNNA 1YECH 2JJVA 2B2XH 5FA3A 3RL2B 1D5MB 4GKOA 2XZQH 5IQ9A 3MODH 4U1HB 2H2SD 1QLRA 1B90A 2G75A 3EOYG 3FOMA 2CLZA 4KK6C 3MLWL 2B1HL 5SX5H 4XC1H 3HR5B 3RKDD 5FKAB 4HZLB 1OF2A 4NQCD 2P5WE 1WCBB 4JFZL 4RA0C 4JM2D 3BGMA 4M43H 3NPSC 2KL6A 2GT9B 3HE6A 3OJVC 4OGXL 5MP6L 5IQ9B 3V6OE 1SYVB 1O7VA 2NXYC 3EYOA 2HT4D 3U30C 2WP3T 15C8H 1NLBH 2OI9B 3D85D 1CG9A 1I75A 4HZLA 1CIDA 3AVEA 1HINH 3S4SB 4MB5A 3H3PL 3BP5A 5D8JL 1CXFA 1OW0C 5LKNA 1GCFA 3NCFB 3C2AL 4YDVB 4EI5C 4DEPB 4KK5C 3LKQB 4MNQD 2PYFA 1T1XB 4UT9L 3U0WL 5CUSH 1L4IA 3N1GC 3PGCA 5IHZA 4Z0XB 5BMFH 3RU8H 4MQ7B 1NC2B 3QCVH 5E99H 1CLYL 2R29L 4X7CC 2OSLB 1PSKL 2H1PL 4H26B 4ZG1A 3JWNC 1G7PA 3P4LA 1UB6B 2WINB 2ICCA 1GGBL 4PJBF 5DFVC 4K7PL 5DQDH 1E4XH 1JN6A 2XIDA 1CXKA 3ROLB 5CJ5A 5T3ZH 5LAXB 2AEPH 1D6EB 5CAYB 3U0PA 4YIQA 1MAMH 3PWJA 3VRLF 2GFBA 3LS4H 4TUJA 4LRIA 5FHBH 3T0WA 4PGDA 3HMWH 4NWTL 2XQBL 3HUJB 3UROR 5CBAA 2X4QB 4NJAH 3ULUE 3BQUD 2GTWB 4QRRE 5DS8B 4EUPA 4AH2A 1U6AH 1GGCH 3EJYD 3NA4A 4RGNE 2Z9TA 2Z0BA 4WCYH 3BZDA 2H32H 5FYKL 3UAJC 2BCKB 1B4JL 4Y4KC 1J1PH 1MLCB 4CVWA 1KBGH 2ZNXA 3G5XB 5KSUA 1WEJL 2VDOL 2DQFB 3RVTD 1E27B 2Y07H 4LAQH 1CXHA 1ROWA 3C9NB 4JJ5B 3QFDA 5DVMA 2J8UE 4ZNEE 3U6RA 3TJEH 1VFAA 3MFGB 5JQHC 5L2JA 5F9OL 4LNRB 5GRVL 3RWFB 1NGQH 3KVQA 1CVSC 1GGYA 4BSVB 4BA8A 1I3RA 3CFIC 2GTWA 3ULUC 4Y19E 5A2KH 4AYFA 3RUGB 1B4JH 1MPAL 4W4NA 1LO2H 4GXVH 4UU9A 5GGQH 2Z8RA 4QT5B 1KB5B 1DBML 3QXUA 3MO1B 5D9SB 1MLCA 4YHKL 4MD0B 2G5BB 1KJ2B 1W8OA 5H2BB 1QSFE 2MCPH 1KJVA 4JANB 1ZLUH 3FB5B 1DEDA 1DQDH 3GSQB 4MQSB 2APTA 4OBSA 3U6RB 1KPVB 4N8CL 3GSUB 3L7FB 4XPHH 3TZVD 3RAJH 4OLZH 1TFHA 3E6FB 4FQ1L 2AV7B 1M6OB 4U6VH 1P7QB 1WICA 3P4MB 3RUGA 1RPQA 1CE1L 2Q86B 2CXGA 4XCEA 4KDVA 1OGTB 4D9LL 4FFYL 3B2UC 5A16B 3QUMA 4F58L 3LRGA 4JFHD 2XYCA 2E6JA 1DE4A 4PRBB 5BZWA 5H2BA 4WO4C 1K9TA 5JXEA 1J8HE 3C2SA 4GRMA 2BJML 4AEFA 4AMKL 3BI9X 1JYWA 1CWVA 3HZKB 1A7RH 1GGCL 3T8XB 3T09A 3WO4C 5CUSL 2VQ1A 3QO1B 3L7FA 2EEAA 1U8KA 3IFPB 3KPNA 1A7PL 4JQVA 1P7QA 3P4MA 5DJ2A 4JRXB 4Z78B 4NT6A 5FM4A 5C0AA 3NZ8A 1HDMB 1LEKA 4GKZB 1XCQA 1BQLH 3BKYL 2W59A 1L6XA 3O3BA 5IEKB 5CILH 4H8WC 2KQNA 2NR6D 1F4WH 5DJZA 2R69H 4JZNA 5BZWB 5D5MB 4JDVB 1ZVSB 4WFGE 3TN0B 4PJ8C 5J12C 1OGAA 5IFHH 1U2CA 4Q0XL 1F4AA 4M3KB 1EAPA 5GHWL 4JPVH 4NCC1 4LCUA 1N59A 4HS8H 4H88H 1PY9A 5BRZA 3ZE2F 2X9YA 3ELAT 2P8LA 4PRDA 4IDLA 3MBEC 1FFPA 2GKIA 2OK0L 1NCWH 3BXNB 5DQJA 3TPUA 1G7IB 1D6VL 1CQKA 4WUUA 3BPNB 3UYRL 4G9DA 2CDGA 4UIKL 3D39B 1IKNA 5BMFL 3GMMA 5C0EB 4PJGA 4DVRL 4Q58C 2X4NA 5C86A 3DX7B 3KPPA 3FQTA 1AC0A 1S8DB 1FO0A 5HI4C 1KXTB 3C5ZC 3P77A 1LDPH 5E5RB 1BQUA 1KCUH 3FRPG 1JI2A 4G8GD 5LG1A 1DEEB 3DMMB 2GYSA 4WI3A 1OP3K 4M4RA 3QEUA 3UDWA 3IAQA 4PGEB 2A6DB 3RI5F 1NBVL 4HMEA 3D39A 1E6OL 1K4CB 4AQOA 1CXIA 2B0SH 2H3NA 4MJIB 5A1AA 4P5TA 4OF8A 1RZIA 2IPKA 1BJ1J 2ADGB 2BVQA 4DVRH 4OGXH 1KJ2H 3FRPA 3UMTA 1FRGH 2A1WH 4LHUB 4QEGA 3SJVE 1RZJL 1MCOH 1XF4B 2A6DA 3MBXL 5EU4B 1HNFA 3BVNA 3RPIB 5C0DA 4I4WA 1J18A 1G7MB 4K2UL 3HPJA 3MRIA 1WFOA 4P0DA 2ESVB 4XGZB 4PRIE 1FL6B 2APWA 4HK0B 3QUYD 1MCFA 5FO9A 3DV4A 1T4KB 1DQQB 1N6VA 1HQ4B 3QEHA 4QNPF 3VRIB 4ZNEA 5AYUL 5TPWL 3S4SA 3DMMC 2EEDA 4HJGA 3BUYA 4MZ2A 2GJJA 3TBWA 3O3DB 1U3HD 5E5UB 3VXMA 2ZCKL 1I1RA 3C8KB 2WZPD 4ZUTB 3Q1SH 3ZKND 2DQUL 2HJKA 1WWAX 4XMKH 4AL8H 1TNNA 1JGDA 3FONB 3D0VA 2PYFB 4M1CD 3G6JE 4XMLH 5E9DD 1E4XI 4HK0A 4PREA 5FO9B 2CR3A 4I5BB 4JPKH 2G60L 3HAEA 4RGOH 5FEBA 4YFDB 1EVUA 3BGFC 5HBBA 4X99B 3T0DA 3NIGE 3HPLA 1MFEL 4XPFH 3IKKA 3TT3L 4O9HL 5EA0L 4BH8A 2YD7A 1JWMA 5MEOA 2WINA 4U1GB 4JFPB 5KS9A 4ZFOL 1JRHH 1GC1C 2FIKA 2RB8A 3QDAA 1EEQA 3WN5C 1VSCA 3MZGB 2QQQA 3GKWL 2EC8A 4DN4L 5HYQA 3F6IA 4NCC2 1RULH 4NSKB 3VW3H 4OD2A 1LVEA 2LAAA 1SMAA 2UWEB 2BVYA 4X6CE 5K9KB 2ILLA 4J2XA 4OZIF 5LGJB 4Y4FC 4X99A 3FQNA 2WSKA 3NTCH 1DBAH 1EO8L 3MXWL 3VW3L 5EN2B 5HGAB 2VLRD 2EXWD 1A4JB 3DTXA 1LEGB 4G7VL 5FECA 1ULVA 4ZS6D 1CICD 3QHTC 5CMAA 1D5ZA 1DBMH 2PTTA 5E00B 1FVDA 2DIJA 5EZOH 3RWHA 1AKJB 5ESQB 1I1FB 5K9KA 3RWGB 2Z92B 4YXHH 1NMAL 4ZS7H 1KELL 1P4IH 3OR7A 3CPLA 4GXUN 2AI0L 5IFAL 5E99L 4GW4B 2B1AL 3IDIB 4H8WH 1I3RB 4NP4H 5F9OH 5K59E 4KVNH 5KJRL 3C60D 5HYFA 2HRPL 4G7YH 4GRLC 4PG2A 4XCFH 4CJ0A 3D9AH 4LVHC 3BPOB 3DTXB 1FL5B 2ITDB 3QDJD 4LRNH 2IWGA 3T65B 2IANB 2HT3C 3MV7E 5EC2A 4QRRD 1IC7L 2QEJA 1NGPH 1P6FA 2PTTB 1ND0B 1T04B 1FNHA 1R0AH 1LQSR 1GZQA 1MREL 3GSOA 4LU5H 4R90H 4EUPG 3CZJA 5C6TH 5TQ0H 1B4RA 3TBYB 5GGTH 3EHBC 4GG6E 1UYWH 3CFBA 3BSZL 4N90D 3QXTA 4GBXC 5EUKA 1I3GL 4Y5XA 1FZOA 3OF6A 1U42A 2OR9H 1Z9OA 5C0AE 3RGVB 4LHQB 2ZUWA 3SCMC 4HPYL 3VXMD 1J1OH 2Q7NA 2WBJB 1NDMA 4MMXC 2ADJA 1T66C 5E08L 3V6OC 4JGUA 2GSIA 4P2QB 3V4PL 5JXEC 4ELKA 4O5LH 4NRZB 2VQ1B 2EO9A 3QIWC 3NGBC 4TUKH 3S5LG 4HWZB 5IVZA 2WM0A 3V2AR 5DQ9A 2IBZY 4GG8A 3PWVB 3UTSD 5BV7L 4P59H 3RX5A 3IRZA 3QIUC 4NKQB 3TO4A 2IFFL 4CVXB 2YD1A 4TSAL 1BX2B 3U9UB 1PD6A 5DRZA 1A9BA 1OM3H 3HNSH 1J11A 5JHDE 3ZTJH 1HXMB 2XKSA 3T3ME 3G9VA 3WFDH 3QDMD 4HT1H 2QQKH 2DM3A 2RIKA 4I77H 5FGRA 2BRRH 1CBVH 1C5CH 1AP2B 2AEIT 1EHAA 4OUOA 3MLUH 2H2SC 2BNQA 4C56D 5K9JL 3LRHA 4GG8B 2GK0A 2GSGB 3GJFB 4H0GA 3EYUL 1PYWA 1XGPA 5HYJE 3GSNB 5C2UB 2JJTA 5IOPA 5DC0A 2Y7QB 4JB9L 4JM4H 3QNZB 1LP9F 5INDB 4YHML 2ZUYA 4TSBL 2YD8A 1N3NA 3MLWH 2CDGB 4RFNB 4JN2A 2R0KL 3NCJH 3QPXH 1P9MA 3MV7B 4OF3A 4X4ZA 4XPGL 4KGLA 3KPLB 5IMKA 1IC1A 4P46D 4WWKC 2DYPB 4ACPA 4RGNC 4YNYA 3UC0L 2Z35A 2APXA 3HG1D 5A40E 5FYJD 4F7EA 2AKRA 4LIQL 3HNTL 4JFXB 4MMZC 2FX7L 1PY4A 2DLHA 3H9YA 5HI3C 2OM5A 3GI8L 3JZ7A 4OFPA 3SDDD 4P4RB 2BXZA 3X17A 1YQVH 2J12B 2OTUA 3FQRB 4HF5L 5ID1A 1QLEL 4D9QE 3TBTB 1RI8A 1N2RB 3CX2A 4WFFE 5E6ID 4AIOA 4NOFA 1ZK9A 1P1ZB 5GS1B 4Y5VB 4DVBA 4YNYB 3MREB 3V5DB 5DMJB 5CEZL 2HTLC 1DANU 2CDFA 4RISH 2CUMA 2PO6C 4ZD3L 3ORJA 4M6MH 3BOVA 4XAKD 5EBWA 4JZOA 3ARDA 1ZT1A 4ALAH 3QXVA 1P69B 4JCMA 3HI6L 5C09B 4YHOL 4PUBL 3WFHA 1J8HA 1HNGA 5JHDB 3TYFA 4L9LA 3VG0H 2ESVA 4DZ8A 3PHSA 43C9B 1ZVYA 2JIXA 3SGKA 5SWSB 3M1BB 4PY7A 1QFUH 5GS1A 1RK1A 3IDGB 1JWUA 4PJIE 4DVBB 1H3WM 5IQ7L 3W9DB 4F9LC 3D69A 1ZGLM 4G5ZH 2DJ4A 5KVEH 1UZ8A 3K1KC 4Q7DA 2I27N 5A2FA 5AAWA 1S7XB 3BWUC 4KV5E 4JO2L 3V6OA 1OLZA 5ANMB 1QQDA 4N0CD 4P2YA 3RIFK 1J1XL 4MX7A 4OD1L 3CXHK 1S78D 5BV7B 2VR5A 1YEJH 3QRGH 3WLBB 4PRPA 4BK5A 1JGVH 5DRNB 4AY0A 1H3XA 4JO2H 4YZFF 3V0VB 5HGBB 5GRUL 4BZYA 1FIEA 3TNMA 5IFJA 4YDJA 3VFUB 5T1MA 3WFBH 3UTSA 4YJZL 5I8OH 5IT2L 4RGOL 1J88A 1F45A 2DRUA 5C0BB 3RKPA 1S7XA 1FIGL 4GG6A 2V7HA 3PL6B 3HRPA 1BZ9A 4AQ1B 1EEUA 3S35L 5JOFA 5CEXB 2WK2A 4YWGH 1X5ZA 1AGCA 4IM8A 3OXSA 5DD3H 1LE5A 4FABH 1ACYH 1HEZA 1V8HA 4U1NA 2VZOA 1ZHLB 3N85L 3BZ4B 5FA4A 1B9ZA 4GRLA 2CDEA 3GMQA 3HS0A 3I2CH 3HI5H 3S36L 1JPFB 3B5TA 1G7JB 3FKUS 3ARFB 1TJGH 3O41A 4PGZA 4XPTH 3NOIA 4Q9RH 3TA3D 2E7LA 2EXYD 4NWTH 2HVJB 2Q87A 3VGEA 3V0WH 4CVZA 3GHBH 5HPMA 3UZEA 4X6BA 4EN3A 4QRSA 3QI9B 2P8PB 2RAMA 5F9JA 3SKOA 3SKJH 3TT1H 4HIEB 1NUGA 2VTFA 1LE5B 4YGVB 4Z6AT 5GZND 4U6XA 3PNWA 2NZ9C 1DDHB 4OLWH 5IBUG 3KLHD 1FVDB 5FKPB 1T3FB 3HS0B 3MOAL 2HFEA 4Z7WB 1KFAH 5L0QC 4KJYB 4JE4B 1MH5A 4N0FA 3SDAA 2A77H 3CFEB 3RIAF 3MLYL 1H3TA 1C12A 2YD6A 2E5EA 3IU3A 3FFDB 5IVXE 1P4LA 2HJFA 4MAUH 4I3RL 4KROC 3X13B 1DQJB 5M94B 1I7UA 1U92B 1IEHA 5E2UH 1MJ7L 3QO0A 5HY9B 1FAIL 2ZCHH 1IL1B 3PL6C 5D5ME 3TBSA 3NBNA 2UZXB 1CFVH 5D7JB 4LCWD 3BRDA 5DR5H 1HHKB 3FO0L 5E5MA 3KJ4C 2QADB 2ZG2A 3LZFH 4C83A 4L8BB 2Q20A 4ZOEA 4JQXA 2JELL 3KS0J 1AGEB 3CFBB 5D2NE 4MQXD 4MNQA 5IIEA 1TVDA 4Z7VB 3IU3B 1OAYL 4F37K 4KKNA 1NCNA 4ENEC 3VFOA 3G6AA 2A38A 2NYYD 1CFVL 5DURB 5BW7A 4LCYB 5I1DB 5CJOH 2CGRH 1J0JA 4P23D 1QFHA 4OLXH 2E27H 1DQLL 3BJLA 3TN0C 3WLWD 3QSKB 1T2QL 3VFTB 1RIHL 4ONGH 4PJBB 1HHGA 3LN9A 3Q5OA 3LEXB 1AIFB 4HUMB 3SE9H 2W9EL 4FTVA 3PABB 3QWRD 2YUVA 4JHAH 1WBYA 5FGCB 3MNVB 1FFOB 5GGVY 3HZYA 2MPAH 5ITBH 2AJVL 2DI9A 2VB5A 4F8QA 1MWAH 1A6TB 1EHLH 1TQBB 4YZFE 3VFOB 1H8OA 3BHBB 4JM2A 2YC1A 2W0PA 3MR9A 4KTEL 3QWQB 5I18L 2N56A 3DWTA 5C6TL 4F9LA 4O2CB 5IM7B 4FQQA 3AAZB 3MOBL 4I0CC 1FPTH 3BSZH 4XMPH 3LB6C 4NBYB 1R5IA 3EOBB 2UYLA 3OKMB 1AQDB 3RVVD 3BX7C 4TNVF 5HVHB 1FFQA 3H0TB 2ZOLA 1RJYB 1A2YB 2FJGA 5IMMB 2DQTL 2QV2A 3DIFB 3F8UB 2EIZA 4X6CA 2Z93A 5T1KD 3UPRB 2GHWB 4JG0L 1T5XB 1RJLA 1X5LA 3D2UB 1YQ2A 5GGVH 3RVWC 1OAKL 3BIKA 3BKMH 4QOKB 1T0NA 4HH9A 4RGNB 4EI6A 3O2VH 2A77L 1FC1A 2DYPA 4OZFA 1JHTB 2R23A 3FQUA 5I19H 2PTVA 2V5YA 1UCTA 3RWEB 1IEAB 2EXYC 2GJ6A 3GMRB 3VXUE 3F5WB 1CD8A 5KSBB 3QCUH 1BVZA 4CNIB 1U8JA 1Y18A 5DF0A 1SY6H 4K7PY 1T5XA 4QYOA 1WGOA 1QPPA 4Y4FB 4NWUH 4OD1H 3NZHL 3P9WB 2E7LC 4WW1B 4ZXBD 4G42A 5GS1C 1OAQH 2Y23A 3WJLC 1QD0A 5HGDB 1FZJA 4QGTA 3FO2A 1S9XA 3QXDB 2HFGH 2R23B 3ARGB 3VH8A 1YMMA 1N4XL 1KLFA 4ZO8A 4XP1L 4D0BB 1S7RB 1KENL 2AJYH 2CK2A 3IETA 3HE6C 4JZOB 2PO6A 4APQD 1ZT1B 2EKJA 1MQKL 4ETQB 2DM7A 1OQOA 3AC0A 4UOW1 1KCVH 5TGBB 2VITA 2R1XB 3S37X 4M93B 2EDLA 3ZKXC 4WW1A 5MI0B 2NXZD 2XZCL 3VDCA 5L8JB 3AS2A 4WUUD 4NJ9H 5I1EH 1T20A 3MLYH 1EFXB 2I9LB 1T89C 5FYLL 1N5YH 2IC2A 1MVUB 3U46A 1S9XB 4ZOBA 2NTFA 5HI5D 5SWSE 1MRCL 2E6PA 4JRXE 3KR3L 4S11A 3JSSA 3ZO0A 3U4AA 4OGYH 2CLRB 1E4KA 1FVEB 1WWCA 4G6KH 4LQ1A 4DGVH 2X1OA 4YLQT 1Q72H 2DQUH 1BVKB 4A2LA 4PRPB 3RWJA 1RZKH 3HC0A 5TF0A 3U46B 4TRPL 5CBEA 3BT2L 4NKDB 1T0MA 4RAHA 4XX1E 4YGAB 4UTBL 2ERJC 5IFJB 4M1DL 3UTSB 4NN6C 1JRHI 1Z3GH 4G6MH 4IRZH 1GHFL 1BZ9B 3H9ZA 4F3FB 4O58H 2I9TA 1QSFB 5I73B 1GIGH 1UWXK 6CGTA 2DBLL 3KDMB 3MRMA 3UP1A 6FABL 1HEZB 4J4PC 4JO3L 4PGBB 5F7DA 3WS3B 2VERN 1KENH 2XNAB 2V2TA 4FQHA 4CW1B 3AREB 1BVLB 4NQEE 3ULVD 2Z91A 3SE8H 1JF1B 1MQKH 3LQAC 3C5JB 4L3ED 1IMHC 3QI9C 5JA9A 5EU6D 3JUYA 2JB6B 4K71C 1XIWC 3NCCB 1X7QB 1HILB 3DI2B 2FD6L 4KAQH 5F9JB 1XZ0A 1X3DA 1XR9B 3VXOB 4D8PA 5I1LA 4RAVA 3MRMB 1TETL 3MC0A 1HOCB 1EERB 4JDTL 1LK3H 1KIRA 1ZHBB 3WLWC 4N8PA 5JOEA 4Z7WA 4P2QE 1K8IA 1RFDH 5DD6A 5FV2A 1D9KD 1MCNA 2JCCB 3MUY1 5B39G 2QQNL 3VFPA 1KCLA 3QDMB 1LDPL 1XGYH 1CS6A 3STZA 4JY6A 5DJAA 4W68A 2AJVH 2OCFD 1CDYA 4IRSB 5D7IA 2ZUTA 2R0KH 2DDQH 3I50L 4FG6C 4UDUB 4PJ8A 4WDIA 2MKWA 1KIUA 4N8VB 3FB7A 1MFCL 3I6LE 3P30L 2B39A 2LAGB 3MGOB 3M45A 2BVOA 3C08H 1ZLVH 3QUKB 5BO1H 5BXFB 2ZG1A 4MSWA 3I84A 4TN9A 4XMPL 3WUZA 4N0UB 3S97C 1MVFA 3MLTA 2F5AH 3QP3A 4MNQB 5C0IA 5IIEB 2IBZX 4I18A 2VDMH 5BVPL 4YBQC 1RZ8B 1N0LA 2E7MA 4U1MA 3C5SA 1KGCE 4P2OC 1YEEH 3PE9A 1JNHB 3G08B 4N8VA 4WO4A 4P57A 2W92A 1OM3L 4O2FB 1HHGB 2IH1A 1RK0B 1MCBA 4DKEL 1OCWL 3PABA 5GS0D 1CFTB 1F58L 3BN9C 4GXUM 2CH8A 1IAIL 4NZUH 4DAGL 3LRSA 4I18B 1DVFA 2EICA 2EC9T 3L5XH 4F57H 1A6TA 1ZLUK 4QY8B 3V4PH 1IM9D 1F90H 1OL0A 5EU3A 3ILPB 1I7TB 5E08H 5DT1H 5CZXD 1U8MA 1OT1A 4Q2ZA 1OHQA 3B3IB 1A14H 2R4SH 4WTXA 1OT2A 5DRXA 3FQXA 4CDGC 3HNVH 3VG9B 4FQJL 4HD9A 3QB7C 5GXBB 1UACL 4AEHH 1UCBH 3VXPB 1F8TH 4NQXB 1UXSA 4YHKH 4X5WA 1VPOL 4ZFOA 4NQSB 4ZPVA 5DHXB 3AU1A 1P2CB 1JHLH 5TE4L 4JZJB 2FX9H 2Z93B 3UPRA 4Y7MA 1CK0H 2Z4QA 2NY5L 1YNLL 4ZS6C 3IYLW 4Y4KA 5TE6L 4OLEA 1K4DA 1G0DA 4K7PX 4LDLB 4WHYH 3LKSA 2FR4A 4IIQA 3VXPA 1UXSB 4FXKB 2A6IB 4HHAB 4R8WH 2FECL 1JPGA 3VDBA 2JKXA 4PFEA 4IMLA 1ZGLB 4KZEH 3TVMD 2KDGA 4HBQA 2YPKB 4X83A 1OTSD 3CDGA 3B9DA 1JYVA 4RQQA 3O11A 2GUOA 4C59B 3KPQA 2BZDA 1QEWA 5D71L 1JPSL 4YH6A 5I1CH 2BHUA 1OWRM 2BK8A 2Q8BH 1M7DB 4G6AD 5JPNB 2H2PC 1NMBH 2BVUA 2VH5L 4JFFA 5B4MC 3FO2B 3QXDA 4NQEB 4Y1AD 4YFLF 1J1XH 4M7JH 3DVGB 3DRQA 1MAML 1BFSA 1ZGLA 3PWNB 4JAMA 3CFDA 2FHCA 4I3SL 4HIXH 4CMHC 5I75B 3WDIA 5F1OB 2R1XA 5SWZB 1V3MA 4PJ5A 3DX8A 4XAWL 3H9SE 4NRYB 4AT6B 5DUBB 1NMCC 2ED7A 1OP3H 1CU4L 3MYJA 4KUZL 4G6FB 5DJCB 3BQUB 5F7LB 2G60H 3W11D 1QPXA 5F7KC 3W5NA 3CU7A 3CFDB 5MEND 1RUMH 5DA4A 4KQ4L 2GAZB 3FFCE 3Q6GL 4U1HA 1I8KB 1JIBA 1HI6A 1QO3A 5HD8D 1I85C 3Q1SL 4P46A 5SWZA 1I8IB 1SVZA 3O6FC 3C2AH 1R3IL 2HG5A 1KEMH 5IW1B 2AV1A 4ZDHA 4JFDE 1KEGL 2P43B 2CRYA 3OKEB 4DW2H 5ITFB 1AHWB 1TCRB 1CYGA 4YAQA 2ATPB 4KJPC 1WQVT 4I0PC 1XFPA 5DI8A 2C4FT 5HXMA 4V2CB 2AK4D 4WI7A 4A6YB 1T0PB 2FJHB 4J3OC 2YWYA 4ZFGL 1AXTL 4J3VA 1OLLA 3SDCA 1EXUB 2XPGA 2FEDD 3HE7A 3ARFD 4IMKC 5J1AB 4X6EB 5HTSA 1H3UA 3GMLB 3BYYA 3Q3GB 4XP4H 4C56A 2GJ6D 5F7DB 3WS3A 5DJ6A 5MENE 4HKJA 3GGWB 1DFBL 5FO7A 4RRPG 4WI4A 3MJ9L 3E1F1 1CL7I 1TQBC 3B43A 4G80B 1KTDA 1MCJA 4G3YL 3ISWA 2IQAB 3EDEA 5D1ZD 1B88A 1RHFA 2VQUA 2VDKH 3I6GA 1X5JA 1Z9SA 4YDVA 1P9MC 5C0BD 1JZ5A 3RL2A 3MBEB 3TO4D 3O9WD 3H9SD 3GI8H 2NMSA 2CLZB 4UBDC 4GSDH 3S9DB 3SQBA 4OLYH 3R1GL 4NKMB 3IJYB 2AQ2A 3O6ML 3UEZA 3OX8A 1F4WL 5AYUH 4ONFL 1QA9B 2WWKT 4NPYA 2AK1L 4NUJB 4G8EA 4PJHE 4L4VE 1UB6A 4OFYD 4KY1L 4ODXA 3F58L 1UM5H 3ARVA 2DLFH 2QLVB 2K9UA 3KYNB 3FT4A 5DO2C 4R0LC 4U31A 3FL7A 4XC3H 3WXWH 5GZOD 3LV3A 3P4NB 1FH5H 2QQLH 4RIRA 4IRSA 5HDBE 1IAKB 2WQRA 1IAMA 3LKNB 5J1TC 3OQ3B 4U6HB 1IARB 5HDQL 5CJXC 2X4PA 3IB4A 2FSEA 5FIEA 1CL7L 4HUXA 1NCWL 4L4VB 4AH2B 3BP5B 4NPYB 3KPRD 4MSWB 1TENA 1CDCA 2VJXA 5EZOL 5GS2D 3I6KB 5ACLA 4LHJB 4L9LC 2C3VA 1BZQK 5F1NA 4U2YA 1FYHB 4U6VL 3MV9A 3F7VB 2OZ4H 3HKFA 5IV2B 4FFYH 1E6OH 2C9AA 4PJIB 3LKNA 1VESA 1BF8A 4QTHB 1QRNE 3GSNH 1JNHA 1QNZL 1QHPA 1VFAB 2CGRL 7FABH 1B0RB 2BSSA 4KMLB 4GW1A 3SKMA 4P57B 4HQQH 4WFGD 5F72S 4DW2L 1G7PB 2BRRL 1CBVL 2ORBL 2VLMD 1CFTA 2OXHA 3EYSL 5J9PA 1N64H 2F54E 2FLBT 1A7PH 4MGXA 1H0DA 2P5EB 3ZHKA 1DVFB 5I73C 3PGFH 4HZAA 1IGFL 3H42H 4J3XA 4FZEH 1TZHA 4YHIB 4QTHA 4PGDB 3LDBB 1TZIA 5CIPB 5JXAH 3FO1A 4JFOB 3KHOA 1ZLWK 4E41B 5L6YL 3F62A 2R2BA 4PLNC 3W9EB 4Z7VE 3B3IA 4HWNA 5DS8A 4EUPB 1PKQE 3TJHD 3KLDA 1S78C 4ZUVA 1CI5A 1UM6L 4FZEL 3QQ9C 4OIIL 2OLDA 4HUNB 3BJ91 5C9JB 2VXUH 3HHRB 1CZ8L 5C9KA 4GMSH 1E27A 5IEHA 1BAFH 1UT9A 1ZHNB 5T1DL 1F6FB 1BF2A 4NQSA 1EJOH 5IFHL 2WIIA 3MRHA 3HZKA 1T83A 1P2CA 1U8PA 1EFXD 5BS0E 5L2KE 1H15A 1F5WA 3CK0L 4G9FB 3QAZB 4YHPB 3RUGE 5D93B 2WWMC 3FN3A 3W9EA 5HHNB 1ADQA 3LMJL 3RIAK 2IALA 1FCGA 3KLAA 5FFLA 5D9SA 3DUUA 3V4VH 4P3CH 4QRQA 2G5BA 2HRLA 2YBRB 2L0DA 5TQ2L 3BN9D 4EXKA 5GS0C 2ZPKL 3MRHB 1KG0A 5EWIH 3GSQA 4L4TD 4RGMC 3KYKH 1KPVA 3QYCA 1OSPL 4H8WL 1NDGB 5I76B 3U0TA 5HI3D 3V4VL 1KBGL 3QQNA 4LQFL 3DVNB 1GRWA 1C7SA 4WFED 2IBGA 2IALB 1M7DA 5EWIL 3U30B 5JPNA 3VD3A 2WBJC 1ZGLP 1FFPB 3L3JB 1FDLH 1I9IL 1G7IA 2YBRA 3DECA 2A9NH 1A6VH 3LAFA 4ISVB 3JTTA 3L7EA 4CMHB 1E0OB 4LLYA 4PJGB 3V7MA 5E4EC 3QUMH 1YEHH 4KRNA 3SKUD 3RHWF 4Y5XC 4MAYB 2VKXA 3P77B 1HZHH 1A6WL 4GLRH 5F96L 5SWZE 4JO1L 3V95A 1IZKA 1ZLWH 3MRPB 1HCVA 7CGTA 4O51B 2VXTL 4DKAA 2R29H 5K9OA 5DUPL 4FFVC 2AJZA 5D5MA 4R7DB 5DDHA 1UJ3C 5HHOB 2CMRL 1CDIA 1RZFL 3FFCA 4WI9A 5BJTB 1P4BL 1BM3H 3U0WH 1K85A 1PX3A 3OKLB 2D03L 4AL8L 1NFKA 1L7IL 3TO4C 1PW3A 2FH6A 1MIEL 4LCUB 3OAZH 2QBWA 2V2XA 4N9GA 1QOKA 2BHYA 2PR4H 4JFYB 5C2BL 4PB0L 4NJAL 1HHHA 3DO3A 4Z76A 5I16B 1JUFA 1XF4A 1ZOXA 2X44D 4WFHD 4X7TA 5IB2A 3AGVA 3GMMB 4WEBL 3DX6A 3OWEA 3GO1L 3HPJB 2P24B 4QRRB 3W0WB 5IB5B 3SDCB 2XOTA 3ARSA 4PLOB 4JPWL 3FZUD 4OD3H 3BH8A 5C8JB 5CJBA 3TC9A 3D3VB 2YHGA 1LNUA 4MAYC 5EU6B 3S5LA 4ELME 2QHRH 2ICWB 2W9LA 4JFZH 2R39A 3QCVL 3S36X 3VWJC 1DFBH 4R4BB 4JKWA 4GMTH 5F6HJ 3N9GH 4D9RE 3GHEH 2KH2B 3PP4L 1VHPA 4IJ3B 2DBLH 4P99A 5ALBH 1RU9L 3FONA 5CJ8A 2Y25A 5EUOB 1CL7H 3D0LB 2YA2A 1BREA 4EN3C 4K55A 4GOSA 3BH8B 5C8JA 3NPZB 3PWUA 1YPZE 5F3HB 4WW2B 2DICA 4NNYA 4J7RA 4PJCA 5IR1B 5T3XD 3IJYA 2QQLL 4OLZL 1D5XB 4QWWD 3HPLB 2DQEH 5DD5H 5D1XD 3EYUH 2WMPA 2RCSH 2MCPL 3NPSB 1G7MA 4TNWK 4W6WB 5CINL 3S3JA 1R3HA 1RUQH 1AO7E 1XMWA 3CSGA 3RHWK 3MLSH 3MRNA 3MV9E 4QHNA 1J9CT 3B9VA 2IF7A 3PWUB 1MWAB 3O6FA 4NO0A 1MFBH 4YHNB 3GM0A 1Q0YH 4OKVB 4YO0B 1O0VA 3LEVH 1BD2A 4ODVH 1S5HA 3QQ3B 5DTFB 3JBG7 3RGHA 1I1AB 3SEPA 3I6KA 3RTQD 4JPVL 1LEGA 4K3EH 5KVDL 1LILA 2BNRE 1JGDB 3OKDA 1GJIA 3MRCB 3F7VA 1UM4L 3ARXA 1X6NA 3U0PB 4OCNC 5L9DL 1AKJA 5ESQA 4I5BA 4D0DB 3RWGA 4PJEA 3NH7L 2WP3O 3OBAA 3HUJA 2AJXH 2GITA 1NBYB 4PLJC 3SGEI 4PS4H 1INQA 1E4WH 3LS5L 1EJ6A 2AXGB 3T77B 5J13C 5MEOB 2XY2A 4ODSL 3SKNA 3LIZH 3RTQB 2DTMH 5T33L 2XWJB 1YEKH 3FMGH 1JL8A 3EJYC 2VQTA 4L8SA 3SJVB 1ZA3B 3CK0H 4NM4L 4I18C 5IGXL 1KN2H 4JRYE 4K7PH 3KPSE 2WQ8A 4OD2B 2FEDC 2BJMH 4F15B 4NZRH 5AG8A 4NO3A 4LQFH 4L5FH 3FO1B 4JFOA 3C6SB 4NIKB 2BSRB 1NBYA 4HPOL 1MCRA 4D9RD 1QSVA 4Y4HD 5D1XC 3WNPA 5IBTL 4ZFZA 5KW9L 4OZGA 4CU7A 4NQDA 1VA9A 4UT9H 3SBWA 4DGIL 3ZYOA 5F44A 3TZVB 1DUZB 5D7JC 3MTRA 4I0KA 5C3LD 2WBJA 3EDJA 4JANA 1V3LA 2E7BA 2NCMA 1FYTB 35C8L 4NCDA 1PKQB 4E42B 5CZXC 1I1FA 2VLLA 3VFRA 3GSUA 2J2ZA 2YPLD 3E6FA 2NW2A 1DN2A 5F7WC 3WDJA 3LN4A 1WAAE 4GW5A 4BJLA 5JW4R 4AK1A 5D1QC 3KXFE 5FGCE 3AY4A 2NZIA 3IGAA 4WJ5A 3D6GA 3C8HA 1T80A 4PR5B 4NYLA 4XX1G 4OIIH 1HXMA 5EU7C 4M48L 4KZDH 1NMBL 1EV2E 1HQRB 2EDQA 3I75B 4OCYL 5HYIA 2D2OA 2EIDA 4GKSA 3R06B 3GFUA 1I9JH 5ICXB 5GJTH 1EPFA 4TQEL 3CMOL 2Y9RT 4ODBD 4OCRH 4ERSH 1L0QA 1XF5B 1X6LA 1RY7B 5E2WL 3CGTA 4WY7L 4GKZA 1ITBB 2Z8VC 3L3JA 5IOPB 1YN7B 3KPRE 4FQXA 4JZNB 2VZ1A 1AQKH 4M61B 5FYKH 1ZSDA 5EU7E 4PRAA 4PJ9A 1DLHA 1YEEL 3O8XB 1MCWM 5C08E 2Q76B 4FG6D 4JFDB 1LD9A 4FQXD 3VMPA 4ZOCA 4XVTL 2YSSA 1IQWH 4OF7A 1RURL 1K3ZA 3VFNB 2IQ9L 2XN9D 3U83A 2MQ0A 3T3PE 2D7OA 4NOBA 5BRZB 3ZL4L 5KN5A 4O51A 3FN0L 2VLKE 5C7XL 1SEBB 4HK3N 3NCYP 4M7KH 1QNZH 3U2SB 1MI5D 3MFFB 1F3JA 3DRTB 3EAKA 1F90L 1UJ3A 5F1IA 3H9SA 2Q76A 1KCSL 3LKOA 4P4RA 2EZ0D 4JFED 3OKLA 1TMCB 1PJ9A 2VUYA 2KQMA 4XC1L 4Q9CA 2UZIH 5BVJB 1P1ZA 3O2DH 4MA7H 1M71B 3VFNA 2YEZA 3K4AA 4PTUA 3V5DA 1FNEA 1I7RA 4JFYA 5BQ7B 4MJID 1FE8H 5IHLB 1L9MA 2KKQA 2EE2A 2Y7QA 5ALBL 3MOAH 1SEBA 4OCMC 4PGEA 1LO4L 5D2LE 4N1CA 5ERWB 3HE7D 1C16A 5JO5A 3IKCB 1M1SA 1AE6L 4NBXB 4OSUH 1K4CA 5CJOL 3TIEB 1I3VA 4FMKA 3TYFB 4MS8D 4N5ED 4JRYD 4K3HA 4FFWD 2P24A 4WWID 15C8L 5EH1A 3I9GH 3CZFB 2XTLA 5E24E 4ELMA 5KVFL 1YYLH 3BUTA 1M71A 5D7JD 1UM5L 1JWUB 3TV3L 1MOEA 4PRHA 5EUOF 5BOPA 2PW1B 5FO8B 3C08L 4PJEE 1IBGL 5FUOL 2PO6D 5GS0H 2FD6H 3RPKA 2AS5M 5F8QC 4YXLL 4F2MA 5BS0A 4Y4FD 1YDPA 3MRGA 5D7SL 1YMMD 5C0DB 4GKNA 3ARBB 5DHYB 3MV8D 3KG5A 3BE1L 2OTUB 4MAUL 3MRIB 4K9EH 3WLBA 2PYEE 4Z5RA 4TULH 4IHOA 1NFDA 3Q0HA 3CZFA 3HMXL 3LSOA 5I1EL 1MNUL 3NIGF 1MIEH 5CP3H 3RA7H 3ZTJG 4JFEB 3IFOA 4D3CH 12E8H 1QBAA 5T1MB 3QQ9D 3KGRA 3INUL 3D18B 3O3DA 2DBJA 2E9IA 1IKFH 4M1GH 4WWKD 1B3JA 2NY7H 5D1ZB 1JI1A 4GRWH 4R6UA 5JHDA 5GRVK 4KDTC 5F7FA 2A74B 1ZHLA 4N1HB 4OZIE 3GBNH 3DNKA 3K2MC 1T2JA 1NLDH 3BKJH 1RZKL 1ODAA 1BP3B 2PW2B 3A6CH 4JFEA 3GEWB 3ZT6A 4GAYB 3D69B 1QLFB 3VI3E 2X40A 1QSFD 1YEIH 4AEIH 3QHZH 1U95A 4BH8B 1BD2B 3H7BA 1F4HA 2IAMC 1S5HB 4KK8D 5DTFA 2Q8BL 4EVNA 5KS9B 3DV6A 1A47A 4HCRL 4JEGB 2AQ1A 3QDGB 4XBPB 5D7LB 3I3BA 3L95B 3U82B 2VXSH 3V0VA 1I8LA 1CLZH 4N5EC 3WSQL 4P4KD 4RISL 5JIKA 2AJSL 4Y2DA 3BAEH 3QNXB 2GITB 2HFGL 4PJ9D 1INQB 1G6RB 3O4OC 4L4VD 1SM3H 1EMTH 3DSFL 5HYJD 3THMH 5ACZA 1DZBA 2VLKD 4I13B 1GSMA 4N0YL 5TE6H 2W91A 2CKBA 3ZE1E 4LMQI 4OI9A 1CGTA 3OXSB 5E8NB 3QDGD 2V5RA 2R2HB 4EI5A 2EDHA 2OL3A 1RJZB 1K8DB 2KZ1B 2I07A 2EH7L 5C08D 1HHKA 3U4EB 4C58B 5I1JH 4F7TA 4QO1A 3QUZC 3RVXD 1XGUB 3OHXA 1MHHB 5D2NC 1RVFL 2BC4A 1N5YL 3F65A 3IFNH 2J4WH 2P8PA 5CP3A 5SV3A 4HIEA 4UDTB 2CUHA 4ODUA 4PJAA 3R0MA 3D3VE 5EIIA 3EFFB 1PKQA 2F15A 4FQXC 1ZMYA 4MXVF 2I07B 4ZO6A 3D3VD 4F57L 1CK0L 1WAAA 3FAXA 4Z77A 2XZAL 4KVCL 3CFEA 1MHHA 1WBYB 2WBJD 4V1DA 1C12B 1NGXB 1CICB 5IMLB 1IKNC 3RGVA 1P4LB 4XNXL 5DEFA 1S9WB 3MGTA 4S1QH 4QGYA 2ZUSA 1C7TA 4K71B 2FECI 5I1GL 3LY6A 4RWHA 2PNDA 2GSIB 3UBXB 3ULUH 1QBMH 1PZ5A 3PWPD 1I3UA 5ICXA 3KXFB 3MLVL 1YY9C 4APQC 2VWEE 2C1PB 3AAZA 3W82A 3O2VL 1AGEA 5IROA 4K8RC 2CJUL 1PAMA 2IGFH 1I1AC 2VZTA 4LP4A 2MWCA 3GMPA 2WAHA 1LP9E 5CKGA 5I9QC 1A7QH 4KI5F 3NFNB 1S9WA 2WBWB 4ONGL 4LCYA 3P30H 4MLIA 2Q3AA 5C1MB 3SGDI 1ZSDB 2CJUH 5B39A 5CGMA 3ZE2E 1TCMA 2W65A 4LSPH 2UZIL 1MCCA 2NY0C 5ESAB 3FN0H 3D2UA 2BSTA 5D7KE 5C0JA 2FX8L 1A7QL 2NX5B 3UTQA 1LD9B 1I8MB 4H1LH 2VWEC 3G04A 1IT9H 1ZEAH 5DRWA 1CE6A 2YSSB 3IDXH 3BPNC 4L8DB 3RTQC 3IXTA 1AY1H 4MJ4A 1IQWL 3KNBB 3HZVA 4KQ3H 5DMIH 4QHMA 3D85A 5I30L 3NFNA 3WL9A 5GGRA 1P5UA 4R90L 4XI5C 4K9EC 3UO1L 5E1AA 2MTPA 3VFVA 2YC1B 3VMNA 2OQJB 1XF1A 3WJJA 2GW5A 4YEFA 2BSTB 5LGKA 5FB8A 1W0YT 4KXZI 3S35X 3ZKNC 1FZMA 4JVUA 3IXTB 2GI7A 1FN4B 2BNRD 1AR2A 4PTUB 5I1IL 2DWEB 2Z35B 4GQ9L 1MWAL 5C6PB 1NMAH 4L3EE 1A2YA 2FJGB 5MERA 3WL9B 1RIVH 3E3QC 4XVJL 3S35H 4O4YL 4ZPTA 2AKRB 3DIFA 3S34L 3ULVE 4O02H 3W39A 2NY6C 2BY2A 3MQIA 3IKCA 1YPZB 1PQZB 1G9NH 2W9EH 5E8OB 1EBAA 4U05A 5JHLH 3BP4A 4WI2A 5I1KL 1T03H 3WO4B 1NAKL 4PG9B 5JR1H 3V0WL 1T21A 3V6ZA 4WTWA 3CFKB 2FEEI 2DWEA 3UAJD 3RWEA 1MIML 3MSPA 2EEBA 5D72L 3QIUA 4UB0H 3SOBH 4ZPTB 1UWGH 4Q9BA 1AD9A 4K3DL 4ODHL 4P3DA 4RZCA 5F7NC 3TJHC 3K1DA 1DCLA 4OAWB 3GB7B 3ARBA 4I3RH 2PCPB 3G6DH 3OKNA 4KXZH 4LNVA 4YWGL 1BVKA 4OQTL 1CF8L 4XP9H 4DZ8B 1CLZL 2X42A 4MHHI 2P44B 3CXHJ 3DYMA 1QFUL 5SWSA 4D2NA 4DFHA 4Y5YC 1FZJB 1NCCL 5CBEB 3OL2A 4M7ZB 3CFKA 2YUWA 4NKDA 3CAFA 4UV7H 5FV1L 3W9DA 3ULSA 3UJIH 3TGXA 5FF6A 1CDHA 3BDBA 3QBTB 4JRXD 3IETB 1WK0A 4TTGA 2VZ3A 2XZCH 2EYTA 1CF8H 1KIQB 4U1SB 4YDIH 3VH8G 4LCIL 4JREC 4U1IA 2PCPA 3OKNB 3NFSH 1IM9B 5TFSH 5AD0A 4O58L 4PJGE 5DRNA 1ORSA 5C07E 4MZ3A 4CW1A 2DN7A 4JO4H 2BY1A 2NTFB 4M7JL 4OQTH 1AD0A 4EI5D 1MFAH 3MZTA 4GAYA 4HK3J 5DLMH 2E9JA 3WIFA 4R0LB 3FN9A 3P2TA 3A6CL 4RCAA 3HC3H 2NTSP 3ZDXF 4BFEA 3QUZD 3QXWA 1EAJA 3H6JA 3FB6B 2DKUA 4U1SA 4KC3B 4U1IB 3PHQB 3TA3B 3GDBA 3IJSB 1YUHB 3L5HA 2G9HA 2OR8A 2GJZB 3I3DA 5B22A 4MXWL 1T1WA 1ES0B 2WBKA 4Y8AA 5H8DA 3HC0B 3BPCB 3VWKB 3WBDA 4GRLB 4PLKD 5F89A 1DQMH 1KIRB 1AI1H 4ZD3H 1BD2E 1F3DJ 4XI5D 4PJBE 1DLFL 4KJPD 3EO1B 4Y2DB 1VERA 5E70A 4K3EL 5FYJU 1G6RA 3VFPB 4RFEA 1KJ2L 4PP2A 4YBLB 3RL1A 4AENB 4NJ9L 5ACZB 3LQAH 1V7ML 4J23A 5D2LA 1CT8A 1QSFA 4YDLC 1JZ2A 3IJSA 4JG1L 1QUNA 3REVB 4GO6B 4YUEL 2DQIL 1SBBA 3QJHA 1NLDL 3BKJL 4Z8FL 1JV5A 3MGOA 4XVSL 5F1SA 2XFXA 3WIHL 3T3PF 1PVHA 5IWLA 4F7TB 3T0EB 5DD0H 1XGUA 4RFOL 5K59F 2EIBA 5JW4M 1OP5K 2JB6A 4NKOA 3V7AE 4Y89A 5C0IB 3WUWA 1UWGL 1OAQL 4K8RD 3A6BL 4NQED 4Y1AB 4U0RC 5KVEL 2AVGA 1A9EA 3GJFK 3BEVB 1RU9H 3SDXB 1VFBB 3C5SB 1JWSA 5T5FH 1I7UB 1A7NL 4LAJH 5D6DA 2R0ZH 1BFVL 1AXSA 4PYHA 2P4AB 1IRAY 3MV8E 4GUPB 5HHPB 1OOAA 3BZFA 5KVMC 2LU4A 4DWHA 1GAFH 1RK0A 3IS0X 5E2VH 1YC7A 4C83B 4OCXL 2HP4A 3N1QC 2UUDH 3P73B 5JMOC 2J3SA 5DURD 3O6KL 5D96B 3S34H 4NKOB 1A6AA 5I6XC 4DKEH 4Z7VA 3E2HC 4OFVA 4OM0H 2IEPA 4G6AC 3MLVH 2R1WB 4NKIL 3LDBC 5E6ZA 1U58B 3QIWD 4YEEA 1SEQL 1K3IA 1HIML 3CFCL 5J12B 3VXSE 1RURH 2KUTA 1U3HB 3QIBD 5D4QA 4M3JA 5HHPA 4QOKD 3DPBA 1R6VA 4LHUG 2JJSC 4OM1H 3KXFA 1FC2D 1IEBA 4KK9C 2F8VA 3AS0A 4PV8A 1VCAA 4JVPA 3HZYB 1AHWC 5CLTA 3LQZA 1EHLL 2FWOA 4LCWA 3X3FH 4Y19D 3UJTL 4AEEA 4U1MB 4U7KA 4HIHA 5I6XB 1A7RL 1BQHB 3T3MF 4MHHG 2HYMA 2W65B 3GBMH 2WLYA 3RP1A 4HKXA 4OCRL 4JM2F 1IAII 4PJGF 1GPOH 4OI8A 4FQQB 1T2QH 5CGYC 1U8NA 4LEXH 4CGTA 1HKLL 3EFDH 2CMRH 2P1YA 5LCVH 4U2ZA 3KNBA 4JDZA 5LXGL 4G9FD 3IDNB 3K8LA 1KFAL 1UJTA 4QHMB 3ZL4H 5BV7C 4QY8A 4N8CH 2WV3A 2H2PD 5JDSB 4LU5L 3AB0B 4H1LA 2YRLA 5JOPE 1BQHA 1RMFL 4S1QL 2YPKA 1IAOA 4EBQL 3OGOE 2D9QB 3WFEL 2OXGA 4EN3D 4XVSH 5CILL 1MCKA 4GLRI 1T0NB 1NAML 2NY4D 1NUFA 1TNMA 1UB5B 1PZUB 4BSWA 3S3SA 5IHUL 4Y4KD 4DGIH 2VABA 1IEAA 3GMRA 4YQXL 3JWOC 5MERB 2V5TA 1JNLL 4H1LB 3D9AL 4JRYB 3VDAA 4LGPB 2CLVA 2ZPKH 3MMEB 3PWNA 5CJQH 5FGBC 3SO3C 5A43C 4CNIA 4UUJA 25C8L 4FQCH 5DJ8B 3KJ6L 4POYA 5GISH 2DQGH 5F7YC 3SE8L 1KB9J 1KOAA 4PJ5B 1OAUL 3WSQH 3QUYA 1KPUA 43CAA 3QDHA 3FRUA 2NY4B 3FB8B 1HHIB 3UTTB 5IG7A 2DD8L 4IIQB 5DZOA 1A3LL 1YMMB 5ISZB 4XCNB 4XNMB 4RX4A 1Q38A 4YPGB 2BDNL 3D2UD 2NXZB 4GS7C 2J5LB 4QRTB 4JQVC 4L4TB 3OKKB 3ARFC 4OFDA 1VADB 4G8GB 1H5BC 2A73B 5DYOA 1I8IA 4WVRA 2YPLA 5CWSA 3FT3B 4KV5F 1U8OA 3QUYB 2F19H 5FK9B 3WE6A 5CKAA 1R0AL 1SJVA 4KTYA 5I1HH 1MAJA 4PJHB 3DSFH 3V5HA 3OSKA 1A6PA 1HHIA 2D0FA 2H1PH 3UTTA 1PSKH 3OKEA 1NFDF 1UA6H 1TCRA 1D9KC 3WN5A 3FO9A 5F7UA 1XAUA 4HAGA 4BZ1L 4HIJA 4LGRB 4HULB 3C87A 1YJDH 2CO6B 1B0WA 4HLJA 5DI8B 4OGYL 1PG7H 5BZDA 3QG7H 1ACYL 2EYTB 4X7SH 4WENB 3BE1H 3QUXD 4F33A 1KIQA 4G7VH 3DGGA 4G8GA 2AJSH 4HFWB 1HHJB 4G43A 3GMLA 3RGVD 1MHCA 1MNUH 5GGRY 2V17L 1FL3B 5E8PB 4HLZG 5FO7B 4GAJH 3ZKQD 2BVPB 4G80A 4TTDD 3VGDA 2DLIA 4B53A 3FO9B 4LVNC 2B0SL 3WIFB 2FHFA 4R2GD 4P2CG 1JTTA 1G1YA 2MQ3A 2O5YH 1FO0L 3HC3L 4DK3A 4QRUA 3SDDA 1FQ9C 1CVRA 1HI6B 5IVOA 5CZVL 4XPBL 4ZTPH 3G5ZA 5DFTA 4D9QD 5HDOA 2WNGA 3KDMA 3Q5TA 4G43B 4F9PA 2HG5B 1TVHB 3HNTH 4DKFH 3VWJA 2XNAA 1EHNA 5ITFA 1AHWA 2W07A 3B9EA 4KKAC 4MCZA 2O5ZL 1P7HL 5HGHB 3HG1E 3PP4H 4U4BA 4XCCH 3PP3K 4G6JL 5F9AC 4LVNB 5LGHL 1BD2D 3C5ZD 5KSAB 5A3ID 2FIRT 3P40A 2EO1A 4JFFD 3DXAA 3EJJX 1Q0XL 4U7MA 3G5ZB 3VXOA 4D8PB 5GPRA 2VLJB 5AWNH 1QR4A 3O6FD 4RGMB 4MWFA 4HF5H 4A6YH 1WCBA 5GHWH 4L4VA 5GGVL 2LTQB 1F4XH 4PBVC 3G5YB 2EDBA 2CKBL 2BMKB 2D4FA 4ODTH 1EGJH 2W60B 4P4KA 4QRPD 3T2OA 3WEXB 3NN8B 2BNQD 3I6GB 2VN7A 1NBVH 4C54A 3WUWB 4IDJL 2R56H 3LHPH 3V5KA 3KJ4B 3P4OB 3ULUF 2UV3A 4Q6IC 4HJ0C 3E6HA 2H9GA 1QFWI 4U1KA 5H94A 3PIQA 4PJAF 4MWFB 1G9EA 1WZKA 2FGWH 3SY0A 5I8EA 3X12A 4D3CL 2ICEA 4XNQB 3HZMA 3QH3A 1M7XA 1BHGA 4ODWB 5FDWA 2AXFB 3CSBA 3NFPA 5FOJA 4WI8A 4O4YH 1H0DB 2P5EA 3NABH 5HYSG 1UWEL 5C0FA 1I9JL 1RZ8A 1RUPH 5D1QA 1Z6JT 3PGCB 2X4UB 4DEPC 5I9QB 1NCBL 5IHZB 1B2WH 4MA7L 4HWUA 4TSBH 5J13B 3UX9B 2CXKA 3F7YA 4P2RE 1NL0H 5C0CB 4YR6A 4P9HL 4DTGL 2A83B 1IEBB 1I3GH 1XGQA 1EEYB 5C92A 4U1LA 3X14B 4UOW0 5F1NB 1J12A 3K0WA 4NDMB 3OAUH 2R4RH 1GYAA 2VLME 5C0ND 1FP5A 3VXUB 1BQSA 2NW3B 4E41E 3EDKA 1QSEE 1Z2KA 2GFBB 4OFKA 1F4YL 1P7KA 4NNPH 1MFNA 2VAJA 4XP5L 1U8MB 4P2OA 4TUKL 4Q2ZB 2AEQH 5IJVB 3MRLB 2O5XH 5EBLB 3BKCL 4P59L 4ZUWB 3ZE0F 2GT9A 5IBUB 1UG9A 5HHXH 3HE6B 4AMKH 4M8QB 1UZ6E 1OD9A 4LASL 4Q6YA 2DQFA 2YMXL 4DUXA 3FJTA 3GSXB 4ERSL 1VKXA 3UTPD 1NFIA 1P4IL 5IB3A 4HUVA 1SJHB 1SBSH 4TNWF 4HBCH 5EORH 3QFDB 3WDHA 2MMXA 1LDSA 1REIA 4M62L 4YHIA 4EEEA 1YYML 4HWBA 3GIVA 4LKXB 4LDEB 1YNKL 4M5YH 5I1JL 4B7LA 3ABZA 3DI3B 2FCBA 3Q48A 4IOIA 4C4KO 1DQDL 2DYPD 3L6FA 5C6WH 4KKAD 2BDNH 2MHAA 5MEPB 5E8DH 1U8LB 1YNKH 9CGTA 1NFIB 4R97C 3LKQA 4XPTL 1YYMH 2ZUVA 5LWYH 3P0VL 2FJFA 1QR1B 4QXUL 4QOKE 1MELA 1A0QH 5HPOA 1H8NA 2B1AH 4UUJB 3GKWH 5EBGA 2GUOB 1NC2A 1V7NH 3O11B 3OZ9H 5ILTL 4M1CC 2JB5L 3CFJB 4DJMA 5HHNA 1GGIL 1RUKL 5KW9H 3RNQB 3ET9F 4GRWB 8FABB 3FB8A 4MQXC 5DD1L 1T7YA 4XPAH 5K9OB 4LLAA 1F2XK 4HCRH 4BUHA 1I85A 1V7NL 3PDGA 1S9YA 3LB6D 5L6YH 4M6OH 4TTDC 4XCNA 2FZ3A 2R9HD 3GK8H 4ZAKB 1RVFH 2XN9B 2VZUA 4QRTA 4FS0A 4JQXC 5DJXA 4NQCA 1BBDL 1HINL 2NY0D 3WFEH 2X4QA 4L5FL 3PV6B 1W72L 2DS4A 4NC2B 3EO0B 3KPOB 2EDWA 2Z8SA 1NSNH 1QFPA 1MJ8H 4HSQA 5C0GA 1F13A 1EZVY 1KTLA 1UACH 1VGKB 5DGQA 1HKLH 4AEHL 2HA1A 3T0AA 4OZGE 4LCWE 3DX6B 1Z0MA 3VXQB 3SE3A 2NXYD 4M6OL 3TZVC 1I8KA 4LNRA 3RWFA 2NPLX 1G9ML 3HTLX 1DBBH 1E4KC 1N59B 2DMBA 3RNKB 4QHLB 4UU9B 3PV6A 1INEL 1G84A 2ICWJ 4B50A 4PJDB 3TPUB 1XF3B 4J3WA 2DQHH 4PUBH 1IGIL 2ATPA 1N64L 4F7MA 1YEGH 1BBJB 3KYOA 3VI3F 1WFNA 1M7IA 2ZOKB 3EGSB 1C1EL 5E56A 2FJHA 1ED3B 1MEXL 5BXFA 3MRQB 4UMGA 2G75B 1JFQL 1N7MH 4PRNB 3WD5H 5FHAH 2EDTA 5KVFH 4PP1C 4GJTB 1TVHA 2FHBA 2V9RA 2CKBH 4NNYB 4ODTL 5DGRA 3VWJB 1OF2B 2AJUL 3QUMB 3QIWA 3P9LA 1XF3A 4APQA 5L88H 1QG3A 4LVOB 3GO1H 1C1EH 2GQHA 1E4XL 1L7TL 2IQAA 5HGHA 2X1WL 5IROC 1BBJA 1IZJA 1BQHG 2E7CA 5CJXA 5DD5L 3W2DL 2IPKB 4I2XA 5CEZD 5KSAA 3SDYL 2ENYA 4QTIL 2YD4A 5TE7L 5LGHH 3GM8A 5ESVA 5DJ2B 4FZ8L 1GOFA 1LNUB 1S5IH 2VLJA 1MWAA 1VFMA 3HMXH 3IDMA 2EH8L 4POUB 1WLHA 5HHME 3O3BB 3L3HB 2A0LD 4YO0A 5D93C 2OL3H 3OPZL 4R4BA 3VD9A 4WGVB 1P4BH 3WS6A 5EPMA 3TN0A 4Z95H 4Z18A 2N7AA 3NN8A 4WU7A 5DD0L 2C3HA 4X9FA 5L88L 4NN5C 4UAOC 3P4NA 1T1XA 1IQDA 1IGCL 5ESVB 1VFUA 5F3HA 3IDMB 4MQ7A 2FSEB 3PIQB 1DQQA 3STBA 4X7DC 2C4FU 4X6DF 2PTUA 5KVGH 1OWWA 4G8FB 1SVCP 3AREC 2Y36L 4NO0D 2IPTL 3P9MA 5TDPA 1F00I 1LO4H 1GIGL 2VSCA 3SJVA 2YPVH 2OS7A 4LFHG 3NABL 4MS8C 4QHNB 5HYEA 4PJIA 3O2DL 1NH6A 1WWWX 4JKPL 4U0QB 1DEEA 3DMMA 4KRMB 4F9PC 5GRJL 1JMZA 5GJTL 3FQWB 4YR6B 3ULVF 4OLUH 2WWKO 1XGRA 2ZSVA 1GZPA 2WLZA 3O0RL 2H3NB 3TZVA 3OKDB 1J8KA 1H5BB 2R56L 2CSPA 2RBLA 2BFVL 3C9NA 2EZ0C 3V52H 1ZANL 4E42A 3SO5A 1T5WB 5A3IC 2DQCH 4P2OB 2OMBA 1MRDL 4OLVL 2CR6A 1A3LH 2EKSA 1DN0A 1EFQA 2AXGA 4I0PD 4P23A 3LN4B 4ZUWA 4HJJL 4QT5A 3GSWB 1VENA 3BVNB 1FG9C 3UYOD 2D3VA 3MO1A 3EDDA 3WKMH 4BM7A 5IB4A 4WJ5B 1MSPA 5T1DH 2IPUK 1BAFL 1OARL 4PR5A 5GS3A 5IEHB 5CMAB 3CU1A 4XGZA 4MXQC 5D7KD 4TUOA 4XCFL 1XR8A 3QHFL 1DBKH 3SO3B 1IGJB 4FFWC 3DXAE 3GIVB 4LKXA 5DVKA 4M02A 3VD4A 1HKFA 4GW4A 1KCVL 1A1OB 3WMSA 4XPHL 2DAVA 3HG1A 3W11C 4FFZL 1OGTA 3KLAB 3GSWA 1A6WH 2V5MA 3L6FB 5A16A 2MHAB 3HAEH 3DUUB 1UC6A 3LPFA 5C07D 4YXKL 2B4CL 4OV6F 3D0VB 1ADQH 1PFCA 5F70A 2WUBL 5JUEH 3B83A 4PRAB 1FYTA 3QEQE 3PWPE 4FFZH 4WWKB 1QP1A 3NTCL 2VLLB 3VFRB 2OZ4L 5I74B 4PS4L 1V3KA 5JW5B 5DSCB 3LEYL 4WNQB 3RNQA 1HDMA 5DO2D 4O9HH 5EA0H 3UTPE 4FQJH 1OB1A 4NBZB 3SGEH 4HEPG 3GI9L 5MHSD 3QQ4A 4KRLB 4Z0BL 4DUVA 1RZGB 4JDVA 2BNRA 1HQRA 3I75A 4UILH 1DUYB 4LSDA 5IBTH 4X6DE 2R2EB 3R4DA 1CFSB 5EZJB 3UZVB 3RZCC 4WRLA 1KCRH 5LGJA 2KPNA 4E41D 3QZWG 1JGEA 5ELIA 1WBXB 4NNPL 1Q9KA 5T3XL 1PG7X 1MRFL 2QTEA 1IGFH 3H42L 4ZOAA 2DI8A 1FGVH 4Z7WE 3CD4A 3T1FB 5DRZB 4KTDH 5E6IB 1YN7A 4S1SH 1EBPA 3R1GH 3QEGL 2H6PA 4FQLH 4NN7B 1BMGA 1NPUA 3MOBH 5C0EA 4NFDA 2YPLE 5E00A 3L5WA 2YXFA 1CFSA 4K3JH 2GCYB 4ETYA 4KK6D 4HC1A 3CPLB 5DMKB 3HE6D 3IDIA 4OGAD 1KTRL 5KANG 4HFUL 3EYFA 4MDJB 5E2TH 4ZSOA 1HIMH 4RBPH 4BKLB 5C0NC 3SCMD 1R5VA 2PXYB 1NAMB 1I1CA 1EUTA 4S1RL 4GBXD 1DTUA 5JIHA 2QSQA 1QRKA 3RDTA