5HYJE

1e6 tcr in complex with hla-a02 carrying aqwgpdpaaa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
246
structure length
246
Chain Sequence
DAGVIQSPRHEVTEMGQQVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSLWEKLAKNIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A "hotspot" for autoimmune T cells in type 1 diabetes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 48
structure length 246
sequence length 246
chains with identical sequence J
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hyjE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hyjE02
3MRRB 4JR9H 2BNUA 1I4FA 5JLZB 2H8PB 2Y5EA 2R2HA 1RJYB 3QNZB 4XI5D 3HRZA 5C07B 3IDUA 2LAAA 1WT5C 3VFVA 1P53A 2R15A 5I8OH 3QG7L 1OP3H 5I8CA 3C5ZD 1NUDA 2VDMH 4L5FL 5A2JH 4FQHB 1FO0L 3BW9B 2ATPA 3P4OB 4LLWB 5FGCB 3H7LA 1QQDA 4XCYA 3DX9B 5I19H 4QY8B 2Y1VA 3EFFB 5C0FA 1RURL 3QIBA 2YZ8A 2QADD 4QXTA 4JFFD 2C1OB 4U1MA 3I3DA 1AQDA 2AW2A 2HAZA 5C6TH 4L4TA 1VADA 1KIQB 5EZLA 3DMMB 5GHWL 3B9KD 1GZQB 1JGEB 4JQIL 3VXRB 4HXBH 3VFNB 3OQ3B 4XVSH 1CCZA 1RMFH 1WJ3A 3BPOC 1C1EL 4J6RL 4KK8D 2HLFC 2JJVA 3WFCL 2Y7QA 4MDIA 32C2A 1IGCL 3KYOA 2QADC 5J1AB 4N1HB 2I07B 5DHYA 4WU5A 4HIHA 3C6LD 3DX6B 1KT2B 3QNXB 1NANH 3VFRB 2ICWB 4X6DB 1AXIB 2JK5B 2IADB 4RGND 3RU8H 3I2CH 1FVEA 2I5YL 1JV5B 1K9TA 2IGFH 5T1KA 3OKOA 4M5ZL 3AS2A 1MWAB 1Q9OA 3C87A 4XPTH 2GJJA 3AM8A 3LDBC 3QYCA 5BVJB 3CAFA 5MP6L 1WC7B 3MRQA 4O02H 3S88L 1JNNH 1KXVC 3TJEH 3UJIH 3KPSE 2VLRD 3QEGL 5MEQB 3F8UB 1A14H 1ZA6B 1ZLWH 4UT6L 4PJBF 5TPWH 2DF3A 3BDBA 3NABL 4HWEH 1U95A 5DHVB 2UUDK 1A1NA 1Z9SA 4RFOL 3DSFH 4P9HL 4EI5C 4GOSA 3KPTA 1I1RA 3BXNA 3W82A 2OL3A 1EXUB 1YEGL 4Z77B 2GITA 4HK3J 3GEWB 3O3AA 1NANI 2NZ9D 3FB6A 4Y4KC 3C60A 5I8KH 1FFOB 4ODVH 1RZKL 5DK0A 1RAMA 1NMCC 3IETB 5K9JL 2MPAL 2ARJA 1P4BH 4X6FB 4KUCF 4RGMC 1OSZB 3LZFH 1AHWB 5D7LB 5F72S 2Z8WC 1D9KC 2WWMD 4LVNB 5IV2B 1XH3B 1D5MB 3KPMA 4X4ZA 1FAIL 3R8QA 2VN4A 1QFPA 1AXTH 3V9FA 1XF2B 4HIXH 4PJXF 3MLYL 1FGNL 3NCYS 3TT3L 4QRQB 2IBZY 2JCCB 2VMFA 4HZLB 5HGAB 4QHNB 3GSRB 2HN7B 1LE9B 1DEEB 1JRHH 1T20B 3V52H 1ZT4A 4S1SH 3ARGD 3UPAA 1DVFA 1WBXB 1K4CA 3SKUD 3U36B 4X4YA 2Y72A 4AH2A 3X13B 1ZANH 4NDMA 1AFVL 2Q86A 5DI8B 4QO1A 3GB7A 3HE6B 1UXWB 5F9OH 3C60D 5F7NC 1FPTH 2OP4H 3DURB 1A6WH 5IMOA 4HAFA 1T7VA 1HQRA 2Q3ZA 2EDYA 3J7HA 1CE6A 3UBXI 3UTOA 3ZLQC 5ICXA 3WKNA 3U2SB 1SEQL 5E4EC 4CKVX 1GGIH 3ULUF 2LV4A 2BSTB 1NSNL 1MCDA 3QXUA 1I7UA 1BD2A 2OK0H 2BSSA 1J8HA 2VL5A 3MCLL 3NIDF 4BZ2L 4JO1H 1JGVL 1N7MH 1BFOA 1I8IB 2D2OA 4QRPE 4W4OA 3RTQC 5DQJB 4AENA 4XP4H 4YHPA 2NX5A 2BSED 5D1XA 5F1NB 3QFJA 4RGNE 4O51B 4ZPTA 3B8SA 1K8DB 2YD5A 3BQUC 1RUQH 5I1JL 4EBQH 3IJHB 4FQXB 4OQ1A 1Y0LA 4XPBL 3FRPG 4JZOA 1J0KA 4RMTA 2W92A 5EBWB 4I3SL 1FNSL 1MEXH 4NN6B 5FFLA 3T0WA 4I1NB 4JGUA 5C6WH 3S4SB 3NH7H 4IMLB 2NY6D 2YS4A 43CAB 3NCEB 4QTHB 4XBPA 2XWJA 1SBBA 5ESAB 3T0VA 4J8RA 4L3ED 3AS3A 2PO6B 3P30L 2NYYD 4OLWH 3SE4A 3DJ9A 2X4SA 3PGDA 4PP1C 1HK6A 2LQRA 4FQ1H 1WFUA 2R56H 2Q1EA 5HDBF 4QKXB 4MQSB 4ERSH 3GMRA 3I2CL 2P42B 2WINA 3L5IA 4ONOA 2F53E 1PLGH 3SDCD 4WV1A 3CK0H 1W72B 3FQRB 4F57L 1QSFE 5DF0A 1NMBL 5EBLB 3WLWC 4XP1H 2PW2A 1J0YA 4ONHA 2X1OA 1CLOL 2GIYA 3EO1A 4BELD 2P44B 1HOCA 2WBKA 1O7SA 5JOFB 2PYEB 4I9WE 4IHOB 5KSBB 2NPLX 1WQVT 4P0DA 4F7EA 3L6FA 1AIFA 4P23C 3CIQA 4PJDF 2OJZH 3V6FB 4HDIB 1AJ7L 1KTLA 5ITBL 3EYSL 5JW4R 3PV7A 3S37X 4YDKH 4CVUA 3ET9F 4Y19A 5F1KC 4NC1E 4BZYA 5L8KB 5IHUL 4DVBB 1BD2B 3S36X 3GJFA 4D9QD 1IVLA 4PRAA 1GCFA 3JV0A 3WMSA 1FNLA 1T6VN 1KIRA 1P4IH 2VJXA 5T33L 3T0XA 1T21A 2AXFB 4GKSB 4GLRI 1S7VA 2Y07H 3GJEB 2AJVH 5FYLL 2PF6A 1G84A 2OTPA 1VPOL 3KXFA 4ZNEE 2NTSP 3EJYC 3LRSA 3F12A 4OKVA 3SKOA 5MEPA 1A8JH 3WIHL 4XCEB 4WW1A 4KJWC 1JYXA 4KROD 2JIXA 5I71B 3BPCB 2J8UA 3MJ9A 2XT1B 5I1LA 5C0AE 4JRXE 4G8FB 1BBDH 3FFCE 3CH1A 1CFTB 1Z5LA 4X8JB 4L8BA 1JPTL 2J5LC 25C8L 1G6RB 2DQEH 2VR4A 1BM3L 2CDGB 5HSFA 2B2XH 5L6YL 3ZHDA 4LSRH 3JV4A 4MJID 3FO9B 3G6AB 4YGAB 2Y23A 3AMLA 4HPOL 3O6LH 4ZFGH 3TBSB 1I3GH 1D6VL 1YEEH 5D7LA 4MNHB 1KT2A 3QNXA 5FHAL 4MLSA 5F3HA 3NA9H 3J8F7 5SWSE 2I07A 5DHYB 1UEMA 3QWOA 4WW2F 4NHCH 1EIBA 4P57A 4WUUB 3OF6A 5IHZA 5IMOB 3QDGE 4PFEA 2VO5A 5BV7L 4OF3A 4HV8B 1FZMB 3T0AA 2WMPA 4YHZH 4LEXH 3K1KC 3I02B 3H6JA 1KBGH 4LP4A 3WJJC 3TO2B 1T7XA 2NXYD 4FQCH 1HXMA 1S8DA 4HC1L 3C6LC 3M17A 1XR9A 5C71A 3ABZA 3G9VA 4PB0L 4HUMB 2O5ZL 4JVPA 4ZXBC 5EB9A 3QDHA 1IGFL 3SBWA 4WEBL 2APXA 1A6UH 1IQWH 1ZLSL 3K80A 5DVMA 2ESVD 4H5SA 3IT8D 3L5JA 4PJEA 4IIQB 4J3UA 3T0BA 1GL4B 1KENH 2IBZX 3OR7B 1HYSD 4MVBD 5KVFL 2IMNA 1IFHH 4X6FA 4FOMA 1RJYA 1TETL 4YDJB 2YXMA 4GG6B 1MPAH 3VXOB 3MV8B 4NQDB 5DMKB 1X6LA 5C0AB 4FZEL 2C4FT 4S1DC 4DGIH 1DQJA 4YZFF 3O8XB 4K2UL 2OCFD 4G42B 5FM4A 5D70L 3IGAA 4NJ9L 1XT5A 3VFMB 3WFEH 1CBVH 1CGSH 4HUUB 3CLEH 5CWSB 2FEEI 3G6JB 3QPXH 3MV8D 5FK9B 3TPUA 4FQXC 2W0LA 1A6PA 3CFBA 5HDBE 1YN7B 3LKPA 3PJSB 4HWZB 4V2BA 3WIFA 1QFHA 3G5YB 4IRSC 4ZTPL 5C8JA 1JF5A 2KQNA 1ITBB 4LASH 4HGKC 1EFXD 1AE6H 4OUUB 1QSED 2E6QA 1A7NH 1I7ZA 4TULH 3VFMA 4JAMB 1XGYH 3ARFC 5IJVA 2B7DT 5GGSY 3S3SA 4LCYA 4C58B 1JWUA 4LF3B 4YXHL 4GW5A 4F7TA 5IBLC 5TQ0H 1MH5B 4V2CB 1C08B 3LV3B 5AWNH 2HFGH 1DDHA 3TBVA 2F58H 3MBED 5GGRB 4LIQL 4X98A 1P9MC 5JR1L 5EUOE 4Q7DA 3FCTA 1H0DB 4LSVL 3U30B 5IEKB 3RFZC 3HUJE 2VLRE 1LHZA 1MI5A 4FFWC 3L3JA 2GQHA 3MV9E 1G7MB 2UWEA 3BISA 4Z7QF 2H1PH 5D96B 5DTFA 4YDLB 5ILTH 4PJCF 4TRPL 4L8SA 4JY4A 1A9EB 1U8KB 3C2AH 3MBEC 4PJFF 1Q0YL 3U9PL 1Z0MA 2X70B 1CFBA 1CICA 1CL7I 3CFJA 3UO1H 1C5BL 5CHNA 3ZL4H 3EYOA 5BS0A 3MLWL 4YDVB 3BHBB 5I18H 1J5OH 3BDYL 1AH1A 1LMKA 1TPXB 3BE1L 4E0RA 5MERB 5I8EB 3QIUA 4M7LH 4PRIE 3WD5L 2LAGB 4JPVL 3ARFA 5DJ8A 2WBWB 4X7SL 3DETD 1B4RA 5C0AA 1V3MA 3N1MC 5CUSH 1MJJB 2IALB 4YBHA 3BT2H 4GG6A 4F9LC 1BM3H 4ODXB 2AJUH 1XGTB 1T03L 1ZWIA 4UUJB 3VXMA 2CK0H 2R1XB 1F6AB 4MX7A 1Y6MR 3MGTB 1GOHA 1HH9A 3ARDA 3ULSA 1JWSA 5BW7C 2FH6A 4NQCD 4UTAH 4DCQA 1QP1A 4L9LA 5D1ZB 3UTZA 3OXSA 2QADB 1SYVB 2ITCB 4NO5A 4QHUA 1BFVL 2G75A 4P5TC 2RCSH 4BQ9A 2IBGA 3UYRL 1HHJB 5F6IC 4OCXH 2VZ1A 2OI9C 4RGOH 3KPRD 1IC5H 5DEZA 3O81A 5ICYA 1EHAA 2WBJA 5DQ9B 5J06A 2AK1L 2NX5D 1D9KD 3QDJB 4NKDA 4QTIH 4UIMA 5M7QA 1EFQA 1F4WL 5EUOB 3TCXA 1VFBA 1FGNH 2I24N 4U1SB 1NFKA 4HC1H 2DQGL 3DYMA 3BH9B 5SX5K 1JZ5A 2R0ZL 4PB0H 4D94A 4GSDL 1TJHL 4LMQE 4WY7L 1UA6L 3BP6B 4Z8FH 4N0FA 4KTEL 4ZTOH 3OG6B 5D71H 1LK2A 4NNPL 1LP9A 3U0PA 3ZO0A 2NLJB 4AG4L 3FONB 5C0RL 3LV3A 3VFPB 3QQ3A 4X9GA 3LEYH 5B4MD 4LPUA 3DYOA 2OR8A 4U6YA 4PJEE 1GJIA 5TF1H 4Z0XA 4R7DB 2WUBL 2J8OA 2LVCA 4IIQA 4PRIB 1FORH 2ZUXA 5IROC 1I9EA 5EU6D 5J11C 4XWOD 1YUHA 1W0VA 4KDTC 2IAMA 3QEQE 1QR1B 1MCKA 3BPCA 3LQZA 3U4EA 1SYSA 1BWWA 3EOAA 4GG6F 5FK9A 1YNLL 1N3NB 1JP5A 3MYJB 3TA3A 1NLDH 4FQ2H 3P0VL 5TE7L 3V4UH 4OZFA 5C09D 2IQ9H 5T3XE 3H9ZA 1OGAE 2WINB 4G6AC 3QA3B 3B9KA 4YLQT 4K8RC 5DJAB 1YDPB 1GIGH 1JTPA 4Z7NF 2FGZA 4JG0L 3NFSL 2VWEE 5DA4A 5DQDH 1N6QL 5BO1H 2R1WA 4PJEF 2VB5A 5IHLB 4O58L 3HZMB 2JCCF 2FCBA 4L4VB 4XVUD 3T2OA 4OZHA 4M62H 1E0OB 3ESUF 4GLRH 2HFGL 3UX9B 5FM8A 1UJ3B 4PTTA 2P5EE 3P9LB 4EI6B 5BVPL 5J12C 2CLVA 4LHUG 3B3IB 3KLAB 3DXAB 4GXUM 3LIZH 3D6GA 2B4CL 5ALBH 3RA7H 3L5WA 4WEUD 4YWGL 1Q9WA 4XVSL 1RMFL 4I48B 3MRGB 4OJFL 4J4PD 1DUZA 2JIXD 2ADIB 2V5RA 4ZUUB 3D2UB 1H3TA 2X4TA 1LP9F 2A6DB 3IS0X 3F7YA 5KVEH 2CQVA 4S1RL 3FRPA 1NMBH 3C8KB 5I18L 1J5OL 3CJJA 3T09A 1HEZA 2NY7H 3OG4B 2W0FB 4P3DB 5DRXB 3DIFA 4WFED 3CC5B 4LHUB 2PUQT 4KGLA 4YDIL 5GGSB 5CEYB 3O8XC 1NAKH 1ZT1B 5C2BL 3AVEA 3M8OL 3MRMA 4RFEA 3P9WB 5KVMC 1YY8A 1S7SA 5FECA 4XC3H 1MVFA 2Y5TA 2AJYL 3M1BA 4RFEB 1U9KA 4Y0GA 3K1DA 5HVHB 3HZYB 3D39B 2F54D 5AAWA 5JW4N 3VFGH 1B0GB 3PWJA 3MLTB 3S4SA 4IRSB 4KH2A 3RHWF 4GKZB 3CFCL 3SDXB 5CZVL 5FYJE 3MUZ1 3MOAL 3IFNH 5T5NG 3FN0H 4XNYL 4EOWL 3RNKB 2QQLH 3MLUL 1FDLL 4LPCA 1PY4A 1U93A 3VFOB 3W9DB 3IDIA 3MLZL 3O2WH 1DTUA 3VXUD 4Z0BL 3EHBC 5CINL 1DBJL 1I8KB 3N1FC 1MCPH 3T0EB 3WS3B 5I9QC 2BVYA 2IQAA 1SBSH 3I6LE 4C83A 3LEVL 4IRSA 4PJ5B 4XWGL 3DTXA 2I9LA 2CLVB 1JNLH 2XA8L 4LSQH 2V2WB 1INDL 4K7PX 2GAZB 1I7RB 3WDJA 4L4VA 1FP5A 1NGQL 2I60H 3QUMA 9CGTA 1YPZE 2V5SA 3CUPB 3DGGA 4TNWK 5EU4B 4YBLB 5HVFB 1V8HA 1GPOL 2DQEL 1FYTD 2XTJB 3QUMB 1N5AA 5D96C 4AG4H 2B2XL 1WBYB 4OT1L 3HR6A 2G5BB 1VGKB 1F6LL 3LB6D 1ED3B 5TF1L 3L95A 3RWEB 3WFHA 4JLRA 1ND0B 4HPOH 5EIVA 4YHYC 3OF6D 5B3JF 4NNYB 4ETQB 2AEPL 3VCLB 2WW8A 5KW9H 1ZT4B 3K74B 1INEH 4PGBB 1ES0B 4DJMA 4JRYA 3BP6A 2BY1A 3HNSH 1KLUA 1GC1H 1SYSB 3B6SA 3FHQA 1IKNC 4HX1A 3Q3GA 2PKDA 4YQXL 2VZ3A 3MRFA 3EW3B 2P5ED 1YNLH 2VE6B 3ME0A 1ED3A 4QCIB 4MNGE 4F7CB 1EO8H 2FSEB 3GSXB 5GGVL 1FC2D 4RMUA 4FP8L 5IJKA 5E5UB 3VI4E 5T3ZD 3QJHB 4XCNA 5INCB 1QRNE 2VDQH 3BGMA 1X4YA 2M2DA 2XG4A 5CJOH 3VWJA 4M1GL 1M7XA 5DJYB 2AV7B 5AD0A 2ICES 1X44A 4PV9A 3T0EE 4NO5B 5HDLA 1S7UB 3JV6B 3GMMB 1TZGL 4PTTB 3ZT7A 5DJZB 3WEXB 4EDWH 1B6UA 1JK8B 4AIZA 3IU3A 5EFIA 3VJ6A 3MOQA 1XZ0B 4OAWB 4APQA 2VAJA 4HFUL 2OMNA 4LLQA 4BH7B 3TVMB 3QUXC 4RMWA 1FNSH 1MEXL 3NFNB 3SKJH 4WWKB 2QSQA 2WBJB 4LHJB 4BM7A 4X8XA 4Q0XH 3RTQD 3GSRA 2F19L 4UQ2A 4GBXC 4R96B 5FUCC 4G8GA 5EIIA 4WTXA 4IOIA 3ULUD 3MLRL 1A6TB 1T1YA 2GJZA 2WIIA 5IR1A 5SX5H 4CMHB 3FONA 2V9TA 4LL9A 5B3NA 2DWEA 2EDTA 5IOPB 2VR9A 1Z9OA 2EDHA 1ETZA 3F5WA 4D8PB 2DLFL 3UPRB 5E2UH 4L1DA 3JUZA 1B2WH 5FYKH 1AXTL 4ELKB 2HRLA 1ZEAH 4L3EA 3R4DA 2A0LD 2O5XH 2VUOA 4IRZH 4UDUA 1CICB 2WM0A 1MCCA 1FL5B 5EU6A 1KN4H 5ADOL 4JFXB 1OB1A 4TTDD 5KSUB 2CRZA 1QYGH 3OWEA 3IXAB 3U0WH 1UVQA 2LU7A 4L29A 4I77L 3VXSE 3BKYH 4M6OL 1I9JL 3O4LB 1SHMA 4YDKL 4B7IA 4OBRA 2CDEB 4WW2C 3I75B 1IM3B 2AJXH 3N9GL 2ADGA 5ISZE 5I1AB 3GMLB 1QBAA 4GRWF 4QF1B 1UQSA 4V1DB 2P7TA 5DZLA 1QZ1A 2VUYA 1NCBL 4KK8C 1C5BH 3ZL4L 4JFXA 4HUXB 1MJUH 2MCG1 5FOBA 1A7QL 4XXDB 4FNLH 3U0TB 5E2TL 1MHHA 1WEJL 2AEIT 3IGAB 3MV7D 1U8PB 4X7SH 4KPHL 3QPQC 4N5ED 3X3FH 2J2ZA 3HNVH 2JKXA 3F58H 1DN0B 2V7HA 3RAJL 4R3SB 3BH9A 1BQSA 2MJWA 3KG5A 1BZ9A 2ZWLT 1F4HA 1TJGL 4QRUB 5T1LA 1YYMH 1DANU 4UIMB 3W0WB 2X4PA 3D1MC 1JHTA 4K8RD 1AP2A 1OAYL 4P2CG 3AXLA 5FUZL 1T2JA 4OD2B 3TBTA 1N2RB 5F3BB 1QR4A 4G8GE 4ETYA 4TYUA 4YQXH 5TE6H 1F4YL 4M48L 1GH7A 3O6LL 1N2RA 1E4WL 5HHQA 4XZUB 1QPPA 5GGRA 4KRMB 1VENA 2RFXA 1XMWA 5IFJB 1MCNA 1KJ2A 3BPNB 1J7VR 1KEML 3GSWB 4P46B 5B4MC 1P2CB 3SDYH 2P45B 1MREH 1T7ZA 3C8DA 4JHWH 4PRDA 5A3ID 4J3WA 4OIAA 3ZT5A 4XCFL 1U8HB 1YECL 5FO9B 2FLBT 1A3LH 3GBNH 2IH1B 5CJQL 2FBOJ 2V5YA 4RAVA 1WSST 1CTNA 3N1GC 5LGHH 1DQTA 5HHVH 1J1OL 1DFBH 3B9KC 5ITFB 3THML 1PJ9A 2EDQA 4OCLC 4HQQH 1I1AA 4JO2L 2UY7A 4HGWB 4Z5RA 3O11A 3TZVC 4QF1A 4UV7L 3AGVA 3FRUA 4DN4L 5CSBA 2NY1B 3DSNA 4KKNA 1ZLUK 2CJUH 2Z92A 1U8MA 3JWNC 4OGAC 5HDQH 2NNAA 1MCQA 4CW1B 4UAOC 1RI8A 3LCYA 4YHLH 2BRRL 1ZHKA 1M4KA 4DKAA 5I8CB 3PGFL 4N68A 5LJYH 3EDKA 1BZ9B 5HHOD 4NWUH 1URLA 3DYPA 1HI6A 5D93B 3VH8B 1Z2KA 1CXKA 3QUMH 4Z7UA 1T1YB 2GJZB 3ARGC 4KZEL 1XF5B 1UJTA 1NGYB 2EXWC 5CBEA 1V5JA 3OKKA 5F8RC 5DQDL 4LSPL 5HI3C 2H32B 2G60L 3OB0H 3NVQA 1S78D 1S5IL 2P8LA 2DQJL 4F7MA 1FZJA 4OQTA 3VXNB 3FT4A 5MENB 4ODTH 2HMID 2VLRB 3NCMA 3QUZA 1CR9H 2OXGA 3QDAA 3CVHA 5FYLD 5E8PA 5EU5B 4NFCA 3I50H 3G5ZA 5TQ0L 4GKSA 4NCC2 1J8HD 3HPJA 1XR9B 3BKYL 1KLUB 3RWCB 1T7WA 2C26A 1RZ8A 2JELL 4O2CA 2WBJC 3SE8H 5EOCJ 1FYHB 4RCAA 3HC3L 3WFDL 1ZOXA 5FKPB 3OKMA 5ICZB 3INUL 4LQFL 4YDJA 1ZS8B 5FOBB 4P2RE 3MO1B 4BKLB 1TZHA 3QI9A 1NCDL 1D7FA 2OTUA 3KPSB 2HVKA 4K71B 4CU7A 3ARGA 5I1AA 4HDIA 3ARDC 4OZGA 5C9JA 1S78C 1LVEA 2FATH 3M8OH 4POZD 2H41A 1GYAA 2HMIC 1HHGA 3OPZL 3LEXB 3P3YA 4MNQB 4RBPH 3MRHB 1WAAF 4TQEL 2HP4A 1OTSD 2EZ0D 3OX8B 5INCA 1T5XA 1AC0A 2B1AH 4XMPH 5SX4H 1NAML 1CFSB 2I9LB 4PREB 1QHOA 4TVPL 1U8QB 1PSKL 3WS3A 3CDFA 3D3VA 1JTTA 4FQJH 2A74B 4QXGH 1RUPH 3W9EB 1U8NB 5C0GA 3NFNA 1WWWX 1IE5A 2JB5H 1D6EB 3QDJE 3VD7A 3GNMH 5L2JA 4BQ6A 5JDJA 4NQED 3LSOB 3VD3A 4TTDC 2IG2H 5C08A 1P4LB 1MQKH 1EO7A 1CQKA 5MI0C 1ACYH 4XVJH 3W39A 5D2LA 3AU1A 4HFWB 4U49A 1NL0L 2Q87A 1GZPB 3H7BA 1EFXA 3KPQB 5C07D 2YWZA 2IPUK 2ZP0T 4XPFL 2A6KA 4JFEB 3ZTNH 3BP4B 1C7SA 1GGCH 4PJAF 3HMXL 1AR2A 2MQ0A 2OS7A 1PAMA 3DVFA 3MLXH 4YFEA 3KVQA 4JPIA 5FA4A 1MUJA 4MAUH 4RFNC 1AGCA 2FB4H 1S8DB 3W39B 5KN5A 1ZA3B 4LFHG 8FABB 2BNQB 4HS3B 1RK0B 1BJMA 1OGTB 1XCTA 2C7UA 4UQ3A 1B4JL 4Q6IB 5GS3A 4LASL 3VD5A 1E4XI 4H26B 1YY9C 1UXWA 4ZD3L 1CWVA 3O6FC 4GSDH 4YHNA 2AEPH 4WHYG 5DDHA 4MNQD 5HGDB 2ZKHH 3GMMA 2X4NB 5IW6A 1NAMB 2XWBB 3UTTE 4M3JA 1E27A 5FYKE 4JRYB 4GH7B 1YEFL 1G7LA 4MA7L 4P2OB 5E0QA 1JRHL 3TO4C 5IB1B 4GW1A 3W0WD 1YY8B 1SJVA 1K4DA 4S10A 4KQ3H 4XCNB 4HS6A 4XNUH 3H42L 3QIUD 3RNKA 4GW4B 5B39A 1KCSH 4M7JH 2D7NA 2QTEA 3KPMB 4DEPB 4Y4FA 4H0IA 3I85A 2EDBA 3HCVA 1IGYB 2JE8A 1S9VB 3HNTH 4QWWD 1IBGH 1FCCA 1ZXQA 4X8JA 5IROA 4K3DH 4Y4HD 3SGKA 4ODUB 1IAMA 3DRQA 3DGCR 5K9OB 5E1AB 3FQUB 5EA0H 1MCLA 1PZ5A 2GAZA 3D3VB 5JZ7D 4O5LH 2Q8BH 1MVUB 4KJYB 4HZLA 2PW1B 3BDYH 2VH5L 4KI5C 5HDOA 1Z9LA 4TOYL 4PJ5A 4P5TB 3ZKMD 3T77A 2VC2H 1NGPL 3TV3L 3I50L 5E08L 1HYSC 3JWDL 3QR2A 4IJ3B 4P9MH 4ZOCA 4CVZA 1KTRL 1MLBB 3ZE0E 4X7FC 5FUOL 3ARYA 3Q1SL 4M62L 1Q0XH 1LO0H 4DVBA 4O9HL 5F7LB 5TGBA 2X9YA 1TIUA 4OCWL 3HTLX 2A9ML 5AYUL 4UAOB 2EIBA 3ESVF 4M6NL 5AYQA 3RZCC 4ENEC 1BFVH 5DI8A 3E6HB 3QXDB 2VDOL 4HT1L 2O5YH 1JPGA 5DYOB 4G80B 3QQ3B 4GT7A 4NQDD 5ICZA 4UDTB 3KPNA 5CP3H 3P30H 1MSPA 2EKSB 2ICWJ 3EOAB 4LKCA 2R4RH 4M7KL 5J9PB 4S1RH 2DI9A 2D31B 1YUHB 2R56L 2COQA 4YO0A 3BGFC 4WHYH 5DMJB 1M71B 2VDNH 4JREB 4I5BB 4TNWF 4P23D 2NY3C 4JJ5B 1MJ8H 5D7LD 1D5MA 3EFDH 4RDQG 5KVGL 3TYGL 3TJEL 3EOYG 1PLGL 3VGAB 5ADOH 5T1MA 2YD2A 5SWQB 3QG6B 2FX8L 4AM0A 3SKMA 3TA3B 2ZSVB 1SJHB 3DX8B 3WUZA 4NJAL 1A9EA 1K6QL 3QO1B 3BRFA 4RDQF 1E4XL 3IDNA 3PDGA 4LRNH 4PRBA 4WIQA 5JQ6L 3SDCC 2VZOA 4HJGA 4QTHA 3ARSA 3P9LA 4EOWH 3CFIC 1D9KB 5C9JB 3BP4A 4P4RA 4OV6F 4DCQB 4D3CH 5I66B 3K3QA 4U1SA 1UM6L 2DJUA 3E6FB 4J3VA 1OAUL 4J23A 4JR9L 4LAQL 1KIPB 1EBAA 5CILH 3MLZH 1ZHKB 2D0FA 2F8OA 4AH2B 5KG9B 4PB9H 3WIIL 5D7IE 5DQ9A 4O2FA 5TDPB 3GM8A 5GIRA 2GFBA 2ZCLL 35C8H 4JFDD 4LCYB 2F74A 1QSZA 2D4FA 3MGOA 4HCRL 4L8SC 3P0VH 4M4RA 1N5YH 3O0RL 1KCRL 2E27L 5E9DB 2FJGA 1IGJA 1BREA 5IT2H 4LNVA 2R0LL 2K7QA 1VFBB 2R0KL 2QKIB 3KJ6H 5DJCB 3PWNA 4YXKH 1GIGL 3IFOB 2GT9B 1AHWC 4OCYL 1JMXA 5DLML 4LVNC 1RVFH 5DEFB 5B39G 2D03L 4Y5VB 3TN0D 1IARB 4N8CH 4YH6A 5E7BA 3JVGC 1EEYA 2MTPA 2VXSL 4MA7H 4J2XA 1A6AA 5CKGA 3K2MC 1AGBB 3P73B 1J18A 3FCTB 3SJVA 5H37H 1MY5A 3GIVA 2B5IC 2VXQL 4Z18A 3BYTA 1UXSB 2HTLD 4JB9H 3EYOB 1EK3A 3NCJL 4JHWL 1DL7H 2BOCA 4U6HA 3SDXF 1C5CH 2R1XA 3FL7A 4JGJA 1L4IA 2UZXB 4K3EL 3FO2A 5HHXL 2D3VA 5FO8A 5E7FA 4V1DA 3DUUB 1QRND 3O6MH 5I1HL 5GGVH 1NFDA 1U8MB 4YE4L 1N6VA 3CSBA 3HAEH 5IB4A 3EOBB 5CFHA 4NQDE 2Z4QA 1OAQL 5IMLA 5HHPB 1BQHG 5C0EA 5T1LB 4IOFC 4PJ7B 3CPLA 4XTRD 3VFNA 4GRMA 5DJ0A 1JNJA 3BQUB 3LS5L 3N85L 1JN6A 1BIHA 3R06A 4KK5D 2AQ2A 5HJ3B 7FABH 1S9WB 3PHOA 4P3CH 5BS0D 1WV7T 3NPZB 3RQ3A 1SYVA 4YUEL 5BZDA 1NKOA 3RVXC 5JHDB 3UJJH 1CFQA 1X9QA 3BH8A 2HRPH 2V2XB 4I0PC 4JFQA 4PS4H 5E00B 4CUCA 2EH7L 5GS0H 5C2UB 3SBWC 1EHNA 4Z7UE 5HI5C 1RK1B 3LKPB 4P46A 3F65A 4DGYL 1T0NB 3TBWB 1ZLUH 5D72L 4WGVB 4WO4B 5D7JA 2HT2D 5HYJD 5EUKA 5J56B 1UYWL 1LD9B 3B83A 4X4XB 5IQ7H 3CK0L 1DBAH 5EIIB 1QRKA 1UVQB 1P7KA 5IJVB 4HH9A 4X4XA 5TDNA 1CFVL 3FQTB 4JCLA 4PRPA 4X0KB 1CBVL 4UU9A 1ZGLA 4YK4B 4PJGA 3U7WH 1U8KA 5B38G 4ZQKB 3DHMA 3QPXL 1DLFH 3WS6A 5E8OA 1RD6A 3CGTA 4UUJA 5CMAB 3VXMB 3IDGB 4NZRH 3JTSA 3NIGE 4QHKI 2WP3T 4N1EA 3QNZA 5C07A 3IAPA 3VFVB 4JFZL 1HINH 4ZUTB 2FYYA 3AREC 4ZO8A 3RWIB 4IRZL 1FPTL 1N8ZA 2OP4L 1XGYL 5EDXA 3HMWL 1ITCA 3FFDB 4XPHH 3H3PL 5DJYA 3TNNB 4N9GB 3RKDC 2Z93A 4H0HB 5DXWA 3T3ME 4YHIB 3V0VB 1CGWA 3MLSL 4TSCL 2X70A 3SKMB 1LO5B 4X9BA 3UMTA 4I9WD 2YMXL 5D93C 4HWNA 4EI5A 1F3DJ 1IKFL 1BX2A 4U1HB 4NRZA 4QXTB 4MDJA 4JJ5A 2EIZB 5EZOL 2Q7YB 2XKSA 1UACH 2FO4A 5GGUB 1E4JA 4OFPA 3U46B 3KYAA 2V9QA 4Y4KD 4FNLL 2MFNA 2X1XR 3LB6C 2FDBP 2UY6A 3CFEB 5EZIL 5JW5A 4P4KB 1U8JB 1FIGH 5DD5L 1AR1C 1P84J 4R2GB 3TVMC 5FYLE 2WIMA 2VDRH 2V2XA 5SX4I 1TQCC 3MJ7B 2VDML 4XPBH 2D7TH 1FG2A 4G8GD 1UKQA 1W72A 5IFHH 4GW5B 4N8CL 4HV8A 1EO5A 5E8NB 1ZGLP 4BFIB 4B0MM 4EDWL 4CJ1A 4JAMA 1D6VH 1HN1A 1YEEL 3RVXD 1K5NB 4F7PB 5SV4A 3ZDXE 4DZ8A 4KRPB 1Z3GL 1R3LB 3BFOA 2CUIA 1A02N 4M7LT 4XB7A 1R3JB 4U2YA 2C3WA 4HIEB 4I0KA 4F7EB 1IGJB 2G9HB 2FJFA 4Z6AT 2VLMD 5IUSA 2RCSL 2VITA 3QNYB 1NCTA 3BEVA 2E7HA 2XKNB 2ATKB 1YJDH 1M6OB 4XMKL 4FQCL 4Z78A 1TVHA 1FAKT 4UDTA 2EYSA 4JY6B 3JVGA 2JJTC 2J8UE 1ORQB 2NX5B 4UTBL 3O3EB 3GIZL 4NRXA 3V6BR 5BQ7A 1LO2L 5FF6B 3BKCH 3VGFA 4LLVB 1NMAH 3MREA 5EU3A 3MLTA 4WFHD 4EN3B 5A16B 1MNUL 1DFBL 3RHWK 1S3KH 3LRHA 5LQBL 5LXGL 2WWKO 1I1AC 4DQOL 4N0CD 2F9BT 5HPMB 5DJ2B 5HHOE 4JZJA 4ODWB 1J0JA 3C2SA 2PR4H 3RUGF 2PW2B 3O45B 4DN4H 4FFYL 3IFPA 1AO7A 5D8JH 1QYGL 1WIOA 3UDWC 2FBJL 3WHE0 4DGYH 1K8IA 1I9JH 4P5MB 3OJDA 1T0MA 4P9HH 5FDYA 5F89A 2VLJB 3PWUB 4ODSL 5FYLH 2NY5C 5AZEL 1X5LA 3WXWL 3RVVD 5E2VH 2YXFA 4PJ8D 4TNVK 4JFPB 2P5EB 3CVIL 1NQBA 2PYEE 5DS8B 2C3XA 1VFUA 6FABH 2HN7A 1LE9A 3KR3H 3VWKD 2XYCA 3DXAE 2E8YA 4N8PA 4KZEH 3ARBB 4OLZL 3VCLA 2BCKB 4DK3A 4LLDA 2BSSB 2GEEA 3U82B 3JWDH 3O6KL 1NC2B 2BCKA 2QHRL 3FOLB 3MRPB 4YHKH 1GGUA 4PJCE 1Q0XL 4UBDC 3RL2B 2LTQC 3UBXA 5D4QA 2BDNL 5K9QI 5LWYH 4ZPTB 5GHWH 2P24A 1D5IH 4HXBL 1FFOA 5AAMA 4JRXD 3QO0B 4QOKA 3PDOA 4LSVH 2J8UB 3FO0H 1FYTA 4J6RH 4RISH 4PG2C 4Q6IA 1FRGH 3WFCH 4XI5C 3WO4B 5EOTA 5ABDE 4IMLA 1IQDA 2UV3A 5TE6L 2NY2B 3QPQD 1YNTA 5ANMB 4F8TA 2FIRT 4YAQA 1FV1A 2H9GB 1QSVA 5EBWA 5IEHA 1QEWA 3AY4C 3OX8A 2ICEA 1T1ZB 5IHBA 4YAQB 1MRFH 2JCCA 4RMQA 5CD5D 5TF0A 2YEZA 4KJWD 2VDNL 1R0AH 2DYPD 3STLA 3QHZL 2XICA 3AB0B 5IM7A 2D4DA 2LVEA 1RFDL 2GSIB 3UZQA 3EYFB 5T5NF 3EJZD 2BY2A 2NCMA 4IBLT 4NQEB 2IPKA 2R1WB 2VLJE 4H0GA 2FEDC 4IRSD 3FAXA 1P4LA 3QAZC 4K94C 4NBYB 2P5EA 2BX5A 2C5DC 1E4KC 3U7YL 4X6CF 3SGEI 2BC4A 3RZCD 5F7KC 3EO1B 4I0PA 4N8VA 1T0MB 3KWWA 3BPLB 3MUGB 4G8IA 3MFGB 1CVRA 5EBLA 1FFNA 1NCWH 3OAZK 5D7IF 4UZGA 1YEKL 1FC1A 2EXYD 1J8KA 2Y7QB 2ESVE 4YHNB 4WTZA 2UYLB 3VGEA 4FG6D 3QUZB 3BVNA 4HUVB 2XQBH 4HMEA 5MHSD 1U8IB 1IEAA 1NL0H 3PWLB 1JCKA 4QTIL 4MVBC 2P8LB 3VI3E 35C8L 2DTMH 1HHKA 3MRGA 2MPAH 2DWDB 1D3CA 3C5JA 1F00I 5KSBE 5HYSB 1OAKL 3KPSA 2OQJA 5CGTA 4WI2A 4BUHA 2FB4L 2XA8H 1MRCL 1KGCD 1QLRA 4GBXD 5GISL 3BKCL 1DVFD 2J8UF 2D03H 2QR0B 4GG6E 3TT3H 5KOVC 4O2CB 3RIAF 1J8HE 4D9LL 3BN3B 3QUXA 2ARJB 3X3GH 5FGRA 1YNTB 3ZE1F 3OAZH 3QEQA 3QIUC 5FM5M 3O3AB 2H2PC 4KMTH 4HWBA 5IVZB 4PJAE 1FYTB 1AFVH 4BSJA 3QIUB 3MA9L 4ZS7H 1U3ZA 3G6JE 3PIQB 4HGWA 4Z5RB 4WWID 4MCZA 4XCCH 5IB3A 1WF5A 4MD5B 1WCBA 5HGGS 2MWCA 2W1NA 1GZQA 4DKFL 1QUNA 4YJZL 2EDNA 1EHLL 1JNHA 3A6BH 3BN9D 4KY1H 4JKPL 3SQBA 5I1HH 4ZS6D 2G2RA 1V05A 3D0VB 3HNSL 3U9PH 4X6DA 2IF7A 2XTLA 3KAAA 5IESL 3L3HB 1U3YA 1XF2A 2IQ9L 1IGMH 1NCDH 5C86A 1QQDB 3QDMB 4JEGB 2VXVL 5J1AA 3PE9A 4GXUN 1SJEB 3LKQA 2XG5A 2GUOA 1IAIL 3KDMA 5HYSG 3I6LD 4J3XA 1HHHA 1NBZA 1F90L 1DANT 3L1OH 2BVEA 2G5RA 3SCMC 5I1IL 1S9XA 3B8YA 3QDJD 4BFIA 2VLKE 4LSSH 3WFBL 4P5MA 4WUUE 3ULUH 4PG9B 2UZYB 3DX7A 1I7ZB 4ISVA 3RWGA 1LD9A 4DFHA 4NKQB 4R8WH 4X7EC 4Y5VC 1A6ZA 2NW3B 4XNMA 3EJJX 5IB5A 3V4VH 5JIIA 4D0CB 1QR1A 5F96H 5ACMA 4HG4K 2UWEB 2AK1H 4U6VH 1DBAL 4FQ1L 4GAGH 2R8SH 1FZKB 2EZ0C 3SY0A 4MB5A 2DQTH 4ONFL 2V17H 4OCSL 4KVNH 3QWRD 5JIKA 3HMXH 3QH3A 4HKJB 4K8RH 3OTTA 2D7QA 1T89A 5DMKA 3RPIA 1RUAH 1ZLVK 3JXAA 3T2PA 2CK2A 5C0IB 3GMPA 3MXVH 4PTUB 1ADQA 4J4PA 3MGTA 5DVLA 4ZUWA 1J86A 2Y36L 3UTTD 4B41A 5ERWB 3HC4L 4K9EC 4A2MA 3FQNB 2WWKT 4AK1A 4TUKH 1KYOK 3CXDH 3I84A 5JPNB 3TYGH 2VNCA 1F45A 1PG7W 3M45A 3G5YA 1FORL 4MDJB 4NC2B 3LKNA 3KYNA 5LCVH 4E41A 5GZND 1KACB 4L4TE 4RNRA 4W81A 3BO8B 4DTGH 1KIQA 1CFQB 5FYJD 3LQAL 5BZDB 2VLME 3MGOB 1LK3H 3MA7B 2YBRA 2OL3L 5E8NA 1KCSL 2B4CC 2F53D 3WDIA 3MODH 1J9CT 1DBML 4QHUB 1YEHL 3VH8A 1NC4A 4P2OC 4XXCA 1AD0B 3HG1B 5ESVB 5IOPA 1AGDB 1MFDL 3LN4A 5ESQB 1YEGH 1KIPA 1EMTL 1DVFC 3F7RA 1X5GA 3UAJC 5JDSB 5E00A 2ERJB 4IDLA 2YD9A 5ESQA 3SDAC 3VGGA 3QDGA 4ODHH 5I9QB 2XFXB 1R5IA 3VXUA 3SGJA 1XIWA 4N0UE 5E2TH 3BAEL 3NIDE 1EVUA 1ZAGA 3SDAB 4NZUH 3RVUD 4AMKL 5GS1B 3CX5K 4FZ8L 5I0DA 4G8EB 5GRJL 3SDAA 1XGQA 5CHNB 4U6HB 4AM0B 2Z35B 4MD5A 1UG9A 4DZBB 4R97C 3OZ9H 2QSVA 4CADB 1IM9D 4HWBH 2AGJL 1MCJA 5DURD 4RZCA 4ORZC 5EO9B 4S1SL 3ULVE 4KJQC 3F12B 4R7NB 1CD1A 4G43A 3WKML 5DJZA 2XN9A 4NYLA 4PJBB 3STZB 3MXWL 2AERT 2E6PA 1T22A 2APWA 2DQCH 2AV7A 2CKBH 1OOAA 5IG7B 3B5GA 1U58B 3D69B 4OCRL 4EUPG 4I13B 4YDIH 1D5BA 1JUFB 1JL8A 3FFCD 4L4VE 4XP5L 1SJHA 4OLUL 3WL9B 4HUXA 2IPKB 4YNYB 3X11B 3QUZC 4MCYA 3QXVA 4X7TA 2QQNL 4LPTA 3U4BL 1CS6A 4LCUA 1NLBH 1MHEB 3A0OA 4KKAD 4WI9A 1WGOA 2BJMH 3RX7A 4L8BB 1II4E 4KI1A 1KLGA 3L6FB 1JPFA 3PQYD 2AJZB 1MLBA 4PD4K 3B4NA 4ZUVA 4WHTB 3TM6A 3WLBB 4M61A 2R29H 2A1WH 1X7QA 1QBBA 1YEDA 1ES0A 1C5DB 2AXGA 1CN4A 2JJTA 4F9PC 1U92A 1WAAE 3GMOB 4WWKC 2N7AA 3MJGX 1C12B 3RNQB 1RHHB 3TT1L 3UBXG 3LN5A 3LD8B 4FQPA 3TVMD 3B2VH 4TNVF 3C5JB 1RQ5A 1OPGL 2VIRA 3SN6N 3RRQA 1BOGB 2AEQL 4XP6L 2V17L 1CFNB 3PWPD 3STBA 1FIEA 5T1MB 2FX9H 4K8RL 2JF1A 4W68A 4F7CA 3BX7C 1LEGA 5IB5B 2VERN 4PJEB 1I3UA 3MROA 4I5BA 1LE5A 3C6LB 1AI1H 1NFDB 1EJ6A 2W65A 1L0XA 4EN3C 4HJGB 2DDQH 5C92A 5J9PA 5DD3L 4NBXB 4PJBE 1AE6L 5DK2A 3WDHA 1R3KB 1SEBA 1MIEL 2EEBA 3BKML 1PG7H 4P2OA 3MMEB 5JXEC 4UIKH 3EUUA 1N0LA 1D5IL 2AQ1A 2WANA 1U93B 2DRUA 5DLMH 3H3BC 3TVMA 4HIXL 4MCZB 5C0RH 1XF4B 1ZK9A 4PJAA 3DO7B 4M6OH 3OHXA 3ZKSD 4XCEA 4PRHA 1WFTA 5ECJE 2YD7A 5H2BB 4KROB 4PV8B 4LIQE 3VJ6B 3HMWH 3A6CL 3FJTA 1YNKL 1YZZA 5HI4D 4ZXBA 4Q74A 4NM4L 3VMOA 1BQHB 2VXQH 5KANI 3DV6A 1Z0NA 4U6XA 1YMMD 1LEIA 1CICD 2XTJE 3OJ2C 1F58H 4JPIB 4J8RB 1H8NA 2I26N 4LSTL 1LEIB 4GG8A 3FO9A 3ULVD 2GTWB 4LQFH 2B5IB 1RJZA 4X5XB 5CLTA 3PHQB 1MHPL 4M1GH 3U1SL 4HSQA 4C83B 1DP0A 3KNBA 4QT5A 5DJDB 2PW1A 4OKDA 4FQ2L 1L0YA 3IF1A 1HQ4A 5T33H 5TE7H 5DS8A 2VE6A 3O41A 5I1DA 2DKSA 1KJVB 5B8CA 1SM3H 3WNNA 1G7PB 4DK6A 4BZ2H 3WHXB 3GKZA 2AI0H 2DOCA 2AV1A 3BZ4A 4XAKE 4ONHB 2XPGB 3BRGC 4LCCC 1T3FB 3RGVA 5EC1B 2VXUL 3AROA 5KZCD 2FJFB 2VYRE 3VI3F 5HBBA 1N4XL 3MV9D 3MRBA 5I1KL 5C0CA 4ZSOE 5AD0B 4I4WA 1LO4L 4PRPD 1YQVH 4YUEH 2Y5TB 3ULUE 3UJJL 1RIHH 3KPSD 1S7SB 5FECB 5E2JA 5B38B 2YC1B 1TVDA 3K46A 2NY0C 1U3HD 2JJSC 3GSNB 4OZ4A 4ZFGL 1OAKH 4MHHI 3NAAL 1YECH 1S7QB 2ZUSA 1NCAL 5IB2B 4PV8A 4Y4FB 1KG0A 3UTTA 4G3YL 4QXUL 3BMVA 5E03A 1FNFA 4NP4H 5IJKC 3JSSA 4RA3A 5F44A 3ZTJG 5K93A 2FZ3A 2OX5A 1D5XA 4LCWD 5BV7H 2NY7L 3RZWA 4Y16B 2BJML 1I8MB 5J89A 4C4KT 4IJ3C 1Q8MA 1JNNL 4CJ0A 4P4KA 2O5XL 2QQKL 1IGIH 1UCBL 3GFUA 4HQQL 2BVQB 4WI7A 2DIAA 3JTTB 4X6BA 5IVNA 2A83A 3CVHB 3IF1B 1HINL 3K8KA 2YZ1A 3AAZA 5GGVY 1FHGA 2AJ3B 3HZMA 3CNKA 2DJSA 3IDJA 1AQKL 3MBXH 3PHQA 1QSFA 4X9IA 4CVWA 3CUPA 3DGGB 5GJSL 4ESKA 1FBIH 4JFFE 3UCRA 3S5LG 4JE4B 2ARWA 1OLLA 3E0GA 5ITBH 1RZKH 1PY9A 1IT9H 3MRKB 1PQZA 5D1QA 1P4BL 1X5HA 2YMXH 5C09A 4NWTH 2HKHL 4Y8AA 4BSVB 2GJ6E 1VKXA 3TWCL 2HJKB 3ARBA 2IMMA 5EZOH 2XPGA 5EUOA 3S34L 1HH6A 1ULVA 2D0GA 3QCUH 1FNGB 1N6UA 4AEIH 1U3HB 3L5HA 1YMME 5CSZB 5HI4C 4EIGB 2YPKB 1W0VB 4FFWD 4GKNA 1BECA 2DLTA 5D1XB 5F1NA 4GRLD 3VXSB 1WC7A 2VSDA 3BZDA 3RL2A 1M6OA 4G8EA 1Q1JL 2V6HA 2XY2A 3O6KH 3V6ZA 1U8LA 1MWAA 1YEIL 2Q6WA 4WGWB 1CFSA 4ZSOA 4HIEA 2R23A 1LE5B 2EDKA 4ONGH 1CXIA 5BVPH 5F88B 3SE8L 2DMKA 4OZIF 1I3RA 2IEPA 4LKXA 4Y2DD 4Q97A 4KK5C 3CZFB 3INUH 4P9ML 3MRMB 4ZAKC 1DBBH 2QV2A 3GJFH 2F54B 5I17B 5F7UA 1BGXH 4KQ4L 4CW1A 1QLFB 1S9YA 2X4UA 3FB6B 2ICWI 4KVNL 4OCWH 2NYYC 1HILA 4NO0A 3OJDB 2BY0A 2DIBA 4NRZB 5JXAL 5HJ3A 3PL6D 4PREA 4Y2OA 3V5HA 1OARH 3QZWA 2WUCH 3GBMH 1S5HB 1NC2D 1YEDB 5FOJA 1NAKL 5HHVL 5HHOA 1BVLA 1CYGA 1SM3L 2E5EA 3DWTA 1YYLH 1OM3L 3ILPA 2P4AB 5I1GL 5E2WH 3UTZB 1HXYB 3IFLL 4R2GD 1AP2B 1MHEA 4HEME 2R9HD 5FO9A 5IIEB 5F1IB 1I9RL 3VXNA 5HHMB 1S3KL 4JGMA 4XVJL 3RBSA 2HTLC 4BJLA 3HG1A 2X41A 4TVPE 4DQOH 1R5VA 5JLZA 2FLRT 2EYSB 4YXLL 2N7BA 4XPFH 3IDMA 4X0KA 1YEHH 3QT2A 3FAWA 1IAII 4NWUL 3DROB 4RWHA 4Z0BH 3T4AA 5KVFH 3D25A 4UT7L 4EQ3A 1C12A 2WQ8A 4F15C 4LVOB 3BWAB 3KS0J 2FYYB 4G43B 4FQQA 4AZ8A 3GDBA 4L4VD 3GUTB 2DM4A 3QCVL 1KPUB 3V6OE 5ID1B 2Y6SD 4FTVD 4LBEB 4LVOC 2W9LA 3DI3B 3U4EB 1LNUA 5IMLB 1IC5L 3BAEH 5CILL 4PJHE 4XGZA 4KJQD 4ZD3H 1E6JH 4XAWH 4Y4FD 4OZGB 4PJ7F 3VXMD 1KEGL 4PLOB 1ZHNA 1CDHA 3FT3B 4U1NA 3QIBB 4G9DA 3IYLW 5LGJA 3P11L 3EYQD 5ALCL 1FNEA 4H8WL 5HYJA 4AL8H 4Q9RL 2Z0BA 1RIUL 3S5LA 3BP7A 3RPIB 4YZFE 1L9NA 5HYJB 5IG7A 2WAHA 2BDNH 5LWYL 1QSEB 5IW3A 3H9YA 3F7QA 1A21A 1RVFL 2D9QB 3WKMH 1G0XA 2Q7NA 4OFYD 5DR5H 5C6PB 1NEUA 1NEZA 4PJ5D 2BHUA 2FO4B 1ORSB 4PIRF 3B43A 4P49A 5K9KB 3A6BL 3L3DB 1EO8L 5F7YC 3WBDA 3RUGB 4F7MB 3OPZH 3MLVL 4JM4H 2OR9H 2NY5H 1OY3B 2FJGB 3O8XD 4X7CC 2R2EB 5CEXA 2O26U 4PG9A 1R24B 4DEPC 4EDXA 1G0YR 1NAMH 3U30C 5D2NC 4Z7UB 4FQIH 3C2AL 2ED9A 4C57C 4N5UA 1Q1JH 4OLXH 4P57B 4WUUA 3A67H 2X10A 1EBPA 15C8H 1NBVL 1WAAA 1IM9B 3L1OL 2UWEE 3RWJA 1H0DA 2NY1C 1JHLL 4PY7A 5FUOH 1S7RA 5F9WB 4PY7B 4U3CA 3NFSH 3PV6A 4A6YB 5I73B 4RRPG 4Z7QE 1T4KA 4G6KL 2O93L 2FWOA 4DGVL 4M7ZC 1HWHB 4HBQA 2O5YL 3FRUB 4Q0XL 2J6EH 5C0DB 1P7KB 3UTPD 4M6ML 2CO6B 3GHBH 5I76A 3P0YL 5CJBA 3VDBA 1YA5A 1NUNB 1QVOB 5EULV 3QRGL 1NDMA 3O2DA 1F11B 1ZKAA 3DETC 3VW3L 1S7XA 2X1PA 1EZVX 5DTFB 1IEBA 2XI9A 4PRNB 2F15A 2YOCA 4DKDC 2YA0A 2WUCL 4OJFH 1AI1L 4X7DC 2Q3AA 1KULA 5JORB 3EOBA 2DDQL 5DD3H 3T8XA 2H2SD 4P4RB 1UYWH 2VZSA 5DJXB 2Y06H 5EO0B 1CF8H 3FQNA 1A7OH 2ZNXA 1EEQA 4PV9B 4X99B 4D0DB 1N64L 4EI5D 3L3OB 4NQTA 1QA9B 2IH3A 3G5VA 5CJQH 3BYYA 4NKOB 3PHOB 5K9OA 3GMPB 5BOZG 4BZ1L 5GJTH 1CIUA 5JW3L 4BFGA 2GK0B 2RFXB 1U3HC 3HR5B 4EN3D 5FDWA 2C1PA 1RJLB 2AJYH 1FZOB 5I30H 1D9KA 1EEYB 3GK8H 3KPOB 4OM1L 1CE1H 4A6YH 3MA9H 8CGTA 5GRVK 3QI9C 4KI5E 2FX7L 5FYKD 4RRPA 3KHOA 5JHDD 4WEMB 5D2LF 4MJ5A 2FH8A 5DJCA 5IGXL 5F7DA 4ETQA 2VABB 4LDOB 3DV4B 3BWAA 2XZCH 1L7IL 4YHML 3WE6B 1LGVA 5EOQL 3BN9C 3NTCH 4ELMB 5EU6E 3GIVB 1TZIA 3S36L 3UTTB 1YN6A 3MNZA 3LPGA 5JOPD 1M1SA 3T2NL 1F4XH 1KEGH 4U1KA 1HZHH 1QFOA 3F58L 1QHPA 2P24B 1CD8A 5CIPA 3RWDB 2CIKA 5FA3A 1S5IH 3MZGB 1FIGL 2HJFA 4G9FA 4Z7VE 2VXSH 1NGQH 1RIUH 2FHBA 5DD5H 5F9JA 3W11D 3VXSD 5AWNL 2C3VA 5EOCL 5T5FL 4O9HH 3OKLB 3BP5B 4LCWE 1LO4H 1FGVH 2FR4A 1S7UA 3JV6A 1RV6X 5KVDH 5FUZH 5DGRA 5EO1B 4O58H 1U2CA 1XAUA 3KXFD 4R96A 3DHJA 4NKIL 3NCJH 3FFCA 4P59L 1F4YH 1F13A 1KCKA 2IANB 4M48H 1HE7A 1E27B 3NIFE 5BZWA 3V95A 4FXLA 4K3EH 1KB9J 4XNXL 1P5UA 1N0XL 2DLEA 3TLRA 5ILTL 2E6JA 3REWB 5IF0B 4JO3H 3OBAA 1Q9KA 1J12A 4OGZA 1YJDC 2ORBL 4KKCD 4P5TA 3D2UA 3EDFA 3X17A 1FLTX 1IAIM 4OGAD 1ETZB 4D8PA 4ZG1A 3WSQL 3RPKA 4XBEL 1A3LL 3GBNL 3LHPL 2IGFL 2EIDA 4GG8B 5C0BA 1FN4A 2XA3A 4KTDH 4KUZH 2DM2A 4P46D 2L7UA 4R90L 2GW5A 4KAQH 2ADJA 1I1AD 3CDCA 1A1MA 2BMKB 2W60B 2AJUL 1T03H 1KB5B 3NMEA 4ZFZB 1H3PH 5IR1B 3RDTA 4JLRB 1MOEA 3QJFA 1E4XH 4MJIE 4PD4J 3RY5A 1VGKA 3QEUB 4YHOH 2ADFH 5DRZB 5C7XL 5HYSA 3ZE0F 2KDGA 5LVEA 1CL7L 5LG1A 4DGVH 3ZKXC 5K59E 3F7VA 2LTQB 2J88L 4GKNB 5DO2C 1NGXB 4JVUA 4IOSD 5DVNA 1KNOA 5FKPA 3QDGD 3CX2A 4LU5H 3BIBX 3DSFL 3CFCH 1G7LB 3QRGH 4HFUH 5ENWA 4M1CD 1TZIB 1FE8L 3BEVB 2C9AA 3RZCA 3Q5TA 4OSUH 2CUHA 3DV4A 3D48R 1B0GA 3PWJB 1XGPB 3SDDD 4WVRA 4TUJA 4OD1H 2MKWA 2VDKL 3WUWA 1N5YL 1ADQH 1BLNB 4OI8A 5IV2A 4F58H 5F71A 2A9NH 4Y7MA 3MLXL 3QUYC 3BGMB 3C8HA 4J3OC 4MYWB 2IANE 4M43H 1ZVSB 3QUZD 3VFWB 2CKBB 1FAIH 2KBGA 4ODBD 1CGVA 1ZMYA 4NZRL 3SE3C 4AJ0A 4LLVA 1QRNA 1IGYA 3B9KB 3VXRD 2A6IA 3QHTC 3FQWB 2IWGA 5ESAA 1CDGA 4OFYA 4GW4A 4PRHE 1NFIA 4XPHL 3STLB 3X13A 3H9SE 3L7EA 1MAKA 1Q72H 2IQAB 5F7HA 1MVUA 1Y6KR 1AXSB 4JB9L 4DUVA 4PGDA 5DUBA 3SDCA 1DL7L 1G1CA 4C56A 4LVHB 4U6TA 3D3VE 2L4OA 3TN0C 4EI6A 3P2TA 4LSUH 1P7QD 3LQMA 4XHJC 3VA6A 4LPVA 1NLDL 1XH3A 3SKNB 4ZOBA 3VMPA 2VDPL 5DD6A 4MA8L 1VSCA 2EH8L 1FRGL 3FT4B 5MENA 1OP9A 3X12A 5D2LE 1CGUA 1GGIL 1T04A 3HZKA 5KTEH 2K3TA 2CKBL 4MJ6A 3ZE2E 3H9HB 3G6JF 5F6IB 4JRWA 3OKNA 1XF3A 3GRWH 1OTTC 5CD3B 3K0WA 3TJHD 1LWRA 2E7LC 1JGVH 5BRZE 2ESVB 4JKKA 3NCBB 4R0LB 3C08H 3PG2A 3LS5H 1R3IH 2FWOB 4IRJA 3CC5A 1XGPA 3BGFB 2M26A 4P3CL 4XP9L 4QHMB 1SY6A 1F5WA 3QDMD 4G9FE 4TOYH 1P69B 1RUQL 4U1LB 2ZPKL 4P2RA 2EC9T 3ZHLA 1DBKH 1EEZB 2OBGA 5IMKB 5KVDL 2GTZB 3I3EA 3ALPA 4CADA 4YXLH 4I3SH 4JM2C 1O0VA 2ZUUA 4POYA 4P59H 1ZA3A 2PO6D 2YN5A 1DEDA 8FABA 4CVXB 3BEWB 5JA9A 2OTWB 4KJPD 5J11B 3N1PC 2O61A 3ES6A 4L8CB 2K9UA 5EO1A 3QCVH 2YUVA 1LO3L 2A6JB 3GSUA 4JFDB 4JRXB 1J8HB 3ZTNL 5ITFA 4NHCL 2CUMA 2FIKB 2M8XA 1BZ7B 5CP7A 3OJMB 5L0QC 4NPYA 3FB7B 4XC1L 3ZE2F 1T5XB 2DAVA 3NACL 2DI7A 1OW0A 3PABA 3BRDA 1WTLA 4FMFA 2AABL 4JDTH 3WSQH 1BVZA 2H6PB 2VR5A 2HFEA 1NCAH 2BHYA 4JFQB 1CQYA 3BDXA 4HIHB 4ZXBB 2X4OB 2ZSWA 5JQHC 5DK0B 2ZZUT 3HB3C 3B5TA 4WNQA 4I8DA 4MQXC 1RPQA 5GRXG 3GO1H 3RBGA 2A74A 4KROC 4K71C 5C08E 3BJ91 4AL8L 2Y25A 4MS8C 2Q86B 1DE4A 1ZSDA 5DSCB 5LQBH 1HI6B 4A2LA 5KVGH 1U8OB 3V8CA 1UJ3C 4I48A 3CPLB 4PRPB 5TFSH 1FDLH 3HE6C 2DTSA 4NSKB 4MQ7A 2P1YA 2CGRL 1U91B 2P5WD 1A7PL 3WFZA 3ILQC 4L8DB 1IKFH 1T4KB 5CINH 4R4ND 3QQ4A 4J3SA 3AXLB 1UJ3A 3CLFH 4EVNB 1NEZG 2DQHH 3ARZA 4GAFB 2OTUB 2HG5B 4LBEA 2APFA 2NY5L 3RDTC 3BSZH 4Z0XB 4E41D 2UWEF 4Y5YC 1LP9B 2I60L 3U0PB 4FQIL 4FXKB 4DUXA 1GHFL 1MCEA 3S34H 2Z31C 1V3KA 3WNOA 4LMQI 4WENB 2RHEA 1INQA 1MJUL 2PYED 4PJBA 3STZA 3D85D 4WW2B 1MFBL 1MFCL 3HE7C 1AKJA 3IDYC 4JN1H 3OKDA 3HFMH 2E27H 4LPWA 1JZ2A 1MFAL 4CMMB 1N3NA 2F54E 3PGCA 3ZKNC 5HHPA 3QIWB 4RAHA 1F02I 3LKNB 1MY7A 4Y5XB 3TIDA 3CVHL 2G60H 3F62A 1RJCA 4HD9A 3G6JA 3F6IA 4S2SB 5FAAA 2R39A 1JGEA 1KF9B 2FIKA 4R26L 1DZBA 4ODTL 3Q5YA 1INQB 3ES6B 4L8CA 5C0DA 3CXHJ 4E0RB 4HW6A 5DHXB 3OR6B 3BPNC 1V7NH 2EIEA 2FL5A 2WLYA 3QXWA 4XCYB 4MXWL 1RIHL 1UH4A 1MIML 4L9LB 3GHEL 4OD3H 4PGCA 1IGTB 4Z7WA 2JJUA 3F6LA 3O6FD 1DE4B 2GHWB 4APQB 4L9LC 2H32H 3BKJH 3LKOA 3R0MA 4OUUA 1HXYA 5GPRA 4YDLC 5A2FA 2R8SL 3G5XA 3VG9C 4MGXA 1KV3A 4F9PA 4MNHA 1MCOL 2P8MB 1RZIB 5CD3A 2BVPB 4JRYD 3MV7B 5E6ID 5GSRA 2FX8H 2CPCA 5T3XD 2D7OA 2HT3C 1OM3H 2AJSH 3TO2A 2QQKH 4E5XB 3QRFM 3HG1E 1BVKA 2HVJA 4HMCA 1CE1L 1KENL 3DUSA 4Y16C 2IFFL 4QCIA 1MI5B 3K7UA 3C60C 3MV8A 3HLAB 1J1PH 3QAZB 5I73C 1CLZL 1VFMA 3PQYB 5FCSH 5GJSH 1PGRB 5GRZA 3HI5H 3V6OA 5D6DA 3KLHC 4K2UH 4NO2A 1HSBB 3WFEL 3MRRA 4PJ9C 4LOUC 3VXME 5T3ZE 5L9DH 3HMXA 1JZ8A 1R6VA 3HE6D 3HPLA 2YA1A 4OLWL 4Q6YA 3OR6A 4MS8D 4HMDA 4QRSB 5ACLA 3QUYA 1U0QA 3DX8A 3O0RH 4AT6B 4XMLH 2XRAL 5DUMH 3SGDI 2XN9D 1UM4L 3KJ6L 4NUGH 4IDJH 3L3DA 1WZKA 1P6FA 1I9IH 4ZAKB 5HGHB 4KTEH 4ZTOL 4HJ0C 1JZ3A 4Z7WF 3MFFB 5KSAA 1J1XH 1KCUL 3SJVD 1HKFA 3T1WA 4FMKA 3D0LA 1QLFA 1S9YB 3I6GB 1JHKL 3DRTA 3SDCB 3RUGE 1A7PH 3CCHA 1UB6A 2MHAA 5D7IA 4JDZA 4FZ8H 4C4KO 1WBZB 3VGAC 1I8MA 2QEJA 3MJ8A 4KJPC 4N90E 4PGCB 5H94A 5E8DL 1TFHA 3V4PH 1NUGA 3OXRA 4LF3A 3VE0B 1MAML 3S3PA 2ZG2A 5HHXH 4EVNA 2NXYB 3L7FB 3QHZH 5IHUH 3TNMB 1A6AB 3WFDH 3QJFB 4IRJD 2UZIH 1GHFH 3G6DL 2VOTA 4PJCA 3MLWH 4O4YH 4PJDA 4Q9CA 4NN5C 3PDDA 3BE1H 2VL4A 5C0CB 1MFAH 1BQUA 1YYML 4I3RL 4FXGB 3T1FA 4CDGC 4MXQD 2P5WB 2I9TB 1PKQB 3MLPA 3IAQA 5GSVB 4ZNEA 4TQEH 1GGBH 3OKEB 4NQVA 5IVZA 7CGTA 1JI1A 3IDXL 5D1ZD 2ZOKA 4JG1H 1KIUA 3ARRA 5BMFH 5MEND 4HF5H 3K4ZA 4PLJC 3V7MA 3UJIL 2GTZA 5D7JD 2HFEB 2ED7A 2J6EA 1KC5H 5E4EB 1MIMH 2DB8A 1I7RA 4KKLC 4LHQB 1RZJL 3PABB 1YMHB 3FB7A 4WUUD 3JTTA 3SDYL 1KCLA 3W11C 2A9MH 4HLZG 1X4ZA 4PJFB 2PXYA 3SGEH 4LLYB 4U3HA 2VXTH 5JPMB 3I6KB 2G2RB 2I27N 5BRZD 4ZODA 1RULH 4S11A 2DI8A 4D0BB 1EHXA 5D2NE 3O6FB 3MRNB 4IS6B 3ARUA 1WCBB 5JO5A 4F15B 1CG9B 1XFPA 1U8NA 3NN8A 4JFOB 2F53A 2JB6A 4LCCB 4NN6C 3ARQA 3NIGF 3REWA 2EDXA 3T77B 4X6CE 2EDWA 2P43B 3PP3K 3Q3GB 1WBXA 2DIJA 2FHCA 1NMAL 3HB3D 5HVHC 2Z31B 3TA3D 5T3ZH 3VXPB 5AUMA 4QRQA 4WUKL 3DXAA 3QJHA 5I30L 2BOBA 1L7TH 2W0FA 5E70A 2C3VB 1BAFL 5IESH 1JGLH 4X6EB 1IGML 5TH2A 1NCCH 2DWDA 5DFWH 1A6WL 1AIFB 5DUPL 4ZPVA 1MPAL 1WFNA 2NXZD 1NDGB 1JNLL 1BQLH 3V0AC 4X6DF 1WICA 5E2VL 5IBUG 3TEUA 3VXTB 2OR9L 5JW4M 2XWJB 3ETBF 2IBBA 4M4PA 4LDLB 4TUJB 4HCRA 1FYTE 2CLZB 1TDQA 4K9EH 4R97B 5D6CA 2DD8L 3KR3L 5LKNA 4Z7VA 3PWPE 4PB9L 3WIIH 1S7VB 3GJEA 1XF1A 4R4FH 1MHPH 4PPTA 2W91A 2VLLA 4UB0L 4ZO7A 5J3HD 3IFPB 4JO1L 4LSSL 1KPVA 5CZXD 5GS1C 3DVNA 4KKCC 3V6OC 5F7FA 4OT1H 4JM2D 5IKCB 1FH5H 3MRHA 3O9WB 5I2IA 5F9WC 1AY1L 1A0QH 3VRIB 1MCHA 5DZNA 4IS6A 1OTUD 1PG7X 5EOCH 1SVCP 4YHPB 4AT6A 5D2NB 2YA2A 3KJ4B 4P5TD 5DJAA 1H8OA 1GRWA 4FQXD 1T6WA 5HTSA 4KVCL 4ZDHA 1VFAB 1YPZB 1SMOA 2R2BA 3V0WL 2DBLL 1JV5A 3TFKD 1A22B 1MCWW 1OTTD 2DQTL 2PYEA 2OMBA 5C0JA 1A3QA 1KFAL 4NQEE 5IK3A 5DMIH 4ZUSB 1GZPA 3H7BB 1PKOA 1DEEA 3G5VB 2MHAB 4MJ4A 3T3PF 1OAZL 3HPJB 2NY3B 12E8L 5K33A 4MA3A 1F42A 4KC3B 1MRFL 3KPOA 1XEDA 1A5FL 2GCYB 2XTJD 1OSPH 5IBUB 4WJ5A 2W9DH 2A6DA 2B1AL 4XMPL 3CXDL 4JFFB 3B9EA 4G3YH 5CEXB 4YR6B 1QACA 4U0RC 2R4RL 4M7KH 3EBAA 3GSNL 2BOBB 5I0ZA 1BBJB 1A1OB 4Z7OE 2RJMA 3FQXB 5DK3A 1OWWA 2ADJB 4P4KC 5AUMB 5FA4B 2FHFA 3OKYA 4N9GA 2IAMB 3P4NA 3GJFK 4N0FB 1SY6H 3LDBB 3LEXA 3MOAH 4JHZA 1MQKL 3LMJH 5HI5D 3QXTA 1OF2B 2EE9A 4NKMA 3TYFB 5GGSA 1VACA 3VXUB 1U95B 4A6YA 5IVOA 1H3VA 3CDGB 3FB5A 5DVOA 5CBAA 1JWSB 1OPGH 5IMMB 3MNWA 5IVXB 3IDGA 4R7DA 5FA3B 4WO4D 4GXVL 3MSPA 3CU1A 5JA8B 3IJHA 3T3MF 3UJTH 1KNOB 3VRJB 5HHNB 1ROWA 1FBIL 4X4MA 4Z78B 4Y2DA 4NT6A 4NQCA 3WJJA 4PLNC 2XZCL 3MRJA 1S7WB 4CMHC 4JN1L 3DRTB 4YDVA 3KS0H 3SO5A 5EOQH 2AK4D 4X5XA 2G75B 1LO5A 1T2QL 3GI8L 1F4AA 4NM8H 4UIKL 5IQ7L 1KB5L 4Z7OF 4E41B 5HPMA 5A40E 5K9KA 3T04D 2ZCLH 3H9SD 1VCAA 2N4IA 3QIWA 3CFBB 4BQCA 1ZEAL 4WU7B 1AR1D 1ORSA 5J13C 1XGTA 1HKLL 2X89D 3V5DA 4RQQA 2VRAA 5FYJL 1JPTH 1CLYH 2R1YB 4MDIB 1YNKH 3OKKB 4KK9D 3ZE1E 1Q9KB 3HE6A 3K81A 3FZUD 4H1LH 4KMTL 2ITCA 5JIHA 4JFZH 4QRTA 3TH3T 4X83A 1GC1L 4XPGL 4JPWH 2I25N 3LKSA 5BRZB 1CDJA 1F58L 2AJXL 3N9GH 5C0BE 4EUPH 3SO3C 1OAXL 3CU7A 5F7EH 1U8JA 4QHLB 4QHNA 4M61B 1AGEB 3TFKC 1MCRA 4G7VL 2CLRA 3HS0A 4X80L 3GMQA 2VDPH 3MV9A 5HHME 1VDGA 1C7TA 4L8DA 2E7MA 1Z9MA 1WEJH 3OKLA 5GGQH 2XFXA 4MA1B 5MERA 3MV11 5CJXC 3IU4L 1I75A 1MLCA 3KGRA 4X9HA 2A73A 1ZE3C 1OB1B 3PGCB 2AJSL 5CD5C 2VC2L 3CFJB 1KBGL 1MQ8A 1FO0H 2SEBB 3O2VL 4M02A 5FHBL 5GSRB 2X9XA 4W6YB 3FO1A 2EDFA 1RZFL 2A77H 2L7JA 2QL1A 3MV8E 1A0QL 1W72L 4OIIL 2ITDB 4UI2A 2GSGA 3E8UH 2NY0B 2OL3B 1FL3B 3ALXA 5HYQB 3JBG7 2ADFL 1CXHA 1DQLL 3EO9L 4W70A 3I6GA 2YPLD 4IMKC 5BO1L 1UWEH 3OGOE 4R7NA 3B9VA 2MSPA 1JIBA 2EDOA 5HGHA 1LNUB 2F19H 4MNQE 2NY3D 4XRCB 3BUYB 3HE7D 4M5YL 3TPUB 5I1CL 5JOPE 2HFFB 5FYJU 1Q94B 2W38A 3IVKA 4NO3B 4ZNCD 4FHBD 3GGWA 4XMLL 1M7DB 3X11A 4OI9A 4UV4L 1AD9A 2BVTA 4RX4D 1S5HA 4WWKA 2E9WA 3OXSB 4F58L 1I9IL 4K3JL 3BUYA 3W0WA 1UZ8B 3SPVB 1RK1A 2ICWA 1U3HA 5CSZA 5F7MC 2BFVL 3RVTD 4ELKA 5F1OB 1I1CA 1S7RB 5TE4H 3KDMB 1B2WL 5AZ2L 5IIEA 4I18A 4D9LH 2B0SL 5IHZB 3LAFA 3WUWG 4I18B 4JFEE 4P2QA 4S1QH 4BK4A 3GIZH 3B5HA 3HE7A 4KRLB 3P11H 4OF0A 5IFJA 4DWHA 3LRGA 4I77H 4E9LA 1HXMB 3H9HA 3NABH 5LCVL 4KGJA 1A7RH 1H5BA 2A73B 4LNRA 3RVUC 3I02A 2P7TB 2HKHH 3V6ZB 4P5KA 1EA9C 1G7IB 4GMSH 4UNVA 1A64A 3VG0H 4NQCB 3CSYA 2VZUA 5BV7B 1M71A 3VXSA 5IVXF 4F37F 5TJWK 1I85C 1DLHB 5FO8B 2CSPA 3UTPE 1EEZA 3WLWD 5MEPB 3SKOB 4TRPH 3KPNB 2GJ6D 2FD6L 3X3FL 3L3GB 5HGBB 2NY4D 5F70A 3Q6FB 3ARVA 4M93C 3L3HA 1DQMH 1HKLH 1U8LB 1UH2A 2VDLH 3B2UC 5IB2A 4OLZH 1P9MA 4LVEA 4NQDA 3QCTH 3ZTJH 5I1KH 3U9UA 4OLXL 3LD8C 5KOMC 4K23H 4OV5B 3T0DA 1M7IA 4B5EA 4M00A 5IFHL 3X12B 4R8WL 3LS4L 4WFFD 4AEEA 3REVA 2CK0L 2JELH 2YD4A 2NY6C 2A83B 2EDJA 3TA3C 5BW7A 4MHHG 4CU6A 5EORL 3FMGH 2WIIB 1J0ZA 3B2UD 3GMQB 3NGBC 4IOIB 4G7VH 1OW0C 4MA3B 1BVLB 1B9ZA 4KJYA 5F7WC 1OARL 4RAUA 1G6RA 5M94B 4NCC1 3WS6C 4J12A 3MRKA 4M6MH 4M1CC 4RGOL 4U1JA 2ZCHL 3OL2A 5C0JB 4NZJA 5CEZH 4LEOA 1RZGB 3MR9A 5J6GB 3FQRA 3GI9H 3GMNA 1G7HB 1K2DA 5FXCH 1YJDL 4XMKH 4FP8H 1X5KA 3HC4H 4C54A 4LQ1A 4Z76B 3R1GL 3QEUA 2VL5B 3QWOB 1HHKB 3ZDXF 3HZYA 4HS6B 4EKXA 1KELH 4NKMB 5KSBA 1TJHH 4NQXA 3EDJA 3EIFA 4Z8FL 2CXGA 3VXPA 2Z91B 1XF3B 4PLKC 4QXGL 1QEWB 3JV5A 4KFZC 2R23B 4HEPG 1H3WM 1Y18A 4KMQA 4PJIA 5HDQL 3ARTA 3G08A 1IT9L 1RY7B 5EC1A 3MRJB 4PUBH 3T4AB 4M8VA 4LOUD 1I8KA 3O2DH 3BEWA 4H26A 4O2EA 3DPBA 4D2NA 2PN5A 4JN2B 1DBMH 4YO0B 5JXEA 5T1KD 4FFYH 3C5ZA 3IDYB 4KV5E 1J0IA 5EN2B 4HIIB 1MELA 3NBNA 2VLJA 1AXSA 4P2YA 3KXFE 2VKWA 1IC4L 3U48A 4GUPB 3CZFA 3LRSB 3I6KA 3TIEA 2YD1A 1SMAA 3TCLB 4N0YL 2PXYB 2GSIA 1XGUA 1FJ1A 5MI0B 4HULB 3IKCB 5CZXC 1W2KT 4PR5A 4HZAA 4BH8B 4POZC 3GSUB 4JRXA 4MQXD 4KZDH 1PYWA 3QIBC 1P7QA 5KBNC 4I0CC 3UTQB 1T1XB 2XV6B 3WN5C 1HZHL 4K7FB 4WFEE 1MRCH 1CU4H 2ZUQC 1GOGA 1XCQA 5I15H 1U8IA 3I9GH 1RU9H 1MAJA 5KSVB 3SKNA 1JF1A 3UXFA 4HWBL 3CMOL 5E6ZA 1NGZA 1HQ4B 1KCVL 3GB7B 3RTQB 2F53B 2H3NA 3BESR 2IPTH 3ZYJA 3WYRA 4Y5XC 5HY9A 4HUWA 2HJLA 5E9DE 2PO6C 4MJ5B 2HH0L 3EOTL 4I2XB 4JHBA 4PGBA 1TTGA 2ATKA 4OD3L 3AFLA 1QFWL 1SEBB 4XTRC 5ICXB 5DRWB 4LKXB 1CGYA 3F7VB 1JPGB 3SE3A 4XP5H 1N0XH 2XNAA 2OQJB 4Y19B 4AENB 1FFRA 3OGCA 4LARH 2HVKB 3WNLA 3OV6A 4NRXB 1B0RA 4KXZH 1OSZA 4PJ8B 2EECA 5IM7B 3GSQA 4XH2A 3UZVB 4E42A 3TESA 4O02L 1WZ1L 3ZT6A 4ZYKA 5A2IH 1G9NL 5C2BH 5IB1A 1H3GA 2ZUYA 2XY1A 1KPVB 4Y4HA 1EGJL 5LGKA 4V1DD 1Z3GH 3Q1SH 4HK0A 4KKLD 4LP5A 3ECBA 4Y1AD 5F97E 1VHPA 5F93C 3DO3A 3FMGL 2A6IB 5DJ2A 4MMXC 3DBXB 1OAYH 4NBZB 3S96A 4HT1H 1N59A 1RZJH 4L3CB 3C60B 1Q9WB 5F96L 1TJIH 4X5WB 3AAZB 1PD6A 1RSFA 1IMHC 2DS4A 4YNYA 5CP3A 3DUHA 2J5LB 5T1KB 5D1ZA 1WVZA 5E95B 2W60A 4OZHB 1J0HA 2VDKH 1W8OA 4ONFH 5GRUL 1ADQL 3EGSB 4O00A 4NKOA 5JW3H 1C5DA 2AXGB 3NA4A 4H8WH 2YR3A 3WCYA 3SE4C 5JDSA 4I2XE 2AV1B 5A2LH 3RWCA 1FVDA 1RIVL 5FYJH 5SWZD 1CZ8L 2X4NA 3MX0A 1I4FB 1VB9A 3OAUL 3KLDA 4DKEH 5EU5A 3AS1A 3BZFA 2HKFL 5L2KE 1KCUH 1NGZB 5CMAA 4MZ3A 4WTZG 4JPWL 4EDXB 5DRZA 3BUTA 4NC0B 2CRYA 2FBJH 1H5BB 4U7SA 4UILH 4RWYH 1E6OH 3UBXB 3H42H 2BNRA 4G9FD 1OP5H 1MUJB 3BIAX 3S9DB 1BPVA 1U58A 3D69A 3BJLA 3RWFA 1ZV5A 3WNKA 3NTCL 1CGSL 1X5IA 1EH9A 2OK0L 2XN9B 2ATPB 1EJOH 4NWTL 5L0QB 3VWKC 3QIBD 3QI9B 1QFWI 2OXHA 5HYJE 3QEQD 4Y88A 2V5TA 15C8L 2RR3A 4XP4L 2QBWA 3U46A 5JHDA 1GSMA 5GXBB 1T5WB 3DMMA 3RJQB 3GRWL 3ARBD 2GITB 4EBQL 2EIZA 4R4FL 2YPLB 1QA9A 4NOFA 3VFSA 4S0TD 3TV3H 5B8CC 1I1AB 1RU9L 1HCFX 1G9EA 1FH5L 4DFIA 1OD9A 3QZWG 3LH2L 3NH7L 5EUKB 3Q5OA 4RISL 1UEYA 4TSBH 1RUMH 4MLIA 2EYTB 2E7CA 2Y9RT 5C8JB 5I1CH 2X4PB 1MCWM 2ZPKH 4ONGL 4WHTA 5GRJH 3WLBA 4Y4KA 3ULUL 3KLHD 5KJRH 2J4WL 4U6XB 4JQIH 4N8VG 3KYMA 5HVGB 2R69L 3MUY1 3BH8B 5ICYB 4BQ8A 1G6RH 1U6AL 2A0LC 5CJ5A 1NC4B 1A2YB 2IFGA 3NAAH 5C0ND 1KPRB 4QNPE 2K7PA 2VLKA 2KUTA 5FDWB 3C09C 4XB8A 3OXRB 2HT3D 3HKFA 1DDHB 1FG2B 3TBVB 4KUZL 1A7OL 5C3TA 2X4QA 1I7TA 5TE4L 3Q48A 4U1JB 3ULUC 1HHHB 5CJXA 1IC7L 4JDVB 3WD5H 5D7JC 3RWJB 5EZJA 3O9WD 3HRZB 3VGDA 1IGIL 1UCBH 3QXAB 1I1YA 3IJSA 3SDDA 3RP1A 3MV9B 3MCG1 1G7IA 1LEGB 3MACH 4U1HA 3FN3A 4B50A 3CFKA 1YEKH 5MP6H 1A7RL 2HLAA 4DAGL 1S7XB 3S88H 1T0PB 4TUKL 3QUYD 1FE8H 3QEGH 1KN4L 1EDQA 3MRIA 1PSKH 3QUYB 2VQ1A 3NZHL 3QH3B 4D3CL 1QKZL 3VFSB 2EEDA 4LK4A 3TNNA 3VWKA 3T65A 5L2KD 4PYHA 2AK4B 2AXJA 2CO7B 1L7TL 5D1QC 1T5WA 1TQBB 1FZKA 5ISZA 4IRJC 4JHAL 1FNHA 4ZUTA 3MJ7A 4UT7H 3CX5J 5E99H 4CRPA 1S7TB 5F3HB 3IXTA 2VKXA 1X5XA 4OF6A 4WCYL 3CFEA 3GMLA 5JHDE 3MYZA 4YPJA 1EX0A 4HCRH 2B1HH 5L8JB 3LPWA 1OCWH 1G7QB 3H2WA 1AC6A 1BEYH 1VADB 4QOKD 4OZFG 1DLFL 1WITA 3VG9B 2CLRB 3P77B 3HS0B 4NM8L 4G8GB 2W0PA 3D0VA 1BVKB 2F74B 1IJ9A 2HVJB 4UB0H 4C56E 3OB8A 1Q94A 3IVKB 2X1WL 3FT2A 3NFPA 3BPOB 4YFLI 3UPCA 1JPST 1MIEH 1CXEA 1RURH 4Q9RH 5E94A 3L5XH 4HLJA 2VLJD 4UOJA 1JJUA 4ELME 1IAKB 3V5KA 1CK0H 4KHTL 5D1ZC 4KK6C 2R2HB 2GKIA 4N0RA 3TN0B 1BGXL 1B6DA 2HWZL 3JTSB 1FL3A 2ORBH 4X98B 1P2CA 3EGSA 3A6CH 4ZQKA 3TZVB 2FO1A 1I3RB 3GI9L 2XIDA 4MXWH 4NPYB 3PWNB 3RIAK 4Q9QL 5J0BA 2Q6WB 3D9AH 1FL6B 3V4UL 4R4BA 1F90H 4WFGE 5EZIH 1OHQA 4JM2B 4MQTB 4KK6D 3GSXA 4HGMA 3SY0B 4PGJA 1T89C 1R3HB 2YPLA 2CXKA 3AUVA 1UC6A 1CIDA 1OSPL 3AREA 3I75A 3S98A 3MRFB 5JPNA 3PWVB 4LDEB 3VRJA 3WFBH 1QFWM 1IQWL 1ZLSH 3QEQB 1Q38A 1TQCB 3ULVF 2W59A 3DBXA 4BFBD 1KTDB 5C9KA 2ICEB 3SOBH 1XZ0A 4OAWA 3BD3A 5FGSA 4CMMA 1I9RH 1J1OH 2QR0A 3PXJA 5F8QC 2XXMB 5ANMA 5FUCE 1ODAA 3WXVH 1OP5K 3WEXA 3THMH 3NGBB 3FHAA 5CJ8A 4XHQA 1J05A 2AK4A 3AC0A 4FFVD 2A1WL 1KG0B 1PEZA 4MWFB 5ALBL 3RA7L 3MA7A 1JYVA 5JTWA 4PGZA 4BK5A 1JN6B 3PNWA 4HWEL 4PJGF 1BFSA 4RNRB 4U0QB 1YQVL 4DW2L 5FKAA 3R8BB 1TCMA 2PO6A 5IFAH 4EUPB 4U7KA 1ZVYA 5EIQA 4P2QD 4J1UB 4LLDB 4IM8A 1E6JL 4RGNC 4ZFOB 3DX7B 4NSKA 4G6JL 3D25B 1CDUA 4TULL 1AGEA 3MUGA 5H8DA 2P8PA 3QB7C 4I2XA 4WRLA 1W8NA 1UFUA 5GGTH 4ZUSA 4J3TA 1IKNA 5ALCH 4HUWB 2EDRA 1IQDB 1UXSA 1W0WA 4HKJA 3E6HA 5GGTA 1FNGA 1P5VA 4J4PC 4U1LA 5TH2B 5E56A 5FEBA 1KPRA 4DTGL 3V52L 3KPRE 3CDGA 3FB5B 4XVTH 5CBAB 5AG9A 4HKXA 4P23A 5DR5L 5D8JL 2OL3H 1ZHLB 2YRPA 1T21B 4NJAH 1PX3A 4WDIB 2BSRA 1ZVHA 2YC1A 5B38A 5HPOA 2F5BL 3M1BB 2P5WE 4GW1B 2AXHA 2FJHB 4YPGA 2HFTA 1NH6A 2ZCKL 5KTEL 4ODSH 4YX2L 2AVGA 1PFCA 1MFDH 1QLRB 1CGTA 4Y1AB 1OAXH 2BVOB 2IJ0C 3S37H 4XX1G 4LCWA 3I3BA 3DXAD 1XGUB 2VISA 4MJ2A 4MA1C 3LOWA 3UEZA 1HILB 4NO0B 4YHMH 4M7LL 2YK1L 4LCCA 4NT6B 4ZFFB 4TPRH 5GGQL 4HIIA 1BEYL 4FQXA 2Y07L 4PJAB 2FECL 3VFOA 3W9DA 3F7PC 5A3IC 4YFLF 2X4UB 4AIXA 3ARBC 2F5AL 4GAJL 3MRNA 3O6FA 3CVHH 5C0GB 4LLQB 5D7SL 3TBYB 3EAKA 2DM3A 4Y19D 4X9FA 3L5WB 4M03A 4PBXA 1K8IB 4PGEB 4PJ5E 5I66A 3QP3A 1JYNA 1ZHBB 4GO6B 3V8OA 1MWAL 4H1LA 4HK0B 1BP3B 3WNPA