5DRNA

Context-independent anti-hypusine antibody fabhpu24 in complex with hypusine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
EEQLKESGGRLVAPGTPLTLTCTVSGFDISDYAMIWVRQAPGKGLEWIGIIYGGSNKLAYAKWAKGRFTISRTSTTVDLKITSPTTEDTATYFCARGYGSMDGYDRLNLWGQGTLVTVSSGQPKGPSVFPLAPCCGDTPSSTVTLGCLVKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis and Optimization of Context-Independent Anti-Hypusine Antibodies.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
molecule keywords Fab Hpu24 Heavy chain
total genus 42
structure length 216
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drnA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drnA01
4H1LA 3QO0B 2VQ1B 3RL1B 2AEPL 4FXKA 4N68A 1IEAA 1PZ5A 3JV4A 4WW1A 1ZS8B 1MFCH 2EXWD 4Y8DC 4C57C 4XH2A 5ID0A 1XZ0B 4P46C 1JZ3A 3GEWB 2NYYD 5FV1L 4X7TA 1GJIA 4TSCH 4GQ9H 3AUVA 5KAQF 4UINH 1KJ3H 3M1BB 1VACA 4NWTH 1I7TA 4WEUD 4JLRA 4PRHA 3T8XA 1MRFH 5E1AB 1GGUA 3VW3H 4IRZH 4OCXH 1A5FH 3BT2H 5KJRH 1TZGL 3ES6B 4N0RA 3MJ9H 3UP1A 3G6JE 5F89A 3MGOB 1PBYA 4HPOH 4UOW1 1KIRB 3C2AH 4GRLB 1F58L 3P77A 1U6AH 4WTZA 1KPUB 4GKNA 5T1DL 4NNPH 1NUNB 2HJFB 3PWLB 1AXTH 5EU5B 3P11L 5C0FA 5IB5B 2OR8A 2ZPKH 1FPTH 3P4MA 4LU5L 4M62H 3TT3H 5TDOA 5ESAA 3EOAB 5KVEL 5E6ID 3IF1A 4LLAA 1T2QH 1CICA 4F7CA 5JXAH 3QFJD 1OGAD 5IBTL 1Q1JH 1ZAGA 3D25B 1FYHB 4KTEL 1QVOA 3Q5TA 1NGXA 1BQLH 3FB5B 5C0BA 4P4KC 4XAKE 3FQNA 2X4SA 3AM8A 4LP4A 3UBXB 4LAQL 2XFXA 3ROLA 4BFGA 5E5RB 4IJ3C 1D6VH 2HVJB 5A2JH 1KLUA 3SKOB 1PD6A 2P5WA 1HOCB 1IGIL 2YN3A 4FTVD 1RZGB 3QEHA 4UIMA 4ZUSA 3BGFC 5I30L 5INCB 5CJQH 1AC0A 5BVPH 3TC9A 1TDQA 3VFWA 4TN9A 5IEHA 3LEVL 3IXAA 1J88A 4TUKL 2IPKA 2NX5B 3O3BA 3VH8B 5IQ7H 3GSWB 3HAEH 2VN7A 5L2KE 5DD1H 5DS8A 5JNYA 1WTLA 2WANA 4U0QB 2BNUB 2GJ6A 4U1GB 4HBCH 1IGMH 3CDFA 4V1DE 5EO0B 2W9LA 1AD9A 4LCUA 2ZCHH 4NUJB 4NQDE 3WE6A 1BD2A 2FHCA 5IHLB 5DXWA 4HWBH 3K3QA 3V4PH 3V6FB 1YEIL 4XTRC 2IPUG 1XIWB 4WO4D 2XKNB 3HRPA 1ZT1B 3ARFA 4D2NA 4MAYD 3U83A 4JFYB 3GRWH 3S8WA 3TJHD 5DJZB 5I15H 5FYJU 2Y07H 5B4MC 1RZ8B 1CDGA 3MBXH 2FIKB 3L3DB 5J4MA 5FYJD 1WWAX 1YEKH 4FXGA 2WNGA 4GXUM 4UU9A 4UV4H 1C08A 2QKIB 2P47B 4IS6B 1LP9F 4ELMF 1FYTD 2RHEA 1B0RA 3LH2H 1CD1B 2AV1A 4OV6F 1M6OA 2ERJC 4OCYH 1H0DA 3HPJA 4OZFG 3FFCA 3PWNA 1YC8A 4M61B 5E99H 4PJ8C 3MV7E 1SM3L 3CSYB 3P4LA 2MKWA 5AAMA 4YC2B 4CDGC 3ORJA 1TCRA 5CD3A 2OZ4A 1KENH 1R3KA 2FATH 4AM0A 1H3XA 1U8OB 4P2OC 1DQQA 1HN1A 3ARYA 4F3FB 1WF5A 5INDA 3X13B 5JZ7C 3PXJA 3SOBL 3F6IA 1B2WL 2EH8H 4YX2H 5JHLH 4NQTA 4NQDA 4YBQD 4R4FH 3WL9A 1RZ7L 4ZSOB 5D72H 2SEBB 1ORQA 1DQMH 1IT9L 1S9XB 2F74A 1RZKC 1DP0A 2V9QA 3T2NL 2CR6A 2NXZC 3C6SA 5E8NB 1FO0B 1A6VL 1INQA 2QL1A 4YHKL 1FDLL 5L7XH 5EUOA 5JOEA 5DJXA 4OZHF 1UJ3B 5INDB 3PWPD 3EYQD 2ATPB 2CLRB 3DURA 4AT6A 1ZLVK 5IEKA 2PTTB 1NBVH 5FHAH 2NY0D 1EEZB 2V7HA 1X5ZA 1Q9LB 3GBNL 4ODWB 2AVGA 3ZKSD 1BIIA 3NACL 4PJGB 2BNRA 1U3YA 1JPFA 5DK3A 3LCYA 3MPCA 3IDMB 3FFCD 2IC2A 4EI5A 3L6FA 2IAMD 4Z8FL 4MAYB 1DBBL 3MV7A 4I13B 5E8EA 1MHHA 4JJHA 4Z0XB 2F5BH 4BSVA 4JFFD 4Z6AT 1W0WB 3I75A 1YEDB 4BFBD 1NL0H 3DYPA 4PJEB 1F5WA 2QEJA 4P99A 1U3HD 2COQA 5A16A 5DJZA 1SYSA 1OP5H 3UJTH 4DEPC 3RDTC 4MXQD 5IUSA 2V2TB 3ARFD 1P4IL 1ZMYA 2EH8L 1M7DB 4QCIA 3C5SA 4XPAH 2UZIL 2VLLA 3LD8B 4QXGL 1C16B 3VMOA 5C6WH 1QSFA 5JW5B 1HEZA 3F8UB 2Z8WC 4J3VA 1BJMA 3D5OF 4GUPA 3MYJB 3D69A 2BRRL 5DMJB 4ETQB 3D9AH 3T0DA 3GSWA 3GIVB 4I9WE 4OLVL 1BF2A 4M61A 1BWWA 4OZIF 1BZ7B 4PB9L 1IGTA 3IFNH 1XGQB 5TPWH 5DGRA 4JFZL 4JFDD 3V6ZB 4PJDE 4MQXC 4HT1H 1M7XA 3FB8B 4IIQA 2I60L 2EYRB 3LKNB 3BD4A 3AY4C 1NCCH 3QWQB 2NYYC 1YMHB 4QXTB 1N6QH 3F12A 5K9KB 1DQJB 5D4QA 4FQXC 3DBXA 1VESA 2VQTA 2QJDA 5HHMD 5L2JB 1JFQH 1MQ8A 5D93C 4P57B 4ZAKA 3W11D 1CICD 1WT5C 3IKCA 3MJ7A 2VXUL 2NZ9C 2XPGA 2NNAB 4LLMA 4R0LA 1MCNA 3MO1A 3HMXL 5IFHH 2PO6B 3GO1L 1S78D 5EDXA 4MA3B 4UIKH 1I7RB 3ARGB 3GSOB 4KRLB 3D0LA 4XHJC 2F8OA 4LLDB 1QTYT 5IBUB 1I9JH 1NFDA 3J8F7 5EA0H 3VFTB 3IKCB 3VFWB 2F58L 4XCEB 5H2BA 4OZGF 3HE6D 4ZUSB 4P4RB 4YFLF 4CVZA 1ZVSB 1ERNA 5SV3A 5LG1A 1A6ZB 4POUB 2YBRA 4OFYD 1QFHA 3WFHA 2UVEA 1Q1JL 4MA8L 4FOMA 1C1EL 3LQMA 5K9KA 5L9DH 3QDJB 2X70B 5ESQB 4UILH 4Y19B 4P2OB 4KZEL 3CC5B 1ORSA 4MHHG 3T0XA 3RUGE 2ADFL 1XGUB 5D5ME 1JGLH 1FRGH 1I3GH 4ZTOH 1FFOB 1EEYB 3GMOA 4R90L 3ULUF 3F5WB 1LVEA 2VN4A 2CQVA 1EZVY 4OCLC 3SBWC 2QV2A 4YGVA 1CFQA 3WLWC 2NY0C 4GUPB 1BFSA 3LD8C 1HSAA 4AL8L 4X83A 1G7QB 3FHQA 5DZNA 4XC3L 4IOIA 3PXHA 3L5HA 5F7WC 3QIWD 4F7PA 1T7YA 3AS0A 3PGFL 3OKNB 5IHZA 1LD9B 4OSUL 4CKVX 1RIVH 2ITCA 3WLBB 1E4XI 1G7LA 1J1XL 3JV6B 2XWBA 2JLLA 3BP5A 3QXAA 4JPVH 3U82B 5CBAB 1IAOB 1NBQA 1TJHH 3QNYB 1JGUH 3CX5J 1MFBH 5C07D 1PKOA 1QLFA 4EN3C 4EDWL 1AQDA 1F11A 1XMWA 5E8EB 1S5HB 1M1SA 1RJZA 2R1XA 1CDUA 3EJYD 1A6UH 5I1JH 1H5BA 2OK0H 2VITB 5MP6H 2BNQB 2ID5A 2V5MA 3RTQD 5KOVC 3VFUA 4U2ZA 2CJUH 4L4JA 4NJ9L 2EDWA 25C8H 1X5YA 3VFOB 3VWJA 1NBZB 5GS0D 2LE9A 4KZEH 3QO0A 1ZLUH 2X10A 2AJVL 1IQDB 3U46A 1U8JB 3QQ9C 5JO5A 1AGFB 1PJ9A 3U9PH 1QLEH 1A7NL 4XPTL 5EUOB 4YDJB 1DL7L 1KXVC 2HT2D 4LLUA 4NN7B 1MEXH 3WHXA 1BQUA 2FBJH 2AXGB 4P23B 3QUYA 4IDLA 3QI9B 2B4CL 4LGSB 4C4KO 1N64H 2YKLL 5IP4A 4K94L 1KJVA 3GK8H 2N1KA 3PWUA 2A6IB 1W72H 2N56A 4M6OH 3PP3K 4Y2DD 3A6OA 2XZZA 4WHYH 5E08L 1MI5A 5J56B 5ILTH 4YBLC 5EU6B 4HMEA 4QHUA 2B39A 1MVFA 2D7PA 1U95A 5IW6A 1JGUL 3WN5C 4NSKB 1NCDH 1F42A 1T89A 2X5PA 1WWBX 1UM4H 3GJFK 1JNNH 4Q9BA 4LNRA 5CP7B 5AYQA 4GLRH 4LSTH 1RZKL 1UWEL 4R97C 5D1QD 4R7DB 1UWEH 2OYPA 3MJ8A 1MJJB 3LDBC 2WLYA 3FAXA 5IMKA 3R0NA 3FFDA 2R2EA 3A67H 4OZHE 1ZGLM 1DBJL 5F3BA 4G8IA 4PJHB 2B7DT 3HNSH 1CG9A 5FO7A 1PG7H 1F4XL 3KPLB 4WUUB 2X7LB 3W82A 3OKKB 4H26A 3LN4B 4QT5A 1RVFL 5CILL 4MD4B 3EZ8A 2D03L 3UAJD 4GW1A 5D7LA 1KBGL 2V5SA 2BHUA 4G5ZH 4Z7UE 3QP3A 4PJ9C 4O5LH 4B50A 4MX7B 4XPAL 3HZKB 1NQBA 4YHYC 4RMTA 3HZMB 3LHPL 3QUZC 5ESQA 3WJJA 3LMJH 1BGXH 1T6WA 1TZHB 3S96A 2BHYA 3V6OE 3QDJD 4WU5A 2RAMA 1N2RA 2MPAL 1U8QA 2ZSVB 1V3JA 1OTTD 3QPQC 5AEAA 5I8OL 1JYWA 3BZEB 3MRGB 4KQ4L 4CMMB 3KPMA 2EDYA 1Q0YL 4HUXB 1Q9WB 4LPXA 3D2UD 1XF2B 5GSVB 1JPSH 3RVXD 2I07A 5TE4H 3SGJA 4YE4L 4Y16C 2ENYA 2G75A 3O6MH 5I1KL 1ONQA 3IDXL 5FUCE 1P4BL 4NO2B 2E7MA 4U4BA 3TCLA 4L9DA 1OD9A 4LSUL 1HDMA 3PL6C 3EDDA 5KAQG 3C2SA 1G1CA 4HJ0C 5CGYD 1VFOA 4X5LA 2IBZX 4F8TA 4KY1H 1PW3A 3EOAA 3RIFF 5DSCA 3C8HA 4JE4B 3W11C 3D85A 1CGWA 4JRYD 1OCWH 3CK0H 1I8KA 4XT1C 5T5NG 3T77B 3O9WB 3PWPA 1OM3H 3WEXA 4YHKH 2DL9A 1IGIH 4DGYH 2Y5TA 1CVSC 1QBLH 4P2RA 2BHZA 5I1HH 2KKQA 4APQB 2EYRA 2MCPL 3PG2A 2APBA 4H20L 3PDOB 4YHLL 3BGMB 5FCUH 3BW9A 4KMTH 4YUEH 3WDIA 3FOLB 3PV6A 4KUZL 4X6CF 3O0RL 3OKYA 4X5WB 1CL7H 4MQXD 5DRNB 4WFGE 1S7QA 2BVOA 3SCMD 3H9YA 1P6AB 1IGML 1JNHA 4M7JH 4XP4L 1NKRA 1AY1H 4C54A 4RMUA 4GKOA 1FQ9C 1J05A 1TZIA 5FYJE 4CVXA 5DJCB 5FB8A 3KS0J 3D3VB 2GTWB 3IAPA 4Q6IA 5DD5L 5EORH 2VTFA 4MD0B 4UQ2A 1QNZH 2VLLB 3ULUH 3GNML 2ESVB 2I25N 5GS1A 5EC1A 2CRYA 5CJXA 4BH8B 4JQIH 1IKFL 4NRZA 4ONOA 4G9DA 4Y5XC 2VDPL 5T5FL 4DN4H 4HH9B 4PJGE 2KZ1B 4MD0A 3X3FL 2DLIA 3MCLH 4YHZL 1KELL 3W0WE 1OTSD 5DJCA 3VXUA 1FV1A 2NW3A 2BY0A 3WV0A 3RZCC 1U0QA 4JZJA 3TIEA 1MRDH 4KK5C 2RCSL 4HUVB 4U7SA 3V0WH 4IDJH 1ZHKB 4KDTA 4MAYA 4EXPX 2Y06L 3QFDB 1F8TL 1OARL 3KNBB 1IC5H 1DEEA 1RIVL 3Q3GA 1WCQA 4ONHA 5F6IB 3DTXB 1SEQL 1OVZA 3IFOA 3UTOA 1YUHA 3P4OB 2B1AL 1MHCA 1FNSH 5DURB 3T4AA 3EOBB 3LEYH 1YEFH 5GGQH 1GPOH 5E8DL 1SJEB 2YRZA 5I1EH 3ZKMD 4JFXB 4AY0A 1VSCA 4OT1H 4UB0H 3MUHL 4A6YH 2MCG1 1J0HA 1O7VA 1BF8A 1EK3A 4JPWL 2I5YH 1BX2B 2EKSA 3O4OC 4HEPG 5GJSL 1HZHH 4HJ0D 1JZ4A 1A6PA 3DMMA 3UYRL 4LSRH 2XN9A 4JY6A 2BC4A 1WBYA 4ONGL 3IS0X 4Q2ZA 1NMCC 4N8CH 1BZQK 3P0YH 4WHDA 4YHYB 5IJVB 3D2UA 3MRGA 1EJ6A 5TDPB 2EIEA 4X5WA 5JXEA 3HC0B 2KH2B 3PGDB 1WEJH 2ZSVA 4TUOB 2F53A 2F5AL 1OGTA 3ZE1E 4M6NL 4JPIA 3WUWA 3L1OL 3QRGH 1CL7I 4NFBA 4XVUC 1YECL 15C8L 3UEZA 3JZ7A 1G9MH 4IS6A 1HSBB 5B39B 4XP6H 2PW1B 1K4DA 5D6CA 4X8JB 1MLBB 1SJHA 1VADB 2IPTL 3QULB 3U79A 3HTLX 4JPKH 3ZT6A 4ZYKB 2XTJE 3T3MF 1NGQL 4TSCL 4YDIL 1C12B 2HFGH 1MCBA 2QQKL 4U1HB 4MLIA 3UDWC 4I0CC 4XCFL 2IAMA 4UINL 4TTDD 5IWLC 1NAMH 1LK2A 3G5YA 4LRNH 3BIKB 2BMKB 3BD5A 4OQ1A 4MJ6A 5H94B 2R0WL 4LBEA 5EZJA 3BT2L 4C4KT 3G5YB 4ZS6C 1OTUD 3CVIL 4LCUB 1J8KA 4POYA 2PCPB 4OI8A 2FH8A 2AJXH 3GJFB 4XC3H 2I27N 1UC6A 4AIZB 1N2RB 1DBJH 4MVBD 3BH9B 3TWCL 3UTSD 3TCXA 5IW6B 1OPGL 3CH1A 1BAFL 3FN0H 1RZJL 1U8LA 1CDHA 2MHAB 1EPFA 4AEEA 4HIXH 3VXOB 4YDLC 5MEOB 3MRBB 4KK8D 1MI5E 2PW1A 2AEQH 1ZE3C 5FK9B 1MI5D 2EZ0D 4TVPL 1N6QL 1GYAA 1RUMH 5IW3A 4ZS7H 4RA3A 5KVEH 2HFFA 4QYOA 1OT2A 1MJUH 3LS5H 3VXMA 3UBXA 3MBED 2OX5A 1MELA 2XTJB 3ESVF 3CVHL 5F7UA 4KKAC 1KFAL 3DECA 1BGXL 3T0AA 5DHVA 2PTUA 1WTGT 5D2NB 4G8IB 2HTKD 4I77L 1P9MC 3OSKA 3V52H 3QIBA 1MJJA 3MJ8B 3DO7A 4M9PA 1L7TH 4Y0GA 5JORA 5IESL 1Q72L 4HS8H 4MNHB 3L3IA 3MRFB 1ZK9A 4CUCA 4E42A 4YXKL 3RJQB 2YD9A 4LCCB 2ADJB 1LP9B 2Z8VC 4K8RC 4ELMB 4YXKH 4GRLA 3HUJE 1A7RH 1KIRA 3RIFK 5GZND 2Z92B 3CDGB 4LHUB 1BQSA 2LVEA 4HF5L 1A0QH 3NFPB 1WCBA 1DVFB 1K2DA 3KR3H 5EU6A 4Q0XH 1JP5A 3JVGA 3QDGB 2ZCKL 3LRSA 2D9QB 1SY6L 4GG8B 1QR1B 3VG9C 1FZJB 3RWJB 2F19L 3EOBA 5HHQB 1IM3B 1KJVB 2D7TH 4M1CD 2KPNA 3NCMA 1CXLA 1WFTA 3NIDF 4PUBH 3VMNA 5T1MB 1AXIB 1R5VA 4YHNA 2APFA 1IRAY 2DTSA 2DQFA 4PJDF 4XZUB 5LBSL 5FCUL 3RWDB 5HYIA 2VQUA 2XZQL 3GBNH 5MENA 3S36H 2IALA 1RHHB 5IJVA 1S9YA 3GIZL 3WFCH 3ISWA 2HTLD 1JF6A 1DSFL 4M7ZC 1B4JH 4H1LB 1D3CA 4LSTL 2PO6C 1BQHG 3ALXA 2AV7A 3BPCB 1F3JB 3E6FB 3BUYB 1KFAH 4HS6A 5D9SA 5IB2A 1J8HD 4KKCC 5DMGD 5HI5D 1EVUA 4OF8A 4FP8H 3MXWH 2M8XA 1FZOB 3RWFB 3VFOA 3QZWA 2V6HA 2AJ3A 4Q9CA 1S9YB 3GGWB 4PRNB 1JHLH 4HXAL 1YA5A 4G7VH 1MCWW 5C0BD 2H32B 5E8OA 5GSRB 1T03H 1PX3A 2EIBA 5HHOA 3AAZA 1I9IL 5KVGH 4UV4L 5EU7C 1WZMA 3ARBC 3KPRD 5AD0B 5T3ZE 1IAOA 4HF5H 3RDTD 3FFCE 4G6ML 3V8OA 1ZHBB 4NHCL 2BRRH 5JHDB 3FT2B 5E99L 2LU3A 3VWJC 4KGLA 4OB5H 4JG1H 3HE6A 2VDQL 5IMOB 1CU4H 4CMHC 2V5TA 5SWZB 5JXEC 4Z0BL 1LP9A 4ELMA 4W81A 3SDCD 3UTPD 2Z93A 3I02A 2EDJA 4XAWH 4DOHB 3DWTA 4I48A 4PRHD 5HDLA 2H6PB 3OGCA 1VKXA 4TYUA 3TYGL 4PP1D 4LPTA 1FJ1B 2X89D 5JUEL 1F13A 2RIKA 2ESVA 1TMCB 1UQSB 2OL3B 2O5XH 4NO0D 3AMKA 4JFPB 4F9LC 1WBXA 4UOJA 4KAQL 5TGBB 2YA1A 3O2WH 4ETYA 4M4PA 3NTCL 5C0AE 2NXZD 1FFPA 2DWEA 4PRDA 4JZOA 4XP9L 2BNRE 3GMQB 4PJIB 5DVLA 4CMMA 2PUQT 2FATL 1UZ8A 1BVLA 1JTPA 3SDXB 3RVUC 2WBJB 4NO5B 4FTVA 3MRJA 1XH3B 3E3QE 4LLWB 2BVQB 4ZQKB 3RNQA 5HVHC 4KI1A 4TTDC 4GSDH 1FO0L 1Q0XH 2BOBA 5CEYA 1MCSA 4ODSL 2ZSWB 1U3HB 3VGEA 1KTLB 4NQEE 3GB7B 3JUYA 5I1CH 4OLVH 3ZE2E 2DMBA 3DXAD 1EUUA 5JW5A 2E7CA 2FJFA 3MO1B 1A6AB 2BVPB 5E2UL 5TPWL 5J1AA 2WUBH 2ZUXA 2P4AB 5E00A 3VRJB 1CFVH 4Y2OA 5I1IH 4K9EC 4QWWD 5ANMA 5C0GB 3O6FB 4U3XA 2HT2C 2IAMB 4OCWH 3LS4H 1DE4A 3TA3B 2PYEA 4XP1H 1C12A 5KSBF 1MIEL 3HE6C 3O41A 4YHOH 2YEZA 1QSED 4ENED 1CT8A 3BVNB 3LPFA 4GKSA 5IMKB 3VXUD 4L9LA 4Z7UB 5L2KA 2BCKB 3X12B 4LCWE 3T0WA 1GIGL 3ZTJG 1I3VA 3S7GA 4HUKB 1GIGH 2AJYH 1TQBC 1OAYH 3RDTA 3HC3L 4N9GB 4GXVL 3NPSB 3BRFA 1NL0L 2BNRD 4MYWB 3GSXA 5J6HB 5HI5C 3OAYK 1NFIB 1NMAH 3RI5K 4HX1A 2CLRA 4AT6B 1KULA 3ZSTA 1O5DT 2JCCA 3G08A 3CCHA 1P84K 2YWYA 4MX7A 1UJ3A 5EZJB 4IOFD 2DWEB 4DN3H 2CLZA 3TT1L 3O6FD 1FO0A 1NPUA 3TN0C 1RUAL 1WBXB 3OAZK 4NFCA 4BSWB 1YC7A 4PJAE 3CFDB 4M1CC 5CKGA 4ORGA 3UC0H 3WIHH 2J12B 1GL4B 4P2RD 4IHOA 3UC0L 3WIHL 2YD6A 2HJLA 3LN9A 2IGFH 3OPZH 1VKXB 1AGBA 4HMDA 1YDPB 4RMRA 5L0QB 5DC9B 5ICXB 4JRYA 5BJTB 4XP1L 3WBDA 3GMMA 4LMQE 2R9HD 3GSXB 4NN5B 4K8RD 4Y4KC 1AP2B 1L4IA 3OWEA 1G7HB 4O2EA 4S11A 1P4LB 2GTZA 1MEXL 2OTPA 1IAKB 3T0VA 5ICXA 4LOUD 3PP4H 4LPCA 2ZP0T 5IMMB 1S5IL 3RY6C 1G7JA 3CFBA 4RMWA 1S7WA 3CIQA 1T0PB 3EYSL 4YHMH 3OZ9L 3B2UC 1KACB 1XCQB 1XF4B 4KJQC 4R26L 1BAFH 1RZIB 4NNPL 1QSEE 3MRPA 3TA3A 4PGBB 5F9JB 4XNUH 2IPUK 3QA3B 2IF7A 1W8NA 4UTAL 2VISB 3PL6A 3C08L 3TJHC 1E6OH 4M5ZH 3TO2B 2P8LB 4LPVA 5I1GH 2AEIT 4YO0A 4HWEL 4IOIB 2EH7L 2BSED 2FEDC 2W0KA 3CCHB 1UYWH 2DKMA 1F3JA 5IB2B 3S88H 5KSBB 1U8MA 4JB9L 4LF3B 4WFED 1IC5L 5FYLD 3ZMRA 3BO8A 4Q74A 3STLA 2DM2A 1KCVH 4BH7A 1QD0A 2R1XB 1I3GL 4G7VL 3QDME 1MCOL 3CC5A 1A22B 2BVYA 1EHLH 3S35L 2EDDA 4OD2B 2CKNA 4WEMB 2OK0L 1QSFE 5MERB 3P2TA 3SQBA 5HHQA 3RAJL 2W60B 4Y16D 3FB5A 1I8KB 4GG8A 1QR1A 2CXGA 5TH2B 3T2PA 5L88H 3V4UL 1RJYB 3X11B 3JV0A 5D5MB 5I6XB 3VA2C 3QXVA 4Y4KA 1WV7T 3V6FA 5B3JE 1NFDB 1HILA 2PXYA 1IGJB 1OHQA 2VDQH 3D3VA 4DW2L 1V05A 2X4OA 4QRTA 1J05B 1IEBA 3BZFA 5DI8A 3HNTH 2A6DA 4XNMA 2YA0A 1L6ZA 1W8OA 4AG4H 4Z95H 5BOPA 3FO2A 3O45A 4WV1C 4URTB 3TT3L 3RNQB 2P43B 5EO1A 3S3JA 2BNQE 3DUSB 1MJ7L 4S1SL 5GJTL 3ZDZF 3VDAA 4UDTB 2JB5H 1T5XB 2IFGA 4LAJH 1EHXA 3L7FB 1OF2A 1MVUA 1D5XA 3DIFB 4KJYB 4P2OA 1MFDH 1YYML 1BEYH 1LO2L 3S5LB 3QG7H 4L3AA 1DUZA 5HGDA 4HXAH 5SWSD 1MAJA 3RKPA 3O9WA 3PWPB 4IIQB 4KV5F 1N6VA 3QG7L 1QBMH 1NSNH 5KTEH 3L7FA 3RWGB 4L3EA 3C09C 3LEVH 3VU2A 5KTEL 1G6RA 1WAAE 3BQUA 3WXWH 4CADB 4FXLA 3O8XB 4H20H 1V5JA 4ELKA 3FO9A 3H9SE 3EGSA 4FABH 4JN2B 4LQFL 3Q1SH 2VE6A 4MS8C 4PLKD 3OKEB 5BW7C 3RWFA 1CG9B 2A6KB 4LEOA 2ZUSA 5D72L 1U3JA 3O4OB 1BREA 3SY0A 3LN5A 3DGGB 5DHXB 4YQXL 2DQGL 3FFDB 5ITFA 3VFSB 4M02A 4HPYL 4PJDB 3D3VE 3V4VH 5C9JA 1KEGL 3PGFH 3B6SB 5GHWL 4QXWA 5L6YL 2E6PA 4J4PA 1K5NA 5JMRA 4LNRB 5CP7A 5DURD 4ZUTB 4M6ML 1LO3H 5D5MA 5L6YH 3O6KL 3QAZB 4UT6L 5I75B 3ZE0E 3VG0H 4D8PB 5CLTA 2I24N 1UKTA 3S96B 5FKPB 4CW1A 1MCFA 4KI5F 5E6IC 3VG0L 3L3JB 3KPNA 2VOTA 5LVEA 5SWSE 3MRLA 4KI5E 5F7FA 3GMNB 3B9KD 1MCWM 1X5IA 1H3VA 1N7ML 4HK3J 3RL2A 4X6FA 3QCTL 4BH7B 4NJ9H 4EI5B 4JRXE 5ALBL 3JV4B 2BNQD 1PZ5B 2A38A 4WUUA 3HE7C 3WFDL 1DVFC 1A21A 2EEDA 2BX5A 1FGNL 4PJFA 3LQZA 3H9SA 3RIAK 1F8TH 2P44B 3KYNA 5HDBE 4WHTB 4IRJD 2FJHA 4JVUA 3RVVD 2WBJD 1A7OH 4Y89A 1AGBB 4OZGA 1B6DA 3QHZH 4YGAB 3ARGC 3C5SB 5MI0C 1S7UB 3KLDA 4XMKL 5MENB 1P2CA 4YDVB 1X4YA 4ALAL 1DQLL 3KWWB 5KS9B 3BJ91 5ALCL 5C0JB 5E8DH 4YHNB 5TF1L 4PGBA 1A9EB 1DQLH 2BFVH 2VZOA 4K7PY 1AXSB 3UPRB 4HHAB 5I9QC 5CJOL 2HJKA 4BZ2H 1IT9H 4MA7L 3L5XH 1HWHB 4XNZB 5DUMH 4U6HB 3SDXE 3OB0K 3VFGH 4H88L 4I8DA 2HKFH 3QQ3A 1NGPH 5IMMA 1ETZA 1VPOH 35C8L 5DD3H 4PGEB 4JFQA 2DYPA 1Y0LA 2AXHA 3TLRA 4R7NB 2E8ZA 3CDCA 4IBLT 2AQ3A 2AAVA 4X6BA 1BFTA 1MUJB 3MJGX 1FHGA 1KCSH 4TQEH 1ZHKA 2F8XC 3GJFA 1P2CB 1T2JA 1PEZA 3VWKB 2V5RA 4ZTPL 1NMBL 3LY6A 2ZUVA 5C0AB 3ZLQC 2QKIA 2HLAA 5E7FA 5HJ3B 2AI0H 2FR4B 4KJPC 4JO3L 1HHHB 5GGSA 5FUZH 3DETD 4UTBH 4IMKA 4X80H 3QEQD 4WI3A 1BZ9B 2VLRD 3BKJL 5C6TH 5IIEB 4WW2C 3WNOA 5DHVB 4MNQB 1FNLA 3GSRA 2HLFC 3PHOA 2MQCA 2FGZA 4TNWK 5C0GA 4CMHB 4YHLH 2YN5A 4OAWB 1MLBA 4X6FB 5TDNA 3VRJA 3MLXL 4I3GA 4KMTL 4YUEL 1UKSA 4WWKB 4XMPL 4QHKJ 4ZUWA 5HGGS 2OP4H 1UH4A 5AG8A 3LQAH 4O2CA 4LRNL 5MI0B 2VKXA 1R3IH 3O2DL 3QNYA 4ZODA 4NFDA 4NNXA 1TCRB 1R3IL 3QDJA 1KTLA 3TBWB 1A6VH 5M94B 5CJ5A 2IPKB 3R0MA 3NIGF 3EFFA 1YY9D 2IANB 1I8IA 2NZ9D 2ITCB 4PY8J 4BJLA 2AV1B 4PYGA 1N8ZA 2B0SL 3HC0A 1CR9H 4AEIL 1H15B 1SEQH 2DQUL 3EJJX 1IC4L 4JREB 1QFWM 5LXGL 3VFTA 4JZOB 2HN7B 1KLUB 4JQIL 4M3JA 3SKOA 4MJ6B 5H94A 5JMOC 2G60L 4D9LH 2BC4B 2XQYK 2I60H 4PGJA 1LK2B 1Y6KR 3L95B 3DGGA 4OF7A 3RVWC 4LRIA 3H9HA 2DQHH 1JV5A 4PJAA 2EC9T 3U4EB 4JG0L 4PV9B 1G9ML 1XGPA 4X6DB 3UYPA 1MCIA 5DEGA 5I1DA 3KPRB 4ZXBD 2V5YA 3U4EA 1K4DB 5D6CB 4ZFGL 1EO8H 2H6PA 4XNZC 1PDKA 4F7EA 1JPTL 3IB4A 5E2WH 4OGAC 4G7YH 4KJYA 5IK3A 3EO1A 1X4ZA 3OMZA 1VEOA 3VGDA 1CCZA 3HB3D 2F53B 1XR9B 3T0EA 3KPOB 3QDJE 1I1AA 4QOKD 5C7XH 3NIFE 2Q3AA 3UZVB 3OKLB 2EH7H 3NFSH 4QRSA 5A3IC 1JN6B 3STZB 4C56B 3OJMB 5E2TL 3B2UD 4YXLL 2YMXL 5E56A 1EJOH 4IEFB 4WU5B 4Z7WF 3S88L 3Q48A 3CLFL 3VDBA 1VHPA 3BDXA 3C60A 4N1HB 3MRHA 4ETQA 2OI9B 3P9LB 4HZAA 1HWGB 2X4SB 2R15A 2ARJB 2HH0H 3RGVA 1A7QH 2F19H 4MNGA 3MACL 4FNLL 4M03A 5GSRA 4FQIH 4OIIH 1RZJH 4YO0B 5M7QA 5DEFA 1QFPA 2GT9A 4G9DB 1XR8B 4DK3A 4YWGL 4FQIL 2W07A 4OIIL 2B5IC 3DRTB 1ZS8A 4OUUB 3LN4A 1QZ1A 4ZFOL 4OGXH 5I73C 4YPJA 3PUCA 1S3KL 1EGJL 4Y4FC 3DBXB 4I48B 2ZCLH 4I0PC 1PQZB 1S3KH 2JK5A 4KK9D 2Z93B 1KTRL 1KPUA 4GKNB 2RCSH 3FB6B 4I2XB 1MFNA 1WIUA 5LCVL 3QZWG 2XV6B 3MZTA 3RZWA 3QQ4A 3HC4L 1QG3A 4LSVL 2W65A 1EGJA 3L9RB 3QAZC 3RKDC 2W92A 1QHOA 5DK2B 5D7IE 5F72S 1LO3L 2BDNL 3ZL4L 2F54E 1TQCB 4HIEA 4N0FB 3SGDI 2YPLD 3A6BL 3O9WC 1BJ1H 2DQCL 3BRGC 5ACLA 4M62L 5EA0L 2R0KH 3K0WA 4BQBA 5FGSA 2DQCH 1HEZB 3S37X 3T77A 1T2QL 1FZJA 2YD1A 4LARH 3TFKC 4HH9A 3VXUE 3T09A 4JY4B 1TPXB 5TDNB 4XH2B 2CDGA 5ID0B 4IHOB 1CTOA 3U9UB 1MSPA 4K3GA 1OGAE 4G6MH 5EIVA 2EDKA 3PL6B 1AQKL 4JJ5A 4XGZB 2NW2A 4JO1H 1AXSA 3QZWB 4Y8AA 5D93B 1RMFL 3U1SH 4MNQA 3I50L 2VQ1A 4FZEL 4Z7VE 3V95A 4Q6YA 1NSNL 5IGXL 3MRFA 1M71A 1S7UA 3WFEH 3ILQC 2R39A 2NY4B 5EOCL 3TIDB 3OL2A 3DXAE 4F3FA 1IQDA 3U46B 1R3JB 4H0HB 1RHHA 3KYNB 1MCJA 5LQBL 5IVNA 1XT5A 3QFJA 3S4SG 4ZOCA 2CIIB 4JAMB 3FOLA 4TVSa 1MUJA 3GJEA 2OTUB 3PDOA 4UI2A 1FVDB 1TLKA 5TF1H 4R7NA 3S37L 2OTWA 1LO0L 4Y4FB 3BWAB 1NAMB 3NZHH 3DVFA 4PJCF 1KEMH 1VFMA 4JRYB 3G5VA 3H3PH 5K93A 5DFWH 3QXWA 2QADC 4X6CB 1YYMH 5CUSH 4JRXA 1J1XH 2XN9E 3D85B 3GJFH 5D7LB 5GGUA 1A4KA 4FQLH 4X9HA 4WU7A 3O6ML 3SKNB 1JGVL 4DK6A 3CFCH 1P4BH 1X5AA 1RZKH 2OR7A 3FONB 4YDVA 4TVPE 1S9VB 1ADQL 1S7RB 1K5NB 5CZVH 1KCSL 2DJ4A 4H8WH 1WGOA 5ESVB 2C3XA 2CLZB 3R4DA 4ZSOE 2VIRB 4NHCH 3WHE0 3QIWC 1TZGH 5ENWB 4QF1B 3SE8H 4E5XB 4JG1L 3RGVD 5HI3C 3GB7A 3BPOC 5GHWH 1GZPA 5DMIH 2V2XA 1T0MA 5J3HD 1JWSA 3FFCB 1AXTL 3PWNB 5J1TC 4L4TB 1KBGH 3OHXB 3ULSA 1U3ZA 1B0RB 5C2BL 1I9IH 5LWYL 1RK0A 4JRXB 1X7QB 3QNXB 3WYRA 4ALAH 3JWNC 2XZQH 4QOKA 3QUKB 2YD8A 1ZLWH 2FBJL 5JXAL 2N4IA 5TGBA 3O4LE 5I8EA 2X1XR 3CVHH 5FYKD 4G9FD 4CW1B 3ESUF 2DF3A 4S1QH 3IDIA 3TN0B 2V2XB 1ZVSA 3VRLE 4P23A 1DE4B 1W72L 1INDL 2EXYD 4R4NC 4ERSL 4GAFB 5EC2B 4Z76A 1DCLA 1G7PB 4XNMB 5JOFB 3TIDA 1CDCA 4D9RD 4I0PB 4NNYA 3HI5L 2J3SA 4LNVA 5DI8B 3QXTA 2E8YA 5DRXA 5IVXB 3FT4B 2EE3A 1Q9OA 5I1LA 4TNVK 3I02B 1BVKA 1KELH 2NLJA 3HI6H 1A2YB 1U3HA 4LQ1A 5JUEH 3O8XC 3OKEA 5SWZA 1GCFA 1U95B 1U58B 4LVNC 3VFUB 3IXAB 3VGHA 4M5YL 1BVLB 1EEQA 2E9WA 2MKLC 3SDXA 4UTBL 4X80L 3V0WL 4HBQA 4KQ3H 5DD0H 2LAGB 4M5YH 3GHBH 4NQCA 2CGRL 1NC2B 3CX2A 2HVJA 1DZBA 1U8HB 5B39A 3EJZD 4NOFA 4EI5D 1A6TB 3FQWB 3OPZL 4L8BB 5GS3A 2HJKB 4C56E 1N5YL 1G6RL 2IH3B 3QUMB 5K9QG 3QR2A 4KXZH 3D25A 3X3GH 3BGFB 1IAIL 4ISVA 3PGDA 2CIKB 2Y36L 4K9EL 1D5IL 1A1MA 1IKNA 4J4PC 5D7SH 3Q5YA 3CZFA 3TJEH 1R6VA 3N85L 5JIKA 1WFOA 1T1XA 2IEPA 4NQUA 1FZMB 5AZ2H 3EBAA 1NMBH 5E03A 3VXRA 2A77H 1QSVA 1YEHH 1SVZA 1NLBL 4TULH 2HJFA 1FZMA 4PJFB 2NQCA 1R3LB 1YNKL 1IQWL 1NMAL 5IHUH 3VD7A 2NY6D 3LSOA 1I3RA 2H26A 5CD5C 4ONFH 4JFHE 1EEYA 5EC1B 5F9JA 1MWAA 4XNUL 1I7UB 4HD9A 2G5BB 3NGBC 1HYSD 2FL5A 4CNIB 2R2BA 1Z2KA 3LIZH 4PJEA 4HWZB 1X5GA 5AWNH 1HNFA 3LIZL 3S3SA 3E1F1 1RJCA 1QRNA 5GZOD 3AM8C 1JNLH 1N5AB 5IW1A 1MWAB 4NQXB 3UYOD 1QR4A 1FYTA 3OJDB 4MHHI 1HCVA 1EO8L 2W65B 5TE6L 5ICZB 1FE8L 1FIEA 3RIAF 1MCKA 5I71B 5EN2A 4PJCB 3DX7B 4JZJB 3TIEB 5KSUA 3VFSA 2HFGL 2AJZB 3FT4A 2JK5B 5IVXA 3BUYA 4HS6B 5D9SB 4MA3A 3BE1H 3L3OA 3L3IB 1BFOB 4MNHA 4RAHA 2VDLL 4U0RC 5CFHA 2Y36H 1LEIB 2NNAA 2VXQL 2NY6B 4XB8A 4R3SA 5ITBL 1PAMA 2Z31D 1IMHC 4MAUL 1G7PA 4IRJA 1G6RB 3BQUB 4CADA 1SMAA 1UACH 2DQFB 4XPFH 1Z9OA 4MLSA 1CGTA 3MJ9L 4MQ7A 3H9SD 4N0YH 4HKZB 1GC1H 2D7MA 3HAEB 3I50H 3FQWA 4HDIB 1T83C 3ABZA 5C86A 1HZHL 4JFFE 3O4LD 2HFFB 3T0EE 4ONGH 3A0OA 5F9OH 4UQ3B 4Z78B 1EZVX 5BVJA 1JZ7A 2JIXA 3HCVA 1E27B 2VL5B 3HPLB 5HYJB 1RUML 3B83A 1EHAA 5GIRA 3B2VH 4R0LC 1VA9A 1U8QB 2ZCLL 3IDGA 4MJ2A 3OXSB 2Z92A 3CDGA 1XR9A 3T0EB 5C9KA 1A7PL 3TBWA 2V2WB 4BUHA 1UYWL 2H9GB 3BH9A 2VZSA 3PQYB 4WW2A 2LU7A 5IK3B 4JHWH 1M05B 1BVKB 2NLJB 1IAIM 4KZDL 4RWYL 3HZMA 3BN9D 2QADB 4LCYB 3C60C 3CU7A 2NY2B 4IDJL 5HYSB 4R26H 3BRDA 5C6TL 1V7NH 5EBMB 4KVCL 1BEYL 3KPQB 4LHQB 3WDJA 4HK3N 4PTTA 4GKSB 1EFXB 5DJYA 4YDIH 4DZBA 2X42A 3CFDA 2Z9TA 3FONA 5KS9E 2A83B 2B1AH 5FXCH 3V6OA 5CJQL 4G8GD 1NAML 2GITB 2UZIH 4DEPB 5EBLB 1XCTB 3LEYL 4NBZB 4PR5A 5EUOE 1ZANL 5FOBA 3ARFB 4F7TA 2XWTA 3DOSA 4YK4B 1A4KB 1RU9L 1YMHA 2UWEE 3BOVA 4KI5C 4YR6B 5F9AC 5ITBH 3ZYIA 4P5KB 5MEQA 2FR4A 4CN6A 4DFHA 5IFJB 3G5VB 5MEOA 1RMFH 3U1SL 4HJJH 3LKQB 3O3DA 4ZFFA 4WI7A 4PJIF 4PJXA 4D9QE 3EFFB 5J6HA 2OTWB 4NSKA 1T0NA 4ZUVA 4XBEH 4AZ8A 1EEZA 3K2MC 1UFUA 3D39E 4KROD 4PJXB 3VXSE 4AIZA 4LLQB 2BVQA 3IU3B 4DCQB 1XH3A 4ZQKA 5B22A 3CVHA 1J1OH 2BDNH 5L8KB 2R56H 1ETZB 1JF1B 1J1OL 2H45A 3MV8B 4U6VH 2AEQL 4L8CB 3TYFB 5JLZA 2FZ3B 4JM4L 3ROOA 4BZ1L 5F7EL 1EVTC 1S7RA 1MH5A 2OZ4H 3EYFA 1B4JL 4FQXB 3MNVA 3UJIH 5GGVH 2HT3C 2AXGA 3TV3L 1AC6A 1UQSA 3SKNA 3KWWA 5KS9A 4ZSOA 1WSST 4PLNC 1V7NL 2CKBB 5MHSE 3OKDB 2J5LB 1H3PL 2MJWA 5HGHA 4LSSL 3RUGA 1G7JB 3CFBB 3OGCB 2HLAB 4G6AC 4H1LG 5HYSA 3SGKA 2LAAA 3T4AB 3VFVA 2I26N 4Y19D 2LVCA 2KUTA 4NM4H 1RI8A 5JOPD 2VO5A 5EZIL 3DO3A 1DR9A 3WD5L 1B2WH 4YX2L 1NBZA 5I16A 3SDDD 5EZIH 1FVDA 5CGMA 4DZ8A 2YUWA 1QPXA 3IS1X 4HIEB 5B38G 1JYVA 2E7HA 3HE6B 4QHUB 3HS0A 4M48L 4FTVE 5JHDA 3CVIH 3TZVC 2VKWA 1HIMH 1J5OL 1SBBA 4HUUA 4J1UA 1VACB 1L7IH 5KG9A 1WBYB 4M7LL 4LCWD 1FNEA 4HZLA 5JQHC 3C6SB 1CIDA 1L0QA 1WZ1L 4HKZA 3WXVL 3QI9A 4Y4HB 5IJKC 1LWRA 3HG1A 4G8EB 3C87A 4TSAL 4DQOL 3MBXL 5IF0B 2R0ZH 5DQDH 1JGVH 4YDJA 1IM9D 4XVSH 4F7PB 4P9MH 3QHFH 4TQEL 1ZLWK 2XYCA 4HXBL 3WE6B 4GBXB 2JCCB 2BVEA 4L29B 2ZOKA 4LL9A 4PGDB 4H8WL 4HX1B 1R3HA 4OJFH 1ITCA 4HCRH 5BV7H 2LU4A 1TZIB 3WNNA 3H9SB 4N5EC 5E2JA 2CR3A 4OLXH 4KAQH 2VE6B 1LO2H 3RDTB 2XWJA 1ZLUK 3PQYE 4FFVD 5ICZA 3H42H 3AB0C 5BCAA 2H8PA 3DUHA 4JO2L 2R69H 1IARB 4NQXA 3ZTNH 3ARGD 3QHTC 4JVWA 1ZHBA 3KPSD 4FXGB 1T3FA 4QOKE 4J2XA 4I2XA 1NUFA 1GGBL 5JHDE 4O51A 4XVTL 1ZT4A 2WM0A 4PG2C 1J0KA 4HWZA 2IBBA 4F7EB 2ZUUA 2FO1A 3OF6A 4OCXL 3DX9B 1QHPA 1NGXB 2XWBB 5FGCE 3LRSB 5KS9F 2ZCKH 1IGFH 2CXKA 1KXQE 5I0ZA 4OUUA 3DUSA 4NRZB 2VUOA 5E6YA 1CE6A 1T7VA 2FJFB 3DV4A 3IFLL 4NUJA 2DYPD 3RGVB 1IEBB 1HSAB 3VGFA 1Q9OB 2BSTB 5I1LB 2VDKH 1I7RA 3ARGA 1CFQB 1DL7H 3HMWH 3KXFA 5IB3A 4N90D 5L8JB 5CEYB 3QIUC 2NX5A 4X0KA 4JN2A 2N7BA 4EQ3A 4Z5RB 4HAFA 5T5NF 5I8KL 2XZCL 1D6EA 3RWDA 3ES6A 4NN5C 2DLFL 5J06A 1RUQH 4PJXF 1I1AB 1BOYA 4U6YB 3GMQA 4PJIA 3NCEB 5D1QC 5EZLB 1FFPB 3BH8A 1A9BB 5FDYA 3QIWB 1G0DA 4ZFGH 2VLME 4P5TB 3TN0D 4ZO6A 3FQNB 1O0VA 2OQJA 5EZLA 4MS8D 4PLKC 1NC2A 2Y25A 2G9HB 3FB8A 2VDPH 4W68A 4XBGB 1P4IH 4JQVA 2ZG3A 4DVBB 5C0BE 4HUMB 4I3RH 2X7LA 1S9WA 4PGCA 4WUUD 4WWID 2AXFA 5C0DB 3RNKA 2FD6H 4Z18A 4Y2DC 3BPLB 2K3TA 3FQUA 4MA1B 2NY2D 1CBVL 5EZOH 5IB1B 1NEZA 4QF1A 1IGJA 1NCAL 1J0IA 1C7TA 5TE6H 1KB5A 4PG2A 5JOFA 5IBUG 5HJ3A 1U36A 3IJHA 3BN3B 2DQUH 4WW2F 5EULV 3VWKA 4U1SB 1BP3B 4AYFA 1CLYH 4YNYA 1RJYA 1VPOL 2PR4H 1KCUL 2CD0A 3SKUD 2ED9A 1I7TB 3VI4F 2PR4L 5A3ID 1NBVL 5FHAL 3ETBF 4Z7WB 1GPOL 1CXHA 3VRIA 4APQD 3M07A 2VLJB 2J6EA 4J23A 3F7YA 3VI4E 1AE6L 1SEBB 3C5ZA 5D5MF 5CEXA 4X7TB 4XHJD 1X7QA 3QCTH 4WGVB 5T3ZD 3FN9A 3TO4A 1FGVL 5SX4H 2VR4A 3MV7B 3SCMB 4HK0A 1KC5L 1IAKA 3WN5A 4CJ0A 5C2UB 4Y4FA 3KPPA 4HWBA 3GGWA 4PRNA 1IL1B 1T0MB 1UA6H 4FXKB 5BV7C 2V7HB 4MSWB 3U4BL 5F3BB 5DRZB 2AV7B 3IDXH 4ZOBA 1HK6A 4XNYL 1FVEA 2VNCA 3O9WD 5AG9A 4RAUA 2F58H 5C0EB 2P8LA 4I3RL 2DQIL 3DMMB 3AREC 4YDKL 5HHNB 4XMLL 3NAAH 4MAUH 5E94B 4XGZA 4JJ5B 1NCNA 2GJJA 2EEAA 3SDCB 4H88H 1SJHB 2CDGB 1AR1D 5BRZE 4H5SB 4J1UB 4HWUA 4X6DF 1Q9KA 1MHPL 4ZFZB 2AQ2A 2VDNL 3GMNA 3NPZB 4OUOA 5DQJB 3RI5F 2GW5A 4PJEF 1QLFB 1NGQH 2VLMD 4PJXE 3MV11 3QXDA 5C0CB 4ZO9A 1ZV5A 1ZANH 4MJIA 3SDDC 1F00I 3CMGA 4DZ8B 4Z8FH 3O11A 2PTTA 3MRNB 3MLYL 2X2YA 2CIIA 4JAMA 2CO7B 4POZC 5CGTA 3W0WA 5JIPA 4MXQC 1NEUA 2EXYC 3RWHB 4YJZL 1N59A 5J0BA 1T7WA 4UU9B 5KSVB 1YEHL 2AJYL 3NZHL 5DJXB 3X12A 3FZUD 4HIJA 4M43H 4KC3B 5CJ8A 2CRZA 2X44D 5EO9A 2EDEA 1NCBL 2HYMA 2YEZB 1FH5H 3VJ6B 4PJ8A 4NJAL 3VXRD 4XWGH 3T0BA 1JHKH 4ZMAT 1IL1A 3M8OL 5FA4A 3VXQB 1FNSL 2J4WH 1OOAA 4JZJC 4U6VL 3MNWA 4JANA 2XI9A 4L4VB 4QXGH 3IDJA 2R0ZL 5DQDL 1L0YA 4L3EB 3OQ3B 3CFJB 2NCMA 2CSPA 3RJDA 2D7NA 5BQ7B 4G9FE 5ID1A 4J3XA 5HYJD 3PHSA 3UCRA 1JGEB 4PREA 3W5NA 1A14H 2EDTA 3BEWA 1JTOA 3EUUA 2X41A 2DIJA 3K46A 1YPZE 2P8MB 1DEEB 1OF2B 3AB0B 3Q3GB 4P46A 2X9YA 1NDGB 2XY1A 5DUPH 2BVUA 3OKNA 1GOGA 4HS3B 5D1ZC 5L8LB 4UAOC 4KKBD 1RFDL 1JZ6A 2W0PA 3CZJA 1F4WH 2Y5TB 4O5LL 3O4LB 4NZRH 2PNDA 2EDLA 5D71H 4UBDC 1ZEAL 1J18A 2WBJC 4OZGE 4R0LB 3DMMC 4MNQE 4HIHA 4P59H 5F1IB 1FFQA 4Z77B 5I1DB 4YPGA 1CICB 4F7CB 4YAQB 1F97A 2BK8A 1XIWA 1FFOA 3X11A 4NIKB 3GSUB 2H32H 4F33B 3RVTD 3AFLA 5EBMA 2EYSB 3RPIB 4MNGB 4Y16B 4Y19A 4TUJA 3K8MA 4JPIB 3WUWB 3PQYA 4WW2B 3B2VL 4GFTB 1Q9WA 5ISZE 5T3XH 3RX5A 3STZA 1JRHL 5F7YC 3ME0A 1VCAA 4KVNL 2W0LA 3ZTJH 4HXBH 5DFTA 1JZ8A 1N8ZB 4KTEH 1I1AD 3HCVB 4WFFD 1FZKA 3QEHB 4UIMB 3WFZA 3UZQA 2HMIC 1AJ7L 5IVOA 3PQYD 2PYEE 1TZHA 4KDTC 4MAYC 2QSVA 3I6LE 1AJ7H 4LLDA 1RIHL 1I85A 4HDIA 3D69B 5JPNB 4PJGF 3GSOA 1OWRM 2UY6A 4MZ2A 1UB6B 1G9EA 3DV4B 4RAVB 2KZWA 2VXTH 5DK0B 5E8OB 4HWNA 5T1LD 1XIWD 5D70H 5I18H 2Y72A 5JW4Q 1T03L 2BJML 4JANB 3MNWB 1I7ZA 4WW1B 3V2AR 2JCCF 1F4WL 4R2GD 2OLDA 4E0RA 1JV5B 3MV9D 4PJAB 2R2HA 1AGEB 1WUNT 4F58L 3MLZH 3BP4A 5A2LH 1BFOA 5KVDH 1DQJA 1GGCH 4AEFA 3P4OA 1YUHB 1C5BL 3MOBH 5KSUB 1KEGH 4QRPD 5J12C 4LP5A 2I07B 1OTUC 5F88A 3ZKNC 2V17H 4PJCA 5IMOA 5C0AA 4QXUH 5KSAC 3NH7H 3FN0L 1I8IB 3I84A 4YBQC 4NZUH 1UXSB 1QKZH 1T66D 3MLTA 3HFML 1FV1B 3F58L 1T1WA 5KSBA 3MMEA 5JW4R 3HMXA 4PGEA 3GDBA 5BJTA 1MI5B 1NCTA 2X4RA 3BFOA 2AK4D 3B4NA 5EU3A 5JXED 3O2VH 5DQJA 1AGDA 1E4KC 5EUKA 3WKML 43CAA 4S10A 5CD5D 4LSQH 4H0GA 3SE3C 4LVOB 3ZDXF 1M7DA 4QCIB 4OM0L 2NY6C 4PS4L 1DVFA 4YLQT 3S34H 3BEVB 2VISA 2C5DC 2CLVA 3I6GB 4LHUA 1DBKH 4YFDB 1AO7E 2OJEA 3P3YA 3G04B 4GKZB 3V52L 1DUYB 4UQ2B 5DF0A 2EEBA 3QEQA 4MWFB 3DSFL 5D8JH 2P46B 3F7QA 1N5YH 5ERWA 5I30H 2FJGA 4CAGA 1MWAL 1KXTB 3E8UH 4AIOA 4X7DC 1NFDE 2EE6A 4FQCH 1EDQA 2YOCA 5IROA 3TH3T 4OQTL 1U8OA 4L4VD 5EG6C 4NT6A 1AKJB 4G6FB 5F1OB 4QHNA 1FC1A 3ZHDA 1OAKH 4RRPG 1CFSA 4P3DA 4X99A 1LDPH 5DJ8B 2BNRB 4PJIE 3D39D 3G6DH 3L5XL 3VXSD 5DD0L 3CAFA 4JQXC 3I3BA 1X6LA 4M8VA 2XQYG 5DMGC 1MAML 3VFMB 1WBZB 1CD1A 2PO6D 4EI6B 2O5XL 1EHNA 3DX8A 3DURB 3QXDB 3AMLA 2Z31C 3TO4B 1N3NB 3ARZA 4UT9L 4X4MA 4FA8A 3W5MA 4GW5A 5D7JC 3LS4L 3N9GH 3SJVE 1IC4H 5DSCB 5I15L 3SDCA 2IFFL 5DD3L 4D9LL 5FKPA 3HI5H 2LTQC 2J8UA 4X4YB 1UM4L 2P1YA 5KVGL 1GOHA 3G6AB 3EYVA 4NKQB 3T3PE 3U0WL 1CD9B 3GKWL 4GAYB 5ANMB 2Q7NA 3WKMH 1LO4H 2WK2A 4EN3A 5CZKA 3RVVC 2MQ3A 4Y1AE 3GUTA 2FZ3A 4KHTH 1DBAH 2VAJA 5JORB 1JVKA 4EOWH 2NY0B 4RWYH 4U7MA 5IG7B 5C9JB 3JWOL 3DO7B 3EZJB 3V0AC 5ITFB 3W81A 1FGNH 1TIUA 1UWXK 1HYRC 4YFEA 4PRID 1JCKA 2ZSWA 1NCBH 3VWJB 4NQED 1Q94B 2I9LA 3EGSB 5DDHA 5HYQB 3MLXH 3IDYB 3F5WA 4GRLC 1YJDL 4KMLB 4XMPH 1VADA 1YEFL 3SCMA 1PFCA 3RL2B 1YZZA 2HLFD 3VXNA 5GGVY 4O00A 3ARBA 4XNXH 4JGJA 1OAKL 2G9HA 1CF8H 2EDOA 5T3XD 3ZKQD 3MRBA 4LHUG 3MRLB 3NAAL 3R1GL 2A9MH 3RWCA 1UVQB 2NY3C 2EIDA 5I74B 1MAMH 4QT5B 2EDXA 5HI3D 1MVUB 5FO7B 4HG4J 2CRMA 2H1PH 4M1DL 1KIPA 4MJ4A 1BJ1J 2VDNH 2AK4A 2DLGA 3TPUA 2PCPA 5I73B 35C8H 4YE4H 4X0KB 3VGAB 1ZKAA 3PP3H 2NZIA 3QPXL 4GT7A 4PJDA 3CFIC 4PJBF 3D0LB 5F3HB 5K9JH 2GJ6B 1MCHA 2VH5H 3GMLA 4RX4A 5HGAA 4XXCC 4NQVB 4NQCD 2R29H 4ODSH 1JI1A 3RNKB 2BOBB 4HGMA 1KNOA 2YK1L 1L9NA 4Z7NF 3MJ7B 2O61B 5M95B 3TVMA 5D2NC 5IEHB 3FO9B 1JNLL 2MNUA 2JIXB 4HUWA 1RURH 1NC2D 5CGYC 1KG0B 3EYOB 5JIIA 4RNRA 2CDEB 1L0XA 3P9WB 3RP1A 3ROLB 3MRMA 2XFXB 1NGWB 4OD2A 1OAQH 4HIIB 4RFNB 1LO5B 1CXEA 1KB9J 3AAZB 1UZ6E 1CGVA 1TITA 4RGNB 3QUZB 2OTUA 3LKOB 3HUJB 4IRJC 1ZA6A 5T1LA 3KNBA 2CUIA 5I1GL 5HPOA 3MLRL 5H35A 1D6EB 5IT2L 4P23D 1MFAH 3DHMA 3QQ9D 4K3EL 5FUCC 4X9BA 3MLWH 4AQ1B 3C60D 1YMMD 2VJXA 4JO1L 3KXFB 1AHWB 3MXVH 2LQRA 4NHUA 4NOBA 2Q86A 4EEEA 1AFVH 4XWOC 2K7PA 1BX2A 4LLMB 1XGRB 8FABB 2Q6WA 4Y4KD 5LGJA 5EN2B 1CE6B 2ESVE 5FYKU 3V6OC 1MIEH 1MCOH 5H37H 5EOCH 1AI1L 1MF2L 5F21B 2QHLA 3DSNA 4E41E 3U9UA 4TVPH 2VITA 4LK4A 4JFXA 5GS1B 2ORBH 4U1MA 5HYEA 4FG6D 2VSCA 3OKOB 2W60A 4BZ1H 2Y6SD 4Y4HA 4D0DB 4KWUA 2GTWA 4Q6IB 1B4RA 4P4KB 3UX9B 2NR6D 2WUCL 2H3NA 4CVXB 5CLWA 3VCLA 1CXFA 1YYLH 2ZZUT 1IM3A 1MCRA 3L1OH 1T1ZA 4HLZG 3ZKND 1OAUL 3AREB 4WRLA 2CK0H 3KDMB 1WLHA 4Y88A 3V6BR 4G8FB 1JUFB 1XZ0A 5DRNA 3HMXH 5IFHL 1Z9SA 5FM4A 2OMBA 1N0LA 1U92A 3ZHLA 3BPNB 1IAII 4QY8A 1KCVL 5DJAA 2FECL 3JWOC 4PBVC 4YC2C 1VGEL 3DYOA 2FEDD 1C5DA 1MFBL 3MOAL 4LF3A 2BSRA 1UJ3C 3WUZA 3C6LA 5FYKH 4GRWE 5GGQL 1QFUL 1NMCB 4QHMA 5GRVK 3ZDXE 5CEZE 1ACZA 1U9KA 1JNNL 1RU9H 4DVRH 4D9RE 2V7NA 2VDOL 4TPRL 5AZEL 1VB9A 4PJFF 4Q0XL 1LMKA 4JGMA 1YJDC 5BO1L 4FS0A 4JDVA 4Z7WE 3QDAA 2NY1B 3QDGE 1S9XA 2F74B 3LPWA 2EC8A 5A16B 2D7TL 4KV5E 4GMTH 1MIML 3WFEL 3SE4C 1BJ8A 1NGZA 2WWMD 4X4XB 1KJ2B 1MFEL 2YPKA 3GSVB 4ZTOL 3BZ4B 3X13A 4NQCB 3FRPA 2VDRH 2IANE 4AEHL 2E7BA 3HNTL 4EKXA 3UZEA 3HS0B 4RGNC 3SO5A 3B5TA 1TJGH 4LLQA 2VLRA 2DBLL 3BWUC 2QSCL 1BOGA 3MOBL 5CJXC 5C0RL 1INEL 3ZO0A 5I16B 1S5IH 1F2XK 4LVEA 1M6OB 1V7ML 4ZFOB 4NYLB 2GK2A 2JE8A 3WSQH 2XKSA 1LDSA 4I0KA 1KB9K 1V7MH 3UTZA 2FGWH 3W0WD 4ODUB 1TNMA 2BCKA 3L3DA 5FV2A 4FFZL 3CFCL 4XCNA 1XGPB 5EC2A 1JHTB 3VD3A 5LJYH 1D7FA 1XCTA 3GMPA 3PGCA 3KPLA 3VH8G 4LSPH 2PYEB 3PDDA 4N8VG 5LGHL 3WXWL 3S35H 1N4XL 4L4TE 4W4OA 4LVHB 3O6FA 1PZUB 3NIGE 5CKAA 4Q9RL 2XKNA 3ROOB 2HRLA 4IRZL 3LKNA 3C6LC 3LZFH 2FO4A 4PJCE 4HUXA 5DMKB 3G08B 1DBKL 4ZO8A 2ICWA 2LABA 5C0IB 4OZIB 1MIMH 3V4PL 4WDIB 3LPGA 1OPGH 3C9NA 2NY1C 3QDMD 1IGTB 5CIPA 2DIBA 1UEYA 3E3QC 1KCRH 5J9PA 3OX8B 3GSNL 4NZJA 3FL7A 2XA8H 4RISL 2D7QA 4I18C 2R56L 4YXHH 1FYTE 2CKBH 3THML 5J13B 2WBJA 1GGTA 3IT8D 4NO5A 1ZHNB 4UT7L 1TQCC 1KN4L 1R0AL 3TYGH 5E5MB 2B1HH 1CK0H 1ES0A 2FO4B 2DWDA 3IDUA 5F7EH 4KJQD 3LMJL 3RBSA 1Y18B 5BMFH 4HJGA 1CT8B 2XWTB 2VR9A 5AZ2L 4MCYA 3AGVA 3BGAA 2JKXA 4JFED 5C8JB 3TO4D 4HC1A 4I77H 1CXIA 3B8SA 4S1QL 1QYGL 4U1LA 3KJ6H 2UVFA 3C5ZD 4WU7B 5CZXC 3REVA 4OLXL 1UA6L 2EO9A 4LSSH 4OBRA 1E4KA 2DI7A 1JHLL 2KDGA 3P0GB 5DMYA 2NY2C 3VXME 4JVPA 1BD2B 4EJ1C 4F2MA 5DJ2B 3UPCA 4X6CA 1YMME 1E4WH 3IKKA 5F7MC 3L3OB 1GH7A 3QJFA 3BKYH 1MHCB 5ABDE 2DJUA 4ZFOA 3BWAA 2RQ8A 2R4SL 3I2CL 4OKVA 3VXPA 5IWLA 4HFUL 4R4FL 3OJ2C 2DMKA 4WGWB 1ZWIA 5IQ9B 1UGNA 2JIXD 1UCBL 4JDZA 2VL5A 5I17A 4G43A 4JFDA 3F62A 1RJZB 3AS3A 1IZKA 5HI4D 5CJOH 2QBWA 4XPGL 1YNTB 2C3HA 4MA7H 1QSEB 3TNMB 4OF3A 3M1BA 2BOCB 4U6HA 3U30B 4ZS6D 1SBSH 2VSDA 4MXVE 3BP6B 1MLCB 3E2HC 4UOW0 1X44A 4IJ3B 5DJ6B 4HHAA 4DQOH 4GRWF 4XAWL 4D3CH 3C09B 1IKNC 5IJKA 2HVKB 1U2HA 5IHZB 5SWSA 3TZVB 4NQDB 5HYSG 3LKPB 2VZUA 2DQJH 2VRAA 3U2SB 4OTXH 2ZUQB 5J11C 3O3UN 3C6LB 1DJSA 5FUZL 3NH7L 4Y7MA 4NZUL 1H0DB 1BBDL 4JCMA 4Z9KB 3MV7D 5I1KH 1NBYB 2FH6A 5I8CA 4HUVA 3RGHA 6CGTA 5E4EC 4WY7H 1LE9B 1NKOA 3HAEG 2PXYD 1GVIA 5F1NA 2D0GA 1N7MH 3MTRA 4YZFF 5HHOD 1DQDL 1PQZA 3ECBA 5D1QA 2R2BB 1MPAL 1U8HA 3VD9A 1JWUB 3WFHB 3FO1A 1YECH 4P4RA 4A2MA 4CVZB 1LD9A 4PRIE 4L4TD 2CO6B 4XPBL 5IBLD 1SMOA 4BKLA 3SPVA 3FCTB 1DQTA 4HQQH 5DEFB 5LGJB 5E2WL 3QWRD 4P0DA 5GS0H 1JZ5A 3NA9L 2FLRT 1WAAF 2ADJA 5CSZB 4FQQB 4WTXA 1KYOJ 3HMWL 4H1LH 5JW4N 4FQCL 5C92A 2C1PB 3BPCA 1ZSDB 1HHGA 3MRHB 5D2LE 4YDKH 1QEWA 1P1ZB 2FLBT 2IALB 4CDHA 2XTLA 1OAZL 5IB4A 3MLWL 2VLKA 2W9EH 3GSNA 2UWEB 1A3RH 5EU6E 1EBAA 1FGVH 3MRRA 4UMGA 1A3RL 3KPOA 3VWKC 3KPTA 5CBEB 5FEBA 4H0IA 2X4QB 1LO5A 3S5LA 3C2AL 3GBMH 4A6YB 5GZOC 4ONFL 1RUKH 2GFBB 5FK9A 1EFQA 5CEZL 4UDTA 1A47A 1TPXC 4JFHD 5DD6B 2J8HA 2WUCH 3KJ4C 1U58A 2J88H 4PBXA 3OAUL 4C55A 3U0PA 4ZTPH 1I1RA 2A6DB 4UDUB 4EBQL 1DBAL 4G6AD 3NABL 3HE7D 1V3KA 1A14L 4JO3H 1HH9B 1ONQB 1IGCL 4XVUD 2VC2H 2YD5A 4WO4A 5DJ0B 5HHVH 2CRIA 1T80A 4XNQA 2BMKA 4NCC1 1AFVL 3ZKXC 3UTPE 2AK4B 4P57A 4ZAKB 3NA9H 3TPUB 1JZ2A 3G6JA 2J4WL 1Q72H 4HS8L 1FRGL 4NN7C 3MBEC 4U1IB 4WUKH 1P7KB 1VERA 2ICES 5E24E 2B8OT 3BPLC 3MBEA 1NANH 4HFWB 4XPHL 2VXQH 5GGUB 1VGKB 1WVZA 2A1WL 3MLVL 1TCMA 4BSVB 2A9ML 5C09B 2BERA 2W9EL 5KANG 3ARBB 2EXWC 2ZG2A 2KBGA 2P5WD 2X40A 2JB6A 3PWUB 3P4NA 1PX4A 2EDBA 3WMSA 1I1CA 4RGOL 3IDMA 4DUWA 3CSPA 3D0VA 3HZVA 5B21A 4PJBB 5SWZE 3SGEH 3U48A 5DZLA 3WJLC 2NXZB 1GZPB 2ZWLT 3NCCB 4EUPG 4NO0A 3BQUD 3GSNH 5I66A 4X9GA 5E70A 1EMTL 3ILPB 4HGWB 4LDOB 2ATPA 5LBSH 1D5MB 4DN3L 5GGSB 5GISL 2D0HA 2GSGA 2VB5A 1J8HE 2R29L 4Q9QH 2J88L 5F7KC 5ESVA 3SJVB 3W2DH 5MHSD 2JB5L 3GMRA 3BMWA 1FL5B 3RY6A 2YUZA 5E8NA 2ZUYA 5DVOA 3CGTA 1YEJL 2C3GA 4U1HA 4LLYA 15C8H 5DUBB 2ADIB 4P4KD 3JXAA 1RURL 4UV7L 5JDSA 1HKFA 2DRUA 1F90L 1XGYH 2AEPH 1DFBL 2IMNA 1BQHA 1MHPH 4JRXD 1W0WA 1H5BB 4Y1AB 4FFYL 2DLTA 3DHJA 3FQXB 3JTSA 1T7ZA 4AM0B 2PYED 1R3KB 2AJVH 4O58L 5DC0A 1R5WA 1V3MA 4GRWB 3BDBA 2C7UA 5FFLA 5CD3B 3EHBD 5DJDA 1JPST 3HLAA 1ND0A 2XXCB 4F58H 1G7HA 4NZDA 1K4CB 4OLEA 1MHEB 1LE5B 4ZAKD 3S9DB 4X99B 1ZLVH 4Y5YA 1J12A 4TSBL 2WBKA 1QO3B 2OCFD 3S37H 2W1NA 3T65A 1HHIB 3OR7A 2X4PB 3RGVC 3EAKA 3MV9B 4XP5L 1RZ8A 1CZ8H 1NAKH 2HKFL 2WINA 5I18L 1J8HA 5D7IB 2Q3ZA 3B9KB 2P5EB 4MXWL 1FSKC 5A2IH 3O6LH 5HY9A 1KN4H 5HPMA 1R0AH 5GGRY 5C08B 1JF5A 3WL9B 5TF0A 2IMMA 3NACH 2VWEE 3QHFL 3GMOB 5E9DB 1CFTA 4K07A 3SKJH 3W2DL 3G5ZB 4RIRA 4S1SH 5ACZA 2C4XA 4BFIA 4NUGH 5HHMB 1AQKH 5F9WB 3U7YL 5IVXE 1LEKB 4I5BB 3VGGA 4WJ5B 3QUMH 3OG4B 1MFCL 2FX7H 1QBAA 3PL6D 4X98B 1JN6A 4C56A 1W0YT 5DO2D 2IAND 4EQ2A 2HMID 3F58H 5EU6D 3K8LA 1RZGA 1H5BC 4WV1A 5JTWA 2CKBL 3THMH 4N8VB 2HWZH 3DUUB 1XF5B 3RZCA 2ITDB 5E6ZA 2DAVA 1T1YB 5T33L 3WEXB 1OQOA 2P49B 4P59L 4W4NA 3H3KA 2A6KA 3T2QA 4F8QA 5I1CL 2HFTA 4UUJA 4NDMB 2VDMH 4BZYA 3X14A 4K7FA 3MNZA 1F4YL 1L6XA 3T3ME 1MRCL 4Y5XA 3W9EA 1CE1H 2IQAA 5GS0C 1S7VB 4EVNB 1EH9A 2DICA 4OLZL 1QYGH 5F44A 3EFDL 1MCQA 3BJLA 4YZFE 4MJ5B 4U1NA 3E8UL 4OLZH 1DEDA 4KQ4H 5IB5A 2A73A 3NGBB 4WHYG 1H3GA 3MFFB 4GMSL 1T04A 5F97E 1Z5LB 5T5FH 4DN4L 4NQSB 2HFEA 3LKRA 1RY7B 2BY1A 3FB7B 5JW3L 3MR9A 1YY8B 4AENB 3GI9L 1D5XB 3DIFA 2O5ZH 3WFCL 4L1DA 1FZKB 2V9RA 1EXUB 3N0PB 3UJJH 3MRJB 4LLWA 4QRSB 1QBBA 4OZHA 4K94C 4B0MM 3FO2B 5EUOF 2OMNA 5C3LD 1BZ7A 3CFEB 3RKDD 1I75A 1FIGH 4HKXB 4OIBA 3UTSA 3HHRB 1ZVHA 4P2RB 3IRPX 5CUSL 3B3IB 1ITBB 2X4OB 3V7AG 3HA0A 4RZCA 5D7LE 3PWPE 5MEND 3RX7A 3P73A 1KPRA 1LK3H 1M7IB 1B0WA 2OL3A 3D85D 1CYGA 4K23L 5ECJE 1SBSL 2XPGB 4P2RE 4EUPB 5I1HL 1XFPA 1OLZA 4GW1B 4K23H 5T1KA 5FO9A 4YAQA 4RQQA 1EAJA 4H26B 3EDEA 1A6WL 1FORL 3BI9X 4HIHB 1ZTXH 5AWNL 4GO6B 5J6GA 2NY7L 3P4MB 3DVGB 1KPRB 2DD8L 4NRXA 3JWOH 1MQKL 3K8KA 1BZ9A 3K4ZA 2FSEA 3NFNB 2X6MA 2G2RB 2WUBL 5LAXA 3P77B 3FKUS 2Y06H 5EZOL 4YIQA 1DDHA 3MUY1 3RZCD 1JL8A 4KTDH 3CU1A 4ZAKC 4HQQL 7FABH 3ULVL 3BZEA 5DVKA 3MV01 4KRPC 4HKBA 5BS0B 3FT2A 4QO1A 2JJWA 3BPOB 1XGQA 3ARDA 3EHBC 5KSAA 4LIQE 5TE4L 4POZD 2IFFH 5F7LB 5TFSH 2EE2A 3ARXA 4NQSA 2QQNL 5AD0A 3R06A 2FX9L 3SDAB 3MYJA 2DB8A 4PREB 5F70A 2MTPA 1BD2D 1DLFL 4IMKC 5F96H 4PLJC 5EU4B 4XHQA 2AK1H 4OZFA 1KJMB 4ZUWB 1JK8B 5SWQA 3BXNA 1TFHA 4XCCL 4MB5A 4OAWA 3BP7A 5HDQH 2V2TA 1M4KA 2EKJA 1AR1C 4HC1L 3WUWG 3KJ6L 3DMMD 5C08A 4JFEB 4M43L 4RBPK 2R0LL 2YZ8A 3HN3A 3QA3A 4N0UE 4ZUUA 3O2WL 4IMLA 4NQCE 2RBLA 5FA3B 1CICC 4TNVF 3MRPB 3DNKA 1MCEA 3IFPB 5CS7A 5IHBA 4PJ8B 2AJSH 3DROA 2NY5L 5D2LA 4XMKH 4HKJB 1FG2B 4CU6A 2NY7H 4NC1C 3RY4A 2VLKE 4ZNEE 4PB0H 3L6FB 4X98A 5E0QA 2R23A 3K1KC 4TPRH 2E5EA 2YPLB 4X6BB 1MHEA 2FBOJ 1DBML 2BRQA 4PP2A 4WFGD 1EIBA 5KN5A 4HMCA 1K6QL 5JIHA 3INUL 2ENSA 2DYPB 2WIIB 2VERN 4FNLH 5H37G 1HQ4B 3N9GL 1CR9L 4AEIH 1G6VK 2MMXA 4H5SA 1CWVA 1NCWH 3N1GC 1MJ8H 2Z4QB 3NFPA 3W39B 4ORGB 4APQC 4L8SB 1FN4A 2X05A 1FLRH 4D8PA 4TNWF 5HY9B 1B0GA 1QA9A 2LFGA 4OV5B 5EH1A 1WT5A 3WHXB 1WEJL 1YYLL 3RBGA 3SE9H 4J3WA 4P2QA 4B41A 2Z31B 3TO4C 2DI9A 4LLVA 4PRHE 2YKLH 4RGNE 1U8JA 2WQRA 1G7QA 5CAYB 3H9ZA 2F53D 3ULUD 1D5MA 4WIQA 1N6UA 5GRUL 1IQWH 2GJZB 2AP2A 2VAAB 4E41A 4ODHL 3PABB 3AY4A 5EIQA 3L3GA 4OLUL 3UJTL 4Z7OE 4ODHH 1OAQL 1K4CA 2EICA 4HSQA 3VFNA 3HPJB 4OGYL 2QQLL 3KLHD 4HAGA 3BE1L 3HLAB 4R6UA 3O8XA 4EDWH 4XNXL 2VDLH 4J12A 3GSQB 5IM7A 1XGUA 1KJMA 5J11B 5CSBA 3SDAC 2AS5M 3LDBB 1PY4A 2Z35A 3GRWA 3KPSE 1CGSL 1C5CL 2VLJA 3BHBB 5DRWB 4TTGA 1FE8H 2X4UB 1H3UA 3QXAB 3A67L 1RJLA 3WFBH 2FB4L 4XXDA 2DIAA 1HHJB 2FX7L 3CXDL 1R24A 1IM9B 2C4FU 4K3HA 3IF1B 1P7QA 4DTGH 3WJLA 5EOQL 1A1NA 3JTTA 4PJ7A 5E00B 1Z0MA 3SDAD 2G60H 4DTGL 12E8H 1U93A 2F53E 3ULUE 4FABL 2G2RA 1AD9B 4M7ZB 4WNQA 1IGYB 3MREB 3QEQE 3SY0B 5CWSA 3MLPA 5DD1L 3EDFA 2ERJB 4FQ2H 4TSBH 2AXFB 5C0DA 2P8PA 3V4VL 3MRIA 1YEGL 1FVCA 4L3ED 1CS6A 1D9KC 3ARVA 1MRCH 4JREC 4PRBA 1E28B 3VFRA 4PLJD 4XBGA 3WNKA 1BD2E 1X3DA 1WWCA 1HSBA 3W9DA 2XRAH 4A6YA 4RZCB 1QRNE 4D0BA 2APTA 3MGAA 1I9JL 1PKQE 3ZHKA 3BD3A 3BH8B 1OSZB 1A9BA 4AG4L 4I4WA 2BY3A 2YBRB 2EDFA 2JJTA 1EX0A 2B5IB 4LVNB 4JGUA 1S8DA 4GH7B 2RGSA 5IMLA 2UWEA 2WW8A 3KGRA 1U8PA 3MV8D 2VLKD 4OGAD 1C1EH 5ADPH 3VW3L 2J8UE 1J0YA 4Q2ZB 3LRGA 1AIFA 4QRPE 3KYOB 5FF6A 4PJ7E 3B9VA 1KTDB 5FHBL 3VXMD 3BAEH 2EE9A 3GHBL 1QBML 3TWCH 1HH9A 4OD1L 2XG5A 4KKCD 1QSFB 1F58H 1OB1A 2PXYB 4F37K 5GRJL 1IBGH 3ZDYE 3FCTA 2X1OA 2Z91A 1RZJC 1EAPB 3BKCL 4X7CC 3RVWD 1SY6A 4PUBL 3V5HB 4W4OC 1H8OA 4AEHH 5L2JA 5GQBA 4KROB 4MCZB 1CD0A 4YQXH 4FQJH 5DLMH 5GS2D 5MERA 2Q8BL 1REIA 4Y5VB 1AD0A 1XF4A 4XC1H 1X6NA 4ZPVA 4N8PA 2JJUA 3I6LD 1ZT4B 1LO0H 1T5WA 2CH8A 1CQKA 4JKKA 3SE4A 3FT3B 4RFEB 4MXVF 4MB3A 4FZ8H 3ET9F 3K2UL 3CLEH 1ED3A 1G7IA 1K8IB 4AH2A 3ULVC 5CMAB 3A6BH 3UTSE 1NLDL 1IKFH 4FFZH 3BIAX 1AO7B 3RPKA 3L3GB 3TBVA 1KJ2H 3D87B 4PG9A 2VABA 2MSPA 3U0WH 1BHGA 1UB5B 3RWEA 2AXJA 3LV3A 5GJTH 1ADQH 2M26A 3G5ZA 1X4XA 1F6AA 5ALBH 2HG5B 4G42A 3LKSA 3ARSA 1QQDB 4XI5C 5HTSA 3U0TA 4ZDHB 25C8L 1I3UA 1YEEH 3HKFA 1RIHH 3K81A 4GG6A 1LILA 3WNMA 4PJ5D 5IGXH 1B0GB 2Y9RT 1CE1L 1CFVL 1JWUA 4CU7A 1TJIH 4HH8A 4X7SL 2VXTL 5MENE 2YC1B 5FYKE 1LP9E 4ELME 2C3VB 2WBWB 1TETH 5KG9B 1S7WB 2VDRL 5TQ0H 3EIFA 4YBLB 3O0RH 3IGAA 4JN1H 2W59A 1DQQB 1SQ2N 1W72A 1FORH 4PY7A 2GCYA 4FQJL 1CK0L 4JDZB 3RWIA 5I17B 3IJSB 3O3AB 2VL4A 5I1EL 4XBPA 4Z7VA 5HDOA 4PB0L 2HRPL 3MRDA 1C5BH 4PP2B 4OTXL 4W6XB 4X4ZA 3PNWB 3QI9C 4NCDA 4R97B 3INUH 3QISA 4X7FC 2EO1A 4U49A 1IVLA 5HD8D 1I8MA 4NM8H 3LKPA 3GRWL 2X1QA 4H25B 2NY5C 2FIKA 2R8SH 3LOWA 4QTIH 2CPCA 3BVNA 2O5YH 5SWSB 4P48A 4WEBL 5HHXH 1E4WL 4J3UA 3MCLL 1GGBH 4MMZC 4BSWA 1YPZA 2PF6A 4JZNB 4Q9RH 3L3HB 4I2XE 2VLRE 4JFEA 4JHAL 4PV8A 1Q0XL 4EOWL 3UTTB 2JF1A 3ARQA 2IWGA 3VXMB 2J5LC 4KRNA 4NQEA 1TXKA 5J1AB 1TTGA 5A1AA 1SJXA 5ISZB 4KY1L 1ES0B 3MV8A 1KF9B 4KK5D 1JF1A 4U6TA 2R0LH 1GGIH 5EFIB 3L3KB 5EO0A 3ZE1F 5TE7H 1ZHNA 2CGRH 4NKOA 2J8OA 5E2UH 1CU4L 1OTSC 3BMVA 3U4BH 4LDLB 4LKCB 3TNNB 2AABH 4M7KL 2B4CC 1T0NB 3WS6A 4ZUVB 2D03H 2FHBA 3OJVC 3NCJL 1TETL 3ARFC 2APXA 1VFBA 3D48R 1NFDF 4NPYB 1UWXH 4B7LA 1UZ8B 5C09D 3RA7L 4CVUA 5IFJA 1DQDH 1RUAH 3TBTB 4PRDB 4LCIH 4F2MB 2P5WB 5F9WC 4PRPD 2C1OB 1DN0A 3JUZA 4P5KA 5MEQB 5ICYB 3D6GA 3BIKA 1UACL 1DBBH 1CF8L 2VDML 2DM7A 3G6DL 4OF6A 4JPWH 3RTQA 4HFWA 3U36A 3MCG1 4BZ2L 1K85A 3OKKA 4BFEA 3LB6C 1QVOB 4O4YH 2D31B 3QWOB 2A83A 4KKLC 3B5GA 4I18B 3MCKA 4K8RL 2VZVA 3CUPB 1JHTA 4ZYKA 4CRPA 4DZBB 1X5HA 5D7JA 4PTTB 3MRQB 3WIIL 1NCWL 3MGTB 3KPQA 1UM6L 2BVPA 2O5YL 3DXAA 4B5EA 4Y5VC 3UTZB 3FRUA 4L5FL 3AVEA 1ZT7A 1Z3GL 5EU5A 2NY4C 1JYNA 4PJ7F 2FD6L 1HI6A 3VH8A 1XIWC 3REWA 1FL3A 3PF2A 5HHPA 4KZDH 4GOSA 4O9HH 1KGCD 3KLAA 3WIFB 5I2IA 4JB9H 5C0IA 4OZIA 3NCYS 3WDHA 4XVJL 1RK1A 3NMEA 5IV2A 4QLRA 5TDPA 3NBNA 3FHAA 1OM3L 2NTFA 1GHFH 5E1AA 1RZFL 5I76A 2Q8AL 4YDLB 1JPTH 2IPTH 4KI5D 1OD7A 4GQPH 1JPGB 2Y6SC 3NN8B 2AABL 4M7KH 2YPVH 4JFOA 4OLWH 1X5FA 1ZXQA 4R8WH 1NANI 3V8CA 1MY5A 2Z0BA 5CBEA 5EBWB 4JZNA 3NFSL 1YPZB 3GMPB 4PJ5A 2X89A 3KYMB 1G9NL 3RU8L 2V9TA 2OP4L 4LARL 3ZE0F 1A7RL 2RR3A 5ADOH 3MLVH 4P2QE 4ZDHA 4XRCA 5FCSH 3CPLB 3ARDD 1IFHL 3FAWA 1AGCB 5T3ZL 1U8IA 4JO4H 4F57H 4K71C 4OCRL 2W38A 4PJ9A 4KPHH 4JFFB 5HSFA 3O2DA 2WQ8A 1KLGB 3DX7A 1MCDA 2UYLA 1NGYB 4G6KL 5D1XA 2BY2A 5A2KH 5E9DE 4KJWC 3U9PL 3QFDA 4TSAH 2W0FB 3NCBB 1FPTL 2DQTL 4UZGA 4WFFE 5F7DA 5JQ6L 3ULVD 4PRHB 1BLNA 3T8XB 1OWWA 4MDIA 2BVTA 2NW3B 5D1QB 3VG9B 2GAZA 2DL2A 3EO0A 1NGZB 5HVWA 4JR9H 5HHOB 4F9LA 3RWJA 5J1SC 1MFDL 2VXUH 1OAUH 1G1YA 3H6JA 3JV6A 1OARH 1CFBA 5EOTA 1L7TL 5CHNB 4OF0A 1K8DA 1VGEH 1IEAB 2FB4H 5BZDA 4R4BA 2CUMA 4JO2H 5ETUA 1FZOA 4Z7OF 2NMSA 2FEEL 3KG5A 1J86A 4XX1E 3E6FA 3JBG7 3WS3B 3P0VH 4YFLI 2J6EL 4Y2DA 4K7PL 1KTDA 5J12B 4NQDD 2EIZA 4ZD3L 1BIHA 4YXLH 3SQOH 1T2XA 4EDXA 4DVRL 1A1MB 1ZOXA 1IFHH 4M8QB 4B7IA 1S7TA 2WP3T 2AGJH 4ISVB 2NXYB 3BW9B 4DKEH 1QLRA 1CLCA 1Y6MR 1N0XL 1B9ZA 1QSFD 4M7LT 1RIUH 4XI5D 4RMVA 3MRKA 1PKQA 2OBGA 3L5WA 4QYOB 2VDKL 4L8DB 2Y07L 5C0CD 3DVNB 3DRQA 3TA3D 1KYOK 2Q7YB 4U1MB 1K2DB 1RK1B 1PG7X 2F5AH 4XCEA 1BQHB 2WV3A 1U8LB 4QKXB 4S2SA 4QTHB 5D2NE 4JFFA 1VEMA 1HDMB 4N0CC 5DTFB 3VXRE 4E42B 5F3HA 4RX4D 1HH6A 3WFDH 3SGKC 4OD3H 1AIFB 4X8XA 1FLTX 5DYOA 1DANT 3QIBD 5TJWK 4OD3L 5IOPB 1X5KA 3KPMB 5I1AB 4GG6E 4U7KA 2ICCA 4NRYA 3H7LA 2R1WB 5H35B 1QPPA 4XXDB 3CFKB 1NJ9A 5IVZB 2OXHA 5BVPL 2XA3A 2YSSB 3PIQB 3SGEI 5GPRA 5DZOA 5BRZA 8CGTA 1RZ7H 1IC7L 3H3BC 1FC2D 1JMZA 2AK4E 5BXFA 3LZFL 2H2SD 1NGWA 4X8JA 3GHEL 1TENA 3QUKA 5HI4C 4QRUA 5C07E 3Q2CA 4JDTH 5JR1H 4X6EB 2ARJQ 3BSZL 3EFDH 3V9FA 3ULSB 4MD4A 4X7SH 3CH1B 3WLWD 3O8XD 5JPMB 4P2CG 3REWB 4ZPTB 5K59E 3GIVA 4WDIA 5CIPB 5B3JF 5HGAB 4NKOB 4PRIA 5EB9A 1XGTB 5TFSL 4OFIA 3UO1H 1BFVH 5BMFL 1KJ2L 2YR3A 2GSIB 2Y7QB 2XN9B 3GUTB 2DLFH 3ULUC 3TM6A 1OTTC 7CGTA 3SBWA 5B39G 4N0UB 4QWWC 4UNUA 4YHPB 4JFEE 5FIEA 1SYSB 1KC5H 1D9KA 3BX7C 3MXWL 2OJZL 1QNZL 1FNFA 2HAZA 1Q8MA 1BBDH 3GM8A 2E27H 4PJ9D 4G9FB 4MB4A 5HVGB 3DSFH 3VXNB 3WD5H 3DX8B 1U41A 1QSZA 4EI6A 3Q1SL 1NAMA 1B3JA 3UDWA 4OQTH