5DRNA

Context-independent anti-hypusine antibody fabhpu24 in complex with hypusine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
EEQLKESGGRLVAPGTPLTLTCTVSGFDISDYAMIWVRQAPGKGLEWIGIIYGGSNKLAYAKWAKGRFTISRTSTTVDLKITSPTTEDTATYFCARGYGSMDGYDRLNLWGQGTLVTVSSGQPKGPSVFPLAPCCGDTPSSTVTLGCLVKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Hpu24 Heavy chain
publication title Structural Analysis and Optimization of Context-Independent Anti-Hypusine Antibodies.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 42
structure length 216
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drnA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drnA01
1RMFH 1JMXA 5D1XD 5DHVA 3TM6A 3WXWH 4DEPC 3LQZB 4IMLB 4HWEH 1CDIA 4P2QB 4KI5F 4BSVB 3QFDA 5F7EL 5HGHA 4EI5A 5J13B 2XZCH 2NMSA 2ESVA 3EOTH 3LKSA 3TBTB 4NQCB 3RBGA 5D5MB 3HR6A 3BP4B 5C0ND 1YEHH 1GPOH 4P9MH 4PJAA 1SEQH 1BVKA 1MRCL 3PGDB 1S9XA 4CMHC 2W9DL 3S96A 1H3UA 1P6AB 3BDYH 2K9UA 5ACZA 2Q6WA 2PTUA 4WFFE 3L3JA 2NY2D 2XA3A 5HYJE 4U1JA 2IG2H 5DMIL 1FNFA 2DIAA 3MV7B 3MGOA 1G9EA 4EBQH 5CKAA 4LEXH 2RCSH 1U8JA 2AJYL 4NN6B 2IALB 2NYYD 5C09A 5SX5H 3UAJC 1DVFC 3SGJA 3EYUL 5GGVL 3WDHA 5IHBA 1R24B 2CDGB 2NXYC 1F3DJ 3TBWB 3RZCB 5JW4Q 4XB7A 3EYVA 1XF2B 5GIRA 2NY1C 2A2QT 3ARPA 3QUZA 5I1KH 1B3JA 1J1OH 2HTKC 1Y6KR 2HKFH 1ND0B 4H1LB 2C5DC 4XCEA 1F00I 1WC7A 2DI9A 1INDL 2BNQD 1NLDL 3T0BA 2DMCA 1NEZB 4HDIA 4HUUB 4YDKL 3VXMB 4GXUM 4XPGH 1AHWA 4YAQA 4DN3H 1XGTB 3KLHD 4KK6C 3RTQD 1W0WA 3P0VH 4WV1A 4LNRB 1KB9K 4I3RL 4LLDB 3IDJB 1ZHKB 5E24E 5ANMA 4Y4HA 1OAUL 5GS2H 2P1YA 5DYOB 1F3JA 4CBPA 4WO4D 2AQ1A 1FBIL 4M7KH 5LBSL 1I8LA 3WUWA 1J8HE 2FIKA 2BY1A 1LP9F 4XVSL 4NO0A 3WIHH 5KVMC 1FZOB 1Z3GL 3S3SA 1I3GL 1EBPA 1FJ1B 3T0WA 3MLRL 1MLBB 5DHYB 4DFIA 3TZVC 2B1HH 2NW2A 2J8HA 1ZLWH 4FHBD 4ZG1A 2P8PA 2W0FB 1A3LL 1VFAB 1T83A 3D9AH 1QHPA 4WENB 3LIZH 3QI9A 4EOWH 2R56H 3T77A 2NY0B 3GEWB 3L3OA 2ICEB 2PO6C 3VXOA 2Z8RA 1FGVH 4S2SA 4PJHE 2DQEH 1EXUB 2VXTH 2YEZB 2YUZA 5SX4I 5LQBH 4N0UB 5ALCH 2GFBB 2AXGB 5D7IF 1P69B 4NC2B 2AXFA 1VGKB 2YA0A 4C56B 1EFQA 4OTXL 2IH1B 3OBAA 5IEKA 2CK2A 3SDAC 2OMBA 2P5EB 3G6DH 3IDMB 1RIHH 1DQJA 4G7YH 2B4CH 1DE4A 1BWWA 4OT1H 1KCRL 2VISB 3QDJB 2Y07L 4LARL 2XA8H 4H26B 5DRZB 5I1GL 4DOHE 4GXUN 3QIWB 2XOTA 4AM0A 1BJ8A 3RNQA 1E4KA 4YXHL 1HCFX 3SGDH 2VABB 1KN2H 3D0VA 2BSSA 5L8JB 3RDTA 3QUXA 4OCLC 3F12A 2VXVL 2NY6C 5HDQH 2EKJA 5HYSB 1X5LA 4XP6H 2Y06H 1IARB 2WQ8A 3VW3L 3FO9B 1T5WB 1I3RB 4AIZB 1YEGH 3QFJB 4M7ZC 1F3DH 4EI5C 5BQ7A 2W9LA 3ULVH 1X5JA 1T7WA 1KPRB 2FWOA 2ZOKB 3AB0B 4RZCA 3VWKA 1LO2H 2E8YA 3VD9A 1OVZA 3MX0A 3OR7A 4NZJA 5F71A 1UB5A 4FQQA 1VKXA 3VXRD 4CVXA 1WTLA 5E94B 4X98A 3JUYA 3DUSB 3OKKB 1S7XB 1SBBA 5EBWB 3LKNB 4S10A 3G5YA 3H9SD 3VMPA 2X4OA 4PFEA 3GHEL 2LV4A 2AJXL 5L0QB 1G6VK 3BE1H 2EEBA 3GJEA 4L4TB 4NNPL 1P84K 4PRPA 3RGVD 5FYJD 3PV6A 4YK4C 4JCLA 1I1AD 4MAYB 5K9JH 2G2RB 3QULA 5EO1B 4LQFL 1RZFL 5DSCB 3IDYB 2D2OA 5BVPH 3H42H 5EZLB 2R9HC 1DLHA 5T3XE 4ZQKA 5LGHL 1OTSD 4L8SB 4L3EA 1KFAL 5JXEA 4B7IA 4UNUA 2PXYA 2X4UB 1B2WL 5TQ0L 2DQTL 1UGNA 4G9FA 4I0PD 3PQYA 2AK4A 5C6TL 4DGIH 3THMH 4LRIA 3VDCA 1F97A 3NACH 1SM3L 1U93A 5MHSD 3BMVA 1RZ8A 5KSVB 1NC2D 2VC2H 4OZIA 4GG6B 2GHWB 4Y2DA 1MAJA 1S7TA 2NY3B 1AHWC 2XPGB 5EU4B 5L9DH 5K9KA 3ARGB 1IZJA 2VDNL 1BD2B 2A9NH 5CP7A 1IQWH 4YWGH 4KTDL 1L6XA 1RPQA 4PJIE 5A40E 2KUTA 4U6YB 3MFFB 4Y4HC 5IVZB 2DMBA 3IFLH 2YPLB 5CJQH 2IBZY 3LN4B 3EYFB 3VFUA 3UROR 2VAAB 4GLRH 4M8QA 2DQHH 3QDGD 4XPBL 4NQXB 1QYGH 4E42B 3FT3B 1I8LC 4JRYB 1FL6B 4ONGL 2R69H 3G5XA 2F19L 1FFNA 3KNBB 4OCNC 4I18B 5D7SL 2QLVB 5LGKA 5J12C 3HI1B 4PJBA 5B38B 3D0LA 4NQEE 1D5MB 3ULSB 5D6CA 1ERNA 3HMXA 2C26A 1JHKL 4WFHE 3V7AE 2BK8A 1T83C 4R3SB 4JM2F 2R2BB 4Y16D 3QI9C 1UKQA 1YEDA 4G8FA 4LCYB 2VIRA 4HWNA 4AEEA 3E8UH 4NBXB 1MCNA 4KKBC 2FIRT 4N1HB 4H5SB 1QRNA 3HG1B 4Y4KA 4PY8I 5FYKD 4RDQG 2BOCA 3RWHA 3QDAA 3DVNA 4R4FH 3TLRA 1RJYA 3H6JA 5HD8D 3BP6B 5FYJL 2OK0L 3QO0B 1FPTH 3AAZA 5I1IH 3LN5B 5ALBH 3TT1L 1I85A 5I75B 5I66A 2BSRB 1R5WA 3EJJX 1HYRC 1GCFA 5AWNL 5HYJA 1ZKAA 5FUCC 1JV5A 3QUYA 1XGPA 2NY5C 3ZE2F 1N26A 2OR9L 1E4KC 3BT2H 1LNUA 2QL1A 3Q2CA 2IPUK 4LLMB 2MOVA 3M8OH 3VGHA 5EBLA 3LS5H 3RDTC 1CQKA 1N64H 3QUXC 5DR5L 1QFWM 4I4WA 4CGTA 5J7CC 2ILLA 3BD4A 1AI1H 2G5BB 2UVEA 1UVQB 2DICA 4UINL 5H94B 5EOCJ 4DVBA 2F5BL 2X9WA 4ZUVB 3BZEB 3MRRA 4M8VA 4DGYH 1G7LA 3GMMA 2EO1A 3VWKC 3I2CL 3VGBA 4PJXA 5CZXD 2BVPB 1AD0B 5CEXB 4LSSL 3FT2B 5D96C 2GJJA 3SDCA 5LXGH 5HGAA 2HVJB 3GI8H 3CUPA 3B5GA 4F7TA 4WCYH 5IMMB 2EKSA 4JJHA 1HYSD 2P24B 2EZ0D 5I73C 3EYSL 4EDWL 3EDKA 3SDYH 2ATKB 4K3EL 4ZD3L 4BQ6A 5FXCH 4YPGB 5JIPA 4HS8H 4NJAH 3MRIB 4O2EB 1I7TB 2F74B 2FBOJ 3ZDXE 2VO5A 3S5LB 3LQMA 4PGBA 3MRPA 2JB5L 5DS8B 8FABA 4KZEH 1GZQB 3O4LE 2CJUL 2QADC 3C6LB 3VXUE 1J8HA 3MREA 4B7LA 1CVSC 2DQJL 2PXYC 5B39B 4NQCE 3P4NA 3VE0B 3UYPA 2D4DA 5HY9A 4UB0L 4AENB 5FA4B 1MWAA 1NUNB 4MXQC 5DC9B 3OXSA 4TULL 3FO0H 5FYKL 3U9UA 3HE6B 4LRIC 1Z0MA 5IBLC 4PJGF 1KACB 3FCTA 1CD8A 5DD3L 3DROB 4GSDH 4Y2DC 4UUJB 2B2XL 4KAQH 1MI5D 4F3FB 3OJVC 1SVZA 5GHWL 43CAA 4M00A 2HLAA 4ZUSB 2Z31B 1K6QL 5IJVA 1MCSA 4WHYG 1KCUL 4NUJB 1FSKB 2APXA 1N3NB 2D03L 4K94H 1A3QA 3QPXH 2IMMA 2UUDK 4LIQH 1HKLH 1T6WA 3GO1L 2ZSWB 1FL5A 4ZFGH 4JFEA 1UJ3A 4JPIB 2P5WD 3BGFB 3B8YA 5FO8A 1DDHB 2Q20A 4K7PY 4WTXA 2DD8H 5SWSB 3UBXI 2IQ9H 5DJZA 1QQDB 2I25N 3L95B 4GH7B 1QBAA 4KHTH 3V6BR 4KV5E 3HNTH 2BRRH 4XBGB 5D72H 5GGSY 3O2WL 5T1LB 4UT9H 1QKZH 4NQSA 2EDDA 4MAUL 4LPCA 3BP5B 5E08H 2MPAL 3OKOA 1WCQA 2BOBA 3OAUL 3MPCA 2DAVA 5IMKB 1JL8A 2HT4D 5T1DH 4FQIH 4RX4D 3PP3H 5IB1B 4GKSB 4KMLB 3FQUB 5I30H 1U3HD 3DTXB 3C9NB 2BNRD 3HZMA 2DWDA 2XN9B 3QG7L 2VNCA 3ZDYE 2VDOL 3CFKA 4RAUB 3VXSD 4Y4KC 3HKFA 1EZVX 5FYLE 1TTGA 4Q9QH 4HIIA 1FAKT 2HTLD 1DUYB 2HN7B 1UM4H 4JFDB 4JREB 5I74B 4MDJA 3GSWA 3IDNA 2IANB 2YRPA 1LE9A 4NO2B 1IE5A 5C7XH 2ZOLA 3WFDH 2MTPA 1OAYL 5KSUB 1I85C 1SBSL 3V4UH 1N7MH 3QUYC 5CMAA 4P9HH 1WK0A 2ZCHL 4P59L 3Q5YA 1T3FB 2WLZA 3WBDA 4P3CH 1E6OH 2CKNA 3L3IB 3V9FA 1HEZA 3GDBA 1CGWA 4NKQB 3HR5A 3ZTJH 3SEPA 5SV4A 5B3NA 2J4WH 3LQAH 4LLYB 2F58L 3P9MA 2GSIA 1ZXQA 4LSVH 3EJYC 3PXJA 1P7QA 1Q9OA 2WWMC 3EGSB 3QZWA 3CJJA 4BZ2L 1KXQE 2VZ1A 3MLSL 4XT1C 4WW2A 3KPRE 4C56E 3FHAA 3NAAH 4U6VL 5IK3A 1RZIA 2P5EE 1UJTA 3U6RA 4N8VB 3V79C 1AR1D 4XWOC 1IEBA 5FYJU 1J0ZA 5IMOB 3QDJE 3PNWA 1T22A 4OFDA 1UZ6E 5DRWA 1FH5H 4W6WB 1MCFA 3U2SB 4NRZB 1LE5B 3B9DA 3N9GL 2IF7A 3FO1B 3UBXA 5MP6L 2JJTC 2A0LD 8CGTA 4OIIL 5F7KC 4J3UA 3SDDA 3TN0C 4JFZH 1T6VN 3D2UD 1DEEA 2E3VA 4NO3A 4NGHH 1AO7D 3MRCA 5DJ8A 4M93C 4PJIA 4QHNA 4OCYL 4ZUUA 2CDFA 3M1BA 4G8EA 1NCBL 4QRPB 4KROC 3FB7A 1OAKH 1IGFL 1IGJA 4TUKH 1T1XB 4NZRH 1CLZH 3AU1A 4JFQA 2FEEL 3AS2A 4CN1A 1E0OB 2HH0H 3EYOA 3FQXB 1YJDC 2DJUA 4MX7A 4Q6IA 3V5HA 4HIHA 3WFHA 4X7TA 3KVQA 5FCSH 5LCVH 4JLRA 5KTEH 1C16A 2CLZA 3HZVB 1J10A 2QQLH 4JPWL 5HHQB 4KGJA 4YHKL 4MJ6B 2NTFB 1OP5H 4WI3A 4IRJD 4M61A 4QKXB 4EUPB 1WGOA 1CD1B 1G9MC 3RY5A 2YC1A 1D9KB 1MWAH 2XQBH 4XPAL 4ZOBA 3GMNB 1J5OL 1CFSA 4G9DA 3U0WL 1KGCD 3WE6A 1A4KB 3PWNA 4JFXA 5AYQA 4MA8L 2P44B 2EYSB 2RHEA 1XGQA 4HJGB 4R7NB 3VFRA 1MAMH 3A6CH 4LSUL 3K4AA 4JHWL 3S4SB 3UDWA 5AG9A 5GRWA 2OQJA 4AJ0A 2AK1L 1K4DA 3H0TA 2FL5A 1QVOA 3S34H 3P3YA 3TVMC 5H2BB 4WW1B 1AFVH 3RPIA 4JFFB 2FRGP 2EIDA 3HPJA 3LY6A 3PF2A 3C87A 1B0RA 4G6JL 1CK0L 5TGBA 4GG6E 5CINH 5DEGB 3QHTC 1V3LA 5FYKU 1VERA 5A2LH 3VD7A 1U2CA 2NNAA 1L9NA 2VXQH 2Z92B 2X2YA 2H32H 2ZJSH 4FXKA 1BD2E 1V8HA 1RUML 4O4YH 3VG9C 1OSZA 1INQA 1NC4D 4X4ZA 1JGVL 1RK0A 1RUKH 2YPLE 4L3CA 2WMPA 4OCWL 1C1EL 3O9WD 5IB2B 4L8BB 2UV3A 4JO2L 4R2GB 4X6CB 4RBPH 3U4EA 4J3SA 1DQDH 2CSPA 3G08B 3DHMA 3NPSC 3T2NL 5I1EL 4F7MB 1ORSA 4EQ2A 4WI9A 3CK0L 3UJJL 2QTEA 2ICWB 2P7TA 1B88A 4HCRH 3ALPA 4KUZL 1NGZB 1KBGL 2ZCLH 4LCIH 3LPGA 4YXLH 1NAMA 2HA1A 4NUGL 5L2JA 3OPZL 3BEWB 3F5WA 2HT2C 4QRRB 4ZOEA 5E5UB 4MQXD 1KN4H 4NO5B 4ODTH 5IB5A 1A2YB 3VFNB 4LPVA 1V7NL 4OLZH 3MA9H 3LS4L 5CGMA 3HG1E 1QFWH 3X11B 3ZKMC 1FZJB 1RIUL 3LQZA 4IMLA 4P2QA 4BSVA 3Q6GL 2LFGA 4HGMA 2I60L 4WW2C 4ZXBB 3TBTA 4NQCA 4POZD 1FCGA 5D5MA 3BP4A 5I1CH 4ESKA 4Q9BA 3SKOB 4J1UB 3VRIB 5C0BE 4NCC1 3PGDA 3B3IB 3SE9H 5A3IC 4U7MA 1FAIL 1MFBH 4N0YL 4KUCF 5KSAB 1XCQB 3G6JE 3GSNH 4U2YA 5KSBB 2Y4SA 4RWYL 5FB8B 4XPHH 3MV7A 2Y1VA 2DLEA 5LAXA 3OF6A 3H3PL 2E6PA 2DF3A 5ILTL 2IALA 1LO3L 3H7BB 2YA2A 2CLRB 1ZLUH 5F9OL 3KPLA 4NM4L 3U9PL 4OZIF 4Z7OE 4X5XB 1R24A 3ARYA 2YUXA 2CDGA 3TBWA 3RZCA 4RA3A 4NNYB 1XF2A 1A14H 4EN3B 5T5FH 1ROWA 1HHGB 4DK6A 1ND0A 1CFVH 3L3DB 3QDMB 4Q6IC 1LO4H 5MEND 3FN0L 3T0DA 3CU1A 1DL7L 5E03A 4D0DB 1OWRM 5FK9B 1NEZA 2FATL 1AJ7H 4XHJD 4HUUA 1YMMB 1DSFL 4M7LH 3B8SA 1HILA 1BM3L 3VXMA 3MJGX 5D71H 1S7QB 3MLZL 4PRNB 1XGTA 2WM0A 2PNDA 2CGRL 2WUCH 1NAKH 4KHXL 3GNML 2FYYB 4LLDA 3IDJA 1ZHKA 5DFTA 1UCTA 4ORGB 3R1GL 2E6JA 4PJBF 4YUEH 5KBNC 1MOEA 2C1PB 5F7FA 3KR3H 4JY4A 5DYOA 2PR4H 2DOCA 4OCXH 4HUVB 3D85D 1H5BB 3P0YL 1OGAD 2GITB 2UYLB 1NGWB 1H15B 5I17B 3QJFB 1FZOA 1EHXA 3UDWC 4EXKA 1FJ1A 1HDMB 1MLBA 4L4VB 2D9QB 5DHYA 4LLWB 1LO5B 5J3HD 2HKHL 3VGAC 5IB3B 2W0FA 1WLHA 1VFAA 3S6CA 3SKNB 4OFYD 3V6ZB 3WNPA 1EK3A 3VGDA 35C8H 2W92A 2ICEA 1LMKA 1DJSA 4YFLI 4YQXH 1RZ7L 4RISL 1A7BA 1EXUA 1MCDA 3CCHB 4N0UA 1UH2A 2GFBA 2AXGA 3UTSD 2ADFH 2IADB 1VGKA 3WN5B 1I9RH 3FAXA 2IH1A 4ZOAA 3VGFA 2DM4A 4WIQA 4GKZB 5CJ5A 2P5EA 3LV3B 4HPOH 3IDMA 4P2RD 3L5WB 3N1GC 3NGBB 3W5MA 3QDJA 4KVCH 5KW9H 4OM1H 4ETQB 2XQYG 1G6RH 5C08B 4H26A 3QCVL 4M48L 5DRZA 5A1AA 2OI9B 3QIWA 1EA9C 2CO6B 4MD5B 5CJBA 4OLUL 4FQLH 3MOAH 1MRFH 4PJXF 5EZJB 1ZHBB 4DQOH 1HKFA 2EDXA 2VABA 3C5ZB 2OYPA 5T33H 4ZSOE 1P5UA 2R23B 4O9HH 4XC1H 4XTRD 5HYSA 1HOCB 5I15L 3B5HA 1W2KT 2XN9E 5JW4M 1GC1C 1S9KC 1EO8L 3FO9A 4FQ2L 5FO9B 1I3RA 3QFJA 4L5FH 1JRHH 4JFDE 3EHBD 1U6AL 5CD5C 1FNAA 2QQNH 1KPRA 2ZOKA 5IVXB 1UZ8B 1PGRB 3SCMD 2M2DA 3S98A 2P46B 5E94A 3DUSA 3OKKA 4Z7WB 2YHGA 4D9RD 1S7XA 3BKYL 3HCVB 5HBBA 2V2TB 5EBWA 3LKNA 5I8KL 4MJID 2CR6A 4YC2B 5HHPB 4D0BB 2X1OA 4LDLB 1DQLL 1QLFB 1QSFB 4L4TA 4P5TB 4Q9RH 3PL6C 4RNRB 4ODUB 4K71C 4XNXL 2BP3A 1HH9B 2HWZH 3DYOA 4MAYA 2G2RA 4ZPVB 4MB5A 3DIFB 1U8MB 2WBJD 3TYGL 5EO1A 4NN6C 4CVUA 5DSCA 1OW0A 5EZLA 1A6PA 4AH2B 1T1WB 3VU2A 5JIKA 3TT3L 1R5VB 5C2UB 4L8SA 5DRNB 2Q8BH 3RZCC 5JMRA 4P4KB 1XR9B 4M7LT 4CAGA 2X4UA 1T20B 2B7DT 2F8XC 4X9HA 4L9DA 5JIIA 1IBGH 1U8LB 1RZJC 3HUJB 3QRFM 2EXWD 4N0CD 3KLAB 4GG6A 3QCUL 2JLLA 2XPGA 2VLRB 5EU4A 4LHUB 1KIPB 3ARGA 3QIUD 1NH6A 1PG7W 1BD2A 1NCTA 3ARBD 3MRHB 3DSFL 3VG0L 4FNLL 2FNBA 4U6YA 3MFFA 5IVZA 3WFBH 2H45A 4QOKB 5F96L 3T08A 1FVCB 2YPLA 4Z0XB 3LN4A 1TITA 3EYFA 2VWEE 5DURB 5TQ2H 2VAAA 5L2KB 5HHNB 3W9EB 1TIUA 4NQXA 3WD5L 4E42A 3FT3A 1TETH 1R3KB 1A1MB 5TE6H 4JRYA 1FL6A 1TVHB 4WI7A 1HH6B 3BAEH 5JQ6H 4X9GA 1Z2KA 3KNBA 3EOBA 4I18A 5JOPD 3HI1A 5B38A 4M5YH 2EYTB 3MRKB 1D5MA 3ULSA 4BUGA 4R3SA 1HWGB 4C58B 4FQ1L 2R2BA 4OD1L 2NY0C 4WWID 4LCYA 1CZ8H 3WFCL 2RIKA 1Q0XL 3ARSA 5E1HB 1JPTL 4H5SA 5D8JL 3HG1A 1FIGL 1V7MH 3ZZ1A 1MELA 1WIUA 2AERT 4J6RH 4R8WL 3VMNA 4Y1AB 1HZHH 2D7NA 3BP6A 3LKOB 4Q0XL 2NXZB 3RY4A 2XZQL 2C3WA 3QO0A 5GGTH 3BUYB 4LVOB 4HK0B 4WWKC 3D5OF 4KPHL 2CMRL 2QSQA 4LPYA 2VJXA 3LN5A 4GBXD 5KZCD 1FDLH 2D0HA 2FB4L 3BPLB 3WS6A 2BSRA 2R1XB 4GAFB 2VN7A 4JFFE 4WW2F 3QIWC 4K9EH 4KK9C 5DO2D 1GHFH 2JJVA 3CX5K 3IJHB 4W4OA 3TH4T 4LCWD 3GI9L 4LLMA 5IHUH 2X1WL 3QIBB 4MS8D 1DBAH 3MUJA 3ZE1E 2G5BA 1UVQA 5H94A 3ZSTA 3NIDF 4Z18A 3BZEA 3MLTB 5HVHB 3KXFB 5I1JL 1FNLA 1CE1H 5AZEL 2CPCA 3BP7B 4S1RH 3AB0C 5IFHL 3AMLA 3WLWD 1IC5H 1IZKA 2BVPA 4WVRA 4XBPB 1AD0A 1XH3B 4C54A 5CEXA 4GMTH 3RVTC 2AXHA 1BX2B 1JJUA 3FT2A 2DRUA 2HVJA 1WAAE 5IMMA 5JOFB 4BQBA 1QUNA 4U3HA 4HK3J 3TO4D 2P24A 1YY9D 1UYWL 2AJYH 4UILL 2MQ0A 3REVB 4QRRE 2CRZA 2ATKA 1IQDB 4KI5D 5E6IB 4MAYC 4ODHH 1F2QA 4H8WC 4PD4J 1I7RB 3TPKA 4WI8A 4NP4H 4S1SH 2DWEB 4YPGA 3KWWB 2VSDA 5GGVH 3MRIA 4KK8C 4O2EA 4V1DD 2EH8H 1I7TA 2AI0L 2F74A 1OW0C 3B2VL 4OLWH 3S5LA 2WAHA 5DS8A 4EIZC 5CCKL 2XRAH 4R96A 1GZQA 5HJ3B 4UT6H 2APTA 4XCFL 4L8SC 3C6LA 2HMID 5B39A 2E9BA 5DDHB 4F7CB 3VE0A 4D8PB 4AENA 1NLDH 5FA4A 1C12B 3F6LA 4I0CC 7FABL 1MFDL 3HE6A 2D7OA 3VXNB 4YDKH 5DJXA 2J88L 1P7KB 3CFDB 1RVFL 3DROA 5KS9B 3D25B 3SGKA 4UUJA 2NY3C 4F3FA 4GRWB 1MCPL 5DJYB 1BQSA 1QD0A 4I3RH 2R0KL 4ZUSA 2Z31A 2F8OA 1A7NH 1Q0YL 5BZDA 4A2LA 4PRDB 1OAUH 4NUJA 1URLA 2R4RH 4QRSB 5HHMB 2LTQC 1ADQL 1N3NA 1WWAX 5BRZD 4BM7A 1FBIH 4WU7B 2XWBB 3CU7A 1QG3A 4XVSH 1N0XL 1I3GH 3HNVH 1MHEB 3QDME 4JPIA 1UEYA 4J3TA 4P49A 1DDHA 2RR3A 2NTSP 4XPFH 5SWSA 2LAGB 4R97B 4ENEC 1QQDA 3L95A 4I18C 1A3LH 1TJGH 4XBGA 1YMME 4YE4H 2HRLA 3NA9L 3FOMA 5T1LA 3LH2L 3BP5A 1C5CH 3QR2A 3VXTB 1S9VB 1L6ZA 5DQDL 2DDQL 5IMKA 2Z91B 3HAEG 4QWWD 4RWHA 3TBYB 4JDVB 2AABH 2ENYA 2X42A 4GKSA 4XP4L 5IB1A 3RIAF 3NFSH 2NZ9D 3DTXA 3C9NA 5GS0D 2XN9A 4RAUA 5HYFA 1N8ZB 4IS6B 4RMWA 3S37L 4OTXH 1DUYA 2HN7A 4JFDA 3ARDD 1OTTC 1Z9OA 3RQ3A 2IANA 5E8OB 3QZWG 3U36B 1FO0H 4KQ3L 3C08L 4NO2A 2P43B 2YUVA 4Y89A 2AGJL 1JGUH 4F15B 3ZE0E 3WLBB 3MRQB 5KSUA 5I1GH 3WS6C 2UWEF 3I6GB 3L3HB 1NGXB 1CF8H 1ZTXL 1LEIB 3NIFF 3QEQD 5I0ZA 5D5MF 3DMMB 2VUYA 4TQEH 2BY0A 1T3FA 3UZQA 4OFPA 3EJZC 4W4OC 3L3IA 3UBXG 2BVUA 5JUEL 2VXVH 4UBDD 4WHDA 1WEJL 3I9GL 3IAPA 2H26B 4NQTA 1J18A 1I75A 4LLYA 1BF8A 4QTIL 2FO1A 2NR6C 2VUOA 3EGSA 5E4IA 1HXMB 1KIUA 4J2XA 3L3KB 1CD0A 1ZLSH 1J88A 1GZPB 1OLLA 4FXGB 4N8VA 1JYWA 5HI4D 5TF0A 5IHLB 4P23D 5IMOA 4H88H 3V0VB 3ILQC 3MXWL 2AJXH 3U2SA 2OR8A 4NRZA 4OSUL 1LE5A 3FO1A 4JFOB 2EDWA 4CKVX 4LCCB 3DOSA 3UEZA 4NBZB 4Y7MA 1KJ2L 3QRGL 2A74B 4MA3B 3V7AG 5FUZH 3RUGA 3RA7L 2DB8A 4LQFH 5FDYA 3CXDL 3K2UH 4U3XA 3ZKND 1QEWB 5E2WH 1ZANL 3RU8L 4QRPA 3EO0B 1HHHB 4OGXL 5AYUL 1KCVL 1T1XA 4TSAH 3ULUE 3RAJL 3QPQC 3F7YB 3O6LL 5MEOB 1A7RL 3C6LC 1DBBH 1KEML 5IVXE 4ODBD 2ICWI 5SV3A 2XZAL 4P46B 3ZDYF 3D39D 5GS0L 1JGDB 4LSRH 4WHTB 3HZVA 4N5EC 4ZS6D 2Y23A 4Z7WE 5TDNB 5HHQA 3HE6C 4KJQC 1TZIB 4MJ6A 2NTFA 4Z7NE 3BOVA 1DZBA 4JM4L 5DZLA 5D4QA 4AIOA 1EX0A 3S97C 4EUPA 1CD1A 1RUPL 2FGWL 2VDNH 3SGKC 4QNPE 3OJDB 4HKJB 4M43L 1D9KA 4KTDH 4WNQB 3BN9C 1NSNL 5BMFH 4LGPB 3KYOB 5C0RL 4HS6B 2Z31C 3GMNA 3WNLA 1IT9L 1NMBL 3WIFB 3EYQD 2X4SB 4PUBL 1KTDA 1FSKC 3KPSB 5F88B 1A4KA 1JZ7A 1OGTB 4XPBH 2OLDA 2XTJB 4U1SA 5C0GA 1HE7A 3BJLA 2L7UA 2EYSA 4ONGH 4HJGA 4R7NA 1UADC 2X5PA 3S4SA 4O2CB 1ZOXA 1XGUB 3BGFC 5I1HL 1BWMA 1OARL 5H2BA 4WW1A 4UU9B 4JFFA 4E0RB 2C9AA 4HC1A 5I1DB 2FEEI 4WDIB 3KLDA 5DEGA 5T1KD 5E6YA 4HXAL 1EUTA 4R6UA 5IROC 2VLRE 5E70A 1ES0B 3T09A 2Z92A 5EIVA 2VQUA 2M26A 5E5RB 3BKMH 4QO1A 4HZAA 3Q1SH 1BGXL 3BVNB 2GK0B 3N1MC 2NY4B 3DPBA 1N59B 3Q5OA 5EOTB 4QOKE 1GYAA 1IGCL 5A2IH 4KQ4L 5F7DB 1PSKH 4L8BA 5FYJH 4Z6AT 5DLML 5I74C 4X6CA 3IS0X 3P4LA 3G08A 1S8DA 2ICES 4F7MA 2A9ML 1CDGA 3TT1H 3OB0H 2NPLX 3KAAA 4MCYB 5MI0B 4JM2D 5C07D 2ICWA 4UIMB 1WAAA 5JPNB 3MFGB 2J5LC 1U8QB 1UCBL 3BH9B 3HRPA 1OAZL 4KGLA 3BQUB 3BEWA 1BQHG 2V2XB 4YDLB 4YNYB 4QRRA 5HGDB 1A2YA 4NWUL 3VFNA 2WSKA 1S5IL 2WWKO 4X80H 4RGNB 4UTAH 1QSED 4JPKL 3X11A 1O5DT 1FZJA 2V6HA 5HHOB 3MBXL 2VH5L 5LGJB 5DC4B 1YNLL 3JWDH 3QWOB 4ZXBA 1KYOK 1KJ2B 4OLYH 3BRDA 1JNLL 1Q72L 5DZOA 3SKOA 4J1UA 3VRIA 4LL9A 3B3IA 1AR2A 4UOJA 4XNYL 3GJFK 3NABH 3Q6FB 5KSAA 4WUUB 1XCQA 4H1LG 2Z8WC 4M6AA 3DYMA 3RWDB 3T2PA 1VEMA 3IFPA 4HKBB 1F5WA 5KSBA 1QBLH 2JK5B 3EYSH 4Q6YA 2MCPL 1NEZG 5FB8A 3JTSB 5D7JB 3GSQB 3AS0A 3VFGH 4K3EH 4ZD3H 3OKEB 1LDPH 3KS0J 2VLMD 1RHHA 5JW5B 1VADB 2WBKA 5EU3B 3H7BA 4FQXB 5DRXB 1U3HA 2CLRA 3VRLF 3UAJD 4XNUL 1WF5A 3UPAA 4GG6F 4X5XA 1DVFD 1IEAB 1A6AB 3C5JB 3PWPD 1R5IB 5IG7B 3ILPB 1HIMH 4NNYA 1KCKA 2NXYD 4EN3A 2X89D 4QTHB 1HHGA 4LPTA 2NY1D 3L3DA 3QDMA 3T3PE 1I9JL 2HTKD 1SJXA 1J8KA 1CTNA 4TULH 4D0DA 4DVRH 5FYKH 5FK9A 2F5AL 1Z9SA 4PJ5B 2MKWA 1ACYL 4MA7L 5TE4H 4UT7H 1YMMA 1U8PB 5EU6B 4NOBA 1N5AB 1DBKH 2B2XH 1AC0A 5LKNA 5J6GB 1S7QA 4IMKA 5B22A 1V3JA 4PRNA 2ADJB 4XBEL 3O3BB 5JHLL 1D9KC 2FYYA 1AKJB 4KK6D 4ORGA 1LD9B 5EIIB 2KBGA 4ODSL 2BERA 3EBAA 2C1PA 4JHBA 3O6KH 5ABDE 3DX6B 3BISA 5EIQA 5M95B 4AL8L 1H5BA 3O4OC 1GVIA 3C60B 2GITA 2UYLA 5F1KC 1H15A 5HGBB 5I17A 1XGYL 1JPSH 3QJFA 5D7LB 1S3KH 3NN8B 2VITB 1HDMA 3C2AL 2VZSA 4L4VA 2OSLB 4LLWA 1LO5A 5ESVB 2VKWA 5AUMB 1XR8B 3TZVD 3X3GL 4FG6C 5CEZD 4TUJB 3SKNA 4R26L 4MCZB 4MAUH 3SPVB 3V6ZA 1UM5H 4GJTB 4ELMB 4OJFH 4LEOB 2VXSL 4GRWE 4OIAA 5E2JA 3VI3E 1FYHB 1JGLL 2KQNA 3FJTA 1VFBB 2PO6D 4FQJL 3F58L 2WINB 2VDOH 1M7XA 3CCHA 3WKML 2DQUL 4PREA 4DJMA 4HMCA 2IADA 5HYSG 3OQ3B 3WN5A 3KPPB 4JANB 1OAXH 3D1MC 1KB5B 4GKZA 4R2GC 3J7HA 3LV3A 2X44D 1CYGA 3SDAD 3L5WA 4ALAL 1TZGL 3ROOB 1WITA 4Z7OF 1FNGB 2OX5A 4JRXD 1S7SB 2YD9A 4ETQA 5C08A 1SBSH 1IM3B 2AVGA 2LU7A 5EOQL 4K07A 3BD5A 4ZO7A 4D9QD 4G5ZL 3N85L 3W0WD 2GJ6D 2VDKH 4P59H 3HC3L 4MD5A 1KULA 1M71B 5IQ7L 2CKBL 4M3KB 5EZJA 3RFZC 1MCWM 1ZHBA 3EZ8A 4G7VL 3C5ZA 3KS0H 2R23A 5SWZD 5GRJH 2VQ1B 3HB3C 1CR9L 4LU5H 1RSFA 5D1ZB 3GK8L 1HOCA 1QLEL 2NY6D 4BZ2H 3F65A 4QHUB 5FO9A 5GPRA 1XF5B 4U6VH 4ZXBC 1Q38A 5IVXA 4EI5D 5CEYB 2ESVD 1T66C 3MV8B 4HMDA 3RX7A 2A6DB 3OKDB 4NZDA 4Z7WA 3IYLW 5D1QB 2ZUQB 3HCVA 3RIFK 1XMWA 5J1AB 5KSAC 1JRHI 4NKMB 2V2TA 3N9GH 2WK2A 4PGDB 4E5XB 4OIIH 5HHPA 4D0BA 4Z8FH 3W5NA 3OAYH 4OGYL 1QLFA 1QSFA 4P5TA 5E2VH 4RNRA 5F7MC 2Q7YB 4ODUA 1HH9A 2JIXB 4ZPVA 3DIFA 2HYMA 2CLVB 4OCYH 1AXTL 5F1NB 4BA8A 1JK8B 1SY6H 1NCBH 2ORBH 5C09D 5CEZL 4AH2A 1T1WA 4PS4L 4K7PH 1R5VA 3O8XB 1P5VA 2R9HD 1T2JA 5DRNA 2ZCKL 1HCVA 4P4KA 1XR9A 4LHQB 1HSAB 1X6LA 4EN3C 1I3VA 1T20A 4JDTH 4NZTL 3FQRB 4H25B 4G8IB 4LAQH 2YKLL 3QUZD 5ITBL 3U1SL 4D94A 4HHAB 1U8LA 3HUJA 3AS1A 3SGEI 4KJYB 1H8SA 5J06A 1HQ4B 1QFUH 3SO3B 2DI8A 2NX5E 3OV6A 4IMKC 1F2XK 4LHUA 4XPTH 1GAFL 2Y7QB 1KIPA 4I5BB 1L7IL 4XPAH 1NCDL 3QEHB 3UJIH 5D2LB 1T0MB 1JFQL 3U0WH 3T65B 3I3EA 4KFZC 1B4JH 4FFWC 4ONFL 5B4MC 1JPST 4W6XB 4QOKA 3TNMB 1FVCA 3GJFB 4ZNEE 4Y4HD 4Z0XA 2RFXB 1N6QH 1FRGL 1B6UA 2X05A 1ZGLP 4MA8H 2R0ZH 5L2KA 5HHNA 1H5BC 2BJMH 5E2UH 3W9EA 3X17A 2YPKB 4UDUB 2RAMA 2EE9A 4LSUH 1R3KA 5HTSA 3AFLA 1TVHA 2ZP0T 1T0NB 2QBWA 1T5XB 4Y4FC 3KPQB 1MCIA 4MD0B 4G6MH 3TCXA 3MGAA 4NO0D 1IGTB 2H3NB 5CSGA 4X7FC 1OD7A 4IRZH 4G6JH 3MRKA 1NL0H 4Y5VB 2FX9L 4JCMA 3RI5K 2J8UB 4Z7VB 1EJOL 3F62A 3K8LA 1UWGL 5KVFL 2K7PA 3IKKA 1EVUA 3NIGF 4XMLH 4MXVF 3QI9D 3UXFA 4MB4A 5EPMB 3OJ2C 4XI5C 1IKFL 2NW3B 4KKBD 4U6TA 1JGVH 1JTOA 2V17L 1WZ1L 1EHAA 3HNSL 1MCRA 4Y1AA 3KPSE 3MO1B 4KTYA 3LKOA 4PR5B 3HFML 4M4PA 2XTJE 3CH1B 3T2NH 3WKNA 2CKBB 1Y6NR 2BVQB 1U8IA 2MNUA 2LU3A 3BUYA 4HK0A 1G9NL 1GL4B 1OL0A 3JV6B 4HWBL 1ZS8B 2BVYA 4HIXH 5EC1B 4J7RA 1ZHNB 2BY2A 2G9HB 4GXVH 1KBGH 2R1XA 5CS7A 3JVGA 3H9ZA 1YEEH 4CVWA 5EG6C 4UMGA 2OI9C 3OPZH 3ZYJA 1JNNL 2VQTA 3IJHA 3IGAB 3H3KA 5E2TL 5A2JH 3TO2B 3C5ZC 3QIBA 3WJLA 4KDTA 3CFEB 1V7NH 4BFEA 4F57L 3RDTD 1JZ4A 3QUXD 1AQKL 2HVKA 2O5YH 4M7JH 2VDQL 3ULUC 3MLYL 1BOGB 3A6BL 2J1KA 3CVIL 3MLTA 4KJWC 3RKDC 3V8OA 3KXFA 3RUGF 3S5LG 1EHNA 4YDIH 12E8H 3BP7A 3QHZH 3TH3T 4XBPA 1FAIH 1XH3A 2WIIB 3VWKD 5B39G 3L5XL 4HZLA 1BX2A 2HFGH 1N5YL 4JN1L 3QNXB 1PLGH 2XIDA 3ES6B 2FDBP 2ZUTA 4RWYH 4B5EA 4G6AC 5JOFA 4X7DC 3WIIL 1KELH 4YC2C 4ZFFB 1Q1JH 3JV4B 1MH5A 4JFHD 3H3PH 3MZGB 4P5TC 4X6EB 2XQYK 3IETB 5DQ9B 4ZTPL 3REVA 4C59B 1LO3H 1IQDA 5E6IA 4KWUA 1I7RA 4PRPD 5HYQB 3BEVB 2DWEA 1TTUA 4NM4H 2N4IA 3KWWA 3U9PH 3TIDB 4IIQB 4E41B 3UC0L 2X70B 3ZT6A 1J7VR 5HHOE 5HJ3A 3LCYA 1K8DB 4KUCD 2OTWB 4P4KC 2QADD 2XI9A 1R3IH 4OZFB 3FN0H 5DDHA 3WSQH 4F7CA 4L3ED 3M07A 3IDIB 3I3BA 5JXED 5CP3H 2PXYD 3MBEC 3NH7H 3OAZH 4U05A 1AGFB 1NKRA 2O26U 4JRWA 2X41A 1C12A 3MCLL 1CCZA 1Q9LB 4MXQD 3PQYD 3VXNA 1TCMA 1NCAL 1P7KA 3CFDA 3DYPA 4M02A 3RL2B 5IBLD 1AGDB 5KS9A 3D25A 2R2CA 1RULL 2EDOA 4Y2DD 5DJYA 4KHXH 3GNMH 3V4VL 3BN3B 1L0XA 2XV6B 5EWIL 2GSGB 4PRDA 4XP5L 1F6AB 4PJDB 4QRSA 4YGAB 4UV7L 3FO2B 4WU7A 2VAJA 2NY5L 2XWBA 3LKRB 4P4RB 4N90D 1J0HA 1Q94B 1MHEA 1CLOH 1PVHA 3SCMA 4RAVB 3IU3B 3BFOA 4QHMB 4YBQC 2HKHH 5E8DL 4PJ5E 1CD9B 4FFYL 4R90H 5E99H 2UZIH 1A1NB 5EU6E 1AXIB 1UXWB 4PJ7B 4X6CF 4Z9KB 5CJ8A 2F53B 1MEXL 4EEEA 4HH8A 3CFIC 3MLUH 1S9VA 3VXTA 1WBYB 3CDFA 5ADPH 5F3HB 4U2ZA 1TJIH 2Z91A 1RZ7H 3B9AA 4RISH 3TBYA 3D87B 4JDVA 3L6FB 4X9BA 3CLFH 1FC1A 1EIBA 4YHPB 1N8ZA 1QRND 4IS6A 1FP5A 4TRPL 1HI6B 3HE7B 1I1YB 2CUIA 4Y4KD 3AY4A 4EI6B 2NXZC 5F6IB 1NGPL 5F44A 3BSZL 5E8OA 2BXYA 3U36A 4TTDC 5D7LE 4I0KA 5T3ZL 5MHSE 4BZYA 3MRQA 3QCVH 3BPLC 5EA0H 3B4NA 2AW2A 2G75B 5JW3L 3I6GA 2WLYA 3L3HA 3JVGC 1A02N 1NGXA 4M6NL 5FA3B 1LEIA 3DMMA 4J12A 3S35L 4WFFD 1AQDB 4ELME 2XFXB 5HYJD 1OTUC 3QUYD 1G7MB 1GGIL 3QIBC 3WJLC 4KDTC 3MODL 5CZKA 2H26A 4KKAC 5KSBF 5CWSB 3W11C 1UEMA 2V9RA 3ABZA 1OQOA 3MXVL 1HXMA 2QHLA 4JAMB 1AGCB 1RUQL 4OQ1A 1U6AH 3EJYD 3L3KA 3ZKQD 3CFJB 2N7BA 2YBRB 4M03A 2WWMD 3R8BB 5HVHC 4HGKC 5EZIH 3OHXB 1GZPA 3FZUD 4FXGA 1GOHA 2YA1A 4TVPL 2PYEB 3BKYH 1ODAA 4NKIH 4XC3H 3V0VA 5I8KH 3SDCD 4KH2A 4A6YB 4JFOA 1NCWL 1ZWIB 4UQ3B 4LCCA 3B43A 4MMZC 4XNXH 5IFJB 2A74A 1QBMH 3TYGH 3W2DH 4MA3A 1GGUA 2N7AA 1FNEB 3TN0D 4EUPG 5E6IC 4CL7A 1A64A 1C5DB 1QEWA 3EO0A 1HHHA 3TT3H 1DANT 5DUML 4KROD 2AQ3A 3F7YA 5MEOA 3DHJA 1ZV5A 1TCRB 2Y36H 4G6KL 1D5IL 2AJVH 1IAIL 3K81A 1E6JL 2XG5A 1J8HD 4P46A 3T4AB 5F72S 3MV8E 1JGDA 3L7FA 2VLKB 3C6SB 2CD0A 5ISZB 4WHTA 2GK2A 3S4SG 5TDNA 3NCCB 2A6JB 3MLXH 4CRPA 1TZIA 4HPYL 1I7UB 4PJ8B 5FKPB 6FABL 2A83B 1BHGA 4JVWA 2EIBA 5TPWH 1VPOH 4LGRB 1I8MB 5FHAL 3JV5A 2YRLA 4HKJA 4WNQA 3DSFH 5HVWA 3VG0H 5C9KA 4FNLH 3KYOA 1MCHA 4HS6A 5F6HI 3OTTA 3O6FB 3WIFA 2X4SA 3BJ91 2W0KA 3D48R 1U2HA 4N8CH 3KPSA 4JR9H 5F88A 4QRUB 1MHCB 5FGCB 1OGTA 3CXHJ 1P4IL 3AVEA 3WD5H 3LEVL 1JP5A 3D3VB 4O2CA 2DQCL 5BVJB 2W65B 1XGUA 1JZ8A 3IU4H 2W59A 4JFED 3T1FB 4MDIB 4V2BA 5AEAA 2BY3A 4UU9A 4R97C 1MJ8H 5D96B 4E0RA 5I1DA 4QYOB 4WDIA 2ZUXA 3KYKL 4FQ1H 3ARFB 5DMYA 1VA9A 2OCFD 3B9KB 4M1CC 4YXKL 4HJ0D 5CBAB 2GYSA 2N1KA 1CDUA 1FVEB 4JO4L 4OM0L 1MQKL 2VDPH 4FABH 5D8JH 1LK3H 2DQDL 4P5MB 3BVNA 5B3JE 2GK0A 3QUMH 1N59A 2WQRA 5CILH 1NKOA 3FAWA 5EOTA 5FUOL 3N1QC 5HHVH 4MNHB 4Q0XH 5F7DA 4JE4B 3RWGB 4WEBL 5GS1B 3ARWA 1WQVT 3AY4C 3MRLB 3PGFL 3TNNB 2CMRH 2W9EL 5BV7H 3ORJA 4I2XB 2WBWB 3EFDH 2JELH 1YYLL 3V4PL 4HJJL 2FB4H 3BGMB 4M9OA 1NDGB 4MCYA 4F15C 5KJRL 2WWKT 3PHOB 4UIMA 5JPNA 1U8QA 5CJOL 3BH9A 4RGOL 3LZFL 1F4HA 1MI5E 3MV9B 4XVJL 4JKWA 4AEHH 3STBA 1PX4A 2J8UE 3BQUA 5I2IB 3DMMC 2QSCH 3MA7B 1W0YT 2V2XA 5IIEB 4YNYA 2RB8A 4L29B 2HT2D 1YJDL 2F54B 3QSKB 4Z7WF 2A1WL 2EH7H 1FG9C 1SHMA 4Z7NF 5HDLA 4W6YB 1G7IB 1JGEB 3DO7B 1MREL 5HHOA 4M5ZL 1PEWA 3ZKMD 1XF4B 4QNPF 5LGJA 3QWOA 3RPKA 4YHLL 1BZ7B 3MR9B 4CDGC 1OSPH 1P7QD 1KJ2A 4Y8AA 2P5WE 1HINL 1XF1A 1AP2B 2YD7A 3FB6B 4KJPC 1BQLL 1CBVH 5DI8B 3Q6FA 3KPNB 4NFBA 4WUUA 1J9CT 2O61B 3RWDA 4HKBA 2FH8A 3GRWL 5F93C 5GZOC 3QXUA 2JK5A 2DMKA 1EEZB 3IT8D 4XGZB 3JTSA 3P30L 5D7JA 4LCCC 2FBJH 3GSQA 4IJ3B 2D7MA 3OKEA 2D9CA 2B1AL 5GXBB 2C1OB 4FQCL 2EDJA 3HUJF 5JW5A 1VADA 4OZGF 5EU3A 5GRYA 4FQXA 5DRXA 4BKLB 3SDXB 5D1XC 3R06B 2AI0H 1DQMH 5JIHA 3IFNH 4F37K 5L88L 3P4MB 3I85A 1MHPL 4P5KB 4K8RL 3GSUB 1IEAA 2W38A 4P2OB 1A6AA 3C5JA 4LFHG 1MCOH 1R5IA 2E5EA 1JWUB 3ILPA 4U1LB 2YD8A 4HG4K 4XMPH 4QTHA 1ZHLB 2YZ1A 1T04B 4NCC2 3O3AA 5J11B 3W9DB 2GJZB 2OJEB 1MFDH 4PJ5A 3B9EA 5DFVC 3BXNB 3BPCB 3RVWC 1RVFH 1KJ3H 5EU6A 2EDEA 2MSPA 3CZFB 4L8DB 1N5AA 25C8L 1L7TL 4XCCH 5J6GA 4DWHA 1MCPH 2ICCA 4U1KB 2ADJA 3O3BA 4U49A 4XVTH 3BD3A 4OUUB 1AKJA 1H8NA 3F6IA 3QNYB 1LD9A 3V7MA 5EIIA 3SKMB 1ADQH 1JNJA 1T1YB 1NLBL 4E41E 1YEJH 4OZHE 3DX6A 4KU1A 4NKDB 2XTJC 3C60A 1GRWA 1U91A 5HGBA 5D7LA 2X7LB 4C55A 2Q76B 1S7WB 2VITA 4TSCH 2OSLA 1CT8B 1A8JH 5DD6B 4CADB 3MLVH 5AUMA 3QQ3B 1XR8A 4FZEL 2LVEA 2IBZX 1A7QL 3NA9H 4TUJA 4URTB 5T3XL 1ULVA 1IGYB 4MCZA 3SPVA 4CNIB 1EFXB 4AY0A 4YDJB 3K4DA 4ELMA 4GAJL 4LEOA 3T0EA 3CDCA 3AM8C 2DDQH 1EERB 4LRNL 5DQDH 4JG1H 4XP4H 3X14A 4G6FD 1P6FA 1Z0NA 1VFBA 4FFZL 5F7LB 2WINA 1I1FB 4WI6A 1CGTA 1PX3A 1A6UL 1CGSH 2HG5B 4TOYL 2GT9B 2NY4C 4WO4C 4PJDE 1JHTB 1LO0L 5ESAB 3KPPA 3KJ6H 2LU4A 2WUBL 2XKSA 2H1PL 4JANA 1JF6A 1KB5A 3T0AA 1BAFH 1RUAH 3F7VB 3G6AB 1MIML 3ROOA 1FNGA 3BH8B 5MI0C 1S7SA 2J2ZA 2FH6A 2D7QA 1IM3A 2EDHA 5EO9B 1ZTXH 4OCSL 3OKLA 3VH8G 3DVGB 4AT6B 2L0DA 5K59E 4PJ7E 2ATPB 3BQUC 4GO6B 5C0JB 1S78C 3Q3GB 5JUEH 2D0FA 4YDLC 4NHCH 2QV2A 2O5ZL 1FORL 2YD2A 3ROLB 2VQ1A 5E9DB 5D1ZA 4Z95L 4QTIH 4RGNC 1YDPB 4DKFL 4PJHB 4G3YL 2V5YA 4NC0B 4EKXA 5C2BH 1TFHA 4QHUA 5L8LB 3GMPA 3SE8L 4OGAC 3FN9A 1CU4L 4OB5H 4P2QD 4YHYC 4CJ1A 5CEYA 1YPZE 2Y5TB 4DTGL 5CD5D 1TQCB 3PWJB 4NQCD 4JHZA 3MV8A 1A6ZB 1M7IB 5C1MB 2A6DA 3OKDA 5M7QA 3JWOL 5D1QA 5J1AA 4XWGL 4NKMA 1PY9A 3PWLB 4OSUH 4PGDA 3TVMB 4E5XA 3BKCL 1VGEL 1AY1H 1KT2B 2DQFB 5BOPA 4NYLB 4TPRH 2DLFH 5D7JC 3E0GA 2Q7YA 3RA7H 3DRQB 2BDNL 1NMAH 4MJ2A 1CL7H 2JIXA 3NPZB 5AZ2H 3MV7D 2CLVA 4GRLB 4H20L 4PRHA 5GGQH 3CFCL 4NIKB 1PY4A 4LHUG 2E8ZA 1JK8A 5F1NA 3OF6D 1WWWX 2R39A 2LAAA 3PDGA 4FQXC 4GUPB 1CVRA 4OGXH 2ZKHH 4NHUB 4LCUB 5KS9F 2OJZH 3RAJH 3O6LH 1F3RB 1OCWL 3NVQA 3QEGL 3O8XA 4GRWF 1TMCB 4ERSH 1HSAA 5KAQF 3RZCD 1ZSDB 3FQRA 4H25A 3GZKA 4G8IA 3NPSB 5GS0H 4HHAA 3DSNA 4U6HB 2A77L 2PYEE 3W39B 2Z93B 5CKGA 5F1IB 5I19L 4ZUTB 4JDZB 1OOAA 2HJLB 1KC5H 2VDLH 1KG0B 4JM4H 3SKUD 1HQ4A 2FGWH 4ZS7L 3VXMD 4GT7A 4I5BA 3HAEB 1NSNH 2EE3A 3NFNB 2FHFA 3U4AA 2AQ2A 4LSPH 3SOBL 5D2LA 1T0MA 1IT9H 1OM3L 5K33A 4WGVB 1CQYA 2QQQA 5IBTL 5INDA 3RWJB 5I8OL 3T65A 2AEWA 1T7VA 1RZKL 3ZKXB 3U83A 3K4ZA 3RWIB 3ZDZE 3TNMA 1E4XH 5IFAL 3GJFA 2RFXA 3DI3B 2JF1A 4Z0BH 4PB9L 2YPKA 4UDUA 1NAML 4I1NB 1PG7L 4QLRA 3C60C 2Z8SA 3GFUA 4JFPB 3MOBL 1UH4A 1UA6L 1T0NA 2E9IA 2R29L 4R4NC 3VJ6B 1T5XA 3KPQA 3ECBB 4MD0A 4HX1B 2OXGA 5JOEA 4OF5A 1IGTA 2H3NA 2VLKE 5ISZE 1RURL 1T7YA 2HRPH 2YXFA 2OL3L 1GC1L 4Y5VA 2J8UA 4Z7VA 4F58L 4IHOB 2R15A 3CPLB 2APFA 3JWDC 3QAZB 5TH2B 2ENSA 4ZUWB 4XX1E 1A9BB 2NY0D 5EPMA 1JCKA 4OLVH 4K7PX 2NW3A 3WNOA 4ZMAT 5ID0B 1IKNA 4QY8B 5IV2B 3BW9B 3MO1A 2IPTL 5IGXL 5FGCE 3NTCL 4FQHB 4PR5A 2F9BT 5A16B 5MENE 3CH1A 3GHBL 2CKBA 2R0WL 5CFHA 2BVQA 3HHRB 3JV6A 1ZS8A 3DURB 1PEZA 3D3VE 4YBHA 2P5ED 4PTTB 1ZHNA 2YOCA 2G9HA 1VHPA 4DKEL 5BJTB 3QDJD 3CVHH 1BF2A 4NQEB 2VDRH 3IGAA 3QIWD 3V52L 1TVBB 1MFCL 2O5XL 2R4SL 3TO2A 5SX5K 4KVNH 2DIBA 3CFEA 3LMJL 1Z6JT 1JI2A 4CU6A 3TCLB 5D1ZC 3GSVB 2CH8A 4JQIH 5GRVK 5KOMC 1YNLH 1OGAE 1HQRB 1BOGA 5DJ2B 1F4XH 1Q72H 1ZGLB 4N1EA 3QFJD 1CICB 4RAHA 4XNYH 4I2XE 4QGYA 2WIIA 3O2DL 1N2RB 3KYMB 5D1QC 3PGCB 2ZUQC 4M6ML 3RVTD 1FNSL 3ES6A 5KVEL 1KUMA 4ODVH 5FYLL 1YNTB 4ZFFA 3KPTA 3JV4A 4LSQH 3K80A 5HDBF 4X6EA 5I1LA 4G8GB 4OCRL 3IETA 4AG4L 5DQ9A 2BVEA 3N50A 5F8QC 4L4TD 3WFEL 1J1XL 2F54E 5HYQA 3BEVA 4O5LH 2FCBA 4TVPE 3UTSE 4MAYD 3TIDA 2COQA 3JV0A 3OGCB 2PUQT 4IIQA 1KTKE 4E41A 5JXAL 3QP3A 4JB9H 1BLNA 4LGSB 1IILE 4KK8D 3WXWL 2X70A 4HWEL 4NSKA 2XKUA 4JKMA 3O8XC 1K8DA 4I48B 4P2RE 2OTWA 5CZXC 3EOTL 3IB4A 4OZFA 4LP4A 3IDIA 4WHYH 1YEHL 3P11L 4HUNB 1GPOL 4P9ML 2F5AH 1ZLWK 4R0LB 3X13B 3BDYL 3VFSB 4OFIA 1Q9LA 4KRPB 5D6DC 1E28B 1W72H 2J6EH 3C8HA 3DGCR 3AC0A 3RL2A 1AGDA 4IDJH 3SO3C 2EXYC 5IKCB 5CIPB 5JQHC 3TP4A 2NY3D 3S3PA 1U9KA 4HH9B 1PZ5B 2NLJB 3L5HA 4XMKL 1B0GB 3ARGD 2GSGA 2ED8A 3SDXE 1F6AA 1R3JB 1BD2D 3UTOA 3FB5B 2OL3B 5GRZA 1TPXB 2AKRA 3FO2A 1T03H 2YPLD 4P4RA 3O4LB 3LKRA 5GRVL 4PGZA 1ZVSB 3S36L 3VXUB 4BZ1H 5I1KL 4NRYB 1XGYH 1J1OL 3MRBA 2HKFL 3MUHL 1I1RA 3C2AH 3BIKA 4RAVA 4JRYD 3IU3A 2ZUUA 4O58H 4QHMA 2ZNWA 2BRQA 2BXZA 2EC8A 5IW6B 2JTDA 5ITFB 1HSBB 4R26H 1NBYB 4ENED 4PLKC 1A1NA 4PJ7A 1UXWA 1BQHB 2G60L 3KYAA 4GQ9L 4Y5VC 4HWUA 4CN6A 4XPGL 5E8NB 2F53A 4DN3L 3PL6B 1WBYA 1QBBA 5F3HA 3DWTA 4HWBA 3CD4A 4K71B 3QYCA 1JZ3A 4FQJH 1OPGH 3P0VL 1HHKB 3B83A 3F58H 1YNKL 3WKMH 3GMRB 4YX2H 5DUPH 3OZ9H 1IKNC 4YHPA 4H0GA 2VL4A 3HG1D 3HE7A 1HI6A 2Z35B 1I1YA 4PJEB 3TGXA 2WW8A 1IGML 4EI6A 5C0DA 4HQQH 4Z7UF 4M7KL 3EOAB 1ZVHA 1CFQB 1OTTD 1YYMH 5IB4B 2C4FU 3WNMA 4YO0B 3WIHL 2IQAB 4H8WL 3K46A 1BZ9B 4MNQB 5CJXC 4HAGA 3QQ4B 4G5ZH 2B1HL 2G75A 5I1AB 4JFYB 5FA3A 4X6DA 5IQ7H 3D9AL 1AQDA 2A6KB 5FHBH 3DGGB 4UIKH 2HT4C 4HIEB 4GAGH 2R56L 4UZGA 3BYYA 1YEIH 3EJZD 3PUCA 4JHAH 1VFMA 4YHOH 1FGVL 3IDUA 2VXTL 4WI4A 4K3JL 4OFVA 5B8CC 2FX7H 2HTLC 3VWJB 5LQBL 5ALCL 5CWSA 2DKSA 2EYRB 4XXDB 4JG0L 2NR6D 4OKVB 4JAMA 1AGCA 5E8PB 3CFJA 2YBRA 5JR1H 3OHXA 3W81A 4DN4L 3MOQA 3G6DL 4WUKH 4B0MM 1RIHL 2OZ4H 2PYEA 2B4CL 4OT1L 1YEKH 1A4JB 5GGRB 2XZZA 5I18L 5A2KH 1D6VH 1NJ9A 2XA8L 5I71B 1JPFB 3ILQD 1KLUB 4A6YA 1ZWIA 4UQ3A 1KTRL 5IFJA 2YUWA 2DTSA 1MUJB 2VZVA 1EEYB 1FNEA 3VXPB 4JKKA 4MD4B 5E9DE 1JWMB 2YN3A 5HDQL 1NGQH 5CEZH 4IIQC 1EGJH 2Y06L 4APQB 3IDGB 2ZCKH 3U46B 1YEGL 3C09B 3TJEL 1G7JB 3KPRB 4DW2H 1TCRA 3QPQD 5HYEA 2JE8A 3C6LD 1AXSB 4HFUH 3ZT7A 4WWKB 3MMEB 4M62H 4RDQF 3T4AA 4ZPTB 3I02B 5C3LD 4X4ME 2VLKA 3C6SA 5ISZA 2CIKB 1G0YR 2A6JA 1MHHB 4TSBH 2X4TB 4N5ED 1I7UA 5BS0B 3VFOB 4PJ8A 5FKPA 5FM4A 2A83A 3HE6D 4KJQD 1I8MA 4FOMA 5KVGL 1D6EB 3MUGB 1JFQH 4JZNB 1KOAA 4U31A 5K9JL 1ONQB 3BUTA 5MERB 3DRTB 3N06B 4ONFH 5JA9A 3BN9D 3O6FA 3PWPB 2Z31D 3LEXB 3H42L 1FRGH 2VZUA 4QRUA 1MHCA 1BFSA 1JN6B 2AJUL 1LK2B 1XZ0A 4BJLA 1CFNB 2YPVH 1NBQA 5JDJA 3BWAB 3C8KB 4QHKJ 3D3VA 5BVJA 2XXCB 2W65A 3IVKA 3T1FA 4MDIA 2HFEA 1JVKA 3JXAA 4DGIL 1F11B 4OAWB 5ICZB 5IESH 4QHLB 2ID5A 5DHVH 3NACL 4QYOA 5D70H 1EJOH 3TYFB 5SWSD 2R1YB 4YHZH 3ARFA 1IAII 1UWXH 5CGYC 5JDSB 2J7LA 1KPVB 3VFWB 5CBAA 5L9DL 1MRDH 5T1LD 2EICA 1RZGB 3T04D 4LLQB 1FVEA 1G9NC 2PW1B 2A9NL 1IQWL 4YWGL 2EECA 4P5MA 4K23H 1WZ1H 2DQIH 3HNSH 1QHOA 5BZWB 3IFLL 2FHCA 4MNHA 2XN9D 3RWGA 3HE7C 3MRLA 1NFKA 2DQHL 2FJFB 3TNNA 5F6IC 3AGVA 4I9WE 1QYGL 4JFDD 3A0OA 4I2XA 2F8VA 4KDWA 1FYTB 1TLKA 1CXKA 3BGMA 2IAND 3SQOL 2YXMA 3PHOA 4YGVB 1CXHA 4HBCH 5K9OB 1Z9MA 3MV9A 5DC0A 3TBSB 1Y18B 3ZTNH 3GIZH 3OG4B 5KVDL 3MA7A 5DD5H 3BESR 5EUKB 5E2TH 2X1PA 5IIEA 4L29A 1S9YB 4OKDA 2F54A 1EJ6A 4F57H 2ZPKH 1I8KB 3E8UL 5D2NE 1G7IA 3MJ9A 3O9WC 5JLZB 2JCCF 1JGEA 3M17A 3DO7A 3QXTA 3LD8B 2LTQB 1XF4A 1UXSB 3MR9A 3LKPB 1FVDB 2VDML 3IFOB 4NWTL 3HPLB 4GW4A 4BFGA 1AP2A 1KXVC 4U7SA 3FB6A 3BKJL 4GW5A 5DI8A 3KPNA 3VDBA 1JI1A 2O61A 1RQ5A 2IGFH 1U8OB 3WIIH 1WJ3A 4XGZA 1EEZA 4MQXC 3RWCB 4K3HA 3KJ4B 3BT2L 2C1OA 1WIOA 5BW7C 3M8OL 4BKLA 4P99A 3SDXA 3R06A 1N64L 3K2MC 4GFTB 5ERWB 3UC0H 4ZO9A 5HI3C 5DHVB 3STZB 1AI1L 3P4MA 1A1OB 4P5KA 2X10A 3GSUA 5EH1A 5DJCB 4P2OA 2VL5B 4X99B 3NCEB 4QRPD 1JWUA 1PBYA 4U1LA 2E27H 4DGYL 4LSTH 3QDHA 3SE4C 2FJGB 5FCUH 5D2LF 1T04A 5B3JF 1A3RH 1WCBB 2C7UB 4WI5A 3V5DB 2AEPH 3W9DA 3MCLH 5C0BB 1ZAGA 4YHNB 2GJZA 2OJEA 3QEQE 1CXLA 5LXGL 3BPCA 3G6JB 3GI8L 3O6MH 4KY1H 3T3MF 4FN0A 3CZFA 4L8DA 3RZWA 1BECA 4WCYL 1RULH 5D7IE 4PJ8C 4U1KA 3V4VH 2I24N 1BFTA 1BZQK 3PP3K 4G8GE 3SDYL 3DARA 4NQVB 4OUUA 1RFDH 1WBXB 1RU9L 1D9KD 3LB6C 3QNYA 2IH3B 1FG2B 4HS8L 3SKMA 4NJAL 3O6FC 3V5KB 2PTTA 1T1YA 3LAFA 4Z7VF 2EE2A 3I84A 2IMNA 2NY5H 4KZEL 5ICXB 3U30B 4TYUA 3IDXL 4NKDA 3DNKA 2CR3A 2BHZA 1MVFA 2IC2A 2CQVA 5DA4A 1BJMA 2X7LA 2Q76A 4PGJA 5M94B 3OGOE 3NCYP 1CT8A 5DD6A 3FO0L 4CADA 3QQ3A 4RFEB 4FTVB 2OP4H 1MFNA 3O81A 1IGYA 2D31B 4HUXB 4JFFD 4QGTA 4CNIA 1EFXA 4FFVC 3ARFC 4FG6D 4GSDL 4YDJA 1T2QH 2JJTA 4KAQL 3B9KC 2DQGH 3QWRA 4PRIB 3TN0A 4G42B 4QF1B 3FQNB 1F4WL 1I1FA 5KOVC 2GT9A 4ZDHB 1JHTA 3UTPE 4IOIB 3FB8B 4K94L 5ESAA 5E00B 1NANI 1NGPH 3QPXL 4N1CA 5GS1C 3MNZB 2ZUWA 2AP2A 3F7VA 3G6AA 3D39E 4NO0B 1UENA 4ZFGL 4R2GD 4U1IB 5J3HC 3CAFA 3QXDB 3BH8A 5F1OB 4HUKB 1C5BH 1J0KA 5JW3H 5E0QA 2DD8L 5EO9A 2IQ9L 3H7LA 3WO4C 4HLZH 3DVGA 3MROB 4AT6A 3HNTL 2BRRL 3S88L 1TNMA 2ATPA 5JPMB 2Q87A 4I77H 4UT9L 2D3VA 3LKQA 3Q3GA 3L3OB 5E08L 1GGIH 3QB7C 4O51B 4ETYA 5GJSL 3ROLA 2QKIB 5E9DA 4QRRD 5T1DL 4MXWH 4FQIL 4MA1B 1YDPA 5I30L 4PJHA 3RGHA 4XNZC 4CU7A 2ITDB 1RUQH 3GRWA 5EOCL 3U7AA 4Q9QL 4PJEE 5DGQA 5LVEA 3JWNC 1UM4L 4XZUB 1U3ZA 4IRSB 4PIRF 2UZYB 3TV3H 2Y5TA 1MLCB 3PWJA 4ZXBD 5FV1L 4RMQA 1P4BH 5EUOF 1M7IA 1BFVH 4X4MA 3WFDL 1OLZA 2E9WA 2HLFC 1MCWW 1T66D 1K8IB 4MNQE 1OP5K 3PWLA 3TVMA 4AM0B 1KT2A 1NCWH 5KSAD 2DQFA 4PY8J 4NM8H 3BRGC 4NYLA 1FFRA 1H0DB 3UTQB 3DRQA 4IJ3C 4MQSB 4P3CL 1E6OL 4FMKA 4L1HA 4GRLA 4ZSOB 1EVTC 4DGVH 4L4JA 1DBJL 1K2DB 4GUPA 4LK4A 3UX9B 3ZL4L 2J4WL 4NHUA 3EZJB 3LQAL 4LCUA 5DQJB 1JTTA 3EHBC 4LSVL 1CL7I 4OGZA 4HC1L 4IOFD 3HMXH 4P2OC 3K8MA 3AROA 4ZYKB 1BBDH 1ZT4B 5DJ0B 1TQBB 2VXUH 3NAAL 1ZSDA 1UB5B 1FNHA 4EN3D 3OKNA 4AZ8A 3MSPA 1V3KA 5J11C 4U6HA 3QDMD 2ED7A 3NCJH 4GKNB 3W39A 2Z93A 5F1IA 4ZO8A 3RIFF 4ZUTA 4HPYH 4JDZA 2HJLA 6FABH 1KG0A 2J5LB 3G5VB 1FH5L 2DN7A 2FLBT 4RFOH 5E5MB 1YMMD 3QCTL 2WBJC 3PV6B 4HFWB 3HAEA 1CDYA 3NFNA 4PJAF 4X8XA 1QSEE 3BHBB 4KKCC 3UP1A 3RWJA 3JZ7A 4QXUL 3RWIA 1J11A 4PJ7F 5J0BA 4FFWD 5B4MD 4LFHD 3BDXA 1OAKL 4TUKL 4RBPK 4JN2B 4Y19B 4NZRL 3LEVH 4L3AA 1WWCA 2HH0L 4G9FB 4JFPA 3ZE2E 1U36A 1E4XI 3ARXA 3VJ6A 1I7ZB 3FONB 3ECBA 2AK4B 3EFFB 1IM9B 4HX1A 1S9WB 3K3QA 5KTEL 3K1KC 4XAWL 2QQLL 4KK5C 3KYKH 1T7XA 4L4VD 5TFSH 1OT2A 3I3DA 3QIUC 4IHOA 5IM7B 5BS0E 5JZ7C 3CPLA 3EUUA 4YZFF 3I75B 2VLME 1A0QH 5TH2A 4ZUWA 1MQKH 3MLWH 3DECA 1A9BA 3E1F1 2XQBL 5CLWA 4MVBC 3WO3B 4M3JA 5ID0A 3PWPE 4XI5D 4QY8A 4X6DF 5HVGB 3FFCB 4F7EB 3T0VA 1NCCH 3BW9A 1G7QB 3PGFH 4FQHA 4F9PA 5A16A 3B5TA 5J1SC 4I3SH 3V4PH 4HJJH 1BREA 1KF9B 4D3CH 3DURA 1MAML 1JE6A 5CAYB 4PTTA 5KJRH 1CI5A 4UOW1 4PJBB 3LZFH 5BJTA 5D6CB 5C08D 4NQEA 1YC8A 3RI5F 3RVXD 5CINL 3MTRA 3MUY1 1TVBA 1KNOB 4ZO6A 1YJDH 3K7UA 1QNZL 1JNHB 2A1WH 3X3FL 1ZLUK 4FA8A 1NGYB 2VXQL 2BCKB 3TCLA 4WTZA 3C5ZD 4Y0GA 4KKNA 3ZLQC 4O4YL 1X5YA 3RWHB 5DEFB 4OBRA 3ARUA 2VLJB 1REIA 4M6OH 3AREB 1HQRA 3IAGC 4PJGE 5DJ2A 1G9MH 3O4OB 3ULUD 1CGVA 1ZGLA 2VZOA 2EC9U 4KJWD 1CICA 1DQDL 4EIGB 1TQCC 1S7VB 1FYTE 1N2RA 3VFVB 4OZFG 1BEYH 3KYMA 1I4FB 3PGCA 4HCRL 2IBBA 3GRWH 4HT1L 1A7PH 4K8RC 2ZCLL 5BXFB 1YNTA 4YXLL 4RMSA 4YEFA 3ZT5A 3O11B 4G6AD 2B1AH 4MS8C 4DUXA 4G8GA 1QSFD 4P5TD 1KN4L 4I4WB 4GRLC 5L88H 3NZHH 3OGCA 1P1ZB 1QTYT 4OLZL 1IC4L 1E4WH 3G9AB 4I48A 4RIRB 3EO9H 5J9PA 1JZ2A 4UQ2B 2BFVH 5I1CL 4P4KD 5GRUH 4ODWB 5C9JB 2BHYA 3SE9L 4R0LA 3SDCB 3X13A 2XWTB 1IGIH 1MFBL 3VFSA 3W0WE 3JTTB 3UYRH 1E28A 3GSNL 5ICYB 1L7TH 4HGWA 1QSVA 4N0RA 3LRSB 4XCNB 4PJ9B 4JVUA 5C0IB 5DVNA 1JTPA 2X4RB 5IKCA 3MRNB 1BOYA 4XPHL 1FCCA 4W70A 5CIPA 1PYWB 3ULVE 3EOYG 4HH9A 1PZ5A 4ZFZB 2NLJA 4LHUD 3FOLB 4I8DA 1B0GA 2WV3A 2B0SH 2FECL 1R3JA 3N1PC 3OX8B 3FB5A 1DCLA 4FXLA 3ZKXC 2OL3A 1OP3H 3O0RH 3KHOA 3LHPH 1XIWB 4QOKD 4NJ9H 3MREB 4JY5H 3O4LA 1A14L 4ZTOH 3VXUA 4NRYA 5DURD 5L2KD 3SE3A 1H9VA 1MWAB 5JHDB 4PGCB 4NN7C 5IW6A 1CLYL 1C7TA 3KPOB 4YBQD 4PGEB 1HSBA 2GEEA 1A7OH 1NBYA 3OKYA 3QHFH 4PP1D 5CBEB 1BQHA 2EDQA 5DWUL 1IEHA 3ULUL 4LRNH 5E8NA 3QAZC 2RBLA 3AUVA 43CAB 3PL6A 2WUCL 3I50H 1NAKL 1T21B 1HHKA 4FRWA 5C09E 5DD0L 4DAGH 3GMRA 4YUEL 5D2NC 4XH2B 1Y0LB 2DTMH 2Z35A 4PJEA 5J56B 2PR4L 4QXGL 1MPAH 3VCLB 4F9PC 2E7LA 2APWA 4Y1AD 3EOAA 1CFQA 1UJ3B 5DVLA 5IB4A 1NBZB 1MIMH 2NXZD 4UOW0 4YO0A 2IQAA 2H32B 4H1LA 4TTDD 2W60B 5C0CB 5IT2H 5F89B 1BZ9A 4MNQA 4GMSL 3EKCA 3QQ4A 1G0XA 5I1AA 4JFYA 4FTVE 1FLRH 4B50A 1JWSB 4LASH 4O02H 4R7DB 1GXEA 4RSVA 2A6KA 3DGGA 35C8L 1C08B 1FORH 4HIEA 4MZ2A 1DLFH 2APBA 4PRIE 2NZ9C 3LEYL 1ORQB 5ANME 3O2DA 5JORB 3L1OH 4LNRA 4YQXL 3QIBD 3ZSSA 3JWOC 4MQ7B 3VWJA 2DM3A 2EYRA 5L6YH 2VKXA 4XXDA 5DD1H 2ZSVB 3E6FB 4MWFB 4KKAD 4OKVA 3TFKC 3W11D 3FL7A 2ZG3A 2ZWLT 3L9RB 3SDXF 1CICC 2Q1EA 5HDOA 3KXFD 4HPOL 1MNUH 3GBNH 4Y5XC 5GGRA 1A4JA 4P57B 3DXAB 4FZ8L 4Y4FB 1J86A 5KW9L 5IWLA 1VGEH 2DLIA 3MGTB 1JPFA 1MF2L 4F33B 1KLUA 1QZ1A 2BDNH 4JQXA 5TF1H 4FQLL 2E9JA 3MOAL 4KMTH 4I3GA 1MRFL 1MUJA 1EEYA 2DBLH 3VXPA 4DQOL 3MC0A 2H8PB 3VRJB 4MD4A 5GS3A 2DYPB 3EIFA 4PRBB 4XX1G 4O9HL 4XC1L 5E6ID 1CGUA 5IVNA 3GSNB 1OCWH 2YEZA 4APQA 1DQQB 3IDGA 3BO8B 3U46A 1PW3A 3X12B 2VE6B 3KPRA 1JRHL 1JYXA 1WWBX 3ARVA 4C56A 5GISL 2QQNL 3RVVC 1B6DA 1AXSA 4WWKA 3MMEA 5FAAA 4ZPTA 3I02A 3V6FB 4R0LC 2CIKA 3ESUF 2VISA 5I0DA 1RZKC 4KRPC 3GUTB 1MHHA 3TA3B 2OBGA 2X4TA 3N1FC 5INCB 1KEGL 1NBVH 3VFOA 5BS0A 3CSBA 3SDDB 3GM0A 1X5XA 4Q9RL 1FIEA 3FMGH 3MRCB 3MUGA 2CK0H 5DJ8B 4JZNA 2HWZL 1OM3H 3ZKNC 1ONQA 5I8OH 5MERA 2Z4QB 3DRTA 1DR9A 2Q8AH 1EBAA 1X5ZA 3LEXA 1RJCA 5CUSH 3FB7B 5E4EB 2IAMB 2XG4A 1JN6A 1MIEH 4MHHI 1TPXC 1LK2A 2B39A 1NAMH 4RMTA 1CFNA 5HHMD 3SGDI 4AMKH 2GY5A 1FFOB 1T5WA 3HRZB 2FX8H 4AIZA 3B2UC 3MOBH 3BWAA 3C8KA 1UA6H 4LKCB 3DETC 3SE3C 2V2WB 3KGRA 3C5SB 3WS3B 4PV9B 4Q7DA 3HC4H 4K2UH 3ARRA 1RURH 3VH8B 1F11A 3LDBB 4JPVH 4OAWA 1GC1H 5ICZA 3H9YA 4QHLA 3TYFA 1AIFB 2R1YA 4JFHE 5BO1L 4ZAKB 5F7UA 2F15A 5JDSA 1KPVA 4WFEE 3VFWA 4BQ9A 1WVZA 5L7XH 1RZGA 1UKSA 4LLQA 3V0WH 2PW1A 2MWCA 3EYQC 4PBVC 3WIHA 2OS7A 1HK6A 2HT3C 2BVOB 2UY7A 3WFBL 4N0FB 5BZWA 1MJ7H 5LWYL 4U1MB 1AE6L 1GIGH 3DV6B 3GHBH 5TQ2L 2P8MB 3NCFB 4Y19E 3FN3A 1XGQB 2FJFA 3KYNB 2E7LC 1IAMA 4YFDB 1TETL 1X5GA 4G9FE 1FYTA 3CLEL 4PJHF 3MBEB 3PQYE 3OXRB 5JQ6L 2AK4E 4YGVA 5C0AB 2JJWA 2CRYA 1JUFB 5K9OA 4XP9H 4M5YL 1YECL 4OZIE 3TBSA 3V52H 2V9QA 4HK3N 1T2XA 1DBMH 5KSVA 1X6NA 4J3VA 4MB3A 5EUKA 2O5XH 4ZFOB 4LIQE 1S9YA 2LABA 3DMMD 3IAQA 2KZ1B 3LMJH 4ZOCA 4H1LH 4BH7B 5GJTH 1CZ8L 1RZJH 1A21A 1I8KA 5F1SA 5I16B 5EZOH 3WNNA 4KZDH 1V7ML 5JLZA 1G6RB 1W0VB 3VWJC 2DI7A 1K5NB 2AJSL 3FFCE 4N9OB 5JW4N 4PYGA 2QHRH 1MFAH 1H3WM 1UXSA 1HZHL 4N90E 4XCYB 4U6XB 3LKPA 1FVDA 1YC7A 1J1PH 3IFOA 1MY7A 3HPLA 3HLAB 4M1DL 2R0LH 5HHXH 1F58H 4M6MH 4KJPD 5FECB 5DT1H 5DK3A 4PJBE 2I5YH 5IWLC 1U8OA 1IAKB 4GLRI 5I71C 3WXVH 1BVLB 5L2JB 4K9EL 3IS1X 1TZHB 1GHFL 3QISA 5GZOD 4AG4H 3RWCA 4JQXC 1MY5A 2DJSA 1B9ZA 4XVUC 5IHUL 1DANU 1B4RA 4H0HB 1DBAL 4H0IA 4AQOA 2UZXB 5ERWA 2YZ8A 3STZA 1A1OA 2W0LA 3CSGA 5DJCA 2UWEB 2VLJE 4APQC 2VL5A 4X99A 2VZ3A 5EDXA 5JA8B 3C09C 2R1WB 1OAQH 3P11H 2FJGA 1CE1L 3WJJA 4S1RL 1WCBA 2C7UA 2V5MA 3T8XB 3V5DA 1IC5L 3I6LD 5C0BA 4YHNA 1KIRB 5EFIB 4GMTL 3EDFA 4PB0H 3TWCH 4K3DL 4N8PA 4P46D 3G6JA 3O45B 1CIDA 5DFVD 4QHKI 1KLGB 1R0AH 3RVWD 1RD6A 2C4FT 2FLRT 1ZT1B 4F80A 5LAXB 4AEIH 4XMKH 4NQVA 3HZKB 4ODHL 5F70A 1WBXA 2JB6B 4NP4L 4S1SL 3KPLB 2IH3A 2R2EB 1FG2A 3UTTB 3V5KA 5GSRB 2EH8L 4F37F 4OLWL 4Z5RB 1FE8L 2XRAL 5F7EH 5FV2A 3FRPG 5ICXA 4PYHA 4UT6L 3S36H 3KPSD 1ZK9A 3GMLB 2DS4A 4S1DC 2J8OA 4ZUVA 2XTJD 4PJXE 1MRCH 4PJIF 1JPGB 1K3ZA 4Z78B 2W9DH 3VD3A 1C7SA 3SJVB 4JGMA 5CSZB 4NQDB 4RFEA 4FTVA 1HILB 1EAJA 2G60H 4GQ9H 2VN4A 2A73B 2Q7NA 2D31A 1F4AA 4HUXA 1DTUA 4JZOB 4B53A 3HI5L 5DMIH 2CXKA 2KH2B 4PRIA 4PD4K 4G42A 1YNKH 5FGBA 1RY7B 4QF1A 2B8OT 2YK1L 2EDYA 3FQNA 1A7NL 2W1NA 1KB9J 5C0EB 4LP5A 4ZDHA 3EYUH 4JY4B 2R4RL 2BMKB 1IGMH 3BPOB 5E95B 3DI2B 2NY4D 3FB8A 4IOIA 5E00A 4XAKE 3MNZA 4OLXL 1UACL 1J0JA 5MEQB 1YQVL 4MLIA 4TTGA 1H3PL 4H8WH 4U1IA 5EU7E 3HNVL 2ARJB 1AH1A 2JKXA 3QXDA 5JHDE 1INDH 3F7RA 3MUZ1 4XPFL 4YHIB 4K3GA 1X3DA 3GSOB 3MROA 1KIQB 2E7CA 1TJGL 3QXVA 4YE4L 5JPMA 2PCPB 5LJYH 1A22B 1JHLL 1HXYB 1C5CL 3BQUD 1S78D 4O51A 2QKIA 4PV8B 5GQBA 1D5BB 2I27N 4K3JH 2AABL 2B4CC 3NFSL 4WI2A 4PG2A 4DZ8B 1NQBA 4JG0H 4RGND 2ITDA 4EDXB 4OF8A 3LD8C 4XZUA 4DN4H 5HHOD 4OGAD 5LBSH 4IRSA 4JFEE 1MLCA 1FO0L 4OI8A 2ZSWA 1Z3GH 5I18H 5DJDB 1JGUL 3MLRH 5C0CE 2CUHA 1K8IA 3PE9A 4WUUD 1CF8L 2EIEA 3RVUC 1H0DA 3UTQA 4TQEL 3S7GA 5IROA 3ULVC 3KJ4C 1LQSR 5D7JD 1FV1B 4ZSOA 6CGTA 2E7BA 4PLJD 1UB6B 1K2DA 4QXTB 1FC2D 4Q58C 4FQXD 3FQUA 3QNZB 5DQJA 4OD3L 3TJEH 3WNKA 4ZYKA 3PABB 1ZT4A 1ZLSL 5DJ0A 1T4KB 1TJHL 4U1NB 4J3OC 3WJJC 2XT1B 4DKAA 1P2CB 3S35X 1KCRH 2Y07H 3DXAE 4GKNA 4LARH 4H88L 3WCYA 3ZDXF 5F7YC 3OL2A 2BC4B 3MYJB 4PJ5D 3G5VA 1IAOB 4X83A 1YMHB 3TIEB 5E5MA 1H8OA 5D7KE 5KVGH 2QEJA 5EU6D 3AS3A 1OY3B 4HFWA 4YXHH 3QA3B 5H37G 4WFGE 5FUZL 2IJ0C 1P84J 3BHBA 3UPRB 3RNKB 1YEFL 2M1KA 4X7EC 2IFFL 3K2UL 3ISWA 4YH6A 3SGJC 1AKJD 5E2WL 2AJUH 4LDOB 2WANA 3VW3H 1UG9A 2QJDA 4JN2A 4TSAL 4Y19A 4LLVB 3U30C 3QUZC 2PTVA 1CE6B 3GBML 3OB0K 1DBBL 4OI7A 3VGGA 3C60D 3U7WL 1I7ZA 2J12B 2E6QA 3FONA 3EFFA 4GG8B 1UWEL 2GY7B 1IM9A 4R4ND 1S9WA 4CUCA 5D7LD 3MLPA 4LSRL 3WMSA 1M05B 4PJEF 3WV0A 4MLSA 5ID1B 3GHEH 5IM7A 2IPKB 3NIDE 4HXBL 3I75A 1QO3B 2NX5B 4NNPH 3QXWA 4LOUC 4J8RB 2YD1A 4WV1C 4WU5B 3T0ED 3FFDB 5FGBC 5BMFL 1A6VL 1WT5A 5EN2B 1RZFH 5D1XB 3IJSB 4KV5F 3FFCA 4WTZG 4F7EA 4MYWB 1G7QA 2I26N 5LGHH 1KFAH 1B2WH 5TQ0H 3FKUS 2DQTH 3SQOH 3CC5B 2Y72A 3FQXA 1GOGA 3EOBB 3BDBA 3OG6B 5JO5B 5C6TH 2NY2B 1SM3H 2MFNA 5KVDH 1T7ZA 3Q5TA 4W68A 4F8TA 1DP0A 1KNOA 5F9WC 1MVUB 1JNHA 1ETZB 1FO0B 1QRKA 1NGYA 2BCKA 3P77B 1WBZB 2X4PB 3BKML 3Q1SL 4MA1C 1FLTX 5D1ZD 5DEFA 2VLJA 4OI9A 4PG2C 2C3GA 3AREA 2XTLA 4D2NA 1PSKL 3FTGB 4WJ5B 1KV3A 1RIVL 2VDMH 4YBLB 4NWTH 4O00A 1YA5A 5HXMA 4IRSC 3BKJH 4LKXB 2BNQB 1S7VA 4GRMB 4PTUB 2Z0BA 3VFVA 2F19H 3ETBF 3ZKSD 4KXZH 1I4FA 2CIIB 3MV8D 2H2PC 5D7SH 5C0AE 1HHIB 5D1QD 3E6HB 5BXFA 1AGEB 1JMZA 2RQ8A 2XNAB 1C8PA 1JHKH 4BSJA 3O11A 4F2MB 1DN2A 1ZT7B 2PYFB 3RTQB 1EUUA 4V2CB 1CS6A 3MACL 2KKQA 2JIXD 4N9GB 4X80L 4UTAL 3R0MA 1P1ZA 5GRXG 4PRHD 3DX9B 1UZ6F 4Q97A 3CMOL 1PDKA 2D4FA 4WO4B 5DUBB 1V3MA 1U8HB 1JF5A 4RIRA 5IB2A 3JWDL 2OK0H 3O8XD 4UQ2A 4OLYL 1QLRB 1TQBC 7CGTA 4ODWA 5C9JA 2XWTA 3NABL 1FGNL 4X4XB 3JTTA 5T1MB 5ICYA 5AWNH 3LRSA 1EO5A 4XCNA 1NGZA 1QBLL 4PJ9A 5C0IA 3G9VA 2X4RA 3MRNA 2BNUB 2OR9H 1PYWA 3VFGL 2EXYD 1LDPL 1KB5L 3V6OE 1RU9H 4ZFZA 4KTEL 3FOLA 4NO5A 1PAMA 5DR5H 3OX8A 5F9AC 4U4BA 4UINH 5IW1B 2B20A 4P2QE 4R96B 1XIWA 2UWEE 3IDXH 2F5BH 5JXEC 1HIML 3NIFE 4DK3A 1A6WL 1KTLB 5D5ME 4IM8A 1GOFA 4YHYB 5HPOA 1X7QB 3I2CH 1QFWI 1BIHA 5JHDA 4TVSa 4PGCA 1NEUA 4DVRL 1GGBL 4LSSH 1UQSB 1YY8B 3KPOA 4YFLF 5DJXB 4PGEA 5IOPB