5DRNA

Context-independent anti-hypusine antibody fabhpu24 in complex with hypusine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
EEQLKESGGRLVAPGTPLTLTCTVSGFDISDYAMIWVRQAPGKGLEWIGIIYGGSNKLAYAKWAKGRFTISRTSTTVDLKITSPTTEDTATYFCARGYGSMDGYDRLNLWGQGTLVTVSSGQPKGPSVFPLAPCCGDTPSSTVTLGCLVKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab Hpu24 Heavy chain
publication title Structural Analysis and Optimization of Context-Independent Anti-Hypusine Antibodies.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 42
structure length 216
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drnA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drnA01
3GI8H 4PRAA 4QRPE 3KR3L 3QEUA 1FQ9C 1BLNB 5DRXA 5IVXA 3HPLA 3LEXB 3LQAL 4LCUA 3VXSA 3RY4A 5GS0H 1A1OB 5D1QA 3ULVF 2UZYB 4M93B 1UH2A 4G3YH 2FSEA 4TPRH 5DMIL 5ESAA 1JNLH 1MRFH 4Q9RH 3K2MC 3GMLA 5HJ3A 4F2MA 4KHXH 1ZLWK 4NC1E 4ZG1A 1Q1JL 1OQXA 4PRPD 4DUVA 1BFSA 3ULVC 4YZFE 3O8XB 4XB8A 5C08D 1MWAH 1T1YA 3Q2CA 4JDVB 1IEBA 4HGWB 1VPOL 2FATL 4WO4B 4JRWA 4W4OC 5E7BA 3U46A 3BO8B 3MR9B 3KWWB 2Q3ZA 2IGFH 1H9VA 4KJWD 4QF1B 5AEAA 1QA9B 3DRQA 4JR9L 4JB9L 1A47A 5AWNH 1QSEA 1R3KB 5D7JD 3Q5TA 3GBMH 4Z0XA 5KAQF 3MYJA 1JRHI 5J12C 5K93A 3QYCA 4FQHB 3PXHA 1LK2A 2VE6A 4EBQH 1MPAH 1P2CA 3VXOB 3JUZA 4UT9H 3PWPA 3GIVB 1EJOH 3H9YA 1BFTA 4NKDB 2CUMA 1A9EA 2AGJL 3O6FA 4ELMB 1HHIB 5KG9A 3CMGA 1TZIA 4AY0A 3RY5A 5KTEL 1UXWA 5D7IE 4FXKB 3P0VH 3IKKA 3GSQB 4V2BA 4XP1H 4NFBA 3CVIL 3LZFH 3LN9A 5IOPB 1KLUB 2N7AA 1VA9A 3STLA 5BV7C 4J6RL 4MD4A 1R3JB 3D2UA 3P11H 3QA3B 1FSKC 1I3RB 1V3MA 2GT9A 3QHZH 4BZ2H 5T1LD 3CFJB 4S1SH 4YNYA 3GI8L 3NFNB 2P8PB 1WICA 1XGTB 2ADGA 2BNUB 2HT2D 4JRYE 3WDJA 1NUDA 2IQ9H 4GMTH 3MUHL 1WF5A 5GS0L 3H7LA 4M7JH 1U9KA 4TPRL 3DYOA 5C0EB 1JNLL 5EZIH 1MRFL 3CFBA 3RWDB 2R15A 2QQKH 3MNWB 4KHXL 5DO2C 2VERN 3KG5A 4YBQD 2E6QA 2EXWC 2EDOA 4P2YA 3SQBA 2OTWB 1JNHA 2WWMC 2YR3A 4P4KA 1UB6A 3UTPE 1ZLVK 4G6MH 5E6IA 4YXLH 4E42A 1MWAL 3RNKB 4MXVF 3S36H 4D0CB 3JV6B 2ARJB 2QR0A 2XG5A 3HE6C 3O2VH 2IGFL 1IKNC 1NAMH 3RP1A 5EC2A 1F13A 4M3KB 1MFEH 1NQBA 1PQZB 3UAJD 4X9GA 5AWNL 3N0PB 2WM0A 3S35X 3RL1A 1MAJA 5I1GH 4NUGH 1BWWA 2BHUA 1X44A 3VXNB 5I75B 1R3HA 3T77A 4H5SB 1OSPL 2W0LA 4EBQL 1MPAL 4QO1A 3SDAB 4BH7B 4UT9L 1ONQA 2YC1A 2EDNA 4FQQB 4JHWH 5D2LE 1EJOL 1FP5A 3EO1A 3D3VD 4O51A 4OI9A 1CLZH 4L3EE 3I3EA 3REWB 4L29B 2W1NA 1S7XB 1T3FA 5FUCC 2VOTA 4QLRA 1D6VH 2A83A 2DQJH 5T3XH 1IMHC 1J8HD 3R06A 5JHDE 1FIEA 3QCUH 4M7ZB 1OD7A 3P0VL 4WUUD 4OF3A 2W38A 3HRZA 2ID5A 4XP1L 1CE6A 1FBIH 3QDAA 3ZSTA 3LZFL 3BP7B 3RY6A 5TGBB 1KIPA 3TZVD 1D7FA 3U9UB 4IDLA 3MTRA 3P11L 5FGBC 3TT3H 2APTA 5ANME 4BZ2L 4XNXH 3CMOH 4S1SL 3HG1D 4CJ0A 2VAAB 1MLCB 3FO9A 5SX5K 5EOQH 4Y16B 1U8QB 1CT8B 5E8DH 2IQ9L 4GMTL 4Q6IA 4U1KA 3FJTA 5CZXC 5EORL 4GW1A 4JAMB 1I7ZB 2VXVH 4LCCC 4M7JL 4XVUC 3DXAD 4KXZI 5F8RC 5EZIL 1D5MA 4JN1H 2O61A 5I6XB 3WUWA 2QQKL 5CUSH 2F53D 4TUJA 4N9GB 5D1XA 3I6KB 4PGBB 2XY1A 2OM5A 4AK1A 2BOBB 1F4HA 2EO9A 4RGMC 3WFZA 4YXLL 3QIUA 4MDJB 1IBGH 1J05B 3S36L 1QZ1A 3DGGA 3O2VL 5DJ8B 1NAML 3RX8A 3F12A 2ZOKA 4X80H 1MFEL 2BSSB 4OF8A 4I0PD 3IAQA 3RWJA 3HS0B 1CICC 5I1GL 4NUGL 3NPSB 4MA1B 1JV5A 4RFNC 3JXAA 5DMYA 1XIWC 4JHZA 5I76A 2I5YH 4BSVA 3LIZH 3SDXF 1N26A 2HFEB 4C4KT 1WLHA 2A0LC 2ZJSH 4JHWL 1LO0H 3QUKA 4OJFH 5DT1H 1LP9A 3V7AE 3QWOB 1YEEH 3DVGA 1C16B 4GBXB 1CLZL 2F54D 4FQXB 3CSYA 1OP5H 2Z35A 3T3ME 4IRZH 1D6VL 5CINH 2DQJL 5T3XL 2O5YH 1U91B 3MJ7A 3QCUL 1UCTA 4DN4H 1KCVH 1DLHB 1HHKB 3O4OB 4RQQB 4WEBH 3RGVB 1WBYB 4XPBH 4RFOL 3HCVA 1JHKH 1T20A 1ZA6A 5LKNA 4GXUN 1WC7B 2Z9TA 3OKOA 4HJJH 5EO1B 4YDLC 4I48B 1AD0A 4DQOH 2VLME 3RDTD 4B53A 3V5DB 3CK0H 3V4PH 2AK4B 5JORB 3HLAA 3FQWB 1J1PH 4YE4H 2A6IB 3TT3L 1FVCA 1QLFA 4XNXL 1GGUA 1QBBA 3CMOL 1NFKA 1NC2B 4KWUA 3GMQA 3UTTB 3OPZL 4J3SA 4GKNA 4RIRA 5EOQL 1FVDB 5E8DL 1AGDB 1Q9OB 2QQLH 4PJ9A 3T1FB 2D31A 3VG0H 1S9XB 5EU6A 2FZ3A 1X5YA 4XGZA 2VXVL 3B8SA 3N1PC 2I25N 5C7XH 1P5VA 5KN5B 4MB3A 5CUSL 2O5XH 5DVOA 3T4YB 5J6HB 1FFRA 3LCYA 3OGCA 4OZIB 5C2UB 1CGSH 1NEZB 1U8LA 3RFZC 3P30H 4QXUH 3QRGH 4JPWH 5T3XD 4JKLA 4M8QA 4ODWA 4Y5XC 3ZYZA 5FOJA 5I66B 3ARGB 1R5WB 1OTTD 1UVQA 2CKBH 2H8PB 1A9BB 3BOVA 3GSUA 4HIEA 5F9JA 2BHYA 3M1BB 2PW1B 4HUUA 4O02H 3VFWA 1FJ1B 4X80L 5D1ZD 2UYLB 5D7KE 3TH3T 1JWSB 4OZHF 4KI5D 1K3ZA 3DUHA 2G75B 3HR6A 3WNOA 1DUYB 5DJ6B 4G6AD 2I5YL 4PJIA 3LIZL 4QXGH 5I1EH 1LQSR 3WXVH 3I50L 5CSBA 3STZA 2AS5M 2ZJSL 5FO8B 1LO0L 1DBJH 3LKOA 5K9OA 4OJFL 5DT1L 3PNWA 1T89C 5DF0A 1YEEL 3EOBB 3OKMA 1FZMB 3WFDH 5GSVB 1IEAA 1H0DB 1FRGH 2P8MA 1M7DA 3CFKA 2VZTA 3JWNC 4IRZL 1RD6A 5IJVA 5CINL 2O5YL 1UXSA 4WENB 3MRJB 3UYRH 4PRHB 1KCVL 4WEBL 4XPBL 3O3BB 3UPRB 1JHKL 1ZOXA 4BSJA 1JZ6A 3GSXB 5DFWH 3X11A 4W68A 3CPLB 3PHQB 4DQOL 1OB1B 1U8KB 5EUKB 2YSSB 4WW1B 2ENYA 3CK0L 3CU1A 3V4PL 4G8GB 2FRGP 3BZ4B 2AXFA 1J1PL 4YE4L 5GRUH 2R2EA 1JHTB 4Z5RA 1IAKB 3S3SA 2NY7L 1A64A 1I1FA 5F7FA 5IMKA 2QQLL 4AQ1B 3VXUB 3VG0L 4MAYD 3SO3B 5TQ0H 5BRZB 5EUOF 1P1ZB 5C7XL 1BECA 4YIQA 3L3GA 4P59H 4PG2C 4AG4H 1G7LB 3DROA 4PJXB 3VDCA 4IRJA 2O5XL 1MCWM 3FOMA 5C0BA 3U1SH 3MRLA 1CGSL 3T0ED 3P30L 4QXUL 3QRGL 4JPWL 3UBXA 3V7AG 1YN6A 1KGCE 5DRNA 3L3JA 5J1AA 5JA8B 3WHE1 4D2NA 4C56A 5HGAA 1YC7A 1TCRA 2X1OA 4QGTA 5BOPA 4GS7B 5GZND 3SGKA 3MGAA 4R4BA 2CKBL 1HHHA 4NDMA 3MV9E 3ARXA 2AERT 5EU4B 3AFLA 3HI1A 3RWEA 2GIYA 2C4FT 4LPTA 4O02L 4BQCA 2VZVA 1HYSC 1JNJA 2APBA 3WHXA 2R2BB 5JPMA 2X6MA 4WI9A 2BVEA 1OW0C 5ENWB 4QY8A 3V4UH 4WJ5A 3I6GB 5C07A 4PR5B 3BZDA 4F9PA 4NKOA 3H7BB 2QSCH 3NTCH 1OT2A 4BQ8A 4UTBH 1U42A 4QXGL 5I1EL 1UJ3C 3WXVL 5FGCE 5I8CA 1DBJL 4OQTA 4OCRH 1QSZA 1G1YA 2JB6B 4O5LH 2ITCA 2VDPL 3WFDL 5DD3H 4L3CA 1FRGL 4LLUB 4KI5F 4LCWD 1M05B 4X5WA 5TDNA 4LHUA 2X10A 4U49A 1H3VA 1RZ8A 4D9QD 5JW4R 2AJVH 4PPTA 5HVWA 3BGMB 5AZEH 4DFIA 3K8LA 1G9MH 5HHMB 1BX2A 1WZKA 3JWOC 4FRWA 4FFVC 5E5RB 5JW4M 1KTDB 4IRSA 1EGJH 1YN7B 4HFWA 4JVPA 2OL3B 1B0GA 2X9WA 4O2CA 5H2BA 4P2OB 4Y4FD 5GRUL 3VFUB 1PGRB 3FQXB 5CEZH 1FFPB 3MSPA 3VXMD 5L7XH 2APXA 1FFNB 1AQKH 3AU1A 2VH5H 5EH1A 4FFYH 3AY4A 1WFOA 4UILH 4JCLA 2FGWH 1D5XA 2XXMB 2EIZA 3KYOB 3PGCB 5TQ0L 4XZUA 1FC2D 2X4OB 5I1HH 2EDHA 3RBSA 2PO6D 4U0RC 1XF2B 3FFDA 4P59L 3QUYB 4AG4L 2KL6A 2IALA 4NQEB 5GS2H 1NBYA 1VFMA 3U1SL 1WT5A 5FFLA 4AEEA 1GC1C 5TFSH 1REIA 3MRMB 3GNMH 3QDGE 5ACZB 3AB0B 4LPWA 2NY4D 4I3RH 3JWDC 2Q8BH 1MRDH 4PG9B 3QIWA 2IANA 3K7UA 2EDWA 5T1MA 5CZKA 3HZKA 2B0SH 1YECH 2AK4E 1PYWB 3V4UL 5CEXA 3RWIB 3PQYE 3GSVB 4J3XA 2C4XA 4LSUH 2QSCL 3NTCL 1ZS8B 5BVPH 3NAAH 4LF3A 3REVB 4UTBL 5JW5B 2VWEC 1DBMH 3V0AC 5BS0B 1NJ9A 1FAIH 3T0EC 3MRNB 4OCRL 3TYFB 4P99A 4HMCA 5CILH 4H1LG 4O5LL 1JMXA 5GGQL 2MMXA 5DD3L 3PG2A 5HHOB 3OTTA 3OR6A 5KJRH 2YPVH 4N9OB 4Z7WE 4ODUB 5EU5B 3I02B 1RJYA 2DBJA 2PYFA 2HG5A 3CSBA 3HI6H 5EIQA 4N1CA 3CFCH 4UU9A 1I4FA 4PLJD 2AJVL 2QBWA 4LPCA 4WHYG 1CGYA 5AZEL 4N8PA 2JK5B 1G9ML 1BD2A 2HFTA 2DN7A 3VCLA 1EGJL 2X1PA 5CLWA 3VGGA 4X9BA 1IEHA 5H37G 5IEHA 4NQTA 3TNMB 2VQTA 5CEZL 3EAKA 2A74A 5L7XL 1AQKL 1YMHA 2R2CA 1UFUA 2VH5L 3G6JF 1XR8A 3CDYA 1YMMA 4FFYL 1N0LA 4LSDA 3O4LE 1HOCB 2FO4B 4UILL 5EPMA 3QSKB 2FGWL 5FHAH 4EOWH 1KN4H 1I3UA 2GTWB 1MCLA 2FECI 4KJYB 1GRWA 2B4CH 3VD7A 4K71B 3LKRA 5I1HL 4QRRD 2XXCB 3IDGB 1MFNA 2WK2A 3RVTC 1ZANH 2YXFA 2CR3A 5FO7B 2IAMC 4PJHA 4MSWA 2PTTB 2IG2H 1C1EH 1UACH 4XCYA 4YO0B 3L9RB 4ERSH 3GNML 3QXWA 4PJDB 4YHYB 5J9PA 2NXYD 4XWGH 1KPUA 4QTHB 1F8TH 1UENA 4OB5H 4B7IA 4JLRB 4Y4FC 5DRZB 1R3LB 3GDBA 3V6OA 1BBJA 4I3RL 1I8KB 5E9DD 3MO1A 3ZDYF 3RZCA 2Q8BL 3EDKA 2E8YA 1MRDL 1DQMH 3K8MA 1OY3B 2EYTB 1M1SA 2B0SL 1YECL 4G8GE 1NFDA 1NFIA 5CEZD 4CDHA 5C09B 5I30H 3HR5B 4XP6H 4LSUL 2PO6C 3NAAL 5DA0B 2F8VA 5BVPL 5ID0B 2HN7B 2NY6D 1D9KB 3K80A 5IIEA 3TA3C 1DBML 1YJDC 2AJ3B 1K6QH 1FAIL 2ZSVA 2AKRA 2PUQT 4RDQG 5CILL 1A7BA 1BVKA 5F7NC 4GMSH 3HC3H 4MNGA 4R2GD 3BH8B 5KJRL 4YHNB 5GS2D 1QBLH 2YPVL 5H35A 4LIQE 3HPJB 3HI6L 2KH2B 3CFCL 5CD3B 5HHQB 3UTZB 3P40A 4N90E 4Z7UF 4EQ2A 2C1PB 4DWHA 5HHPA 2V5RA 4HIIA 2B2XH 4APQA 1R24B 2NY0D 1HSBA 1YPZE 4PRID 3BKCH 2HMID 3TT1H 1R0AH 4LKCB 4Y4HB 1OHQA 1XGYL 3CCHB 4OZFG 4KK5D 5EZJB 5FHAL 5JO5A 1EZVY 3ESUF 1MJJA 3SJVB 4PGDA 3ZKXB 2HKFH 2B4CL 2ZWLT 4O9HH 5DJZA 5T1KB 1MCPH 3AXLA 3S96A 4QHNB 1Z9MA 4PLJC 1AO7D 3L5WB 1ZANL 3VWKB 6CGTA 2HTKC 4M5YH 2IG2L 1C1EL 1UACL 5HI3C 1T2XA 2NY1B 2W91A 1CXKA 4N68A 4ERSL 3VFVB 4TOYL 4XWGL 1P6AB 1F8TL 4OB5L 1T5XA 3VA2C 5MEPB 3U6RA 5IW6A 3QDJD 2VUOA 1JHLH 3IGAB 5F7MC 2AQ1A 5ISZE 1DQML 4LSTH 4CMHB 5HYIA 1KUMA 3SE3A 5TE7H 3RPIA 4YAQB 1IAOB 4R26H 1WQVT 4LVNB 2D03H 4GG6A 4GAYB 1SJVA 3QXAB 5D2NB 1OSZB 1YNTB 4R7NA 2AJZB 1I3VA 2P45B 2RFXA 1WISA 1F3JB 5I30L 1UGNA 4KI1A 4PBWD 1K6QL 3KPMA 3G6DH 4PRNA 1IAMA 4HS8H 1KB9J 5I74B 3IT8D 1G9NH 5JR1L 5I71B 4GMSL 3QRFM 3HC3L 4DEPB 4LSQH 1P4BH 3LKNB 3F7YA 1QBLL 2J3SA 5DGRA 4KGJA 1INDH 5GRWA 4NUJB 4Y5YA 3QQ3B 3S7GA 1LO4H 2HFFA 4KY1H 4YGVA 1S7SB 2B2XL 5DR5H 3PWJB 2FJFA 1T1XA 2BRQA 3OAZH 1FZKA 4YC2C 3IU3A 3T0WA 4PJBA 2HJLA 5IROA 3H0TA 1IKFH 3BKCL 4HS6A 4E41B 1NH6A 3TT1L 1R0AL 1GOHA 4OBRA 1KG0B 3C6SA 3CUPA 4L9LB 4OGXL 5GHWH 3ROLB 3VD3A 3MUGB 4R2GC 3VFTA 1FE8H 1TNNA 3ZHKA 5CP3H 1MLBB 2HKFL 4O9HL 1MCPL 3VFMB 1F58H 4M48H 3D87B 5HGHA 1W0YT 4U1LA 3QPQD 4XBPA 4M5YL 1B6UA 3QO1B 3VXSD 1DVFA 2ITDB 1CFQB 1IM3B 5D1QD 3H6JA 1Y6KR 3QJFB 4Y1AD 1FYTA 2ICCA 4QRTB 3QWRA 5KSBA 2EXYC 4PBXA 3BEVB 4L8DA 4X6FA 2MCG1 1TQCC 1JHLL 2I26N 1PDKA 4LSTL 2M8XA 5TE7L 3RTQA 3W11C 2J8UF 1HKLL 3HE7C 4R26L 5SX4I 3CFDA 2D03L 5EBMA 2GJ6D 3W81A 2ADFH 5FUZH 5IGXH 5FKAA 4KK9C 3QUMB 5DEGB 1MI5B 2DQHH 1K4DA 3VI4F 5ITFA 5ALCH 5F7DB 3PHOB 2X1QA 1KV3A 2CPCA 4PJEF 3EJZC 4KRPD 4OTXL 3K0WA 1QSED 3G6DL 4HS8L 1Z6JT 3MBEA 1G9NL 4UQ3B 3BGFC 2WBJC 1QFWI 1INEH 3F58H 5D7LB 4YBLB 4LSQL 1P4BL 1MIMH 1NBVH 4KK6D 2ZP0T 3G5YB 2QADB 2ICEA 3RL2B 1OQOA 4ORGA 1INDL 4P5TB 4PJ8B 2VLRD 4JRYA 4NNXB 4QRQA 3CC5B 3GZKA 1DDHB 1BZ9A 3Q3GA 4QOKE 1ZA3B 3MLXH 5I18H 4H8WC 5EU3B 3PABB 1LO4L 2EO1A 2HP4A 4KY1L 5DR5L 5JLZA 3HMXH 5ETUB 3IDNB 1C7TA 5C0JA 3OX8A 4N8CH 3S35H 1LDSA 3RIAF 1IKFL 4HWEH 4HGMA 4NBYB 4E5XA 2W0KA 4NN6B 3NA4A 4NM8H 5IMMB 5EC1B 1CDUA 5EDXA 1VFBB 4P46D 5SWZB 4F3FA 3G08A 3HAEB 1GGTA 5GHWL 3WN5B 4PJ7F 5F9WC 3CXHJ 1FE8L 2P7TB 4J3WA 3DMMD 2UZIH 1AI1H 1MCFA 1FL5B 3WJJC 3MRFA 4KV5F 3MLTA 4UV7H 4F7EA 1F58L 4YHIA 1TFHA 4U6HB 1AGBB 3FB6B 3ARBA 1MUJA 4N8VB 3TBWB 5KVMC 3QEQA 2BDNH 2ADJB 4MWFA 5D5ME 2G9HB 5GS3A 3UDWC 2RR3A 1PY4A 3V52L 4TYUA 4OD3H 3MCKA 3O45A 5LGKA 3PXJA 3S4SB 2XKSA 1MREH 3G9VA 4LSRL 3BQUD 3QXUA 3KPQB 3RI5K 2DQCH 5E6ID 4NQCE 1EEYA 2R1WA 4ODTH 1KCSH 5JHDA 3LDBC 2ADFL 2JCCE 5FUZL 5C0RH 5IGXL 1HH6A 4F8TA 3IJYA 2DQHL 1F2XK 2CXGA 3T3PF 1CYGA 4MA3A 1ZGLP 1FG2A 5IB5B 1XF3A 5AUMA 5ALCL 4NO5B 1IGTA 4L4VB 5E24E 1HSAA 1UADC 4JO3H 5EWIH 3SJVE 5F89A 5E2WH 1ZGLA 1CGUA 1MFDH 4MNHB 1YZZA 1H8SA 5D1QC 3KDMB 1RY7B 3QFJA 4ZNEE 4TUOB 5DMKB 1INEL 3F58L 1MIML 5HI5C 2FECL 1XGQA 4OAWA 2GITA 2NXZD 2GFBB 3V6ZB 3GO1L 4AT6B 4NKQB 4P48A 2ATKB 1FZJB 2Y72A 3ILPA 2CIKA 1YDPA 3MLXL 4U1MA 4AEFA 1M71B 5E8PB 5I18L 4JRXA 1YEHH 2DLEA 4K55A 4YX2H 4K8RD 2VZSA 5K9KB 1JYWA 4PTUB 4R0LB 4M62H 4UDTB 4HDIA 4JFZH 4N8CL 3S35L 5BOZG 3L1OH 1VACA 2KZ1B 2SEBA 4KRPC 4HWEL 5KAQG 5D9SB 5L2KD 5D2NE 5DUPH 4GKSA 4NM8L 3MRKA 4ZFZB 3T04D 2NTSP 3MLWH 3O6ML 4G9DB 4JN2A 1RHHA 3IJSA 3OGOE 3EYQC 3DBXB 1J18A 1ZE3C 1ZKAA 1U95A 2NY3D 2UZIL 3GK8L 1AI1L 12E8H 3IS0X 5KZCB 3ROOA 2HLAB 1KIQA 1YNLH 3FQTA 4UV7L 5F1NB 3WIFA 1KBGL 3Q6FA 3EGSB 4G8FB 4JE4B 4EN3D 3CNKA 3O6FC 3OKEA 4JFQB 4KKBD 4JFOA 5IB2A 3SE9L 1NGPH 2DQEL 5KSAB 1MJ7H 2E5EA 3GSNB 1BLNA 3ETBF 1U58B 1HXYB 2Y06H 3U48A 3ZT6A 1URLA 4OD3L 3WIHA 1OF2A 5FV1L 5D72H 4MCZB 1Z9LA 3IDIB 2XN9B 1MREL 4QYOB 3F5WB 1YYMH 3O3AA 2DQCL 4BH8B 3MRCB 4ODTL 1KCSL 1FO0H 3MZGB 5C0RL 1INQB 4X6CF 4XXCA 4JDVA 2CDEA 3CLEH 4HGWA 4WO4A 2HLFD 3BO8A 2RCSH 3MR9A 1T0NB 4FXGB 3VI3F 1ITCA 1HHJB 4OCLC 1M7IA 2C3WA 4JO3L 4X99B 5EWIL 1XGUB 4HF5H 5E2WL 1MFDL 1NGXB 2APFA 3T09A 3QAZB 5A2JH 3B83A 1RPQA 4FFZH 1BFOB 3CFEB 4OLUH 1ZT4A 3MJ6A 5E6YA 2FHBA 5FB8B 1JN6A 4P4KC 4LPYA 3QI9B 3QHFH 3ZKMD 5E6IC 3GIVA 3ECBB 2H41A 1W0VA 1ND0A 1YEHL 2OI9B 4YX2L 3RKPA 2W9DH 1S78D 4JFZL 4ELMA 1HHIA 3L1OL 3W0WD 3C6LA 4HFUH 2V5MA 4FXKA 2FR4B 2ESVD 4PY7B 5FF6A 1MI5E 2WIIB 5SX4H 3GSQA 3MLWL 4FABH 2QSVA 1ZLUK 3OB0H 2EDYA 2GTZB 2BVPB 3VG9B 12E8L 5A40E 3ZYOA 2BNQE 4D0DB 1YNLL 4TNWK 5GRVK 2AAVA 1R3JA 2G60H 1J86A 4MS8D 3CX2A 4LNVA 5CJOH 3TBTB 2GSIB 3CFJA 5DURB 3NFNA 4K8RC 3GJFA 3NCBB 5EU6D 2XQBH 2P8PA 1QFWH 1XGTA 2BNUA 5IWLA 2MSPA 3KPOA 1WBZA 5EOCJ 1MJ7L 3RUGE 3Q6GH 1LNUB 3QFDA 1EO8H 4KUCD 2Y06L 1TLKA 1AD9B 4P2QB 4FTVE 5C0EA 3RWDA 3RY6C 1YYML 1P84J 4AYFA 2OTWA 5L9DH 4PJ5B 1FO0L 1JYVA 1CI5A 2NY3C 3U7YH 3MJ9H 4X9FA 1T7ZA 2IPTH 4NO2B 3IETB 1EIBA 3CLEL 1TNMA 1JYNA 1CFTB 1KOAA 3FOLA 2MHAB 2VLKE 3CLFH 3ILQD 5SWZE 4D0CA 2ARJA 3RVXD 2RCSL 3VXRB 3MJ8B 3ZT5A 1TTUA 4JQXA 3AREA 4P2CG 4Q6IC 4HF5L 1A1NB 1DL7H 3D5OF 3ME0A 1PQZA 3IJHB 3EYFA 4CU7A 2BVOA 1R5VB 1AGCB 2KUTA 3NCMA 4H1LA 4FFZL 3VXNA 4H5SA 4P2RD 3B9KB 4OLUL 5D1XC 3DVFA 4Z7NE 1CIDA 5C70A 1NUGA 3SDAA 4BH7A 3QHFL 3S3JA 1MY7A 3LQAC 1OWRM 1ZWIA 5HHVH 3QIUC 4Q9CA 5E1AB 4AH2B 3T1WA 2O5ZH 1CTNA 4KDWA 2DS4A 4JEGB 2W9DL 3BPLB 4RGNE 4RFEB 2D4FA 3REWA 4L29A 1ZSDB 3H9SB 1WFNA 1S7XA 3GMRB 4KAQH 4PTTB 4X4XA 4G8IB 1RZKH 3QNXB 2OL3H 1QUNA 3ELAT 3RVWD 3QIBB 2R2HB 1UCBH 5IKCB 2BRRH 4HFUL 3IDYC 3GHEH 3ZTJH 1U8IB 2Z8SA 4ZDHB 4Y2DA 4FABL 5I16B 1GPOH 3FMGH 4NQDE 5E7FA 4WV1B 3MV9A 3MV8D 4LAJH 1A6UH 5TGBA 2X70B 1B0RB 4ETQA 2VDLH 4EUPB 4J3OC 1R6VA 3U9UA 4L3AA 4NBZB 4LFHD 4GSDH 3SE4A 3L95B 4HWNA 4I18A 3S5LB 5DK3A 1T2QH 5CJOL 5IMOB 4XMPH 5C9JA 1JGUH 2XQBL 2VAAA 1MLCA 1QFWL 4Y16A 1U8QA 1CT8A 1H8NA 3U4EB 3M8OH 1QFWM 3KS0H 3Q6GL 2E7CA 1MCOH 1EO8L 3MROB 4MYWB 3WO3B 2BNRB 1I7ZA 4JAMA 4U7SA 1RUPH 1ZMYA 4LRIA 3VGAB 1HCFX 4OI8A 1S7RB 4YHML 4JG0H 1I1AA 2EYSB 4N9GA 5C0GA 1Y6NR 4OGZA 5L9DL 1JGDB 3TBYA 2PXYA 4X8XA 1DN0A 5MI0B 3U7YL 4C56D 4YJZL 3MJ9L 5CGTA 3K2UH 2IPTL 3QR2A 2VDNH 2XWJB 5H8DA 5DSCB 1NDGA 4MDJA 4Z95H 3CLFL 4KUCF 3SPVA 4F33A 5DJ8A 1X5XA 2CIIB 2E9WA 4PJ9C 3VDBA 1DL7L 5CP7A 3QDMB 4DZBB 2BSSA 4YHPB 2EECA 3F7RA 3VE0B 4UT6H 4WFED 3HS0A 2JLLA 2Q87A 1G6RA 4HS3B 5E00B 4J4PA 1QKZH 4FHBD 4OZFB 3DHJA 4ZO7A 1Q9LB 1SEQH 3VWJA 2WZPD 4ZXBA 2RQ8A 1LILA 5JHLH 5SWQB 5GS0C 5D96C 5HHVL 3LKSA 2O5ZL 3QWOA 4URTB 1C16A 4GBXA 2XN9E 1X5IA 1BF2A 2BFVH 4KAQL 4G42B 4PJIF 1K8IB 1RZKL 2HWZH 2OL3L 1FH5H 4LLQB 1KXTB 5T3ZE 1U91A 1UCBL 5DS8A 2BRRL 2ZUSA 4LMQE 1DLHA 1HHKA 4RQQA 1C5BH 3TN0C 4Y4KC 1WBYA 2Y36H 5J11C 1GPOL 3FMGL 3L6FB 5DDHB 5EB9A 4ZUWB 2CLZB 5GIRB 1A6UL 2FB4H 4YEFA 1XEDA 1J0ZA 2VDLL 1L0YA 4HMDA 2AK4A 2VZOA 4LPXA 5JW3H 2FEEI 4GSDL 4XB7A 3PQYA 5IK3B 1I7RB 5KSUB 1T2QL 2YOCA 4KGLA 1EFXA 3EYSH 3DX7B 1H5BB 3QZWG 5D6DA 4XMPL 1JGUL 3UTTA 4KMTH 1ZXQA 1G7MA 3M8OL 5E5MB 1AGDA 1Q9OA 3DI2B 3T1FA 3RIFK 3TVMD 4LDOB 1MCOL 1RZGB 4ZAKA 1BP3B 4WGVB 3GGWB 4ZYKA 2Z4QB 4YK4C 3RVWC 5CWSA 4YHOH 1RUPL 4PLOB 1PKQE 2D7QA 2WUCH 4TSAL 3CDGB 4JG0L 3GRWA 1IGJA 5J6HA 4ZQKB 3JV5A 3FQRB 4OZIA 7CGTA 1VFOA 1NEZA 2PR4H 5CGYC 4CL7A 5IFJA 1U93B 4QHLA 3UJIH 2DOCA 2VJXA 3MRRB 3X17A 3K2UL 4LBEB 2VDNL 4LGSB 5DTFB 4OCYH 4JZJB 4Z95L 1ADQL 1E0OB 3TBSB 2NW2B 4P9HH 2IAND 1R5WA 1UA6H 1U8OA 1I8IB 1OAZH 2CMRH 1A9BA 1A1MA 1XF5B 4M6AA 4X6DB 1MEXH 1K5NB 3M1BA 5CEYB 2PW1A 2AEQH 1WGOA 4OIBA 5EIIB 3RRQA 2UYLA 3A6CH 5IBLD 4OZGB 4UT6L 1JWSA 4ONHB 4Y7MA 2X4PA 1HIMH 3MMEB 4XWOC 2AJUH 4HAGA 4JFDE 4A6YB 2B8OT 1QKZL 1XAUA 4IRJC 1LE5B 1F45A 5BZDA 4MQXC 5AD0B 1F4AA 3U82B 1SEQL 5ALBH 4XRCB 5JHLL 5FO8A 4KK8D 1MH5A 1MNUH 1SMOA 3V0VA 4X5XB 4XAWH 2VLJB 3SGKC 4YLQT 1H0DA 4L8CA 2BFVL 4EXKA 3M45A 2HWZL 1DQTA 3T4AB 5I1JH 1FH5L 4TVPL 3VGHA 1E6OH 4PJ5E 3MRJA 1KN2H 4PRHA 1Y0LB 3EYOB 1C5BL 3W9DB 5CJBA 4HKXB 1RIVH 3O3BA 3FRUB 3UPRA 4NCC2 3FQUB 4U1SB 5FYKH 2Y36L 4HUMB 3GSXA 1TQBB 3H3KA 2BHZA 1ULVA 2FX7L 2VMFA 2FB4L 3CPLA 3NGBC 3VXRE 1U8KA 5BS0D 4NSKB 3V6FA 1MFAH 1OGAD 2W9EH 1V7NH 4G8GA 5JW3L 3BZ4A 3EYSL 5DMJB 4HW6A 3MGOB 4KMTL 4XMLH 1D6EB 4OLYH 4U6YB 1H15B 5BRZA 3VFNB 1RK0B 1NGZA 2WUCL 4H25B 4YXHL 1G7LA 2K1MA 3EFFB 4IRSC 3SKJH 3P4MA 2PR4L 3UJIL 4S1QH 4MQTB 4R97C 4RMQA 4XVTH 4XPFL 1NBZA 4M7KH 5LBSH 2IPKB 4OCYL 1P4IH 5I73B 2P24A 3ALWA 4P9HL 1UA6L 4IJ3C 3DARA 1OAZL 2CMRL 2HAZA 3AY4C 4ZS7H 4LLWB 1MEXL 4HZAA 2AEQL 1MHPH 1P7QB 4K9EH 2R2BA 3A6CL 2VN7A 3PIQB 5ENWA 1HIML 2CRMA 3CIQA 1RVFH 2AJUL 4LU5H 1KCRH 1LDPH 1IQWH 1PEWA 4PJCE 3SDYH 1OTUD 3PV7A 3H7BA 2GEEA 1QLRB 1WT5C 3LS5H 5ALBL 2N7BA 1U8HB 5HD8D 3MGTB 2X4NA 3ULSA 1IL1B 1KB9K 5CKGA 1QP1A 1WJ3A 3C08H 1MNUL 4MCYB 2PW2B 4NGHH 4XAWL 3HC0B 1OM3H 4D3CH 3UTSD 4LLUA 5HI4C 1W0WB 3DYMA 3LV3B 3VRJA 5K9QI 3QIWC 2ILLA 5F3HA 3SGEI 1T1ZB 2R0WH 2XOTA 1B90A 1E6OL 5AZ2L 1KN2L 4NWUH 1RIVL 3BGMA 2XG4A 5FYKL 1MJ8H 2EKJA 2GKIA 4N5ED 3W2DH 5DYOB 4AIOA 1I7UB 4ZPVB 3ZDZF 1KTDA 3QUZC 1YN7A 1DZBA 1MFAL 2W9EL 3U0TA 1V7NL 3BGAA 4P2OA 4HWZB 4PJAB 5GGVY 3B6SB 3U4AA 5IM7B 2DLTA 1GGYA 1J1XH 1FFNA 4MLIA 1Z9SA 4CN6A 2ZCKH 3N9GH 4GAJH 3LKQB 4PLKC 4XMLL 2LVCA 4Y19D 2X44D 4OLYL 3KYOA 3PGCA 3QUXB 4BK5A 5IBTH 4NQXB 4U4BA 3QUYA 3HZYA 2HT3C 2Q8AH 4WFFD 3I3DA 4HKBA 4NQEA 5FHBH 4HPYH 4KRMB 3SKJL 1W72B 4JZNA 3KXFE 4OCWH 5SWSD 1CVRA 3P73A 2Q7NA 3MV11 4S1QL 3P9WB 4QRUB 4RAUA 5FM4A 5GGTH 3ZDXE 5ACZA 3TFKD 4XVTL 3D69B 5HGBB 4M7KL 5LBSL 3TIEB 1P4IL 5JW4N 1AR1C 1KNOB 3KPSB 5FYKD 3NIDE 1MY5A 3G5ZB 3KLSA 5HBBA 4ZS7L 4PJHF 5GJTL 4WHTB 1MHPL 4K9EL 3L3IA 2FD6H 1U3HD 4KVNH 5DEFB 1PYWA 5C0IB 4EI6B 1RVFL 4ZPTA 3GSVA 4LU5L 1KCRL 2DWDA 1LDPL 1IQWL 5D6CA 3SDYL 2ZOLB 2O26U 1ADQA 1J0IA 1UEMA 3REVA 4Q9BA 5JW5A 3LS5L 1T4KA 5FEBA 1IAII 5CBAA 5J1TC 4GFTB 2IMMA 1U8PA 3MRNA 3C08L 4G8EB 4NGHL 4G9FE 3B4NA 4QRPD 4AIXA 3V6OC 4XAKE 3RZCC 2MKLC 4D3CL 1KPVB 2Q1EA 1JF1A 1MSPA 1WAAF 5EIVA 4NCDA 4ODUA 3HRPA 3I02A 5BV7B 2R0WL 1YYLH 5TQ2H 1JPGA 3G5VB 4FQ1H 2KBGA 4NWUL 5DD5H 5C0CE 1QTYT 5EO0B 1SQ2N 4D9RE 3W2DL 2XFXB 1FNSH 3HAEH 3E1F1 2WLZA 2P5EE 2H2SC 1OTUC 1QFHA 3SGDI 3I3BA 4Z78B 3DECA 4TN9A 3D6GA 4NYLB 2VIRA 3TNMA 5HD8C 4NC2B 1J1XL 2NX5D 3PWUB 1RSFA 1MOEA 2D7OA 3N9GL 4DOHB 4GAJL 3WIIH 3CXHK 1CXLA 5DJYB 5A16A 1OARH 4LLYB 5IBUG 4V1DE 3C60B 2GTWA 1H8OA 3FONA 5IBTL 1BGXL 4K7PY 3TO4B 3DX9B 3D39E 3IDGA 2Q8AL 4PJFE 4J8RB 5FHBL 4G6FB 4APQC 4HPYL 4N0CD 5C92A 3I2CH 3DVNB 2X4RB 5FO7A 5GXBB 4OCWL 2PTTA 4DAGL 5F1IB 2C1OA 3QWRD 2N56A 4X7TB 4KDTA 2VABB 2XWTA 5GGTL 1N59B 2Z93B 4QOKA 4PJDA 3RVVD 3WBDA 2LTQC 5GGSB 4QTHA 3OMZA 3FZUC 3T65A 3V2AR 3LKPB 1SJXA 5DRZA 3RTQD 1VB9A 1I8KA 4CGTA 4OD2B 1L0XA 1PY9A 3HZVA 2NR6D 4PRPB 2FD6L 4KVNL 1MCBA 3H9HB 3OAYH 4HV8A 5C08B 4X6BB 3HR5A 5EU7C 3U7WH 5K33A 3P2TA 1T7YA 4POYA 3LY6A 2FEEL 3FFCE 3VD9A 1D9KA 3P4OB 5J1SC 3HN3A 2FHFA 1DQDH 3QQNA 4FQJH 2KPNA 2H2PC 3TF7C 3LOWA 1A6AB 2IC2A 3UYOD 3O11A 5D7JB 3BPOB 2MFNA 4JRYD 1UJTA 3BH8A 3MREB 4YHNA 3SE3C 1S7VB 1QOKA 1ZT1B 3LN4A 2WWKO 4NZJA 3HPJA 1T7XA 1YYLL 5D5MA 4LLDB 4K3HA 5TQ2L 3O81A 2ZUYA 4HUKB 1J10A 2L4OA 5CD3A 5DD5L 4OGAC 4S0SD 4GRWH 4XPTH 1FNSL 4UQ2B 1GXEA 2C1PA 1KJVB 1KTRL 1LK3H 5CIPB 3UTPD 2XPGB 4NQCA 1U8MB 1HNGA 2BY0A 5HVGB 1CG9B 1CQYA 4LKCA 4Y4HA 5D7LD 1SVZA 3CCHA 3M07A 1NCTA 5EZJA 1OARL 3RHWF 3SJVA 4FFWD 3CH8A 4PFEA 2E7MA 4F7PB 4Y5YC 1Y6MR 5IVXE 1A7RH 4WDIA 4YZFF 5L8KB 1SJEB 3MNVB 2VXQH 1S7WA 5T1KA 4QHNA 3B5TA 4RMUA 5T1LB 2DIBA 3VWKA 2VSCA 2Q86B 2ADIA 3I2CL 3SDDA 4Z7QE 4L5FH 1YEGH 2VC2H 5IROC 2YRZA 4OFYA 3OKDB 3G04B 1N7ML 4L3ED 3S34H 4LCCA 1H3TA 3SGEH 5FDYA 2WINB 4NKMA 3IGAA 3BUTA 5F88A 5JHDD 1C08B 2Y6SD 3F62A 3QXAA 3L7FB 3EKCA 5B3JE 3HNSL 2XA3A 5D2NA 1N5AB 5TPWH 2AJZA 4UBDC 4AZ8A 1F3JA 1UKQA 3U7WL 4GRLA 3SDXB 4HWBH 4F37F 4OGYH 2OP4L 4XHQA 4WIQA 5C9KA 4HK3J 1DVFC 1DQDL 2EDQA 3NIGE 4FQJL 4IIQB 4QWWC 4MNQE 1M6OB 3IXTA 2QTEA 5SV3A 1A5FH 1ZVHA 2GSGB 2OMBA 3JZ7A 5D7IF 4ZUUB 3RVVC 2EDRA 3LKNA 1Z5LB 3RTQC 5E5UB 3O6KH 5CD5D 2QHRH 2LFGA 4NUJA 1CIUA 3QQ3A 3DRTB 3D3VB 3HMWH 1T7VA 4XPTL 3UEZA 3DETD 4J23A 4PRDB 1NMCC 1S7SA 3QB7C 3PWJA 1HEZB 1UM4H 1RQ5A 3NCYS 2J8HA 3BZFB 4HHAA 1D5IH 3MBEC 1KELH 1J8HB 4ISVB 2ZSWA 4E41A 2I60H 2YZ1A 4PRBB 2J4WH 2DMCA 4WUUB 5JOPD 1KG0A 2FWOB 4WU7A 3VMOA 4L9LA 3DTXB 3T2NH 4U6XB 5IHZB 4OFPA 3VXTA 3MUGA 2E7LC 1NCDH 4KJPD 3TZVB 3E6FA 3TBVB 1MLBA 4YHKH 5TH2B 1A7RL 4S1DD 2VXQL 4AEIH 2A6DB 5L0QB 5IG7B 3VFMA 3ZT7A 2A73B 1IAIH 1JPFA 3O3DB 1QR4A 5ITBH 2HRPH 4HK0B 3CU7A 2VNCA 1X6NA 8CGTA 2QQQA 4MGXA 4L5FL 1YEGL 3QO1A 3MC0A 1X5JA 2H26A 2VC2L 2ITDA 3QJFA 2VITB 5K59E 3W9EA 2WBWB 3S34L 2OYPA 3DXAB 2EDJA 3WKMH 1VHPA 3FAWA 3WS6A 3BEVA 4LQFH 3DUUA 3UPAA 5JPNB 2X2YA 2WW8A 2F53B 2OMNA 2V17H 5DD6A 3LMJH 3QG6B 3IAGC 1OVZA 3DUSA 5IFAH 3BIAX 1IGIH 2XKUA 5TPWL 4ZUVA 5D2LF 5JUEH 3FB5A 3QUMA 1G1CA 3UZQA 1MI5A 3SGDH 2VLMD 5CMAA 3ARBC 4HWBL 4HEME 5F7DA 1QRNB 1II4E 4OGYL 5DUMH 4Q6YA 2F74B 3MRGA 1DP0A 25C8H 4KVCL 1F90H 3S36X 2HA1A 5KSAD 2PN5A 2BNQA 5FM8A 1A5FL 4I0PB 1EEZB 2FH6A 4PGZA 5GZOC 1F2QA 3RZWA 3QZWB 4X7SH 3RL2A 3O6KL 1JWMA 1TJHH 4B7LA 2QHRL 1CLOH 3CC5A 1DDHA 1UWGH 1ZA3A 3RNQB 4MXVE 3HMWL 2RBLA 2Z91B 5INDA 4FTVA 4JPKH 3PABA 5EU3A 1SEBB 4PGEB 2VDKH 3E2HB 3L3DB 1VERA 2F54B 4TNVF 3C6LD 1UM4L 2I27N 5CHNA 1MCIA 3ZKNC 5MHSE 1D5IL 1KYOJ 1KELL 4HH9A 1DE4B 5HHNB 3LSOA 2I60L 5FYJL 2J4WL 3KYKH 5IMMA 4G7YH 4MJ6B 5EC1A 2VR4A 4LDEB 2VLKA 3X3GH 4P5KA 3Q0HA 5SWZA 3WN5A 4XBEH 3T2NL 5D7KD 1NCDL 5EUOB 2H3NA 1YY8B 2MOVA 3RDTB 1T0MB 4YHKL 1W2KT 2CRYA 3KJ4B 4AEIL 1FFOB 1HHGB 1IAIL 1V3KA 5E8EA 5F9DC 5IQ7H 5ITBL 2HVJA 1IAIM 2GCYB 2HRPL 3FB6A 3WLWC 4NQVA 4OLWH 3ARFD 3TBWA 2ZG2A 2G5BB 3BPNC 5IR1A 4AQOA 2ADJA 3LEVL 5I2IB 3WKML 3KLHC 3VRIB 5GSRB 3EDJA 3S4SA 1UZ6E 2WQRA 3SDCA 4LSSH 2V17L 1UJ3B 4ODBD 2NTFB 1HCVA 3B9DA 4M61B 4ONGH 5DXWA 1IGIL 3KPQA 5IFAL 4ZFFB 2B39A 3JTTA 43CAA 5HYQA 1T83A 5JUEL 3H9ZA 2IH3B 4XVSH 4HKJB 1V7MH 4MJ5B 5D71L 4S1DC 4BSWB 5IB5A 3ARED 2XA8H 4NO3A 3LRSA 4NO5A 2X4QB 4OZFH 5DUML 2EDKA 1HKFA 2YD2A 25C8L 3TM6A 1F90L 4GRWF 3BVNB 3T3MF 2ENSA 2C26A 2MKWA 3TJHD 1JIBA 5D1ZB 2YEZA 4FG6D 4MNHA 1B6DA 1OAYH 2OTUB 3KDMA 4M93C 4F9LA 4TUOA 2OZ4H 4U0QB 1CE1L 4YPJA 4X7SL 1QHPA 3J7HA 2IH1B 2E9IA 5FKPA 4IS6B 1VGEH 5DJDB 1TJHL 2GFBA 1JWUA 3NZ8B 3V6ZA 4AT6A 4DKAA 5KVDH 1CLOL 4OV5B 4KHTH 4L8BA 3GFUA 3OJVC 1UWGL 2EIDA 5T1DH 3GIZH 4XXCC 1M71A 2NY5H 5E8PA 2DIJA 4JPKL 2BJMH 2VDKL 5JIIA 3OB8A 4PTUA 4WO4C 2YUZA 4UDTA 2YUXA 1MCQA 1KLGB 4U05A 2FYYB 4PP2B 4JM2A 4Q0XH 3W39B 3V8OA 1VEOA 5D9SA 1F4WH 4X4ME 2ERJC 3WJLA 3KYKL 1CXFA 3MV9D 4G7YL 4ZFZA 5IVOA 3RAJH 5DJXB 3X3GL 3VFSA 4DGYH 4XBEL 3WV0A 3DBXA 4BKLB 4HUNB 4UV4H 4PY8I 3V5HB 3C5SB 1T04B 2HLAA 1DBBL 5F7WC 2XZQH 3O3EA 3LD8B 4NM4H 4G8FA 5IQ7L 5CJ8A 4ONOA 2NNAB 4OLWL 2IBZY 2VL5B 1G7QB 4IEFB 1Z3GH 3C6LC 3GSNA 4MAYB 1XH3A 3KPPB 1YUHA 5B38A 1JNNH 4MJIB 3SKMA 1S7UB 1U58A 1ACYH 3ULUH 1HXYA 1LO3H 1GOGA 1I1AD 1RZJH 3IDIA 4LSSL 2XN9A 3BD3A 1ZHKB 4QYOA 2A9NH 4ONGL 3T0EB 5TE4H 1KTLB 1AIFB 1V7ML 5DHYA 1JJUA 4A6YH 3TJEH 2X89A 2XA8L 4M6MH 5F6IB 4X99A 4Q2ZB 3MRHB 1NGXA 1O5DT 4J4PD 1OAYL 5E94B 2OZ4L 5TJWK 1KJ2B 4PIRF 4F80A 3VWJD 4ZXBD 1Q0XH 3HG1E 3T08A 4X6EB 1BFOA 3CFEA 1MJUH 2NW3B 5B39G 1VGEL 5E8NB 5KVDL 5FB8A 2VISA 3FKUS 5E99H 5T1DL 1JUFB 3GIZL 4FQIH 3ECBA 3WNKA 1PKQA 3WUWG 2NY5L 3HFML 2BJML 4LIQH 3NN8A 5B8CB 2B1AH 3QDGD 2X05A 4LCWB 4JQXC 3QXDB 1KACB 2FBJH 4Q0XL 4CMMB 4EVNA 2EDBA 3UTQB 4JVWA 3VJ6A 2O93L 2XYCA 3G6JB 3EO9H 4XC3H 1F4WL 2CQVA 3IB4A 4Z76B 4JY4B 2FR4A 3RAJL 2WIIA 4HKZB 1FN4B 2JJTA 1A6WH 2Y5TB 5I75C 1AC6A 4DGYL 1AP2A 3G6AB 2GTZA 3LAFA 3SDAC 2BVPA 4UV4L 3PQYD 2V2WB 5I8EB 1B4JH 2I9LB 4HC1A 1EFXD 4P23A 4Y4FB 4ONFH 3VXMB 4NM4L 3PJSB 2GSIA 4OLXH 3PL6A 4ZAKD 1JGEA 4JQVA 5C0BE 1Z3GL 4HBCH 1LNUA 1JNNL 4O4YH 4YFEA 3ULUL 4BUHA 1ACYL 4L4JA 1LO3L 3LEYH 1VFAB 2PO6B 3D18B 4Y2DC 4U1HA 1RZJL 4JJ5B 4ENED 2BC4B 1MVUA 3D9AH 2A9NL 4NP4H 3GEWB 1L9NA 4PJ5A 3MJGX 2NZIA 3SE4C 1KJMA 4I18C 3V6BR 2X7LB 2DQTH 4A6YL 3IETA 1FNFA 2FJHB 3TJEL 5C07E 1T6VN 5DRWB 1CFTA 2MHAA 1LEGB 2NY4B 4HIXH 4NZUH 4M6ML 3UZVB 3TGXA 1Q9WB 4Y16C 4WI7A 3VXRA 3MJ8A 1VKXB 4QXWA 1A1NA 1CDBA 3U7AA 3RWCA 3IJHA 4QCIB 3BZEB 3PDOB 4LRIC 1TMCB 1R5VA 3O4LD 4JY6B 1AGCA 1Q0XL 1QR1B 1I1AC 2D9QB 4IHOB 1FZOA 1MJUL 1Y18B 3TA3A 5KOMC 2PXYC 1ORSB 4GRMA 4Z7UB 2IJ0C 5E99L 3C8KB 4FQIL 3ULUD 2R23B 5E1AA 4AH2A 1UEYA 4LIQL 1HQRB 4RDQF 4RCAA 3U4BH 3I6LE 3RPKA 4WW2F 1T7WA 4RFEA 4XX1G 5AAMA 1QG3A 1IC5H 4PTTA 2FBJL 4G8IA 4XNUH 1NL0L 3QIBA 3AMKA 5T3XE 4XC3L 3EO9L 5IKCA 1GGIL 1NCWH 2X41A 5GGUB 4ZDHA 1G84A 1V5JA 4J4PC 1A6WL 3GJEB 3NPSC 4MA1C 5I16A 5ICYA 1WEJH 3O9WA 3PDDA 4WV1A 2GK0B 2DLFH 3VWJC 4ZXBC 3ULVH 2AW2A 1B4JL 4EUPA 2HTLD 1DQJB 4UNVA 5J7CC 4HCRH 3RVUD 4KROD 1HH9B 4ONFL 4GT7A 3L95A 1LVEA 6FABH 3S5LA 4PJCA 2IF7A 4GBXC 4OLXL 4I4WB 3SKNA 1W72H 1KB5H 4Q9QH 4OD1H 1JZ7A 3VMPA 5T5NG 4HBCL 4XXDB 4O4YL 3MROA 1CGWA 1SYVA 1OPGH 3PWNB 4HUWA 3LEYL 4QRRB 1NC4A 5HYEA 3IRPX 1S7RA 4NP4L 2WP3O 4YQXH 1JGDA 4N0FB 4N90D 3DSFH 5DQ9B 3IDMB 4NC0B 3VXQB 1X5KA 2NXYB 4R4FH 1EAPB 2DQTL 1ZLWH 3QQ9D 3IF1A 2XWJA 5DSCA 4HIXL 1IGMH 5IVNA 4NZUL 5E9DB 2MJWA 3TCLB 3E3QE 1BF8A 3DX6A 3ZO0A 5KVGH 5BQ7B 4Z7WF 2CIIA 3FT4B 3O41B 4ZAKC 3IFPB 4L4TE 4DZBA 2CR6A 4YHPA 4JKKA 3VE0A 4XP9H 3GUTA 4ZOEA 2H32A 5E00A 4CVXB 1CD8A 4U1JA 1A02N 1S5HA 1U36A 2NY6B 4HJGB 4ENEC 3VH8B 5BV7H 2LVEA 2OX5A 4GG8B 5TE6H 3NCFB 1VSCA 1FCCA 3DO7B 4JFHE 2W0FA 1MHHA 1ZHBB 2D0GA 5M7QA 3L7EA 3U4BL 3ARGC 3VFPB 5D8JH 4R2GB 5C0AE 3DX8B 2C3GA 4BQ6A 4D8PB 2P42B 1PG7X 4P57B 2GY5A 3BP4B 3KXFA 3C5ZD 1IC5L 4XNUL 3K4AA 5FOBB 1XMWA 1P7QD 1Z0NA 1I1YB 1NCWL 2L7UA 2V9RA 4NQSB 5ISZD 4OCNC 4DVRH 4MQ7B 4LK4A 1KFAH 3ZYJA 3AS3A 3D0VA 4DW2H 4UIKH 1WEJL 3L6FA 5DDHA 2CLZA 2DLFL 4WI3A 4OM0H 3OB0K 3QT2A 3HZMB 3ULVL 2D7PA 2NY0B 4HCRL 4NT6B 1XT5A 2N4IA 4LDLB 4PRIB 2ARJQ 2MCPH 3T2QA 2I07B 6FABL 5KSUA 1WWCA 3OF6A 3MA7B 2DI9A 1H5BA 3JVGA 4Q97A 1W72L 1OWWA 4RMWA 1KB5L 4OD1L 1JMZA 5E5MA 2Q6WB 2WMPA 3TPUA 1RZGA 1GH7A 1OPGL 3F65A 4M3JA 2Z4QA 4B5EA 4LSPH 5IVZB 2GJJA 2J8UB 4ZD3H 4IBLT 1AO7B 2DQFB 3CDGA 4I2XE 2KQNA 4WGWB 3SY0A 4LHUG 4ZFOA 1I85A 3GSOB 1GZPB 1FDLH 4YQXL 2ZUXA 3DSFL 2OS7A 4GQPH 2DQUH 4R4FL 5C0CA 5BJTA 4PJEB 5C0DA 1C12B 4F7CB 1DEDA 4G80A 1IGML 3EOAB 3QDJB 2VTFA 1A7OH 1ZLVH 4X6DA 5CEYA 3SO3C 4MVBC 2AXGB 4ELKB 5EIIA 2CLVB 4LEXH 4OZGA 4ONHA 4XP9L 3MMEA 4GLRI 2D7MA 2IMNA 3VXME 1GHFL 4CVZA 1LE5A 4NZDA 3WL9B 4FMFA 5BV7L 1BJ1H 2J6EH 4V1DA 3O2DA 3PP4H 5KW9H 1U0QA 4G43B 1YPZF 5TE6L 3A6BH 4QXTB 2EYRB 3D39A 5I9QB 3B43A 4X5XA 4PJFA 2DKUA 4GS7C 5I15H 1IM9A 3GMNB 3QQ9C 1NAKH 1ZT7B 1FHGA 1ZVSB 1A7PH 5E0QA 3D85D 1T21B 3EYOA 4PJ7B 4DVRL 3UPCA 4HKXA 3FQUA 4U1SA 2HVKB 4UIKL 4DW2L 4M9PA 1OAUH 3SKOB 1JBJA 2DM3A 2WV3A 4YDVA 5KSVA 1FL3B 4HUXB 1L4IA 4DFHA 1JTTA 3FFCA 3M17B 3MGOA 1FNAA 5EU7E 2C3XA 4RMSA 4TTGA 3GB7A 1D6EA 4U33A 1H15A 3VFNA 2XZZA 4JO1H 2DYPD 1B88A 5SX5H 4ODVL 3NIFF 4ZD3L 2Y1VA 5F7KC 4H25A 4BFGA 1ZAGA 1VDGA 3EFFA 3S8WA 1VEPA 4QOKD 5DRXB 3ZL4H 4W6XB 4C55A 5BW7A 1YNKL 4LCUB 3VXSB 1FDLL 5BO1H 5D1QB 3ZE1E 4Y1AB 2FSEB 4M4PA 2DQUL 2HJKB 4P2OC 1KPRB 4MHHI 2NLJB 4EZMA 3GMLB 5HJ3B 4F2MB 2IPKA 5DO2D 2OXHA 4I5BA 1S8DB 2EXWD 2AEIT 5F71A 5GRYA 4EDXB 2WWMD 1A7OL 1KLFA 4LLWA 4DCQB 2YKLH 4S11A 1T1YB 4LEXL 2R39A 1IEBB 1FFQA 3PIQA 4EEEA 3U46B 2PTUA 3QUYC 3HE6D 2XQYK 2YA1A 3HA0A 1AKJA 1EEUA 1QFPA 1QLRA 1F6AB 4KRPB 2J6EL 2EC9U 2ED7A 1QSEB 1N6UA 3PP4L 5KW9L 3OAUH 1U8HA 3FO1B 2XT1B 1IL1A 3KPRE 3A6BL 3MYJB 5JMOC 3DV6B 5KOVC 3WNPA 4MCYA 3HC0A 5I15L 2VE6B 1NAKL 3A0OA 2VLRB 5LGJB 3ET9F 1T1ZA 1A7PL 1P4LA 4PJBE 4Z9KB 1OD9A 3RGHA 3UJJL 4K3DH 5IUSA 3K8KA 2BXYA 4G6JH 1LD9B 4NQCD 3ZHLA 4HIHA 2P46B 4ZPVA 1TZIB 1OAUL 1N2RB 1UXWB 3QWQB 3ZHDA 2AVGA 2AI0H 3WE6A 3SHSA 2PYEE 1FAKT 1G7HB 1FVEB 4PJAA 4HWZA 5IM7A 1CGTA 4P46B 2ZCHH 5HY9A 4KTEH 1HINH 1B9ZA 4MNQA 3DMMB 3IFOA 4MD4B 5FA4A 4BFEA 3CVHA 1XCQB 1LO2H 3QUXA 4YNYB 1FYTE 4XNYH 4JO1L 5KSBE 3SDDD 1A6VH 2ADGB 4UAOB 5BCAA 5HYSG 3ZL4L 1X5AA 5FO9A 5BO1L 2R1XB 1QSFE 4QKXB 5CZXD 1U92B 1MELA 4X6CB 4XVUD 4H0GA 4ZOCA 4WY7H 2FX8H 3D69A 3WSQH 5HGBA 3C2AH 4JFEE 3KPSA 3IXAA 4XP4H 3NH7H 3G5ZA 2FGZA 1TZGH 2DLIA 1EO7A 8FABA 3BQUB 5E6IB 4E42B 4WHTA 4X5LA 2YKLL 3U0PB 2YK1H 4GRLD 1WIPA 4PRIE 5EN2B 5C0IA 1ETZA 4N5UA 4EI6A 5TF1H 2ZOLA 3D25B 3EOYG 5IESH 3HHRB 1EEQA 1KCKA 4I0CC 2EEBA 5IMLB 3CXDH 4KDTC 5DJ0B 3OAUL 2J88H 4YHYC 4PUBH 1E4JA 4AJ0A 1WZLA 3GMOA 1CICD 1LO5B 4Q58C 1R3HB 2IFGA 4G3YL 3WFHB 3C9NA 3HNTH 5D4QA 1BBDH 1XIWD 2D9CA 4Q9RL 3WHE0 4JPVH 2W60B 4R90H 2NXZB 3U30B 2A0LD 3QISA 4OCSH 4O51B 1FLRH 4HG4J 3G5VA 2DRUA 4FXLA 1NPUA 3ESVF 3PGDB 1X5ZA 5EO0A 2CGRH 2HRLA 1JCKA 1X4ZA 2XFXA 4G6JL 4R9HA 1D9KC 1X5FA 1T66C 4GAFB 4POZD 3IVKA 5HVHC 2EIEA 3SCMA 1L6ZA 2AI0L 4F15C 5D5MF 1KYOK 4JO4H 2PCPA 4NYLA 3MNZA 4B41A 3OBAA 5L2KB 5JQHC 5C8JB 3GKWH 3QULB 3GBML 3PWUA 1K4CB 2FDBP 2ZCHL 4KTEL 1ES0A 1CDGA 1HE7A 5DJYA 2NY3B 3QEQE 4GLRH 1OAXH 4Y8AA 5I17B 3C60A 2JCCF 2BXZA 1LO2L 3GSWB 5INCB 5IQ9A 4XNYL 2EE6A 3TO4A 1V05A 4DZ8A 3DX9A 1A6VL 3FO9B 3FRPA 2B5IC 3O0RH 4EN3B 4LGRB 5HGGS 4PREB 3DVNA 4U1KB 1J5OH 5F1IA 1B0WA 4YR6A 2ZUWA 4HSQA 4MMXC 2VABA 1WITA 1N59A 4WY7L 3MV7D 2FX8L 1D5MB 3WSQL 2O61B 5GGSA 3C2AL 4Y4HC 4PJ7E 3LKPA 3FB8B 1WV7T 5CBEB 2XTJE 3P0GB 4XP4L 3NH7L 4OD2A 1RZIB 1TZGL 1RJLB 4KV5E 3BH9A 2YK1L 3IAPA 3H9HA 4ESKA 2YPLD 3DGGB 3JWOH 3QFJE 5TF1L 3BRDA 5C08A 4X6BA 3QHZL 1YEDA 3VWKC 1A3RH 5IESL 3TESA 3SDDC 2BNQD 3P4OA 3B9VA 3CXDL 4U2YA 5EZOH 2NY1C 2J88L 1IFHH 2OR9H 4PUBL 5B39A 2EZ0C 3P0YH 1W8NA 4HLZH 4NZRH 2BSED 1J88A 4WI8A 3HNTL 5D7JA 4JRXE 1BBDL 4BSVB 4ACPA 4OT1H 2D3VA 4CMHC 4JPVL 1EDQA 4R90L 1TPXC 2ZG1A 4LVNC 4S2SA 3UX9B 1FLRL 4DKEH 3EYUH 4LLDA 4PJGE 5TF0A 2ZUQB 3KYNB 4FTVD 4Y1AE 5D2NC 3OZ9H 2GI7A 3DVGB 1E27A 3MRIA 4G6ML 1BOYA 5F7EH 2CGRL 5E08H 4GRLC 2C7UA 3CSYB 4NOFA 4S1RH 4UQ2A 1KJVA 2Z35B 1QRND 5T3ZH 4LLVB 1GC1H 4QRSB 3RA7H 1WFUA 5CIPA 2YD9A 2XPGA 5CJ5A 5I74C 3W0WB 4JO4L 1JGLH 2GJ6E 1T20B 3HCVB 3OKNB 4YDKH 4NRZB 4KKCC 5I71C 1CG9A 4HGKC 1I1RA 2ESVB 3JWDH 1MFCH 4ORZC 1FGNH 1Q94B 1AD0B 1P7HL 5F7YC 2P49B 3FHAA 4GW4B 1OAXL 3EZ8A 5KANI 4F7PA 1S9YB 2IQAB 2UUDK 3BE1H 4NN5B 1QO3B 1RIUH 1SJEA 3D48R 4RIRB 4ETYA 3O0RL 4U1IB 4U2ZA 2Q86A 5EU6B 2FZ3B 5HVFB 1J5OL 3FB7B 4CN4A 4POZC 3OKDA 1QQDB 4RGND 3WEXB 3SDCD 2X4UB 3TV3H 2P8LA 1FBIL 2WINA 4L9LC 4F7TB 2DTSA 1JZ2A 4C54A 3VMNA 2V5SA 2ED9A 1R3IH 3L3OA 2W07A 4MB5A 4X4MA 4NQDD 2AQ2A 3JWOL 1UVQB 2DLHA 4OSUH 4R6UA 1KJ2H 2YMXH 3GSUB 3SDXA 4PY8J 5AAWA 3VFWB 2OJZH 1HYSD 2M26A 4IIQA 4O2EA 5EZOL 1IFHL 4J2XA 2OR9L 3JUYA 1UKSA 1S9WA 3P0YL 1NGWB 5F97E 2GSGA 4NZRL 3WS6C 3MODH 1NEUA 2OLDA 4JN1L 4PJIB 4RRPA 4OT1L 3L5JA 3CFIC 3K74B 4CBPA 3C5JA 4P2RB 4ELME 2CO7B 3LKOB 5K9OB 1UKTA 3EYUL 1Q9KA 2X4TA 1FYHB 4Y5VB 3OKMB 2Y7QA 3OZ9L 1BQSA 1UB5B 3DRTA 5F7EL 1Z9OA 5E08L 2P8MB 1M7DB 3CFKB 1IBGL 2P5WD 4S1RL 2GAZA 5IJVB 4F58H 5LGHH 4PRDA 4JM2D 5T3ZL 1GC1L 3RA7L 4OI7A 1CBVH 3TH4T 4D9LH 4P3DB 3RUGF 3VXPB 1JGLL 1FO0B 4BK4A 4OKVB 4YDKL 2CDGA 1A3QA 4NN7B 3X11B 3JWDL 1MFCL 4YBLC 4FFVD 1FGNL 1MWAA 3TN0A 4Y4KA 2QADC 1N6QH 3WLBB 3MV8B 3DTXA 1FNHA 5IHZA 4U6XA 4PJ8C 2DF3A 4G6KH 3TZVA 1SY6H 1K8DA 4N0UB 5DJCA 3TBVA 4Z5RB 2DWEA 3BE1L 1RIUL 3LPFA 2A6DA 5IG7A 5F96H 2A73A 1I1FB 3O3DA 3HG1A 1YJDH 4HK0A 1TITA 2KQMA 1Q0YH 2Z8RA 4E0RB 1FIGH 1KXVC 4ZODA 1A6PA 5GGRY 3L3GB 2GK2A 3VGEA 4DN4L 1YEIH 2EH7H 4NN6C 3DROB 3RBGA 3E8UH 3TV3L 3LS4H 1SYSA 5JPNA 3WN5C 3MOQA 5KBNC 1PAMA 2F53A 2VR5A 3UBXB 5T3ZD 5L88H 4HJJL 2ED8A 4Z7NF 5C6WH 3QG6A 4NHCH 3B9EA 5DRNB 3VD4A 1R3IL 5D7SH 4C56B 1TCRB 3OAYK 4OUOA 1HHHB 2HYMA 1KJ2L 2YMXL 4UI2A 2R0LH 3MRPB 3HI1B 2K3TA 3MLPA 2OJZL 1BQHG 3WHXB 2FH8A 5EA0H 1EERB 4JJHA 4X9IA 4WJ5B 4HQQH 5IV2A 4MJID 4I0PA 1EEZA 4NKOB 3MODL 4RGNC 3TH2T 1YQVH 5DHVH 3SDCC 1D5BA 5I8CB 1LE9A 1T6WA 5H94B 5I1LB 5IB4A 4I8DA 2A1WH 1XGRB 1T83C 4UOJA 1A6TB 3BWUC 3RNQA 4YFDB 3QQ4A 1RUAH 2BSRA 1SEBA 4F58L 5LGHL 1ZHNB 3L3DA 4WI2A 2AQ3A 2F54A 3L5HA 4D9LL 1CBVL 3R4DA 43C9B 1RURH 1RZ8B 4IM8A 5IW3A 5J8OA 4F9LC 5AYUH 2CLRB 4TTDC 3TC9A 1I8MB 2LABA 3T0VA 1A8JH 3KPTA 1N6QL 5GS1B 1B0GB 4P23D 2EE9A 4G6KL 5EUOA 1SY6L 5E1HB 1NAMA 1YY8A 3RDTA 4JM2F 4JFDD 1T0MA 2JKXA 3JV4A 3RJDA 4PB9H 3MYZA 1FFOA 5F96L 3PL6D 4WCYH 1H3XA 1BQUA 3CJJA 1D5XB 1UWXH 3S98A 1Q0YL 2FL5B 5JIPA 3OHXA 4JM2C 3TVMB 1AGEA 3UYRL 1YEIL 4I9WD 3WJLC 5I2IA 3AROA 3E8UL 3RVTD 3LS4L 4U1NB 2IAMD 5GSRA 4M7LT 5L88L 4L1HA 1I1CA 4NHCL 3LRHA 2FJGB 1ZVYA 4ZFFA 5D7SL 3W0WE 4F7MA 3ARDA 1A4KB 2IH3A 4MJ5A 2F19H 1IC7H 2R0LL 4BSWA 1EJ6A 2IANB 3ISWA 3MXWH 5T1MB 1DR9A 3HZKB 5EA0L 4CW1A 3LN5B 3BVNA 4BFIB 5CEXB 4ZFGH 2D4DA 2YN5A 4HQQL 5D1ZA 5E56A 5HXMA 3LHPH 4K23H 1FV1A 3W82A 5ELIA 4MD5A 2OTUA 1CL7H 1DLFH 3GHBH 4LF3B 5EFIA 4ZUSB 1YQVL 3TA3D 4GKZA 2VLLB 4W4NA 5FDWA 1AGFB 3OXSB 4IS6A 2A1WL 1IE5A 4XCEA 2UV3A 3OR6B 1RUAL 3MRBB 4NOBA 2PYFB 5ID1B 3TCXA 1KLGA 4K7FB 1RURL 1J1OH 5KS9F 5F7LB 2FYYA 2F8XC 4UOW1 2X40A 3FN0H 5AYUL 1RHFA 5DK2B 1U41A 4C58B 2XTLA 5DJXA 4N1HB 4QHMB 5IEHB 3UTTE 1CF8H 2FLRT 2OCFD 5JXAH 3QUZA 1T03H 5DZLA 4L4TA 3V5HA 2V7NB 2NY2D 1OGAB 3C5SA 1CXHA 1A3LH 1T04A 4PB9L 5IP4A 1OLLA 1UG9A 1MCJA 2BK8A 2OI9C 1PG7H 4MXQC 4WCYL 4YBHA 4WU5B 5KVFH 3WKNA 3KLDA 1L0QA 4LCYA 5ADPH 1WWWX 1G7QA 4P3CH 32C2B 4AENA 3H2WA 4LCIH 4OZIE 1NC4D 1N8ZB 3KPPA 5CJXA 4HT1H 1S7UA 4XNZB 2JJTC 2HTKD 4PJHB 2VKXA 5C0AA 5HI3D 2E27H 1CWVA 1ZHKA 4YH6A 4IOFC 3VG9C 5J9PB 3CZFA 4FZ8H 1KPUB 3FTGB 1MIEH 4P23C 5FA3A 4H8WH 1AIFA 2BSTB 4M43H 3MO1B 2YPKA 2F19L 1IC7L 3I75A 2DM2A 2CH8A 5HYJD 1A6ZA 1WBXB 3B3IB 3PL6C 3EOTH 3MV8E 4JQVC 2YXMA 1IILE 4ZFGL 4N0UE 2DQGH 3MRHA 3LHPL 4K23L 1CL7L 3FAXA 3GHBL 5E94A 1HNFA 5F6HJ 5IIEB 1A2YA 3D0LB 3CZJA 2BOCB 2ZSVB 2AKRB 2JIXD 2NW3A 4R3SA 4NWTH 1KIRB 1BIIB 3U36B 5TFSL 1EUUA 1BVKB 5E8OB 5DMGC 2V2XA 1AC0A 2MNUA 4MNGB 4PRHE 3R0NA 3WS3B 4LP4A 3KXFD 5H35B 3NFSH 5IHLB 5B8CA 4I2XA 3UTSB 2DJ4A 3CH1B 3QXDA 1R5IB 4FS0A 1KF9B 3FN0L 4ODSH 4JY4A 3H3PH 5HHPB 5CSZA 1AXSA 4Z7VF 4APQB 1A4JB 4HKZA 1FN4A 3T0DA 2Y5TA 2OSLA 4KKAC 4MXWH 2CKBA 4MX7B 1CF8L 4JPIB 5JXAL 2LTQB 1T03L 2R1YA 2V2WA 4LL9A 3VXUE 1A3LL 1G9EA 2I9LA 2Z31A 3PV6A 3BP6B 5BRZE 1PG7L 4WFEE 3VXMA 5KVFL 4TUKH 5JO5B 3BPLC 1MJJB 3FCTB 2Q3AA 4PGDB 1JK8B 5MP6H 4PJXE 5ADPL 4LNRB 4P3CL 5D93B 1MHCB 4LCIL 3DHMA 4Y19B 3AXLB 3S96B 5HYSA 4G9FD 3QIBC 4XAKD 1QYGH 4HT1L 4MD0B 5GRJH 4WI6A 1VFAA 3D18A 4PJCF 3O9WC 4JJ5A 4WV1C 5TDPB 5EZLB 3P9MA 3CGTA 4RA0C 2CRIA 1EA9C 3WD5H 5IB3A 5SWSB 5C0CD 4FZ8L 1G7IA 1T5XB 2NZ9D 1MIEL 4D9RD 2EXYD 4RZCB 4AL8H 4H8WL 3U6RB 3EO0B 4M43L 1YA5A 2P5ED 2NY2C 3UMTA 2A6JB 2X7LA 3VA6A 4R4NC 2V2TB 5DRWA 3W11D 1LEGA 4IOSD 5HDBE 3EUUA 3HE7D 1NDMB 3EOTL 4L8SB 4FQCH 4JANB 1Q9WA 2YD8A 5CKAA 3ZKQD 1VKXA 4EOWL 1KN4L 4R7NB 2DQGL 4KK9D 1U3HB 2RFXB 5F9AC 3STBA 3PWVB 2UWEF 4QCIA 1TZHB 5TDOA 1EK3A 1QSVA 3VGAC 3GBLA 2APWA 4JY6A 1UC6A 3EJZD 2I9TA 3MLRH 1QR1A 4V1DD 3JSSA 2GUOB 3SN6N 1Y18A 4NWTL 5DEZA 4MB4A 4P4RB 1ORSA 3OG6B 3D39D 4Z7UA 2WBJD 5MI0C 5C6TH 1BOGB 4QRPB 3NFSL 2GQHA 1YEKH 5HHME 1KT2A 1NEZG 5L8LB 1KSRA 5FYLH 4M5ZH 1F4XH 2UY6A 2AEPH 4ODSL 3H3PL 4YGVB 2DM7A 3BD4A 3GJEA 2FJFB 4XP6L 1T1XB 4MXWL 4TVSa 3X14B 1MRCH 1MAKA 4Z18A 4Z7OF 3ZDXF 3F7VB 3NPZB 1I3GH 1NBQA 3FFCD 3GBNH 2AK1H 4LRNH 3F6IA 2NX5B 4CRPA 3VFTB 4TUKL 3NIDF 3HUJB 3HB3C 5LAXB 5MP6L 3VRLF 4NQEE 4I4WA 5J0BA 5MEND 4R7DA 1PBYA 4K07A 1OP3K 1DBAH 3KPRA 1CFBA 1QYGL 5HGHB 5GRJL 4U1LB 3PWNA 4QRRA 3EHBC 2F15A 2V6HA 1IGCH 3ZDZE 4XHJC 5FK9A 3WD5L 3ARQA 4XNQB 4JFFD 4N0FA 2DICA 5DQ9A 1J0YA 4AL8L 3IDMA 4L8DB 3VXQA 5ICZA 3JTSB 3OG4B 4PYGA 3OXRA 1EAPA 4B50A 4N1EA 3RTQB 1H5BC 3P3YA 3JVGC 3CFDB 2I24N 4FQCL 3RWFB 5BQ7A 5D7IB 1EGJA 1ZV5A 4LGPB 1FNGB 1HQ4B 2PYEA 5BS0E 1CU4H 1AKJD 1MCSA 1IJ9A 1NMCB 3RX7A 1EBPA 3MLRL 5HHOE 1ZHLA 1I85C 2YZ8A 4PBVC 3UBXI 4NO0A 2NZ9C 5C6TL 5IHUH 3DO7A 5HI5D 4NCC1 2ICEB 1ZHBA 3TEUA 4K8RH 3UZEA 1YEKL 3VFPA 4JRYB 5F7HA 3ARPA 4QRQB 4GW5A 5FYLL 5HGDA 1V8HA 1BZ9B 4P57A 1F4XL 3TO2A 4D8PA 3MX0A 3Q3GB 1GSMA 2XIDA 1QSFA 4F57H 4HG4K 2AEPL 2D0HA 1I1YA 4TVPE 3K46A 3S88H 4NQSA 4Y88A 2J5LB 4MQ7A 4JFEA 1F11B 1JI1A 4PJFF 4CDGC 3BHBA 5BMFH 3FL7A 2A2QT 3EYVA 4HX1A 2IEPA 3CD4A 3HZMA 1MRCL 3FO2A 3QEHB 4NT6A 2VRAA 4PRIA 1I3GL 2WQ8A 4F3FB 3GBNL 4OCXH 2AK1L 4LRNL 2R8SH 2QKIA 4J3VA 3EYQD 4KMQA 1X5GA 2LU4A 4X7EC 5F1OB 3PWPD 2E7LA 3MLTB 3R8BB 1DBAL 1FLTX 1M4KA 5DWUH 5DFVD 3UP1A 4PJDE 4WTZG 4YHIB 2VO5A 1JYXA 3O6FD 1G7PA 1IGCL 1O0VA 4YUEH 1RULH 1TQBC 2J8UA 3BRFA 1AO7A 2DQFA 1NCBH 5FYLD 2FLBT 3BIKA 4EI5A 5I1DA 5D2LB 1FNLA 3GSOA 5JXEC 3MXVH 1N0XH 4L3EB 4LLMA 2DJUA 4PJEA 4PV8B 4NKIH 1C12A 3P4NA 1EAJA 2DMKA 4U6VH 5C09E 3EOAA 3QDJA 5JHDB 4X8JB 1HH6B 4XTRD 3D2UD 5F70A 3QJHB 1PX4A 1NLBH 3VDAA 2AXGA 5F21B 4MA3B 5F3BB 1CU4L 5CGMA 3LPGA 5AUMB 3G5XB 4M48L 2QJDA 3N1GC 4C4KO 4TQEH 4LVHC 5BW7C 3N1QC 5F89B 3BN9C 4U6TA 3WL9A 1UQSA 1A22B 1XR9A 5ANMB 5B21A 4G43A 4HK3N 5IHUL 2EYRA 5I73C 4OAWB 4K8RL 2GITB 5FUOH 1TVBA 4P4KD 2VXSH 5DFTA 3ILPB 2CIKB 4XI5C 1YDPB 1VADB 2C5DC 4DVBB 4F57L 3PP3K 3OJDA 2ORBH 4POUB 5IVXF 5DQDH 1HI6B 3S88L 1T21A 4PJ7A 1BJ8A 5FYKE 5BMFL 3SCMD 2SEBB 2GJZA 2VN4A 4Z7QF 4QEGA 2VQUA 4DGVH 5GGSY 5MERB 2J8OA 3VU2A 3C09B 4YDJB 2JTDA 4HUXA 4OCXL 4JN2B 1DSFH 2R8SL 3IJSB 1NBVL 3L3KA 2EDFA 1OGTB 1P7KB 3M17A 3ROOB 5GRVL 2OQJA 3BPCB 1GCFA 3RI5F 5DWUL 2XQYG 5B3JF 3BP5B 3OKEB 5BVJA 3V5KB 5IB2B 4RSVA 3X13A 4YUEL 1RULL 4FQPA 4ZSOB 1NCBL 5AYQA 2Z92B 3HMXL 2R4SH 5HDOA 1TJIH 4BM7A 3NIGF 1S3KH 3MXVL 1CLCA 4PJGA 1I7TB 1OF2B 4X0KA 4Y1AA 2UY7A 2HJKA 5CSGA 1KPRA 1N0XL 2NLJA 3MFFA 5JDSA 4RBPH 3VGBA 3CDCA 4NKIL 3O3AB 4GRWB 1S8DA 4U6VL 4ODXB 5MHSD 4JM4H 4EDXA 4ZOAA 2BVUA 4DCQA 1BQHA 1NLBL 4WWKA 2GJ6A 2CDEB 3QUXC 2DBLH 5E2UH 2FO1A 4LVOC 4NHUB 5LJYH 1CN4A 5DFVC 5GRXG 1BMGA 2NX5E 1M7IB 1S7QB 2EDLA 4TQEL 3SGJA 3HUJE 1QBAA 3EZJB 1F6AA 2BDNL 4JZOB 1NCUA 1LHZA 5ACMA 2ERJB 5L2JB 1KC5H 3FO1A 2E6JA 1E4WH 3LEXA 5JIHA 3DV6A 3BMWA 2A38A 1PKOA 1A1OA 1EXUB 3V4VH 2AP2A 1OSPH 2YN3A 1ZT4B 5D1XD 5FUOL 1P5UA 1JN6B 3ZLQC 4U3XA 2VXSL 1E4KA 2ZKHH 1TVHB 2PTVA 2VLRA 1B2WH 5LGJA 1W0VB 1ND0B 2ORBL 3QIUD 5DQDL 4XTRC 1OCWH 3O8XA 2OXGA 4E41E 1EHNA 1BVLB 5A43C 1LD9A 3C8DA 5C1MB 5J3HD 3C6LB 3KWWA 4DGVL 1N2RA 2RJMA 4QF1A 1QA9A 5FF6B 35C8H 1G7HA 5K59F 1FVEA 1DSFL 4WI5A 4EJ1C 1R3KA 1TTGA 5B4MC 4P46A 2FX9H 3EJYC 3R0MA 4FQHA 4EDWH 1RFDH 5CAYB 3I84A 3DMMA 3VXOA 2D7NA 4LSVH 1XCQA 5DLMH 4Z0BH 4WFGE 3ZE2E 3MRQB 2D0FA 3GJFB 4NKDA 3IYLW 1GYAA 4K2UH 3KPOB 1WBZB 4M62L 2R4SL 1TJIL 3KNBB 3ARFB 3QFDB 1S3KL 3SCMC 5EORH 1ZLSH 2R1XA 3C87A 1U92A 4X6CA 1BREA 5DUPL 1IVLA 4OIIH 4JM4L 1BHGA 1T22B 2E7HA 3BQUA 5IOPA 4LKXB 3C60C 1KLUA 3U0PA 3AUVA 5JMRA 4NNPH 2JJUA 2DBLL 5E2UL 3FOLB 5EN2A 3TO4C 3QA3A 1I3RA 5D7LE 5T5FH 3AREB 3D25A 4X4YB 4PJ9D 1NGPL 2VDOH 5IMLA 4OQTH 1IGYB 5ECJE 3EYFB 1S9VB 5DJ0A 2BVOB 1KC5L 4RAHA 1E4WL 5CP3A 3KVQA 1FL6B 1LO5A 2IADB 4H1LB 1J9CT 3V4VL 4EKXA 1JI2A 3WFHA 1CR9H 5D72L 1NANH 3ZZ1A 3ARZA 3MNWA 2W60A 2AJXH 2ZKHL 3BKJH 1B2WL 5I19H 1ZWIB 2BP3A 5GS0D 5FAAA 4FA8A 4TNWF 1NGYB 1OCWL 2RB8A 4UNTA 3PGDA 3DO3A 1G7JB 5E70A 3RNKA 2FIKB 4X4XB 3UCRA 1RZFH 2FEDD 3JV6A 3VGDA 4GJTB 3O2WH 4KJWC 3WDHA 35C8L 4MA8H 2NQCA 4RFOH 4Y2DB 4Y4KD 3TN0D 1VENA 4O58H 5L2KA 3X12B 5C8JA 3MV9B 5D7JC 4WFHE 3BPOC 3QULA 2WIMA 1K4CA 1M7XA 2FX9L 1UZ6F 4ETQB 4EDWL 1RFDL 3U83A 3K1KC 1HWGB 4I18B 2BY1A 1ODAA 2IBZX 4LSVL 5DLML 5I17A 3DI3B 3Q5YA 1P6FA 4Z0BL 4FQQA 4XH2B 3GSWA 5INCA 4RX4A 2VQ1B 4XMKH 1WIUA 5C9JB 3B2VH 3OPZH 4UIMB 4U31A 4EN3A 4FZEH 4K2UL 4Q74A 5FGCB 4PREA 3MUJA 3GI9H 2D7TH 2A77H 5KVEH 1ZLSL 1NUFA 1YEJH 5J3HC 2DL2A 3INUH 5M95B 1DEEB 1LP9F 1I1AB 3FB8A 4OIIL 2BVQB 3AMLA 4M1CD 4QNPF 5CBEA 5C0GB 4EXPX 3TBYB 2PXYB 1RZIA 5CGYD 1DN0B 3HMXA 3BP7A 1RJLA 4L4VE 2GY7B 4NNPL 1NDGB 2QEJA 2LU3A 2G60L 4HZLB 3QH3B 3SPVB 4F33B 5JOPE 4JO2H 4KMLB 5T5FL 5CP7B 2ATPB 1PSKH 2VDOL 3D1MC 1DCLA 4OQTL 2HT2C 3TNNB 5ABDE 5C2BH 1OOAA 1G6RB 4XWOD 5E95B 1JL8A 5EG6C 4WW2B 2LE9A 4IRJD 4WEMB 1WVZA 1CR9L 4MQXD 5C0BD 3BEWB 4ZSOE 3VWJB 4ZXBB 3MZTA 2AJXL 4YBQC 3I50H 3BKJL 1ORQB 3NBNA 3I6KA 5I19L 4PGBA 3LKSB 2BOBA 1MCCA 3KYNA 3L5IA 3R8QA 5LCVH 3UROR 2LV4A 5A2LH 3F7QA 4EQ3A 4HXAH 1J05A 4GRWE 1RZFL 1CFSB 3QDGB 4X98B 5DK0B 4LLVA 4QRSA 3AM8C 4IIQC 5DS8B 3O2WL 4P5MB 2WBKA 2A9MH 4MA8L 3UAJC 3W0WA 5C07D 4O58L 3OKNA 4NRZA 1RUMH 4WI4A 4XC1H 2ESVA 3KHOA 5J13B 1TCMA 1Q94A 4YDIH 3AAZB 4LHQB 4ZTPH 4G7VH 4GW4A 3PQYB 2HFEA 1PW3A 1EFXB 1S9YA 2IQAA 4XT1C 4XMKL 4LARH 1QO3A 4XCFH 3B2VL 3THMH 2NY7H 1P69B 1G7MB 4U1IA 4FZEL 1GAFH 5DVKA 3T8XB 3GI9L 2D7TL 3LH2H 4FQXA 1JRHH 2A77L 4LHUD 4ZAKB 1ZTXH 4ZYKB 3ZYIA 5KVEL 1ACZA 1YEJL 2FEDC 3FB7A 5CWSB 1CXIA 3INUL 1ZEAH 2BMKB 1QQDA 3I6LD 3GHEL 3WEXA 5T5NF 2X4UA 4IOIB 3RGVA 5A2FA 1IGJB 4Z7WB 4IRSD 1WC7A 3C2SA 4F7TA 5IFJB 3QEGH 4QHLB 5EO1A 4I48A 1BVZA 3TZVC 3HC4H 5FM5M 3ARDD 1E28B 1L7TH 3V5DA 3QNZB 5JORA 2Y07H 4JFXB 3FQWA 5L0QC 3HAEG 2A6IA 1U8OB 1L6XA 4JO2L 4E9LA 1A1MB 3ARTA 1TENA 2KKQA 9CGTA 1NC2A 3WCYA 3OKLB 5FCSH 1PSKL 1FVDA 5C2BL 2X4PB 1HK6A 5DVLA 1S9XA 5LVEA 1NGWA 3OR7B 2YRLA 2GHWB 5BZDB 4BQ9A 3W5NA 3O4LB 5KN5A 4N8VG 3AS0A 5ESQB 2XZAH 3BW9B 4M1CC 4P2RA 3T4YA 2MQ0A 4QHKI 1MH5B 3V0VB 4KJQD 4Y5VA 2VDPH 1UB5A 5LCVL 3S4SG 4L8CB 2CUIA 5HI4D 1SJHB 3QIWD 1KXQE 4HXAL 5I66A 3ARGA 1NLDH 2H8PA 1QRKA 2OTPA 1AHWB 1LMKA 4GKOA 4P3DA 1JE6A 1FJ1A 2A9ML 2DM4A 3RIFF 3VXPA 1FO0A 4I0PC 4OKVA 2V9TA