5DRNA

Context-independent anti-hypusine antibody fabhpu24 in complex with hypusine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
b'EEQLKESGGRLVAPGTPLTLTCTVSGFDISDYAMIWVRQAPGKGLEWIGIIYGGSNKLAYAKWAKGRFTISRTSTTVDLKITSPTTEDTATYFCARGYGSMDGYDRLNLWGQGTLVTVSSGQPKGPSVFPLAPCCGDTPSSTVTLGCLVKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Hpu24 Heavy chain
publication title Structural Analysis and Optimization of Context-Independent Anti-Hypusine Antibodies.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 42
structure length 216
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drnA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drnA01
1OTUC 3UTZB 4F58H 1R0AH 2BNRB 2GQHA 5ESVB 1LGVA 4G7YH 4AENA 2W65A 3DGGA 3CLFH 3E2HC 5EOCL 4WCYH 3FHQA 5D1QC 2NXZD 1WQVT 3FO1A 4HFUH 2EDLA 4KXZI 3WEXB 4IRZH 5CFHA 2VKXA 1L7IH 1QACA 3KPSB 3L1OH 3MR9A 4P5TD 5IMKA 3EYVA 5HHXH 2H3NA 3QDMB 5GJSL 2JTDA 4YX2H 4KKNA 4NHUB 1RJZA 3GUTB 2CDEB 3QWOA 5C08D 1J8HB 4NO0D 3GMPB 5DD6B 3CFDA 2GCYA 2NXZC 3QDHA 5F1NB 5IEHA 2VIRB 4P5TC 5T3ZH 1SEQL 2VMFA 3SDXB 2QQNH 4OBRA 4LBEB 8FABA 3KWWB 1T1XA 3BPNC 3SKJH 1I1AB 5T5FL 2F9BT 2R2HB 1NKOA 4HJ0D 4LVHC 3GSVB 1Z9OA 1WITA 2XN9B 3D39B 1VGEH 4OLWH 5K9JL 1OAQL 5DJYA 1ORSB 3EOBA 4IIQA 4DOHB 3ULUL 1YY8B 4NQSB 2D03L 3IF1A 4HJ0C 2MCPH 3HI6L 4R0LC 1YEEL 1IBGL 4U6TA 4ZTPL 4I0PB 3Q5TA 1T5WB 3KPNB 1XZ0B 4L3AA 1HZHL 2HFEB 5BV7H 2RQ8A 3H3BC 2D4FA 4P5KA 3RTQA 1WCBB 3MGTA 4HIXH 5DD1H 4BZYA 4QXTA 5KSBF 3I6LD 4LQFH 2FHFA 3QQ9C 5BMFL 5I15L 2JE8A 1YEDB 3H9SD 4NJ9H 5FUZH 4IRSA 2X70A 2V5RA 5T1KA 2BOBB 1KUMA 3OXSA 2MPAH 3CXDL 3HAEH 3L7FB 2DD8H 3P4MA 3FOLB 4UNTA 5CILL 3ZE1E 1K85A 1R5IA 1U8NB 1HHIA 2A6JB 3MUGB 3VXSE 5A16B 1SY6L 3SEPA 2YN3A 4N0UE 3N1FC 3VG9C 2NW3A 4JO3L 3L9RB 1Q38A 1U8LA 2FH8A 4XBGB 5J6GB 3BGFB 3G5XB 1EZVX 4KKCD 4NNYB 3SJVD 4QNPF 1I9RL 3BESR 3OX8A 2DWDB 1CXHA 2JIXB 4HXBL 1X6LA 4KKCC 3ROLA 4YHIB 2AJZA 1RZ8B 2YHGA 1OTSD 3C2AL 1DBKL 4N0RA 3F7YA 2CLVA 5M95B 1G9ML 4UQ3A 3WO3B 3H3PH 3MRHA 2IG2H 3EOTH 1AQDB 5I1LA 1EAPA 3TNMA 5D7IB 1H5BB 1A7BA 1ZSDA 3WIHL 4FA8A 1SJEA 1MPAL 1T3FA 3PQYA 1UADC 5JPNA 5DJZA 1B4JL 4WY7L 4YHML 4S10A 3I50L 5C0ND 2F5BL 1AR1D 3IB4A 3GMLA 4K3EH 1HQRA 1AO7B 1DJSA 3QFJA 1F00I 5T3XL 4AL8L 5C0NC 1NFDF 5GS3A 1UFUA 4HG4K 1AR1C 4ONFL 1MFDH 3U30B 3QUMH 4P2QA 1IQDB 4JDZB 4ODTH 5DC0A 2GJ6D 3VFPA 1MAML 5HI4D 1G7MB 1NBVL 1F5WA 2NY5H 1JCKA 1KJ3L 1X5KA 2ICWJ 4NOFA 3MNWA 3O6LL 2RFXA 1YEJH 5HI4C 2VQUA 1KN2L 1J7VR 3PV6B 5ISZB 3MRDB 5FCUL 2QADD 4H25B 3UPCA 4XCEA 3M1BA 3BP5A 3SGJA 1FNEB 2CDFA 1MFAL 3PP3K 2J5LB 2XZCL 4R8WL 2QADC 4HJGA 3JVGA 5F9WC 3MFGB 3WDHA 2R4SL 4XAKE 1RZKC 5EBWB 1E6OH 3GSOB 5EN2A 4JGJA 3IXTB 3K46A 3I6LE 4PJEE 5DMKA 4JE4B 4WUUB 2NXYB 3WFEL 1ACYH 2B39A 4H88H 5I17A 3LKPB 5DZOA 3QAZC 2WBJA 3E2HB 3GJFK 1RULL 5D1QB 4HT1H 5ENWB 1AFVH 3FFCD 5EIIB 4EQ2A 2DDQL 1LEGA 4XXCA 4NQXB 3TP4A 4UOW0 3IFNH 2CDGB 2GAZB 1L7TL 4LPXA 5BVJB 1S7XB 4NSKB 2C1OB 4I77L 3SPVA 1MUJA 4W4OA 3BIBX 4P5TB 4GXUM 4X4YB 3KJ6H 3TA3A 5TH2B 3LQMA 5C08B 2LV4A 3SJVE 4I9WE 1RUPL 3RWHB 4FQHB 4O2CB 4LVHB 1K4CB 1M7XA 3G6JA 1K5NA 5CP7A 2NLJA 4WW2F 1IEAA 3NCFB 1B4RA 2BRRL 3IETB 2ICCA 2SEBB 4QCIB 1F4AA 4PRHE 1EGJH 4QHNB 5D8JL 2JB5L 3CNKA 3FN0H 3N50A 4LLVA 4LSUL 5FOBB 3MRJA 1FVDB 4E5XA 4K2UL 2H2PD 4LLYA 1M4KA 1RUKH 1C1EH 4KDWA 1ZT4A 4GJTB 4MD5B 4KZEL 2ARJB 2H2PC 3IDXL 3ARDB 5JMRA 1HWHB 4NJAL 4NZJA 3S5LB 1R5VA 3UJIH 3L3KB 1TJHL 3BISA 3F7QA 5CWSB 4XH2A 3IGAA 1MCIA 1BVLB 4HC1H 1PQZB 5J13C 3TV3L 2NY0D 2LQRA 2VXTL 3H9SB 5EU7C 4RAVA 2GJ6E 2IPTH 5T5NG 5FM5M 1MY5A 2R1YA 4FMFA 3VG9B 2GT9B 1FJ1A 2Y72A 5EZLB 3V5DB 2X41A 5ILTL 2NY0C 4WV1A 3S5LG 1BQLL 2HTKD 1OAZL 3MV9D 4MNQA 1EFQA 4YBLC 3MRMB 5TGBB 3CU7A 4DTGL 1YZZA 1R3JB 1IAOA 3RL2A 2ZWLT 4H1LB 4J7RA 3VFRA 4M9PA 3NA4A 5F7MC 2HTKC 1S7SA 2YSSA 4E41E 3ZKSD 3RVVD 4NM4L 3QHFH 1UM4H 4K7PX 4PIRF 2X2YA 4HUUA 1N59A 4WJ5B 1LK2B 4KK5C 2VR4A 3TO4A 3TBYA 4H8WC 5C0CD 5DWUL 1RZGA 1H3VA 4KJYA 3RVVC 3O2DH 1OY3B 2MCG1 1XR8B 2G9HB 3HUJE 3QHZL 5I8KH 5CLWA 2PYFA 4U3XA 3KR3L 5DVOA 4GKSA 3PWPA 1S7WB 2XYCA 3SBWA 3WLBA 4H1LG 3T08A 3DSNA 3B3IA 1OGAB 1A6VL 3QNYA 5GHWL 1RSFA 2Y07H 3WFBH 1QTYT 4JREC 3FFCE 5FM4A 3FQTB 1AC6A 4OZGA 2PO6A 1EVTC 2FEEI 1QRND 5A40E 4WTZG 4QOKA 5HGBB 3TGXA 4LP5A 1U95B 3HE7A 1QPPA 4YDKL 1CQYA 4NO2A 4WEUD 3CFJB 4XNQB 3V4PH 5B21A 3RNQA 2VABB 4OD2B 2D2OA 2XRAL 1SYSB 4PJCF 1CR9H 1WUNT 3D9AH 1A64A 3FQNA 3HZKB 3SY0A 1W72A 3SKMB 4QEGA 1CE6B 3OPZL 4A6YA 1JGUH 4PRPD 3DWTA 3IDJB 4OTXH 4U6VL 4D9RD 1OARH 4NQCD 2FWOB 4N8CL 4JCMA 4MLIA 5GGSB 1DSFH 1YEKL 4AG4L 4M1GH 1JPFB 1YQVH 2NCMA 4EDXB 3P77A 4JQXC 3K0WA 5HD8D 4ELKB 4JO1L 1Q0XL 5FFLA 4QXGL 2QADB 5F9WB 4RFNB 4UQ2B 1MJJB 1VGKA 4OCYH 3WXWH 2ITDB 4LSQL 3BKYH 3ZKXB 1Z9SA 2I07B 1X5YA 5HD8C 5K9QI 3B5TA 1U8QB 4BQBA 5DHVB 4MWFA 4WVRA 3EO9H 4FQXA 3CPLA 2VDLH 3HPJB 4X9BA 2AGJL 2PR4L 1MJUL 3UJTL 4P4KB 4GBXD 4DAGL 5EU7E 5EA0L 2BXYA 2ADJA 3SO3C 2HJFA 3PWNA 3BGMA 4OZHB 4QF1A 4Q2ZB 3FONB 4GBXC 5I8EA 3Q3GB 1ADQA 4OZIB 4F58L 4FXGA 3ARRA 4M93C 4XPGH 3GSQB 1R0AL 3HRZB 4CADA 2H2SD 2X4PA 1NAMB 2NW2A 3PWLB 2GKIA 4NN5C 4U3HA 4WCYL 3B5HA 5EZJA 2IANE 1FL6A 4JRXA 1CGSH 2A9NH 1S5IL 2YMXL 4PRNA 5DMIL 4B50A 1JGVH 2PCPA 1MFBH 3I9GL 1OF2A 4KKBD 3QUXB 5E1AB 1X5XA 4R7NA 4YX2L 4HWBA 2H2SC 1G9EA 1E4XH 4NQTA 6FABH 4DCQB 1SM3H 3K8LA 1ZHKA 4KKBC 3RKPA 4BELD 4JFOB 2AEQH 4RISH 2V2TA 3SKJL 4KQ4L 3BYTA 4ONHA 4PBVC 3VW3H 4AYFA 3VGAB 3OKLA 3MV8A 1U6AL 4JFPA 5BW7A 4HIIA 4YHYB 4OLWL 2VXUL 1QR1A 1B0GB 1ZE3C 2IWGA 1NCBL 3ZSSA 1WEJH 1ZHNB 3Q6FA 3VFTB 4HIHA 5EOCJ 2FJHA 2YPVH 3MLYL 3GSNB 4XMKL 3D3VB 5L2KE 1RJLB 4J6RL 2X4RA 3ULSB 4U4BA 5HXMA 5J13B 1NCAL 2NZ9D 3T2OA 5EWIL 1UWEL 5KVDH 4X5XA 3VFVA 2CQVA 4LKCB 2LVCA 4TNWF 3P73A 1FPTL 4G6FB 5DI8A 4Y1AA 3ZYIA 9CGTA 3LEXA 4P9HH 4OLXH 4NJ9L 4F7CB 1X5ZA 4X7TA 2WK2A 4IIQC 3NZ8A 3UTSE 1FG9C 2NY0B 4I3RL 3EYSH 4J8RB 3W81A 2ZG3A 1CFQA 4XB7A 4M8QA 4K3HA 1A0QH 3L3OB 4PRPE 3WMSA 1MQKL 4IHOB 4D9RE 1UKQA 4NQCE 4IRSD 4WW1B 1G0YR 3MV9B 1MWAB 5T1KD 1DE4A 4U1JA 4BQ9A 3QJFA 5DVLA 3I6GA 2GUOA 3ZT5A 4ZUSB 3KJ4B 2DIBA 3FO2A 4IRSC 3ZE2E 5SWSA 4N8PA 3KYOA 3JV4B 5HHQA 4K7PL 4EZMA 1YN6B 2AJSH 2XZAH 3BP4B 3S3PA 1BP3B 3U46A 1FAIH 4WEBL 2FO4A 5C0CB 3WSQH 1EHLH 1IM3A 5TFSH 4G8GB 1NEUA 2JF1A 3GBLA 1MAJA 2LU7A 3U48A 4RWYL 3S37H 1P5UA 3MGOB 1RFDL 4FQIL 2VZ3A 2GY7B 1JYWA 4I3SL 3KDMB 1RK1B 2C3WA 5D5ME 1J11A 5HPMA 1QRNB 4PRAB 4NZTL 2L4OA 3PQYD 5E7BA 1S7TA 4L29B 1XGRB 3OHXB 4MJ6B 2IFFH 3EFFA 4JG1L 2FD6H 3HC0A 4LIQH 4U1LA 3CFCL 4B53A 3GK8H 3MRCB 2DBJA 1T2QL 3QFJD 2DLGA 3X12B 3QXDB 5DS8B 4NQVA 2E7BA 1RIUH 2NR6D 1QEWA 1VHPA 4CJ1A 1HCFX 4ELMF 4NWUL 4TSAH 4FQ2L 4P2QD 2GSIA 3IDNA 5CD3A 5DJDB 3NFNB 3TPUB 3BHBB 1X7QB 5JHLH 4OGAD 5IMMA 1LO0H 4LF3A 4XBPB 5EPMA 4F7TA 3R1GL 4JPKH 5IB3A 4OGAC 3H7BA 5J1AA 2NY3B 5TQ2L 2QQLL 4WFED 2J8UB 4HUWB 1MJ7H 2DRUA 5GGSY 2C4XA 4TUOB 3UDWC 3BO8A 3DVNA 3BZEA 3EW3B 2X4QB 3G5ZB 4FTVA 4GBXB 4HGWB 4O2FB 4M7JH 3LKRA 4D0DB 4TPRL 3RNKA 1UXSB 3OZ9L 5DHYA 1KB5B 3RDTB 4HT1L 3QRGL 4ZO7A 1JF6A 3SGJC 4O4YL 43C9A 1KELH 1BQHA 2Y36H 1D5XA 4JFDA 3QUKA 4XBEL 5AAMA 1LDPH 3IFNL 3JVGC 2W60A 3UP1A 1KGCD 4QHLB 2D7NA 2X05A 3DVIA 2WBJD 5LCVL 1LO5B 4KVNH 1UZ8A 3QIUA 2HAZA 2AXHA 3EYFB 1NCCH 4XGZA 4OQTH 5CIPB 3FB6B 4QHKI 2MNUA 1AHWB 3O6FD 4AENB 1WBYA 2WBJC 5FGSA 5L7XH 4X6CB 5F21B 1QFUH 4MVBD 1HQ4B 4ESKA 5IQ9B 5DK3A 3GSXA 5K9KB 4XXCC 2VDQH 1PG7W 2BX5A 4Z95L 3TA3D 4XMLL 3O6FC 2H32H 1PEZA 3LHPH 3BVNA 5C09D 3UZEA 3CFDB 3SKUD 5IEHB 2BSTB 4W4OC 4EXPX 4LVNC 5K59F 3TA3C 1CF8H 1RUKL 3MPCA 4F33B 5KANG 1HKLH 3UZQA 1CGVA 3FQUB 3EDKA 3VJ6B 5I73C 3JWDH 2VSDA 1F3RB 3QEGL 4MXVE 4V2BA 4C57C 3PQYE 4JO4H 2O5YH 3BH9A 1OAYH 4GG6B 1S5HB 4PREA 3C09C 5DRZA 2OJEA 1IC4H 5CZXD 2IPTL 1ZXQA 3UTQB 5IFJB 1A6TB 1CLYH 5I18L 1ZVSB 3X17A 1RHHB 4OUOA 4MXQD 5CEZD 2BSED 2VL4A 1U36A 4P2QE 3ZDXE 2A74A 1GZQB 1JVKA 1JFQL 3QULB 2FATH 1BAFH 4Z77A 2B1AH 2AJ3A 2BXZA 1DQJB 4MXQC 3IXAB 3T1WA 4NQDA 3WNNA 4MD4B 3TIEA 4LLDB 4JFZL 1J9CT 5B3JF 2N1KA 5AD0A 1HHIB 3FQWB 1BF2A 4X7CC 3HE6A 3GI8H 4MNQD 3K81A 4P23A 1U92A 2OTWB 5D1ZA 5E2UL 2CUIA 2BVQB 4DK3A 3S35H 3HI5L 3J8F7 4WV1C 1F2XK 3F58H 1IGYB 5DSCA 2B4CH 1RZIA 1X5AA 2BZDA 5FA4B 3FT2B 4GRLD 1CK0H 1JJUA 1KEML 2R0ZH 5L6YL 4EUPA 1BZ7A 4I13B 4P2OA 3S37X 3I84A 3MUJA 4U7SA 3QCTL 1J0IA 2YZ1A 4UV4L 4GRLC 4JR9H 4OQ1A 3NFPB 2A6IA 4ZQKA 5F6HI 3WJJA 1OP5K 4AQOA 2CLRA 1HHGB 3TJEL 1KGCE 2BY2A 3V4PL 3VRJB 4PP2A 4NZRH 1GGUA 3OKNB 4MB5A 5DUBA 1GAFH 4JZJB 3RHWF 3MXVH 3V7AG 5ERWB 4PJBB 2PO6D 3MTRA 4PBXA 1A14H 1CFVH 3SBWC 1HYSD 3D9AL 2P7TB 3QFJB 4K3DL 3A6BL 1CIDA 3HB3D 2NZIA 1RVFH 4WENB 1AKJB 3KPRB 3X13B 1JGUL 2PO6C 5IW1B 1HYSC 3SO5A 3HE7C 1LWRA 3FO9A 1LO2H 4W6XB 2FGZA 3HB3C 4M1GL 5D1XA 5DRXB 1P2CB 2OSLB 1FSKC 4PJ7B 5L9DH 4MQ7A 3CX5J 3G6JE 2YD6A 5GGRB 1GGIL 5IHZB 3VDBA 5EUOB 2MQ0A 2DQTH 4Y19B 2RFXB 4WDIA 4JDVA 4MNHB 3ULVD 1YJDH 2BC4A 5EZIH 3GJEA 3Q1SH 4MDJB 3DXAB 2APVA 4WWID 4AT6A 1G6RB 5I1IH 2FBOJ 3SQBA 1Q0YL 3ULVC 5FGCB 5FF6A 2EDQA 4MAUH 5I71C 4FQXD 1E4XI 1KTDB 4MD0B 1YNTB 3QUYD 3I3BA 2MSPA 4JY4B 1F2QA 1HH6B 3DO7B 4RFEA 4HGMA 1DEEA 1QO3A 1RQ5A 3DHJA 2R0KH 5LBSH 1CG9B 4FQXC 1ZS8B 4GAJH 3OR7A 3QDAA 1CGSL 3RX8A 2N56A 1JGVL 2ZUTA 1MFBL 3LB6D 3V95A 3LZFL 1EHAA 2UWEB 5I8CB 3C5SA 4FQLL 2F8VA 3L3IB 4Y7MA 3OR6B 3KPLA 3O6FB 3D69A 4JRXD 4HX1A 3LB6C 1KPVA 1AXSB 3MJ6A 2AEQL 3N9GH 1DN2A 1KJ2H 4MNQE 4RISL 5A2JH 5IB1B 4LRNL 3NCYS 1CD9B 1U8IA 1UB6A 1EEZA 2X4UA 2EICA 3QEQA 2FL5B 4PJ5D 3VG0L 2R2BB 5C09B 1Z9MA 2XY1A 3HZYA 1N0XH 1UCBL 5FDYA 3MRGA 2F53A 4L8SB 4OF8A 3BSZH 4UI2A 2NLJB 1A3QA 4JRYA 1DDHA 1LE9A 1JGEA 1PYWA 1HH9A 4K71B 3S6CA 3ARFB 4JG0H 4CW1A 4P5MB 3NGBC 4I1NB 4G6AD 4NKIH 3C09B 1I1YA 3PWPE 4E0RB 5KVDL 1AGDA 3VU2A 4KJPD 3TT1L 3BKCH 1FL3A 3O4LB 4M4PA 4OIAA 4LNRB 5DUPH 4QHMB 4YHKH 5BW7C 1ZT4B 1QNZH 4G6AC 3QEHB 4X8JA 5DFWH 5I75B 4OZGE 4PD4J 4S1QH 4NO5A 4QOKE 4KJPC 4DFHA 3MNVA 1OTTD 3AAZA 3BN9D 3STZA 1U8OB 2Z91A 4AEHH 4Y1AD 5IJKC 2DYPB 4AIZB 1IAKA 3WE6A 5DRNA 3FB7B 4ODXA 1T03H 2E9JA 3HNSH 4DGVH 2VUYA 2XOTA 1IGMH 3MRBB 1NDGA 1OTTC 4JY6A 3BN9C 2FJFA 4YR6A 5I1KL 1F02I 2QQKH 2GJZB 5AWNL 5D96C 4ZUTB 1LK3H 3RJDA 4GW1A 4AEIH 3H6JA 5B39B 3EKCA 5IVXA 1II4E 2EIZB 4HZAA 5DLMH 1U8JA 4MB4A 1I8LA 5TE7H 3GIZL 1HOCB 2KKQA 4B7LA 4CVXA 2WINB 3C2SA 1XR9A 4OF5A 3DVFA 4X5WB 3IJHB 3WSQL 1DQDH 4KZDL 3T09A 4Z7VA 1CI5A 4PJFF 2HWZH 5D7LA 4NT6A 5TFSL 5JHDB 1WZKA 1QSEB 3GMQA 3ORJA 1T2XA 2EDTA 1MNUL 2XKNA 4WRLA 4XNYH 4GRLB 4PV9A 4QTIL 4GXUN 1A1OB 2E5EA 3MFFB 4HZLA 3S37L 2V17H 1XF5A 4YNYB 5B39G 4X6DA 4F7MA 3ZKND 4UUJA 1BD2A 3FOMA 5MENE 4UILH 4YGAB 4GAFB 1I75A 4IOFD 3B2VL 4HW6A 5I1CH 4KAQH 4PY7A 5C0GA 4NPYB 4U1SA 4OUUA 3ZKNC 4ISVA 4QO1A 1ZT7A 1SBSL 3EOAA 5HHNB 4IOFC 1BIHA 2IBZX 1V8HA 4NC2B 4LSRL 1O5DT 4HEPG 3WO4C 4JRXE 3S3SA 5EORH 4R97B 1IAIL 4PJIF 5FO9B 3VXNA 5FK9A 4HK0B 4JANA 5ACZA 1VEOA 3PDOA 1MRDH 1FFOB 1OQXA 5DK0B 1ND0A 2OJZH 5DTFB 2GIYA 2RR3A 1OWRM 4KJWD 1R3KA 5KOMC 5I16A 1TXKA 2YD7A 4QTHA 3BDYL 4JPKL 5D70L 4ZXBD 4HS3A 3VXUD 4MX7A 1FBIH 5D2LB 1D7FA 1JPST 1WAAA 3VFUA 4KJWC 4YHZH 4YEFA 3MV8E 2AEWA 4PD4K 3QH3B 2JJSC 4CKVX 3HPLB 4ZXBC 2HFGL 2FLRT 2CH8A 1IZKA 4FFWD 1NGPH 4RIRB 5C0IA 5GS2D 1GGCL 4G43A 1DQTA 4G42B 3HG1A 2ID5A 4OCWH 4RGOH 3GHBL 1WWBX 3BP6A 1K2DB 4BH8A 4L1DA 3VXMB 3JXAA 2H45A 3QUYB 4ORGA 4FFWC 5FECA 5E8NA 5FKAA 3ZTNH 2ADJB 2N7BA 1LDPL 3UYOD 4Y1AE 1JYNA 2AJVH 2DLFL 3N1QC 4G6KH 4TSBH 5D7KE 1GRWA 3OMZA 2X1OA 1NCCL 2FIKA 3ZLQC 4F15C 3GGWA 4OQTL 4JFDD 4FXGB 1NMCB 1AD9A 2RJMA 5DRWB 5FXCH 1PX3A 2XWTB 3BWAA 1I7RB 3H8NA 3KPMA 1NUDA 2Q20A 4X9IA 5KOVC 1NBYA 1AD0B 2ZG1A 3DX9B 5BS0A 5JQHC 4NUJB 2NY6D 1DLFH 4PJ5B 4RGNB 3GKWL 2XACC 2EDEA 5SWSE 2DAVA 4Y8AA 1CF8L 3OF6D 4O2EB 4Y4HA 3BKJH 4PJAA 4QYOA 3V5KB 2B0SH 2NY6C 4AQ1B 3OAUH 1H3UA 4X6FA 3OKLB 1Q9WA 4HS6A 4C56E 4EOWH 1S8DA 5CUSH 2DQEH 2HVKA 2H9GA 4TQEH 4NKMA 4UT7H 2NY4D 5JNYB 3NTCL 3BT2H 2Z9TA 4MHHG 4JO4L 2O5YL 4F2MA 1OP9A 3LEYH 2XT1B 2MTPA 1OAYL 1FYTA 1FRGL 1TVBA 2DKMA 3FQRA 2MFNA 1WFUA 4LCYB 1EJOL 2NY4C 1IGTA 2XPGB 1TPXC 3O45A 1JPTL 2ZPKL 2W38A 1BVKB 4NWTL 2YXMA 5EU3B 1IT9L 4DUWA 4LSTH 1H15A 4MJ5B 2IAMA 4LPWA 3PUCA 4PJGB 4ZNCD 3OKMA 2K7QA 4OZ4B 3NIGE 4XNZB 4JM2F 5EH1A 3LMJL 3DUSA 4QHKJ 5SWZA 3CLEL 4LSSH 1F42A 3HMWH 5H37H 2FATL 5GSVA 1OLZA 2AQ1A 4X98B 3JBG7 2AXJA 3B9EA 4G9DB 4NNPH 2HFFA 3E0GA 1CQKA 3GJFA 2AJUL 2FSEA 1IM9A 1INQB 4LVEA 4PYHA 1J1PL 3A0OA 4ZUWB 4QHUA 4MZ2A 3RRQA 2HJKA 4KRPD 5EBMB 3I6GB 3NIDF 3LQAC 1KF9B 5HGAA 4Z7QF 3KYOB 4KRPC 5D1ZD 2P8MA 4P3DB 2HKHH 2OL3A 4GT7A 3RKDD 3SDDB 2DQGL 5B38B 1YEIH 1FORH 5GQBA 4FTVE 3LS5H 1NPUA 4P23C 4ONOA 2CLZB 5GS1B 2F5AL 5D1ZC 2HT2D 3IFPA 2VL5A 4YO0A 5IG7A 1U3ZA 3SDYH 1GPOH 4CRPA 4P2OD 4LSPH 2VE6B 1GZPB 4TNWK 4GMSH 4NZRL 3PGCA 1BQUA 1PAMA 3WO4B 1A6ZB 1U91B 3RJQB 1A14L 4EI6B 2HT2C 4JFDE 2DWEA 3FB5B 1T0NA 4P2OC 2W0PA 5ACLA 1S7TB 1RVFL 4ZFOA 4U49A 4O02H 2DM2A 2AABH 2XWBA 1P53A 3EFFB 3WJJC 1HXMA 4F37K 5LVEA 1NGZB 2Q86A 2ICWA 5EU6A 1F4XL 1DR9A 2D0FA 1L0XA 3LRSB 1OAKH 1UQSA 3CXHJ 2C26A 4JFHD 1MF2H 4O00A 3ZE0F 1ORQA 2ZNWA 4Z0XA 4D3CH 4ZXBB 2GSIB 3VXUB 5JLZB 1AGFA 2P4AB 4NQEE 5T1MA 2WIMA 1EBAA 2DICA 3VDCA 5MHSD 5D1XD 1N8ZB 1YJDL 1G0XA 1W2KT 2DLEA 4RSVA 5E00A 5GRJH 1Z0MA 3W9EA 5I6XC 1GGYA 2R8SL 5EC1B 3QEUB 4GFTB 5SWQA 1LVEA 3BQUA 4PJHB 4OD3H 5KSAB 5D1XC 2C9AA 5IB3B 1P6FA 2EH7L 3WNMA 3ZHKA 5J1AB 5F6HJ 2O5ZH 2VDRL 3MRFB 4ZFGL 2BCKB 2PF6A 1GC1C 4M02A 1FL5A 2J6EH 3FN9A 2FECL 2Y7QB 3JWOL 2V9QA 4OI8A 3NCMA 1KFAH 4OF6A 1IMHC 5LBSL 4U1HB 3ZDYF 1A6AB 4PLKD 3I3DA 2W91A 3VI3F 4UB0L 4M7LL 1HSAB 3TIDA 2UZXB 5F3BA 2VZTA 3T3ME 4LQ1A 3NCJH 2HLAA 2P8PA 4Q7DA 2EC9U 4MA3B 3EDFA 4MA8L 2BVEA 4P2YA 3AS3A 1A8JH 1GH7A 3FL7A 3B4NA 5C6WH 3BD4A 2VC2L 1RK0B 3T3PE 4FRWA 1FZOB 4Y4KB 4QGTA 3PHQB 4JKWA 4H1LH 4RQQA 4DGIH 1AXTH 4XGZB 4NGHH 4NQDE 3FHAA 2F74B 4TUKL 3SDXF 2Q1EA 3VD7A 1MCPL 1S9XB 3TBTA 3HFMH 2HTLD 4WFHD 2IC2A 1LILA 1NANH 2Z31A 1CLZL 4PB0L 4M5YL 4ZUUB 1U93B 1NQBA 2HTLC 4ERSH 1M7DA 2GTWB 4DN4H 3ARGA 2F53D 4EEEA 3V4VH 2VSCA 2PTTA 4HKJA 4KI5D 4ZS7L 1TPXB 4JRYD 2I9TB 4M7KH 5E94A 1QNZL 2AJXH 2HFTA 3VI4F 4U1KA 5CEYB 3L7EA 5FV2A 2FJGA 4KI5C 4S1QL 1FIGL 1Q94A 5LJYH 1N64H 4PJ9A 3WXVH 5IHBA 3VFSA 5DMYA 1V5JA 3IFLL 1S7QA 5IF0A 4U6XA 4QRQB 1J18A 4QWWD 5SX4H 4WI4A 4DZBA 1XCTB 5KTEL 1A7QL 1IL1B 3GEWB 4PREB 3I02A 1T03L 4V1DA 2FH6A 5FDWA 3TN0D 3RWFA 4DGVL 4OB5H 1A7OH 3Q6GL 5FIEA 4CU7A 2R0LL 4UNVA 5BCAA 5LXGH 2J88L 4QWWC 4FABH 4MMXC 2OTUB 4KTDH 5FKPB 4JFHE 4K9EL 5IEKB 1ZT1B 2JLLA 3WYRA 4KK6D 3TN0C 2NMSA 4FZEL 4JGUA 5IVZA 5DLML 1MI5A 3X11A 1S7UB 2VQ1A 4Y2DA 4ORZC 3QDJA 5MHSE 1F90L 2DS4A 2QSCH 3IDIA 3L3DB 4FMKA 4UTBH 1H3PH 3C5ZD 5LGJB 5DO2D 2NX5A 4XC3L 5FYLL 1DQDL 4KK6C 1QSFD 1XH3A 4G6JH 4U31A 4C4KT 4NO3B 3ARBB 4H26A 3VGGA 1CDBA 1RZKH 3G5YB 5I8OL 1EO5A 4JVWA 5HJ3A 1KLFA 4YHOL 5DHVH 5E5RB 3VE0A 4I4WA 1Q9OA 4DJMA 3RGVA 5CSZA 5DO2C 5D1ZB 3DX8A 5J3HD 1IC5H 4ETYA 5D7IF 3BH8A 5GGVL 5D7LD 1CFNB 1I8LC 5DSCB 4N0FB 5GPRA 4AY0A 4M6OL 4A2LA 3REVA 3T2PA 5I1CL 3O9WD 1FO0A 2MKLC 1NLBL 3EJZD 4BFBD 4F57H 3UO1H 4FNLH 1NAMH 3U1SH 5AYQA 2DMCA 3EJZC 5HHOB 3IYLW 4G6ML 3T1FB 3GIVA 1T66D 5KS9A 3UBXA 3TBVB 3MLWH 4LU5H 3B5GA 2X44D 2I9LA 1IFHL 2HVJB 4APQA 3E3QC 2GTZA 4LVOB 3RWGA 5ICYA 1H0DB 3UTTA 5BRZA 3QWRA 1SYVB 1CGXA 1T66C 2XI9A 5H2BA 2BFVL 4KRNA 1HEZB 3IAQA 4EI5A 4HPYL 3HLAA 5ANMA 4BM7A 1UXWB 3NIFE 4TULH 3IAPA 3GSRA 3RY5A 1FZJA 3QEQE 4JJ5A 4OLEA 2V6HA 4LARH 2X4TB 2M2DA 3RP1A 3RA7H 2RHEA 4GQPH 5FYJL 3OAZK 5DQDH 1S3KH 3CSPA 3DTXA 1INEH 1T2JA 3GO1L 2EYSB 2F53E 4NFCA 2Z8WC 3GSNH 1QKZH 3UC0L 1NGPL 1T6WA 1VACB 3SQOH 3P0VH 1I9IL 3PE9A 3TBWA 1P4BH 2W9DL 4YK4B 3LEVH 3LPFA 4MNGA 3I6KA 4XCCH 3U9PH 3QI9A 5CMAB 3CIQA 4XMPH 4XZUB 4Y89A 2BC4B 3F7PC 4WFFD 1W0WB 2CK0L 1CD1B 3P9LB 2D7MA 3WL9A 2HRPH 3ZTNL 1LMKA 3LPWA 1U8PA 3V52H 2H8PA 3MJ8B 1NCDH 3BYYA 2VLLA 5JOFA 1QSVA 1WSST 3FAXA 3RHWK 1SMOA 2Q7YB 1B2WH 3PJSA 1CT8B 1DQMH 3O3EA 5JW3L 3V6FA 1HDMB 4KMLB 4QXUH 4RNRA 2P8LB 1FFQA 1CXIA 5J8OA 1WJ3A 3ME0A 1MWAH 1UVQB 3NACH 1IGIL 3BE1H 4G8FA 4UIKL 2ICES 3HS0B 2WAHA 4LCCB 2VLJA 4WTWA 4MMZC 2ESVE 4DKEH 2K1MA 1DLFL 5KJRL 2EE2A 3P0YH 5IVXE 1MHEA 2J3SA 1WFOA 5J06A 2F8XC 3QT2A 4GRWE 1DN0A 5DMJB 1D5BB 3BKJL 5J57B 1HI6B 1Q1JH 1M05A 3T0XA 3LOWA 2B0SL 2PXYD 5KVMC 3KYMB 5E8EB 2XIDA 3X3FH 2X4OA 32C2A 4Z7VE 3MRNA 4XT1C 5CUSL 5TJWK 4TQEL 5D7LE 1I3RA 3O3DA 2EDKA 3QQNA 1PX4A 2CKNA 4YFEA 1BECA 1GHFH 2E9BA 3MRGB 2PXYC 4Y4HD 3BT2L 1MVFA 2YXFA 4AM0A 4U1MB 3U4EB 3KLAA 4GAYA 4JRYB 3KLDA 1PYWB 1NCUA 4I3GA 4QY8A 3PP4H 2CXKA 3M45A 5F9OL 4X9GA 2IGFH 2B5IB 1BD2E 4QRRB 2VH5L 4Y4HC 4U7KA 3D1MC 3E3QE 1GIGL 3RUGA 3ZHLA 4L8CA 2DQDH 2PYEB 5EDXA 1FYTD 5CP3H 4OGXL 1IKFL 4LSSL 1AP2B 3MOQA 4BSWB 1U3YA 4CU8A 4H20L 1KENH 3TN0B 4TUJA 1FLRH 4HIJA 1FVEA 1RMFH 1YNKH 5INDB 4PRIA 3D5OF 4OCSH 4NNPL 1HSBB 2IAMD 4ZPVA 5F7WC 5DK2B 4NDMA 3ARUA 5SWZD 4E9LA 3MRRB 4MA7L 5F7FA 2XWJB 3OV6A 1AI1H 2IAMC 4HKBB 2LE9A 3VXQB 3C5ZB 2FX7L 1R3HB 5AZEH 5FHAH 5DFVD 3PHOA 3KAAA 1QSFB 1IM9D 2BJML 1T20A 2HP4A 4XNXL 5BO1L 1WAAE 3ALXA 3CCHA 4FQQB 3CDGB 3V6BR 2VDNL 1QFHA 2XKUA 5DFVC 4F9PA 1D5ZA 3VXOB 1I8MB 1FDLL 4WFFE 2X4SA 4Y16A 2K7PA 1ZV5A 5JZ7D 1H3WM 5H35A 1OSPL 3HG1E 3BZFA 1KB5H 4XPHH 4PV9B 1GPOL 3O9WB 5CHNB 2QSVA 2VXQH 3V6ZB 4HZLB 3QQ3A 5DURB 2P45B 2YD9A 4EVNA 4X6DB 1T21A 2E9IA 3QCUL 1CXFA 3X14B 5HHMB 3IRPX 3MJGX 4UDUA 4ZS6D 1QG3A 2YA0A 1N7MH 3TYGH 1V3LA 5CBEA 1SJHA 4ZOEA 3S8WA 1BX2A 1OPGH 2AABL 1F4WH 4TTGA 1BMGA 1DBJH 4YFLF 1AR2A 5CIPH 2V2WB 4K23L 2EIDA 4ZS6C 4IDJL 5DQJA 1PSKL 1KIQA 1OAKL 2R23A 1JWUB 4RMVA 4XHQA 4P2RA 3OG6B 5DZNA 3WFDL 2F54A 5F7DA 3MLZH 5CJOH 3VRIB 5IMLA 3W9DA 5FK9B 3HTLX 3T77B 3RY6A 5BS0E 5EBLB 4WWKA 4GW4B 1KJMA 1D9KB 4LHQB 1R3KB 2ZCLH 2P5WD 5IOPA 4WO4B 4PJAE 2XA8H 1J1OH 3EAKA 1QQDB 4PGZA 4OD3L 5C07D 2IFGA 4HCRA 5C7XH 3OXRB 2O5ZL 3MACL 2NY2D 4PTUB 3FKUS 1WTLA 1BGXL 1OB1B 5JQ6H 2R1WA 2Q7NA 4HV8A 3BQUD 2J6EL 3B43A 3CZJA 3LN4A 3RWIA 3MA7A 1KFAL 5L0QC 4OZHF 5C0BB 3F12B 1FYTE 2CO7B 5JXEA 5KVEL 3QNZB 3BQUC 4BH8B 2OI9C 4OZIF 1I7ZA 4HIEA 1EZVY 3HNTL 5LGKA 2IQAA 3VA2C 3BRGC 1UJ3A 1CDIA 3DRTB 4KK9D 3U4BL 2OXGA 3H9HA 3N85L 1L0YA 4U2ZA 5HYQB 1JYXA 1E28A 5SWZE 2FIRT 4WNQB 4KK9C 1AXTL 3D18B 1XF1A 1H8OA 4MJIA 4ODHH 4NGHL 5KSBA 4BZ2H 2G5BA 3STLB 2ADIA 2PETA 3FFDB 2VTFA 3ARPA 2CIKA 3T2NH 3VGEA 1I7TB 2UY6A 2XQYK 1IGCH 2QJDA 3AFLA 4MXWH 1P84K 2PXYB 5SX5H 2A83B 5DVNA 4BUHA 5HDBE 1TQCB 2VRAA 1CVSC 5F7EH 1BWWA 3V4VL 4JLRA 4PGCA 4QRTB 4YFLI 1K8DB 3E8UH 3MX0A 5C0DA 4M7KL 3DETD 2APBA 1KC5L 2KL6A 3REWA 1NGWB 4OFKA 1NDMB 3V0VB 3WDIA 5D4QA 2P47B 1M7IB 1EDQA 4NKMB 1DLHB 4M4RA 2Z31C 2JK5B 3DETC 1JWSB 1JPGB 5JORB 4MDIA 4PG9A 3T65A 2IMNA 2AK1H 1UKSA 4XB8A 3WKMH 2YBRA 1N6VA 2CMRL 1FN4A 1F97A 3EUUA 4PJ9D 4HQQH 1S9YA 5LXGL 4ZSOB 1ZTXH 2YPKB 1B0RB 3VD3A 1RURH 5LAXA 5E08H 1MCLA 5MEOB 5GGQH 4PJ9C 1DVFA 5A3ID 4V1DD 2W0FA 1L0QA 1T1WA 3PHSA 4KQ3L 3HMXA 5E2WH 4JQVA 5EU6E 3LDBC 5GSVB 1T0MB 2GW5A 2R15A 7CGTA 1R6VA 3N0PB 1H3PL 4OV5A 4YWGL 1UH4A 1CFSA 1NFDA 1WWAX 3IDMA 1C5DA 4HF5L 1A6PA 2QHRH 3C5JA 3U0TB 5A3IC 3W11D 2AEIT 5GGTA 1RZJH 3QPXH 2BOCB 4YDJB 5J6HA 1KLUA 3GMMB 4ZYKA 3QDJD 4YDVA 1NAKH 2AXFA 1QLRB 5DJXA 3S96A 4LEXL 1ZLSH 3MODL 1GL4B 2NX5D 4U3CA 4CN6A 1G6RH 3GBMH 3W11C 4WEMB 1MCHA 3SKNA 4OD1L 3L6FB 2EZ0D 2P44B 3OGOE 3ZSTA 1X5HA 2YS4A 4YUEH 3RGVD 5BVPH 3LKNA 4BFIB 2EEDA 3UO1L 2FNBA 2EZ0C 3PWUB 1I8IA 2FR4B 2WWMC 2CRYA 4HDIA 3D25B 3IDYC 4P46A 1PKQA 3RGVC 5T1DH 3BAEH 2EDBA 3O41A 4Z7UB 3AXLA 3THMH 1N4XH 2Q8AL 3MLVH 4S11A 3MLWL 4LU5L 5DJCA 4UNUA 4ZD3L 1QBLH 3W0WA 2DIJA 2P24B 4OLZL 2O61A 3I75B 1EIBA 2R4RH 3JTTB 5F71A 4KHXH 4R90H 3RGHA 1CZ8H 3LKOA 1G7JB 1T0NB 2P48B 5FM8A 4AH2A 4YAQA 2ZCKL 5ID0B 1TCRA 4PRDA 5ID1A 2ZNXA 4J12A 2AK4D 2EC9T 2D0HA 4X4XA 2APFA 3FTGA 5HGHB 4DVBA 3U2SB 1BFOB 1INDH 4E42B 1VFAA 4IDLA 4JFEB 2CIIA 4JN2B 5FYKE 1P4IL 1TVHA 3QJHB 3UTTD 7FABH 2R29H 3QWRD 1J05B 4IOIB 5ADOL 3MV7A 2Q3ZA 3DVGB 2ZSWB 1CTNA 5I1GH 4GW5A 4EI5D 4RAUB 3GSNL 3MMEA 3ECBB 3H7LA 4DEPC 4YDLC 2P5WB 2IH3B 3NBNA 1BM3H 5JA9A 1EO8H 1F45A 4IRJA 4XCCL 5C07B 2J8UF 3BKMH 1BJMA 3WIIH 4F9LA 4JM4L 1TZIA 5ICZB 1RAMA 1JZ6A 2NY2B 1C08A 1YMMA 3ARZA 3EO1B 3IKCB 4EI5C 3AMKA 3MCKA 1NJ9B 1JYVA 2YRZA 4WW2A 2OI9B 5ALBH 1EXUB 4FQ1H 3QDGD 5IW6B 2YUVA 1OAXL 2OQJA 4PJDA 5JO5B 1QBML 3MRLB 2F58H 4LDOB 5L2JB 3J7HA 3DX7B 4OKVA 1T7VA 1ZEAL 4J3VA 3IVKB 3BWUC 3S34L 4LHUA 5DMGD 4BZ1L 2OZ4A 1ONQA 5CEZH 5B8CA 1FGVL 5JW5B 1JBJA 2D7OA 1K9TA 3GSUA 4K7PY 3RWDB 3S9DB 4X83A 1A1NB 1OT1A 3T0VA 4V1DE 5DMGC 2WUBL 1W0VA 5K9OA 5IESL 2P8PB 4GS7C 1YEGL 3G9VA 3RL1A 2EDJA 1UC6A 4H8WL 1PJ9A 1YYLL 3RAJH 4X6CF 3CJJA 3IJYA 4Z78A 3LPGA 5T1LD 1V7NL 2HMID 4M48H 4MCZB 2OK0H 1MI5E 3UJJH 5D93B 3MXWL 3EYUL 1Z5LB 3QDJE 2F15A 4RQQB 1EV2E 3MUY1 2VLJD 4M61A 2NX5E 4GO6B 2HMIC 1DUYA 4DGYL 3GMNA 4LGPB 3SOBL 3TBTB 2OP4L 1MCDA 3F5WB 2GJJA 3PNWA 5LWYH 2QV2A 3GZKA 1FZKB 1ED3B 1GGBL 3PP4L 4ZUVA 1XF4A 5HHVH 4KK8D 4YQXH 3GRWH 4JHWH 1QYGH 4P3WA 3LQZB 3D0LB 1KBGH 5TDPB 3MLUL 4GG6F 3VXRA 1PKOA 4KK8C 5MEPB 1CGUA 5IR1B 3QIBB 3WS6A 4J3SA 4U1KB 4OJFL 1QRKA 3KGRA 2B1HH 2GK2A 4LEOB 1R24B 3U0PA 5C92A 3EGSA 1RMFL 1GOGA 3K2UH 4Z7WB 1JIBA 3WFHA 1S7QB 4PTTA 3QP3A 1G9NC 3LDBB 5IF0B 5KS9E 5IHUL 1CFBA 3GMRA 4DZBB 5KSVA 3TZVB 4R7DB 4WGWB 4P3CL 3WN5A 4AK1A 5BZDA 4GKNB 1ZVYA 2R56L 3UTTE 5BRZE 1JV5A 1NC2B 2CJUH 5I2IA 5FHAL 3VWKA 2A6KB 2P42B 3MYJB 4MQSB 5IV2A 4Q6YA 5C0EA 3BRFA 3IU4L 5ANME 3JTSA 3ZKQD 3OKDB 2EDDA 5F6IC 1JPSH 3C8KA 4PJCA 3ULVH 2CKBL 4QRPB 1NFIB 4X6BB 3W39B 4XNUL 4NOBA 5FYJU 3HAEA 4RFOL 4K7FA 4Z0BH 5E6ZA 1EFXA 3FRPG 1CDHA 4ODUA 3UEZA 1XH3B 4OLYH 3L3HB 3U9UA 5ITFA 1KXVC 4L4TB 4PLOB 3KPPB 5IBUB 4K3GA 2NQCA 4MNGE 3GI9H 2X1PA 4HSQA 4YHNA 2XNAB 4HLZG 1UWXH 4X0KB 1JZ3A 4Y16D 2YRPA 1A9BB 1YPZB 1JNHB 4J4PD 3KYNB 5IK3A 2AXGA 1OM3H 1I7UB 1KV3A 3EYQC 4F9PC 1X5IA 4Y16C 1MHCA 1OPGL 4PJBF 5INCB 1F4WL 4YZFE 1G7PB 3CFEA 1EA9C 1JE6A 1X4ZA 4GQ9H 4M1CD 4D94A 2R2EB 2PTUA 5IBUG 1I3GH 2ZSVB 1KT2B 3QQ4A 4U1IA 2B20A 2UUDH 4F7EA 4M1CC 5MEQA 2H26A 5KS9B 3UBXB 3MLZL 5CJOL 1L9NA 2AK4B 5EUKA 4M3JA 2WBWB 1LEKB 4YDLB 4WTXA 4CMMA 4PJ7F 4WFGE 3TLRA 3UCRA 1K4DA 1I1RA 4KU1A 2F54D 2A9ML 1AQKL 4LAQL 5EUOF 3FN3A 1CTOA 3QUMA 4OT1L 3DPBA 1EEUA 4ENED 5AYUH 2Q76B 1LEIA 2J2ZA 3B9KA 4WWKD 3DTXB 1D6EA 3LIZL 4UU9B 4HUKB 1Q8MA 3W2DL 3UBXG 1YUHA 5E9DB 4ENEC 3RY6C 3MOBL 4WWKC 5HDQH 5ITBH 1T89C 3TBWB 3QDGB 3S88H 4D8PA 5H8DA 2IJ0C 3KPTA 3OG4B 2X9WA 3I2CL 1JHKH 1Z9LA 1XIWA 4M3KB 2VDPL 4XPTL 4C54A 1A4KA 4AMKL 1OGTA 1KACB 4JFFB 3RUGE 4GOSA 1JGDB 4L5FH 2IQ9H 3SE3A 4C4KO 5JXED 3CMOH 5I1HL 3ZYOA 1VPOH 3MRPB 3PJSB 4JZOB 1E27A 3O3EB 1FAKT 4PRIE 4XPFH 1ZLUK 3PWVB 1Q9LB 3CZFB 5JXEC 3VFOA 1BHGA 1AY1L 5ESAA 5JXAL 3T2NL 3P9MB 5TDOA 1B9ZA 5T1LB 4FFZL 4ODWA 1GXEA 1DQLL 3GB7A 4P57A 1M71A 5EOCH 5C0JB 3B83A 3DURA 5BZWA 4MJID 4O58H 1I1FA 1KPRA 2VLJB 5C9JA 2P5EB 1G7HA 1S78D 5GJSH 1QZ1A 2ZOKB 4B41A 2PKDA 3G04B 1E6JH 4BH7A 1QOKA 4HUVB 4YPGA 1KLGB 5HY9A 3SE4A 5IMOA 4NKDA 3TPKA 4I18B 4WU5B 1SEQH 4NKOA 2A6DA 2I60H 4OF0A 5T5FH 1T22B 1I3RB 1I9EA 2ITCA 4Q0XL 4GUPB 5AUMB 4OCLC 5E6YA 3T0ED 2R69L 3WIFB 3KXFA 5IFAL 5EO1A 1AGBB 3CH8A 2C3GA 5K9JH 1EGJA 1OAQH 3WKML 2R1XA 3ULUH 2D03H 1U3HA 3T0EC 1IRAY 3HI6H 1FFPB 5LGHH 3VFWB 1YEEH 1IBGH 1CICA 4ZTPH 3NPSC 1IEBA 3AREB 1BEYL 4DWHA 4JZNB 3O8XA 4FXKB 3DV6A 3AS2A 5E2WL 3HA0A 5J11C 5JDSB 5F7NC 3UROR 4TTDD 4HIJB 5F6IB 1F6AB 5BMFH 3RX7A 1EERB 5I15H 1T7ZA 3TYFB 4P2RE 5CSGA 4HC1A 2F54E 2VAAB 3WJLA 3JWOC 3CXDH 1KTLB 3EJJX 2IH1A 5B22A 2FGWL 5CILH 4KDTA 1XGTA 2JCCB 2DJUA 2VDOH 1SY6H 5JW4R 4JFYB 4Y4FA 4ELMA 4Y5YB 3H3KA 1DVFC 3MJ7B 4JO3H 1CFTA 5EO0A 5HYEA 1K3ZA 5GS2H 4X6EB 3VXPB 1REIA 3D0VA 4JQVC 5GZOD 3MO1B 4YUEL 2XV6B 4DN3L 4LCWA 5BVPL 5D9SA 3P2TA 2D31A 5FB8B 1YQ2A 1MCKA 3O11A 1NBZA 2EC8A 2ZG2A 3LV3A 5FO8A 5GZOC 2ZOLB 3C2AH 3C9NA 1DBKH 1MCBA 3G08B 4XVTH 4EN3A 3MLVL 1LO3L 3S4SA 3O2DA 3WIHH 2KDGA 1FVCA 1MPAH 2WBKA 5DDHA 3EIFA 4R90L 5A2IH 1JZ2A 1B4JH 4G5ZL 4YHMH 5DZLA 3SE8H 3ZL4H 3I50H 2NTFA 2F5BH 4HH8A 3PGDB 4GRMA 3O6MH 3VWJD 4YHPA 5FO7A 1Q9KB 1A1MA 3LSOB 1PZ5B 4YBQC 3ALWA 1LD9A 4P46C 1XMWA 3W0WD 1R5WA 5T3XH 4MJIE 4AL8H 4UAOB 5KSBE 1ZHLA 2ATKA 2WV3A 4CVZA 3SDAB 5I1GL 2IALA 5JPMB 3P9WB 4JKLA 2W92A 4MB3A 2BSSB 4R3SB 1O7SA 5D2LF 5I1EH 1BM3L 3V9FA 1EO8L 1MAMH 3CC5A 4FFYL 3HZMB 1NBVH 4AIXA 4WWKB 3OJDB 3VH8B 1KJ3H 3DUUA 2AAVA 2C3HA 1IVLA 2WMPA 4P59L 5JIHA 3QIWB 2VLME 5EIQA 1P7KB 3O6LH 2X7LB 5ICXB 1Y0LB 1C5CL 2D0GA 4YBHA 4QNPE 5FYLD 4Y5VC 4K94C 2DQJH 2I27N 4JPWL 1R3LA 3MOAL 2FO1A 5KN5B 1HXYA 3MREA 2EYTA 1MFAH 5F3HB 4ZMAT 3DIFA 2XZCH 3P11L 4X99A 5EU4A 2M1KA 3FCTA 1UB5B 5ESQA 4Z5RB 2R4SH 2FZ3A 3T4AB 3VH8G 4GSDL 1D5MA 3SDCA 1JN6A 3T4YB 3AU1B 3IFOA 2LVEA 3MROA 4WW2C 5I76B 1VFBA 5DJ0B 1I7ZB 3U0WL 4LHUD 5DHXB 1IJ9A 3FRUA 3WFEH 1JNNL 5DEGB 5FUOL 1XF3B 3OB0H 1U2CA 1JI2A 5J0BA 3LQAH 4UT6L 4ZFFA 1ZGLB 2DDQH 1SMAA 1F6FB 5DJ6B 3A67L 4UIMA 1VADB 5B8CC 1RUQL 1L7TH 4BQ8A 1HYRC 1NFDE 2BVYA 4I77H 1WBXB 4KROB 2DQCL 1FFNA 3QO0A 3ARXA 5EC2A 1JNLL 5C2BL 3GBNH 1MY7A 3ILPB 3NPZB 3PL6B 5IWLA 1DUZA 3QPQD 5I66A 2A73B 3MRIA 3BIKA 4UTAL 4X5LA 3QG6A 3OKYA 1J8KA 4JHWL 2BRRH 1A7NL 3P40A 2DI7A 3QPQC 3IDUA 25C8L 2JB5H 4LSUH 3T0EB 2VWEC 3QXVA 2DQIL 5ELIA 5FYJD 3SCMD 1OD9A 2C1PB 1MLCA 1WZMA 4GKZB 2XTJD 3DMMA 4POUB 4RZCA 2BNQD 4L8BA 1PKQE 2BY3A 4FFVC 4TN9A 4NNXB 4PJGF 3SCMC 4KZEH 1S7VA 3RBSA 1MHHA 4UOJA 3P4OB 5J11B 3IDXH 4HH9A 4NJAH 4XXDB 3C60A 2XTLA 3T65B 3AM8C 5DA4A 1RJYB 3W0WE 1W72L 2AV1B 3ELAT 2NPLX 5EULV 2G60H 5HYJA 4A6YL 5KVGL 2O5XH 2QHLA 2UYLA 4YH6A 4I0KA 3WS6C 4KUCF 3QO1B 2VXTH 1NMAH 2V7HB 3NAAL 5TF1L 1ZA6B 1TQBC 1T83C 3WD5H 4EJ1C 3CFKB 2NY1B 3ULVL 1HNGA 1K6QL 3MV7E 3D2UD 1BQLH 4G8IB 4LCUB 2XQBL 1OAZH 3WN5C 5KZCD 5J9PB 2Z92A 3OKOB 2I26N 1EVUA 2DM7A 5KG9A 5BV7C 2P46B 2KQMA 5HVHB 4ZYKB 1ZOXA 1YMME 4NM4H 1WK0A 1WV7T 1NL0L 3C6SA 1CIUA 1KB9K 4OCRL 4LLQA 4F7PB 5E8DH 4NRYA 4MHHI 4WU7B 1H9VA 5L2KA 4PJDE 1KN4L 1FNGA 4JHAL 1M6OB 2G2RB 3QHZH 3RZCB 4N90D 3KR3H 5I9QC 4BKLB 2DJ4A 2AJYH 2YPLA 4XCFH 4TVPE 3ULUF 5I1DB 1S9VA 4UT9H 5TDNA 2BNUA 1MHPL 1A6VH 3AUVA 3QZWB 5IB4A 1ETZA 4NM8H 4R96A 2FYYB 4G80A 3VWJB 4HWBL 3UTSA 1N26A 1A02N 4HMEA 1BZ9B 2BMKA 2EDFA 2QR0A 3PABB 4KJQD 3V5HB 4FN0A 4YDKH 4PY8I 2VYRE 2C7UB 4ZG1A 5DJ8B 2BVOB 1NGXA 2UVFA 3HI1B 1TCRB 4PRDB 1JGLL 4KJQC 1QLEL 3IU3A 4XP9L 2OBGA 4PB9L 1P7QB 4QXWA 1KEGH 5EO9A 2NNAA 4ZAKB 3QZWG 4KHTL 2V2XA 2VWEE 3OPZH 1LP9B 2JELH 1FNFA 4Q74A 2Q6WA 1SEBB 3OGCB 4U6VH 5ETUB 4PJHF 1OAUL 4N8CH 4Y5VB 4WIQA 2ERJC 1ZAGA 1F11B 3BJLA 4AG4H 3MMEB 3JWNC 1JF1B 3PXJA 1XF2A 3B9KD 2GK0A 4JO1H 1Q0XH 2YN5A 5DR5L 2CGRL 2QSTA 4HKXA 1C08B 5T3ZE 5FEBA 3BEWB 1AIFA 4G3YL 3TVMD 1NUGA 3MCKB 4LSQH 1ACZA 3NFSH 1S9WA 3MBEB 3B9KC 1CU4H 1IQWL 3U7AA 3VXRE 3TCLA 2AGJH 2PR4H 4U6YB 1MJUH 5F9AC 2Z8VC 5EOTA 5JUEL 4R4BA 2NY5C 4DAGH 5EA0H 4DUVA 1XIWD 4U1GC 3CVHB 1PG7L 1C12B 1JHTB 3BUTA 1WC7B 2B2XL 2HH0H 2OR7A 1YEHL 5HYSA 3OKKA 4NHCL 4XPFL 3VRLE 5DQ9B 5B8CB 4H0HB 1XIWC 4IMLA 1HILA 2GSGB 2O93L 4PRBB 1OSZB 3WLWD 4L9LA 4PGEB 1BBJB 5LKNA 2HG5B 3G5VB 3SE3C 4O58L 2YMXH 1S5IH 2ADGA 4XCYA 5HVFB 5DMIH 1GCFA 5DVMA 4I5BB 4ZPTB 3I9GH 2Y5TB 3TF7C 5F9JB 4I48A 3WLWC 1YN7B 4B5EA 2A0LD 3NN8B 1E6JL 4XHJD 2LAAA 4X7SL 5E8OB 4PJCE 4WHTB 4LHUG 2AI0L 3BZ4B 4XRCB 1OLLA 2VLKA 2R2CA 3DHMA 1QFPA 2E8YA 4DKDC 5IB2B 1BLNB 2A0LC 1P1ZA 2I60L 5E4EC 4XHJC 4KQ4H 1SVCP 3MNZA 1FZMA 1U6AH 4HEME 3DBXB 4LPCA 4NCDA 2H32A 2VISB 2VITB 2VXUH 2RGSA 3SCMB 4N90E 1NCBH 4PJFA 2HN7A 1UH2A 2XTJB 3KS0H 1U8MB 2BNQB 3SE4C 3NA9H 3MLYH 4XMKH 5LGHL 5K9QG 4J6RH 3LKQB 2EDXA 4L4VB 4LASL 3QQ9D 3OBAA 4PP1C 1NCAH 3RPIB 2APWA 4W68A 2DQUL 4XI5D 4XAKD 1IGJB 1UWEH 2BVPA 5EWIH 4DVRH 1CLOH 4BSVA 3BPOB 3SKOB 2APTA 1CICD 1FPTH 5GJTL 3MV01 1TQBB 3EGSB 3MRKB 4XI5C 3LKSB 2C4FU 1HHKA 4I3RH 3O8XD 4ZDHA 3RWEA 5DC9B 1RU9L 1I8KB 1KCKA 2E27L 1CICC 4OFDA 2ZUYA 3KYKL 4RX4A 1JWMB 1MRCH 1S7RA 4UZGA 4Z8FL 4JB9L 2VDOL 4UDTA 3E6FB 3INUH 2Z4QA 1MQKH 1BPVA 4LSVL 3O8XC 4HHAB 4PGBA 3D2UB 2Y23A 4JKMA 4PJIA 5KZCB 5F88B 5KSUA 2W59A 4HUXA 4I9WD 1FNLA 4QRSA 4J3TA 3WS3A 1QVOA 5C0AE 4OSUL 1WBZB 1NUFA 4MCYB 5I1AB 3WJLC 4Y4FD 4K7PH 5DD0L 5E6IB 5DA0B 2ILLA 3F7VB 2J8HA 4WEBH 4LCWD 3EYOA 4PRHD 4XVTL 3TWCL 2AV7A 2YR3A 2ICEA 4OAWB 4Y4FC 3ALPA 3HR5B 3QWQB 4NRXA 2HJLA 1TIUA 4PJ8A 4NRZB 4RMSA 1BVZA 3E6HB 4RWYH 3HCVB 3SE8L 3ZL4L 1RFDH 4FQIH 1MCCA 2VDMH 3BPCB 3O6ML 4EN3D 5GGUA 4I3SH 2VLRA 3ZMRA 2KBGA 1MHCB 3ZKMD 2RCSH 2MHAA 4YE4H 1RIVL 1QA9B 4NZTH 1PW3A 4URTB 3M17B 3VFGL 4JAMB 4EN3C 4JG1H 3ZKMC 4RBPH 3CFCH 1UGNA 4KY1L 3D85A 1T2QH 5D6CB 5F44A 5I1EL 5BOPA 1EPFA 3UYRL 4BFEA 3QHTC 3SGKA 2DB8A 1KIRA 4M8VA 4GKOA 5B3NA 4NWUH 5D7JA 3C6LA 4FQ2H 3VXSB 5CJXA 5GRVL 2G75B 5SX5K 3L3GA 4N0UB 3LVEA 1JHLL 2X4NA 1A2YA 4Z76B 1SBBA 2PW1A 1T4KA 4XTRD 2YEZB 1KIPB 2C3VB 3B9KB 2E7MA 3AS1A 4OGYH 3R1GH 2HYMA 2UZYB 2DQJL 3VGDA 4E41D 2CO6B 1D6EB 4NYLB 1EUTA 3TVMB 1RUAL 5TQ2H 3VFMA 2QQLH 2V7NA 1T1ZA 3KXFE 4XTRC 3X3GL 3ZO0A 2Y5EA 3L5HA 2ZKHL 4L8DA 3FT3A 3IDGA 5FOJA 3RY4A 1ZLWH 3CH1B 4L3EA 4EXKA 1XIWB 3PP3H 5SV4A 3T0DA 2YK1H 4TPRH 1SQ2N 2EH8H 3OZ9H 2LAGB 3LQAL 3QRGH 3RPKA 4PV8A 4O4YH 5E2JA 4PPTA 5HVWA 3ARVA 2R0WL 4LNVA 3G6DH 4UINL 5IB5B 4XBEH 1BIIA 1P69B 3U79A 3BXNB 3CSYA 1MREL 4LLUB 1N3NA 1SVZA 1NC4A 4IMKA 2NXZB 5LCVH 3O3AB 4JM2A 3MLSL 3KPQA 3GBNL 4L3CB 2D4DA 3BEVA 4KVCH 2RIKA 5LQBH 3BPNB 5E4EB 4NO0B 5DT1L 1HHHB 1HINH 3CK0L 3H0TB 5ECJE 5IIEA 1U8HB 3PWJA 4QT5A 4ELME 1LE5A 4F3FA 1YDPA 1U58A 1DBMH 1MRFL 4Z95H 4KI5F 2IPKB 4XMLH 1KJ2A 4PJDF 1WZ1L 4XCNA 4LCWE 5EU5A 3O0RL 5GRUL 2E7CA 5F1IB 4R0LB 1U8KB 1CGYA 1N5AA 3UMTA 5GXBB 3TM6A 4MS8D 5L8KB 3UPRA 1Y18B 4IEFB 2BSRA 4RRPG 2A6DB 4J1UA 5B4MD 1UKTA 5IWLC 4PR5A 1MH5B 2AKRA 2IADA 1KNOB 2H1PL 4JFQB 2EO1A 1N2RB 1HK6A 4MS8C 1JK8B 5CAYB 1AGCB 4PLJC 3KNBB 5B4MC 5KW9H 1ZHBA 4U6HA 3QEGH 3DMMD 2QLVB 1Q72L 3MLTB 2YD4A 3FT4A 4M5ZL 2HLFD 5EBGA 2G60L 4PJEB 5E5MA 2O5XL 2FHBA 3DMMC 1V3MA 1NMAL 4KRMB 5F7LB 3GMOA 3DARA 3ES6A 2HLFC 4NIKB 2ED8A 4NKQB 4ZFZA 5I18H 3WD5L 3PIQA 4LKXB 4YIQA 4J3UA 4M1DL 1C16A 2IAND 5HYJD 3K7UA 1AGEA 4HWZA 1IZJA 1VESA 1JFQH 1GC1L 1BOGB 3K80A 3OKEB 1MAKA 4MSWA 2DL2A 4KK5D 3KG5A 3SJVB 4C55A 1HN1A 4JFZH 1JUFA 1YY9D 4C58B 2YC1A 5I30L 4P9HC 5CJQL 1T5XB 12E8L 5E8DL 1TMCB 1H8SA 2WIIB 5E2UH 5BJTB 2EYRB 3HI5H 5CBAB 1MLBA 1YY9C 4JFXB 1E4WL 4LCWB 4PRHB 4HBCL 3L95A 2DF3A 3VGFA 4G8EA 5K59E 2AJYL 1KEMH 5L6YH 4XCFL 5CEXB 4UT9L 3VRLF 1TJIL 2GITA 3C9NB 5L2KD 1F3DH 5D2NA 3WHXA 3QCTH 4NBZB 4NM8L 4UV4H 1G7IA 3FB8A 3K4AA 4P4RA 1XGQA 5IGXL 4IS6B 3VMPA 5JMOC 1FV1A 3TNNB 4NZUL 3TJEH 3WUWB 2ZZUT 1I9JH 5D72H 2EXWD 1MCRA 3WHE1 2RB8A 2GFBB 3SE9H 1IKNA 4Q97A 1IEHA 1DBAL 1T04B 3UTSD 3RX5A 3DROA 4G9FA 3UTZA 2GJ6B 2BNRA 5ESVA 3I3EA 1KEGL 1BBDL 2EXWC 4K3DH 2DOCA 3A6BH 5F7KC 1LO4L 2JELL 3L3JB 3KPSA 4CNIB 4CVZB 5CZVL 3QDMA 4EQ3A 3ESVF 4NHUA 3GUTA 2CDEA 1J8HA 1ES0B 4KKAC 3WUWG 3GMPA 4XWGL 5IW3A 1FC2D 5GSRB 2Z35B 1RUML 4BK5A 5F1NA 2WM0A 4O9HH 2VIRA 1TNMA 1KCSL 3SDXA 5B3JE 4DZ8B 2EO9A 4LBEA 5MERB 4JN1H 1GGIH 4E41B 1P4LB 1I1AA 4Q9QL 3NFSL 4LPVA 4YFDB 2WQRA 1CU4L 5E24E 3GSVA 3QFDB 2WUCL 2Z93A 3D39A 3H2WA 1G7LB 5J7CC 4YEEA 3U6RB 1BQSA 3QAZB 4U33A 5MENA 3HUJB 4U0RC 3K2MC 1ORSA 4JY5L 1YY8A 4NQSA 1Q0YH 1MVUB 2HH0L 5SV3A 3R06B 5IJVB 4I0PA 1QFWL 4PJXE 1T5WA 4MLSA 2FZ3B 4MYWB 4PY8J 3QXTA 1XZ0A 3FFCB 3TFKC 43CAB 4D0CB 1WCBA 2KUTA 3C8HA 4HLZH 3B6SB 1NGYB 1FG2B 2H41A 5HYJE 3FRUB 2EDWA 1YEDA 4JQIL 1MFCL 1CDGA 1KXQE 3IJSB 3LZFH 5E8PB 4Z18A 3AS0A 2BOBA 4FQLH 2UV3A 3L7FA 3FOLA 1YYMH 1I4FA 4LLWB 5DGQA 1U8NA 1FGNL 2A6JA 1NEZB 2X89A 3MUGA 5A16A 2DKSA 3BUYB 5JDJA 4LRNH 3T0AA 4L9LC 3L9RA 1OP3K 4RMWA 1ZA3B 4XBGA 5J6GA 4NNYA 3DGCR 3CSGA 2VLKD 3VG0H 1UCBH 2QKIB 4XVSL 4S2SB 2DWDA 3C8DA 2JIXA 4W70A 1UWXK 3NA9L 4YHIA 4YXHH 4ZOBA 1RZ8A 2HRLA 4X9FA 1NEZG 4GAGL 5I74C 1AQDA 1BFVL 4XP4L 3DYMA 5D7IA 4DVRL 1CLOL 1H5BA 4OF3A 1WTGT 1EAJA 1KYOJ 3T04D 2YPLE 4RZCB 4R4NC 2XZQH 3N1PC 3TT1H 3VXTB 3UYPA 1S7VB 2ATPB 4YDIL 2DJSA 1F3JB 5DEFB 4XP1L 1AO7A 3RTQD 5AAWA 1XGUB 5JW4M 1HKFA 4YBLB 1MRCL 3AROA 1OD7A 3JV6B 3INUL 2IANB 2UYLB 4K07A 3WUZA 1UZ6E 3RTQC 3GM0A 1IQDA 3JWDC 4JDZA 1EEQA 4LIQE 1NSNL 4QRUB 5I1KH 5DJ2B 4GH7B 5AWNH 3NCYP 4RX4D 3H42L 1G7MA 4HK3J 3GIZH 3DX6B 1WICA 1K8IB 3CVIL 3CUPB 5ISZA 3MRDA 1ZANH 4KZDH 4C56A 4H25A 5J56B 5H94A 1A21A 3R0MA 1MNUH 4JREB 5F8RC 4OZFB 1YEFL 1FNEA 4QTIH 4Z7UF 4F80A 3P4NB 3QSKB 4NBYB 5L2KB 2HA1A 2VDML 1Z6JT 3QA3B 1CXEA 3ZTJG 2RCSL 5EBWA 4YE4L 3B2VH 3GSOA 4PJ8D 3IXTA 3VFNB 4ODBD 5KAQF 4WUUA 2A2QT 4ZNEA 1HHJB 3LKPA 4EIZC 1SBSH 1A6WL 2RAMA 5D1QA 2VLRD 5ENWA 4PJ8C 5EIIA 3EO0B 2DQHL 2B4CC 3H9YA 4LSRH 4OZFG 3UTSB 4H5SB 4NQXA 2CR3A 2GAZA 5EFIB 3O3BB 3U36B 5BVJA 1S7XA 4HS8L 1IAIH 2C1OA 4PRPB 4X4YA 3D85D 4NQCB 5TH2A 5F89B 2VLKE 4HKZB 5C08A 5F93C 3RWHA 4FQHA 4O2CA 1KYOK 4L1HA 2NNAB 1SJVA 1K4CA 3BDYH 4OGYL 3C6LD 3Q5YA 5D70H 4YGVB 2Q6WB 3U7YL 2CUMA 4NN6C 3KPOB 3SO3B 2SEBA 4QCIA 4RMQA 4RMUA 5IM7B 3OJVC 4K3JL 1PY4A 4OIIH 4QHNA 1G7QB 2CKBB 5FOBA 3C6LC 2ZUXA 1FVDA 5CJXC 4U1NB 4XVJH 2HFGH 4PJFE 1A9EB 1XGPB 4NCC1 1GGCH 1CGWA 2YK1L 4M93B 1L4IA 3GHBH 2A1WL 4MD5A 2EH8L 2ARJA 4NN5B 4C83B 3ARDA 3S5LA 1YMHA 1TZHB 3G6DL 4ETQB 2CPCA 3L3KA 1P5VA 5CWSA 5D5MB 3K4DA 1UACL 1BVLA 4N8VB 3T8XB 2DLFH 1A22B 1IAIM 5K33A 5BQ7B 3H9SA 3FQXB 4PGDB 4KVCL 5LQBL 5FHBL 1C7TA 1CL7L 2GT9A 2W65B 1HINL 2YD1A 3DGGB 5EZLA 3V5DA 3FO1B 2C4FT 3MR9B 4JM2D 3HR6A 5IMKB 1IAMA 3EYVB 4PJIE 1DBML 2H3NB 3MRMA 5TGBA 2CUHA 4NQEA 1RJZB 1R3JA 2J4WH 3QWOB 4Y88A 5J89A 2OL3L 4H1LA 4NUGH 1YNLH 1XGYL 4IMKC 2GCYB 4N8VG 5I19L 3GKWH 5E7FA 4JM2C 1NMBL 8FABB 2OXHA 1T1XB 1T80A 4WTZA 3LAFA 4WJ5A 2Q87A 1LK2A 4XPBL 1RY7B 3HC3L 2VXVL 3O6KL 4ZO6A 1XR8A 2G9HA 5KW9L 1I1CA 1T7YA 2FB4H 1QR4A 4NN7C 4FQCL 3NTCH 5DJYB 2KZWA 3EOBB 4IIQB 1S7WA 3IF1B 4Z7WF 2APXA 4M62H 2VXSL 4ZFOL 1OGAA 3EDDA 1FRGH 3TJHD 5CLTA 1TZGL 1VSCA 1EJOH 2VLRE 3FQTA 3V0AC 1KSRA 1JPTH 2ZPKH 4OIBA 5GZNC 4NWTH 1IT9H 4BSVB 2YWYA 3GSWA 5HGBA 2DQFA 5JIIA 1TITA 4P5KB 3RTQB 3MGTB 4LLMA 3TJHC 4QXTB 2V5MA 4OM0H 4UV7H 3CFJA 4XNQA 2OX5A 3F62A 1CS6A 2LFGA 3LMJH 4DK6A 3H9ZA 3CLEH 1FNSL 5A2LH 4IRSB 2X70B 2VABA 4OD2A 3VA6A 1SYSA 2YZ8A 1B90A 5T1KB 3OXSB 3HZKA 4AJ0A 2ZUSA 3P4MB 3M07A 3SKMA 1CE6A 2AJUH 5F1KC 1R5IB 4JEGB 2Y6SD 1DBBL 1WZLA 1J1PH 4GXVL 4PGBB 2FWOA 2NW3B 5IKCA 2FHCA 5GGSA 1U8LB 1JPFA 4EDXA 4DKAA 4ELKA 3O4OC 2Y6SC 5JOPE 1KTRL 3ROOA 3MCG1 3RVTD 5C6TL 4JKPH 1URLA 4UQ2A 1MJJA 1YPZF 4QGYA 4YC2C 3OX8B 2LTQC 2ITDA 3ROLB 2I07A 2AJZB 3TO4D 1N0LA 5E4IA 4PJXF 1U8QA 3ETBF 1WISA 4YLQT 2DQGH 3F7YB 5DHVA 2FBJL 2CLVB 5F97E 3RVTC 4UQ3B 3LN9A 4P4KA 3MRHB 3T0WA 4KPHL 5E99L 5I1LB 1EAPB 3TNMB 4L3EE 1ZSDB 1TNNA 2F5AH 3PWPD 3TO4C 2BVUA 2LABA 1SJEB 2Q3AA 3PQYB 1A6UL 1T3FB 1I9JL 4N9OB 4OZHA 1VDGA 5D72L 5DJZB 4Q2ZA 1N6UA 3FONA 4LGRB 4U05A 3SE9L 5D71L 1U42A 1CDYA 2WP3T 3OB0K 3Q3GA 3GMLB 4OZIA 4QOKD 5CSBA 3GSQA 3HRZA 1HQRB 3HE7D 1NCTA 1NAMA 5FYKL 3PWLA 3MLPA 2YUXA 4KMTH 3WBDA 5E1AA 3QUXA 4P2QB 2X40A 2AEPL 4G9FD 2HT3D 1MELA 1J5OL 1F4XH 3VFPB 4DCQA 4N0CD 4O9HL 5CGYD 5IP4A 1IKNC 5JOEA 1JMZA 4JFOA 5KVFH 4JN1L 4QLRA 2HT3C 3MNWB 4UOW1 1NGQL 2D9CA 4N0CC 3MRQA 5CGYC 4KWUA 2R8SH 4J3OC 2JKXA 2FDBP 3NIDE 1B0GA 4XCEB 3M1BB 4PYGA 3BP5B 1ZHNA 4Z7QE 5F96L 4MAYA 3VFTA 3MJ9H 2CDFB 2EH7H 3D3VA 4TRPL 2VDRH 1RJLA 3KLSA 1V3JA 4HJGB 3MV11 3D39D 4ZFGH 3ULSA 3K8KA 3RU8L 1CBVL 5MEND 3JWOH 3JZ7A 4X9HA 5EN2B 2I24N 5L88H 4LKCA 5DMKB 4UB0H 4M7LH 5I17B 1UZ6F 2WBJB 4F7CA 4POZD 4MA8H 1G1CA 4J8RA 1LEGB 1YYML 2VC2H 1TJGH 3WNLA 3L3OA 3ARQA 4POZC 3CFIC 4IHOA 3SPVB 1MUJB 1V05A 4WW1A 3MV9A 1MWAA 4LVNB 3TA3B 5IT2L 1UENA 4CL7A 3LY6A 4WI3A 3BZDA 1D5IL 4TUKH 1F8TL 4ZUSA 1MCPH 2X89D 5I73B 4O51A 3G6JB 1K5NB 3ZE0E 3JV4A 5CP7B 2D9QB 1YN6A 1IEAB 1J0ZA 4YXHL 2FX8L 1FO0L 3BP4A 4NN7B 1CLZH 3MV8D 4PB0H 4M5YH 1YECH 3FO0L 4FOMA 5ALCH 4LLVB 3MRJB 3NH7L 4E5XB 4G8GA 4LLYB 5DD3L 3BGFC 2XZQL 4ZS7H 4F8TA 1X44A 4OLVL 4PR5B 5HHPA 5IHLB 5D2NE 3HKFA 3MGOA 4Q9BA 1AC0A 4JKKA 1FIGH 3KDMA 1RK1A 1R5VB 5IROA 3CX5K 2HKFL 1QRNA 4PRAA 3IFLH 4L29A 3IGAB 4XH2B 5E95B 3ZDYE 3OHXA 4MJ6A 1B3JA 3BMWA 3VI3E 2VO5A 5KTEH 1A7QH 1H5BC 4BA8A 2DIAA 3KS0J 4G9FE 5D7KD 3MRCA 2BVTA 4RAVB 1IGFL 2BNRE 3Q6GH 2R0LH 3X12A 4XC1H 2J88H 2R1YB 3QXDA 2JCCF 4OLUL 5DS8A 2ESVA 1FJ1B 3BGAA 1QBAA 5IQ7L 4K9EH 4PFEA 3KPSE 4XP5L 4JQXA 3G9AB 4FZEH 4WV1B 3O4OB 3QDME 1MCQA 5DJDA 5DUML 3NFNA 3V4UH 4GMTL 4DQOL 4DUXA 4MNQB 3TPUA 1UEMA 3BHBA 3A6CL 1J8HE 1X7QA 1F90H 2ORBL 2LTQB 2IPUK 3CX2A 4LOUD 1IAOB 3RL2B 4XC3H 4XBPA 1ZANL 5FYLH 2VN7A 1J10A 3VFRB 1A5FH 3SDXE 4XWOD 1S7SB 5SWSD 4Y0GA 2YSSB 5I8OH 3JV0A 2BDNH 4MQTB 4YHOH 4LOUC 5I0ZA 4HUUB 1N59B 3TO4B 2X1WL 2XN9E 3TBYB 2J8UA 4JGMA 3D39E 4HUWA 1N6QH 4XWOC 1RZGB 3CVHH 4KJYB 2BHYA 3Q0HA 4C56D 5GGVH 4TUOA 3DJ9A 2X4QA 4DOHE 4GBXA 2PYFB 4M6OH 1IAII 4O2FA 3HC4H 4GKSB 3PWPB 4D0DA 1NLBH 4Y5XA 3WLBB 4XX1E 2E7LA 3EHBD 2GITB 3B3IB 1UXSA 3LS4L 1T1YA 1KB5A 3JUYA 5D7SH 3QNYB 3RDTA 3VI4E 2OR9H 4OZGB 2PO6B 5FM5O 4U7MA 1V3KA 5CKAA 4RA0C 4QOKB 3EHBC 3R8BB 2IBGA 3HE7B 4G6MH 1FV1B 2NXYD 4HWEH 4NO2B 4QHLA 4LMQE 3IT8D 1FSKB 1LO5A 4AEEA 1ODAA 1IFHH 3V0WL 3RNQB 4GG8A 1EO7A 3EYFA 2W07A 2UZIH 4ONGL 3DROB 5CGMA 2NXYC 5CIPA 3FB6A 3FQNB 1AHWA 3SY0B 1W72B 3UAJD 2W0KA 2RBLA 4X6CA 1ZMYA 2BFVH 3NABL 1HQ4A 4A6YB 4HPYH 5IQ9A 3PGFH 5K9KA 5FYJH 3ARSA 3UAJC 4OIIL 3P77B 3GO1H 3V8OA 1G9NL 5I71B 2BSTA 5GIRA 4XVJL 5EOQL 5ABDE 4FS0A 1H8NA 1VGKB 3UC0H 4ODVL 1AE6H 1I9IH 4F33A 2W9DH 1V7ML 1MEXL 4HG4J 5GGRY 3FQUA 3VJ6A 4MWFB 4FQXB 3CPLB 1EBPA 2Z93B 5D7IE 1CYGA 2CK0H 4FTVD 1VKXA 5MENB 3GDBA 2ADFL 2HJFB 2KZ1B 3PWNB 4ZTOL 3BGMB 2YA2A 5AZ2L 4GG6A 4QF1B 3DO3A 1S5HA 3MZTA 4G7VH 4DW2L 3ARDD 2J8OA 3PF2A 1IC7L 5I8EB 1PZUB 1AO7E 5JW3H 3UTQA 5IFJA 1A6TA 1H3TA 1ZVSA 4CADB 3A6OA 1UYWL 2X4PB 2NW2B 4DKFL 1RHHA 2EEBA 1T7WA 3ARDC 4WUKL 5EZJB 1FL6B 4JRXB 4PRNB 2MQCA 1GZQA 2PCPB 1DCLA 1OF2B 3QIUD 3QULA 1IGIH 4R7NB 4UIKH 3FMGL 5D6DA 1DQJA 2J4WL 3IXAA 3DI3B 4NUGL 1YNLL 5KJRH 1I4FB 1C7SA 4MD4A 4XX1G 4LLDA 1ZHKB 3QIUC 3FQWA 3NGBB 4FQJH 2V2TB 2Y1VA 4NQED 2OTWA 4ONHB 5IBTH 2W1NA 5ISZE 2PN5A 2BVQA 3MV8B 2I5YL 3OAYH 4JFPB 4LL9A 2ENYA 1IGYA 1VA9A 4HIIB 1L6XA 2FB4L 1QR1B 5FA4A 3FT2A 2MWCA 4I8DA 3Q6FB 4HIHB 3TH2T 4M62L 2FJHB 4J2XA 2X4RB 5F9OH 2VH5H 1RZFL 1CE1H 3NFPA 4R26L 4X80L 3TESA 1FH5L 1HHGA 1GIGH 1OTSC 3QG7L 4WUUE 4X5XB 3RIFF 4ZNEE 3VFVB 4OM0L 4UV7L 1OGAD 3P73B 5DI8B 4OGXH 4Y1AB 3VRJA 5D96B 1IKFH 3LEXB 3OKNA 2F8OA 1NLDL 2XXMB 4JZJA 4EDWH 5ERWA 4PJBA 3ZDZF 3D87B 4X7TB 4H20H 3NZHL 3NZ8B 2AP2A 4RBPK 2P7TA 1DANU 1CFQB 2XFXA 3IAGC 4M8QB 1AKJA 3KPRA 3X13A 1KIUA 2VZ1A 5ADPL 4N5UA 4MA7H 1P6AB 5IW1A 3LRGA 5C71A 1QP1A 4NCC2 5CGTA 1A3RL 1MIEL 1DE4B 4HCRL 5C08E 4U1JB 3QJFB 4NQDD 2GUOB 2FX7H 1P2CA 5DRXA 2OSLA 4PJ7A 3MLXL 3FO2B 4R4FL 2BJMH 4JKPL 4XNXH 3HE6D 5GGRA 5SWSB 5BO1H 5IHZA 5HHQB 4P23D 3UDWA 5HVGB 5EUOA 3LH2L 2VDNH 4Y19A 4MNHA 3U46B 1FDLH 2FO4B 3DLQR 3HRPA 3QR2A 4MDJA 3DXAA 3HE6C 3AMLA 4C56B 2ZUVA 1IM3B 1ZGLP 4P9ML 5H94B 1G6RA 4KFZC 1OSPH 4LK4A 1KCRL 1ZLWK 5H37G 4HPOL 2IBBA 1LDSA 1KTDA 4MD0A 1YNTA 4RFNC 4P4KD 4XAWL 1EMTL 4KRLB 4JY4A 1LHZA 1HH6A 3QCUH 3ZKXC 3DO7A 35C8H 1RJCA 5FGRA 5HPMB 5IVOA 3MUHL 1CG9A 1ZS8A 5GISL 4P4KC 4KMTL 4OFVA 3H9SE 3HC0B 5IVNA 4U1LB 4JO2L 4K23H 4IDJH 2UWEA 4ALAL 5I8CA 1PSKH 3QBTB 1F3DJ 3L5WA 3L3IA 4NQVB 3OR6A 1LP9F 3BW9A 3O6FA 1A7PH 1QEWB 3WFDH 2VR5A 1AXSA 5KVFL 1J0YA 3QUXD 2A38A 5IB1A 5GRWA 3IDNB 5CD3B 4V2CB 3HZVA 2FL5A 2FECI 2J1KA 4OV6F 3P30L 5IMMB 5JW4N 4LF3B 2R2BA 5EPMB 4F7TB 5C09A 3QUXC 4HULB 2ZJSH 4L8SA 2YKLH 2EKSA 4Q9RL 3MJ9L 3H7BB 3MACH 5FAAA 5C0FA 3ARFA 1BGXH 2DLHA 4P5MA 1MCFA 2YD2A 3BO8B 3DVNB 3BZEB 4E0RA 4FTVB 3VGAC 4MAYD 5C0RL 4F15B 3LKRB 5L88L 3O4LA 3D3VD 1OGAE 4LNRA 4QHMA 3RNKB 4YHYC 5KVEH 3QEHA 5DHYB 2B8OT 3HNTH 1YMHB 3HMXL 4MAYC 1UEYA 43C9B 1BQHB 3U4BH 1D5XB 3N85H 1J1XH 4JFDB 3QUKB 1TJGL 1U8OA 3R0NA 2W60B 4G6FD 2DYPA 3PXHA 2WLYA 4AIZA 2QEJA 3C87A 2ZUQC 5GGTL 3FB7A 3CMGA 3U4AA 2ENSA 1BREA 1JP5A 4F8QA 1UZ8B 3QIUB 2AVGA 3MRBA 4S1SL 2X1XR 3CD4A 2GJZA 4PUBL 4ZUTA 4WI7A 1UG9A 2NY6B 4L9DA 1WBYB 4TSCH 1FE8L 5B39A 2EIZA 5DGRA 3GSXB 1HOCA 1BQHG 3QEQD 2WINA 4NQEB 1Z0NA 4X5WA 1YECL 3IJHA 2FLBT 3BFOA 1B0WA 3BVNB 5ALCL 1NBQA 5HYFA 2DBLL 5JHDA 1QSEA 2NY4B 4Q6IA 4GRLA 5DEZA 1CVRA 1A1OA 5E56A 3MFFA 2FX9L 3KJ4C 4W6WB 1KC5H 3FJTA 4YNYA 5TPWL 4U2YA 4G8GD 3CXHK 3EDJA 3ILQD 5C8JA 3GRWA 5DD5L 3AC0A 4OZHE 1ZLVH 2AQ3A 1QBBA 4NPYA 3BH9B 5EZOL 5HHNA 5J1SC 2CMRH 6CGTA 5DRZB 2OJEB 3ILQC 4YHLL 4OZIE 4N5ED 4XC1L 4X7EC 4X7FC 5FYKU 3GSWB 3EOYG 2DQFB 4HJJL 2QQQA 4LPUA 4LLMB 4K94L 4N5EC 5FO9A 1OCWL 2A74B 5IROC 4R2GD 3V4UL 1T7XA 4Z77B 1KG0A 4HK0A 4KQ3H 2AJ3B 2I25N 1FFOA 5DK0A 5DTFA 1OQOA 2E8ZA 4YWGH 1J0HA 4KRPB 2ESVD 5C3TA 4NQDB 4GLRH 1F58L 4HF5H 1A5FL 1QHOA 2FEEL 4UMGA 4R2GC 4YXLH 3TIEB 5AD0B 3RVXD 2BDNL 5FA3A 1XFPA 1Y6NR 3HE6B 5D2LA 2BY0A 4OCXL 4P23B 5IKCB 1U92B 4LEXH 3LN5A 3MODH 1N6QL 3QH3A 3CVHL 4P0DA 3RVXC 3HPLA 1MIML 4OD1H 1N5YL 1MFNA 3ROOB 5GS0L 1RZIB 4WI9A 2EE6A 1X6NA 2ZUWA 4TVPL 2OZ4L 4RIRA 3HC4L 4G42A 1X4XA 3QRFM 3D3VE 4FHBD 2NY3D 4EUPB 1BZ7B 1GOFA 1K2DA 4P2OB 3VXMA 5D7SL 5FV1L 1KCUL 1M1SA 3QUYA 4P49A 1BD2D 1NCWL 2OR9L 2A6IB 3F6LA 4ZQKB 5HBBA 2NY3C 2CLRB 3FAWA