3T5WA

2me modified human sod1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
152
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural switching of Cu,Zn-superoxide dismutases at loop VI: insights from the crystal structure of 2-mercaptoethanol-modified enzyme
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 37
structure length 152
sequence length 153
chains with identical sequence B, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3t5wA00
3KM2A 1PZSA 2ZKWA 1Q0EA 3L9EA 3GTVA 1EJ8A 1E9OB 1SPDA 1SOSA 2WKOF 3HFFA 2WYTA 2XJLA 3MKGA 4B3EA 1CB4A 1F1DA 2AQNA 1U3NA 1F18A 3HW7A 1PU0A 4OH2A 2C9UA 1YAIA 1MFMA 1XTMA 2E46A 4A7TA 1TO5A 2WYZA 2VR8A 2GBTA 2K4WA 3GZPA 1B4LA 1SDAB 3F7LA 3RE0A 4BCYA 2GBUA 2Z7ZA 1IBDA 2WZ0A 3CE1A 3T5WA 3GZOA 4FF9A 2C9SA 1QUPA 3ECWA 2Z7WA 1F1AA 1HL4A 4BCZA 1Z9NA 2AF2A 1OZUA 1PTZA 2SODB 1E9PB 2WZ5A 1B4TA 3ECUA 1IBFA 1IBHA 2Q2LA 1OAJA 3KH4A 1DO5A 2APSA 2NNXA 3PU7A 1OEZW 4A7GA 2WWOA 2AQTA 3KBEA 3GQFA 2JLPA 5KBMA 1SDYA 1SXNA 1YSOA 2C9VA 3KH3A 1KMGA 2VR7A 1XSOA 3K91A 1SXAA 2ZOWA 5CU9A 1OALA 3QQDB 4OJAA 2E47A 3GTTA 4MCNA 2VR6A 2Z7YA 4N3UA 5KBLA 1N18A 3KM1A 5KBKA 1AZVA 1IB5A 1JK9A 3CQPA 1P1VA 1F1GA 3SODB 2JCWA 2V0AA 1RK7A 2XJKA 1E9QA 1S4IA 1IBBA 4A7QA 1DSWA 2LU5A 1UXMA 3CQQA 4L05A 1FUNA 3GZQA 4BD4A 2AEOA 4A7GF 4N3TA 4A7VA 2GBVA 1TO4A 2AQRA 2R27A 4U4IA 3KBFA 1UXLA 1HL5A 1OZTG 1E9OA 3MNDA 2WKOA 1BA9A 1SRDA 1Z9PA 2AQPA 3LTVA 2ZKYA 1SXBA 1JCVA 2ZKXA 1BZOA 1SXZA 1L3NA 1CBJA 3H2QA 1XTLA 4A7SA 1SXSA 3L9YA 1E9PA 1ESOA 4A7UA 3S0PA 1JK9B 3ECVA 1N19A 1E9QB 3H2PA 1EQWA 3F7KA 4MCMA 2AQQA 3HOGA 3QQDA 2AQSA 2WWNA 2Z7UA 1COBA 1YAZA 1SXCA 2WZ6A
chains in the Genus database with same CATH superfamily
3GSVB 1OAQH 1F41A 4JKMA 5F7EL 1MH5B 2J8UF 2WXPA 3GKWL 1ZVSB 3FO2B 5AEAA 1G7PA 2ZUXA 1HYSC 4HIPA 4Z78B 4QHMB 5BQ7A 2AJYL 4OZFB 1A6AB 1W0WB 3NK4A 1ZV5A 4GKNA 3C8HA 4ZMZA 3DX1A 2HTKC 4ONGH 5GSRA 1H8NA 3L45A 3MV9D 4KJYA 3ARGC 4RLDA 4XI5D 5EO9A 6PCYA 4O4YL 2UYLA 2FD6L 3L3IB 3L7EA 1KN2H 1RK1A 3FSAA 4FFYL 4TSBL 2A6IA 2D7MA 1HESA 4Y19B 2FJFA 5GRZA 3O2DL 2NY2D 5T5FH 2JKLA 3HG1E 4JM4H 2O6DA 2MQ0A 1QFPA 1G7LB 4YO0A 1DHKA 3PXJA 5D7KD 3ZHDA 3RPIB 3KW8A 4POZC 2JSFA 3MJ8B 3DK2A 4UQ2A 5F93C 3RVVC 2WKGA 5JHDA 5PAZA 3L3JA 4H1LH 2AEPH 5E03A 5FOBB 3BPNB 3BVNB 5MENE 5C0AE 4UINH 2VL5B 2OW7A 3EF7A 3MX0B 5HHXH 1M1XB 2DL9A 2Z64C 2HT3D 2ZXAA 4EI5C 3SYPA 5IM7A 3HMXH 3ZT5A 4HD5A 3QC5X 4YDVA 3PWLA 5IKCA 2FEJA 1FV1B 2XY2A 4BA0A 2A3TA 1JZDC 5D7SH 1REIA 2JVUA 4NZUH 3GBMH 1I1YB 2UX7A 1CG9A 1DVFC 4ODXB 4JQIL 2FX7H 5ILTH 5LG6A 4UNIA 3ROOB 2FLMA 5LNDA 3E9TA 2X70A 1M2VA 5CZVH 5C70A 3CQQA 3F8UB 1FUNA 1U8QA 1QI5A 2K0RA 4O9HL 2XRAH 4E68A 4DJMA 5E6IB 5K9QI 2J25A 3TN0D 1ASPA 1GH7A 1UA6L 3LOWA 1YEDA 3ABLB 2WKOA 5D1ZI 3WL9B 5BUGA 3VFGL 2IBZY 3HG1B 5I19L 3GPSA 2PXYA 3HKFA 4ATTA 4EQ2A 2DKSA 1IJ9A 2ZOOA 2NNAB 3ARTA 3MA9L 3EYOA 1ZS2A 3HG0A 5IHBA 3RZCD 4GKZB 5ALBL 2K1MA 2FCBA 3IMTA 1KCVL 2HRLA 1CGVA 2NXYB 5MENB 3QC6X 1WD9A 4L8DA 5EO1B 5KUMA 4ABUA 1I82A 4RRPM 2JCCA 4IRSC 4M1GL 1JPGB 1QPKA 3MRBA 1G9NH 3TM6A 2Q5BA 2WWKO 5AW1B 3DV6A 3S5ZA 3E9UA 4QKTA 1RUKH 1D9KC 1SBSH 3M17A 3QG6B 4TULL 4XPHL 4TQHA 3NEEA 2YSTA 5AB2A 1URIA 3BO8A 3RWCB 4KO6A 1NIAA 2COQA 4FKHA 5E9DB 4WUKL 4TTGA 4QNPF 4FXLA 3PL6A 4PRIE 2H0PA 5L4JA 1KBPA 1XZ0B 4XNBA 1JXDA 2XCMC 1JHTA 3BQVA 2JKWA 1MCKA 3DBXA 4KMQA 4AM0Q 1JAEA 1ZAGA 2V4LA 5BS0A 3US0A 2VE6B 4JR9L 2EXWC 2X89A 3VSUA 2GSIB 2JJTA 2ODHA 1BD2D 5I6XB 1CGWA 4J5VA 3EG9B 3MJ9A 1N6QH 5IB4B 1QRNA 1FAIH 4G8EB 1F4HA 5DMGC 3EXJA 1HXMA 5J9PA 1G5GA 3BN9D 2O5NA 1YNTF 1VFMA 1TVHA 3KR3H 3KWWA 3JWOH 1WZ1L 2Q87A 3ISRA 4FQJL 3N1MC 5JW4N 3S88L 1AHKA 2P44B 1V5JA 4URTB 3NQKA 3LPOA 2OP4L 3TEYA 1YZZA 4HKJB 1TYJA 3SBWC 3I6LD 4WTZG 4JPIB 1FC1A 2PETA 4R9HA 4PJCE 1JPEA 5AQ0A 2BNQD 3V0FA 3BQUB 1EXUB 3H53A 3TBTA 4HKBB 3VQ2C 1I3VA 3HPJA 1FVEB 1HE8A 1JF5A 5DS8B 5L9DH 3EDKA 5IFJB 2H32H 3K1DA 1TJIH 5JQ6L 4HF5H 1H6FA 3AC0A 4S1DC 2WO3B 1QAWA 2CCVA 2G75B 5JZ7C 3RJDA 1TSHA 4F15B 4JKNA 2ICCA 1NBQA 3DC0A 4U33A 5D8JL 4C56E 3CX5J 4X2UA 1GGUA 3D0AA 4TQPA 1L9OA 3ESPA 1ZLSL 5JHBA 4WEMB 2ZOLA 5MP6H 3TO4B 1TJGL 2IXQA 5FWRA 1NGWA 5D1XD 1LNUB 1TO4A 1C08A 2ZUSA 1WBXB 1IEBB 4M6OL 5HDQH 3BEVA 1V7MH 5SX5K 1VERA 4HGWA 4CSTA 1BFVL 5KW9L 4YFDB 1I7ZA 2CMRL 2NX5D 4JW3A 3U7YL 3VI3A 4HAKA 3FONB 1QBBA 4W4OA 2JJSC 2FUTA 5K9QG 1ACXA 1NGZA 4NJAL 2PCFA 3C6SB 2Y3AA 3V79C 2QSCH 4N8CH 4MB1A 2RQEA 5JXED 2BC4A 5CJ5A 1M53A 4LRNH 4LSRH 3KL0A 4ODSL 1ORQA 4P5TA 4FABL 1KBWA 5EPMA 1OD7A 3EH3B 3MRQA 1P4LA 2X4UA 5K59E 4PJCB 1A3RH 4RFOH 4U2YA 2WN3A 4PGCA 4BFIA 3LNEA 3SE3C 3CH8A 3EJSA 3A4DA 4IMLB 4PY7A 43CAB 1MWAB 2A6JB 1T1ZB 2BSSB 2QV4A 3SDAB 1X3DA 3PJSB 5CWSA 1JWMB 2XIDA 1RY7B 2NYZA 5BRZD 3V52H 1X7QB 3VH8G 1EGJA 4TNVF 1PU0A 4JBSA 4LP8A 4U6YA 1SMDA 1GCFA 3T1WA 4C56B 1PAMA 1R6VA 4NFBA 3U4KA 1S7TA 3I6KB 3WO3B 3QXAB 3VVVA 5C9KA 1JXJA 1VEOA 5EF1A 3LD8C 3QWOB 1MN4A 4Z3HA 1QFWM 2ZUTA 2ZJSL 5LQBH 2MQCA 1S5HB 1NBZB 2LGNA 3ARBB 1AIFB 3WFBL 3VU2A 4ORZC 2EZ0C 1MFVA 4KY2A 5DFWH 3O45B 5I66A 2GW5A 1B4TA 2ZOKA 4WU7A 1IAOB 4IDJL 4MNHB 3HAEA 4XTRD 3HR6A 4BFEA 3FO0L 4B9YA 4GP4B 2ARJA 5DEZA 1BEXA 4AQAA 4HBCH 4TNWK 4N8UA 3HE7A 2OL3B 1N6UA 3SPJA 3GXNA 2E76C 2BDNL 2F54D 2IH1B 3FUEA 3IMSA 4ZS6C 1KLGB 1KB5A 4PB0H 1F11B 1SXAA 1RUQL 4NQCA 3U9PL 4S11A 3U4AA 4N85A 4GMSL 4K8RC 3SE9H 3QQXA 1BYNA 3FB8A 3GI9H 4LGPB 2NW2A 3HC4H 1DVZA 3CVIH 3LZQA 4JREC 4ZTOL 1YG9A 4I18A 2E9WA 1V27A 2Q3XA 4JFEA 3N44B 3U6XA 1T22B 3CDGB 4YDMA 1G6VK 1IE4A 3BUQA 3QORC 4X5QA 4Z95L 2J5LB 4UM9D 5EFIA 5SV3A 3TCXA 3EJYD 4I1RA 1WWCA 4KMLB 3DNKA 1BYPA 2VQUA 4WTQA 1T6WA 2O5XH 2TSAA 4IDLA 3EGDB 2UZXB 3KL5A 3V0IA 3HI5L 15C8L 4U0RB 1OSZB 4AK2A 3TBBA 2AV1B 1JYNA 5BVJA 3M07A 4FQHA 4HH9A 4MA1C 1DUYA 4JGMA 4UV7H 3S5YA 3G3LA 1XWVA 3HTLX 3OKDA 2CLZA 3MGTB 3KBPA 4ILDA 2C4FT 1K8DB 1JFQH 4Q89A 2ZSVA 4QRSA 1EHNA 2N7SA 3IGAB 4WHTA 5KVFE 1FL3A 5DHVB 2AV7A 4WW1A 5AKSA 1UXSB 2C4XA 3KD4A 4JRXE 1D5MA 2J1WA 5AVTB 3G6AB 1NUDA 3BMWA 5DR5H 4ANVA 5CUSL 1DBML 5E8PA 4TRPL 1D6VL 2HUEA 3I3DA 3Q5YA 3WLBB 3AREA 1CN4A 1YEJL 2GHZA 2PP9A 1ID2A 3GJEB 5DQJA 2ZYRA 4F7EA 5AAPA 4JFQB 5EOCH 1T0OA 3KLAA 3U46A 1J5CA 1MCCA 5EMYA 2LQRA 3V0HA 2EADA 4LEBA 1UZ6E 3MXVH 4HZAA 5E8DH 4JFTA 4LLYB 2QMJA 3M1CA 5F6HI 3VYPA 4M9PA 1YAIA 1KCKA 1N3NA 3ZE2E 3T0EE 1BZ9A 1CDCA 5JW5A 2LW3A 3ZHNA 4YGVB 2NTFA 2VMEA 4YS4A 1B4RA 3GZOA 3KAAA 1IGML 4I3RL 1H6TA 4X6BB 2N0MA 4PBDA 3O4OB 2ZT9C 3MC0A 1Z9NA 4N26A 3QIWA 3VW3H 1GYVA 1LDPH 5IBTL 3WD5L 3QUYC 4OB5H 1HDMA 2AI0L 2D7OA 1D7BA 1I31A 3KPPA 2GQHA 3LKNB 1N4XL 3C8DA 4JM2D 1P4IL 3O6MH 1TCRA 3L5WB 4AENB 5LGHL 4FLHA 4JRXB 4MAUH 1WBZB 2ADGB 4W6WB 4K23H 3RYMA 2R0KH 1MY5A 2WMPB 3N42B 2EXYD 2XA8L 4LRIA 4GS7C 4AYFA 3BP4B 2YEZA 1TNMA 4HJ0D 3FU8A 4X83A 3FZUC 2FWUA 3O2WL 4QRBA 2JLLA 5TFSH 2BIMA 3THMH 3TYFB 4XPAL 3ZRCC 5F1SA 3IEAA 1UG9A 4Q9RH 4Y2DB 3SGEH 3WUWB 2E9BA 4GSRA 2W07B 1IFGA 5KSVB 4BQ9A 3FRPB 1DZ0A 1DBKH 4X80L 2ORBH 1OQXA 2FDBP 2H2PD 4KJQD 3ZE2B 3T0EB 4U1IA 3BD4A 4BYHA 4EDWH 2IALB 1H3PL 4G6FD 5EZLA 1BJ8A 4PV8B 2D2OA 4X7SL 4A2DA 2J7LA 1FGNH 2CA4A 2D3LA 4A55A 1E2VA 1H8LA 3NFNB 4J3XA 1KJ2B 1UGKA 4R0LA 2AMUA 3D87B 6PAZA 4E41E 4APQB 3RFZB 1XDTT 5GGTA 1S9VB 2ERJB 3OR7A 4NWTH 3RX9A 5T33L 3EDEA 2Z6FA 3IGFA 3TWCL 1O0VA 2ADJB 2NY0D 4LOFA 3H3PL 3BWZA 4G7YL 1VCAA 5AOJA 4LDCA 4G71B 2BXZA 3T09A 3SDDA 4O02H 1RZJL 3APDA 3ZZSA 3AM8A 5JO5B 3B2DC 3QUZA 5GGVH 4KQ4H 4WEBH 3IGKA 4FQLL 1HN1A 4ODVH 4RQQA 1E27B 5IHUH 2VLRB 3KDPB 1SYSA 3C5ZB 4Q6KA 1S3KH 4NQXA 3T0XA 1KWGA 3GI8H 2FZ3A 3DX6B 5D2NC 2H0EA 4JJOA 1NJ9A 1IUZA 2Y6TE 3FQ4A 3H7LA 3ULVC 3TA3D 3CVDA 4JRFA 1AXTH 4NGHH 3BSZL 3LX9A 2DYRB 4XP9L 5FO7A 5ID0A 1OB1A 4LESA 4LSSL 4LZKA 5EZOL 3GJFA 1UB6A 3T6ZA 3HPLB 2HVBA 5SX5H 4ZPVA 1THCA 3FH5A 1IU1A 5K59F 2KHAA 1W6WA 3QQ9C 2FYYB 1NLDL 3UTQB 3RJOA 4ISVA 3DOIA 4X6CA 4BH8A 3FJTA 3WENA 3ZTCC 1UURA 4PREB 3K8MA 1MW0A 1WT5C 3RDTA 3T2PA 2ENYA 2RMNA 3C2AL 1VSCA 2JV6A 2PXYD 3RX5A 4GAAA 1OPGL 4RGNC 3VXUE 2WUCH 3O8XA 3RIFK 3VD3A 3LZNA 4GRLC 3FQYA 4HJ1A 3LZFL 2KYIA 4F58L 3ASNB 4QHKJ 3FRUB 3GGWA 3K3QA 5AVYB 2P8MA 1WSST 4IK6A 2X9XA 1YNLH 4AQ8C 1CLOL 3BLBA 1XSOA 1BFOB 1MNNA 2EKSA 4KXDA 4QYOB 1GZHC 4UILH 1N9PA 3VGFA 1KZQA 1BPVA 4NYLA 3LIZA 3VUAA 3N85H 4OCSL 1T2QL 3NSDA 4JKKA 3TONA 3ZVVA 5I1HH 4JDTH 2F8VA 5I28A 2V9TA 5I71C 2X9WA 4WZ9A 2F5BL 4FQXB 1IBGL 4G6JH 2CJSA 1CGTA 1L0XA 4I0PC 3EBAA 4L8BA 4XGZA 5JIIA 1NPJA 5SX4I 4IMKC 1MLBA 1OAYH 3CLFH 4LCIH 2L8AA 4MQXD 3U1SL 5BUPA 5KVMC 4UI2A 2F19L 1NAML 3S3CB 2FR4A 2YZ1A 1RIVL 4CN4A 1MAJA 5I0DA 1X5XA 1OAZH 1UD2A 3VNZA 3L5IA 5BS0D 6FABH 1NMBH 5M7QA 3ULVH 4DKFL 3LTVA 1AR1B 4G7VL 1KT2B 2CA3A 2PWFA 2X89D 1NKRA 4PJXB 4Q0XL 4WJKB 1IE5A 3C12A 4U2ZA 3X14A 1SDDB 3KNBB 3GF8A 1QRND 5FF6A 2WQVA 2Z31B 2X44D 2W0KA 5DSCA 1ZANH 1LEGB 3LEYH 3SE6A 1P4BH 1XVSA 2R23B 3AQDA 3BW9B 2B1AL 4LF3B 2MNWA 3TT1H 4RMBA 3PWPA 3HR5B 1OY3B 3F7VB 2A7BA 4XC3L 1COBA 3JYBA 4J8RB 4J1UB 4TOYH 5MHSE 2MKLC 5HJBA 4QRRA 1EUTA 3VWJB 4OCYH 3MACH 2HRHA 1OANA 2IH3A 3C5JA 2A6DB 3HS9A 3QAZC 5DJZA 4GSDL 2YXWA 4PJ5B 3VJ6A 1FZMB 2WSKA 1INEH 5C1MB 3LKRA 4DCQB 4R3SB 1W72L 1FH5H 1J86A 2DQDL 4MASA 4YHNB 5EEYA 3FO9A 2QQNL 1P5UA 2IAMA 5FECA 2Z34A 1Q9LA 5IR1A 2WQ8A 4LLAA 3QCTL 4GAGH 4M8QB 4PJBF 4DVRL 2YD5A 4MJ6B 4P5KA 3ZKND 8CGTA 3F83A 1TEFA 3T3PE 3JV4A 4ODTL 1NFDA 2R1WA 4GEIA 3P9LA 5D7IE 4LBAA 4YWGH 2Z4TA 3MLVH 1JZ6A 1PG7W 2G30A 3QEHB 3CFDB 1L0QA 2MPAL 1ZRUA 4JFXB 2WOBA 1DL7H 4R97C 1L7IH 2B1HL 5IBLC 5DMIL 4H0GA 4FNRA 3KPTA 4NZ8A 1W8EA 3S35L 3D25B 3TZVA 4YXHH 3L1OL 1KGJA 3PY9A 2UY7A 3CVHL 5GJTL 1YSOA 4P5TD 3H7BA 2CR6A 3UPAA 4YLQT 1CFQB 3BGFB 5D71L 1HILB 1J0IA 4L3CA 4P2OB 3MJGX 1A7PL 4IIQB 1LEIB 4D94A 2ZAHA 4PJ7A 3PDOB 4B60A 5KSAD 3K71A 5IMMB 4FQ1H 2Q7YA 4JO2H 5E5LA 3ARBC 2QPDB 4WI0A 2VXSH 3G04A 1AQKH 1AY1L 2WQXA 2BP8A 3V4VB 1U2CA 4JVUA 4WFGE 1F0LA 2X1OA 2EDOA 2AEOA 4XMWA 2FECL 4P23B 4PJBA 3NN8B 4RDQG 3CDZA 3FOLA 4LSPH 1R9FA 1MJ8L 4MJ5B 3NUKA 4K15A 5FYLH 4NHUA 3MJ6A 2CBQA 3O0RL 2I26N 4G9FE 5F9DC 4P3DA 5HHME 1U3ZA 3L9RB 2R69A 3C8KB 3T3PB 1G7HB 2GITA 4U0QB 3F12A 4NS0A 4DZBA 1U58A 1W15A 3AXLB 5C0GA 5IFHL 3WN5B 3UTTA 5F1IB 3JTTA 1Q38A 1LXMA 4FYQA 1FZJB 2A38A 1GZQB 1NCNA 3CFBB 3DSNA 3P4NB 3VO0A 1L9SA 1X5GA 4WHYG 2BOCA 4U1MA 3HE7D 2X42A 2FECI 3LH9A 4ZMQA 1R3LA 2B3RA 2R8SH 2PYEA 3PG2A 3QFDA 1OGAA 5FA4B 3UOAB 1NPUA 1NBVL 3CH1A 3ZHKA 5KYWA 3VRJA 2I69A 4NQCD 1V3JA 3WJJC 2CHWA 1IC7L 4MRCA 4NO2B 4ONOA 4XP6H 5I24A 3LKQA 4ZMWA 1SOXA 4EUPG 1FORL 4JFED 5KG9A 4UQ3B 3ZYJA 4GUQA 1RZKL 4QT5B 4UQCA 1XV8A 3EYQC 2AVFA 4MNGA 5IWLC 4MA8L 1FE8L 3SHSA 1K5WA 1BYOA 3SQRA 3WE6A 1SEBB 2C9SA 4NIYE 3UZQA 3DX9B 3WLWC 2W0FB 1OL0A 3KWVA 3LH2L 1V7NH 3U2JA 3APMA 3KXFA 1NA8A 5TE6L 4L4VA 3Q9QA 1TZGL 1BV8A 2WKLA 2HLFD 4M7KL 3KYMA 3IJHB 3RY4A 3IF1A 2WWMC 4YX2L 1H0DA 3OMAB 2EDJA 1J5OL 1MCOL 4I3SL 5AZEL 2WN2A 3MRJA 4X98B 2IH9A 4FQQB 4H0IA 3KLLA 2P5WA 3ATAA 4BFFA 5I74C 2BFVH 1G9ML 3F7PC 4AEFA 4HUWB 1KFAL 2NW3B 3HNSL 1HHKA 4IM8A 3FBQA 3KPQA 5BVPH 3P73B 4JFFA 3WKQA 1AZZC 1UB5B 3N1QC 3SYCA 3ARED 3LKSB 4GT0A 4F37K 1J9QA 1NM9A 4EEEA 2E8ZA 1T83C 2HFFA 4N3UA 2KDYA 1F1GA 5GGRB 4JHWL 5CFAA 1HT6A 4FQIL 2GPZA 3SEPA 2HKHH 2XI9A 2IPUK 2OI9C 3VXMB 3GIVB 3ZSTA 1OD9A 1CE1L 3OKLB 5LDUA 4XNXL 4OGZA 5IVOA 3SO3C 3EYSL 2NY5H 1A1MA 2FX9L 2HUHA 3FU7A 5DJ2A 4I0KA 4NM8L 3SPVA 1DJXA 3WFCL 5EEVA 3GSRB 5ANHA 3QIUB 5FEBA 4YDKL 3NEXA 2XX0A 2Z1PA 2HPTA 2WTRA 3D9AL 4JN1H 3GC3A 3QIWD 3M8OL 1F90H 4H1LB 3U7WL 3O4LA 3CN3A 3PJLA 3T6VA 4A39A 5HHNA 5DD5H 1SYVA 2JFCA 5AOIA 5B39B 4D0CA 5EUKB 2ETWA 2EH7H 3SKUD 3FQWA 2CZNA 3HBZA 3D48R 4NXSA 2GTZB 1EX0A 1FL6B 3EOTH 4JO4L 1FG9C 1UQSB 1A0QL 1JPFA 2HLAA 5DUBB 3D85A 1D7DA 4WNQB 5ENWB 5DHYB 5KYUA 1EJOL 4F3FA 1B3IA 3P4OA 2GTWB 3UACA 2GAZA 4GH7B 2AKRA 4QLWA 2CKNA 2EDHA 4HIHB 2JWYA 3I75A 3EJTA 3H4FA 4ALAH 1GRWA 1UJTA 3AQXA 5CIPB 3GRWH 3RVXC 1ZA3A 4BZ1A 2VZVA 1TENA 3SKMA 5DJYB 3CHQA 2BVEA 3C6LC 4N8VG 2V2XB 1VACB 5FA3A 5I76B 3O6FC 2Z7ZA 5GGRY 1R3KB 4XZUB 5DQ9A 2UUDK 5DD1H 1HOCB 4HMDA 4AW4A 1E65A 2UV3A 3DETD 3RUGE 3GSUB 4YEEA 3VB8A 2FHFA 3RWEB 1XIWB 2QLVB 2QJDA 4ZODA 4ZO6A 3MRPB 3SGJA 3MOQA 2J71A 2EE9A 3IMUA 4OIBA 1E4KC 5E8NB 3WGVB 5EN3A 3BH9A 1JWUB 2G5BB 3DURB 1DYZA 3DXAA 5J06A 1Q1JL 3OAWA 1G9EA 5FYJH 1FQ9C 3NZHL 4H13C 4NKDB 1JNJA 3GXUB 3O0LA 1A6TA 1EEZA 2H26B 5L88L 4I1NB 4LSVH 1U8LA 3W57A 5LGYA 4V33A 3SDDD 3FSZA 2ZOWA 1NGQH 2YQGA 3DX7B 4UIMA 4HJJH 2A9AA 1RURL 2B39A 3GMMB 1J0HA 3IXAA 5D7IF 4KK8C 2DWYA 4K55A 4I8DA 4WRLA 4Z3IA 4LNVA 2X53A 3LZRA 1BF5A 3VRLF 4YDIH 1IFHH 1NFAA 4BH7B 2O5YL 1BQLH 2FGWH 3IFNL 3BP5A 2GCYA 1OCWL 4M61A 5DRNB 3PWVA 3RIKA 2A4EA 3SE4A 1B0RB 3TH2T 2DI9A 3NIFE 4FMVA 4X0NA 2W91A 5AAWA 2GK0A 4LBEB 2CO7B 4MVBC 4GRWH 3RUGB 3BRFA 1VF5C 5C8JA 3B5GA 4LNRA 2C1OA 3IWVA 1GOFA 1CDYA 2HG5B 4U31A 4FG6D 1AQDB 3RZWA 2IDTA 4W9JC 4JDZA 4AEIL 2EVHA 3BVXA 4R7DA 5DLML 1UCTA 1UM5L 3FBKA 2H2SD 4M8UA 5AW8B 4A7SA 3OLEA 4JZJC 3J07A 5EDXA 4XZ4A 4PGDA 5ADPL 2LAGB 2DJ4A 4HD9A 4K9EL 5LGJA 3BT2H 4NLAA 4QRPE 4XC1H 4KOBA 4Z6AT 1OHQA 1MIML 1DANU 4PRHE 1CVRA 3O8XD 4NSKB 4XVSH 2BINA 3H9ZA 1K4CA 4K3EH 4OCMC 1T0PB 1MHCB 4XPFL 3WS3A 2CE6A 3VTTA 4DOHE 4EOWL 4X4KA 3U4EA 4L8CB 1E4WL 1YUHB 3IMWA 2EH8H 3JWDL 1XH0A 4MJ2A 4Q2ZA 5D93B 5FO9A 1PNCA 3TFKC 4XCFL 1WFMA 4AYGA 1EFQA 4KKRA 1E4XI 1BVLA 2CDFB 2V8MA 1OPOA 4I88A 4U1LA 1U6AL 5I5JA 4LEXH 2OTUA 2BSEA 4XBEH 4AUYA 5KYNA 4Y5VA 3F01A 5ALCL 1KTLA 4BCYA 4ABVA 2XWBB 3NIFB 4ZNEE 3ES6A 3W9EA 5A2JH 2WLHA 2WZ0A 4OSUL 4U1GC 1IARB 3REVB 5EU6A 4LFHD 1A1NB 4PR5B 5CS7A 4YE0A 1ZE3H 2PWEA 1KXTB 4JZOA 2Z31C 4LQ1A 1Q94A 3ILPA 3UC0L 3L7FA 1FNLA 4NPYB 2H6PA 2ENPA 2GK2A 4FMFA 5C09E 3UADA 4JRYB 1I9JH 4JNXA 4Z77B 4RMTA 1KB5L 1IGIH 2J2ZA 5TDNB 1R3IL 1RPUA 5GGSB 4EKXA 5I0VA 3FFCA 3ZGIA 1TQBB 2VWEE 1KXHA 3JTSB 3D34A 3Q6GL 4ZBJA 5GHWH 1UGNA 5T1KB 3ZE1B 2GIXA 4QXUL 3DIFA 2PO6B 2ITEA 1J8HA 4KI5C 1X5KA 1ZEAH 2ATPB 3UAJC 1IJNA 3PWPD 1XF2B 2J4WL 1QRKA 3MLRL 1ETZA 1ANUA 1IAIH 4A37A 1T89A 1WH0A 4QRRD 3P4MB 4MQTB 4OCXH 4F8QA 2VDKH 1IL1A 1JK9A 3MRDB 4S1QH 2X9ZA 2KS0A 3ZT6A 5KSBA 4ZQKB 3QZMA 5ABAA 2Q1EA 1C5DA 1CXLA 5DGQA 3FFDB 3L3DA 4JFOA 3EOBA 2D9QB 4JVPA 3WEOA 2XWTA 4U3HA 3R7RA 3MNZA 4DNLA 5ETUA 4PJ9C 5AVVB 2WV3A 4AVHA 3T6QC 4OGAD 1DVSA 5BMFH 1EDQA 4X5XA 2D7TH 2DD8L 5J89A 4PG9A 1ND0B 1D5BA 2VR3A 3MV8E 4OF7A 3Q06A 4XBPA 4APXB 3D09A 4TQ8A 4TVPH 3BLKA 3H9SD 1LE9B 3LQZA 4GBXB 4G72B 3F05A 3KYNA 4G42B 3BGFC 5I15H 2DQJL 3QNYA 3IBEA 4XN4A 1UACL 4JEGB 2WJ7A 3V10A 3TZVD 1RQ5A 2N1KA 4EZJA 1T2JA 1E6OH 1I7TB 1NBYB 1KB9J 3CPUA 3LQAC 2BOBB 3BGMA 4XB7A 4ZOCA 2PLTA 3LAFA 1VCBC 3MRCA 3PQYA 4Y2OA 5IEKB 3US9A 4PVBA 5B7MA 2WVUA 2CBOA 2E27H 3VDCA 1OE1A 4P23C 1N26A 3P0GB 4GLRH 1GGCL 3GK8H 3IJEA 5HGBB 5HY9A 3FB7A 1OAXH 2OMUB 3N04A 1GZPA 4WDIB 4E5XB 4DP6X 2EEBA 5FM4A 1R3HB 2CJUL 3O3EA 4JPWH 1I8IA 2UZPA 4GW4B 3STLA 5E9NA 1QSFE 4TXVB 4HIJB 2YPLA 1KB3A 1HH6A 1UVQB 5G5DA 2M2DA 2OX5A 4HS6A 4KAQL 1NC4B 3PF2A 4OJFL 2WZ5A 3AABA 4IKJA 1YECL 3DUUA 2VO8A 4KQ0A 1BOGA 3MV8B 4CMMA 5KVEH 4V2CB 2F58L 1RXLA 1S8DA 4JAMB 3BDYH 4AT6A 3BAEL 1MCFA 4F9PC 1NDGB 3PIQA 2X0UA 3QULA 3NPZB 1E50A 3UTTD 4BK4A 3P0YH 3JT0A 4BSWA 4J3OC 1KBKA 5IB3B 5F89B 4PRNA 4JQVC 3EYVB 5EZJB 4NB7A 3KZ8A 2I27N 2Y4SA 1Y1UA 2VC2H 4PB9H 1LE5B 3UG3A 5E8OB 3QQDB 2X05A 4FEIA 2NY1C 4HUUA 2PYED 1LL1A 1OGAD 2AXGA 3ERXA 2Z0UA 4KHXL 4ZXBB 1RULH 3KPSE 4O51B 4WQOA 3ZX1A 4QRTA 4P3CH 2I60H 1RFDH 1BXUA 1ROCA 2UUDH 1H6UA 5C0EB 5L2JB 2Y36L 4HXBL 1XCTB 3FB5A 5GGTL 4HS3B 3MOBH 5TE7L 1HKLL 3LQAH 1A4JA 4U4IA 1QSFB 2XXMB 2AJ3A 1OSYA 2DWEA 3ZDXE 1RI8A 1ML0A 1BVOA 2A4ZA 1R19A 4HWEL 5ITBL 4X4XB 5F70A 1HS6A 4WEUD 1M4KA 4KKCC 5C0CE 4Y8AA 1WIUA 5E6YA 3OL2A 3T77B 1BLNA 1MHPL 4EI5A 2I07B 5J7CC 4HCRL 2A9DA 3K0YA 1HI6B 4L4VD 1TZIA 4GIOA 3RILA 3N06B 5ERWB 1CK0L 3HC3L 3MU3A 4A7UA 1BZ8A 2P26A 5GGUB 1LGVA 4PIBA 4NZFA 2VQTA 3KW7A 3W0WE 1BBJA 1QACA 4PS4H 3IU3A 5K9JL 1DN0A 3BFWA 2RQ8A 2BVOA 4G43A 1HTYA 1OWWA 3OJDB 1VZGA 3KM2A 4HK3J 3UYRL 4YMPA 1IVTA 5FK9B 2BZ7A 2D3VA 4RWYL 3ZZ1A 2IQ9L 4ZMYA 4JFFD 5FHAH 4UT7L 2E7CA 1YMME 2XQBH 1A14H 3LPGA 1TJHH 3IK2A 3GXPA 5ISZA 1AXSB 2H3NB 1R34A 2E7MA 1OTTC 3KPSB 1KTDA 3QRGH 1UWEL 3JWNC 1XTMA 2OMZB 1K5NA 3OKEB 1BAGA 3MA7B 2KZKA 5DJ8A 3QIUC 3RGVC 2B1OA 1NCUA 1RVFH 1QATA 1U36A 1AGFA 4XE0A 2BRRL 5C86A 3CE1A 2BP0B 3CFUA 4ONFL 4J2XA 4JFHE 5A2BA 4X50A 1M9SA 4Z7WE 4FQCH 3ZDXB 3ARDC 4W9EC 4D2NA 2E7LA 1KG0B 3GDBA 2YA1A 4ANUA 1NGYB 4DO6A 2RD0A 4J6RH 1W2KT 1WDAA 3D0VB 3SY6A 4AGNA 4K3DL 2BJMH 2KQNA 3UZVB 3VMPA 3NJHA 3GMOB 4JHZA 2BY1A 5HHQB 1JGDB 3QVAA 4OKVB 1DLHA 4E9XA 4NO5B 1D9KA 3RWHB 5GZNA 1SJMA 5F3HB 2L7EA 1TVBB 4Y5YA 3QARA 2DQFA 3EOAB 3O4LD 4NAJA 3SJVE 4WAFA 3U36A 4EBQL 5JIHA 1S9YA 3W0WB 2OJZH 3HZYA 2IWEA 3FDWA 2BIQA 2HFGL 4IS6B 2APFA 4FYSA 5HDBF 2EDFA 4A04A 4M9OA 4NQVB 4JPKH 4QCIB 1JF1B 3D85D 4IGBA 3L4CA 4NO3A 3Q5TA 3V6OE 2AJVH 2YAFA 4AYDC 1YUKB 1YEEH 4XXCC 1KIRA 4XCEA 1A6ZA 1USZA 2VM4A 3BVVA 2LAAA 3BWAB 5TF0A 3QHFL 4K71B 3VA6A 1HINL 4LCWA 2CJ3A 1ES0B 4UT9L 4PGJA 1XIWC 1OQOA 3MYJB 1B0GB 4MD0A 4YJZL 1KYFA 2WTPA 1KJVB 5D2NE 4NUGH 4Y16D 4H8HA 1GAFH 4CVWA 2X6BA 3TX4A 2YSSA 5K39B 1TXKA 2ICEC 4Z7WB 2GHWB 4IHOB 4TVUA 1A1OA 1BMGA 4CKQA 4WCYL 2PYFB 3V0WL 5CEZH 2NZ9C 5J1SC 2IPTL 1WAAF 1BZOA 3RVUD 3PGCA 5CZKA 4DZ8A 3OC5A 5FLUA 4L0PB 3DGCR 4OCNC 4N68A 3EIFA 2D03L 1YPZA 1ZHKB 1RUML 5IQ9A 1J18A 5E1HB 3FN3A 1ZSDA 1CCZA 3UP6A 3VQMA 3SJVB 3U2IA 4A2MA 3DXAD 4AK1A 2HPOA 1AS7A 4PP1D 4WJ5A 4QWWC 1IGYB 5CBAA 2H0FA 3WIHH 2JJUA 3ISYA 1XF5A 3D69A 1SM3L 5GGVY 1VFUA 4RGNE 4H88L 25C8H 4FI8A 3KPRE 1L7TL 2OJ1A 2VZ1A 1IQDB 4AZ8A 3H9YA 1JDCA 1KGXA 2R56H 2Z4QB 1DQDL 3PHQB 1FFRA 4FS0A 1F8TL 1F4AA 2YR3A 4P59L 4M8VA 3SIKA 2YMXH 3F58H 4Z3JA 3CZLA 2RFXA 4I48A 4NPJA 4WFFD 2VLLA 5F9JB 2VDMB 3D4CA 1HL9A 4BFOA 2VO5A 3MSPA 4D0BA 4NRXB 3GMNB 3WXWL 5E00B 2QQLL 3BPOB 4HKZA 1XHHA 1JTPA 4FN0A 3ZQXA 1U92A 3VXTA 3ZDYF 1FFOB 2WGXA 4D3CL 2FSEB 2V3DA 2OXHA 1AHWC 1UD5A 1CBVH 3PP4H 5F44A 1NIFA 3VNYA 1AYOA 4A2LA 2E75C 4NO0A 1GPOL 3FUKA 4DUXA 1KLFB 4AKOA 3QDMA 3LEVH 4G3YH 2ZF8A 2DQTH 2UY6B 5I8OH 3DTUB 3F2LA 2Y24A 3LMJL 2BY0A 4ZFQA 3HVDA 3N43B 3WCYA 4MMZC 4OZHA 3QBTB 2NR6C 2K3HA 4OFIA 1UWYA 2GJRA 4YHKH 2DI8A 3PXHA 2HJKA 4GKLA 4CC4C 1CLZH 3CMOL 3ZL4L 2CIIA 1FBIH 1BAFL 4BXSV 4FA6A 2DWDB 3EGSB 4JHAH 4MYPA 3UERA 3KPRB 3P2TA 4AQ1B 4LSTL 2FJHB 4WW2B 4ZS7L 2BLFA 2OXGB 3GO1H 3WI9A 3VFSB 1NL0H 5INDB 3HZMB 4OD1H 1CT8A 4M7ZB 2KH2B 5BV7L 2N3JA 1CF8L 3V5DA 2WXGA 3VFPA 1A4BA 1YYMH 2JI2A 2YC1A 5DZLA 1D2PA 3OHXA 3TNMB 5FYLE 1TPXB 1PVHA 5IBUG 3LCYA 4BK5C 3Q6FA 5IHZA 5AZ2H 1A3ZA 2BSED 4EJ1C 2PR4L 4XHJC 5D7JC 1ETB1 5ICUA 1NGPH 1XEDA 4WK2B 1QVOB 1J12A 3GLDA 5CP7A 4YOKA 1I85A 5EU6D 3ZTJG 1F5WA 2LOEA 3C60B 3PPSA 3MRMA 1TQBC 2LLNA 3G6JB 5AKVA 5MERB 5I9QB 2WM0A 2UWEE 1HSBA 2FUQA 1QNIA 5F3BA 2EO1A 5I1LA 2DY2A 4N0YL 1KJMB 2R0LL 2PO6C 4YHOH 3N9GH 1YRKA 5IK3B 3QORA 1NKOA 3FQ2A 1R17A 1JUFB 2VDNL 1FGVH 3FQNB 3HC0B 4BKTC 4LFHG 4XVUD 3FFCD 5BXFB 1N12A 3EZJB 3L1FA 3RI5F 4L18A 3WO4B 2WWNA 4DQOH 1Q0XL 2K78A 3EW3B 3N40F 5F96H 2GKIA 3FSVA 2X41A 2H6OA 3EHBD 3MLPA 1CICD 1EBPA 1VADB 2GSGA 4P05A 1J8HD 4F57L 4G11A 1ZJBA 2YBRB 4WK0B 1OAKL 4G8GE 2C9UA 3GSOA 2YLKA 5I6KA 1AFVL 3FNKA 5EA0L 5B21A 1SFDA 2NDGA 1B2WH 4U05A 3C6EA 1I9IH 1UEMA 4PAZA 5FWQA 5CJXC 2ZSWA 2VABA 3NZUA 4L2YA 3EFOA 4Y1AE 4AH2B 3NCYS 5DURD 3FT4A 3GKWH 3K72A 4KHTH 4ZSOE 1C9SA 4Q6IC 3OPUA 4E9VA 3TBCA 5D4IA 1PKQA 1QR4A 4RMSA 2AJYH 2NQ3A 3CZKA 4AYBA 3FQTB 5IZ7A 1XX9C 5FDWB 3ZDWA 4YPGA 5B38A 1JPST 1OXYA 2UWEB 1E4HA 1T7XA 3NFPA 2WW8A 4R4FH 2NXZC 4MB5A 5IFAH 4N0UE 2DIEA 3QJRB 1XFPA 3L95B 4O4YH 1EZLA 4HEMA 5DHMC 4Q14A 5A6LA 4TSBH 2CUAA 2NSQA 1G4RA 2Z9TA 1FFPA 1A6UL 3AU0A 3O2DH 4FULA 3UJIH 3EOYG 4MAYC 4WO4B 4M00A 1NOLA 3L6FB 4W9CC 4GUPA 2E47A 5SWQA 1FVDA 2VDPH 5DEFA 1K9TA 3QPQC 3ZPDA 3PQYD 2XACC 3QUYA 3CPLA 4G8GB 5EHFA 4WNJA 1BG1A 4Y5XB 3ECBA 2PPFA 2CR0A 3RTQC 4OCRH 3SD5A 3HCVB 3HUJA 4CDHA 1UH4A 3DVGB 2WVVB 5IIEA 1B90A 4XN8A 2ESVE 3GSVA 4Y1AB 3BT0A 1MH5A 1FLRL 1ZVSA 3CSTA 3FO2A 3MBED 3VG0L 4FZ8L 1ZXKA 5EOCJ 2YPLD 2NZ1A 3R18A 1A7QH 1JFHA 1PZ2A 4QHMA 4RH4A 4G70B 4Z78A 1KCBA 4OZFA 3B9KB 3JVGC 1A6AA 2RBLA 1KCLA 2IBGA 4EAEA 5EZIL 3ESVF 5D7EA 1WGOA 4U1KB 4BINA 3VFRB 1NAMB 4HULB 4MMXB 5HHOA 1DBJL 2YXFA 1JWSB 1NM4A 3GXMA 1N70A 3L3IA 5BW7A 5AYUL 3ULVF 2W94A 1AS6A 3MRIB 2PCPB 4Y19A 3RQ3A 2GT9B 3VFOB 3VFGH 2F7PA 3P0VH 5F7MC 3IDMB 4RISL 1G7LA 1N64H 2NRDA 1EHLH 1SY6H 4E36A 4FCHA 3RPIA 1FWXA 2XQ0A 1MRFH 3DRTB 3MJ8A 3W1ZA 5ABDE 2DIJA 3UJJL 2WXOA 3CDYA 5ALBH 1RIUL 1SN5A 4BXVA 3ARQA 4RZCB 5FOBA 4H20H 3BVNA 4QOKD 4JE4B 4UBDC 1YYLL 3GZPA 5C3TA 2VL5A 4E2OA 2LTQC 3M1BB 3MX0A 1M1XA 4DN4L 5FIEA 3TF7C 4M1GH 2WCSA 2ESVB 2CDGB 4POZD 4NLHA 4KDWA 5CSBA 3RVVD 2AJSL 1S9WB 2WLLB 4J3WA 2AK4B 7PAZA 1FV1A 2PCYA 2UXFA 1JPSH 5AW6B 2W1NA 1I1YA 1W72B 1XGZA 4ODXA 1YYCA 5IP4A 1A6VL 3ROOA 4Z7OE 5FYJE 1VFBB 2X4OB 1KCUH 4EI5D 3FTZA 3QT2A 4F7PB 12E8H 2ZX6A 2VZSA 2QVFB 5IREA 5E6IA 3V8OA 3IE9A 1JCKA 2C9VA 4ODWB 4PJHE 5E2WL 1XGQB 3GRBA 2APVA 3WDHA 1YEFH 3K6NA 2IDUA 2FT8A 2N4IA 2NNAA 2HJFB 4NERA 4OF0A 2BFGA 1EEUA 5DC4B 1JYVA 3ZKQD 2QLYA 4CRPA 4G8IB 4GKZA 1WZ1H 3LHPL 1KV7A 2B4CH 1S7SA 4UF7C 2YHGA 2KQMA 4XVJH 4AL8L 4L3EE 5ISZD 5MENA 2OP4H 3VSTA 3S2CA 4CUCA 3MFGB 3ZJAA 2H1PL 5EO1A 4GRWE 2D31B 3N6YA 5C0JB 3BXNB 1JPGA 3B34A 1KCRL 3LN4B 4YHZH 4MNQE 5D4HA 2HCZX 5GGQL 5TF1H 4JJ5B 5EC2B 3HFMH 1J1PH 1MKFA 1Z66A 1PY9A 1J8SA 5D4JA 2BY3A 4AQ8A 1FVCB 4NOFA 1M7UA 4WFHE 1SN2A 3RWCA 1GZHA 1MCLA 2ZF9A 5E9DA 4AM0B 3HA0A 1A9BB 1OTSC 3CFCH 4QRUB 1WZLA 4Z7OB 1XZ0A 2F7RA 1T1XB 3V4LA 4BZ2A 2A5UA 2C7FA 3S37L 1AS8A 3K2MC 4AYEC 1GOHA 4NI6A 2CRZA 1D9KD 5GZND 1F58L 4MJHA 3MOAH 1BQUA 3UYPB 4DP7X 3WIFB 1A7RL 1F4XL 4OLYL 2GSIA 2ED9A 1YEKH 4Y2NA 1BFVH 3EG9A 4PJHB 1II4E 5IB4A 1DVYA 1K6QH 4RIRB 4IRZH 2XN9E 2OZ4H 3E7JA 4JHUA 3PWUB 4XI5C 4NNYA 3GPEA 3T71A 4OW6A 1ZTXL 5IW1B 4IGBD 3KMDA 2VDOH 4DGIH 5JQIB 2V5RA 5I6NA 5E2VH 3A67H 5ACZB 2NY2C 4M7JL 1L9PA 4MZIA 3X1BA 2ILLA 3H2WA 3II1A 2YZ8A 4HKJA 4E0RB 3IRPX 3V7MA 4LCWD 2W5PA 3BQUA 4TSAH 4HKBA 3MR9B 4Z7VB 5DS8A 4QUOA 5IFJA 2XBDA 4N9GB 2NY6B 5TQ0L 4X6FA 3EYUH 4A2EA 2AQ2A 1TSRA 3UBHA 2H5UA 2G75A 4HFUH 5L2KE 1KJ3L 4FZEL 3I2CH 3F85A 5DUML 1P6WA 1IKFH 1FIGL 4PTTB 3VFTB 5HYSB 2HT3C 4JX0A 4ZO8A 5T3XL 3TO4A 1EDHA 2D0HA 3QCVL 1LNUA 4WJG3 2W60A 2ZJSH 3P2BA 1WBXA 1IEBA 5J3HD 5TK2A 3UO1L 1T0NA 2P47B 4AV0A 3LZOA 5E56A 3NFSL 2LU3A 4BK8A 4A6YH 3UH8A 1Q9OB 1WYJA 1B4JL 2ZYSA 1F6AB 1CE6B 1E7UA 2XN9B 5GS2H 3FONA 3BAIA 3QEUB 5DJ6B 3TA3B 3L8QA 3BPOC 2MOVA 1QASA 4WV1C 4XN5A 3C6SA 4GAYB 3MODL 3FSOA 2UX6A 5LAPA 2LFGA 1NCWH 3TN0C 1RPQA 3MCG1 3GS7A 3D05A 2F0CA 3ZXAC 1AE6H 3MNVA 4HA1A 1CS6A 3T2NH 3NYKA 1MF2H 4YZFE 1R46A 3STZB 4CVUA 1CYWA 5LBVA 3ZKMC 4L4TB 3FT1A 1P69B 5GXBB 3T0DA 3I85A 3DJSA 1SVBA 1U95B 4GMSH 2ENQA 3MGOB 4X42A 3RZCC 43CAA 2BSSA 5HVHB 3SDAA 3PJSA 2RCSH 3OTTA 4J28A 1JYWA 1JWMA 1G84A 5CLWA 4FJYA 2HTLD 2VXTL 1X7QA 4TVPE 3ULUH 3LPWA 5L2KB 5A43C 1L3NA 3QDMD 4C56A 1QR1B 5C92A 3I6KA 3UG4A 3QXAA 5KANG 3QWOA 1HC1A 1YEHL 2WNWA 5EEZA 1NC2D 3WAJA 4QHUB 1G6RH 1KCSL 1NBZA 2XV0A 3ARBA 4HC1A 4ECNA 1AIFA 1U8JB 1Y18B 1E40A 3MTRA 4MZ3A 2YQ2A 3QG7L 5F2FA 3O45A 2MQ3A 1QX1A 1XR8B 4X8JB 4XN7A 5D96C 3AUVA 3S2AA 5T3ZD 4UTBA 3X1FA 4KKZA 4MNHA 1SPDA 3HFFA 2VM9A 5HHVH 2VDKB 4KROD 3FYEB 2XWCA 5IG7B 1F4WL 3DLQR 2OAAA 1XF1A 1M3JA 4CL7A 2OL3A 4DAGL 1GGTA 2IH1A 5CUSH 2CUIA 4I9WE 4Z18A 2KZWA 3PV7A 4Y9EA 3CK0L 1D6VH 1KLGA 1JGLH 1TITA 5DCCA 1YEJH 2O61B 1F11A 4WHCA 3BN9C 2XVKA 4M48L 1V54B 2LHAA 3QR0A 1QEWB 3EYFB 3WY2A 2AEWA 4UZGA 5TPWH 4BUHA 5KVEE 1LMKA 4IJ3C 1NCBH 2ADFH 3RP1A 1T22A 1QLFB 1MSPA 3CDGA 1VZHA 4KKPA 2YS4A 1R0AL 1DBAL 4JDVB 4O2EB 3FTWA 1D7FA 3W82A 5TK4A 3KHOA 1IKNA 3EGDA 4KK6D 4EN3B 4L4JA 3PU7A 2AQTA 5CCKL 4MCZB 2P8LB 4YDLC 2AV1A 4UUJB 1WFUA 3WHXB 3F3HA 4JKWA 3TU6A 2E5EA 3AS2A 3Q5OA 1RZJC 3UPRB 5IWLA 2R29A 1ZGLA 2PPCA 4BQ6A 3MGTA 5IW6B 1U8IA 1K8DA 3A22A 1WA1X 2VMJA 4JUSA 4OLUL 1MRCH 4EZMA 2Y06H 1U8CB 3IGAA 3IMVA 5D1XC 4FNUA 5DHVA 4FTVD 3HRZC 4HWBA 4KBPA 3X12B 1UXSA 1U8OB 3AG2B 3RVTD 1AZVA 3C09C 5I6OA 1C7TA 3G6AA 1CXHA 4NQDB 5IMLB 5T1LA 4XB3A 1IMHC 2RACA 3E8UH 4C59B 1WP6A 4XVOA 3WLBA 2ATKB 2W9EL 2DQIL 5C0BB 4D8OA 3GJEA 1AANA 3FT3B 3NAAH 3DI2B 4JFQA 4ACTA 1CDJA 3QDJB 1J1OH 4XP1H 3DRQB 2EJ1A 4M1CD 5EBWB 5JXEC 1OIOA 1VPOL 5KJRL 2CQVA 3EO1A 1P7HL 4LLYA 4TQEH 4F2ME 1PS3A 5HP5A 2ZWLT 3BZ4B 1W80A 3LN5B 2AAVA 2QDWA 1XGTB 3L2LA 1QLEL 1WCQA 2YRBA 3QEQE 4GRWF 4PRDB 4YGVA 4WO4C 4D8PA 4OF3A 3VXSE 1ZD6A 2PWDA 4X6BA 1DQJB 5DO2C 2VDLH 3T2LA 1RZIA 2BIIA 2J1ZA 5GRXG 1V10A 2R4SH 1HNFA 3IDYC 2JMRA 4Y88A 3HI6H 3JZYA 3FQXB 2NMSA 1EJ8A 4LIQH 4UTAH 2IWGA 4J3TA 3K2UL 4PWGA 5DD0L 5DA0B 3LKNA 3BD5A 2IFFL 2F18A 4YXLH 3L5WA 4Q9QL 4AENA 4LXFA 4JRXA 5F7LB 4ERSL 4BHUA 5JYLA 1HWHB 2ADGA 2OZNA 2FQGA 1N8ZB 2VXQA 5E95B 2WMPA 1B4LA 2R2HA 1RZJH 4PP2B 1MRDL 3NCJH 3CSYB 4GI8A 4XTRC 5EU7E 2ZCKL 3BP4A 1CR9H 3SZKC 2AQ1A 3TYFA 1IGJB 4N2EA 3D39B 3Q1SL 1HHHB 4MMXC 4Y2DA 3WUWA 4OVVA 2W07A 5DXWA 4S2SB 1YVLA 5KSVA 3FRPA 4F2MB 2R1XA 4Y89A 4CU7A 1UYWL 2EDEA 2XWDA 1DEEB 3KPOB 3FZUD 4XE5B 3QJOA 2FX8H 3QEQB 3RWIA 3TNNA 4PV8A 5CJQL 3MBWB 2EDLA 2D2CC 4RDBA 5DJ0A 3NABL 3VXSB 3QYMA 2VN7A 1GY2A 3NCFB 3NFNA 1KJ2A 3CMGA 1G7QB 1I1CA 4YFLF 1FRGH 3WNKA 3EJYC 4Q56A 1EAPB 4APQA 3MREB 3RFZA 2P5EE 3LS4L 1QFHA 2GY7B 4FDWA 1S9VA 4Y19D 3SOBH 4OJAA 4B6ZA 1CC3A 1XXFC 1MNUL 2G9HB 3MJWA 5C07E 3NGBC 1JZ5A 2ADJA 4V1DD 1M3IA 5AB0A 4YPJA 3NPSC 3KVQA 2I9TB 3TWYA 3QPXH 4QF1B 4RAVB 2YD4A 3V7AG 4P5RA 5AWNH 3LSOB 1QSEE 1QFUH 5SX4H 4M1DL 1CU4H 1RK0B 4F58H 5ICZB 1TZAA 4O58L 5JO5A 3OR6B 1BEYL 1CLOH 2VN4A 4BFRA 1XGPB 2ZNWA 3LXUX 4EE2A 1E27A 5CEZE 2VLRA 5C7ZA 3C5ZA 4BCXA 3AT0A 4XOEA 5LDSA 2WBKA 3NCWA 2R9HD 4WHYH 4XX1G 3U7AA 1A7OH 1E5ZA 3CFMA 3BIBX 3DX6A 2ZKYA 4GMTL 5KJ7E 2YUXA 1IVLA 4N2LA 2EXTA 4PCKA 1IBGH 3V0VB 1N59B 3DX4A 3HPLA 3G5VB 4PD4K 4YZFF 1ADQA 2VSCA 1KENL 4EUPH 3U1SH 5JMOC 2FYYA 4HSCX 1D5IH 2F8IA 2JF1A 1RIVH 2DH3A 3ESUF 4YSRA 3UTQA 4KH2A 5FC9A 1RZGB 1QBAA 3OF6D 5E6ID 4DKFH 3CU1A 2P5EB 4I7ZC 2W59A 3LYRA 5KUKA 4Q0XH 4PREA 5C07B 3HG1D 4WI5A 3W2DL 1NCCL 1KYUA 3QXVA 1HJBC 4QGTA 3JTBA 3TASA 3HC2A 2X4TB 1Q72L 4F37F 2UXGA 4EIUA 5KVDL 4JE0A 3FRUA 3WXVH 3FU0A 1I4FB 1DJSA 2NXYD 3OXRB 1WEJH 4XP4L 5MEND 1BAWA 1BFOA 3PAVA 3C9NB 4QYOA 4UANA 4JM2C 3CZUB 1YC8A 1HL4A 2DTML 3GEWB 4AEHL 3MUJA 2X38A 5CSZA 3L4XA 4PJFF 1QNZL 5FYKE 4ZW7A 4Q97A 2ICES 3HMWH 4D9LL 3ALPA 2B2XL 4RX4A 2EXYC 4NN5C 3HHSB 4AMWA 4FQXA 1PYWB 3VFNB 1ZHNA 4HJ0C 2MTPA 4OLWL 3V4UH 3WFHA 3QFJE 5E9DD 4KI5F 1JZ8A 4ELKA 5SWZB 3P40A 2RR3A 4NPKA 4UQ9A 3DSFH 3V95A 2WLYA 1LEKB 1A9EB 2QQNH 1EMTH 3EFDL 3HHRB 3FMGL 3TJEH 1YQVL 4DFIA 1RL1A 1UCBL 5EF2A 2O93L 5L7XL 4OUOA 1ZA6B 2YGVA 5EO0B 3JV6B 3CFIC 4KJQC 2H2PC 1PDKB 1TTAA 4PJXA 5J13C 1IQWL 3BDBA 1CXFA 2IG2L 3KNBA 3RWGA 2E9JA 1C5CL 4B3VA 2Z91B 2Z31A 1A6PA 1F2QA 1LEGA 5DMIH 3CXHJ 3WNIA 2A77L 4BUGA 4LARL 1CLYH 2R23A 1K4DB 3TL5A 2PW2B 2IC2A 4LF3A 3REWB 1RUPL 1RZKC 4KUCD 4DKDC 3CVHH 3QJHB 4OF8A 1L9NA 3BAWA 3HR5A 3F7VA 4NRYB 2NY0C 5LG1A 4FYRA 4LKXB 4J8RA 1OCOB 4G83A 3CN1A 3V6ZB 4BKSC 1J0YA 3BQUD 4G1EB 3VWJA 3FU3A 4W9LC 4JFPB 4WUUE 1ZT1A 1FYHB 1OOAA 1F3DH 2VLKB 4M5YH 2XYBA 4FG0A 2R0ZL 4PJ5A 2A6KB 3CFEB 1FZMA 1BZ7B 2NLJB 3ZKXB 2IBZX 4FJZA 1SHSA 4WTWA 4YHNA 3CHXA 5GJSL 4K7PL 4R84A 5FGCE 4CVXB 1MJ8H 3H2PA 1G9MC 3TA3C 4M8QA 3TO4D 1QWNA 4MJ6A 3EO0B 3O0RH 5DUJA 4BM7A 2GJPA 5BOJA 1W16A 4AYID 3MLZL 2IANE 4IIZA 3ALXA 4FQPA 4LQFL 3GHBH 1YHPA 5LXGH 1BBDL 3GNMH 4WI6A 3QEHA 3CFDA 3GSNH 1DSFH 1U3NA 1MCRA 4JFXA 4N8PA 3UJTL 3OZ9L 1T20B 3LJ3A 3D25A 5KSUB 3IDIB 5F9WB 2K4WA 1XCQB 4FQ2L 4K2UH 1DE4B 4OVUA 5CINL 3JYCA 1IM9B 4J7RA 4Z0BH 3DV4B 2L7JA 3GINA 2ZUQB 2JI1A 1QSVA 2PXYC 4PRPE 1X9RA 4WI4A 1HILA 4P2OA 5IF0B 5DZ9A 5C6PB 4IIQA 2NUTB 5IBLD 3O6LL 1HXKA 1E0OB 3OZKA 5C3LD 1LEIA 3AW5A 4WUUB 2VB5A 4XHQA 1JZHA 2HT2D 4CC1A 1DLFL 5KEZA 3SDAD 4J3OF 2WUBH 5IMMA 1BREA 3V4PL 3KJ6H 4UT6A 3Q13A 5BO1L 2VKXA 3AITA 3V9CA 1RZKH 3V4VA 1E3ZA 3K46A 5FCUL 4ETQB 1RZ8A 2GJZA 4C56D 5T1DL 4GFXA 3DOHA 4A7GA 3OAZK 4P23A 3NN8A 1KGCE 3ELQA 4HUCA 4ZX4A 2KC0A 4J2QA 4MJ5A 3R8QA 4PSPA 1TF4A 2I5YH 5HYJE 1KIQB 3FAXA 3R4DA 4HPYH 5D2LE 1TYRA 3LH2H 4L5FL 3L9RA 3ARBD 3SGKC 4K5MA 4HOXA 2IANB 3C8KA 1TZGH 4G7SB 4KVNL 1G7HA 4LLUB 3QWNA 5FKPB 2QPFA 1MFDL 3RB5A 3AXLA 1DDHB 2C34A 2VDQL 1GW0A 4MQXC 5B22A 4F92B 1J5OH 5F1IA 2P49B 5KBLA 2J73A 4OZIF 3GT6A 3AZUA 1FZJA 1IB5A 2YAMA 1GZQA 3P4NA 3CFBA 2BIOA 2B9AA 3E38A 1G9MH 4WSJA 2XZAL 1QI4A 4DHLA 3S8GB 1Z9OA 1KFAH 1DQML 3BKYH 2F5AH 3DJTA 4KZ0A 2CO6B 3QZPA 3VXOB 5FA4A 2E7BA 4XCYB 4JG9A 1M1SA 5LBSL 1ZHLB 5C0DA 5E6ZA 1OARL 2NYYD 4NO2A 4DEPC 4EN3C 3VI4B 4KTYA 5ESAB 3MXWL 4OLXL 2AEQH 4JRWA 2GTQA 2OR8A 2JKIS 4UQ3A 3BJ91 2UXTA 4QT5A 5LUMA 2F6AA 4FQIH 1P7QB 4LSQL 3P3RA 2DN7A 3DUHA 4MLSA 3SKNB 3ZIYA 1M57B 1SEBA 3DX9A 3EKCA 3F62A 2W0FA 4M93B 4NM8H 5D2LB 3BD3A 5FM8A 5DVPA 4PS3A 5J11B 3IJHA 4YNYB 3M8OH 4OZIA 3U7WH 5E51A 2FJUB 1MAML 3MNWB 3X3GH 2CK0H 4R96B 3UTOA 1GTNA 3WLWD 4MXWL 1ZT4B 4X98A 3TGXA 4AG4L 4FQQA 3ZKNC 1NFIB 1S9KC 4FKEA 4PW3A 3EO9H 1GIGL 5D1ZB 3LXCA 4HUWA 2NW3A 4R7XA 2EIJB 4JO4H 1A0QH 3AXIA 3P73A 2C3VB 4DIXA 3IFLL 4PHZA 5I75B 4GEJA 3IJYB 3ECWA 3LKSA 1QTPA 3WTTA 5FUZL 4W4OC 1UWGL 4IJTA 4ONHA 3L4YA 3K80A 5GGRA 1JPTH 1YNKH 2CHZA 3EJJX 3VXMA 3EZ8A 3MJ9H 4LMQE 4M5TA 3OKLA 3OG6B 4K9EC 2OJEB 2Z65C 3ZU8A 5T5FA 2ZYIA 2ZNXA 3O6KL 4YSUA 5KSAC 1MI5B 2EIKB 3GSRA 1WLHA 4OFKA 3NZ8B 3QIUA 2VDRH 3NOIA 4E9WA 1OALA 4LGSB 2XY1A 3Q8CA 4PJGE 4YSCA 2IO5A 4NAMA 4H1LA 1BM3L 4I77L 3JWDC 4HMEA 4Z8FH 1MZYA 2ZCHL 3QUXB 2Q8BL 4QXVA 1C12B 3BP7B 1DFXA 1FHNA 1Q1JH 3OSVA 4W6XB 2ISDA 1URLA 5B38G 3VD4A 2GTZA 4F93B 1FL6A 3DYPA 4JRXD 1JVLA 3BE1H 1UQSA 3NK3A 3PGFH 4ZAKB 1MFAL 5DUBA 5J12B 5IVNA 2CAKA 1NPNA 4WNQA 5ENWA 5DHYA 1SLWA 4OCWL 3K6SB 4BZ2L 2JB6B 3QP3A 1SRDA 3D4ZA 1XGRB 3KGRA 4XMKH 4XPGH 4HIHA 1JCVA 3GTNA 1OSPL 1SJXA 5IJKA 3HE7C 5CIPA 4Y2DD 3GJFK 2O5YH 4EXKA 5KS9E 1Y07A 5DJYA 1OCWH 3TEXA 2V2XA 1VACA 3DMMB 3VFUA 5I76A 1MCEA 1ZHBB 4M43L 1R3KA 2E6QA 3AS0A 2EEAA 4XXCA 4XZUA 5D7LE 3T0ED 1I1FB 2VERA 3ZIMA 1C5BL 3GSUA 3M6DA 1ZVYA 3MV7E 2X3CA 5L0QB 3DGDA 1XIWA 1T3FB 3FN0H 4NP4H 3MRPA 1UKSA 4QTHB 1A3LH 5AVZB 4NKMB 4J3BA 5E8NA 1E4XH 4S10A 3WJLC 2I32A 2ICEA 4PJGB 1G4MA 4APQD 1JWUA 2F53E 3DURA 1AIZA 4FXGB 4B3EA 1GGBH 2ICWB 2YAHA 5ADPH 2VDNB 4OQTH 2WLIB 4K9EH 4OZFG 5D70H 2Z1KA 3S5LG 3NCBB 4NFCA 4KO7A 1Q9KB 1YEGH 4P2QE 3BKMH 2CHDA 1PF3A 4NKDA 4TPRH 2O30A 2HLFC 2H26A 2XZCL 3QQNA 1Z3GL 1EGJH 3IVKB 1EO5A 1HWWA 2Z8SA 2DWXA 4F91B 4JJHA 3ZTDC 3JWDH 2Y2WA 1AO7E 4OGYH 3RNQB 3GMMA 2IMNA 3BKCL 4GQ9H 1IO4C 1UM4H 3C5ZD 3NESA 3P11L 4PJDF 3NACL 1DQTA 3MFFB 4R8WL 4BH7A 4GSXA 1KNOB 2VT0A 5DI8B 3G08B 5EOTB 5KS9B 5DRNA 2EDDA 1B0RA 3AREC 3U25A 1U8HB 3H6AA 2YKLL 2MHAB 4LBEA 5D7LB 1JZ2A 1ZDQA 5GS0L 5I1IL 1XR9B 3RUGA 3MV7B 1ZIBA 4UNTA 1Z5LB 4AZUA 2HG5A 4KTEL 5I0WA 1AQDA 4Z7UE 2Q8AL 3K74B 3J2PA 4QIRA 3NA9H 3ZYIA 3X2QB 4E41D 3PUUA 1IILE 1QBML 3CIQA 3KYKH 4MVBD 1UJ3B 4GIAA 4A63A 1MWAL 4PU2A 5EU4B 2FIRT 4NSKA 2FATH 2G3NA 2ADYA 1UXMA 3S3BB 3QIWC 2NR6A 1MHCA 5EIVA 4YHMH 4EN2A 1P7BA 4GUCA 2DQHH 1A7NH 4L8CA 4HUNB 3NSJA 2OMNA 2YPVA 3ULUE 1K8IB 2FHCA 1AO7B 2J4WH 1P4UA 1ZY9A 2ADIB 2D4FA 3EDJA 5AKRA 1T21A 3MLRH 2CDFA 1SNRA 4PUBH 1TETH 2HLEB 1CPUA 3OAZH 5I1CH 5JW4M 4LRIC 3BAJA 4RX4D 3VSQA 3FPXA 1PX4A 2Y7SA 1TKWB 3UAEA 3HNVH 2WD0A 2XWBA 3W56A 4FQXD 4JFZH 1TZ8A 2FAUA 3REVA 3T4AB 3UEQA 3WNNA 1DVQA 4HS8L 1A1NA 4PR5A 5I8KH 1KXTA 4HXAH 1GHFL 4ZUVB 3N91A 5E5UB 3VWKB 4Z7UB 2EECA 2QL1A 3ZE0E 1O7SA 3SDCB 2A9BA 4NPYA 2O5ZH 1MWOA 4G59C 4JRYA 1AR1D 4XMLL 1QA9B 4Z77A 4NUJB 5TDNA 1KLUB 5CAYB 2VMCA 3DETC 3HW7A 4FFYA 4N0CC 5FHBL 5GGSA 2E46A 2Z31D 1OM3H 4YQXL 2G4EA 3JTSA 4TNEA 4R0LC 1P9MA 3TPKA 1UACH 3FCUB 4S0TD 2XTJB 5T1KA 3VE0B 3LH8A 3PNWA 3C5SB 5SV4A 1NLBL 2PO6A 1LP9E 3Q2WA 4WSGA 1MW3A 1MZZA 4KZEL 2ATPA 4K5NA 1WC7B 1XF2A 5F0MB 4LL9A 3BISA 4U1JB 4OV5B 1JI1A 1IBZA 4TUKL 3VWJD 4NHCH 5H94B 5F7AA 1S5IH 4AYMC 3ZZQA 3MRDA 4G5ZH 3SDXE 4F1ZA 2A1WH 4ZQKA 5EB9A 2BSTA 1N0XL 1G6RB 1BGXH 5A1AA 2R29L 1EWHA 2HRPL 2I85A 3AM8C 3FFDA 1MHHB 2Y23A 4PJ5D 1T03H 5HTSA 4HQQL 3KJ4B 5JPMC 4N9OB 2E7DA 2AEIT 2JKSA 3VRIB 2DQGL 3CSGA 4PMFA 1KIUB 4JQIA 2FEEL 4OM1L 1R5WB 4C57C 1F6FB 1JGUH 3TH3T 2QQQA 4KAQH 3QYNA 2VXVH 4X8CA 4WY7H 2J6EA 4ES8A 1ND0A 1DCLA 4XPBH 3ETBF 5KOMC 4XBGA 3NRPA 1OP4A 4N90E 1AZUA 1J5DA 5F9WC 3WEBA 4AWJC 4APXA 5HVGB 5C0ND 4NXKA 1TVDA 2OR7A 1LE9A 1GGIH 4GBXA 4G42A 2WP3O 1EZSA 1WIPA 3DIDA 2EICA 4UWQB 1UZGA 5DMKB 4ZTPL 4MBOA 4C4KO 4KZDL 1TZHB 2H2SC 3S36H 1OAUL 4N5ED 1I7TA 1NBYA 5DS1A 2BOBA 4DN3L 35C8L 1F00I 5IEKA 5EUOF 3HZVB 4XNZB 4P2OD 3O8XC 3NH7L 4GJTB 4GXUN 5I0ZA 3COOA 5MHSD 4ES9A 3L4UA 5GRVL 3CBRA 5HGBA 1BXAA 4FFWD 4IU3B 4ANXA 2OMUA 4E5XA 4WDIA 4JG1L 1AZRA 1ESOA 1R3HA 2DS4A 1PJWA 5GGTH 5TE7H 2IQAB 1IEAB 1HKLH 3BAXA 5F8QC 1W8NA 4ATWA 4CJ1A 3R1GL 4HIJA 4CVZA 5KVFL 1Q8MA 3W9DB 4P23D 1UVQA 4M62L 4LIQE 4F7CB 2GUYA 2MWCA 1WA0X 3WY3A 4RAUB 4DGYH 1NC4A 2WQSA 1HCFX 2ZKHL 3E6HB 2CRYA 5JA8B 4UQIM 4LVHB 3MV8A 3MROB 4HPOL 1VKXB 3F6JA 2AFNA 4JAMA 4PG2C 5D1QE 4LCCB 1NDGA 5JR1H 1EEQA 3X11B 5A16B 5DC9B 4NBXB 3U0PA 5TE4H 2NTSP 2I7SA 5K9JH 1SDAB 3OAYK 5IB3A 5F89A 3RE0A 1AR2A 5LXVA 2HKFL 4ZPTB 4BSJA 2JKXA 1JD9A 4U7KA 1MLCB 2BS71 2CO3A 5DRWB 5AD0B 5E8OA 1CFVH 4MXQD 4RWYH 1V05A 3SBQA 3MRHB 3GJFH 4H26B 3NIGF 4RESB 4G82A 4BHUI 5I1KH 4ZXBA 5JYMA 3OJMB 3BRDA 3IPBA 4O51A 5I1AB 1DFBL 3FCSB 3BUIA 3E1F1 5C0EA 1O7DC 1HL8A 5DRZB 1ITCA 5AB9A 1AGEB 3HNTL 2VDLB 2VRQA 1CLVA 2WPGA 5K9OB 5J11C 1QSFA 3QK0A 4WFGD 1YJDL 2CCLA 5A6MA 2MNJB 4X4XA 4JB9H 3KWTA 4L1HA 3GBLA 4K3DH 3T77A 1U30A 1KEML 2I07A 1ROWA 2ED7A 5F6IC 4P2YA 1HI6A 5DRXB 3TJHC 1HXYB 4PJAF 5ERWA 5BRQA 4B96A 5D1QB 2OCCB 2ZX9A 2VJ0A 1TU2A 4OGAC 4NKIL 5HDRA 3ARWA 1P5UC 5GGUA 3AG3B 4LOVA 1J9CT 3TPUB 4DUWA 4HUXB 3LIZH 1TFPA 2FBJL 4KKCD 4WI2A 4BQBA 1I3GH 3MQIA 2KUTA 5E70A 2R27A 3OJDA 3RWDB 4PFEA 2NY4B 4WENB 5LJYH 2AGJH 4HT1L 5EN2B 4ZNCD 1ADQL 5E4EB 3HS0B 1AXSA 1V3KA 2H3NA 2VXUL 1X7TA 3KPSA 4OLEA 2OMZA 1TZOA 1E6JH 3QHFH 2ZCZA 3WMPA 1PL3A 3MA7A 3SQOL 1NAKL 2Q3AA 4HAFA 4ZMOA 4DGVL 3K2IA 2BP0A 1RZ7L 3IKKA 3O2VL 2F54E 3AG4B 3VXMD 5CCHE 2WBJB 3VVWA 4UQBA 3CVBA 2VRKA 3QQ3B 4P9HH 2X4PA 1KG0A 3B2MA 1UADC 1NGYA 2X6AA 3D0VA 4Z7NE 1M7DB 2JELH 2EDBA 1ED3B 3VX1A 3UZVA 1NCDH 3QIUD 2K7PA 1UWXK 4IBQA 5HHQA 1JGDA 3KGSA 2VLJA 1VFAB 1T0MB 3AWFA 4NO5A 3RWHA 2WNGA 5F3HA 3WFDL 1TVBA 4YFLI 3EOAA 5BV7C 1CL7L 2Y69B 3WU1A 1AZNA 1L5GB 4AI7A 2OA9A 3D18B 3QJFB 4IS6A 3G5YB 4TQIA 5F7KC 4KNQA 3BYYA 4H88H 3MBEB 1OB0A 4FX5A 4WWID 4NQVA 4BWWA 4C47A 4KRPB 4QCIA 1JF1A 3ZE0F 3W11C 4YSSA 1DQDH 3HB3B 4AKPA 1F8TH 4XWGL 2WINB 4GP5B 5KYXB 2HT4D 1F4YL 5KWYC 1BX2B 3BWAA 1IBHA 4FA8A 1JIBA 5DGRA 1ES0A 3LDBB 2OSXA 3MYJA 1B0GA 2XPYA 1X6NA 1KJVA 2G2NA 4UZUA 4D3CH 4G6KL 5K39A 3ATFA 4I0CC 1R24B 4Z7WA 3FF7A 4IHOA 1A7BA 2CUMA 1LP9F 1K2DB 4ZMAT 4G7RB 2HSIA 5I18H 5B1JC 5C6TL 1KEGL 5F7HA 4LAQH 1RJLB 1I3RB 3HVNA 1J05B 3KYOB 1XIWD 4J39A 2WIIB 1KBGH 1HH9B 4XXDB 3P3UA 2QHLA 4KQ3H 3SDXF 3WUWG 3DOSB 3IBOA 1ZHKA 3KEDA 5T1MB 4AV5A 3FRPG 1Q4NX 1C1EL 4UZSA 4XMPL 3DO3A 3EJZD 4MB4A 2BWQA 4TSCL 4NEHB 3HEIB 1PCXA 1IGYA 2ITCB 2NZ9D 4LU5L 4HPHA 5BJTB 5IJBC 2ENJA 5HPMB 4HK3N 2I9LB 2MEJB 3JT2A 5DD3H 4X6DE 1JNLL 3PYCA 4QXGH 4ELMF 2EUZA 1IQDA 2MFNA 2XQYG 2XN0A 2XOTA 4PEEA 4N0RA 4PGZA 2Z4QA 1G94A 3PHQA 1HCZA 2YOCA 3V6OA 4H0HB 3IJSB 2H41A 1DN2A 1FN4B 3FULA 4MWFA 3UBXB 2BZDA 1X5AA 5BV7H 4TMPA 5F9JA 1HE7A 5LWYL 43C9B 3FCTB 1QP1A 2DWSA 4NRXA 1S3RA 2BHZA 3GMNA 3PREA 4UQDA 2H1LM 3PXLA 5E00A 3WFEL 4HEPG 1HHIB 4XP5H 2R69H 3OPZL 1FFOA 2R2EB 2ZXWB 3C08H 2FSEA 3S3DB 4K94L 3V0JA 2ZUVA 4JO8A 3INUH 5E8EB 4QLRA 1AD0A 5EDSA 2V8LA 5DMJB 3KCWA 4L9LC 4Y1SA 2QSTA 4ZFFB 1K85A 5J4MA 2ZX5A 4CSSA 3GBNH 3H6JA 1G5AA 2WZ6A 5DJDB 2UY6A 2DV6A 1E9OB 4G5AA 4BQ8A 3JZ7A 1XF3B 3RZCA 5D72L 1JXGA 3QDGE 3MKGA 4NQEE 3OC8A 1FG2B 4XO9A 3TYGL 1HU8A 1RCYA 4YAQA 1H8OA 4HIEA 3EBGA 1CURA 2CH8A 2DQUH 4L37B 5I1GL 4TLTA 2JXMA 4YGAB 5JUEL 1YQ2A 4EIBA 3P9MB 2DWDA 3EGSA 1CXIA 3GM0A 3KPRA 4X6DB 2A74B 2EKJA 4EDXB 4UT6L 4AQ1A 4BZYA 5A40E 1SVZA 4WW2A 2NR6D 2OXGA 1XCXA 4H8WL 3V4VL 3VFSA 5INDA 3HZMA 1A5FH 3HN3A 1PZUB 1TQCB 4H25B 4R90L 4B0MM 2YA0A 3BUPA 2AITA 3SYQA 4CMHB 1JZ4A 3GIZH 5CGYD 3T4AC 3SE8L 2Q2LA 2QFRA 2BNRE 3N5AA 3O11B 1M56B 4XR8C 4OU3A 1MJ7L 2APSA 3TNMA 2XKSA 1TR7A 4PJEE 3H42L 4DP4X 5JHDE 2DH2A 1SN0A 1DQQB 2YUZA 1RIHH 3MCLL 1EFXB 3SOTA 3GQFA 1QVOA 1BD2A 1WTGT 2D0GA 1G1KA 2DQ6A 2J8OA 1P6AB 1TLMA 3C60A 3GSNB 3A5VA 2J8UE 3SBPA 3G6JA 5MERA 2VLMD 4K73A 4OLZL 4Y16C 3QDGB 4NQEB 5D5MF 1XD1A 3OAYH 1G7JB 4Z7AA 2OS7A 1BVNT 1E90A 1KJMA 1WBYB 3KLKA 2YO3A 1A4KB 1V8HA 4JRYD 2Y2YA 4JKPH 2Y22A 4NENB 1AGCA 3W39B 3X1EA 1HZLA 3EJQA 5CJOL 1JUFA 3FQNA 3HC0A 3QA3B 1TJMA 3SGJC 5BXFA 4RDQF 5CFHA 4NZDA 2IV9A 5T1KD 3A4EA 2ZE0A 3MRKA 5L6YL 4ICWA 1P1ZA 2PO6D 5E99L 2H3KA 2Y1AA 3DHPA 3IRZA 1AYRA 2YBRA 2FEDD 2HWZH 4PP1C 4YBHA 4AVKA 4EXPX 3OWRA 5CZXD 2BNRB 2EIBA 3QGVA 2WZPA 5FM5O 5TQ2H 2Y7NA 4OM0H 3AWGA 4PJEB 3F04A 3MBXL 1DQVA 2OSLB 4Q4EA 3A6CH 5JHDB 4LK4A 3QI9B 1PY4A 5L4FA 4GG6F 4JPSA 4AH2A 3UROR 1FLRH 1N68A 4JM0A 2EDMA 1WFTA 4N2DA 1SXCA 3SYOA 4IBLT 2J8UB 3FQTA 1JRHI 4WEBL 3ESOA 4ZOEA 5FDWA 1OAQL 4GG8B 5EZIH 1PEZA 5HI4D 3SE4C 3PDDA 1A4AA 4RGMB 1DSYA 3AY4A 5IESH 1VAHA 5AAWC 3D3VB 1PZBA 1G0DA 1RZPA 3L95A 3ZT7A 3IWUA 1D5ZB 2YARA 4E9SA 2ZG2A 4R7VA 4GBXD 5JHLH 4HU8A 1OCCB 4ONGL 4JMNA 4L29B 3VXPB 4AVIA 5IQOA 4YDZA 1IC5L 4WO4A 1U8QB 3GFUA 4R6UA 4BZ1H 4Z7NF 3L6FA 4Y4HB 3QUMB 1M42A 4H4NA 5DUPH 5L8LB 1GTFA 1NWOA 1MREH 4QHNB 3L13A 3NJGA 5T5FL 5CGBA 2RA1A 1OP5H 4G8GA 2D0FA 4JM4L 1V3LA 3DO7A 4GQQA 1QRNE 4Y5XA 4MQ7B 2QKIC 2X6UA 3HCVA 5HYFA 1XGUB 3EYOB 3DVGA 2WVVA 3P3SA 4P06A 2AEPL 4Y1AA 5IB2B 2AJSH 4GO9A 1MFCH 1UWXH 3P69A 4UINL 5HHXL 2X2IA 5EC1A 5AW0B 4PJIF 3QISA 3B9KA 1NC4D 2X87A 2FQFA 4FLSA 1TQVA 4PW4A 1A6VH 1RP8A 2BVYA 2VIRB 1NAMA 4LCVA 3VFRA 3MV8D 1MEXL 4IBTA 1DP0A 4HDIB 4MMXA 4H8QA 5D7SL 2KZBA 3E3QE 1JWSA 3QRFM 3ZZLA 4QNPE 3GBML 3T2OA 3TIEB 2XJKA 2XSKA 5ILTL 5FCSH 3PL6B 3CIAA 2QHRH 3MRIA 2PCPA 5J57B 4B9IA 2V5YA 5H8DA 1FIEA 2GT9A 6CGTA 3IDMA 2Z8VC 4IOFD 3RAJH 1OZTG 2XRAL 3SZ6A 1NMAL 5E6SB 5IW3A 3DRTA 3T8MA 2DJSA 1KXVC 5DWUH 5C9JA 2G2RB 4XVUC 3VI3E 4RZCA 1ZT7B 3M1OA 4ZXBD 1UT1A 3FK3A 2GJJA 2C9AA 5EZPA 4HG4J 2V5MA 2OFQA 3M1BA 2X4NA 3MI6A 3S0PA 3EHBC 5HGHB 2XA3A 5E7BA 1CICC 1KCRH 2ESVA 3PV6B 2ZUYA 5EIIB 3WTSA 4EI6B 1SMAA 2IV8A 1S9WA 4P5MB 2AK4A 4N1HB 4PJIA 3EAKA 5IVXF 1QSFD 2G3XA 4OKDA 1T89C 4Y4FB 3P02A 4G6AD 2PWGA 2P52A 1G9NL 1W72A 2DW5A 4WI8A 3HPJB 3GKZA 4GW1B 4J3OG 1IC1A 1OK0A 1VFBA 1JXFA 2XWJB 2KZ1B 2X4OA 4JM2F 1SBSL 1EO8H 4KV5F 2BP3A 1MFMA 2WNXA 3BPCB 1TO5A 1F58H 3JQOB 4KUZL 3QE5A 3ZTNL 1T6BX 3MUHL 5AOKA 3B1TA 3C75A 4JG5A 4ZD3H 3HS0C 3V0DA 5SWSE 1MHEB 4ODWA 1AMYA 2ZQKA 1X6LA 1XGQA 2Z3FA 3IN2A 3CN4A 4IRJB 1BIIB 3LNGA 4XVTH 1BZQK 3A4FA 1U2HA 4WGWB 1ZTXH 4G8IA 4LVOC 1IZJA 2FB4L 2P42B 2NY7H 1VGKB 4OT1H 2P1YA 4X7EC 3U1QA 4BIKA 4GAJH 1N6QL 4X9IA 2B0SH 1FAIL 1YNTB 1EUUA 3KPSD 1ACYL 3DVIA 2D31A 2CR3A 3BXNA 3KR3L 3JWOL 3WTXA 3ULSB 3LN4A 2J57A 4M6AA 1TFHA 5JHMA 2ZICA 3CZFB 4JJ5A 4QXWA 2YFOA 1I1AB 3NCCB 3V4PB 5TQ0H 1AH1A 1FVCA 2FL5B 1P4LB 3CUPB 1PQZB 5AENA 4BJLA 1A22B 4Y7OC 1KJ3H 5L9DL 4AM0A 3TVMB 4QRUA 1A9BA 4JM2A 5DD6B 3U6XS 4AY0A 4LDLB 1TJIL 1T1XA 2ZCLH 4HF5L 2YK1H 4XWOD 5EWIH 4JFEE 3MBEC 3ET9F 5B4MD 3SODB 4DKEL 4KXZI 2OKMA 1OO2A 2QDVA 4U6YB 3UO1H 3UYPA 3EGXA 2ZX8A 3HB3C 3WIFA 1QSZA 1KCWA 2AK1L 2OR9H 5F97E 3W0WD 2ZWZA 3QH3B 3M46A 3MLUH 5H35B 5SWSB 3QIBB 4LVNC 4PJHA 1B4JH 3JWNG 1BECA 3DWTA 4RIRA 5MP6L 4KOCA 4XN1A 3PWUA 2JIXB 5DJCB 3TCTA 4P2CG 1V7ML 2X2UA 1JZEA 5IW1A 5E2UH 4JO5A 1UASA 5HJ3A 2AERT 3T9WA 4PV9A 3UPCA 1HNGA 5ACZA 5CD3A 4HJSA 3S48A 4TNGA 2PPDA 1FYTE 2QSCL 4N8CL 2OYKA 4Z7VA 4LRNL 2B9BA 4LSRL 3SBRA 1GKOA 1OCZB 2HG0A 3NIDF 4N9GA 3KGTA 4JFHD 4ZW3A 2XUWA 4L3AA 1AKPA 2VXTH 3VTAA 4HH8A 4KZCA 1A3RL 1PZSA 4MDIB 4RFOL 4JHVA 4V1DB 4FHKA 3QS3A 2WKOF 3VFTA 4PTTA 1GJUA 5E08H 2X0VA 3PAZA 1AGBB 2CPUA 2F68X 4I18B 3V52L 4QMEA 3I74A 4WF7A 3ECQA 4ANWA 4YLBA 1DJZA 3PHOB 1KCSH 3B5HA 1QBLH 3SJVD 3WN6A 4JFDE 3LB6D 1Q9OA 2Z7WA 1CE6A 1SEQL 2XN9A 5LQBL 2VYRE 3B7UX 2JCCF 5IHWA 3QEUA 3TA3A 2KLTA 4R83A 3DX8B 4GAYA 1GSKA 7FABH 5FKAB 1E5BA 3BRGC 3WEMA 4DAGH 1THAA 4WFEE 3MN8A 1PPIA 4MHHG 4X4ME 5DFVC 3CK0H 1FYTB 2J6EL 3D1MC 1HIMH 4L4TA 3SPHA 2K9UA 1CD9B 4P4KB 1U95A 1MVUB 4W6YB 3BUDA 1MQ8A 2Q2EB 4QRQB 1CTMA 1HEHC 3B3IB 2XTLA 4PB0L 5DQJB 4JDEB 3RKDD 3SE9L 3ZKMD 1QR1A 3GI9L 1F3DJ 3HC4L 3LKOB 2OK0H 4QHUA 2HJLB 2NT1A 2ZXEB 2X0WA 5C0AB 1U8JA 1Y18A 2E7LC 1JSYA 3H0TB 4JFDB 1HEJC 1XF4B 1H5BB 1XR8A 2O5XL 3H3KA 4X8JA 4P48A 2NY3B 3B56A 1VZIA 4OLUH 1PBYA 3APCA 3KPRD 1CFMA 1HHJB 1T5XB 4R26H 1FFNB 5IG7A 5GZNC 1F6LL 3JV0A 4Y5YC 3OGOE 4UV7L 3SGKA 1UATA 4N24A 4JPVH 2Y7QB 1JFQL 1T4WA 5MI0B 2PWHA 5I8CB 2FO1A 2W9EH 4PGEB 2O61A 4IYKA 4U3SB 2WXNA 3QAQA 5DR5L