3T5WA

2me modified human sod1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
152
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural switching of Cu,Zn-superoxide dismutases at loop VI: insights from the crystal structure of 2-mercaptoethanol-modified enzyme
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 152
sequence length 153
chains with identical sequence B, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3t5wA00
2ZKYA 2Q2LA 2AQNA 1BZOA 1IBHA 2GBUA 2AQRA 4BD4A 2C9VA 5KBMA 3KM1A 2Z7WA 1TO5A 1BA9A 1OALA 2WZ5A 3QQDB 3KM2A 3QQDA 1L3NA 2V0AA 4FF9A 5CU9A 3T5WA 1SOSA 2WWOA 1E9PA 3H2PA 1SDYA 1SRDA 2WKOA 1E9QB 1OAJA 1E9QA 1SXAA 1SXNA 2JLPA 1EJ8A 2JCWA 1IBFA 2C9SA 2AQTA 2ZKWA 4BCYA 2GBVA 1XSOA 3ECUA 4MCMA 2WYTA 1COBA 2ZOWA 5KBLA 1SPDA 1TO4A 1ESOA 1B4TA 4L05A 3SODB 2APSA 1UXMA 2ZKXA 4A7SA 1PTZA 4N3UA 3LTVA 2E46A 1F18A 1DSWA 1XTLA 1S4IA 1E9PB 3MNDA 1F1AA 4A7VA 1P1VA 2LU5A 2WYZA 4A7GF 4B3EA 3ECWA 2AF2A 1F1GA 3ECVA 1IBDA 1JK9A 2VR6A 3HFFA 5KBKA 4A7GA 2WZ6A 3L9EA 1DO5A 3HW7A 4OH2A 1KMGA 3GTVA 3GZOA 4N3TA 4A7UA 1Q0EA 2Z7UA 1MFMA 3GZPA 4A7TA 2VR8A 1YAIA 4BCZA 1OEZW 3HOGA 1SXCA 1PZSA 3RE0A 2C9UA 1U3NA 1YAZA 1FUNA 2R27A 1EQWA 1IBBA 1SXBA 1SDAB 2GBTA 2Z7YA 1QUPA 2SODB 1AZVA 1JK9B 4OJAA 3H2QA 2VR7A 3GZQA 3MKGA 4MCNA 4A7QA 2WKOF 2AQPA 1B4LA 1HL4A 2WWNA 3S0PA 3K91A 2E47A 1OZUA 3KBEA 1JCVA 1E9OB 1E9OA 1N18A 1RK7A 1IB5A 2AQQA 3CE1A 1XTMA 1SXZA 3KBFA 2XJKA 1F1DA 3PU7A 2AEOA 2XJLA 1YSOA 1CBJA 1UXLA 3CQQA 1HL5A 1PU0A 1CB4A 1Z9NA 3KH3A 3GQFA 1OZTG 3GTTA 3F7KA 2AQSA 3F7LA 1Z9PA 3KH4A 4U4IA 1SXSA 1N19A 3CQPA 2WZ0A 2NNXA 2Z7ZA 3L9YA 2K4WA
chains in the Genus database with same CATH superfamily
2CO7A 5D7JC 4HCGA 3VVVA 2DQJL 5K9OA 1R0AL 1A25A 5CP3A 15C8H 1MQKL 2Z91B 4X6BA 4P23B 4PJDB 2IAND 2WTRA 3CZJA 3GM0A 1ZIBA 3KS0H 5GGRY 4P57B 1SDYA 4KPHL 2MH4A 4LLMA 5AFAA 1UWEL 5E2WL 3HRPA 3RTQB 1KCSL 1NBCA 3LQZB 4P2RA 2B2XH 2DJUA 2LAGB 2VXTL 4AMKL 2WVTA 2J44A 1PZ5B 4TQ8A 3JVFC 3QCVL 3H85A 4KGLA 4MXWL 3EJPA 3ARFB 5D70L 8FABA 2K7PA 5FK9A 1Y0LA 4PLOB 3IFNL 4HUCA 4QNPE 4BV1A 1IJNA 2D3LA 1J0IA 3UTTE 4KQ4H 3OD3A 3HC0A 1J8HD 4J1UA 2R1WA 3S3PA 4D8PB 5G4OA 1GGTA 1ZLUH 4GQ9L 2CDFB 3CC5A 1PAMA 1U8JA 5DJYA 2MWCA 1TU2A 4PJXA 4M5YH 2PXYD 5KJRH 2MTPA 1O7VA 5JW4N 5AW6B 1E65A 3AFLA 5A2AA 3DSFH 2VLKB 2VC2L 3HC3H 2X1OA 3DJSA 3O2DL 4AXWA 4NDMA 3RU8H 1ACYL 1NBZB 1YYCA 3JWDC 3LXUX 3HHMA 5EOTB 1WISA 4ADGA 2VDMB 4CDGC 2K70A 1QFUL 3DGGB 2N0MA 1SBSH 3E6FB 3QE5A 1T5WA 2HFGH 3SBPA 1MG2C 4G6KL 5FO9B 4IIQA 5CSGA 5D2LF 5AOMA 3H42L 4WI4A 4XO3A 2FB4L 1TJXA 1UXSB 2Y23A 3D0LA 5JOPD 1YMHA 3GMNA 2VT0A 4OLWL 2Y6SD 1LM8V 4LLDB 2PXYC 2XWDA 4NO0A 2ZNWA 4MNGA 3UGXA 5CCGE 2HUHA 3PWJB 1OCWL 3KBEA 5DJ0A 3VVWA 1A8ZA 1PSKH 1ETJA 3EF7A 2OI9C 2H3NA 5KANG 3FL7A 5FCUH 1B2WL 1MRCH 2QGEA 1KV3A 3PGFH 4YFLF 3EFOB 1KUMA 3SQOL 4UQCA 3ATFA 4PJEE 1T6VN 1MRDL 3VD9A 1Z9PA 4N25A 3IJEB 3D50A 4YSEA 3RDJA 4DVBA 1UJ3C 1NCAL 2PTTA 2NNXA 2WQRA 4EN3B 1FG2A 2WLKA 2UWEE 3V7AG 1U41A 3BQUC 3W38A 1QNIA 3QQ4A 4GRMB 4RLDA 4LF3A 1M9WA 3LZOA 3VMOA 1FHGA 3FONA 2Y6SC 1TO5A 4H8WC 4H5SB 3DXAE 4YDIL 1V05A 4MMXB 4HFWA 1KGIA 1L3NA 1A14L 3I6KB 4YL9A 3T5WA 1NCGA 3K8MA 4RSVA 1NAML 3CX5K 3R18A 1GH7A 3QJHB 3ZHKA 2BNUB 4Y89A 4QTHB 4AVHA 3UTTA 1DANT 3O0RL 4NJAH 4XVJL 5L4IA 2DD8H 1DJSA 4AYFB 3CZKA 1K4DA 3QB7C 4Z7QE 4D9RE 4IKLA 4TPRL 3EJZD 4IKIA 2AJXH 1OE2A 4K23L 2W07B 5HJ3A 2NY5L 3C5SA 2UY7B 4PJ7E 2I9TA 4JN2A 1ET5A 4ZNCD 1BAGA 3CDZB 1TJMA 1S8DA 5DZLA 4CILA 4WWOA 5F6IC 3DV4B 1OGTB 5HHXH 1E4HA 2A9NL 3OVUB 1JNLL 4K71B 4AWJC 1GJWA 4JKKA 4B41A 1XF5B 5IK3A 2VDKL 3LKNA 5D1QE 3H55A 4KTEH 4FE9A 4M5TA 4Z3TA 1BEYH 4NZJA 1G6VK 1HSBB 3F7YB 3GO1H 1UASA 4O4YL 5G5DB 2KLRA 5TK4A 4A39A 5CZKA 3FO9A 5DFAA 5JIDA 1OD9A 1BG9A 3D6GA 3MFFA 4A7GA 2A6JB 3SGEI 2BIOA 3S34H 3TO2A 1AFVL 2ICEA 2X3AA 4N2IA 1YEDB 3SDXF 4Z8FL 3EJZC 4NC2B 1KYOK 2JCCA 3ILEA 2A6DB 2CLVB 4JJOA 3MJ7B 3B5TA 1FFOA 3CDCA 4TUOB 2AV7B 5GPRA 4L37A 2JKSA 3SKMA 2CLRB 2GJRA 3HOGA 4IJ3B 4LT7A 4DP7X 1FZKB 2F74A 1D9KD 2LOEA 3KPSE 5MP6H 1SVCP 2IOMA 3PJSA 3GXIA 4FQJH 5HYIA 2GJPA 3ISRA 1BJ1H 4JRYD 2X1XR 3N40F 3PWPB 3SGDH 3CLEL 5J7CC 2KQNA 1KEML 1V7ML 4O02L 1QEWB 2WQSA 5DC2A 4OY9A 3PNRB 2YC1A 2XQBH 1HAWA 4X9YA 2UWEA 4HH8A 2F54A 1DBMH 4BZ1H 1TOXA 3MRRA 3QUGA 2FQFA 3MODL 4NI6A 4ISVA 4HLZH 3I74A 3WD5H 4LCUB 4CN4A 5KVDH 3W0WB 4ATWA 2OMYB 3IN0A 3DXAA 2ORBH 3S7GA 2E9JA 4KKAD 4UNIA 1UUSA 3RWEA 4HUVB 4G9DB 2XA8L 1D9KC 4R7NB 5TE4L 1MY5A 4KK9D 5IQOA 1ZVHA 2AJUH 2E9BA 5TQ0L 3RLSA 3EUDA 5E8DH 2XFGB 4MSWB 1FYTD 5HI4D 4XVTL 3D09A 3V4VB 3GDCA 5IROD 5KYWB 1JUFA 4KU1A 1QG3A 4RISH 1TTFA 1KB5H 4ZX3A 4FQCL 4GW4B 1A4JB 3ZTNL 1FYHB 2OX5A 3BWUC 4PJ7A 1QYGH 2OTUB 4FFZL 5E5RB 4QHUA 1TJGL 2YPKA 4OD3L 4IRSB 1FZOA 3BAXA 3E3QC 4OKDA 2W9EL 2XQ0A 5JPMC 3ESVF 2X1WL 4XPBH 5DZOA 5J6SA 1AR1D 2C5DC 4KROB 1C5BL 2J88L 2XBZA 2VXSL 1SDDB 4I3SL 3MRMB 4PJDE 5D7IB 5D1QA 4XH2B 1MJ7L 4KKAC 5FEBA 5K9QG 2CKBH 3HG3A 3TH4T 4WUUE 3QJSB 3RHWK 3O6KL 3LIUA 4HCFA 2K7QA 4YX2H 3UJIL 3S4SB 4KK9C 4PI2A 1JZHA 4KHXL 2X89D 1WQVT 4S2SB 1YMMD 2L7QA 4YEFA 4CGTA 2F0CA 3GJEB 1WFTA 2DQTH 4DGIH 1UQSA 5LGJB 5HI4C 4ZX4A 4GUPA 1S9YA 1BF8A 3MR9A 1NLBL 2DWDB 3RYMA 4PS4H 3GHEL 4QYOB 3U25A 2W0FA 1IBDA 3UC0H 4CUCA 3EGXB 2VDRH 3DOIA 2EE2A 3MA7A 2EH7H 4NQSA 1K8DA 2ZOLB 4R97B 1AR1C 3GRWA 2ICES 1BD2D 1KTRL 4EUPH 3MLUL 3K8LA 1CQKA 4ZSOB 5GS0L 1E7VA 1H15B 4KXDA 4HA1A 1QATA 1SJEA 1X5IA 3L3JA 2VLKE 2X4SB 4MXVE 1TYEB 3N6YA 4LCCA 4P4RA 4M29A 2OYMA 1LO5B 4AJ0A 1Q0XL 3ATAA 4X5LA 2IQAB 2EXYD 1M53A 4HIQA 3KWUA 3AS0A 2DLGA 2JJUA 2W60A 4P4KD 4R4FH 1Q1JH 4YNYA 3VX0A 4PRHD 4EOWL 1ZANH 2QV4A 3BSGA 1QR4A 1QRKA 1DBJL 3O41B 2HT3D 3WHE0 3DX8B 3BZEB 4HKBA 3R4RA 4ORGB 1RZJC 3BVXA 2LW3A 3S2CA 3G5WA 1E27A 3QUYA 2A6IB 2JLLA 1XR9A 5ESAB 4C54A 1S9KC 2VZTA 4D9LH 3GXUB 2JQMA 5B7EA 1A9BA 1MF2H 1IV8A 3G6DL 2VLLB 5D7SH 3SE4A 1DQMH 4HX1B 3FU7B 3HE7A 4YLQT 3LHPL 3MRHB 4HPYL 2MQ3A 4EBQH 3BVDB 3MXWL 4H8UA 1OSPH 4E41B 2GVYA 3C6EA 5L2JA 4ONFH 5D2LB 4X7EC 4D94A 2FUQA 5K9KB 3MLXL 3RI5K 2EXYC 1G4MA 3FTVA 1LO4H 2V5MA 3MBWB 5D1ZB 1BXXA 4NQDE 2W65B 4P4KC 3S8GB 5E1GA 2PWFA 3D9AL 2MRYA 3T2QA 1J9TA 2HT3C 3T8MA 3UCRA 2VB5A 3VE0B 2BIIA 2XWBB 4HWEL 1U3HD 2V6HA 1E9QB 4K7FA 5MEQB 3BT2H 4FG4A 3RTQA 2MFNA 1Q72H 5DR5H 2P45B 4B60A 4HV8B 4AIEA 1FL5A 2KYIA 4Q56A 4Z7NF 2AJZB 1E5UI 5FO7B 3KLAB 3NAAL 2JMRA 1BMWA 1BFOA 2PPDA 4LCIL 4WGVB 4WI8A 1EEYB 3HC4H 4FZ8H 1BM7A 3VACA 1HJCA 5F89B 1NOAA 1F0LA 3EOAB 2AJYH 4PVMA 5EG6C 5CF3A 4I77H 4ZS6D 4TUJA 2R29L 2EYTB 3UFIA 3VW3H 3UL4A 4XXWA 4D8PA 3CHRA 4UM8A 2BSRB 1PNCA 4M43L 3O3DB 2EIKB 2NY6B 4BQ8A 1U3HC 1P84K 3EFFA 4KXCA 4RA0C 4W9GC 1ZS8B 3GF8A 2BY0A 4K5MA 4PBXA 1PG7H 2PW2A 2F5AH 3PREA 1NBZA 1LP9B 5CILH 3RIKA 3FQYA 4F58L 2OMNA 1L9PA 2YBGA 3TIDA 3ZDYB 1P69B 3EG9A 3A4AA 3DGGA 3NH7L 3ULUD 2BNQE 1MZYA 3QQ3B 4OCRH 3LS5H 4W4OC 3V4PH 1P4IL 5GZOA 5DA0B 5JQHC 3C09C 2EDNA 2XFXB 4AKQA 3LN4B 1FUNA 3OKEA 1UXSA 3MCKB 1M71B 3MLZH 3SKNB 4GP4B 3DPBB 1ZXKA 4M6OH 5MHSD 1RZFL 4NXSA 4QHKJ 3VD7A 2C7UB 2ENPA 4LLDA 5T1KB 1RD6A 5HYJB 4PRBB 2DKMA 2BP8B 3NOIA 3QHFH 1YEGL 1JNNH 3ZT6A 3RPIB 4DK5A 1G9NH 1UA6L 3C08H 5CEZL 3G5XA 4XP6L 3EFOA 1YRKA 3KWWA 3EYFB 4Q9BA 1QHPA 1W8OA 4I1PA 3AU1B 2DQDH 1X4YA 5IOPB 1RSYA 4N0RA 1CFMA 3SDXB 5IW6B 1CDBA 1G6RA 3MRKB 3ULUC 4HIHA 3S5LB 3IJEA 1GC1L 2GJJA 4LEXL 3KE0A 1ZLSH 1ZPLA 3PABB 3Q5OA 1IAOB 2J12B 3VFGL 5A43C 3PL6B 1PFCA 3P9LB 1JWSB 3GBNL 4GRMA 1S5IL 3P4NB 5HGDB 2VXQL 5AVTB 3R19A 5MEND 1NWPA 4KQ3H 4M3KB 4P2RD 3W0WE 2DM2A 1DUYB 1P7KB 3LV3A 1U58B 1HXKA 4LPXA 4MMXA 3TN0D 1UXWA 3K3QA 4IRZL 4D7BA 2V5SA 5B3JE 3P3UA 5JQIB 1WGVA 2VYRE 1G1KA 1U3JA 3BUIA 3KL3A 4FHJA 2BNUA 2XPYA 1LE5A 4QTHA 1G9NC 3KPOB 3INUL 2VO5A 1B6DA 3BUBA 1YUKB 4DFIA 4XNMA 1CI3M 4X9IA 1S7SA 5I17A 4JFXB 2W07A 4I87A 2UY7A 4OB5L 5KUKA 1NEZB 5A2BA 1D2OA 2WYHA 3X1NA 1T7XA 1ODAA 1FH2A 3CDZA 4EIBA 3BQUB 4PJHA 3BP4B 4G7VH 5C0CD 3P0YH 3DV4A 2D0HA 5LWYH 3ZL2A 2EIZA 2ZYIA 5IJDC 5KSUB 5FYKU 2G9HB 2H0JA 1Z3GH 2XA3A 1UD4A 5EDXA 7TAAA 5L2KA 3TN0C 1NBYB 5D1XB 4Y5XA 4WFGD 2PMZA 2YEZB 2CHNA 1HSBA 3F7YA 3K7UA 4XMVA 1OCZB 1WDAA 5DD5L 1P53A 4BFFA 2ARJB 3NJNA 2KDYA 4UINL 2J72A 1TVBB 2HX7A 2O61A 1IGJB 4BFRA 4KZEH 1YEDA 3T6ZA 2CLVA 3GEWB 2ENQA 3MJ7A 4I85A 3O3UN 4TUOA 2AV7A 3NZHH 5GGVL 5IHHA 4K9EH 4IK6A 4NO0D 3SDDD 4XPAH 4Y4FC 1AI1L 5BOZG 2FX9L 3EJUA 4F91B 3LXBA 1CK0H 2YXFA 3LRLA 1VEPA 2CO4A 2V9QA 3KWXA 1IGMH 4ZSOE 4FXGC 2EKJA 4NAMA 2H5UA 4TSAH 1LEGA 1MY7A 3PWPA 2I5YH 2J8HA 4QF1A 3ZHLA 4W93A 4UU9B 3G7TA 5DWUL 5CWSB 1QEWA 4RRPM 3WMQA 4PJCB 3D4ZA 2FO1A 1F4HA 3M17B 2DMKA 3X11A 4R4BA 4OW6A 1BJMA 3R0MA 1FCCA 1EHLH 1KGJA 3ULUF 3QRBA 1IARB 2X9YA 5JORB 4KAQL 3RUGF 1OARH 1UGNA 2OMYA 3MRCB 2B3RA 4FJ6A 3DARA 4HUVA 5D7LE 2OS7A 3SDDC 2NZIA 4KTYA 3QHZL 3DDFA 3N9GH 1EWHA 1JRHL 1MCPH 4R7NA 2DQMA 2WAQA 2BP5M 4KI5D 3EIFA 5F9OH 4XCEB 5C0ND 4MSWA 3V4VA 5D4HA 1ORQA 5T3XH 1BZQK 1OHZA 1AKJB 1FNFA 3D34A 3VXRB 3MUY1 4DT2A 4DO5A 3SOTA 4Z3IA 5EEWA 1MI5B 4FFYA 1A4JA 1E6JH 4GW4A 4KKRA 1SXAA 4BWUA 1RK0B 4PYGA 5D2LE 5DJAB 4HZLB 1JRHI 2GBAA 5C0RL 3RHWF 4L4TD 3QORB 2L7UA 3MREA 4WRLA 3SOBH 2YEQA 4XAWH 4I2XB 5D7IA 5FYKL 4PJ9A 2KHAA 3UTPE 1YDPA 1FVDA 3T8XB 3DPDA 4FLOA 1SHWA 1J88A 4E42B 4JVPA 4F7EB 5C0JA 3S4SA 3K6SA 3CZLA 3QISA 4AH2A 8CGTA 1EGJL 4AQEA 4KI5C 5EF2A 4G82A 3GJEA 4OV6F 4XNZB 5DK2B 5F7AA 5C0NC 2FJGB 3L4WA 5LGJA 1JZGA 5HHOD 2QQNH 5F7HA 4M6AA 1NCIA 4N2KA 4OGZA 1AQHA 3VG0H 2APFA 3EGXA 4HGMA 1MXDA 5B1AB 1AZRA 1I3UA 3G08B 3QXDA 1JMXA 1TSHA 5CD5D 1S6NA 2ZOLA 3SPVA 3T8VA 2VZVA 1SJHB 3GRGA 3QWRA 4B0MB 1A9EA 3DJRA 2WHVA 5GRVL 1H15A 1T66C 3QQNA 1P7BA 4JKMA 4Z7NB 2ZUTA 4DNLA 2AITA 1AJ7L 1UHVA 4I0PA 2X4SA 5CINL 4K3HA 4XAKE 1OANA 3LD8C 3EOBB 3RL1B 3BYYA 1YAZA 2ZONA 3BGAA 2IH3A 2MNUA 4DERA 1LP9E 4UAHA 2IQAA 4BZ2L 1P9MC 5IJVA 3ZDYE 5E00B 3QO1A 1XBRA 4LLQA 3FB6A 3L4CA 2A5UA 4R7XA 5F6HJ 3O41A 1ZWIA 1KB5B 4HS8H 3TBBA 5KAQG 3DX8A 2VO8A 4J3BA 4RAVB 2BC4B 3LEYL 5CD5C 1TQTA 5GJSL 2DLIA 1OCOB 2A6IA 5ESAA 1C5DB 1JFQL 3LAFA 3S4SG 3VXSD 1Z9NA 5J06A 5E6UB 5AAWC 1XHHA 4HX1A 3WY2A 3FU7A 1YNTF 1SLXA 1SFDA 3WFZA 1WFUA 4DP6X 9PCYA 1QX1A 3RI5F 1TTUA 5ICZB 4QY8B 4GG6F 4OR1A 1NPNA 2H1LM 3NFNA 2CKBB 4PWIA 5ECGA 5AZ2H 5KBNC 3TESA 1NANH 4HIIB 3DYPA 4GIPD 5CJOL 1C7TA 4JO2L 4E41A 1S9VA 4XMXA 1AG0A 3FSZA 4Z6AT 3BSZA 3VSVA 3SQBB 4PGDA 4BEIA 5D1ZA 2EZ0D 4LSPL 5F9WC 1E28A 3C9NA 1OAXH 1USQA 3SDXE 2V9UA 1N64L 5GGUB 1SY6A 1UB5B 2XWBA 2V2XB 3ROLA 1E9QA 5MEQA 4JFFA 2VDRB 3OB0H 5AEAA 1U0QA 4JFVA 2K4AA 4NHUA 4URKA 5GISH 2GPZA 2H4EA 5HVFB 1CDIA 1XSOA 4NQCD 3CMOH 3ECUA 2E74C 2IH1B 2WIIB 4MMYB 2AJZA 1KT2B 2QSCH 1AR2A 4EUPB 1IZJA 1MCKA 3E80A 1EEYA 1IQWL 5GIRB 2QJDA 3F12A 5F89A 3EOAA 4X6EB 2ZWYA 3KL0A 5EU3B 2R69H 1Q9KB 3IMRA 5GRWA 2GY7B 3X1BA 5J4MA 4K2UH 4B3VA 2EZ0C 3W1ZA 3VGAB 3MBEA 3LRSB 4AVIA 4XOAA 1JNHA 4A7VA 4JCMA 1HFUA 3PV7A 2Q1EA 4N1HB 4Y8DC 1CLOH 3ZKXC 3ECVA 3GT6A 5INDB 4JQIH 2GSGA 4PG2C 1CTNA 1X5JA 3B37A 3TYGL 5EPMB 3A4EA 5DRZB 5EC2B 4AQ1B 4JRFA 2BRQA 4HULB 4CSTA 2Z0BA 2JELL 5E1IA 3C5JB 2FVNA 2WJ5A 1LP9A 2NRDA 2UY6A 3E1F1 3A6CH 4JDVA 1ACZA 3W9DA 3F58L 4RZKA 3UH8A 2TSAA 2KQMA 3BZDA 1IL1B 5HGHA 4P5KB 5D1XE 3NGBB 4DKFH 3FOMA 3BVUA 2E7DA 3QQ3A 3L54A 3RX5A 1N6UA 5I6XB 2I07B 3ZYZA 3BXNB 1HSAA 4LBEA 1F5WA 2VZUA 3LN4A 5C8JB 1VPOL 2KDGA 1M71A 1JGDB 3MCKA 4HCIA 5C0IA 5KSAB 3LIZH 5DMIL 4LLAA 2PF6A 3AG1B 1CFBA 3QIBA 2RQEA 4RZCB 3N42F 2C7UA 1G1YA 1UD8A 3L5HA 3B3BA 3D4GA 3MUHL 1Q90A 4FULA 4OLUL 3STLB 5C0AB 3TYFB 5HYJA 3WNJA 2R4RL 2F7PA 3RPIA 3TJPA 4R4ND 4WSGA 4YHIA 5AW0B 3NFSL 1ADQL 2KLSA 3CFDB 4M02A 4NKMB 3VXTB 2VRAA 2CK0L 3ZX1A 3JV6A 2JKLA 3AU1A 3MMEB 4PJIF 5F70A 5L6YH 5E5UB 3F7KA 4AENB 5IW6A 2X4QA 2HJKB 1P4BL 5A6MA 2DQUL 4P59L 3S5LA 5I1KL 3KHOA 5C0BD 4UQ3B 2EDEA 3C09B 3U9UA 4PJCE 1IAOA 2WNGA 2ZWKA 2BHZA 3PL6A 4OTXH 2OSYA 2CPUA 3QYCA 3TEXA 3Q6GH 2ZUUA 2DTMH 5CXPA 2Y7LA 3P4NA 4NWTL 1IC7L 4BK4A 2E59A 2QQLH 3LH2H 3HR5B 5HGBA 2GSMB 1HNFA 2ZUQC 1DUYA 1KY7A 3FFCB 3SE4C 1S7VB 3VCLA 1U58A 1AZZC 4NO2B 1M7IA 2DMBA 1BW8A 3RQ3A 5BVJB 3MV01 4X7SL 3W9EB 35C8L 4P2YA 3KPOA 3WO4B 2AQTA 2XKSA 2Q8BH 2B4CC 2WUBH 3VXRE 4JFXA 3DMMD 4HUWB 1GA2A 2EABA 2IXQB 3ARED 3FFDB 1MI5E 3RUGB 5E08L 4S0HA 2UV3A 4OJEH 2D2CC 1JGLL 3LRMA 5EU7E 2A77L 3TV3H 4W68A 3V4PB 3JT0A 4NHCH 4XNYL 2ED6A 1T7VA 2VMJA 1KN4L 5KSUA 1Y07A 2LV4A 2QHRL 3K80A 4UILH 3X12A 2ZUVA 3O6MH 3S96A 4I2XE 4XCCH 4WSJA 1U8MA 1VGKB 2ITCB 1NBYA 3S37X 2YPVA 4GXVL 2YEZA 3ZSTA 1BZDA 1E5ZA 1NC4A 2Y2WA 5A7EA 4P07A 1UEMA 2AAVA 4Q7DA 4WZ9A 5GZOD 2YQ2A 1QASA 1DJZA 3S5LG 1ZRUA 1TVBA 3Q2VA 3S35X 1XH3B 3FUDA 2BRRL 3UTZA 2BFGA 5IHLB 4FLRA 3ZDZF 4XXWC 1ZGLM 3GMOB 1QVOB 3DMMC 4PBWD 2YS4A 1H0DA 4F27A 3AREC 3GXFA 4N6QA 2OPCA 5F7FA 4AL8C 2WINB 2WQAA 3OGOE 4S1SL 3L2LA 5DQDH 4LPWA 3TPUA 1ZDSA 3OR7B 1FNSL 1RZ7L 2RJMA 1MPAH 2QL1A 4XPGL 1XR8B 4YOKA 4ANUA 4PREB 4MTMA 1IEBB 1EQWA 4XN2A 1KXQA 4JDZB 1FNEA 2F7OA 1ZV2A 3LYRA 3BE1L 3MRPB 4X4XB 3WJLA 4X5RA 5IVZB 5KVDE 4Z7NE 1CU4L 4AGMA 3HCVB 3KPMA 4PG9B 4S1DD 3EO0A 2WWMD 4UU9A 3VGDA 3VU2A 1NAKL 1YJDC 2WXOA 4PJCA 3VXUD 3S98A 3QAQA 2C3HA 3PXJA 3H9ZA 2XY1A 1C7SA 1NEZG 2XYCA 4JHBA 3MNMA 1YLBB 5AW7B 2IJ0C 2XIBA 5FWRA 3BP5B 3WFDL 3HI1B 1UWYA 4KWUA 5FCSH 4BUHA 2ARWA 2F8XC 4WKXA 1L0PA 3QXUA 5I1HL 4RQQA 2A9BA 4LPYA 5AW1B 2HTLD 3IJ9A 4FYTA 1IKFL 4U1KA 2PCXA 5L7XH 2NNAB 3QNFA 2VITB 3GBMH 2K1MA 1B6UA 5HDWA 1QKZH 3RGVD 4L0YA 5J12B 4GINA 1AKJA 3VXRA 1CYWA 4X6CB 4JG0H 4PS7A 4S1DC 4ZUSB 4ANKA 2WWMC 3FOLA 4LMQE 3EYOA 5CLXA 2WWOA 5FYLL 5B38A 2D3NA 5EEUA 2Y25A 3FQRA 3T4AA 2BVPB 4OI7A 4XMUA 1QLFB 4PP2A 5CMAA 4ZMXA 2EEAA 4H25B 5DJAA 4HZLA 3SEPA 1AD9A 4TNVK 3P3RA 5DJ6A 1RUKL 3B7RL 3MQIA 3FN0L 5BUAA 4PRDB 1Z9LA 2QPFA 3IM1A 2EYRB 1BM3L 1TXKA 1Y6KR 3B9KD 5L2KD 4UCFA 2GTWA 4GG6B 1KPRA 1A0QH 4XZ4A 4F7EA 3ARBA 2HTLC 4AQ8C 1EJOL 3CUPA 2R56L 3QJFB 1A5FH 4BGLA 2VKXA 3ZTNH 2FJGA 4J28A 3ARGB 1F45A 1OAUL 4R26L 3RGVC 4KRNA 4U1NB 1T20A 3FFOA 1U8QB 4MX7A 3NK3A 1HTYA 2DBJA 1F2XK 4OZHF 3IGUA 4PV8B 5DTFA 3VXOA 3M88A 3QPXH 4JG5A 2A7BA 3FHAA 3G08A 3L1OH 3I9GL 3PG2A 2CSPA 1HCYA 1BGXL 3AS3A 5HDBF 5CHNB 3IN2A 1WCBA 3LKQA 3DVNB 4ZTOL 5C2BL 1XF2B 2WNXA 2MQCA 1A7NL 3DA0A 4L1LA 2DI7A 1MFMA 5C08D 4LPUA 3B9KC 5FA4A 2APTA 4Y5XC 1FSKB 2ZUXA 3BAJA 2BM3A 2I9LB 1A6VH 2C9UA 3JQOB 4NKOB 3EOBA 4N28A 5JA9A 3EDFA 3L7EB 3AY4C 3TTYA 4QUOA 2XTLA 1F2QA 1X7QB 3IETB 5C7XL 1Z9SB 5ENWA 1NCOA 2EDKA 3NIDF 3H2QA 4HIEA 4J6RL 5E00A 4FQXB 1HHKA 1L3WA 3LZFL 3DO7B 2WKGA 3PLYA 4YK4B 2H32H 4KFZC 1HL4A 2F53B 3V6OA 3VGGA 1OZUA 3DX1A 4S11A 2BC4A 5DURD 4FI6A 4G6ML 2AEPL 4C8XA 3FCSB 1R19A 3H56A 4ZD3H 4R90H 1RLBA 2JK5A 4U4IA 5ICZA 3FO0H 3CZGA 4F93B 3SHSA 4TRPL 4HIIA 3WNNA 4NUJA 1KB9J 3EO9H 3DUHA 1YQ2A 2ITDB 3SQBA 1GZHA 1NCJA 3IVKB 1KTLA 2FT7A 4LFHG 1NKGA 4JFSA 4JM2A 1Z7JA 5DJXA 3U4EB 3FCGA 5D4JA 4AM0A 5GGUA 2P80A 3N42B 2XN0A 3MRBB 3I3DA 2WLIB 1JZFA 1MAMH 4PJ9D 5ES4B 2R9HC 1GSMA 5EU4B 2BZDA 1VZIA 3FQWB 1A7QH 3SKOB 2C3VA 4GOSA 1LEKA 4MMYA 2WIIA 4MRCA 2H0FA 3F05A 4XP9L 2V17L 4ZJ9A 3RDTB 2J1YA 1KT2A 2EH8L 3FFCE 4EUPA 1GW6A 5I15L 2XACC 2QLVB 4X6EA 2AGJL 5EU3A 3ZU8A 2B1AL 4APXB 3WKPA 4A38A 5PCYA 3LRSA 3X3GH 1BECA 1TYRA 1XGRA 2M2DA 2MKWA 3STZB 1OE1A 4LEOB 2P47B 4R5VA 5ELIA 2GYSA 2AF2A 3EJJX 3MUZ1 3JTSA 2AK1L 5INDA 3APFA 3QWRD 2R0ZH 3RUGE 5CZVL 5I73C 4PJ9C 4MMZB 4FI7A 4M93C 4JFDB 5ESVA 5DRZA 3WDHA 4IQHA 2WLLB 1SN5A 4QHPA 3HE6B 2OJEB 4I0PD 4K9JA 4EZJA 3C5JA 4HAKA 2ZYRA 5I6NA 1C5CH 1IZKA 4UIKL 1A3LL 5I1JH 1KV7A 2CJ3A 2NXZB 4U6VL 1IL1A 1MLBB 3EOTL 3JWOH 1X9QA 2VR8A 1U6AL 3HBQA 3P1VA 5M7QA 1TZIA 3GM8A 2PR9A 1Y1UA 3G9AB 1OT2A 5CU5A 2W81C 4M1CD 3TL5A 4J4PC 5ALCL 4JPWL 1I75A 1IM9A 2CRYA 5DJCB 1VFBA 3UAFA 5KSAA 1JGDA 1SDAB 2GFBB 4O2EB 3WSQL 4EZLA 4P2QB 4Z95L 4UI2A 3QIWA 3ZKQD 1VLXA 3MOBH 4KK5D 2Y22A 4RZCA 3NCJH 4U33A 1N9PA 1OB0A 2GUYA 2JKJA 5C0AA 2HVJA 4I89A 4P3CL 3P9MA 4EE2A 3CVHL 3JUYA 3QS2A 3WIHL 1IB5A 2P52A 3GXNA 4I3GA 4M8QB 4EUPG 4I0PC 4E41D 4HWBH 5AVRB 4NKMA 5KEZA 5I6LA 1HL5A 1N68A 4WLCA 5E6ZA 3MMEA 3TJEH 2N0KA 3QC6X 3KLSA 3UG5A 4AENA 3ZDZB 2HJKA 2LT9A 3VNYA 4YDKH 5IGXL 4Z1PA 4PCTA 4WI0B 1KFAL 4HHWA 5EBGA 4M1CC 4UQ3A 1U30A 2CXGA 3MRGA 4S0TD 2VDPH 3EJCA 4Y19D 2R2EA 4W6WB 2DQEL 4JFFD 5BW7C 2PW1A 1Z9OA 5JDJA 4MD4B 3KM1A 2ADYA 3P40A 3HMWH 3HNVH 4KK5C 1UD6A 1WIUA 3BO8B 1S7VA 4N24A 5DT1L 3HHSB 5ECJE 1MJUL 1RMFH 4NO2A 4XNUH 3S6CA 5BVJA 5C0CE 1PLCA 3WS3B 1VESA 4IU3B 1RUAH 3ZQWA 2ZP9A 3TA3C 2VSMB 4AW4A 4DPCX 4ZW3A 2H8PB 3WTUA 1E5YA 1MCWW 3CFBB 3TP4A 5EA0H 4O5LH 1R34A 1KJ3H 2ZOWA 2ZXWB 3MBED 4X6CE 4QOKB 4X83A 5LCVA 4QRRB 4FQ1L 4KO7A 2VSDA 3S37L 3EJSA 2PYFB 1T03L 2NY6D 1ZV5A 5EF0A 4AUJA 3KG5A 4UZUA 4CSZA 1IC5L 2CDGB 1EVUA 2Z1PA 3S35L 1B4RA 4Q89A 3GI8L 1RHHB 1YC7A 4QCIB 2DQCL 3N91A 1WGOA 3ECWA 1Z5YD 3S2AA 3WXWL 2ITCA 2XWXA 1UH3A 2YD0A 2W0KA 3RZCA 1TQWA 1J48A 1QI4A 2EIJB 4ODVL 4GG6E 1UVQA 4HFUL 5K59F 1W15A 3RURA 2HH0H 1HOCB 2XXGA 3BDXA 4LESA 5ANHA 3OXRA 1B3JA 1DQLH 4LGPB 4ZTPH 3VJ6B 2FECL 2XSKA 3MBEC 3GMOA 1QVOA 3NZ8A 4ZFOB 4F37K 1JZ5A 1I8AA 1IGCH 3HZYB 5D71H 1FNAA 3A21A 1YCSA 4PJAF 1BQHB 4U1LB 3QIBD 3ZT7A 3TBSB 1MJJB 3DBSA 5EOCL 4PWGA 5FHBH 3G3LA 3CVDA 1FFNA 3ZY7A 4PRIB 4GQQA 3IJSB 1IEBA 3J2PA 4N0FB 5KJ4A 4JDZA 4PJ6A 1QUPA 5AOIA 1CLCA 1NCHA 5C86A 5C0DB 4CVXA 4AVJA 3ZE0F 2VR7A 4X4XA 5HP5A 5IVZA 3MRIB 4F7PB 1PZDA 2D03L 3HCVA 4PG9A 3LH8A 5D7KE 4L1TA 2JNZA 5CCKL 2E47A 1RZKL 4MHHG 3UYOD 3ZO9A 5KBPA 3L3GB 2A4CA 5CEXB 1HH6B 4WI2A 1FA4A 4Q6IB 3QCTH 4OBSA 4YLCA 4AITA 5HDBB 3RIFK 4GLRH 4KMLB 1D5MA 1CD0A 1XZ0B 1WK0A 1SEQL 5TQ2L 1CICB 3VI3F 5T3XE 3BP5A 1A1MB 1JN6B 2F53E 2X4UB 3QIBC 1LILA 4JHUA 2EC8A 1OAQH 4CJ1A 1BBDH 3FSVA 3P3YA 4UV4L 3BPLB 3TH2T 4EZMA 2Q87A 1J0HA 4V1DB 2OR7A 4HUNB 2J56A 2NNAA 2YXVA 2WLJA 2VITA 1DZBA 1KF9B 1LNUB 4NERA 1R9FA 4BK8A 2XN1A 5D5MF 3O3EB 5FUCE 4X6CA 2CRIA 4Y2DA 1P0SE 4ZUSA 4TNVF 1EXHA 4FEIA 3HA0A 2UYLB 4DN4H 1W72A 3ZIYA 1UYWH 1WTGT 3WTTA 5K39A 1CFQB 1BIIA 2NY0B 2RQ8A 1BAFH 1JZ6A 1MSPA 3QDJB 3DHPA 3KPRA 4TNGA 4HS6B 5E7BA 5HHOE 3T71A 1E5BA 5J0BA 4UZSA 4U6TA 1BZEA 1F11B 1BOGA 4UV7L 2FJFB 3MJ8B 3CFUA 2OR9L 4UNUA 3MGTA 5E8NB 1IT9L 5IESH 4UYPA 1NC4D 2ZX9A 3PWNA 1ZTXH 1FGVL 5T5FH 4OCWH 4I1RA 2B1HL 2NUPB 1WPCA 4NLHA 1XGTA 2FATH 3DX7B 4UT6H 4IBZA 4WF7A 3F2LA 3BRDA 4OLYL 1UKQA 3V52H 2H6PA 1MFCH 1MHHB 1NGWA 4P8QA 1E42A 6PCYA 4NOFA 1GIGL 4HEMA 1O7DE 4PJBA 1CBVL 4XOEA 3OJMB 5CHNA 1QHOA 2Z0UA 3RY4A 5IB2A 1XF2A 1UCBH 4HHAB 3UCQA 4E5XB 1K4CB 5E4EC 3EDEA 3L16A 5ACZB 1DBBL 5GJTH 2WQUA 2QHLA 3F65A 3KHQA 3ZTCC 2NPLX 4IS6B 1WA1X 4JFDE 2ATKB 3H9HB 5GGTL 3SPGA 4R9HA 4NKOA 1AY1H 4LVNB 4BHUI 4UDTB 1RKRA 1U8IB 1MAKA 4L5FL 3VXSE 3L5WB 1SVZA 3EH1A 1RZJL 3KJ4B 1W6LA 2DQGL 1Z9SA 3DV6A 3OAUH 2ALWA 2LFGA 4FQXA 4R3SB 5IREA 3FUEA 2F53A 2DV6A 4B7LA 1KDJA 2WUCH 1UOLA 1JCVA 1E9OB 5B1JA 5I8KH 2MNWA 4F7CB 1WWWX 3EGSB 2M26A 1KULA 3RPBA 3GMPB 5IKCB 4LNRB 4QDGA 4OJFL 3UJTL 3KH3A 5EUOA 1P7QB 3IU4L 3BYTA 1UA3A 2RGSA 2WK2A 2CLZA 4I0KA 3TOPA 1MFVA 3IDIA 4X80L 1DSFH 2A1WH 1A8JH 5FO8B 3HUJB 1YEHL 3MRFA 3FDWA 2Y7QA 4UT9H 3RKPA 3OKKB 1L7TH 5D72L 3H4FA 1FFPB 1INEL 2ITDA 2XPGB 4DCQA 3P4LA 1PY0A 4N2GA 5I66A 5IHUL 4AGQA 3IVKA 1DEEB 5SWZB 2SEBA 1JF5A 2GK0B 3QZBA 1OTUD 3ZDZE 1BQRA 3NA9H 1E4JA 4FHBD 4XTRD 4Z3HA 1I9IH 3QNYB 1OGAA 2APVA 2BY3A 3F7QA 1ZTMA 3T6WA 4EDWL 5JXAH 5FB8A 1TQVA 4OLZH 3ARBD 1NMBL 3IPEA 4F15B 4ZUUA 3HB3D 5TDNB 5E1AB 3DWTA 4XPFH 4B9KC 1H5BC 4G8FA 1XB8A 2EYSA 3C2AL 5L8KB 1VGEL 2Y36L 4L8SB 4ZO8A 2G60L 3QT2A 4GKNB 2W59A 5EO9B 5GRJL 2ROYA 1B0RA 3T4AC 4TL4A 2E46A 3BDYH 1EDHA 2JJTC 1KJMA 3BD5A 3DO3A 4GQPH 5LGYA 5EBMA 2BHYA 1EJ6A 1OTUC 4AQAB 1WC7B 5F72S 1ORSA 1NCCL 2J8UA 4QOKE 4LKCA 4QRRE 4FJYA 4XTRC 2PCFB 3SZKC 5E2TH 5HTSA 4AJVA 5CN3A 1HHHB 3CIAA 4JR9H 2IG2L 1ZJAA 2WLLA 5E4IA 4WTXA 1CFVL 3HE6A 4QJ3B 2OJEA 1FVCA 3ARBC 1FFTB 3CN4A 4WW2B 5B7FA 1FE8H 1KZQA 3MLVL 4KRPC 2PKDA 3RAJH 3HB3C 2VZSA 4OLVH 1YYLH 2Y5EA 5GGQL 4S1RH 5H37A 3BT0A 2TRYA 1Q9OB 2EUZA 3FYIB 2VN4A 4OAWB 1LWHA 2GW5A 3K6FA 4OQTH 3WAKA 4L18A 2W88A 1KBGL 1MFAH 3VYNA 3FU3A 1PQZB 3AS1A 5DJCA 4JKPL 2A6KB 3U4BL 3BLBA 2WQVA 3DJ9A 4XMWA 4KUCD 4P2QA 1E8WA 5T3ZD 2AJVH 4HLEA 3C5XA 1W8NA 3NCCB 2OM5A 3QWOB 3ASWA 4CW1A 3KW8A 1YHPA 4OFIA 3ML8A 3HIZA 2KLTA 3MCLL 4N0UB 4NFCA 4F2EA 3F5WB 2NXYB 1LYQA 2AQQA 5EEXA 3ARWA 1RFDH 4PRIE 4NN7B 5IW1B 3FB7A 3VG9C 2KZBA 4NNPH 5ID1B 2A3TA 3HS0B 1FFQA 4DTGH 1WD8A 3FUNA 5EU5B 4JM2D 1H6UA 4X5QA 5IQMA 4PJAB 3CSYB 2W94A 4OZHE 2P80D 2ESVD 4YBHA 4Y88A 5E4OA 4L8BA 1BLNA 4NRZB 4NN6C 1XXFC 1MCEA 5A16B 3D06A 2O1AA 5HDBE 1GPOL 2R0KL 4N0YL 5DD1H 4CU6A 1PD1A 4FP8L 2WZ5A 4HS3B 4N2BA 1JK8A 2V0AA 3HHSA 3L08A 3MSPA 3ZE0B 2Y7SA 4AW7A 4JHZA 2OZ4L 3DTXA 4JQIA 2DJ4A 1CCZA 3T0BA 2ENYA 4IU3A 2P5PA 2CMRH 2NX5B 4PCYA 4JFPA 4V1DE 4OZFH 4XPTL 3G6AB 4BSVB 3OKYA 1GZHC 3FYEB 5I5JA 5FW6A 5EN3A 2ZQKA 4JMXA 4JM2C 1FNHA 4Q74A 4GAFB 2MNJB 3VI3B 3UZQB 1UUNA 4IOSD 4ONGH 1RSFA 1H3PH 2X6AA 1RUPH 3RVUD 4L3FA 3OKLB 1NFDF 2XN9A 3O8XB 3QDJE 1J5OH 4MJJA 2FIKA 4QRQB 2OYPA 3KZ8A 1RHHA 3LIZA 2IFFH 4MJIA 4NZUL 4P9HH 1HEZB 3U83A 4BKLB 4HK3N 2QELA 3DRQB 1AHWB 5D5MB 2J5WA 1EAPB 2EDDA 5L8LB 2EJ1A 4MCZB 4F37F 3TA3B 1HOCA 1NGYB 4JJHA 4JPQA 1CD1B 2BMKA 3ULAB 2Z8RA 2O5YH 4DP5X 3X1EA 1IM9D 1TMQA 3SD2A 3WNIA 5KANI 5DD6B 3L4XA 4ZFOA 3I75A 4ODUB 4Z77A 3QIWD 2X87A 1DVYA 2XKNA 4U1LA 2VWEC 3X1FA 1RPQA 3TBSA 2WXPA 3C6SB 1K3IA 1MJJA 1NCDH 3JWNH 2CR6A 1PNDA 1I9RL 4GMTL 3NCMA 1ZA6B 3RVUC 2FT8A 4GW1B 4K94C 5BJTB 4PRIA 3IJSA 1JVKA 3EJRA 2GTQA 2VDPB 4NIKB 4N0FA 2EXWD 1AGFB 1DN0B 1FH5H 4N2NA 2E9IA 2GT9B 4ZG1A 1I8KA 1KJ2L 5JPNA 1GOGA 4MXQD 1KXTB 4UB0L 1WFMA 3BP7A 1TLKA 3FUMA 5I76A 1L0QA 1QWNA 3Q2LA 3RIFF 1Z5LA 4NCC1 1LO2L 3L3GA 4MJ6A 5CEXA 1HH6A 4K8RH 1QO3B 2G3NA 4X0KB 4RBPK 5EU6B 2G3XA 3N0AA 3CTTA 4WTZA 4Q6IA 1KCRH 4KO5A 2ZIDA 2MPAH 4K8RD 4JHWH 1XZ0A 3WXVL 2NCEA 3QIWC 5E6IB 1T04B 1A1MA 2PLTA 1DQDL 2X4UA 4N86A 1AGEB 4NP4H 3SDAA 5JUEH 5E9DE 4Y4KB 5DEGA 4X7TB 5MERB 4YPGB 5F1OB 5I75B 2FCBA 3LQAC 1TPXB 2GKIA 1OM3H 1URIA 2EXWC 2BWIA 4G59C 4GSDL 3CXDH 4AKPA 3IS1X 3O2WH 3TWCH 1E4KA 1RZPA 1F8TH 5DHVA 1X5HA 4MXQC 4JFZH 1AHKA 2BS9A 4LVEA 2UYLA 1JF6A 1ZOXA 2X6CA 4G8IB 1ZT7B 2ZNXA 1A3RH 4MAUL 1CFQA 4JW3A 1FIGL 1K5NA 1NA8A 4M62H 1BQHG 4GKZB 5L9DL 4K8RC 4N85A 3KYMB 4XBPB 5SWZE 1EO8H 1P5UB 3AM8A 3JTBA 4LP5A 3NPZB 2APXA 5KVEL 4NPYA 1UOKA 2VQ4A 4Z0XB 2FJFA 3MJ8A 4XGZB 1RJYA 5AVYB 4PGEB 4XP1H 1TT6A 4KX7A 2X10A 3ELQA 4XCFL 2ICWI 5E8NA 5T1DL 3RZCD 4DF9A 1SHXA 1YNKL 2HX9A 1DSWA 2EIMB 4LDCA 3CFMA 5I1IH 4POZD 3VD1A 1KCUL 3IE4A 4HC1H 4OGYL 4Y9CA 4EDXA 1JWMB 1MUJB 1KIPA 1A7PL 3DX7A 4BRVA 4HGKC 2IBBA 1MHHA 3U4AA 4AG4L 1G0YR 4U1JB 4A1RA 3BPNC 1Q94B 4HWUA 1WVZA 3EYSL 4HHAA 4KY1L 7PAZA 4ZRGA 5LGHH 5KS9F 5EZOL 5ACZA 1JPGB 4XNAA 3MLSH 1IGFL 5IFAL 2LE9A 1BAWA 1ZHNB 2ZG3A 4U2ZA 5L88L 4L3CB 4JRXB 3RZCC 1GGIL 2PR4L 3WFBH 2P43B 1U8IA 1SXBA 4HUUB 2P5WD 3L5WA 3B2VL 4POZC 1HE8A 5I24A 2X4OB 2BPBA 3C87A 4A2DA 1H19A 3FQXB 4K4KA 3HG1B 3FHQA 3CPUA 1QBAA 1X6LA 43CAB 1E9OA 3GSOA 1AQDB 4JZOB 4F7CA 3F83A 3IGFA 1UA7A 3L7FA 3P11H 3BPCA 2AXFB 5IKCA 3GMPA 2NY3B 2O6PA 1WG3A 1XD0A 3INOA 3VSUA 3ULVH 3B56A 1KYDA 3S36H 3VQ1C 1UD3A 3TEYA 1QR1A 4I88A 3AT0A 5AKVA 2OL3H 4MD5A 1T80A 3GB7B 1FVEB 1NCWH 2WTPA 3CHQA 4N0UE 5FO8A 1MWAB 3HUJA 1GOFA 4Y2DD 4XI5D 1NSNH 3OKKA 5K9QI 5F8QC 4XNQB 1KEGL 2XPGA 4AGOA 1N5YH 3GNML 3PP4L 3VWJA 5G2NA 5MEPB 1DEEA 2WB7A 2WO3B 2CIKB 3BN9D 1NCUA 5SWZA 4KTGA 3KPRD 3TZVD 3CFQA 2XPZA 3KM2A 3R7RA 3VRJA 4R7LA 3BDBA 3P77A 2P26A 3NSFA 4PJAE 4E5XG 3QNYA 5CKAA 5IHWA 2OFQA 3EF4A 3TH3T 1GMEA 2R8SL 3TO4A 5LLIC 1TLMA 2YJLA 5MI0C 2C4FU 4NQTA 4RGNB 3QK0A 1MCJA 5TDNA 4G42A 3QG6A 3ZE0E 4L8SA 4ODTL 1THAA 2YPLD 4Y2DC 4XI5C 3LQMA 3QUZD 4GKNA 1H3VA 2NX5E 2IH8A 2WXJA 5GSRB 3O4LA 3W37A 1UOWA 1YEJL 1PZ3A 2R4SL 3CLFH 3BN9C 3VRLF 1SGKA 4G71B 3TZVC 3ETBJ 3NUKA 4UTBH 3VAEA 3ZE2F 2E9WA 3KW7A 4MZIA 3SGKA 4JO5A 3VI3E 4ELMF 1F4YH 4ZXBD 1HS6A 1LK2B 3FMGL 2NSQA 3KVQA 4WW2A 3CFJB 3TBWB 3PGDB 3TLRA 5ITBL 3N1GC 3GC3A 4L1BA 3VYPA 3EXLA 1PZCA 5AZUA 4IGBD 5DD0H 1UCTA 5D5ME 2I32A 1SJXA 1CT8A 3QUZC 3GRWL 1DQVA 1G1OA 1QFWH 1WF5A 4G1MA 4X5WB 3RFZA 1SUJA 1IAMA 3LN5A 1PQZA 1F4XH 3QXVA 1D5RA 2A6KA 2VMEA 4IKNA 4AE0A 1DL7H 1NFDB 3AABA 4GFTB 2HLAB 1JTTA 2NY4B 5GS2D 1IC4L 2IPTL 2OMWA 5D8JL 2HX8A 2VDNB 3WE6A 1A9VA 1XFPA 3K2IA 3K4ZA 5CD3B 3WU1A 4YLBA 4ZXBC 1IIKA 4N0UA 2NY1D 4NUMA 2XXFA 1XAKA 4PR5B 2AHIA 4KMTH 5IEHB 1H9VA 1HKFA 1CQYA 2NZ9D 5IW1A 1UACH 4FL4C 3HS0A 2P24B 3K0WA 4FXKB 1BZ8A 4QXGL 4MA7H 4TV3A 2V7NA 4EQ3A 4HJJH 4IGBC 2HFFB 2X53A 3L5XH 5EU5A 1PJWA 4IDLA 4F8TA 1SXSA 5JXEA 1PPIA 2V2TA 1E5AA 1C1EL 4Z3JA 4HIXH 5DD3L 3ML9A 5JA8B 1LWRA 2CDEA 4N90D 4PP1D 1OGAD 5EU6E 5B1JC 2AQNA 5A16A 1MJ8H 5ACLA 3GSVB 4B9JA 2P8MB 2IGFH 4A68A 5BV7C 1JZ2A 1J10A 4NM8L 4HS3A 3N0PB 3V6FB 2B4CL 2NY1C 4MNHA 3OPUA 5EUKB 2IWFA 1ES0A 3PJNA 3BGFB 2NZ9C 2B0SH 3IT8D 1NUDA 3IFOB 1WZ1L 2ZCHH 3ULVF 2OCJA 1E5CA 5PAZA 1GZPA 2DI9A 2X09A 4UOJA 4UTAH 2X44D 3OSVA 2E7LC 1QI3A 3UZQA 2K8MA 4HK3J 1DJYA 4JE4B 5TDPB 3HS9A 3OHMB 4PP1C 4DO4A 4NN6B 3OKLA 3LNGA 4HUKB 4Z7IA 5AZEL 3AADB 3IFPB 5AVUB 4I3RL 4QRQA 1AXTL 1PZUB 4JY6B 1P1VA 2AJSH 1OPGL 3I02A 4FNPA 1HEZA 1CLVA 3S8FB 4BKLA 4QKXB 1AHWA 2F58L 2YR3A 2ZAIA 1EAPA 4JO1H 5GZND 4U0RC 3DURB 3VGEA 4DP1X 2XWRA 3EGDA 3DIFB 1AQKH 2EDLA 4HUXA 2LU4A 4MCZA 3IAGC 1JZDC 1CD1A 1WUNT 3OXSB 4GSXA 3BAEH 4MFHA 4ZQKB 2DTSA 1XGYL 1AH1A 5TH2B 4ODXB 1NGQH 2CA3A 4HW6A 3V4UL 2BX5A 2KZ1B 4NM4L 5DD6A 4LSQL 4ODUA 4LSUH 1RULL 3FN9A 4FFWD 5A2JH 3OAWA 2VDLL 3L81A 3T0EB 4FFTA 1FI8C 2VDML 4KBPA 5DVLA 2B15A 4UMGA 3LY6A 1MVYA 4ZPTB 5IW3A 4HGWA 4X98B 1VEOA 1AGFA 4XC1L 4C56D 5FOBB 3FU8A 3ZRFC 3US1A 3MNWB 1Q9WA 3BUDA 1O9WA 2Q8AH 5GZNC 3MJ9A 1I7RB 2VERN 4Q6KA 3MV8B 4JGMA 2CJTA 2ARJQ 4XWGL 2QT6A 2VABA 1QO3A 3U6XA 4K5LA 4OQ1A 1VACB 1XB6A 5IT2H 1R3LB 1AGCB 4FQIL 4OZFB 2ITFA 4LSSH 4LHUD 3KVDD 1RIHL 3OKMB 2A74C 1KTDA 5FFOA 5E6IA 1T04A 2AVFA 3BMWA 4FFWC 5E99H 5KS9B 3JXAA 1R3JB 3QBTB 2FEEL 4Y4KA 2DIBA 2R29A 1H8OA 1R1CA 2CNZA 2ZG2A 1TJIL 5EF1A 1JJUA 3LB6C 3WN5A 5HYSB 1O6SB 1G6RL 5IVXF 4FERA 3CVIH 1YA5A 4FQ2L 1O9ZA 2QR0B 4LKXB 1AMYA 4YVNA 5L0QC 1X3DA 3ECQA 4D0DA 4PD4J 1CJYA 4AIXA 4TVSa 2XU9A 4F5CE 4XRCB 3DJTA 1BPLB 4NI3A 2Q7YB 2PP8A 1W80A 4CMHC 1WAAF 4FNLH 4HD9A 4N26A 1HNGA 1SLVA 3B6SB 1ZTXE 3PQYA 2R15A 2XN9D 4BFBD 3GS0A 3CFIC 1P4LA 4PLNC 1QBMH 4BSWB 5CSZB 1GGBL 4KHTH 4MJID 4Z0XA 2BIHA 1BFVL 4OZIA 3ET9F 1RIVH 3CG8A 3BKCH 2DLFL 3ZRCC 1ID2A 1PIFA 2GJ6B 2W5PA 4YWGH 4O58L 4RGNE 3CCHB 3W2DH 5EBWB 4OFPA 4QJ5B 2JJSA 4ZNEA 2CBQA 1JWMA 4KNUA 2H9GB 5I71C 4ELKB 2KZKA 25C8L 3IMBA 2RB8A 2GSIB 4YE0A 1E3XA 1R0AH 4NQEA 5KBKA 4U1JA 3BKYH 4WHCA 1QSFB 4RSYA 2PPFA 4XBEL 3JUZA 4YL4A 3G04B 5GSVB 5F7NC 3RPKA 3QI9B 2DL9A 1JCKA 1G5GA 3T09A 2BW4A 2MMXA 1UWEH 2YAEA 4JB9L 1FJ1A 5E2WH 1CS6A 4Z18A 3GSQA 3WE1A 1PFOA 1UKSA 1HXMB 1HAUA 1KCSH 5T1LB 3VFMA 1A1NB 1MVUB 4JRXA 5I74B 3SCMA 1DFXA 3TT3L 3QCVH 5ICYA 4N87A 1K2DA 3VFWA 2EINB 1N4XL 4MXWH 1NFIB 2H1PH 1Z0NA 1K6QL 5I16B 2LHAA 5C0FA 4IRZA 3KYNB 5IBTH 3AVEA 5HDOA 5J9PB 3O3AA 2Q6WA 4PSPA 3FQXA 3ZE2B 3HG1A 4GG8B 3QUKB 2FD6L 4P0DA 5DMKB 2K6ZA 43CAA 1J0KA 3K46A 1ODUA 1XTMA 3SDAD 3NG5A 3BPNB 4HEPA 4ELMB 2D7PA 3K2MC 5BRZB 4XVSL 1NTDA 3GIZH 3BAWA 1HIML 1NFDE 4Z78A 5KVFH 1JTPA 3ULSB 1G7LA 1BZ7B 2FWLB 2A9AA 2V7HB 4PTUA 3MDJA 1YG9A 4YXKL 2YGVA 4DPBX 2YD3A 3O2DH 1MEXL 1T0NB 3GB7A 1FVEA 5JPNC 2XZZA 4JAMB 1MWAA 3V0IA 3REWA 3MPCA 4JGNA 4XNQA 1CXIA 4RGMC 2QDWA 3UIZA 2GBUA 3AXHA 2YHGA 4NOBA 4R5TA 4MLIA 5MEPA 5T5FA 2CIKA 2J5LC 4G6KH 4ZUWA 3RJOA 3QQDB 3TM6A 3U7WL 3U9PH 1KPUB 3H42H 2YK1L 3FTUA 2NMSA 1UT1A 5DC9B 1OV8A 3OL2A 3K2KA 4UT6A 4FG6D 3SDAC 4PEEA 3UO8B 3V4VL 5L4JA 2Z8SA 3CV5A 5D9SB 4OLWH 2K8QA 5DQJA 4QR7A 3S3CB 3DRTA 4FFYL 2H3XC 4MCMA 2ZPKH 3ROOA 4C4KT 1M57B 2VQTA 1OCWH 4F7TB 4L4JA 3LZLA 4WKZB 4NNXB 4PD4K 3UAJA 2EVHA 2L04A 3CX2A 3T6XA 3QGVA 3QUXD 1B2WH 4MAZA 2F7RA 2G2PA 3B4NA 3PFUA 5IB1A 2Z8WC 1XCWA 2WAHA 1MCOL 4WV1A 2VAJA 4G9FD 4HEPG 1CGSL 4UTCA 4DP2X 4YDLC 1QW9A 2GUOA 3AM8C 1GYWA 3N85L 3VGHA 3X3FH 5FXCH 5EZIL 1QTYT 1TMCB 4FG6C 3GKWL 1QAWA 1LK2A 2QPEB 2XUWA 4LCYA 4LGRB 3KL5A 4DUVA 1TSRA 4DEPB 2RTTA 5CGYD 3TBWA 3Q44A 3PGDA 1VA9A 4ONHB 2B39A 1HC1A 5DYFA 2IDUA 2R23A 5KSBB 1GS8A 4ELDA 4H13C 2W9DH 1KTKE 3QUXC 3O0RH 4XVJH 2OL3B 2YD7A 1TG8A 4DGVH 4Q2ZB 3J8F7 3D85D 2P1YA 5J8OA 3RB7A 1OB1B 4UT9A 3UYRL 5EDSA 5CLTA 4K23H 1SM3L 3P2DA 1JK9B 1MCHA 2DQHL 3PDOB 4YHML 5I6MA 4RFOL 2ZOKB 4MZ3A 1DJGA 1WBZB 2OP4H 1PL3A 2A9NH 3O4OB 4HSAC 1FBIH 4F9PC 5IEHA 3WUZA 5CGYC 4ZW8A 2VDKH 4TNEA 5HDRA 1II4E 2P8LB 3T0AA 4Z7VA 4UT7L 4Y1AB 5TK2A 4C4UA 1QRNB 4UQIM 3VWJD 2FGWL 3IXAB 4N2MA 4O4YH 2HFFA 1J1OL 4PJ5A 4WU7B 3IGLA 3SPHA 1Y7VA 2X4PB 1UWFA 2OMZB 1SHMA 4XMKH 2IBGA 3MV8E 3IDXH 4JY5L 1VERA 3C12A 3V4LA 1XV8A 1WZMA 2C9VA 2VNCA 5ISZB 3GSNH 4W9ZA 3TO4D 4CVWA 4JN1L 2W92A 3GSVA 4ZPVA 2P8MA 1LTXA 2O6CA 3TWYA 2NY5C 3AWGA 4MQ7A 2N01B 5D2NA 4BFNA 5KS9E 2VWEE 1ERNA 4FTVB 2ZUWA 3BSZL 3SIKA 3FTSA 1JDAA 1AGBA 5EUKA 4GAYB 3MRJB 4OLXL 4LASH 2HWZH 2XCMC 3IFOA 5B39B 2XZQH 4IJTA 1SY6L 2J2ZA 2GIYA 1KEMH 1V7MH 3O4LD 4RWYH 4Y0GA 5EN2B 1V3JA 3VWJC 1ZLVK 1BWWA 5ID0A 3H7BB 3MCG1 3QO0B 4KV5F 1EBPA 3T65A 5CJQL 5CLWA 2WOBA 5AL8A 1PVHA 5GRYA 2WXKA 2A9ML 4JFEB 4OQTA 3RY6A 3CHOA 5D1ZI 3LRKA 4HPHA 3VXMB 1MIEL 1HZHL 5C0EB 3TT1L 4O51A 3ES6A 4J3OH 12E8L 2J21A 4MBOA 5TE4H 2OSWA 2OTWA 4FRWA 2FSEA 5JHMA 1E67A 2YMXL 1JE6A 3DURA 4DGYL 3DIFA 1TQBB 3I6GB 3JWNE 4JM0A 4XVTH 1JPTH 3LMJH 2BXZA 4HIJB 1X9RA 1MFDH 2JIXB 2GJZB 3OXSA 2GJ6E 4ZQKA 1A7OL 3KDPB 3P4OA 3LKSB 1GZQB 1USZA 1IAIL 2AK4A 3MOAH 4FQCH 4ODXA 4PCKA 1O0VA 4YFLI 5TH2A 5EFIA 3V0DA 2E27L 4ZMPA 1ETB1 1S3KL 5I0VA 1CIDA 2B9AA 4OD3H 5JR1L 5C09D 3P3TA 3GSXA 3SGKC 3T0EA 5E6RB 3HI6H 4U31A 2ADFL 1MHPL 4HYTB 1QSFE 1C5BH 4N5ED 5IUSA 3JZ7A 4ZPTA 2QQQA 5AG9A 2SODB 3EFDL 2PTUA 1MJ7H 4R7DB 3HS8A 3RBSA 32C2B 5FOBA 4AOFA 4Q4IA 5JHBA 1A66A 3O6KH 3MNWA 4Z7WA 5BQDA 3UMNA 2CUIA 1IAII 4JZJA 2ZD0A 3PHAA 4L0ZA 1QA9A 1HKLH 1UZ8B 1I7RA 4L29A 1A7RH 5ETUB 4MKMA 3RRQA 3RFZC 4DZ8B 15C8L 1AANA 1CVRA 4YSOA 1J0JA 1VACA 4B97A 2D31B 4G7YH 2L0DA 2DIAA 2RBLA 1X5GA 1IVTA 3VRLE 2GIXA 5DYOB 4X6DF 5B8CB 3FO1B 3ZE2E 4OM1H 4M8VA 1R3JA 5B3SB 2EEDA 2JB5H 1N7ML 4UM9B 3K74B 5EOQH 5L4FA 1MHEA 4OFQA 2B2XL 4ELME 4N5EC 1QBBA 5BRZE 2F5BH 1JHLH 1O6SA 5GS0H 1KY6A 1DQQA 4JEGB 5GS0D 1FN4B 3CK0H 1TTRA 2JB6B 3QZOA 4O00A 5DSCB 4KQ4L 4XN5A 1EUTA 3ALWA 2HXAA 1F4WL 1UT2A 2O72A 2Q7YA 2P4AB 3CZSA 3FTXA 3KYKL 4HPOH 5IEKB 3MTXA 3B6SA 4JLRA 3A6OA 2HKFH 1DBJH 5KJRL 2AFNA 1MCIA 3MV9B 2RALA 5FYJD 4GEIA 3DSFL 4IOIB 3RA7L 4BSWA 2KUTA 5CSZA 3VSTA 2Y3AA 3RU8L 1X5ZA 3C6LA 3X17A 5HHMB 1JXKA 4LIQL 3V7MA 3S88H 3HLKA 4RRPG 3G6DH 3HZVB 1CTOA 1FLRH 5BVPH 1G7JA 1QZ1A 2O5NA 1UENA 4Y16B 1SBSL 5GS0C 3CCHA 3FT0A 3CMGA 3T2LA 3F7VB 1P2CB 3NYKA 3Q01A 2VLJB 3L1GA 3VQMA 2QSVA 4ELKA 2EVFA 1PG7X 2GSIA 2V2WB 2Y1YA 3B5HA 4OZFG 2X0UA 4QRUB 3MACH 1E4XH 4LLWA 1OP9A 2P5WE 1CF8L 1QSFA 3MLYH 4TLKA 3D9AH 4P3WA 4AV4A 3G04A 2NSXA 4Z7UA 5CUSH 3MO1A 4MAYB 1ZE3H 2WJ7A 2PYEB 4KK8D 4MWFA 3NEXA 1OAYL 1TZAA 1XZWA 1SEBB 1TJHL 4R7VA 1PSKL 3DUSA 5T1LA 1FC2D 4IBSA 5FCUL 1MRCL 1MVUA 1N3NA 1Z1WA 3NJHA 3PGFL 1NIAA 4OD2B 5T1MA 5I16A 4RDQF 1NFIA 1AS8A 3U0WL 4LCIH 4K3JH 3OLIA 5G55A 5TPWL 2P46B 4J2XA 3KYNA 4ZBJA 3U0TA 4R6UA 3ULVE 4J3OF 2E7BA 5FA3B 5ADOH 1MH5B 5IHBA 5KSBE 3D3VA 3VWKB 1ZV9A 1JPFB 3QUKA 4GG8A 5AKSA 5DMKA 1T0PB 1N18A 3FH7A 3IDYC 4XHJD 2V37A 2XWTA 1ZLVH 5FPIA 1IBGL 4L8DB 1YQVH 2N7AA 5BQ7A 1KG0B 3NTCH 1CGXA 3D30A 1SNRA 4PMEA 1QTPA 3T4YB 4JL1A 3ULSA 3WHXB 1KJVB 2V7HA 1UWGL 4KK8C 3JWNG 3EH5B 3F7LA 3VO0A 3WNKA 3EHBB 1T0NA 3NFPB 1D5IH 3X2QB 3GI9L 3NZSA 2OULB 3OKDB 3QDGB 3QEGH 4LVOC 3NJKA 4NJAL 3WOVA 4H2AA 5I9QB 2DD8L 4MD0B 3VTAA 1FNLA 4F58H 3ARVA 2WKLA 2VTFA 1KNOB 1ILUA 2BLFA 1SUHA 2AJXL 4PBDA 4Y1AE 1QRNE 4YBQD 2XTSA 3CFKA 2EDRA 1KBVA 1P4IH 3PQYD 2MSPA 3QQDA 1YVLA 3EYUL 3X13A 1E9PA 2P5EB 3FRPB 3LPPA 2HP4A 1AIFB 2OMXA 3GSWA 3I6LE 4XHJC 5JIIA 5HHXL 4Y4HD 4IDJL 4ZT1A 1RZFH 3HRZB 5DMGD 2UX7A 2C9AA 4DKEH 5ISZE 1MN4A 3WN5C 4Y9BA 1NINA 5IR1B 4U6YB 3UTQB 1GY2A 4F7TA 2HN7B 2WW8A 3L8QA 4NNXA 1UA6H 4FTVE 4LVHB 4MQSB 3WFCL 4YDVB 2DM4A 3AZUA 4F9LA 1ASQA 3V0WL 3QZNA 4R96A 5E2UL 3S34L 5EIIA 3HZMA 3WBDA 2Y5TB 5CEZD 2YAHA 4CC4C 4NQED 3HTLX 7FABH 3ME0B 2AW2A 4M7ZB 4YBQC 4G8AC 4OCSL 2QGDA 3V8OA 1BX2A 1GC1H 3LRGA 1PJ9A 4PWKA 4OV5B 3BMVA 2B77A 2B7DT 3VFGH 4OF0A 5MP6L 5GRVK 1DVFA 2OYLA 4UIMB 1TQUA 4H40A 4U7MA 4Y4HC 2Y1VA 2UZXB 2VXQH 4JFEE 1XWVA 4FQJL 5DMGC 1DTUA 2FQGA 2I25N 3FRUA 3L3HB 2NZ1A 4OZGF 3SCMD 2IGLA 3UAEA 3BCDA 4ONHA 1RZGB 3VXME 4U1GC 2CO6B 5IVXE 1A02N 3GZPA 4BH7A 1KIUA 3BEVB 3SPJA 2XQBL 5KSBA 4MA8H 3BP6A 1MCCA 3INUH 2WSDA 4BZ1L 3LSOB 3D39A 1F58L 4XPHL 2O4EA 4WHDA 2YFNA 1OB1A 5KVDL 2X42A 2R1YA 2VXUL 4DH2A 4B5EA 1WAAE 4OB5H 1AXSB 4LLYB 2RR3A 4JFYB 2HFTA 2ADGA 2BJML 2ADIA 3SGDI 1V55B 1WBZA 4TUKL 3QEQA 2AJUL 5TE6L 5I2IB 5E8DL 2VGLM 2QQKL 3GSUA 1MFBH 3SCMC 4UQ2B 2K45A 4RISL 5DJ8B 2NTFB 2AJ3B 3R8BB 4NBXB 1KB5L 1CE6B 4Y1AA 1OZTG 2VJ0A 2OJZH 4GP8B 5BNXD 4HJEA 2GK2A 4M4RB 5F88B 4WIQA 1QYGL 3IXAA 1IC1A 2YBRB 3MRLB 4MASA 4WU7A 3B2MA 4HU2A 2MHAA 2WBJD 5HHQB 2X4PA 1CN4A 3L9YA 4UINH 4V2BA 5HHNB 3TGXA 3U2SA 3RWFA 5D93C 4HKJB 1ZVYA 4R84A 1NCTA 3PUCA 4U1HB 4X99B 4XPBL 5IOKA 1CXFA 1S5HB 2IEPA 3QHTC 4LL1A 3M6DA 5ISZA 4GQRA 3E6HB 5GGVH 3UERA 3BH8B 2EC9U 1OWRM 4DP4X 4WW1A 1AI1H 4GAGL 4UTBA 2BNRA 3PIQA 5IWLC 1OAJA 2DQTL 5JW4Q 3UAJD 5LQBL 4RGOH 2D0GA 3GMMA 1XCQB 5F9DC 3QNXA 2Z4QB 3L5IA 4PS4L 2DQ6A 4XMPL 1QQDA 3U6RA 3KNBB 1KBBA 3T3PB 5EN2A 1QD0A 4WHTB 2A83A 2DYRB 2VDRL 1UZ6F 4LMQI 4QKTA 1OAKH 3F7PC 2WBJC 3TS8A 4P46B 4GO6B 5HHVL 4X6DB 1I1AA 1XEDA 5IFHL 2X70B 3WS6A 1HHIB 3EZJB 1PDKA 2ZKXA 4OCXL 3ZL4L 3LKRB 1WBYB 5K9JL 1KOAA 4GKLA 5T5NF 3IYLW 1TF4A 3QG7H 4FQHB 2E8YA 2YMOA 4M4PA 2MEJB 2TAAA 3QHZH 2JSFA 4CSPA 2X88A 4YHLL 2AQ1A 2M1KA 1TUPA 4GNKB 3IRCA 4DETA 1EERB 3UAJC 5HHME 4UANA 5KN5A 3QJZA 3HFFA 4NCC2 2GI0A 1NUNB 2VLRB 3MUGB 2F8VA 1JDDA 4PJ8B 4XBMA 2Z31B 5SWQB 4G6JH 1NMCB 2JIXA 3SGJA 2VDKB 3SDYH 1ZANL 3NQKA 2R2CA 4WFHD 3KLQA 2VLJE 4B6ZA 4WV1C 3QJOA 1LJMA 3OJVC 1EDQA 4LAJH 2ZWZA 1DN2A 3ECBA 2CU9A 3K6DA 3MCYA 1JI1A 4D9LL 3BC9A 4F8QA 3RWJA 5HVHC 3LCYA 1DVXA 4ADJA 5D7SL 4OJCA 4TTGA 1MCNA 4HD5A 5FYKH 4F57L 4MNQD 1IILE 3PGCA 4R7DA 32C2A 4DIXA 2XZAL 3GSNB 3VI4A 4Y5YB 4EBQL 3QAZC 2PYEE 4MA1B 1RZIA 5FYKD 2JJVA 4FABH 5B39G 1EGJH 2QKIA 3ABZA 4WSKA 3U46B 4PJ5D 1FCGA 1UZ8A 3IRZA 5DS8A 2W0LA 5ETUA 2X1QA 3BSHA 4PWFA 4DKTA 2XBDA 5AL0A 1IFRA 1WE5A 2D31A 1KCBA 4ZFZB 4OFVA 4XCNB 1XIWB 1N8ZB 1HWHB 1JD9A 1D7BA 1ASOA 3NPSB 4K5OA 5B8CA 3FBQA 3S48A 1BVOA 3LEXB 3QR0A 3BT2L 3GIVA 1MCBA 1Q72L 1T2QL 2DY2A 2VE6B 3GJFK 3ZYOA 3WTSA 4KDTA 2I24N 3L4TA 4G7QB 2GITA 4QRPD 1KELL 3ZYJA 5BS0D 2UZYB 3HNSH 6FABL 5K33A 4Z23A 2N7SA 4WO4B 5E8OB 3UG3A 5EEVA 2FBRA 5GS1A 4HQQH 4OF7A 1FN4A 5IG7A 2AJYL 3NCFB 4LE8A 5F7EH 5JOFB 1BQLH 2JB6A 4I77L 4MLSA 4WEEA 5DSCA 2IWGA 4ONOA 1U91A 1SMDA 3QDGE 3UROR 3VFPB 4NT6A 5MEOA 3VW3L 3MZTA 1XAUA 4FKKA 1G9EA 2IAAC 2PO6B 4C83A 4CADA 4GS7B 2ICCA 3FQNB 4PWHA 3T08A 4M5SA 1C9SA 1G87A 2ZXEB 3MV9A 1EEQA 3M1OA 1JYWA 2YRLA 3LEVL 1PG7L 1RUML 5D2NC 1J05B 4IBVA 5CILL 2C1OB 1OP5K 2Y7MA 2X4RA 3HZVA 4QHNB 2F6AA 1TTCA 5LCVL 4QRTA 1EHNA 1XTLA 4OIAA 1M6OA 4JK0D 2BSSB 2XNAA 3F7VA 1P2CA 1JXDA 3LS5L 2AK4D 2ED7A 1CLYL 2VLJA 3ERXA 3V4PL 4A2FA 1T4WA 3WIHA 4JO2H 3SE9H 1S7QB 3GTNA 4K7PH 2V2WA 3E2HC 2YRPA 5KSVA 3MLZL 3OMNB 1XX9C 1AO7B 4M6OL 4P5MA 2JWYA 5CIPH 4TSCL 1G9ML 2BP3A 1XH2A 3V0FA 3RVXC 3U48A 1N64H 5EC1A 3RY6C 4W9CC 3H9YA 3QJRB 3HZKA 4X8XA 5HY9A 1KB3A 1L4IA 3QHFL 4L9LA 1JNNL 2PYEA 1AP2A 2JKWA 1UD5A 4M61B 1TENA 2FO4A 5CS7A 3LNEA 2NLJB 4PGCB 3WHE1 2WP3O 4HDIB 3B2PA 5DC0A 3KEHA 3BH9B 1YEIH 5H35A 4N6RA 4IRJA 1EJFA 3K5RA 2Z7YA 4DQAA 1TEGA 2DBLH 3AQXA 4KC3B 3UBXB 1MRFL 1IQWH 1J12A 2TRHA 5KVFE 3D1MC 5FF6A 1HESA 4G5ZH 4APQD 1ZLSL 5IB5B 4G6AD 4YHNA 5KUMA 1I9JH 4KV5E 1DLHB 3UTSB 1RK7A 2Z93A 3NIGF 2GC4C 1TQCC 3FAXA 4GBXB 5AYTA 4JVWA 1F1DA 2C26A 3C8KA 3O9WA 1YN6B 3OMIB 4PSRA 2FX8H 5KW9L 4L8DA 3QSKB 4NXKA 1T7ZA 4KQ3L 3TIEB 5KOVC 2A2QT 4OZGB 2Q86A 3KEDA 1KJVA 4RVBA 1A65A 3I2CL 4I9WE 4XX1E 2FX7L 4AMXA 1RUQH 3NFPA 3AJ7A 2JELH 2JQAA 3B2UD 3D08A 1PY4A 3DTUB 4HAFA 2FHBA 4JZJC 4W6YB 5AW9B 2WANA 3ZUNC 2WGXA 3FT9A 2IDTA 3L5JA 4N2LA 1W0VB 2J1KA 1AHMA 3FCUB 4XO5A 2ZWNA 4APQC 4YXHH 2NR6A 1JGEB 4ZYKA 4B9ZA 1G5AA 4G6AC 3ARYA 2EUVA 1OL0A 2P5EA 3FRPA 1KXVC 3P0YL 5IQ7H 1M7DB 3CXHJ 4PLJD 3E8VA 3QDMA 4FCAA 3IKCB 5LWYL 4X5PA 1V8HA 2G5RA 2XQYA 3HRZA 2X6UA 4WQOA 3FPYA 3C6LD 5BCAA 2YA1A 1CDGA 2FQEA 4OLUH 1A6TA 4G9FE 1IGTB 3H1ZA 3CHXA 3SJVE 2CO1A 4KVNH 1W72L 4W9JC 5IR1A 4U6YA 3LDBB 3UTQA 3OG4B 1Z9MA 2Q3ZA 3M86A 3KLDA 4NO3B 3ZZ1A 5FFGA 4N8VA 1ADQH 1FZJA 4PLKD 4YDVA 3B2UC 5IMOB 2ATAA 1IX2A 5EZJB 3DX2A 1KIQA 1KLFB 2GIMA 1IQDB 1ND0A 1VF5C 4YHPA 1FL3A 4DAGL 5E9AA 4KZEL 2Y5TA 1ULVA 1OW0C 4TLSA 3K71B 1TQSA 4MDJB 4X4KA 3ME0A 1P4BH 4F8OA 1DVUA 3U2JA 2BCKA 3DK0A 1NL0H 1CE1L 2GEEA 3NZHL 4K9EL 3RNKB 2J6EH 4CN1A 4U05A 4PS8A 5JHDA 4X6DE 4NQVB 3Q8CA 4PRNA 4PLJC 3WEXB 1CK0L 4ZMNA 1IC7H 5JOEA 5E51A 1JS4A 2YN5A 2VJXA 3C6LC 3DVGB 2C1PA 1IGML 3QDAA 3VH8A 1T0MB 2OK0L 4TSAL 1E3FA 4QT5A 3JV0A 2CO6A 2I5YL 3MN8A 4WI3A 3GJFH 4MJ5A 5CLYA 2YZ8A 1VKXB 2QVMA 4X7SH 4PLKC 2EECA 3UBFA 2YSSB 4J3WA 3V5DB 4ZFFA 2MQ0A 5E95B 1IGYB 1YY8A 2X3CA 2YAMA 3D3VD 1MCLA 2VLRE 3LSOA 2R83A 1EHLL 1H6EA 1D7CA 4OJDH 1ONQB 3FRPG 1AQ8A 1OARL 2CK2A 3F84A 3RIAK 2FYYB 3OGCB 3ETTA 5JIPA 3MKGA 4LLYA 2VUKA 1JGLH 4JFYA 5DK0B 2A77H 1T1YB 3EH4B 2E7CA 4KZDL 4XNYH 1X6NA 1CMOA 1AZBA 2ZYSA 3CDYA 1ECYA 5F9OL 5I2IA 2VRKA 2QHRH 1WCQA 1CG9A 5BMFH 1DDHB 4PGBB 4UQ2A 5DJ8A 5CFHA 2NTFA 4U0QB 4PGZA 1CE6A 3DSNA 2IAMA 2AQSA 2ZKHH 4M4RA 5DI8B 1DFBL 3WJMA 3TBVA 4WWKC 5HHQA 5KJ7E 3ZR5A 2AMUA 2BRRH 4P5TB 1ACXA 4X99A 2OSLB 4CAGA 4OUUA 3PAZA 4OCYL 2VR5A 4AEIH 4OSUL 4S1SH 5DVOA 4BHUA 2PABA 3BH8A 2N3JA 1FNSH 1RZ7H 4XPGH 2HPTA 1VZGA 1NIBA 2AKRB 3CZFA 3K72A 4AT6A 2VR4A 2CQVA 2R2BB 4JFHD 4WDIB 3L3OB 3D87B 3ISWA 4NRYB 2OW6A 4YHYB 2WOYA 3IMUA 2Z4QA 4BK5A 2QQNL 4LQ1A 1LQSR 1CU4H 3DGCR 1ID5I 4J7RA 4MYPA 5KBDA 1HU8A 1O5PA 2X4NB 3KNBA 5HGAA 4LSTL 2GI7A 2OTPA 3VG0L 1NAKH 4WHTA 3FU5A 4Q9RL 3PNWB 5JW5A 2FBJH 3IEAA 5GGTA 3APMA 4P46A 4WWID 1L9QA 4MDRA 3LKOA 1OAZH 1HHIA 3BIBX 1DVFD 3LKRA 4GKSA 4XMZA 5B4MD 1WBYA 3MROB 4XX1G 3LZQA 5J57B 2AI0L 3S3JA 1FL6A 3BPOC 1TZOA 3WFDH 3ZGHA 5I8CB 1KLUA 3D2UB 3T1FB 2DB8A 1NFKA 5KTEL 5I1HH 4G7SB 4HZ1A 4M7LL 2XC8A 3MYJB 1OSEA 2X12A 1S9XB 1CGVA 3IDMB 3S5YA 3IMWA 3MUGA 2RMNA 5DRWB 4PJ8A 3ZKND 2YJQA 2Z31A 3E0GA 5F1NB 3D39D 4LCWD 1RPUA 4I18B 5C70A 3UX9B 1T3FA 2BVEA 4LEBA 5DS1A 4HS8L 4A7TA 4AV0A 4Q8BA 1EDYA 4JCLA 1BQUA 5FYLD 4ENZA 3MFGB 1PS3A 1DVFC 1RUKH 4HMDA 1S9WB 5B4MC 1AO7E 3FN0H 2VH5L 3DROA 2L8AA 3QEQD 5GHWL 1BM3H 3N1QC 3O6FD 3AMKA 3EBAA 3IJHA 3VFUB 4WFFE 4HJ0C 4E0RB 3MX0B 3THML 1OOWA 2DRUA 5AZ2L 3N1PC 1S7XB 2VISA 2YRZA 2ZJSH 4KTDH 1JZJA 4XR8C 5G4MA 2R56H 2NQCA 4YFDB 3AMLA 1OAUH 2DEYX 3ZKNC 4LSRH 9CGTA 5IP4A 3L4VA 1R75A 3OAZK 1UKTA 5EZPA 2ZF8A 1OAXL 3SO3B 4JFUA 4F7KA 3UBGA 4POUB 2AVGA 2ATPA 1YPZA 1VADA 2XOTA 1CGTA 2MCG1 3OAYH 3UTSE 1BGXH 5GISL 2H0EA 3K2UH 2BNRD 4JQVA 1NANI 2VE6A 3BZFA 2FJSA 5C2BH 4OCLC 5JZ7D 1A7NH 1O9VA 1YYML 3O6FC 2UZYA 3Q8AA 4RIRB 4IEFB 3MTRA 2QSCL 3OC5A 2NCMA 4OZGE 3GPEA 4I7ZC 4WO4A 2P48B 4JY4B 1ROWA 1ZMYA 2EDFA 2HVKA 3DX9A 2DQFB 2R69L 1WS8A 3C60A 2OMUB 2EDTA 3L3KB 4Q0XH 3VFPA 2V9TA 4K2UL 3KPLB 1I1AD 3NIGB 5C7XH 3IKKA 4J6RH 5DS2A 1SJVA 2PO6A 3KPSB 4CU7A 2R0WL 3R7QA 2VN6A 2DICA 2VXVL 2P7TB 3SE3A 3NEOA 3DX0A 4QJ4B 4JQIL 4S0SD 4WNJA 1XCTA 2EDQA 1J05A 1ZEAL 1WA0X 2QFRA 2QBWA 4G6MH 3T0DA 2HVBA 1KTCA 5JZ7C 3EO1B 1PTZA 5CP7B 2C1OA 2V8LA 3A6CL 3HFMH 3GSRB 4PTTB 3WCYA 3ZDXF 3ZHFA 4E9VA 5AYUL 4QHNA 2OMBA 5IB4A 1F18A 5DFWH 4I5BA 4DKFL 2ISDA 4AEHL 2BSSA 5FFLA 5A40E 2X6MA 5C92A 2WXNA 4UAOC 4GXUM 4ZMLA 3G9VA 4S1QL 2V9RA 4XE0A 3E9UA 2EE3A 2XWCA 4WCYL 4ZMTA 3L4YA 3WFHB 1I1AC 4WFED 3LIZL 1AO7A 5JO5B 1FO0H 4BKTC 5FM4A 1MW1A 2QSQA 3G6JF 1WIPA 3I9PA 4LO9A 3TVMB 4F20A 5FUZH 3QXWA 4JMNA 4XNXL 4BH8B 4FADA 1ZLDA 4N9GA 1CD9B 3JT2A 3U2IA 4M61A 1NDGA 4HDIA 3MV7B 4E9LA 1XXDC 3QFGA 2CCVA 4RDQG 2NW3B 1DE4B 1TTAA 2DJMA 3BH9A 5H4YA 3X1GA 4ZFOL 1HYSD 3H3PH 4XP9H 4J3OG 1NPUA 2V17H 3CX5J 5K1VA 5L6YL 3KCPB 1BZ9A 2H41A 1QSVA 3ALXA 3U30B 5J11B 3UBXA 3FXIC 3MNZB 1T6BX 3TNMB 1T1ZA 1QFPA 1OWWA 5I15H 5IB5A 2APBA 2IC2A 2AGJH 2OZ4A 3RKDD 5DU7A 1FPTH 1UZ6E 2ALAA 4ZUVB 3WTVA 1LE9B 3UTSA 2EAEA 4L9DA 3V5KB 5C9JB 3B43A 3NSJA 2QV2A 3Q6GL 4GBXA 4RX4A 3ZTEA 3PHQA 2DYPD 4WUUB 3LH2L 2IOOA 2X6BA 5C07A 3JWDH 4PQXA 5CZVH 5JIQA 4N8UA 3S3SA 4J6IA 3FU0A 3MOQA 1P7HL 4BFEA 3NQIA 3I85A 1E2VA 2JV6A 3B7SA 1WZLA 1DVQA 1WA2X 2QKIC 2NY2B 4HMCA 4XB3A 4UIKH 4C59B 1HYSC 2Q2LA 2Q8BL 4U6VH 4L3EE 3EOTH 1OF2B 3TBYB 1W0VA 3RWIB 4GRLA 3N43F 1S3RA 3APCA 4FF9A 3RKDC 1JV2B 4KXAA 4BXSV 1KYOJ 3VFRB 4NHCL 1WT5A 5K93A 4F8LA 1J86A 4X9GA 1N0XH 2R1XB 3BFQG 3II1A 4Z95H 4D9QD 5J1AB