3T5WA

2me modified human sod1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
152
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural switching of Cu,Zn-superoxide dismutases at loop VI: insights from the crystal structure of 2-mercaptoethanol-modified enzyme
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 37
structure length 152
sequence length 153
chains with identical sequence B, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3t5wA00
1E9OB 1U3NA 2WZ6A 4A7UA 1YAZA 2Z7WA 1PTZA 5KBKA 3RE0A 3CQQA 1BZOA 1SDAB 3GZOA 2AQRA 3F7KA 2ZKXA 3MNDA 2WKOA 3HFFA 1IBHA 1IB5A 1F1GA 2C9SA 2Z7YA 2WYZA 2GBVA 2R27A 1CB4A 3KH4A 2Q2LA 1SXAA 3KH3A 1SOSA 3S0PA 3KM2A 3CE1A 3PU7A 1CBJA 4OJAA 2C9VA 1OEZW 2XJKA 1Z9NA 1XSOA 2AQSA 3CQPA 2VR7A 2WKOF 2WWOA 2Z7ZA 4A7VA 2SODB 2WWNA 2Z7UA 3HOGA 3KBFA 1HL5A 1S4IA 1COBA 1EQWA 2JCWA 1RK7A 5KBMA 1JCVA 4L05A 1TO4A 4BCZA 1JK9A 3H2QA 1UXLA 5KBLA 3HW7A 2GBTA 1IBFA 3H2PA 2AEOA 2V0AA 4BCYA 1AZVA 3K91A 3GTTA 4N3UA 3LTVA 2VR8A 1OZUA 2E47A 2E46A 4OH2A 1BA9A 2AQQA 1XTMA 1OALA 2ZOWA 1SRDA 2WYTA 1SXNA 1B4TA 3GTVA 2ZKYA 2WZ5A 1IBDA 1YSOA 1OZTG 4A7SA 1N18A 1B4LA 1IBBA 1F18A 4MCMA 3ECVA 1DSWA 1E9PB 1E9PA 1JK9B 1F1DA 1YAIA 2JLPA 3GZPA 1PZSA 1N19A 2NNXA 1Q0EA 2AF2A 2APSA 1P1VA 4N3TA 3KM1A 1HL4A 3GZQA 4B3EA 1KMGA 4BD4A 2AQNA 1E9OA 2C9UA 3SODB 1PU0A 3ECWA 5CU9A 1UXMA 1SDYA 2K4WA 1Z9PA 2XJLA 3L9EA 4U4IA 4A7QA 4A7TA 1MFMA 1QUPA 1L3NA 1DO5A 3F7LA 4A7GA 3GQFA 1SXCA 4FF9A 1FUNA 2AQPA 2LU5A 3MKGA 2AQTA 1SPDA 1SXSA 1OAJA 4MCNA 3L9YA 1XTLA 1ESOA 2VR6A 3T5WA 1TO5A 1E9QB 1E9QA 3QQDB 3QQDA 1F1AA 3KBEA 1EJ8A 2WZ0A 1SXZA 2GBUA 3ECUA 2ZKWA 4A7GF 1SXBA
chains in the Genus database with same CATH superfamily
3ARGA 4KKLD 2FL5A 4HCGA 2V6HA 3EGDA 4QXGL 1VB9A 2H3KA 4AGMA 3ZIYA 4P2QD 1NFDB 3U6XA 4L3FA 2MNJB 1GPOL 1DQVA 2VM4A 5CEXA 4P23B 1JFQH 1ONQA 2B16A 5E08L 2AEIT 1MAJA 2AMGA 3P9MB 2CLVA 4MXWL 2H5UA 4ZPVA 3HAEA 3WLBB 1E3FA 3QDJA 2Z31B 4AXWB 2O6CA 2RACA 2WBWB 4K3JH 4Q9RH 2GFBA 2LHAA 2WKOF 4JRXA 3S48A 2VZOA 5GRYA 4JQIA 1A7PL 2NLJA 2OSWA 5BW7A 3LZQA 1E3XA 1NCWL 3FU8A 4HMCA 5DHVB 3TYGH 3C8KA 1UH3A 4QAMB 2CBPA 1OSZB 2CIIB 3DIVA 2YLHA 2FUQA 1OW0A 4FD0A 2F54D 2ZP8A 4PRPA 3NIFF 3V5KA 4G8AC 2G4EA 3AAZA 1O9VA 2HZHA 4Y9EA 4ZOBA 4J23A 1H6FA 3GTTA 1YEDA 4DHLA 3MRPA 3VH8A 5E0QA 4LFHG 1LK2B 1HCZA 1CWVA 4HUVB 1VFBB 1WHPA 2CXGA 3OKLB 3RGHA 4NI6A 2WC7A 3FK3A 5SX5K 3PJLA 1WBXA 1NFIA 5T1KD 3O9WC 3NJFA 3O3AA 3X3FH 2B1OA 4PBVC 5D2LA 1E4XL 2XKNA 2VERN 2ZXCA 2VL5A 1T83A 3D2TA 1QLRB 1S7TB 2GIXA 4PLKC 2UXFA 5DT1L 2V3FA 3KLHC 2J6EH 1AS6A 2PYFB 1OOAA 3U9PH 4NNPH 3LKSA 2WNKA 4KAQH 4A6YB 5JZ7D 2Y7MA 4XMPH 4EVNA 2XDHA 3L3OB 1DQJA 4OZFH 3X11B 3RIFF 3U0PA 4FZEL 3VRLF 1AYOA 5JQ6L 5AYTA 2EYTB 3SBWA 2JKSA 2B3IA 3B2UC 4KKQA 4N8CH 4ERSH 3C6SB 4HV8B 4XC1L 1VCAA 3II3A 4KNTA 4PRNB 4GSQA 4TQ8A 4JUSA 2GSGB 2DQCH 4ONFH 1FVDB 2OMYA 3WS3A 5GS1B 4NQCB 3P2TA 5I1IH 5T1JA 4QO1A 1UYWL 1HNFA 2KUTA 1ACYH 2ZX8A 1CL7H 1VDGA 4S1SH 3TX4A 4AL8L 3Q5TA 1SYVB 1UJ3C 2Y07H 3F00A 5INDB 5HSFA 3KR3H 5TK4A 3VWKB 2O6EA 1WITA 1GZQA 2J2ZB 3JWDL 2O5YH 3QXDA 2EEDA 4F58H 4ZOAA 1EAJA 2G60H 4KKCD 4G3YL 3B9EA 2AI0L 1FFRA 1L6ZA 4QRAA 1TPXC 4FRWA 2OM5A 4NXKA 3II2A 3HZ3A 3X2QB 1RURL 5B7EA 4JFSA 2CJTA 2FEDD 2DBLH 2EC9U 3MRRB 2VDLB 5HXMA 4QXTA 1MCFA 2HX7A 3O6LL 1SJXA 3MV8B 3OMNB 3RKPA 5CJXC 2VDNL 4RMRA 1PG7L 3CSYA 4YUEL 4AH2B 3PWUA 1J11A 5JO5B 5DJXB 1RU9L 3OKYA 5CLYA 1AR1B 4BFOA 2WQ8A 5FB8B 3U0TA 5JUEH 4QI3A 2O1AA 3GGWA 3MRJA 3EBGA 1MNUL 1AP2B 2JTDA 4FKKA 4TTGA 3AACA 5DZAA 4AEHH 4LLQB 9PCYA 2X87A 1WO2A 3L5HA 2VW6A 5HY9A 4AYID 2VZTA 1WLHA 2P48B 4MS8C 3ZZQA 5FGBC 3VFPA 4GSDH 5JYLA 1M71A 1JK9A 2W38A 3VG9B 1E67A 2VSKB 5F1NA 4GG8B 4R90L 2FAUA 5F6IC 2P3YA 2W9DH 4YSRA 4WENB 1QSFE 1WIPA 3IU4L 4S1QL 5BRZE 1E5UI 2AEOA 2R23B 1N26A 3I75A 5DUMH 2OMWA 5D2NB 3WNKA 2XNAA 3RWCB 3V4UH 3FCSA 2ZCHL 4H8PA 3NT0A 5KEZA 3CC5B 4TF4A 2E9WA 3ARQA 1BBJA 2DJSA 2ED6A 4IKLA 4E5XG 4CVWA 3GSRA 2WUCH 3EFFB 1KTLA 1YMME 2N3JA 5F89B 4R7LA 1KZQA 4W6WB 3V6ZA 4ODHL 4DTGH 2DD8L 4Y2DD 4KNSA 2GUOB 4JY6A 2G5BA 3BQUB 2GJ6A 3WJJC 4MYWB 3KYKH 4UT9H 2YEZB 4G5AA 4UQEA 1AQDB 5HGAA 5J9PB 3EUUA 1I9RL 4KU1A 4LCYA 3QJZA 4PJ7A 4DVRH 2VLLB 1EAOA 4DP7X 2IXQA 3U36A 1PSKH 3DDFA 4HH9B 2P8MB 1CD1A 3L9EA 2JMRA 3D12B 3RL2A 1UB5B 4XWGL 4PJXE 1I53A 3BRDA 1FF5A 1C9SA 3VGAB 2DAVA 1IAIM 3A4AA 2XFXA 3GSWB 4EUPB 1U8JB 1LEGA 4AZUA 4Z7VE 1BXAA 1QFWI 5K1JA 4RWYL 2BS9A 3NDZE 5EBLA 2WWKT 2JWYA 4JM2B 2DJ4A 5IW6B 4JZJC 4HP5A 4EZMA 5I74C 2G2NA 3A21A 4OSUL 4KHXL 2ZX7A 3ES6B 4G8FB 5EOQL 3T2LA 3KDPB 2YUZA 1JGEB 1UT2A 1U8PB 5HYQB 3H3PL 4KXZI 1ADQH 2QGDA 2YQ3A 3BISA 4UM9D 1I85C 5AZ2L 2H26B 3NPSB 4UAHA 5AW0B 2OMBA 4S1DC 5I5IA 5HHPA 2YZ8A 1AH1A 2FQGA 1IC7L 1T4WA 2ZOOA 1FGVL 3NZ8A 4I0PA 1TETL 4JG0L 4YXHL 1TZ8A 2PETA 4JFED 1IM9B 1XF5B 2ZNWA 4APQA 1R5VB 2WGXA 4BGDA 1NH6A 5D4QA 4NO5B 3QWOB 1I8KA 4LIQE 5KZCB 2F8VA 4AV0A 1AHWB 4ZX3A 4R2GC 5I8KL 3KJ4C 3ARFA 3TN0B 4EDWH 4XCYB 2IGFH 3VG0H 1WISA 1AZBA 4LCWA 3MJ6A 4LCIH 5HYEA 3AG1B 4N8VG 3ELQA 2X3BA 3FQWA 3V4VH 4C4KT 1QW9A 4RMWA 3C09C 3KLLA 4O02A 5L0QB 4PB0H 4F92B 2VO8A 3H1ZA 2PCFA 3MJWA 3QULA 4Y4KC 3BWUC 4KHTL 3U4AA 3MBWB 4Y4HD 3BPOC 3MOQA 3B83A 3H3BC 3RFZB 1FCCA 1FIGH 1YEKL 1VFAB 1OAXL 3P4OB 1BD2A 4LSRL 4PTUA 2EVFA 3MYJB 2DI7A 4X99B 4XCFL 1Z9SB 4FULA 5J3HD 2VCOA 3CXHK 5ES4B 3D9AH 4ELKB 3NCEB 1Z7JA 3UP6A 5JXAL 1Y0LB 3TT1H 1HSAA 4JPIB 5C9KA 1FBIH 2G75A 4MJ5A 1I8LA 4PJEB 4JFFB 4YLBA 3T2NH 4OV5B 1T6WA 2CIKA 1Z5YD 5L88L 4QWWC 1F6LL 5IIEB 3Q01A 4KJQC 4LU5H 4PY7A 3ZT7A 2XT1B 5JPNC 3VM5A 2YLKA 2XWJB 2B5IC 4PJFA 3RHWF 1J1PL 3APNA 1WZKA 4BD4A 1PDKA 2BY2A 4E5XB 4JO4H 3SODB 3RX9A 4UTAH 4CVZB 1V7ML 3FUHA 1WSST 1WPCA 2GSIB 4CJ0A 4EBQL 1N7MH 2GI7A 4BFGA 1F45A 4M48L 5F3FA 5CD3B 2C34A 4Q6IB 2WBJD 4XBMA 5TFSH 2ESVE 2YD3A 4J2QA 1RIUH 2OCJA 4P4KC 1AQKL 3WUWA 5K59F 5IHHA 5FUOL 5FIEA 3AY2A 1GJIA 1X5JA 2WO2B 4NQEB 1SGKA 4RMBA 2X6MA 1FFNB 1E8ZA 3V4PA 3DUSB 1U92B 4G8GE 4Z8FL 4JN1H 3VFWA 3ZRFC 1UCTA 1MKFA 5ANHA 5HI4D 2CLZA 4DKFL 3DX3A 2YPLD 4RMSA 3L95B 2HJLB 1AG6A 3OHXA 3OWRA 3BT2H 3EH4B 5CF3A 5LNDA 2TSAA 5MP6L 5LQBL 5HPMA 3N85L 5A7BA 1O7SA 1R9FA 2IAAC 1SJMA 8FABB 4LQFL 1N5AB 3V9EA 5F6HI 2YC1B 3VW3L 5EOTB 1KGCE 1RZGB 1XIWC 4I4WB 1UADC 1JN6B 5IB2B 4NT6A 4LNVA 1UWXK 5B3JF 4X6FA 1A47A 1L9RA 2JKLA 4XNQA 3NIFE 2EIZA 1XSOA 1LYQA 2V2TB 4JRLA 4POYA 3K2UH 4F7MA 4FNTA 4QTIL 3T0DA 1FZJA 5EUOA 1I3RB 2YOCA 1D7DA 5DRXA 1JVOA 1NAMH 4GSXA 1DN0B 5FW7A 4K9EL 4P2OD 2EH7L 1NDTA 3MQIA 2A5UA 5HDBB 4GAFB 3N42F 1X5AA 1O9ZA 5DR5L 4UT7L 3GHBH 4YS4A 3BWUF 1INQA 2W94A 4PGBB 1M6OB 2K3TA 2OMTA 4JFOA 3MRDA 4OF0A 3D0VB 3IJHA 3ZJAA 3U4KA 1IZJA 1WG3A 5DWUH 1NSNH 3Q1SH 2F8XC 5IVNA 2FYYB 5DLLA 4JLRB 4N8VB 4IU3B 1KBKA 3SQOH 4E41B 3KPTA 3KPRA 4P3CL 1CU4L 4UQIM 3VRLE 4JANA 4PPTA 5FUZH 4EZKA 3FONA 4M9PA 2XTSA 1UOVA 3UTTA 5DYOA 4IIZA 4AQEB 2DMCA 2EDOA 1CG9A 2DIBA 2IMNA 4PGCA 1X5HA 2NOYA 3CSFA 3DXAA 3MRGB 1N10A 1OVZA 4TUJA 3TVMD 1XXFC 2DQGL 3HC2A 1GYUA 4F33B 2P46B 5DDHB 5FCSH 4HIEB 4FNQA 1PU0A 2KERA 3G5ZA 1ZCRA 1EHXA 2ZICA 3UC0L 1VZHA 2BVPB 1OGTB 4LSVH 3RDTB 4EN3D 5SX5H 3L54A 4F24A 1JF5A 3VFUA 3MBXL 2PN5A 4PJDB 3MBED 1GCYA 1KCKA 1JDDA 2BSRB 4ISVB 2EVHA 1R19A 4KKLC 4NZ8A 1NCCH 2WMPB 3DV6A 2J8OA 2R0KH 3C2AL 1ZLWH 3V7MA 4NC2B 4GRWH 1FPTH 3WDIA 4ANXA 3I6SA 1CIDA 4MRBA 3WMPA 1P53A 4M43H 4HXBL 3BE1H 4X8JA 2P7TA 2D4DA 4K8RD 5JPMC 2XBTA 3E1ZA 2VXQL 4HBCL 5MEPA 2XA8L 2X3AA 2D73A 4QIRA 1YN7B 3FO1B 4QJ3B 1ASQA 4GEIA 1BZQK 2ZAGA 4RDQF 1CYWA 4N0RA 1CPUA 1AIZA 4X6CE 5T3ZL 4A6YL 1YEJH 1KDJA 2W59A 3V0DA 1QUNB 4OZFG 3EXJA 3BPNB 5E5MB 4XT1C 2EAEA 4IK7A 4OCWH 2OS7A 3RPIB 1E8WA 1UM6L 4XMWA 5IQNA 1UKTA 1QBMH 1KPRB 3ZKMD 1RUAL 1ECYA 1GS7A 1AO7B 2FH6A 4GQ9L 3S2AA 5KJRL 1CGUA 1B9KA 1K3ZA 4JKPH 4DO6A 4Y5YA 1XR8B 3HVDA 4N3UA 1ZGLA 3UACA 1JVLA 3RG1C 1QA9A 1T1YA 2C8NA 2QQNL 3GLZA 3PWLA 4YDKH 4NQXB 4ZFFA 3BDYH 1OM3H 4DEPB 1NIFA 5TE4H 1GKEA 3O3BA 4Z3FA 5E8DH 3B7UX 3V55A 3WNLA 1T6VN 2E9JA 1EXUA 4MTMA 5JZ7C 2VDLL 5GGTL 3VAEA 3UYRL 4GBXD 4K71B 5LXGH 4DP4X 4MCMA 4ZAKD 1P6AB 1INEL 3ESUF 4GRMA 4IU2B 5F9OH 3V8CA 3EG9A 3E2HB 5D70H 4W9KC 1YY9D 4MNQD 4EI5D 1B6UA 4XR8C 4KTDH 4PU2A 3S97C 1TQCC 3NSFA 3GSNL 3UO1H 1C5DA 3SPVA 1JI1A 5DRZB 4X5PA 1Z5HA 1P2CB 4WFHE 1NIDA 1AIFA 4GUPA 5F7AA 2R0WL 2FR4A 3EAKA 5F7EL 3KEHA 2VJ0A 4I1NB 2AJSL 4Z0BL 2R2CA 2L4OA 3SY0A 3P3TA 4Y1AB 3KLAB 5I1DA 4KKCC 1IC0A 2KPNA 4P8QA 3ILPB 3R06B 3GSVA 3WN6A 4NDMA 3GI9H 3LNFA 2IWEA 2W81C 4MJIE 4RZCB 5L2JA 1HOCB 2MQCA 2FEDC 2R56L 3T5WA 1DJSA 2CJUH 1UACL 4X5RA 1S7WA 2HVKA 4XZUB 4HC1L 3SIKA 4X6DF 3FO0L 4GKSA 5A6LA 3NFNB 4OGYH 3O2VH 4FFVD 3T0EB 2AZAA 3UEZA 4CN1A 5EB9A 4I2XE 2R4RH 5EZPA 2ZOLA 2XSKA 2XZZA 2VKWA 3FRPG 3OLGA 3NCCB 1XGTB 4LHUB 3TONA 5TD4A 1X6NA 2IGLA 2K1MA 3OHMB 2H2PD 5IQMA 2LTQB 4X5WB 1REIA 4V1DB 3MNZA 3A23A 1CB4A 1E4XI 5IOPB 4PJCB 4X5XA 1NCAL 3MRNA 4WO4A 1AACA 4AUJA 3OAWA 4FFWD 2A74A 3TGXA 3MFFA 5FA3A 4H13C 3EUDA 3IDXH 3L5WB 4TNWK 3HMWH 4EE2A 4EIZC 1V10A 3FTWA 1NDGA 2WVSA 5FYJH 1RMFL 1JNNL 4R26H 3S36X 3NUKA 3HS8A 3P9LA 2P5EB 1DSFH 4NQSB 2J8UB 4XVUD 4D0BA 4Z7NF 4U0QB 3TO2B 2CMRH 2O4EA 2IWGA 3B9AA 1NC2B 2JELH 3MGTA 4RISH 1TSHA 1RD6A 4UOW1 4YDZA 3MJ7B 4Q2ZA 2ITCB 1PW3A 1QSFA 1DQLL 2XFGB 1L5GB 1IAIH 5BRZA 3TM6A 5T33L 3EOBA 4L48A 5F72S 4M29A 2XV3A 4I0KA 1DQDL 1XZ0A 4Q4EA 1TLKA 1GAFH 4OZFB 2ZWZA 3JT0A 2JI3A 4Y2DC 3WDHA 4LL1A 4JW3A 4YFLI 3ELAT 2YAFA 4PG2C 3BMWA 2ZOKB 1NOFA 4PP1D 4ONHA 1QKZH 2DJUA 3P1VA 1AGBB 2Z4QA 2WPGA 3GKZA 1DQML 5JHLH 4UQDA 1I1AB 2E27L 4BWWA 2MOVA 1TU2B 3BUTA 3FN9A 4FXGA 4K4KA 1MCNA 4LXFA 1BQSA 1JNHB 1H8LA 1QPXA 2DB8A 2P8PB 2XOTA 3C75A 3ZSSA 2F53B 1S7UA 5DJ0A 1AY1L 4JHWH 4UOJA 1HL4A 5K59E 4CW1B 4MDJB 3U1PA 1ZIAA 2ZP0T 2DH3A 1CURA 1LK3H 4UDUA 3VXMB 4BGLA 3BAYA 3QG7L 4L4VD 4DP8X 1KB9J 1CLZH 3MJ8B 3WXWL 3CTTA 3FT9A 3KG5A 2ZXGA 1KCWA 2WLKA 4A7GA 4RAUA 4YDLB 1YEIH 5C0AB 1MH5A 2BP0B 2BNQD 4G6JL 4U1JB 2EDNA 2YKLL 5C09E 1CLVA 4Z7VA 4PJBB 3M1BB 3C8HA 3T65A 3EJTA 4YSTA 3FJTA 1U91A 4LSDA 2NYYD 1IGJB 3F65A 3FBQA 4A38A 4EIUA 2AV1B 3ALXA 1CFMA 3K3QA 2GK0B 3QPXH 4NQDD 4G6ML 5JA9A 5ICUA 3QIWA 4BSWA 1T7YA 3HS0C 4QY8A 1UWGH 2QKIB 2MNUA 3VXSB 1WQVT 3MR9A 5B3JE 1IBGL 4TUKH 1CZ8L 5ALBH 4IJ3B 3IJ9A 2DWDA 4PCTA 1BVKB 3D85B 2IV8A 4P9MH 4WTXA 3SN6N 5B1KA 4X80L 2V33A 1CT8A 2OSLA 2AANA 3FW6A 1MRDL 4GH7B 5D7LE 4KZEH 2WLLA 1GHFH 4XX5A 1NA8A 3B7YA 1HAUA 1WVZA 4M5TA 3RWGB 3UTSA 5I23A 1IMHC 1UA7A 2J56A 4U1NB 1HXKA 1THAA 4HDIA 2XV6B 3NYKA 3FTGA 2PP8A 1K5NA 3ARDA 3CCHA 3KDMA 5LGHH 3SCMD 2ID5A 4NS0A 1A64A 3FRPB 1F4XL 4S10A 3C12A 1DBBH 1RQ5A 1SVBA 4WK0B 4Y4HC 4PS3A 2JJSA 1NCHA 1A6VH 1SYSB 4MD5A 1T1WA 1AGEA 4HIJB 4PJ8D 1AGCA 4L05A 1UH4A 2HTKD 4NJAL 2BMKA 1XAUA 1C1EH 3GB7B 5D1QD 1EANA 3BZ4B 3M46A 2R1WA 3FPYA 5AVQB 1LE5B 5AKTA 5J3HC 1ZPLA 2DQUH 3I9AA 2Q86B 3AREA 1FQ9C 4I48A 3PHOB 5C0EA 3TA3D 1DDHA 4OH2A 4AT6B 3DRQA 5TQ0L 5DRWA 2V7HA 2MFNA 3MMEA 1RZJL 1S7QB 1TQWA 3K2MC 2PW1B 3Q2VA 3BKYH 4W9LC 3UPRB 4AQOA 3PWJA 1S7RA 3ZHKA 4PWKA 4Y0GA 1MI5B 1D9KB 4AE0A 2RCSH 3LSOB 5BJTB 1DSWA 4PCYA 1F1DA 4JFXB 4YR6A 3CHPA 2MIZA 1SFHA 4AC4A 5FO2A 4OVUA 5HGBB 4ALAC 4PMEA 1A6ZA 4PV9B 5BO1H 4UB0L 5D1ZA 4D0DB 3RZWA 1IE5A 5H37H 1XCTA 2W0KA 1MJUH 2HVBA 3NN8B 3BRGC 2F61A 2FJUB 2WBJC 2F68X 4LDOB 1C12A 4GOSA 5ADOH 3LV3A 3UJTL 4A67A 4UNTA 1TR7A 4QHLA 3DJRA 3QJOA 2Z4TA 4PJGE 1LL1A 4GQZA 1D5IH 5I75C 4FP8H 3I02A 4XP6H 3N43F 3QR0A 4Q9QH 5DLML 5INCB 2J72A 4FTDA 3X1GA 2ESVA 5AKSA 1NOLA 2NY0B 3L9YA 1AJ7H 5DC4B 4Z77A 4I3GA 1NGWB 1RJYA 4PWIA 4AW7A 5C8JA 3KVDD 3RY5A 2FSEA 1A4AA 4L3EE 2YUXA 2GB2A 5JHBA 1QVOA 2X12A 2YPVA 5T5NG 3L9RA 2XXGA 4BA8A 5KBNC 3S88H 3OX8B 3KYMB 4C55A 3G6DH 1UXSB 2Z7WA 1TITA 1S9WA 3V4VB 4CA4A 1YEFH 1G9HA 3G9VA 4NYLB 5FYLE 1L9MA 2WKOA 1KBBA 5ANMB 5A16A 4GXUM 3I6LD 5AOKA 4R8WL 2EE3A 1IFGA 3CZFB 4JQXC 1Q8MA 1TYRA 2WXIA 4P2OC 3NZUA 2JQMA 2RD0A 2BJML 4X9IA 1CBJA 1QABA 2EILB 1AFVL 2NNRA 4DN4H 3MREB 3UDWC 1JWMB 4HCRH 4QUOA 5FYJE 3WSQH 4DGVH 5J1AB 5JHDB 5L4MA 1K5WA 1R75A 4FTVE 1F6FB 1E27B 3GF8A 1PZCA 3CDZA 3TBVB 4BZ2L 2YK1H 3L2NA 3TNMB 1XEUA 2WQVA 1T5XA 4HKXB 4M6OL 2P26A 1VLXA 3QDMD 1WS7A 3D4ZA 4PJAB 4HJJH 1IAKA 1TTBA 1KGIA 1AANA 2JIXD 4L3CA 3WGUB 4CDGC 4TPRL 3U2SA 3SBQA 5ESAA 4L8SA 1G4RA 3G08B 4Z78A 1EJFA 4H20H 5D96C 4OGQC 2OJEB 4YPGB 5H94B 4YK4B 32C2A 4UZSA 3TVMC 1PZ3A 4K23L 5ACZA 5L9DL 5E6IB 4PV1C 4Y16B 3CX5K 1KLGA 4XX1G 4LLYA 5L8JB 5C0CD 3ZE0B 3U7WL 4ZMNA 1JGVH 2Q76A 5F9JA 1HZHL 3QRGH 5HVWA 2BW4A 3FCTB 2Y06H 2AJVL 3QG6A 4XVJH 5LBSL 4EIBA 4U6HA 2QPFA 2X2JA 4EN3C 3K2KA 5IMMA 5E56A 1VFMA 1IL1A 1KG0B 4GSRA 3MBEC 3FULA 4WU5B 1OP5K 4AGQA 1J5HA 3ARVA 1O7VA 1ASPA 1FZOB 2HG0A 3K6DA 4FI7A 3HB3D 5L8KB 4N2EA 2J1KA 2XU9A 3NPZB 5B8CB 1IVTA 1UFGA 2VYRE 2RBLA 1QI3A 4X6DE 1N8ZA 3QUKB 1EEZB 3QQ9D 3RL1A 3IJ7A 2EDQA 5DJ8A 2NY6B 2UXTA 5CBEB 1OSPL 1K3IA 4UINH 3FN3A 4FL4B 4K8RC 1Z0MA 5B39G 5KVGE 3EJRA 1F2XK 2YJQA 4L9LB 2HKFL 4DPCX 1DUZB 3HA0A 4TRPH 2X4TA 3B5HA 5L8LB 2EDFA 3JV0A 4OY9A 3P3RA 1MFDH 5JR1H 2UYLB 4UZGA 1P5UB 3IE4A 5KYWB 5M7QA 3RX5A 1O6TA 5AW4B 4M5YL 1YAZA 3WNNA 1NAMB 4PHZA 4ONGL 4XMKL 2GTWB 1CXEA 3OKNA 4NKQB 4P5MA 3S36L 3NJJA 4PV8B 3IXTA 2QADB 4Z7NE 4Y9CA 1F90L 5FCUL 1JYNA 5MEOB 3ZKMC 1G4MA 2K6ZA 1DBJL 1UM4L 4IGBD 1N6VA 1NBVH 3LNGA 3M17B 4OM1H 1MUJA 5E8OA 4TLSA 1MLBA 1JXDA 5ISZB 1MVUB 2R4SL 1K8DB 1EUUA 3O6ML 2D3LA 4XN8A 4HX1B 4GAYA 5C08B 2Z7UA 4NRZB 2E74C 3OR7A 3ZTJH 3L4TA 4KKBD 1I8IA 2CBOA 4LCUA 4PWFA 2IOMA 3MRHA 3HR6A 2UXVA 2Q9OA 4I7ZC 1RERA 1FG2B 1ZOXA 5IWLA 3WO4B 1AS8A 1BZEA 5GRUL 2MEJB 1X7TA 4XVTL 1FVCB 4FXKC 4GBXC 5GS0C 4ZAKC 1NCBL 4JCLA 1I8MB 4O9HH 2DYRB 4WWNA 2OTWB 3AT9A 4XCNB 4ZTOL 3VXNA 4P5TC 2PO6B 4ALAH 4AIEA 2VISA 1YY9C 4EI5C 1U8HB 2BSEA 4UQ2A 2FWSA 3TYGL 3CFMA 2W60B 4L1TA 3DTXA 5J56B 4ODSH 3UTZA 2Y3AA 5ACMA 3TU6A 4XHQA 2WXNA 3QNXB 4S0HA 4PMFA 3Q06A 1HI6B 3ARWA 4GRWB 3BN9D 1HH6B 1JVKA 3MUY1 1PBYA 3MRKB 4PIRF 3IKCB 1OOWA 5HHQA 1WZAA 1H5BA 2DKSA 2UZYA 1UJ3A 4KTEL 2AGJH 5F1IB 3VQLA 1ETJA 1TUPA 4D0CB 2A9NL 5A2JH 1TTRA 2WVUA 3CZNA 2OL3A 2MCPH 2Z8RA 2ZWYA 1GKOA 3J8F7 3RIFK 3IBEA 5ACLA 3FB6A 2F7QA 4KOCA 3QT2A 1FYHB 4N5ED 2J6EL 4FFVC 1RIVL 4Y19B 2ZUWA 5DVMA 3U9PL 1MCRA 4NNPL 4KAQL 3UOAB 4FJZA 1DLHB 3C08H 4MJIA 3ZYZA 2HWZH 1Q9WA 1UTDA 3KYNA 1ZXQA 2B39A 3CUPA 4XPBH 1CXKA 4W4NA 1IGCL 3CFCL 3AXLA 2VT0A 4K94C 5KYXB 5HVGB 5CJXA 1J8HB 1XAKA 1DZ0A 4WWID 4I9XA 4QRQB 1MQ8A 2VW4A 1YRKA 2A6KA 5I2IB 1V27A 3FMGH 4I2XA 3W56A 3PXJA 4KRPB 3CQQA 4FFWC 1KYOJ 3GSXB 4JGJA 1DCLA 3V95A 3BXNB 3MOAL 4U49A 4A2EA 2OAAA 1CL7L 4XMLH 4E9YA 5AOIA 2Y07L 2Y5EA 3TNNB 4XNXL 4IBYA 3IETB 1XO8A 2MKLC 2NCEA 4JDZA 4XO8A 2F2HA 4TTDC 2VN5A 1MXDA 5FGBA 4XVUC 1MF2L 5HHMB 3QWRD 3TOPA 2O5YL 4RIRB 4W6XB 1IEBA 3WFEL 1N4XL 3CQFA 4D8OA 3ZL1A 3FTUA 2EICA 2IAMB 2E59A 3VU2A 4QXWA 1NGZA 3V52H 3HG1D 4I85A 3QXUA 4P4RB 3ARGB 2L0DA 2QGBA 5ABDE 3EGDB 2NSMA 2AERT 3HRPA 4M5SA 6FABL 2XWBA 3CFDA 4UT6H 4Z3HA 1FFTB 4PRHB 4XODA 5CCKL 3AU1B 3QDAA 5CEXB 2Y5QA 2QFPA 1E65A 4TVPD 1B4RA 1ED3A 3FUFA 4PP1C 1ONQB 3OQ3B 2DLHA 4WFED 3VXPA 4NQUA 4KMLB 5DURB 4ZPVB 1HXMB 3QDJB 3H7BA 2X1QA 2HX9A 3I6KA 4ENED 2GFBB 4CVUA 4JRXB 4GAGL 2NDFA 2QSQA 4PN6A 4GXVL 2ERJC 2NLJB 1MFBH 1LDPH 2Y6TE 3OXRA 5DS8A 2BC4A 3OPZH 2J88L 1H15A 2CDEB 4JS7A 1B4LA 3QO1A 2CBTA 2W9DL 3NBNA 1N2RA 3V0IA 1ZJAA 3AJ7A 2CBQA 3W38A 1MDTA 5DD1L 3KWXA 3POCA 1E43A 2BWQA 4J3TA 4YHIB 4JVWA 4PRPB 4UUJA 1I9JH 1KACB 1T2XA 2P43B 3LZNA 4NGHL 3OSVA 1SBSH 4P5RA 2EADA 1Q90A 2XN2A 4BFRA 1W6WA 1ET7A 1MCKA 5DJYA 4JZJA 2APTA 3L5JA 4A2MA 2O5XH 3R4DA 1WBXB 4GMTH 2VQ1B 3GNMH 2NYYC 1NFIB 2EUXA 4OVVA 3HR5A 3O3AB 3MJ9H 1OE2A 3OB8A 1C5CH 4JFEE 2AQPA 5D2LB 1T0OA 1G6RA 1SDDA 1YJDL 2B9AA 4DFHA 2VL5B 3LS4L 4UT9L 5C09A 4FG6D 5IB5A 3QZNA 1C08A 1I85A 3L48A 2AQ3A 1UURA 2QQQA 2EECA 4GUOA 1JZ2A 1AHKA 1KCLA 5C7ZA 3VXUD 2D8KA 4P2RB 4ZUVA 1RPUA 1DQJB 1PSKL 4NCC1 2DDQH 4ZMVA 5JW3H 3D09A 4NENB 2IADA 3CFKA 1HKFA 3AUVA 1DVFD 5DVPA 5EC2A 2BY0A 3TBYA 1RVFL 2EEFA 3QZBA 1SDAB 4KRLB 4NQQA 5H35B 1H0DA 1NM4A 4M8VA 3ZBMA 2DRUA 2K7QA 3WS3B 4AEIH 3SCMC 1MCQA 4QO1B 4MCYB 5D7LA 5AVYB 4Y5XA 1MJ7H 3JWOH 5I6XC 3TIDA 4PJ8C 1F4AA 4DETA 1IJNA 4KKZA 2VN4A 5H37G 4G82A 1A6AA 2EXYD 3MAWA 4JM4L 5D1QC 1WA1X 5C70A 4JFHD 3QXDB 5E94A 1ADQL 3QAZC 4Y4KA 2AQSA 4AQ8C 1UJTA 4AWJC 4C83A 3IDYC 4GFTB 2OK0L 2IPTH 5GS0H 4MQSB 3SDCD 3TA3C 3F58H 3W2DH 2CSPA 3OAYK 3RVVC 5L2KD 2UWEB 3LVEA 1OIOA 3MTXA 4IBZA 4QRSA 4WNQA 1LO4H 5B39A 5KBLA 1BBDH 3N2JA 3GO1H 3BDBA 5FYKH 1VPOL 3AZUA 4YHOL 5C0FA 1BVOA 5D9SB 2R69L 1JSYA 3FOMB 3W57A 1D7CA 3CSYB 1FVEA 2JXMA 2DIEA 3PWUB 4JDEA 4LL4A 3MRBA 2A83B 5FGSA 4Z3GA 2QDWA 1TOXA 3BDXA 3VG0L 1OALA 2ZSVB 3GGWB 4YNYA 3AROA 3TS8A 4HFWA 4FG2A 4LCIL 1JRHL 1EEYB 1S3RA 1R3LA 4NAJA 2DLFH 3V4VL 3DO7B 2W0FA 3B43A 4HLEA 5HY9B 3RGVA 3WD5H 3PJSA 1JK9B 3D69A 4P0DA 1A3LL 3BI9X 2NNCA 4FQCH 5HYFA 5D7KD 2GTQA 2QGEA 2Y7OA 4PREB 4WVRA 3I75B 2OMWB 3L3JB 1HE7A 2B2XH 2CCVA 3L3KB 2ENSA 4NRYA 4QKXB 3FCSB 2A77H 2Y3NA 3C8DA 1QLEH 1J8KA 2O5ZH 3NSXA 4POZD 3TT1L 4RGMB 3WMSA 1FBIL 4BFNA 2NY5L 4K94H 1GGUA 4M8RA 3GSRB 5BZXA 2QT6A 3F04A 5E6YA 3T2NL 5T3XD 3VFVA 3ESMA 3QXTA 4PGZA 2MCG1 2DKMA 4KOBA 4N2BA 3V6ZB 1ZVSA 3APMA 1CMOA 1IFHH 1X7QB 5CJOH 1SXSA 4KNQA 3EADA 1JPGA 4NPKA 3MLRL 1SJHA 2VIRB 2YSSB 2ZKMX 3RAJH 1FGNH 4DEUA 4U1KA 2J55A 3A3YB 4L3EA 4JO4L 3PG2A 3PHQA 4LCYB 3VMNA 4UTAL 3C9NB 4K0OA 4NO0D 2Q7AA 1BEYH 1INDL 1XIWA 5DD3H 2IXQB 3U36B 1FNGA 3GYRA 4OQ1A 1CD1B 4WFFD 3L6FA 3RL2B 5TFSL 2CDGB 5GJTH 1RIUL 1P4BL 1KENH 2H8PB 3EDJA 2VMEA 4OCRL 4X5QA 1M1SA 1XMEB 2AEPH 2XFXB 4F91B 1KDIA 3EGSB 1LEGB 4U1MA 3UTQA 2FO1A 2JK5A 1H8SA 4BM7A 2C4FT 4R3SA 4JN1L 3UG4A 2W95A 3REVB 4ZPTB 1EFXB 5A40E 4NNXB 4NPJA 4ZW7A 2BX5A 1OEZW 4P59H 2F0CA 2A9MH 3X13A 3Q05A 1HYSD 1NBZA 2VR7A 4PVMA 4FTVA 1OCWH 2FJHA 4ZRGA 4GW4A 5D72H 1CXFA 4XXWC 1K8IB 1W9XA 4YPJA 1DVTA 1FH5H 2WLNA 3EJYD 2Y7QB 1KIUA 3NZ8B 4I0PB 3CH8A 4R4ND 3WIHL 43C9A 2AXHA 4BCYA 5AZEL 3FFDB 4APQB 2Y4SA 4Y5VC 5DJCA 2BVTA 2O6PA 2X09A 2VLKE 2GEEA 2FECL 3K2UL 4YXLL 4HMEA 3HE6B 2GUYA 5J1TC 2MPVA 1NAML 3ARFB 5FX3A 1MFCL 1JNLL 5KUMA 1CUOA 3MV9D 2DV6A 2EINB 3NCYS 4OCXL 1BYNA 3FQWB 1MFEH 1ES0B 3TWCL 1E9PA 3GHBL 4GO6B 4TL4A 4BE6A 3HB3C 5CGMA 1YNLH 3DVNB 2WWKO 15C8H 3UO8B 1BQHA 1C5BH 3IEAA 1CI3M 4M1CD 4ZNEE 1MFAH 3QULB 1DL7H 3QQ9C 2WB7A 4OJDH 4UILH 4M5ZL 1NSNL 3Q1SL 5DS1A 2AXGA 1WD9A 1TZHB 5JOEA 1BD2B 1G7HA 5AEAA 4JPWH 2ICES 3SQOL 3VJ6A 5GISH 3Q8FA 4PB9H 1KCSH 1UATA 4KZDH 5FUZL 2WVTA 4X6DA 2XZAH 2BIQA 2PYED 1TQVA 3CWGA 1QUPA 3ZTJG 1D5XB 4QHNA 4DZ8A 3AG2B 4EOWL 3ZQ9A 3NP3A 2GABA 5JPMA 4UTCA 4MJ5B 2VQ4A 1OTTD 1PGRB 1PKQE 2D3JA 3I3DA 4MCNA 1KIRB 4HK0A 3SE4C 5LVEA 1DVSA 4YHNA 3IN0A 4X4ZA 3CIAA 2Z65C 4H40A 3S35X 1A1MA 4PY7B 2V3DA 5MI0B 1JGLL 4AOFA 1KN4H 4B7IA 2GBUA 3QQ3A 1CE6B 3NJNA 1ULVA 4A04A 4E42A 2BHFA 1ZTXH 3QGVA 5DQ9B 5IKCB 4OI8A 4KJWD 2DQMA 4C4KO 2C1OA 4BFBD 5AW1B 4RGNB 1XGYH 1URLA 4IGBC 2BSBA 5T5FA 5AYUH 1NIBA 1WP6A 3GKWH 1N5YH 3OKOA 2R0KL 4FNPA 1FPTL 1XR9B 4OD3H 3MNMA 1L7TL 4M43L 2HAZA 4Z3EA 4KKBC 5E4EC 3P2BA 1MG3C 4P2YA 5CFHA 3MV7D 4F8NA 1S9VA 3IWUA 2DM7A 2ZXWB 2DQIH 1O6SB 3VFWB 4DKDC 4XP9H 1VFOA 2IQAB 2Q6WA 2CHXA 2CLZB 2E6JA 3TXAA 4R4BA 4WV1C 4XCCL 1FNAA 3OHXB 1RPQA 2CRMA 3CG8A 3ETSA 4X4ME 5FK9B 2PTTA 1OB1A 3MCKB 4MNQE 1JI2A 4OFVA 3V0FA 3IDUA 2XWDA 3HNSL 1FAKT 1OCRB 3P0YL 4HJGA 4MDIB 4P07A 4LCVA 2NSQA 3X1EA 5AOJA 4GNKB 4RFNB 2FO4A 3UABA 2IF7A 4FFZL 4PEEA 4EEEA 3R1GH 1FYTD 3U2IA 4X6FB 1P7QD 4OCWL 4Q4IA 4XNQB 4UQ3B 2I26N 1KJ3H 2EIZB 3DX9A 4GIOA 2ICEC 1EK3A 4JR9H 4JFUA 4EDXB 3BN9C 1AXTL 4NQVA 3RZCC 3VYOA 4F7MB 3FSOA 3UG5A 4KMQA 1FZJB 3DSNA 5SWZB 3UBGA 1BX2A 2LR4A 3B3BA 4L0PB 4M8QA 5D5MB 3V7AG 4JKPL 4UV4H 1PZSA 4WHTA 1QPPA 1NMCC 3DNKA 4B41A 1ORQA 1NBYA 3N41B 5J7CC 3HPLB 3BD4A 4YDKL 4M62H 5K93A 2X2UA 2PR9A 2OMTB 3EYOB 4G80A 4N5EC 5J6GA 2B4CC 4JFOB 3MRDB 3LRGA 2Y6SD 2OULB 3RVWD 3OGCA 2GY7B 4LLDA 1T3FB 4GKZA 4OJFH 4P57B 1PFOA 3B1UA 5LXGL 4JFDB 1SF3A 1WD8A 4ECNA 1MFMA 5F9OL 4DCQB 3C5XA 4YHKL 3NAAH 1MWAH 1BSIA 3KPRB 2RA1A 2H7WA 1OK8A 4P2CG 5DYOB 1AD0A 4KTDL 3UO1L 3JV5A 1Z3GH 5EU4A 2CA4A 3DXAB 5F71A 1E9QA 3OKMA 4Q52A 1M3JA 5E0FA 3LDBB 1A2YA 2JH2A 4M1GH 1XV8A 1RJCA 1PKOA 1XD1A 3W5MA 4JQIL 1PZ5A 4N2KA 3SO5A 3CBJB 1YEWA 1AXSA 1LGVA 3GMNA 3VFUB 3KPNA 3CU7A 4WTWA 1D2OA 2I69A 3X1FA 4N2DA 4PY8I 2CJUL 1OP3H 3VD1A 2DQJH 5CLXA 3C5JA 3U4BL 2W9EH 3DV6B 3BUYA 3VXTB 2EIJB 1A7RH 1G84A 5C0BD 4OGYL 4CMHB 1JPTH 3IMTA 4XNZB 3VFMA 3WN5C 3LCYA 1WFNA 2R4RL 4X8JB 2P7TB 1KEMH 2XZQH 3MGOA 4MYPA 3OSKA 2H6PA 1WWAX 3PFUA 1PLGH 4Y2DA 2BDNH 1GJWA 5MEPB 5EF0A 1U3HD 3W3BA 3KZ8A 1HHIA 4A39A 3TH4T 1NCDL 2VE6A 4WEBL 4WU7A 3EJUA 3TCLA 4ENEC 5EO0A 3SJVD 1DEEB 2AHIA 1MN4A 5FHBH 4KKAD 4JPSA 5C1MB 5J12B 2FWOB 4AYSA 1JE6A 5ESVB 3NRFA 4KVNL 3A6BL 4JDTH 4L4VE 2W07A 1VACA 1ZHLB 1MCHA 4GPVA 3REWA 3BWZA 3MRFB 4R26L 2Q8BL 3KL0A 3QJQB 1DSFL 2GTZA 4XH2A 1KB9K 2CMRL 3VUAA 2VN6A 4UU9A 2ALWA 3KPLA 3BZEB 4OCMC 1H6EA 2WXHA 1SQ2N 3ZUNC 2VSCA 4MVBD 1D5RA 1EJOL 5F9AC 1CL7I 2OLDA 1OAQH 5HVHB 3UAJD 1LJMA 3WY4A 4Y5YB 1IGFH 4NQDE 5J11B 2BCKA 4GT7A 3RWFA 4YE4L 3WFHA 1CR9H 4FHBD 1ZGLB 2SEBA 1J5IA 4GRLB 3PWLB 5DVLA 2YXWA 4FG6C 5KJ4A 1QKZL 4ZFFB 4UM9A 4WCYL 1DEDA 2VXSH 3ARYA 4R96A 1B2WH 4NXSA 2WNGA 1EXUB 3BGFB 4KGJA 5CEZE 2YWZA 4YHLL 3DOSA 4LNRA 4WO0A 4JFEA 5F7DA 3TO4B 4GRMB 1KWGA 3EFOA 1DVFC 1VF5C 3KXFA 5TPWH 3PYCA 1EGJA 4OIIH 4U3HA 1A9VA 3F6JA 3P69A 1YPZF 4BQ6A 5K5YA 1LK3L 3SPVB 3HLAA 3FUEA 1NC4D 4GG6F 3SKMA 4GUPB 4CSSA 2FR4B 5DZJA 5DC9B 4OLWH 5KBKA 5D1QE 5EU3A 1LLAA 1YEIL 2EXYC 1QZ1A 4N2NA 2YGPA 1KIQA 3SBRA 4G1MA 1YUHB 2C9SA 3HUJB 4TM9A 1J9CT 4Y4HA 1WJ3A 3BAEH 5C07A 5G5DA 1GZPB 2R83A 3GSVB 2NY4D 5EIQA 3WE6A 4GUQA 1BZ7B 3GJEA 4FKHA 2X0UA 1XMWA 4NFBA 4OLUH 1L9TA 5DQJA 4JRYD 4AEEA 1S7WB 2HVKB 4XBPA 4ODVH 5K33A 3VE0A 2MHAA 1MHCA 1E42A 5CP3H 3NZSA 4GKSB 5ICXA 2OZ4A 4MJHA 4WEMB 2BVUA 2CRIA 4AIZB 3DTUB 3MHZA 1ZHNB 4FQ1L 1OAZH 5ALBL 3V10A 3IDNB 2B0SL 3CFTA 2ZOLB 4NM4H 1WGOA 1RK7A 2CRZA 4AX3A 4MNGE 2FATL 4KZEL 1GHFL 4Z18A 1RK1A 3RBSA 3Q9QA 4U1SA 2XYBA 1R1CA 4N24A 3EBIA 3UADA 3BVTA 1SJEA 3LEVH 2GJJA 4Z95H 3NJVA 2R39A 3MRNB 4IRSD 5KANG 4FX5A 1OHQA 3GSOA 3KWWA 1FRGH 3KLQA 4LEEA 5K39A 5LGHL 2XYCA 5JORA 2A74B 4FEMA 3MFFB 4R0LA 4XOAA 5FA3B 3I85A 1OKEA 4MQ7B 4PYGA 3V0EA 1RPKA 3P73A 4M6MH 3G5YA 3L3DA 3EHBB 2ZXBA 1NDGB 3TL5A 2WBJA 3DURA 3P9LB 1C1EL 1TENA 2Z92A 5A2LH 5TF1L 3QEHA 4D0BB 4DP5X 2F19H 2IFFH 2DQUL 4ZFQA 1E5BA 3QIUC 2JSFA 4HUMB 1G7MA 2P42B 3MGTB 4POZC 2FLBT 3ZHNA 4Q2ZB 3SSGA 1E28B 1U8IA 4F20A 1QSFB 5BRZB 4GT0A 2PABA 5EMYA 5KVMC 3EOBB 5HYSG 1XZ0B 1IQDB 2K3HA 3ARPA 4AJYV 5DJZB 1QR1B 2QHRH 3BKYL 1VGEH 5ETUA 1HQ4A 3M7OA 4O2EA 3S35L 4XNDA 1JV5A 4QHMA 1IGYA 2C9AA 4M93C 4JG1L 2RCSL 5IFAL 4ONHB 3LPWA 3I6LE 2FQEA 2M2DA 4PJ9B 5BO1L 2OMZA 3CH1A 5AQ0A 1WE5A 1OAJA 4XB3A 4ZMOA 4CGTA 1BJ8A 5C0DB 3MLSH 2JKRM 4O5LL 1FO0A 3LZFL 1TJHH 1SN2A 1T2JA 3MRLA 4GW1B 2Z0BA 5DJ0B 4NZDA 5ELIA 3H9YA 4HU8A 1KXVC 3VB8A 4TSAL 3K6IA 4NLAA 4JQXA 3VMOA 3P0VH 3QQNA 4UDUB 4P2OA 1D5IL 3PGDB 1YQVH 3CFJB 4FP8L 4XP6L 5HI3D 1V55B 4Q9QL 1B0RA 4LCCC 1E7VA 5TE6L 4RFEA 1PL3A 5KAQF 4KI1A 3OWEA 3MNDA 1HYSC 2O6DA 1ROCA 2XQBH 3SKUD 3VDCA 2UX7A 4NKDA 1Q4NX 3LXCA 3VSQA 4DPBX 1HZLA 2QLYA 3BZFA 4Z7VB 3BCDA 3HC4H 2OX5A 4ZMTA 4BFIA 3LQAL 1WCBB 2UUDK 5FUCC 2IOOA 1S9YA 1U91B 1GC1L 1IIKA 3K4AA 4JGNA 4WHYH 1IQWH 1P69B 1IM3D 2J71A 3MN8A 4Y89A 3VSVA 4ACPA 1A3ZA 2B3RA 3NRPA 3P2DA 5DFVD 3EJYC 3G6DL 4Q58C 1T5KA 1FIEA 4R4NC 4JKKA 4U6VH 2H0FA 1NKOA 4PRID 1K2DA 4RSYA 1JWUA 1JTTA 3QIWB 4GJTB 4RLDA 5C0CE 2UVEA 4BFFA 4IBUA 4X8CA 1WFUA 3PFQA 1TZOA 4P46A 1I7ZA 2DWDB 3B9KD 2XVKA 3OAZK 5DJ2A 5AAMC 3NACL 3B3IA 1KCRL 3S5LA 1S5IH 4B9ZA 1CT8B 3UC2A 5DEFA 2WLLB 5C7XL 3QDGD 3GI8H 2Q87A 2JVUA 3L4ZA 4O51A 3UTSB 3FQ2A 4JFVA 2BCMA 1E4HA 2F7PA 4RGOL 2VLKA 4HCRL 4DGVL 4EN3A 2BFGA 4IOIA 1NCUA 3ETTA 4AI7A 3ARDB 1H3TA 1II4E 1K5NB 3CBRA 3NFPA 1TEGA 1CLCA 2F08A 4M1CC 3QUZA 1KNOA 2OZNA 2LABA 4NN6B 1CXHA 4MD5B 4NN7C 2XN0A 5KWYC 4BZ1H 1FSKC 2M1KA 2R1WB 1HAWA 5JIPA 3IF1A 3ZKXB 3AREB 4ZNEA 3EYFB 5HJDA 1JHTA 1N0XH 2B59A 5C0JA 2NXYD 3BGAA 3QFDA 5C0EB 1OTTC 3BSHA 4Q74A 3DRQB 2V17L 2V7HB 3O6FD 3MMEB 1AKJA 2OW7A 3L2LA 4D9RD 3PWJB 1J7VR 4FQXB 1RZPA 2WLHA 3WL9A 3P9WB 5DMIL 2OXHA 5ITBH 1TMQA 1PKQA 4WJ5A 1JZ4A 3ARTA 4YR6B 1MW3A 3QCVH 4Y1TA 3P77A 1S7VA 2EDEA 1MW0A 4KJWC 5CSBA 3IFOB 3U7YH 1X44A 1A6ZB 1RJZB 3BIKA 4K5NA 5I73C 1XCTB 4QJ5B 4CVXA 2XX1A 4ELDA 1QWNA 1ZT1A 3MXWH 1C12B 4KDVA 4MX7A 1WAEA 2ROYA 2XIDA 3LV3B 5I1EH 4QHLB 1MQKH 3S37H 4DOHB 4ZS7H 3LKPA 3N91A 1A8ZA 3IM1A 3QPKA 4QGTA 5BS0D 4HIIB 3PWNA 4NKIL 3I02B 4QRPE 1MWOA 2EE6A 5JW4R 1F1GA 3DX7A 3MLZH 5FKAA 1MCPH 4TRPL 3KLSA 4R7XA 1NGPL 3QORC 5F7KC 2CO2A 3O41A 1QFUL 2XWXA 2Y2TA 4OFPA 4Z0XA 1CDGA 3HBPA 5C8JB 1ZA3A 1EMTH 2JCCF 3MNWA 2Y0SA 2ATKA 4GBXA 4C59B 5F7UA 3L9RB 1BLIA 3QH3A 2EH8H 4OFDA 2OMXA 1S9WB 2B15A 3LPGA 2OI9C 3JVGC 3L1EA 4X4MA 4Y2LA 4E9XA 1KBPA 4MNQA 4EI5A 5I0DA 4DKAA 1LVEA 3Q8AA 5LAXA 2WGNB 3QFGA 4N90D 4HWEL 5A16B 3LN9A 1D5BB 3CXDH 2WXPA 2GBTA 4K3DL 4ZJ9A 5I1LA 4HALA 1RLWA 5J1SC 3QR1A 4K2UH 2I9TA 4X9BA 4H8UA 4P23D 4BKTC 3LX9A 1T80A 4OM1L 5AAPA 3PPEA 3U25A 3U79A 2WXKA 3IAPA 1EBPA 3NIDF 4QRRB 1XDTT 2WYTA 3QB7C 2Z31D 3RA7H 2WXOA 3JSSA 2OYLA 3L17A 4HKBA 3BMVA 3CDZB 3O3EA 4F7TA 1PG7W 1BWWA 2Y6SC 3UZQB 2ZKHL 3RVWC 3K80A 5F8RC 2VMDA 1T5XB 5T5FH 1BOGA 4LMQI 4Q14A 5F6HJ 2KQNA 2PPDA 1HOEA 5CZVL 3FPXA 2P8LA 1U3ZA 1J12A 3FSVA 4X42A 4F3FB 3D1MC 3LIUA 4LVHB 5ESAB 4Z7QF 4L8SB 4F1ZA 5ITFA 4A2FA 1W8OA 1G9ML 2VABA 2XVLA 3VCLA 4JO2L 3W9EA 2HH0H 2DMBA 1YPZE 1KYOK 5ACZB 4YLCA 3IDMA 1KIPB 4LP5A 4GG6E 1KLGB 3O2WL 4F27A 4YHPB 4N6RA 2H45A 4H1LA 2Q76B 3EYUL 2J1YA 4S0SD 5F9JB 4PI0A 3QJSB 3TASA 4U6HB 3NG5A 5IMMB 1EUTA 2XTLA 4BV1A 3HG1E 1IL1B 3L7FA 2AGJL 2RFXA 4LLAA 4C4BA 4WSJA 5F9DC 5T3ZD 1CGVA 1AQ8A 3C87A 4JKLA 5CO1A 2MCPL 3CHRA 4ZD3H 3MLYH 3QFJD 4XP5H 4KY1L 4LPXA 3QW9A 1N8ZB 4TVPE 4C4UA 3RL1B 5D7JD 3C08L 3W1ZA 4WFEE 5CD5D 5H4ZA 3B2DC 2UVFA 4DN3L 2BH0A 2XUWA 4XPBL 2HRLA 4NQCD 1U3HC 4LVNC 3K81A 1FNLA 5HHNA 4FFYA 2X4TB 1BREA 2WBXA 4HGMA 3ZPDA 5DRNA 4AC2A 1QAWA 2EDKA 1MJJA 2WCSA 3FMGL 1TEYA 3PWPB 4QHKI 5L6YH 5CJ8A 5CU5A 4UAOC 5EEYA 4KKAC 3SPIA 1YNKH 4XE5B 5GIRA 4G9DA 1PX8A 2WWMD 4RETB 4G6KH 2J1ZA 1KFAL 4XMLL 3ZRCC 2CKBA 2XPGA 3LN5B 3GXNA 3OKNB 4P5MB 4PP2A 5ICZB 5D71H 5IUSA 4XPFL 3IXTB 3SKJL 3T04D 1NICA 1Y6KR 2QQLL 2VTFA 3T6ZA 5GZOD 1KLFB 1UB6A 1O7DC 5D1XD 2WY3B 4L4VA 1R3HA 2NTSP 3SBPA 4MVBC 2WTRA 1T7XA 3N1GC 4FQQA 4X7SH 4HF5L 4L1SA 4NUGH 5EZLA 2G0LA 1AR1D 1ZE3C 4TUOA 4U0RC 3UAJC 3VU1A 3WKMH 4ANVA 4UT6L 4Y8DC 3WEOA 1L0PA 2Y7SA 1I8IB 5B1JC 1MREH 4HG4K 3MLWL 3MRHB 3GMOA 4X9YA 1DJXA 4DW2H 4MLIA 1YECH 3JWDC 3O0LA 2OJZH 4QHUB 3MKKA 4NQDA 3NTCL 3FQRB 1N3NA 1ETA1 3PGCA 2B77A 1SN5A 1ZS8A 3CZLA 2P80D 3KM1A 1PCXA 1SHXA 3VXNB 2ZAIA 5E5UB 1MFBL 4U2YA 4UQ2B 1AE6H 1P4IL 3DTXB 3TT3H 1J0HA 2FYVA 4YC2B 1E7UA 3UTZB 4OLVH 4I18C 1I9JL 3T1WA 2CE6A 2EO7A 3GHEH 2G2RA 2X1OA 1DJYA 3DRTA 4G8IA 4DO5A 4LLVB 4FJ6A 5IHLB 4JFHE 4JY5L 5ADPH 4G71B 1Z1WA 4ZUSB 3SCMA 5KVEH 2VC2H 3CFQA 3I84A 3KS0J 3SDAD 2XQYG 5HHQB 4BDVA 1H5BB 1I75A 4GMTL 1PQZA 3GNML 5L2KE 2BIIA 4LPTA 4LFHD 2NY4C 4PJ8A 1USQA 4GIPD 5E1HB 2Q8AH 3MJ9L 5D1QA 3HE7A 3LH9A 1JK8B 4XO4A 4AQ8A 3HG5A 3M8OH 3NDYE 3CSPA 1AZCA 4NWUH 3FB6B 3OR6A 5IBLD 1LWJA 5FC9A 4AMKH 5AW9B 2A4EA 5TGBA 1IAII 3TA3A 5KSBF 1L0QA 1IAMA 4E36A 4MJIB 2YGNA 1Q9WB 4LP8A 1TMCB 3KYNB 4G6AD 3T3PF 5JW3L 3CUPB 1OGAA 2ZF9A 1JJUA 3AXLB 4MA7L 4BFEA 4JM2D 1ZSDA 3F7PC 5ECJE 3MUHL 1LE9B 3IJSA 2A6KB 4IRSC 3AGVA 4I2XB 1UT1A 2HKHH 3A6OA 4JE0A 1MIML 3LS5H 4NBYB 5GHWL 2WINA 5D7KE 4MNGA 1UXLA 5GRVK 4F5CE 5F0PB 5CJQL 3JWOL 3HRZB 2BNRA 4L0ZA 4EN2A 4OGXL 2NYZA 3K0YA 2COQA 1X3DA 3OD3A 7FABH 4M02A 3FUNA 2I24N 1IEBB 3SY6A 1XGQA 1IM9D 2CGZA 2IPTL 4DGUA 3NP4A 4LPCA 4NZUH 5AVRB 2V4LA 1U93A 3F58L 5H2BA 4DGIH 3LKNA 5T3XE 5ID1A 4U3SA 3F7YB 5EEWA 4OZGF 1LO4L 2GJZA 4MD0B 1YSOA 4XP1L 5FM5M 3GO1L 3TN0D 5FYKL 1U3JA 2XWBB 3CFDB 4HAKA 5F97E 4YFLF 2H0PA 4XMXA 1ED3B 3FHQA 1DVXA 3L13A 2CUAA 1B3IA 2FQFA 1GOHA 4N2AA 3RVUC 5E08H 4N0YL 3VXPB 3HZMA 4MXWH 4ACTA 4WHYG 3B2XA 4QPEA 4DNLA 4WFFE 4LBEA 4CRPA 5BCAA 1HHKA 4B53A 3H7BB 3I6KB 3EW3B 3WD5L 4IOSD 1RK0A 3IFPA 3B8SA 1JXGA 2PCPA 4NP9A 5AOLA 1F13A 5TDNA 3ZMEA 4CC0A 2CLRA 1A7PH 5DS8B 2BC4B 1NCWH 1H15B 4FQCL 2VDOH 4KXAA 1G7LA 4GXFA 2X1XR 2H9GB 3IRZA 3V0AC 2X4QA 3O81A 2IBBA 5IJKC 2B2XL 5DHEA 3CDGB 1QRNB 3VFOA 1ILUA 1R5WB 3ECBB 2A77L 4JFFD 3AC0A 3BP5A 3AQZA 3T6WA 3V5DB 1GCFA 4LIQL 1D7BA 1U8LA 5EU5B 2DW5A 2VITA 3TBBA 1HEZA 1V5JA 1KBGH 3C6LB 4R5VA 5KUKA 5KVDH 2QKSA 4EO5A 3RTQA 5DJYB 1OK0A 5FUCE 4JZJB 5GGQH 3GJFA 3X14A 4ZMAT 1W91A 2LU7A 4JN2A 2JCCE 2QR0A 5CJOL 4FLHA 5DFVC 3B4NA 5IVXF 2W88A 1FZMA 5E99L 1CF8L 2AEQL 4QAWA 3MZTA 3TFBA 3TWYA 5FDWA 2JIXA 5B7MA 1ZHBA 1SDDB 1ZGLP 5I19H 1EZUA 2O93L 2E75C 5DT1H 3HFML 1C08B 3DPBB 5I30L 5FO9B 2OJ1A 4MBOA 4OLEA 3K8LA 3U30C 3B9KC 1BEYL 4L2YA 4AKOA 1YMHB 2D03L 4M61B 4ZUVB 4NQED 1ZSHA 2A6DA 4FZEH 3IJEA 3MV9E 5DFTA 5JQ6H 1TTUA 5C0CA 4U6YA 1KENL 4HOXA 3TBYB 5E2WL 3U4EA 4W9JC 1CC3A 1FE8H 3NIDE 1H0DB 3DOIA 4F7EA 2COVD 2XLLA 3BEVA 1EZLA 3D39D 5EEVA 2EDRA 4KJPD 3H9HA 1J87A 5A1AA 1UYWH 4Y5XB 4HAFA 2NNFA 4AL8H 4P3WA 3TIDB 4ZFOA 4FMFA 1A6AB 1BYPA 5KOMC 3N42B 4G7VL 1HNYA 1HT6A 4MKTA 2PYEE 4C83B 1EX0A 4XPAH 5D72L 4G3YH 1XF3A 1OZTG 4Z7QE 1CGWA 1FH5L 1RURH 2CUIA 2FJSA 1I3VA 3AXIA 5A6MA 3S3CB 2E7CA 4HUKB 1ZT7B 3DGDA 2EZ0D 4AGNA 3DUHA 1B0GA 3LNHA 4AGLA 2ZTBA 1FVEB 2R29A 1A7QL 2D7QA 1UM5L 3MRBB 1K4DA 5HPOA 1JZ6A 2DMKA 4H26A 5I0VA 4TNVK 4JPKH 4YNYB 4HFWB 1MNUH 1R3LB 3TESA 1H8OA 2W0FB 1HSBA 4YGVA 1OF0A 1YNLL 4HJ0D 3RGVB 3PJSB 1NIAA 3L3HA 4ODTL 3Q6FA 3C5SB 1C5BL 4E41D 2X4OA 1QWUA 1MFAL 1RZ8A 1JZGA 4R90H 1UEMA 3MV7E 3NIGB 5JNYA 2H47C 1HESA 4IGBA 1P84K 3VQMA 4XNYH 3IU4H 2X42A 4IM8A 4U1GC 4FMVA 4JPWL 5A2KH 4PB9L 1FAIL 3EO1A 2OSYA 2ZCHH 2IV9A 2XZAL 4GW5A 2V2XB 2BNUA 4HLZH 2R15A 3FB5A 4K9EC 3T8VA 3II1A 1D5ZB 1HS6A 2H0EA 4XC3H 2N59A 5I5JA 2D9QB 2XXCB 4NUJA 3PP3K 1QTSA 2OP4H 4ABVA 4QRPA 4X7CC 3RDTD 4OD1L 4WV1A 1ZVSB 2EXSA 1TQUA 2DD8H 5FM5O 3QR2A 5F0LB 3L1OL 5CGYD 1FYTE 3BP7A 1KN4L 5K9OA 5EOCJ 3FHAA 4U1KB 2VZ3A 1XGPB 2ZG2A 4QRUB 1I9RH 4UBDD 1JFHA 1LP9E 3PHQB 1W0YT 3HMXH 2NX5D 1A66A 4Q9CA 1TZIA 4HUWB 1IFRA 3WI9A 1I4FA 1FNGB 2BOCA 2NT0A 4P23C 3E6HB 4JFYB 3L6FB 2TRYA 3GKWL 3WV0A 1N5YL 2ICEA 1Z9OA 4F80A 3D3VB 2ZJSL 4NZTL 4AK2A 3HN5A 2Z31C 4J3OH 3SZ6A 1Q72H 3K2IA 4DQOH 1JV2A 4U1MB 4O2CB 3BAWA 3UTQB 5IG7A 3KYAA 4IKNA 1U8MA 3DYMA 5IJDC 1KTRL 1LO2L 4U6TA 2Y9RT 4JKMA 4XP9L 1SLVA 5F3HA 4OSUH 3GUTA 1A4JA 5AWNH 3X13B 1NBZB 3INUH 4ZMWA 2C3VA 4Z1PA 3D6GA 2ED9A 5DMKB 4FTVB 1MDAA 4ZX6A 1CS6A 2WXGA 1UZ8A 2L7JA 5AZ2H 2FZ3B 5EBGA 3BH8A 3GEWB 4WWKB 3H54A 1HL8A 3BKCH 1IC7H 2EUWA 5DK2A 1TETH 5I24A 1CDUA 3DBXB 3UFIA 2FT8A 1KJ3L 4U33A 1YYLL 2YA0A 4HIXL 4OZHF 5DJCB 4KKRA 1E9OA 4RBPK 4M6NH 3RWIA 4P49A 5ICYA 3TCXA 1NZRA 1YPZA 4CSZA 2VL4A 2FEJA 3LMJH 3ZW3A 4JFPA 4UV4L 2K6WA 5IBTH 4GG6A 5PAZA 1CFSB 5TE7H 1UCBH 3GPSA 3QWRA 3KVQA 3L3OC 3DMMD 4FQHA 5C0BE 3AS2A 3GWJA 2AABL 3AG4B 5TDPA 4WQOA 2ZCLL 2EYRA 4F1SA 1BQHB 5MERA 5DVKA 1WGVA 4BZYA 3HG1A 2O61A 4FLQA 4GKLA 5IM7B 2AXGB 5CD5C 4OJFL 5KSBE 2X44D 1TVBB 1YEKH 2A6JA 1G7HB 1OAXH 3O8XD 4LSRH 3K7UA 5GS1C 3VJ6B 1BV8A 1QMUA 3JUYA 3NAAL 2D3VA 4XCFH 3T3PE 3UL4A 2GC4C 1QEXA 4JL2A 4X6DB 4NSKA 5E4AA 1BAFL 1GJUA 3SJVE 1KT2A 2X89D 5JXAH 4DZ8B 1M05A 3GSUA 5AENA 2AKRA 4RDBA 3VWKC 1T7WA 2WYZA 4Y1AD 4HK0B 2WWMC 4EI6A 5KYUA 4OV6F 4M1GL 3CFEA 2FQDA 1GS8A 4HUUA 1DSYA 3ASNB 5EV7A 1NFDF 3QQ3B 4H88H 2Y69B 4U1HA 1G1CA 1N59A 3WJLC 4LOFA 3P3YA 3SE8L 3EJZD 4E42B 4NM8H 1PAZA 5GZOC 4FQPA 1NMAL 1DBAL 3T0ED 2C1OB 5D1XC 4FAAB 2GT9A 3K6FA 5K1VA 4EBQH 2QZ5A 3LHPL 5CBAA 3ZZSA 2DQJL 4JFQA 4IHOA 3OKOB 1AR1C 3H55A 4OZGE 4L29B 2ITDA 1A7RL 4LHUD 5T1LA 1AQKH 4QCIA 2B20A 5FUOH 3DDGA 4MCZA 1ZLVK 5I1GH 1XGZA 1J5DA 2ICWB 3S37X 1E5AA 2IH1A 2XZQL 3JTTA 3Q5YA 4CADA 4Y9BA 5DD5H 1S9VB 5DD6B 1PLGL 5EFIA 4Z8FH 3VG9C 1HXYA 2Q6WB 1CD9B 4DKFH 4R4BB 4UQ9A 2CGRH 1HWHB 2CO6A 4NAMA 3TEZA 2OMVA 1BF8A 3GRWA 2FVNA 2PTTB 1OB1B 4JHBA 4KRNA 2HG5A 5D2NC 3I2CH 4L0YA 4JMNA 2P5ED 5MP6H 3N85H 1DANU 1ZVYA 4BELD 2BM3A 2YGOA 1B90A 1NC2D 1KB5A 1RHHB 4LQFH 2FO4B 4Z7UB 5IVOA 1L7IL 4ELKA 2X9XA 1DVFA 1KJ2A 1W0VA 1R3IL 4B6ZA 3RQ3A 3GZQA 2EXWD 4PGEB 2VR4A 3VVVA 2J21A 4FERA 1BJ1H 1LXMA 4NQVB 1LO0L 4U3CA 5EEXA 3DSNB 1GGTA 2AJ3B 3B56A 3BQUC 1T4KB 3SDAC 1BM7A 3B2PA 4O58H 4M8QB 4YIQA 3RPKA 1B4JH 4WHTB 1IGFL 4OZIB 1FNHA 4JRYE 1EIBA 1I1AD 4UT7H 1J9RA 1NBYB 2WAHA 2XPYA 3CDYA 3DOHA 5IVXE 3KBEA 4HPYL 5IBLC 3EOYG 3L3GA 5LBVA 3SDCA 1DYZA 2CPUA 4JFZH 1UOLA 4RESB 3UZEC 5L2KA 1B2WL 3VGAC 3PLYA 1J0KA 2X4NA 4G6FD 4LESA 3VWJD 3TPUA 4G6AC 3QNYB 5GGRY 3GD1C 5A3ID 5GS2H 4AENA 3EGXA 1MZYA 3VXMD 1T1XA 1UA6L 4P3CH 4JM2C 5TPWL 1CU4H 2RQEA 4OIIL 3ULVF 4HS3A 1RAMA 3JTSA 4IRJD 4QGYA 2GK2A 2PWFA 1D6VH 3G04A 4MMXB 5DGRA 4CN4A 5C0AD 3KH3A 1JIBA 5EU4B 3H9SB 5F9WB 3WGVB 5EORL 4NX0A 4DKEL 3OKMB 2KZKA 1J5OH 3ARUA 5CEYA 4RWHA 4I1RA 4YVNA 1A9EA 1T5WB 3O6KL 4YBQD 2CR6A 2ZXDA 4ATWA 4JY4B 2RJMA 5I1KH 1J9TA 1GYWA 1PZ5B 4FXLA 4YO0A 4LARH 4G43A 2TSBA 2IQ9H 1LDSA 1AXSB 2DY2A 5DHVH 2C7UB 3LHAA 3BAEL 1K4CA 2XXFA 3GMNB 3KPNB 3ZT6A 5E8NB 4TV3A 1MY7A 3UG3A 4F5CA 2IWKA 5FGRA 4QRTA 5KSAB 2KLSA 5BXFA 4IRZA 1AHWC 3V0JA 1T0MA 4QDGA 5IEHA 3D85D 4NLHA 2L7QA 5KW9L 2WZPD 3PAUA 5IVZA 4HZ1A 4QNPF 2VZ1A 2VMFA 3BUYB 3C2AH 3ATEA 2WTOA 2ZG1A 3TN0C 2Z34A 3V6BR 3VI3E 5LDUA 1X5KA 4YBHA 1OAZL 4KUCD 4C58B 3MGOB 3VDBA 1E3ZA 1OB0A 2C9QA 5EU6B 5L0QC 3KGRA 4A7SA 1DBKH 2VXQH 5BRPA 4HBCH 2XA8H 3LEYH 4PS4H 2VE6B 3TCTA 4J2XA 2HT3D 3KGUA 2G3ZA 4HKJB 5EO9B 3T3MF 2GAZB 3RFZC 4QRBA 5EO0B 2EP6A 2FHBA 1V05A 1FFPA 4HWBH 1FRGL 2OR7A 3SQBA 1RUQH 2APWA 2VC2B 1GZHC 4NO0A 1BFSA 4M7LL 4A6YH 5C86A 4PUBL 3TBTA 1M6UA 3QWNA 4XRCA 1VACB 4OJYA 4Z7AA 3N55A 3REWB 3ZTNL 3L5XL 3PXLA 5IHZA 2GTZB 1TYJA 4L4TB 4M7KH 4XH2B 5E9DD 1AZRA 1IC4H 2IFFL 1FV1A 1IAOA 5I1CL 1KXVA 1IEHA 1AD9A 1LM8V 1UM6H 2RHEA 35C8L 4UU9B 2X28A 5CMAA 3QISA 1CDIA 3KPLB 3FZUD 1RUAH 1MI5D 5AL0A 4LCCA 1D9KD 2VDRL 1I7UA 4GQ9H 1JZFA 3NFSH 3I50H 1OY3B 1NEUA 5KJRH 2QHRL 3HS9A 3LRSA 1VGEL 4NHUA 4AQZA 3ZX1A 3QQDA 1G0YR 4PRIE 1SXZA 1A1OB 3L3IB 4KX9A 1IZKA 1WBYA 5A2FA 2QQNH 4Q6IC 4F9LA 3AWFA 2BSSB 5IR1A 1GTFA 2YN3A 2R2EA 2ZSWB 3RE0A 3DJ9A 4R96B 2D7TL 4MLSA 3QZWA 2JCCA 3VFRA 3QJFA 1XBRA 1Q94B 3MRQB 4JM2F 2VDLH 3DOSB 3MLSL 5GGTH 4JFEB 3NESA 3QDGE 3RU8L 1TJHL 3QYNA 1S3KH 5LJYH 2XA3A 2CBMA 4AQ1B 3EFOB 3UBXA 5I76A 3FU3A 3KXFB 4F7CB 5FF6A 4MMZC 2E3VA 5BZDB 1ZDSA 3N1MC 4X4KA 4YDJA 3PAVA 5EEUA 3CVHA 2XBZA 3GSNH 5G4OA 2EKSA 3P0VL 3HLAB 4KJPC 2QBWA 3MV9A 3OKDB 3UMNA 3F3HA 1W15A 3SKMB 1WF5A 4BH8A 7PAZA 3MLUH 3HN3A 4NWTL 5F7EH 5EU3B 4X7TA 1EQWA 4K5LA 2AJSH 3JWNH 3ZKND 1KIQB 2O6FA 3PP3H 1BVLA 3HC4L 1QATA 5C07B 1KV3A 5G5DB 4DF9A 3H42L 3WE6B 3MV11 1V3KA 3GJEB 2R56H 4LKXA 3O9WD 5IHUH 4FQ2L 2GHZA 5DQJB 1UACH 4NB7A 4U6VL 4URTB 1HILB 4D9RE 3EJPA 3VE0B 4YAQA 2MHAB 3FO0H 2EZ0C 4YSPA 2PYEA 5ICXB 3D08A 4HLZG 3WHXA 2G0KA 1WICA 1XCWA 3WNMA 4MJJA 1UWFA 4MJ4A 2B8OT 2I07A 4OZHE 3VA2C 4EKXA 2VDOB 4N0FA 4PJHB 2I7SA 2NR6D 1I1YA 3GI8L 4U1SB 3B2UD 2QGCA 1YCSA 1SJEB 3FTXA 1NCAH 4F8PA 4HJ0C 5BOPA 1WFIA 3D18A 5C3IA 3GSOB 2V7NA 4AIOA 1H3WM 1Q1JH 2VOTA 1A9BB 4U1LB 5H4YA 1LEIB 5C0RL 3BP6A 4R0LB 5BS0E 3P4MB 4PJEF 3P73B 4Y2OA 1SEQH 1RZKL 3G5YB 3L3DB 1RMFH 4Z3IA 1JNNH 3DURB 4X6EA 2Z92B 1J48A 3KLDA 4TSBL 1SBBA 1VKXB 5E6ID 3MKGA 4Y16D 4EUPH 3QUMA 4EXPX 4R5XA 1X4XA 1U8IB 1N0XL 3MV7A 4J3OG 3F85A 1DQLH 3BSZA 3Q8CA 2IPUK 4MSWA 1XXDC 1DQDH 4WKZA 3GBNL 3EYQD 3V8OA 3RDTC 4CU7A 2F1AA 3M6DA 5I15H 4LGRB 5ETUB 1HQ4B 4LAJH 5CGYC 1JV5B 4BK5C 4DUXA 3U46A 4QHMB 4KK5D 2P24B 5DJAB 3LKRA 5ITBL 3W9DA 5F88A 2IDCA 1NFDE 1CBVL 2QEJA 3HFFA 3MRMA 3U7YL 4K55A 2DQDH 4CU8A 1OAKH 1DUYA 2OMZB 3CH1B 5JIHA 4QF1A 1FYTA 4L18A 3IGLA 4UM8B 2NY6D 4LEOA 5BV7C 3ASWA 4PH8A 2OTPA 5CUSH 3WAJA 1ZHKA 1MAML 1IKOP 1ZVNA 3MRLB 1G7QB 5TJWK 3JZ7A 2Y1VA 1LP9A 3FQXA 1J88A 1F6AB 3J7HA 3D4CA 3S37L 1AY1H 3S3PA 4NN5B 2GCYB 3GBLA 3CN1A 4BQ9A 2E4TA 2GITB 1B0RB 4PGJA 4PIBA 2DICA 2W8CA 3MLZL 4RFEB 4S11A 4LSUH 1MCPL 5TDOA 4FQLL 3QEUB 5AVVB 4W9IC 3K0WA 1F3JA 2XC8A 1G5GA 5DEZA 1IGTB 4NKDB 3L1GA 3NA9H 3PUCA 4G6JH 2YRZA 3BZFB 2E7HA 2OX5B 2WQSA 1ZLUK 1EMTL 1DVYA 2QADD 4X7EC 1VRSA 1S9YB 4UANA 3ZU8A 2ZPKL 1QHPA 2P1YA 2EH8L 2ZIDA 4FA8A 2EIKB 4XPHH 5HDBF 3CN4A 1K2DB 3KPMA 4G6MH 1JWUB 4LKCA 1Q9LA 2WTPA 4N9GA 1T2QL 1D5MB 3EO9L 3A5VA 2NPLX 1GYAA 3QO0B 1BZ9A 3EJCA 1CZ8H 4NRXB 4P46B 1I7ZB 5C08D 4HH8A 5CILL 4K2UL 3B3IB 3UTPD 4X80H 3PV6A 4AJVA 5DEFB 1MRDH 5IB1B 1HJBC 4DEPC 1JZJA 5T3ZE 3D50A 3GT6A 3GRBA 2ADYA 1T1ZA 4ZUTA 3NEEA 3H2WA 2VLKB 3BPLB 3QFJE 3RA7L 3DMMC 4C54A 4K71C 4JK0D 4QYOB 3NFPB 3BC9A 1UXMA 2DF3A 3QUZB 2XJLA 4FEIA 3ZMRA 1KNOB 1YY8A 4JO1L 3E2HC 1F4XH 4F2MB 3IXAA 2ADJA 2WVVA 4W9ZA 5T5FL 3IVKA 2WV3A 2X0VA 5HGHA 4NQCE 1ZANH 3O8XC 4NJAH 5D6DA 2DWEB 1DLFH 5IQOA 5C0BA 3UGUA 3R0MA 3CX2A 5I1JH 3IF1B 2DL2A 4MNHA 4B9FA 4Z76A 3LD8B 5LAPA 4KO5A 3EO0A 3ULVE 2B59B 4D3CL 1FH2A 3QFDB 5T1MA 4S1DD 5KSBA 4PI2A 4JAMB 2NQCA 5TQ0H 4JRFA 1U3HA 1AKJB 1S5HB 1RZJH 2OQJA 3Q2LA 3IN2A 2P9RA 2X70A 4U1IB 3WL9B 3PIQB 5EA0H 4WHDA 3J27A 3EJZC 3MO1B 3AUWB 5D1XE 1LNUA 2CRYA 1P5VA 1LMKA 3CNKA 3T0EC 4Y19D 1C16B 2QTEA 1GSMA 4UB0H 5HHVL 1MELA 3E3QC 3EOAA 4YQXL 1VA9A 4AQAB 2B1HL 3WEAA 4WF7A 1RJLB 3ULSB 5TK2A 2JQAA 3MLYL 2JI1A 3R0NA 4XP5L 2HJFA 2JJVA 2MKWA 4MX7B 4QNPE 2LTQC 1IEAA 2YAOA 1J8HD 3Q2CA 3UJTH 3VFTA 1JHKH 2QDVA 1S4IA 1J0YA 3HOGA 4QR7A 3PDOA 4V11A 4AZ8B 4QTHB 4R7DA 3R4RA 4LEBA 5LB1A 3PWNB 1Y6NR 3UAJA 1H3PL 4KRPD 1OM9A 4OZGA 2EEAA 5SWSD 4ICXA 4XVOA 1JWSB 2K7PA 1N70A 5D2NE 5B1JA 2WO4A 3O41B 3ASOB 5L6YL 1EO8L 4Z0XB 5I6PA 4B3VA 5ILTL 3VTAA 1Q9KA 5HHMD 1YG9A 2CHWA 3MNWB 2AQ1A 2BIPA 3RNQA 3K4ZA 3L1FA 3FFOA 2E8ZA 1BCIA 2YRBA 4M56A 1O5PA 1XGUA 2IAMD 3QH3B 1CVSC 5I0YA 2VB5A 2OMXB 3SB3A 5D71L 5L4JA 3ARGD 1H3XA 2EXWC 4MNQB 3HI6H 3DJZA 2XY2A 1TJMA 3JUZA 3MC0A 1YN6A 5I1LB 4PRHD 1UZGA 4R8WH 2I9TB 4I18A 4XOEA 1NMBL 4YEFA 4PJXF 3CMGA 4KROD 2IDQA 5JXED 1XD0A 2YUVA 3QBTB 3WKML 4WDIB 1NJ9B 1QHOA 1CFNB 5G2NA 1FHNA 1G9NH 1MHPL 3CHSA 1AFVH 1I1AC 2V37A 4LLUA 4P4KD 4D94A 5JLZA 1MCJA 2RB8A 4DERA 1VZIA 2CAKA 1BWMA 3IDIA 4FS0A 4HKBB 3IDJA 3O3EB 4F7TB 3N9GL 5HJBA 1PMYA 3UMTA 2OJZL 2AQTA 1S46A 4BZ2H 2Z8WC 3JYBA 2HT2D 2C9XA 2W5PA 3NK3A 1T66D 4JRYA 2FBRA 4M6OH 4J3BA 3TH3T 3VWJC 3GSQB 5A3IC 1SNRA 5IVXA 3BKML 1JMXA 1KLUB 5DFWH 4DUVA 4AG4H 2W65B 2X6AA 4QOKA 4TPRH 4F9PC 3QUHA 2VDPB 3FB7A 3ZO9A 1M7DB 5DUPH 4IRJC 1AE6L 1WT5C 2BZ7A 5ITFB 3MZGB 3RWDA 2WIIA 1DJIA 4YDLC 3VCLB 5G4NA 2E9BA 3W9EB 2X41A 1JYVA 4MFHA 1ZTMA 1EPFA 4K23H 2KZWA 4M7JL 5L9DH 1SY6H 1NEZG 4YBQC 1QYGL 4IRSA 3KBPA 3TJHD 1MLCB 2D31B 2HB0A 4ZO9A 3LB6D 3D4GA 1HZHH 2HLFC 1I1RA 1IUZA 2VC2L 4JCWA 5E5LA 1SXAA 4HUXA 4MZ2A 4AVHA 1MFNA 2NZ9D 4JGMA 4HJ1A 3L7FB 2QKIC 2J8HA 3QNZA 3DYPA 2H32A 5FS5A 4IJ3C 4OKVA 2GY5A 4P2RD 2YGQA 3M8OL 4PJCF 1HHGA 1N6UA 1RSFA 2FGZA 3T4AC 4AMKL 3MUGA 2DMGA 1NTDA 3CVIL 2D3NA 1SLXA 1OSPH 2VLMD 5CNHA 2UY7A 2YSTA 1OP4A 1WIOA 2HKFH 4OUOA 1FLTX 3LTVA 4G7QB 5LCVA 4YSQA 2HT3C 2VLRB 4OFIA 1OQXA 1BPLB 3L4VA 3LS5L 5F1SA 2YD0A 3SE3C 4MJ6A 5GIRB 3I6GA 4F57L 3PABB 4M5YH 3H4HA 2CKBB 2XPGB 2JKNA 4WTZG 4XMKH 4PP2B 3TBCA 3LEXB 4PJEE 4FI8A 4JFFE 1S8DA 7FABL 4PY8J 4KXDA 1P9MC 1UKSA 5DI8A 5JDSB 3DWTA 3NJXA 3QJHA 1UQSA 5F7HA 4OIAA 1U8OA 1D2PA 2PW2B 1F8TH 1UB6B 1TF4A 4RQQA 4DGIL 4L4VB 3D51A 1DBJH 1R3HB 2AV7A 1D9KC 5B21A 2O30A 4FQQB 1AS7A 5EZLB 3VXRD 1P4LA 4FGMA 5CU9A 1I1FA 3K72A 2R4SH 3RWEB 3O6MH 2CDFA 4C8XA 4WI5A 4HOZA 3JWNG 1EDYA 2Y5TA 4KXBA 4PLNC 4KWUA 3GMOB 4WAFA 5EN3A 3QQXA 2X6CA 5L7XL 1IM3A 2XI9A 4WK2B 3VGGA 1YYMH 5GRUH 4NQDB 2WUBH 1FL6A 4NQEE 5F7FA 4PRIA 4XVTH 5KVFH 3Q8EA 7TAAA 1ZS8B 2OZ4L 1NCBH 3BAJA 1IVLA 2HFFA 2WAQA 4ZTOH 1HIML 2V2WA 4HIQA 2ALAA 3B9KA 2AAAA 2APFA 2NY0C 2VDOL 3D39E 3QZOA 2Z93B 1V3JA 3L16A 1XGRA 4ZS6D 2YAEA 4PRBA 2X2HA 5C3TA 3M1OA 4IBTA 5EBMA 3E9UA 2J1XA 2VZVA 2Q7NA 3OQRA 2G2RB 2IIJA 3DRTB 4KH9A 5FYKU 5BVPH 4XZ4A 5E1IA 2Q2LA 3DK0A 4JVUA 3JT2A 4FHKA 3UBFA 3ZKNC 5IK3A 4MGXA 4DK6A 1KBGL 4K5PA 5KVDL 5GGQL 2ZUQB 4KDTA 4GEJA 1EV2E 1PQZB 1QZNA 4MWFA 1ZVHA 4KTEH 5CR8A 3O2DA 4WI4A 1NEZB 5C6PB 3HE7B 5IW1A 3BFOA 2A9NH 1HDMB 3WTYA 5I19L 4LPUA 3OR6B 1FN4A 4JO5A 4KUCF 5HDBE 5E8EB 1QO3A 3EJSA 3MDJA 5IMLA 1B0IA 5HGDA 4AYFA 4EUPG 1KJMA 1RIVH 4N1EA 5TGBB 3TA3B 5DK3A 5C6WH 1AZVA 3NQIA 5C9JB 3D0LA 5CWSA 4GB9A 1TJIL 3O6FA 4K9JA 4FYSA 3DC0A 1MW1A 3GMLA 4OZ4A 3IGKA 1OGAB 3SDXB 4FXTA 4ZQKA 2EYSA 2NR6C 1IGCH 1GS6X 5FO8B 3CFCH 2ORBL 3B5GA 3H6AA 1ZSDB 3RPBA 5TTRA 3IJSB 1EFXD 2XG4A 1XCQA 1FE8L 2VRQA 1A4KA 4H5SA 4OZHA 4E41E 1KJVB 3MGAA 2WINB 1XF2A 4MNGB 1J05A 3MOAH 2Z1KA 2VWEC 4WEEA 3K6SA 2BNRB 3VXQA 1I7TB 1AZUA 4XNXH 3AB0B 4OR1A 2UY6A 5E24E 1MF2H 4I0PD 1ZLUH 1F5WA 1JF1A 1XGQB 3QSKB 4XPAL 5E6IC 3WFEH 1XCXA 4Y16C 5HHOB 1N4XH 2CA3A 4APQD 2X4UA 3FS9A 4ZG1A 5BS0A 1OP9A 1U93B 4F93B