3T5WA

2me modified human sod1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
152
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural switching of Cu,Zn-superoxide dismutases at loop VI: insights from the crystal structure of 2-mercaptoethanol-modified enzyme
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 37
structure length 152
sequence length 153
chains with identical sequence B, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3t5wA00
1SDAB 1AZVA 2LU5A 1CBJA 2WKOF 3ECWA 1F1GA 3H2QA 1IBBA 2R27A 1E9PB 2ZKXA 2AEOA 3ECVA 3MKGA 4A7GA 1B4TA 1SOSA 3LTVA 4A7VA 3HW7A 1SXNA 4A7TA 4A7SA 4BCYA 1F1AA 4OJAA 2C9VA 1SXZA 2XJKA 3T5WA 1F1DA 4L05A 2AQTA 4MCNA 5CU9A 1JK9B 3H2PA 3GZPA 3HFFA 2AQRA 2Z7YA 3CQPA 3PU7A 2C9SA 1XTLA 2ZOWA 4FF9A 1YAZA 4BD4A 1JCVA 1QUPA 2GBUA 2XJLA 4B3EA 1XSOA 2ZKWA 1XTMA 1OZUA 2E47A 1PTZA 1DO5A 3F7KA 2VR8A 1E9OA 2NNXA 1SDYA 1YSOA 1IBFA 1L3NA 5KBMA 2JCWA 1BZOA 1SXAA 4U4IA 1OALA 1Z9NA 3GZQA 2SODB 3L9EA 3S0PA 1EJ8A 1SXSA 4N3UA 1TO5A 2WZ5A 1DSWA 3GZOA 1E9QB 1S4IA 2ZKYA 2K4WA 1UXLA 1KMGA 1PU0A 2AF2A 1E9QA 1SRDA 1IBDA 2E46A 1F18A 3L9YA 3QQDB 1YAIA 1Z9PA 1UXMA 1RK7A 3QQDA 3KBFA 2WKOA 1N18A 4MCMA 2Z7UA 1BA9A 2JLPA 2WYZA 4BCZA 1N19A 1E9PA 5KBLA 1SXCA 3F7LA 2WWNA 3KM2A 1Q0EA 2WZ0A 4OH2A 1IB5A 2WZ6A 1P1VA 1PZSA 4N3TA 4A7QA 1B4LA 3ECUA 3MNDA 1SXBA 3K91A 1JK9A 1COBA 2GBVA 2VR6A 1OAJA 4A7GF 5KBKA 4A7UA 1HL4A 2V0AA 2C9UA 1E9OB 3GTTA 3CQQA 3KM1A 1OZTG 2Z7WA 3CE1A 3KH3A 1FUNA 1ESOA 2AQNA 2APSA 1SPDA 2WYTA 1HL5A 2AQSA 2Z7ZA 2VR7A 2WWOA 3SODB 2AQPA 3RE0A 3GQFA 1OEZW 1U3NA 3HOGA 3KH4A 1TO4A 1IBHA 1MFMA 2AQQA 1CB4A 3KBEA 2Q2LA 3GTVA 2GBTA 1EQWA
chains in the Genus database with same CATH superfamily
2ETWA 3MX0A 3MRLB 1J9TA 2ZWYA 4U7SA 1FPTH 4PREB 3T77A 4R5TA 3H2QA 3PJNA 4YE4L 5AVTB 4Y2DB 2Y7QA 5CINL 2YQ2A 3C8HA 4CC0A 2AI0L 4MXQD 4G82A 2ARJB 1W0YT 3J7HA 3TEXA 4F93B 3GSNB 5EORL 3BGFB 1GYWA 3OKLB 3QIWC 2BNUB 4E9SA 5B3JE 1TR7A 3BQUD 3P1VA 3CPLA 3N40P 5EG6C 1MLCB 5I1KL 4AYGA 1LDPH 2Y1VA 4XWGH 3HZVB 4M6ML 1SBSL 1IQWH 3OJ2C 1UA6H 5LNDA 1CF8H 5MENE 3ELQA 4KZDL 4YOKA 5EBMB 3HG3A 3OXSA 2CIIB 4H20H 4UQCA 3WNLA 4Q9QL 3MRCB 4AC2A 3RRQA 3FSWA 3STZB 4F33A 1M57B 3TESA 4HDIB 1Y0LB 4TTDC 5F7EH 3QORD 5J1AB 1N6UA 1KJMA 3QDJD 3U30B 1KXQA 3ULVC 4PR5B 1QBLL 1XHHA 3T2NH 1BJ8A 1ETA1 1N26A 2JTDA 2PYFA 2EO7A 1Q0XL 4S1DD 3NH7L 5HYSA 5ANMB 4DOHB 1N3NB 3DJTA 2OQJA 4JKKA 3NSYA 4MVBD 3DETC 4XNQA 5TH2B 1HZLA 3CVHL 4X4MA 4EAEA 4X8GA 5AVWB 3UL4A 1TOXA 1HAWA 2EEAA 3QQDA 1NLBH 4P04A 1OPGH 2ZXDA 2CNZA 2NY1B 4HOXA 1IZKA 4CSPA 4B0MM 4HPOH 4NM4H 4ODHL 1PMYA 2FEDD 4JHZA 4XNUL 5TK4A 1YEGH 1ZLVK 5CBAA 2MPAH 1BYNA 4N1HB 2K3TA 1R6VA 4LF3B 5TDPB 3TO4C 2AQ3A 3BZ5A 3TH4T 3ZSSA 4KVNH 4F9PC 1KFAH 4ZTPH 1MLBB 3UJTH 3QVAA 3HC4H 4BWWA 1IILE 2A1WL 3MA9L 1XXFC 2F61A 2VXSL 1TZ8A 1MWAH 5LKNA 4FQPA 3R1GH 4HPYL 3MUJA 3SDXE 4QXGH 1QX1A 4BV1A 2HLEB 4GO8A 5HDBE 3DX9A 5CEXA 3GLDA 3LXUX 2X09A 4LHUG 4XN1A 1IGTB 4WDIA 3ZO0A 5EOCL 4DK5A 5DS8B 2HFEA 3H9HA 1UADC 4P2QB 4P06A 1QSFB 5BPPA 4MAYB 1FNSH 5ICYB 3ULUF 3TXAA 3BHBA 3LB6D 3FYEB 4KO7A 5T3XL 4B95C 4ANWA 1UKSA 2DDQL 3B2UC 1HSAB 4WFHE 4WU7B 1HHGA 4G3YH 1U8OB 1L9NA 1S9VA 4OIIH 3RB7A 3VWJD 3X3GL 1I82A 3QEGH 4FQCL 4AKPA 5IJVB 1EQWA 3EZ8A 4R9HA 1U8OA 4G7YL 2IFFL 4EI0A 4M62L 5LBGA 1SHWA 1LEGB 2FR4B 4X6CE 3P4OA 1R5WA 4ELKB 1UJTA 2Q3ZA 3G6JF 2BNQD 1VADB 5C0RH 1NMAL 3LPFA 1UD8A 4J3SA 3WO4B 2CXGA 4GFXA 4HBQA 4KJYA 4L4TE 5C8JA 4P5MA 1VZHA 1RUPH 5ILTH 3FCSB 3GJFA 1LO4H 1E65A 1NCWH 3L1EA 2ZUTA 4WFEE 3V7AG 4POYA 2VM3A 4MCNA 1CLZH 5IIEB 1TF4A 5IW3A 3NH7H 4ZT1A 5FR3A 3KCWA 4X6FB 2Z93B 2GB2A 2YEVB 3V0FA 1E3FA 4PU2A 1VPOH 4QT5B 5ISZA 3FB7B 2M26A 4AMXA 3IE4A 4X5WA 1AY1H 1G7JA 3RWCA 4ODTH 4KTDH 4PG2C 3C5JA 2Y4SA 3EOTL 1T7YA 3HHRB 1RAMA 4QHUB 2XV2A 1OLZA 1MNUH 4P3CH 4X7EC 5IVXA 1QLEH 3O6MH 4NPYB 1YYML 5ABAA 4WW2A 1UVQA 3QEGL 4FQCH 5C1MB 5E94A 4HXAL 4JN2A 1EGJA 2DQMA 3SBRA 4MJID 4WHCA 2QELA 3GSRB 4NKMA 4IGBC 2EE6A 3HMWH 1RERA 3FUDA 2XTJE 4J7RA 4U1IA 5HDWA 1UXLA 3QBTB 2YPLE 3ISWA 5EU6E 4U1IB 2KERA 5CF3A 5H2BB 1KGWA 5FYKU 4KGLA 4BZYA 5LLIC 2YBGA 4DWHA 3ZKXB 1NKGA 2A2QT 3UGUA 4NQSA 1WRFA 3GGWA 4NQDD 2YHGA 3DSNB 2XWTB 4CVXB 2IH9A 4F91B 1DDHA 4XB3A 5AOMA 4NBZB 3MJ6A 3EOAA 4GRWB 1EMTL 1PYWB 3UC2A 3TO4B 2VW6A 2XVKA 5HGDA 2LLGA 3MLXL 5T5FH 3MJ9L 5HGDB 2VLJD 2PW2A 4CC4C 1EZVY 4OZGA 3V10A 3Q3GB 1TKWA 4JM0A 3TT3H 2EAEA 3NA4A 5AFAA 2B9AA 3PRZA 4Q6IB 1IC1A 4DNLA 3D69B 3F7YB 4K7FB 4YXKL 2G2RB 4LFHG 4O02A 2AJZA 3GMQB 3WMSA 3IKCA 3IDGA 3OKOA 1SM3L 4JFQA 5IVZA 4IMKA 1QSFE 2SEBA 2BP5M 2YD9A 3O9WA 2ZCLL 3I6GA 4KVCH 4NO0D 1A6UL 5FYJE 3HB3B 3PWNA 3BP7B 4YHML 3U2SA 4OAWB 3VQ2C 1NIDA 1JZGA 3DX7A 2WQAA 1B2YA 2RQEA 3FU0A 2AXJA 3SJVD 2F0CA 1XVSA 3FFCD 3MRKB 3RVWC 1JXFA 2WLZA 1GGYA 5JW3H 1RFDL 5DVLA 1X3DA 2OXHB 1Z5YD 4QXWA 2QVFB 1I1FA 5I8CA 4CDHA 1CYXA 3BZFB 2R0LL 5IW1A 3SE4C 2ALWA 1BM3L 2A6DB 2HWZL 1QSED 2NY1C 1YLBB 2C7UA 1GPOH 4KV5F 2LT9A 3PV6A 2ADIA 2WLYA 3VWJC 3DWTA 5HHOE 5IW6B 2J4WL 2Q86A 3SYQA 4W6WB 3CNKA 3K1KC 3BGMB 3QFDA 3B2XA 4ZO9A 2R59A 2CDGB 2EDDA 2Z31B 3QRLA 3FHAA 4LEBA 5AZ2H 3VFGL 4WFFE 2E6JA 4RRPG 4W6YB 1AGCA 2X5PA 4ZO8A 3ZKSD 4XCCH 1WZ1H 1IRAY 1WT5A 2FJGB 1G9MH 5DS2A 1XH1A 5AYTA 1MVUA 1OP5K 1UOVA 3LN4B 1PX4A 2MCMA 3W11C 2DKSA 3BIAX 3CCHB 4LDOB 2XTJC 1X9RA 2VH5L 5FC9A 3V7MA 5KBDA 3DYMA 3VI3F 3DROA 3FF8A 2IV8A 4Z0XA 5JR1L 4BRVA 2COQA 4XAKE 2VL5B 1EK3A 4LBAA 1JZ3A 4HC1L 4P48A 4F7PA 3W0WE 3D51A 1OAQH 4H20L 3BP6A 2ED9A 3HUJA 5D6CA 4NQED 3PY9A 4PCYA 1A3RH 3C6EA 1CDHA 4W4OA 2GTZB 2WWNA 5ETUB 1EFXB 4ZTOL 5E5LA 4PG9A 4QY8A 1QBLH 3T2NL 1UD5A 4P4RB 3WIFA 3UZQA 4WWKA 3KGUA 1KXTA 1MVYA 1NCOA 2B4CC 2P43B 3MRBA 4N22A 2VDLH 2C9RA 3T3PB 1JGLH 5G5DA 4HIEB 2L04A 4NQDB 1AANA 4AGPA 3NCBB 4HIEA 2C3WA 4QRBA 4OD3L 1Q9WA 2G75A 3MZTA 3F6IA 1QPXA 3PWPD 4KMLB 3MOBH 4H8HA 5TGBB 1D7FA 1IAII 4K8RH 4M56A 2VRAA 4F33B 1MJ7H 2EVJA 3BSZL 1HI6B 1PBYA 3GS4A 1BGXH 3ZN6A 2IC2A 4LEOA 4N25A 3LEYL 4JKWA 1YNTB 1U41A 3ZE1F 4Z8FL 4OJCA 1S7UA 4B9GA 4FNUA 2BVPA 4OFQA 3X11B 5F7DA 1BQHA 3O6KL 5JIKA 1WITA 1CTNA 1KYFA 2QGEA 4TVPH 5HJ3B 2CCVA 4MNQB 4QRPA 1MCKA 5EC2A 5HBBA 4OJFH 5EEXA 2WKGA 3TBSA 3V4VH 4QXGL 1KBGL 3RWHA 3R1GL 4HPYH 5DI8B 1UACH 4KZ0A 1JE6A 1F6AA 3G6AB 4WWKC 4ABUA 4P07A 1MRDH 1P4UA 3U1PA 4BBWA 1L9OA 1U8JB 3G9AB 1N59A 1KTDB 2VDOL 4LSPH 3TN0C 1QHQA 3QUXD 1Z3RA 2PPFA 4AVKA 5C0CE 4H1LB 4F8TA 1ROWA 4GIOA 4GW5B 4NNPH 5L8LB 1DO5A 1M3IA 3X13A 1KZQA 3LMJL 2O6DA 4L37A 2YN5A 5DJDA 1PF3A 3RWJA 4XP4H 3F5WB 2IFFH 4R8WL 5E8EA 4WDIB 3GSNL 3V9EA 4NJ9H 4GG6A 4GAFB 4XVSL 1ORQA 4RDQF 2BZCA 3ATBA 5FUZL 1YMHA 3SBPA 3KWTA 2RCSL 5ABZA 3OZKA 4JHVA 1TT6A 1WISA 3BYYA 1DVFC 1QLRA 2DL9A 4RMUA 4JRWA 1XSJA 3V6OA 2CXKA 5HPOA 1YAIA 1TJHH 3BD5A 4C4KO 3HNTL 3QDGE 1QSEB 3GB7A 4DCQB 3EJCA 4PRIB 4E9TA 2WM0A 4YQXH 1B0GB 5IKCA 3IB4A 4D2NA 4HCRL 5I6XC 3PGFL 3TA3A 1TG8A 5JA8B 5JPNC 3LY6A 3T0ED 3L1FA 3NSCA 4HBCL 1BAGA 4JRXB 3B2DC 3Q13A 1JGVL 5L2KE 3WI9A 3C6LB 2A9CA 4Z77B 3RX5A 4R8WH 3VFTB 1ZDQA 2UV3A 1HXMB 4KKPA 4P57A 1HTYA 1JFQL 2OSWA 8FABA 1YZZA 3EBIA 1EPFA 1RPKA 3UYPB 1OSPL 2JKIS 3G5ZA 4PCSA 4F80A 3D0LA 2BNRE 1JHLH 1NAKL 1HQRB 4Y1TA 4OKVB 3V5KB 3LHPH 4NC2B 3IJHA 3AU0A 3RPIA 1RSFA 3SGKA 1J5DA 3VWJB 3RPIB 3TEUA 4OLYL 1A0QH 4AXWA 4F24A 1O6VA 3TEWA 4OGAD 3RVTC 3EO1A 5CIPH 1KY6A 3N85L 4JRLA 3HOGA 1DUZB 3ZT6A 2ICCA 1KYAA 3FT0A 4XXWA 2WXRA 4HMEA 2EDHA 1O6SA 2N0KA 4XNXL 3MGOA 2X2YA 3L48A 3SOBL 1S7XA 3OWEA 1FORL 3D39A 3W9DB 2K7QA 4LHQB 1UKQA 2FE0A 4NZDA 4ZMYA 2R27A 3TT3L 3HI1B 4A2LA 3GI8L 3QO1B 3EYVA 5DJAB 5F7NC 5J1SC 4E0RA 1O5PA 5AL8A 1KCRH 2OTWB 3CX5K 1AO7D 5HYQA 1HINH 3O41B 1HQ4B 3QO0B 2V9RA 5T1MB 4BQBA 3QXTA 4YWGH 2E6PA 4IRSC 4WCYH 4IRSB 3K74B 6CGTA 1AHMA 4LLQB 5GGTA 2W95A 1JYWA 3SYCA 3EADA 1GSKA 1QUPA 1T1YA 3BRDA 3CLWA 1GW0A 5AOJA 5DZNA 2AK1H 1A7QH 4UV7L 2YLKA 3SCMD 4GQQA 5D7LA 5KSAB 4ZFOB 3CHSA 4PJGB 2ADFL 2P9RA 4PJ7E 2WO2B 2VQUA 4P59L 3T6XA 1VFUA 2Z92A 1I7UA 3IDMB 2QMKA 1RVFL 2Z92B 3LIZA 1IGIH 2CBQA 4HS6B 1TEGA 1ZK9A 2KMWA 4H2AA 5F9OL 1F3RB 3FBKA 4HCIA 2R69A 3CWGA 2VMEA 3M6DA 2G2NA 4K23L 1QQDB 5EFIB 5I5MA 3QUKA 1E0OB 4MVBC 2OX5A 1IFRA 1ZWIA 3BW9B 3D2TA 4JFSA 3I9GL 3QUKB 2DMBA 4FCHA 4N0CD 2F1BA 9CGTA 4PJCF 1UD6A 1XCXA 2ORBH 4M1GL 2UWEB 5KS9F 5CKGA 4Z9KB 2XG4B 2V9UA 3VJ6B 1TQCB 2P44B 2Q7YB 4AGOA 4HKZB 3CDGA 1T3FB 5JHDB 1LEKA 4AYBA 4RFOH 3RAJL 4WV1B 3NRPA 1ZGLP 3A67L 1XCQB 2JB6B 2VMCA 2X4QA 1OD9A 2ZTBA 5I1CL 2DWDA 3V4PB 5KVDE 3FQRA 1RZQA 1S7QB 3RDTC 3WLWC 3S48A 1T2QH 3PP4H 4AYSA 3ZUCA 1NWPA 1ZPLA 5KVFL 1OPGL 2CBTA 1AR1C 5AB0A 1AC0A 1N0XL 4HUKB 2J6EL 1F8TH 3CE1A 1I3RA 1UJ3C 2V8MA 3VMPA 4WO4B 3GS7A 3BWZA 4LPUA 3EH4B 4PWHA 4I18B 3IFOA 1GS6X 5C0BA 5IK3B 2XETA 2BOBA 2DMHA 2PCPB 5EEWA 5IHZA 3ETSA 5C6PB 5LAXA 5DC0A 1WBZB 2HJFA 2R4SL 2DAVA 5HYJA 4HH8A 1RJLA 4NSKB 4YSEA 3U7WH 12E8H 3QEUA 1DN0A 4ZYKA 2NUPA 1Y6MR 1AJ7L 4NWUH 1D7CA 2WKOF 4YH6A 1DN0B 3RNQA 4P5TA 2XHNA 2NXZB 3GMLB 3QI9A 3TBWA 1QUNB 2G2PA 5DRNB 1Z9SA 1GHFH 2R0KL 1ZAGA 2FQGA 1PFOA 3TBWB 3WIAA 1P1ZB 5GRYA 5I28A 1PZDA 3DVIA 4QKXB 1T21A 1JZEA 3OJDB 1B4JH 5DGRA 2ZF8A 4RMSA 1EANA 3GK8H 4XPBL 1MQKH 1GGCL 4ZW3A 1HEHC 1BYPA 4WI4A 4ADGA 2LTQC 4OZ4B 1OP5H 3Q9QA 3ARGA 3FT3B 3GSOA 4BD4A 5LXVA 1DBKH 3GSWA 4IU2B 4DPCX 4A67A 2W0KA 2MCPL 1B0WA 1W6LA 4X8JB 5D1XD 5TE4H 3ZW3A 4WU5A 1NCIA 1G84A 5C0RL 4MJ4A 1L5GA 3LYRA 1UB5B 5F7YC 3VXNB 2EDYA 3LKNA 3ZDZE 4A6YA 4ODUB 4Z7NE 3ZDXF 3HS8A 5HYFA 4MB4A 4NC1E 2AK4B 2Y1YA 4RQQB 4LO9A 4GG6F 2ICES 4PRPA 5HHMB 3FHEA 2NY2D 2I07B 4Y7OC 1NOAA 3BIBX 4XVOA 3VG9C 4BFFA 3FRUB 3PLYA 2XIDA 2P7TB 3NK4A 3QDMA 4DVRH 2A6IA 3ARDA 1TO5A 2EYSB 1BMGA 2FX7L 2D7MA 3ES6B 4RDQG 1JF6A 2OMZA 4XTRC 1SJMA 5IB2A 3DJRA 3DX8B 1T22B 4KFZC 5B22A 4L18A 4X80H 4LKCB 4JPIB 5AG9A 4HWZB 5FFLA 2ZAIA 5LQBL 2JH2A 2AK4D 3FN3A 4G9DB 3O4LA 1BECA 3OLDA 5J6SA 2R1YA 1BVOA 5IVOA 2F7IA 2R1YB 1WFOA 1NFAA 4JZNA 5KVDL 1JWSA 2JQAA 3WIHA 3WTXA 4NJ9L 1CE6A 3Q1EA 2VC2L 2YOAA 1LP9F 1CDJA 3BLKA 4D0BA 2VR6A 3QRFM 1J1PL 2P5WE 4AQ1C 4Z76A 2M83A 4NQDA 1TZOA 3KPSA 3S5ZA 2E4FA 2EXYD 3RY5A 3PPEA 4E9VA 1CICB 1FL5B 3ESMA 5BVPL 4FAAB 5CGYC 1KGUA 5GS1A 3NSXA 4MAUH 1KPVB 4EQ2A 1OGAE 5TDNB 3MBEC 1W91A 5GS1B 5MENB 1HHHB 2H5UA 3MR9A 3BDYL 4WTZA 3OSVA 2A9NL 2CR0A 2G4EA 5J13C 1TZHA 4ECNA 1U3HA 2BERA 2EIKB 4WO0A 1F90L 3K6FA 2H2PC 5KJRH 3LZLA 3V4LA 4B9JA 3GEWB 2IPUK 4R4ND 1FZKA 1FZJA 3D87B 4WO4D 1T5XB 3APMA 4QRQA 5SX5H 3BH9A 1NGWA 2D3VA 5AVYB 2J8UF 1SXNA 1PW3A 1XZ0B 4CMMB 2E56A 4JN2B 1MWAL 4EZKA 3MJWA 1AP2B 4FFZL 2IH1A 5FYLH 3E8VA 5DQ9A 1ACXA 3RFRA 1V27A 4OLYH 4FF9A 4Q4EA 3R7RA 5ID1B 2AGJH 1LWRA 1AOZA 1NMAH 3X13B 3HEIB 5FKAA 1G6VK 5MEOB 3DBXB 1CU4L 3AXLA 2V7NA 2AV7A 3PHQA 3K72B 2V6HA 5JLZA 2R8SL 2O5ZH 1DEEB 5IMKA 3VXRD 5HVFB 3QS2A 5C07B 1DEEA 4BK5A 1FORH 1UA7A 1MFCL 4JG5A 3SOBH 1YSOA 5AENA 5E6RB 2CJ3A 2JCWA 3KGTA 1SXAA 3DIFA 1D3CA 2O6CA 4R26H 3RURA 4JANB 4IKKA 5E2UH 5GQBA 3V5DB 5B3JF 4FADA 4OZHF 3VFWA 4I9XA 2DD8L 1H3VA 4AYFA 2PO6A 3ULUH 5T3ZL 2P3YA 4NNYA 4JRYB 2WOBA 4XBGA 1GGTA 4P4KB 4BZ1H 1VEPA 2UYLB 4ODTL 4P2QE 2K4WA 3VA6A 1BAFL 2YQGA 3NSDA 4DUWA 1FA4A 2PW1A 4KXZH 3MTRA 4MDJA 4JFZL 1BEYL 3EDJA 3IN0A 2QV2A 1B0GA 5DC2A 3VFNB 4TQEH 2D7NA 4S0TD 3PQYB 5DZOA 3X2QB 2NY6B 4FI7A 3KVQA 3H7LA 4ZUWB 2BSCA 3HZKA 4FI8A 1Y1UA 3VXSE 1BXUA 3T2OA 4P5MB 3G5YA 2WPGA 4CUCA 2MRYA 4BYHA 2P5EE 3CZLA 4P23D 5EWIL 3AG1B 3NJLA 3WN5B 3MJ8A 5CLYA 1GYUA 4NHCH 4NCC1 5H37A 4CDGC 1GY2A 1ZE3H 3CFDB 3QZNA 5DRXB 4FQ2H 5HHNA 2PWGA 2XPGB 1Y1DA 5DRXA 3VTTA 4Y1AB 3KBPA 2DOCA 3QNXA 3FTUA 3GXDA 5FLVA 1SMAA 2Z34A 3K46A 1C1EH 2MCG1 5E8PA 4MD5A 1SOQA 2EDNA 1GTNA 4NZRL 2G60H 4X5LA 1CDBA 4U7MA 3RNKA 1DSFH 2PN5A 2YMXH 5TDOA 1HKFA 4C83B 2EIBA 1YQVL 4PJDF 4NZFA 2X42A 4KBPA 4B3VA 1OW0A 3BXNA 2CALA 3FOMA 3EFFA 3MV7A 3QPXH 5EFIA 4FI6A 3K6NA 2EUZA 5F71A 2AZAA 1OOWA 5CEYA 3FUFA 5GRUH 4Z7IA 4N2CA 1UFGA 1RK1B 1S7RA 3HB3D 1AGDA 1IM9A 3U0WL 4XPAH 4EBQH 4X9HA 3IU3A 3S96B 5DLLA 4AT6B 3C8DA 1CTMA 1FGNH 1FVCB 2ESVE 2PR4L 4ELMA 4MKTA 5IFHL 3JV5A 2D3NA 2NY7L 3RTQD 1JYXA 4KNUA 3HAEG 1NINA 4AWJC 3MBWB 5L9DH 4JQIL 4FQIL 1T1WB 4PJCA 1XGYL 1E4XL 1P6AB 3VXSD 4TTDD 1HKLH 1H3UA 3L4VA 5GGVH 3L5WA 1URZA 3SKOB 3NCFB 3NAAH 3VXMB 1T1YB 1D6EA 5CO1A 2B5IC 3MLTA 3LN5B 4EIBA 1AFVL 5HXMA 1NOFA 4H1LG 5HVHC 3GXFA 1NUDA 4R7LA 3TBYB 3CVIL 4YR6B 4OZGB 1N5YH 3QNYB 3WKNA 5HJ3A 1XF5A 4RX4D 1BAWA 1BG1A 5JDSB 3FTXA 1N6QL 1W8OA 5C07E 1WS8A 4MJ6A 4WFED 5I1HL 4GP5B 1ZTXE 4YC2C 4M62H 2OTUB 2X4UB 2WQXA 4NRYB 3CZEA 2FQFA 3E80A 1MLCA 3LXBA 1A9EB 2C9AA 3CU7A 5DJZA 3MRMB 1KXTB 2BVYA 2DI8A 3T8XB 3SOTA 3TF7C 2VXVL 4JO1L 4MYWB 3F2LA 3MRGA 4U6VH 5AZ2L 3TYGL 5I9QC 4YHOH 4FCAA 1YNLL 1XIWD 1OCOB 4Y4KA 2ERJB 1E7VA 3FQ1A 1CQYA 1HHKB 3BUTA 3Q9PA 3UTTE 4GIAA 5BUGA 5TE4L 1THAA 3NGBB 1L0XA 5SWQB 1RZPA 4EIUA 4ODXB 1RJYA 4HXBH 5AW9B 2VLME 3FQUB 5C70A 3T09A 1UG9A 2NZ9C 5LDSA 1BVKA 4BHUA 3RTQB 3DBSA 1EAPB 4X6BB 1R3HA 5HHOD 4LFHD 4H2CA 1A6AB 4O2CA 4MCYB 4Y16D 2F7PA 5D7JA 5EU6A 3IN2A 5HI5D 4ZOEA 4DW2H 1VFMA 5DTFB 2A9AA 2W38A 2L7QA 1GA2A 2AJSL 1EDQA 1JZ6A 3R19A 5ANHA 5FV2A 2JXMA 1F4WL 5HHOB 4WWPA 3RFZC 3FFCE 4Z7UB 1FYHB 1INDH 3ZU8A 2IGFH 2XWEA 5SV3A 3D5OF 4UZGA 1KTJA 2P7TA 1S9XA 1T6BX 2OSXA 3S3SA 3NTCH 1T6WA 1IAOA 1IM3D 4N8VA 2AJXH 4D9LL 5I6LA 5J12B 2X9ZA 4HWBA 5EULV 3DHMA 2HTKD 4P23A 3D09A 3NZHH 3H9HB 3D18A 4Q6KA 3AY4C 3ILEA 2Z65C 2FH8A 4PV1C 4TRPL 1GJUA 4K3JH 1NWOA 3S8WA 2QVKA 1UGNA 1JGLL 4IBVA 4DO6A 3HAEA 3PWLB 3SE8H 3V6ZB 3KLHD 2EXYC 1YEFL 2QQLH 2TRYA 4HIHB 4YBQC 2AQRA 5JOEA 5IM7A 3RWGB 3BDYH 4ODSL 4A2DA 4LLMB 1G7HA 2OYKA 1JJUA 2XWJB 4JO8A 3ZBMA 2PPDA 2EC9U 1SOKA 1ZS2A 2RR3A 4Z3EA 1ANUA 4WZ9A 4IDJL 2P5PA 3IMTA 4I0KA 4MAZA 3DYPA 4EJ1C 3GI8H 2M8XA 3FQNB 2BY2A 4U6HB 1FL5A 1N4XL 3VFPA 2HH0H 4OBRA 3D33A 4CC4A 4DK6A 1OANA 3UC0H 3ATAA 4OCMC 1D9KC 2DJUA 3JTSA 3ILDA 1DL7L 5D1QE 1E4KA 3FB5A 4XH2B 4GRMB 2XNAA 2Y7NA 4Q9CA 2A9ML 1JPGA 3QXAA 5M94B 2F8OA 4ZJ9A 4KPHL 4LSVH 4XX5A 3ARFB 4CVWA 2OKMA 2WBXA 1OP9A 3QUXA 1UXMA 4E9QA 1G9MC 1D5IH 4ZUTA 3U4KA 4G9DA 2JQZA 1WD9A 2BSBA 4YHIB 1N18A 1ZVHA 2VAJA 2LFGA 2OAAA 3RWCB 1TVHA 3OB8A 4QYAA 4S2SB 5CR8A 2LU3A 3FMGL 1IGIL 5CMAA 3PHSA 3G08A 4MX7B 1CJYA 2DLIA 5A2IH 4WW2B 5KW9H 1J86A 1G5GA 2J8UA 2CM5A 4KY2A 5IHBA 3VD9A 1XF4A 1I7RB 4WJKB 5F0PB 4M7LH 4KUCF 1P9MA 1FC2D 3GSRA 5GJTL 4F9LA 3SQBA 1N4XH 5HHXH 2OMYA 1R0AH 4JO3L 2JKXA 1KDIA 3EJYD 3TIEB 2VKXA 2VM9A 1NSNL 1S7SB 3OX8B 4OZFH 4QHLA 4FP8H 5D9SB 3US1A 1PZBA 1KNOA 1OGTB 5D72L 1H19A 5L0QB 4NN6C 3UTSA 5DJDB 3UIZA 3UYOD 3S5LB 3L81A 5E8EB 3AVEA 4XCEA 2CMRL 4ZZFA 3DTUB 2XWTA 1RMFL 4TYUA 4WUUB 3QIWB 3TJHD 3IYLW 4UM9D 5C6WH 4WW1A 5SWSE 3TA3D 3Q2LA 4F37K 2AKRB 1S7TB 4POUB 2DWEB 3QUXC 4YBLC 1RH8A 2V3DA 5EU5B 3VGAB 2OZNA 1MCSA 1FLRL 1AR2A 2J55A 2B3RA 1UQSB 4UIMA 3O8XD 5C0AA 3WD5H 2DQTL 4EMZA 2WGNB 5C0BD 1B6UA 2J3SA 3EBHA 1UENA 2ZUXA 3BQUC 3CFEA 5GGSA 1UM6H 3NVQA 1NFDE 1BBDH 4JFHE 3ZE0B 2NQDA 1I9EA 3THML 3DO4A 2WXMA 4GSRA 3VXTA 2C9VA 2ICEB 3IMRA 3FB8B 3ZE2F 1JG9A 3TT1H 4B9IA 5EU3A 4UAHA 4AG4H 4ATWA 2R0ZH 4GAAA 5I23A 2EADA 4X4ZA 3CSPA 3MLUL 5BRZD 5KYUB 2DMCA 3W5NA 2FSEB 4OD1L 2YD3A 1B88A 3BKJH 2EDRA 5C07A 3LZFL 4KOBA 1U8QB 1HNFA 3FQWA 4LLYA 2AABL 2KH2B 2GJZA 3HS0C 3UYPA 2WBJA 4PBWD 4DKEL 3IMVA 3ZHLA 1A7OL 2GEQA 4UCFA 1E27A 1RZGB 4TNVF 4YSAA 3B5HA 3JV6A 4JRYA 2G3MA 4NN7C 4XBGB 5GGRA 4M93B 2GUOA 2DWDB 3V4PA 5L9DL 5JOFB 1QA9A 2W65B 4D3CH 1FNEA 3GM0A 5F7HA 1G43A 4FERA 3GLZA 1KIRA 3L5JA 4ETQA 2OJEB 4YHPA 1HNYA 4G59C 3ECBA 5JHBA 3OR6A 1HINL 1I4FB 3P77B 1U36A 2H3NB 4YDKL 4P5TD 3X14B 1B9KA 3MHZA 4PJ5B 2FK9A 5FYJH 4PRPD 1JDDA 2JKSA 4YFDB 2WWKT 3EYUH 5SWZE 3GRWA 4GW4A 5AQ0A 32C2B 4G6JL 1LGVA 5T3XH 3MODH 3K5RA 1ZVSB 5A2KH 4ZMLA 1CFBA 1OK8A 3LVEA 2X7LA 3AFLA 5J12C 4EI6B 3QQ4B 5DFAA 2GFBB 2HJFB 5ISZD 1HZHH 1CYGA 1ZHKA 4A39A 4HIQA 1I3GL 2DEYX 4M5ZL 5D1XB 3ZDYF 2RFXA 1JMXA 3G3LA 1H9DA 3B2VL 3F7PC 1G7IA 1NBZA 2PXYC 1BQUA 2VZTA 4FGMA 2GJ6B 1XBDA 4QRRB 2ZJSL 1KN4H 1MCFA 3VGGA 3FO1A 2YEZB 2XWDA 4RBPK 4Y4HB 5IROA 4X6DE 2BM3A 3VQLA 1YNLH 2C7FA 2DQTH 1EAJA 2IANE 3KXFB 5T8IA 5D7LB 1ZHBA 5DJCA 3ZYZA 1OCWH 5FCUH 3RNKB 4ZS6D 3QA3B 1P7BA 2H2SD 3SODB 3ZOAA 5ESAB 1LDSA 3ARDD 3IJ7A 2VC2H 1E4JA 1ZA3A 4R4BB 2C7UB 3WEBA 1KJ2L 4L4TA 4GXVH 3BPLC 2J6WA 1QW9A 1ZKAA 4MDIA 1I8LA 4LEEA 5GS0C 1WC7B 3HRPA 3ZTNL 2N0MA 1SUJA 3V5HB 1SBBA 4TUOA 2XQYA 3LEVL 4LEXL 2ZOLA 3TBVB 3U36A 1I3GH 1EIBA 1U3HC 1RZJC 4L3CB 4M5ZH 5GGQH 3TBVA 4BCYA 2LABA 3WSQH 3FTWA 2Q10A 4GQ9L 2Q7YA 1S8DA 2EYSA 2P8LA 3ES6A 5BOJA 2DWSA 3UDWA 5F7DB 2D7TL 3BE1H 3FO9B 2J71A 1J87A 2JB6A 2X4QB 3IEAA 5SWSD 3OMIB 3DVGB 4G72B 5TFSH 4DGYH 2VXQH 1HOEA 5IG7B 3JXAA 3QCUL 5FGBA 1AE6H 2ZX8A 3ARXA 1I9JL 3MV8A 4FQ1L 1EZVX 1NCAH 2VDNL 3IU4L 2ENJA 3DMMB 4MS8D 4PGDB 3RQ3A 2NQ3A 3TBSB 4IBSA 5T5FA 1ORSA 4MA1C 3MGTA 2ENSA 4YDZA 1A3LL 4XE0A 1SN0A 3WHXB 4X7CC 1MFAL 3BMWA 1ZHNA 2GK0B 5IBUB 4JREC 2H1XA 2XRAH 3EJZD 2FH6A 3LPWA 4R7XA 5J11B 1NC4B 3UZQB 2O61A 5J9PB 3D2UD 1CLOH 4AW7A 2Y2WA 2H3XC 2GTWB 4CSZA 5BXFA 2MFNA 3S5YA 4B7LA 1KJ2A 1PU0A 1KOAA 1IFGA 4P9MH 4WI0B 2VC2B 4XPHL 2XLLA 1TQBB 5CUSL 5CZXD 3K72A 3N9GH 3EYFA 5GISL 3AXHA 3TVMC 2MSPA 4IDJH 3SDCD 1RJYB 3P0GB 2OP4H 3EYOA 3QK0A 5DMKA 3TLRA 5DWPA 1PY9A 4AEHL 1FFNB 1QW8A 1NEZB 5E70A 3ZYOA 3ULUE 4BGLA 5FOBA 2V2TB 2BVPB 4BFNA 1TETH 1UXWA 3PXJA 2WQRA 2Y36L 4Y19A 5KYNA 3Q8FA 4NT6A 2DEWX 3CXDL 1EDHA 1RUML 4K71B 4PGCB 1F4HA 4IOFD 1KEML 1SHXA 1N5AB 4ZMZA 4X7DC 4G7YH 5F9AC 2DQHL 3VWKB 3I6KB 3WJLA 4FZ8L 3LQMA 2APSA 4MXQC 3T8MA 2EYRB 5K9QI 1FO0B 4AE0A 5MP6L 3PDGA 4JFFE 3AACA 2Z7ZA 5EUKB 4PD4J 4IRZL 1ZMYA 4IRJC 1M9WA 3UTQB 2AK4A 1ZA6B 3Q5YA 4PH8A 4UDTB 2Q9OA 4V2BA 4UB0L 4HQQH 3C6LC 4CKVX 4GAGH 3FB5B 2F7QA 1Z9MA 1WUNT 2ZCHH 3WLBB 3VUAA 1QFWI 5EN3A 3EHBB 3WEXA 3CFDA 1TZGH 5ICXB 3QCUH 2H0EA 2W9DH 2Q6WB 4HH9A 3PP4L 1R3IH 1X6LA 3MKGA 1BCIA 4J4PC 1UFUA 3HAEB 5FS5A 3V6ZA 2EABA 1DQDH 1OXYA 2YEQA 1TSHA 3FQXA 3RP1A 1CI3M 1QLRB 1UZ6E 4NQVA 3L7EA 3NJFA 5KBNC 3IE9A 1DJXA 3B34A 4H26A 2BIIA 3IPBA 1E4WH 2FWOB 1JZ4A 3HS0A 3S37L 1MWAA 2BSTB 2VZSA 3HS0B 1VB9A 2YZ8A 4ISVA 1FLRH 4R2GD 3D9AH 1L3NA 5GPRA 2E7LC 2HX9A 1AGEA 3BUYB 3VQ1C 4FTVD 3IAGC 1RZFH 1SVCP 3MUUA 2XQBL 4J28A 2YZ1A 2FWSA 3DO3A 5DZLA 4D8OA 4XNYH 4PUBL 3THMH 1TQTA 1M2OA 1W72H 3H6AA 3HPLA 4HKXB 4F7CA 3OJVC 3GZOA 4ZK8A 3CFCL 2OL3B 4XMKH 1J5CA 1DHKA 4RGNE 4PJGA 3FUMA 1ET5A 4IRJD 3HE6C 4O51B 4TNVK 5IMLA 1MNNA 4XPGL 3VFOB 3LZFH 3QC5X 2IADA 1F3JA 4R0LC 3ZE1E 4Z7WB 3TA4D 3EGSA 3HS9A 4L0YA 3GZKA 4BCXA 4OCXL 4JDVA 4X5RA 3DUSA 2D3JA 3HVNA 4L9DA 3EXLA 4FABH 5I0XA 2DJMA 2WQWA 2OMYB 3MRMA 5DMIL 4FJYA 5EV7A 2Z9TA 1IAKB 3WV0A 4DESA 3P3YA 2VR5A 4NUJB 1YNKH 4KUCD 2H47C 1MCEA 5D5MA 4IIQC 4XC1L 2HKFL 3QDHA 4P05A 1J5IA 3TYFA 4H5SB 3GGWB 2I9LA 2YPVH 3KH3A 5B21A 5L0QC 2IMNA 3DX6A 5ESVB 1VGKB 1CQKA 4G8GB 3SDCC 4NHCL 1XIWB 1PYWA 4F9LC 2OSLA 2JCCF 2LU7A 1FAKT 2E8YA 2VQ1A 4YDVB 4PSRA 3WE6A 3ZKNC 2AKRA 4NHUA 4DVBA 3UBXA 3M17A 5GZOC 1ZT4A 2OLDA 4OF0A 3WE6B 3KH4A 3ARVA 1EA9C 3FF7A 3Q6GL 4G8IA 4J6RL 3QIUD 1AZRA 4N85A 3QQ9D 1WGOA 1FC1A 2CHZA 1MFBL 3UBXG 4ZFFA 2Z4TA 3ZDWA 3B2VH 4FNRA 1RXLA 1CDYA 4J3OF 5C0EA 3MRFB 5E24E 2HAZA 3ARDC 3MRQB 5EIQA 4YLCA 4UUJA 4J2XA 3ZMNA 3ILPB 5I1GL 1ET7A 1HSBA 4Z7UF 4ZPVB 1U2YA 1WA1X 4POZD 3SDDD 2X7LB 2MTAA 3F04A 3HE6D 5ACLA 3HI5L 4AI7A 2HT2C 4UINL 4B3EA 1QSVA 3VXSB 4G6AC 2P47B 4RZKA 5I73B 4Z7OE 2LHAA 4KZEH 3TJHC 2YGOA 4LLYB 2X0UA 2XTJD 5E8DH 2FLRT 5FA3A 3C60C 1JXKA 2JIXB 5B7EA 2CGZA 2GKIA 2JLLA 4K9JA 5BO1L 2R9HC 3FSVA 5HYSG 3JWNC 4JHUA 4HKZA 4LP5A 4GEIA 4PTUA 4ODWA 1TPXB 3L3IA 5EBWA 5I24A 3MLSH 2XWXA 4LPWA 3MA7A 3Q6GH 3LEXA 1P5UB 1QA9B 2MQ0A 2X3CA 5DD0L 2TSAA 5F9DC 3MTXA 3MRHA 4P9HH 5D6DA 2K0RA 5GZNC 1QBMH 2F19H 5D8JL 4O58L 3HC3L 3N1QC 4U4BA 5C0JB 3WY3A 4GUQA 4L8SA 5C9JA 3MFGB 1TYRA 4OD2A 4PJHF 1LO0H 1U3YA 3X12B 1MY5A 1H15A 1VFBA 3DV6A 2B59A 3MUGA 2CO7A 4Y2OA 2ED7A 3PJSA 5F89B 4JDZB 3U0TA 3DV6B 5BV7B 3RG1C 1TTGA 1KCVL 1C7TA 2MIZA 3T6WA 3LOWA 3KPQB 1J9QA 1I9JH 2JXMB 4Y1SA 2F8XC 1NEPA 3IU4H 2FDBP 4RGMC 3SO5A 1MRFH 4ADIA 3BI9X 1PNCA 1U8HA 4YDIL 1GZPA 4OQTA 4PRDA 4PS4H 2R9HD 43CAA 1Q4NX 2GI7A 2QSTA 5FO8B 1UJ3A 4G6FD 1IAIL 5I1LA 4N2IA 1PLGL 2YWYA 3SYOA 4CU7A 3S97C 2DYPB 4HWBH 1TTUA 3TPUB 5IB1A 4H88H 2ENPA 3WFBH 4CN6A 1ZLUH 5ALCH 5D4QA 4OJFL 5EBLA 2O5YH 1RU9H 4WGKA 4ZUSB 1MCJA 2QZ5A 2DH2A 3R18A 1WIOA 1X4ZA 2XWCA 4AKQA 2YQBA 3VXQA 3GPEA 3ALPA 4Z78A 2ITCB 4KAQL 3P2TA 4U6VL 3TYGH 3BKMH 1E5CA 3QIBD 4PV9A 1DVFA 1RV6X 4G9FB 4NRZB 2X38A 1L7IH 4IRJA 3T6VA 1ZSDA 2ZSWB 3TL5A 1OB1B 2DIJA 3OZLA 3ZZSA 2J73A 3RGBA 2EC9T 5DO2D 2YPLD 1DZ0A 2DQUL 1PZ3A 5JPMC 2TRHA 4FP8L 2VXTL 1KWKA 2XY1A 3N3EA 1E42A 1BFVL 3KS0J 5AKRA 5EZIL 4QTHA 3QP3A 1CFVH 3ARGC 2YC1A 5CSZA 1XWVA 1LD9B 4I13B 3L16A 3MRCA 2ZXAA 3GMMB 1PLGH 4GXUM 1W8EA 3FO2B 3CN0A 4O5LL 3WEMA 1DBBL 1Q0YL 4KJWC 4DP2X 4JDEA 4E2OA 4W81A 2PCFB 3SN6N 4HWNA 1A1OB 1ZS8B 4BKLA 1ZTXL 1EV2E 2ATKB 2ESVA 5HHMD 1CXIA 4ANKA 4XOEA 1R3HB 4MAYD 1GZQB 4X5WB 5G4NA 4PJXE 4QLRA 1F4WH 2H6UA 3NIFB 5E8OB 4N20A 3K6IA 3IM1A 1YN6B 3BQUA 4QHUA 4RRPA 1TZGL 3P9MA 4L8BA 5IM7B 2X44D 3NSFA 3UDWC 4KK8D 4EN3A 4Q9QH 1D7BA 1JMZA 3SEPA 3U30C 4HCRA 1L0PA 3QDJE 4EKXA 1XZ0A 3FUEA 4JKPH 4CMMA 3I50H 5BS0E 5HTSA 3J27A 2X40A 4IS6B 1F11B 5KS9B 1DVQA 1V3LA 3RY6C 3L1OL 2ZKYA 1D2PA 3RUGB 1R5VB 3FFCB 2VDKB 5D7IA 3FC8A 1J8HA 4PYGA 4F7MA 5L7XH 1DUYA 2NZ9D 4MNGA 2AABH 4ACTA 3KBFA 1KPVA 5JOPE 4JMNA 1KCLA 1A66A 3QZLA 2VLRB 5IOPA 1A21A 2K78A 5CWSB 4PTTB 3V9CA 3FPYA 4ODSH 5D7SL 2YA0A 1UB6A 2YD6A 2GPZA 1JN6B 3L4CA 5ICYA 3T04D 5J3HC 5TJWK 3MNMA 2VL4A 3GJEA 2IPTH 3QJTB 2WLMA 4HUWA 4W9HC 3KWVA 3QHFL 4B5EA 4UZUA 1M3JA 1UM4L 5I9QB 4TULL 4NUPA 2IPUG 1RIUL 4GUCA 5B1BB 4BQ9A 5DQDH 2X4NA 5E9NA 3EHBD 3WFCH 1JZ2A 5EIIB 3EG9B 4QHNB 4QRUB 3N1GC 1YN7B 2Q8AH 3DA0A 2AQSA 2F08A 3L08A 3WXWL 2QQNL 5DUBB 3O6KH 5C09D 3GYRA 2YBRA 4I0PB 4XNUH 3EH3B 2K9FB 4EI5B 5MEQA 2J1YA 4OLWH 1BOGA 1TEFA 1CC3A 2J5LB 3A47A 1T5KA 1DR9A 1H9VA 3DK2A 3LSOA 5D7SH 3T0VA 1E2ZA 2A6KB 5B8CA 3EUDA 5IROC 1WWWX 2WWMC 1SF5A 2VABB 1KBKA 2GVYA 3VM7A 3COOA 3D39D 3VYOA 4Z7VE 1YNKL 4DP7X 4MNGE 1FO0L 2E75C 2XZZA 1CGSH 2J12B 3SE6A 4UQ3B 3VWJA 1WJ3A 2VDRB 1EBPA 1VESA 4FMKA 2UZIH 1SYSB 3C5SA 4MX7A 2ZOKA 3H2PA 5FM5M 2Z7YA 3C5SB 3C5ZC 1ZA3B 2VN4A 3DURB 3RGVB 4B41A 6PAZA 4G83A 4MQ7A 2GBUA 1RIHH 1I1RA 3EJRA 5HJDA 3D12B 2K9UA 2Y7OA 4F7TA 4UNTA 5FUOL 1T20A 3KLHC 5AW5B 4UTBH 2WXPA 4NUJA 4NUGH 3PQYA 2HT4C 4JDTH 3FFDA 2EIJB 1CO1A 5LWYH 4JFXA 2B14A 4JM2D 4JY6B 4OZFA 2KLSA 4P46D 2NZ1A 1CMOA 3EGXA 5LBSH 4HD9A 1TITA 2IDUA 2NZIA 3QNZB 3E8UL 4R6UA 2BNQB 5DLMH 4JFEB 3C12A 4L8SC 3MV8D 1ZEAL 1MCDA 2KBGA 3NFSL 4O2EB 1DSWA 3N0PB 4UAOB 5IQ7L 2NY0B 1CGSL 2ICWA 1MF2H 3LRSA 1B4RA 5DJXB 2YS4A 1TKWB 5EU5A 4LRIA 2BNRA 2EILB 1KXVC 5E7BA 5J1TC 4WSGA 5SWSB 3ZL4H 2CA4A 4HJ1A 5HSFA 2NYYC 1NCJA 4Y2DA 1ZLUK 2MH4A 1Q1JH 4W6XB 2XPZA 1N68A 2XRAL 1Q0XH 3X1FA 3DX1A 3Q44A 2EXWC 3ME0A 5BRPA 2CO6B 4JFPA 3ZDXB 5DA4A 2FJHB 5T3XD 1SJVA 4XXDB 1HHJB 2N7BA 1A4JB 4ABVA 2FAUA 3TFKC 3MACH 3BIKB 1A4JA 1UT2A 4F58L 1BQRA 1PIGA 1L6PA 4L3FA 4PRNB 1KJ2B 2HRPH 3UAEA 5CEZH 1JSYA 3IGFA 3U36B 4GRLD 1AACA 3F8UB 4I87A 4J8RA 4QWWC 5E1GA 3MRJB 1NGZB 5SWZD 1MCIA 1WHPA 2VLLB 3DPBA 1RZJH 4L5FE 3BAKA 4K94L 4HCGA 4B9PA 1BG9A 1IBZA 1QTPA 1KFAL 1W0VA 2AQPA 2UZXA 1BD2A 1K3ZA 1MQKL 4AUYA 1NC2B 1OAUL 4D9RE 3P30L 4B5ZA 1JNNH 2UZXB 4PB0L 3DVNA 3GSXA 4LBEB 4MNQA 3MV8B 4PJFA 3WUWG 4ELDA 5E4IA 5JHDE 3VI4A 4F2EA 2IAAC 3QXUA 3WFBL 5INCB 4JO4H 5D7JB 2IAMD 4H88L 3FUHA 4QUOA 4BUQA 1JPFA 4JFDE 5F3BB 4HUCA 3RZCD 2OMUB 2VYRE 2Z8SA 4MBOA 3CZGA 3DYOA 2H2SC 4NPKA 1LP9A 4ZW7A 1X6NA 1ZHNB 2ZD0A 3LKNB 4HX1B 4IK6A 4PLJC 4A6YB 2UXVA 4GG6E 1SXZA 4FZEH 4NDMA 4Y89A 2V2WA 2IVFC 3G6DL 3O81A 1UH3A 1T04A 3MO1A 4KVCL 1U8KB 1MJJB 4H8WH 4JG0H 1TENA 5F1IB 1RZKL 2OMTA 5CEXB 1J0YA 4OLUH 4Y4FD 4N8VB 1T0MA 2GJ6A 3L3JA 3V0JA 2AJUL 2C4FT 5LQBH 2YD1A 1QEWB 5BJTB 1BFVH 4KXZI 5EZIH 2N01B 1NCGA 2XXFA 4HCFA 5CGYD 3EH1A 5I71C 3ZL1A 4QRRE 4H8WC 1YPZB 3ZE2E 1X7TA 3C6SB 5ANMA 2IXQB 4WAFA 2DLFH 1KLUB 2HFFA 3ULVF 1IGYB 1JHKL 4OUOA 1BIIA 4ALAC 1MIMH 1DBBH 2F58H 3GSWB 4L8SB 4NRZA 5F9JB 4ESKA 4JO2L 5J0BA 2V17L 1QFUH 2WJ5A 4PSPA 4WWKB 4AQ1B 4AJ0A 2HFGH 2RA1A 3QQDB 4WVRA 5GGQL 3SSGA 1XR9B 5FW6A 1QR4A 1HL9A 2WXKA 1U2CA 2WINB 4JPWH 4KTDL 1FG2A 4HEME 2PWHA 4HGWB 3QXVA 4OLXH 3IETA 1Y7VA 3A67H 3SD2A 3O6LL 1I9IH 2XFXA 3AWEA 1S9WB 1J1OL 2J8OA 3I02A 4U2YA 2FQEA 3C6LA 4K15A 2A9NH 2W60B 3SPJA 1IGJA 2NXZD 2D0HA 4QT5A 4TNFA 1UOWA 3RFZA 4A7UA 4P46A 5B4MC 5KVMC 3PDOA 4UQIM 1UM5H 4G8AC 5HHME 5L4MA 5K9KB 3RWFA 4GQRA 2GYSA 5DZVA 3LKPB 4QI3A 4L0ZA 4K7PL 4NKOA 4W9JC 2DKUA 1IFHL 2R2BB 5CS7A 2NTFB 1U93A 1C08B 5DI8A 1U6AH 2FX8H 3NIDE 3I6SA 4FKHA 1N0LB 4KNSA 2BNRD 3B2MA 5FDYA 4WWOA 3BEWB 2HTLC 1BZ9A 1GGIL 4Y4KD 3PNRB 1MDTA 3VNYA 4H26B 4DAGL 2DTSA 2VIRB 5BXFB 2WKLA 4Z0BH 3MV8E 3L4ZA 2HKFH 4FQXA 4TKWA 4L29A 4OM0H 4K5MA 1DLHA 3FFCA 3QJFB 4FQXB 3UZEA 2F1AA 3DHPA 4OB5H 2ATAA 1WZMA 1AGEB 4IKLA 2HKAA 2UUDH 3K0YA 2CA3A 3IJYB 1OGTA 2Y06H 3ARED 3EOAB 3MRRB 4PGBA 1GC1H 1A1OA 1G94A 4GG6B 1T0NA 3TURA 3T4YA 2NX5B 4LAJH 4U6TA 1WIPA 3ZGIA 2DLFL 4U1NA 5DWUH 1FGVL 1GZQA 4PS8A 4ACPA 4GBXC 2QKIB 4JQXC 1OGAB 4H0HB 2RACA 4E41B 5SWZA 1MY7A 1KC5L 1I85C 1N64L 5E95B 2EVIA 5FF6B 1PEZA 3MNVB 1OTSD 2HTLD 4Y4KC 3BH9B 3FRPB 3SDXA 4ZMAT 3I9PA 1F4YH 3IKCB 4XCFH 2IADB 2FHCA 4PWEA 1JZ7A 2G9HB 5DEFA 4PBVC 2X89A 1PQZB 4MNQD 3FB8A 1FO0A 1BZQK 3S98A 1T7WA 4UUJB 1B9ZA 1YPZE 3AW5A 3KYNB 2PXYA 4D8PA 1OAXH 1T89C 3L9EA 2CK0H 3C9NA 3KHQA 4E41D 25C8L 2PO6D 1CBVH 1WG3A 1CD1B 1I9RH 1QBAA 2N7AA 4UTAA 1S4IA 4Q9RL 3QIUA 3M8OL 4RNRB 3VNZA 3QG7H 3UBFA 4K3DL 1UOKA 5CZKA 4FKKA 1FAIH 5KEZA 1R3LB 2H32B 4NB7A 5BO1H 2VLRA 3VRJB 1TJHL 3FAWA 1KTLA 1UUNA 2CBOA 2WSDA 1JWUB 1E27B 3PP3K 3A0OA 1T66D 4MXVE 2BHYA 3B7YA 5DD0H 3UBGA 3NSJA 2EKSB 3UBXB 4QOKE 4S10A 2HZHA 2W59A 5T33H 3T0WA 4PJAF 5FUZH 1A9BB 2EEBA 4YHPB 2F74A 3WG7B 3M88A 3A4AA 1DN2A 3CMGA 3FUKA 4J12A 4GKSA 3LNFA 3WNIA 4DHLA 3NZ8A 3HKFA 4F7TB 5DD3L 2IOIA 1YN7A 5LGJA 1TJMA 2JJWA 2ICEA 2IV9A 4AEIL 5J8OA 3AGWA 1J0IA 4YSRA 5J57B 1U3JA 1DQML 3G5WA 4GO6B 4P2RE 4OF8A 5AD0A 2Q7AA 1ECYA 1WD8A 2IOOA 3JYBA 3TF4A 1JGUH 2ZSVA 3QUZD 1TU2A 3L5WB 3LN4A 1V3JA 2ZF9A 1BVNP 2ENQA 1EFQA 2FSEA 4QAMB 4OT1H 4X6CF 5HHNB 3S88L 5ID0B 4MD0A 4ADJA 1NCCH 1DFXA 5IQNA 2OL3A 3IFLH 4C55A 2XQYK 3M86A 4OD3H 3FTGB 4HT1L 4I5BB 3EJJX 3C6LD 4YSQA 3TFBA 3ARBA 2ZNWA 3CDCA 1K4DB 5B39G 4G42A 3V6FB 1ZJBA 1WZKA 4PBXA 4OJAA 2I5YH 3P3UA 4MWFB 4S1QH 2BRRH 3PWUB 3KGRA 4U0RB 1QASA 3DVFA 4OZ4A 3R7QA 5D6DC 4ZX4A 4LLWB 4OU3A 3RDTA 2ATPB 5BW7A 2YMOA 2PYEB 3TCXA 1ID5I 1A1MA 2GIXA 2WCGA 3K80A 3L2NA 3MROB 3OSKA 4R0LB 5DUMH 2R83A 4E41E 5CSBA 1OZUA 1PAZA 3O4OB 4EUPH 2KQMA 3F7KA 1DJYA 3VXNA 5JQIB 5GGUB 2J21A 1R4XA 3QJUB 5IV2A 2PCXA 2BDNL 4RZCB 4U1SA 3QFJE 1MAMH 1S3KL 1DDTA 1TJXA 2KPNA 4L4VE 1KJMB 4OJDH 1LK2B 3TBBA 3VI3B 3L3DB 4ZXBD 1QMUA 3GBML 4G8GE 2ATKA 2ESVB 2AEWA 4AQOA 5IJDC 2HB0A 4NQEB 5CEZD 3SDDA 5AVVB 4PJFB 4GI8A 3IJEB 2QDVA 3KYMB 3FOLA 5CD3B 1ORSB 2I7OA 3S7GA 3N1PC 4XWOC 2WLLB 3EFOA 1QRNE 3OKLA 2A73A 3D7PA 4GY4A 1S78C 3I50L 3TPKA 1A7RH 1P1VA 1MHEB 4TLKA 4OGZA 2X4TA 4R7DB 3I75B 1FVDA 5J9PA 4RFOL 5C0FA 2JJTA 4MA3B 3DMMD 1G9NH 4LP4A 1KCUL 7FABH 4WEEA 5ERWA 1JCKA 4RWYH 4D9LH 1MW0A 3WN6A 4HWEH 3ZL2A 1Y0LA 5HHVL 1D5ZA 4ZD3L 4PI2A 5CZRA 4ORZC 3HZMA 1HN1A 3TNNA 4OZHB 3GD1C 4KKQA 4L3EA 1MN4A 3A6CH 2H6OA 3UP1A 1G6RL 4B7IA 2D03H 4HPOL 2NW2B 4I88A 1SHSA 4YPGB 1M7DA 4LVNC 4LVHC 4J23A 1U95A 1QFOA 1QPKA 4RMBA 4K55A 4X8JA 2X2HA 3NPSB 3V0HA 3P54A 12E8L 4JDZA 3UBHA 5JPMA 2PF6A 2FECL 5KUKA 4A7GA 2KLTA 4NWTH 1XQ4A 2B16A 1HH9A 2RB8A 3H0TB 3PG2A 3UIYA 4DIXA 1QO3A 1G9NC 1F45A 1U8HB 3GFUA 4XNMB 3RWIA 2J1XA 4X4XA 4N24A 2JV6A 4X2UA 1JXDA 1CG9B 1MG3C 1MQ8A 4LDLB 4YBLB 5JQ6H 3VD0A 1UWYA 1RFDH 4QOKA 4AVJA 2MKLC 4KAQH 3DX8A 4LSQL 4LE8A 3WEXB 2WXOA 4PV8B 2Z4QB 2GJJA 2DZEA 3NJHA 4Z7QF 4MJIE 3MCKB 3ULUD 2OZ4L 3L3HB 1KBWA 1E8ZA 2EDEA 1QZ1A 2V3EA 4P3DA 2BIPA 4L4VB 4NNYB 2OI9B 3W5MA 1QSFA 2EEDA 2Q8BL 2VLKD 3TC9A 2MNUA 3VI3E 1VZIA 3X1BA 2X4PA 2QGBA 2ZX9A 3L7EB 2HLFD 2MOQA 4LCCB 4WWID 2VWEE 3FT9A 1YMMB 3BP5B 2OMVB 4BFRA 1UZ6F 4X6DF 5C6TL 5MHSD 3I6KA 5DMYA 2VIRA 2YOCA 3QDGB 1KCUH 4H13C 1BPLB 4ISVB 2ADFH 4PRIE 4RWYL 1XR8A 2V7HA 1MWAB 5I1DB 3MCLL 4FJZA 4Q2ZA 5K59E 1WWAX 3RBGA 3G5YB 2EIDA 3I02B 4BZ2A 4JY6A 4OZFB 4AV0A 5KYWA 2ZZUT 2UY7A 1MI5B 3EGDA 1GCYA 1ZK5A 3AC0A 1JRHH 3NFSH 4F7CB 2V3FA 2PCFA 3G5XB 2DL2A 3GTNA 4K73A 1KB5A 2CUIA 2Z6FA 1I7ZA 5I66A 3PDOB 1U21A 4N68A 5LBSA 4KJQD 2AITA 3LEVH 1XD0A 4KTGA 1TJGL 2F5BH 1OZTG 3PQYD 1H3XA 1CICC 2B7DT 5CZVL 4YHYC 2FYYB 3V0IA 5CGTA 2APVA 4NPYA 2G2RA 3G04A 5IBLD 4QRRD 2P26A 1Z7JA 2OK0L 1K8IA 2Y1AA 3KPRB 5EDSA 5IUCA 1U92A 4GAYB 1NBVH 3W57A 3B2PA 3IDMA 3PAYA 3ZTJH 3RILA 1TNNA 1U92B 3MLRL 4GAYA 5HYJE 1IL1A 4M7ZB 4I3GA 4HS3A 4OVVA 1CD1A 3KCPB 4K8RL 5FYLD 1QFWM 1ZHLB 3RA7H 3HBZA 3MNWB 5CEZL 1V3MA 3QDJB 3DHUA 2I9LB 1V7NL 5FKAB 1R5VA 2NLJA 35C8L 3QI9D 5MEOA 4WLCA 5K69A 3VXUA 3RHWF 5C0AD 5KJRL 1WK0A 3OF6A 1HXYB 3CH1B 1BPVA 3RUGE 5DYOB 1U33A 1ERNA 3M46A 2OSLB 5FFGA 3D50A 4NERA 1CXEA 2C9SA 3TBYA 1NIFA 1CFNA 1ETZA 3I9IA 3MRLA 3GSQA 4W68A 1FRGL 2D3LA 3KPNA 4S11A 4GFTB 3VSUA 2ZX6A 2AXFB 1QPPA 4PJGE 3REWA 4UM8A 3BGMA 4HT1H 4MJIB 2O5ZL 2JI1A 4YK4B 1BX2A 4X50A 1L7TH 2BNUA 2WBJD 4ZOAA 4Z3GA 3HG1D 2CO6A 1YEIH 4JFPB 1TTFA 4KI5F 2I27N 4F2ME 3U2SB 5KZCB 1QQDA 4XWGL 4X98B 1PLBA 3HG4A 4UANA 2WQSA 2LQRA 4MASA 4JDTL 2HX8A 1YMME 5E5MA 3U7AA 3ZK0A 1CS6A 4HSCX 3EAKA 4ZFZB 3TV3H 3BWAB 2FCBA 1CU4H 2R29L 3WDIA 4OGXH 1QNZH 4U1JB 2PTVA 4JFZH 2H8PA 4NPJA 4XP1L 4JGNA 3MA7B 4JL1A 2D7OA 4LRIC 1NL0H 3T1FB 2WMPA 4FEMA 4MJ5B 3B4NA 4PTUB 3S4SA 5DSCB 1MOEA 4L9LB 4NHUB 5D4HA 4UWQB 5GJTH 4DVBB 3GPSA 3P4NB 4MLIA 2DQJL 2JJUA 4PG9B 3N50A 4QY8B 3TZVC 4CMHB 4KDTC 4L4TB 1S46A 1OE1A 3G6JB 4EDXA 4WI3A 1A6TA 3DOSA 4DN4H 1ZD6A 4AQ1A 4X7TA 2AJYL 4OLZH 3K4AA 1SF3A 1W6WA 4EOWL 4YHYB 2GI0A 4DO4A 1GZPB 1MJUH 4JR9L 2OCJA 5IHZB 2X6MA 5C86A 2NRDA 3ZTJG 4JCLA 2R2EB 3D6GA 4GXUN 5DK3A 2H26A 4N8VG 4E9XA 1FZOB 1N6VA 2K7PA 2PCYA 5HYJB 4F5CA 1WFTA 3L3DA 3MRNA 4N0YL 2YMXL 2EINB 3QUYD 2W60A 2CO3A 3TONA 4HK3J 5DU7A 3PFUA 3U9UA 2CDFB 1PD6A 1T22A 3VACA 3WEOA 3U9UB 4Y9CA 1D9KD 1ZHBB 5DJCB 5EOCH 2R15A 7FABL 1G9NL 1A1NA 4DF9A 3QZMA 3CQFA 3U0WH 4XHJD 2MJWA 5ETUA 4LGSB 5F0LB 5TTRA 2IH8A 3HHMA 2PYEA 4Y9FA 4QR7A 1C5CL 1NTDA 1X5HA 3EO0A 4L3AA 4PJEB 4W9LC 4BFKA 4HMDA 1AR1D 5D7LE 3MRIA 4XO4A 1SDDB 1S9KC 1CCZA 3HZVA 3MUGB 1Y6NR 1JPSL 4AMKH 1CICA 3A6BH 2VZ3A 3BPOC 3AGVA 3DOHA 4PJ7F 3FQNA 4F20A 1LNUB 3NP3A 4G7QB 3JV4B 1K6QL 4WNQB 4YSCA 3ENEA 4N6RB 1NBYB 5F6IC 2YARA 1BZOA 1DVUA 4IBQA 5HHQB 3L95A 4TUKH 2VLJA 2XWBA 5DMIH 2PWFA 4F2MB 4WUKL 1LQBC 5MHSE 1TETL 2H0FA 4X99A 5C2UB 2JKJA 1U3HB 4KH9A 4HWZA 2FD6L 5ECGA 5ENWB 5A2FA 2EYTA 3OMNB 1U95B 1QBBA 5TD4A 3VSVA 2ZKHL 4LCYB 3VE0A 4QF1A 3OL2A 5DEGA 4MCMA 4WI5A 4LSQH 2COVD 3JWNE 2DBLH 4UILH 4YDMA 4KRPC 1ADQH 4OKDA 4NQTA 5T5NG 4BINA 2YA1A 1BBJA 1NMBL 2ZIDA 3ATEA 3EYSL 3INUH 5I8KL 1MJ8H 2P5EB 3OG4B 1I9RL 3UTQA 3LZRA 3RY6A 4AJWA 1Q9KB 3OKDB 4FTDA 3RYMA 2DQ6A 1HCYA 3PWVA 5ALBH 1JDCA 1KBGH 1Q72H 2WO4A 3MXWH 5EHFA 3S2AA 4Z3IA 4N90D 2BP3A 1PFCA 4YEFA 2XVLA 5DVOA 1P2CB 4LOVA 3IXTA 4IIZA 3DX9B 4HISA 1KPUA 1S9YA 3WUWA 1G1OA 2FJFB 4GBXB 4KKRA 2WXGA 4CGTA 1K9TA 3S34L 1HS6A 2DY2A 3ARTA 3NFNA 4PJ8A 3CZFB 3TNNB 4S0HA 2G5RA 3CDYA 4PJ8B 4P8QA 4RH4A 1JVLA 3GIVB 4P3DB 2C3GA 2QKIA 3GI9L 3RVVC 4NJAL 5ACZA 3OHXB 5E2WL 4M8QB 3PHAA 3D8MA 5DD3H 1AZVA 1CDIA 2OBGA 2VLRD 5CD5C 1E4WL 4I77L 4CL7A 4YXKH 4RAHA 1DVSA 1S78D 4IJ3B 1MHCB 2Y1ZA 3GIZH 3AU1B 2ZYSA 4U6HA 1ACYH 1I8KA 4IIQA 4LLVB 4UDTA 1MKFA 4I3SH 1D5BA 1JWMA 3HC3H 3RX8A 5JZ7D 1PG7W 2GSGB 2IO5A 4L05A 4AYEC 4MMYB 2AXGB 3JWOL 1MI5A 2BK8A 4ZMQA 3VFTA 2NY4D 1OE3A 1IKFH 4QO1A 4GT7A 4GRMA 1CL7H 4IDLA 2FB4L 4OFVA 5CP3A 2BLFA 2FL5B 2EO1A 5F7WC 5I1JL 1VZGA 5IT2H 4J5VA 2VXUL 2YUXA 3VRJA 3GINA 3GKZA 5H94B 1CYWA 5EF1A 2WTRA 3GXNA 2YIHA 2VO8A 2A74C 3UPRB 4F1SA 1QRND 2WUBL 4YHIA 2Y25A 35C8H 3JWNH 5AAMA 2XBDA 3VG9B 3BZEA 2DMGA 2EIZB 3RU8H 4B6ZA 4O00A 4BEIA 1XCWA 1F58H 4OCXH 1WLHA 2A77H 5E94B 4LCCA 1GIGH 1D9KA 2FBJH 5F8RC 1SN5A 5INDB 4YWGL 4HJUA 2Q86B 2FWOA 1VJSA 3B9KD 4U31A 5DMGC 5EUOE 2KDGA 3TZVD 2BDNH 4URKA 1N6QH 4ZS6C 5FKPB 2JKTM 1DLHB 3DDGA 1S7RB 2AK1L 3LIZL 3UTTB 5TQ2L 4UTAH 3T8XA 1FGVH 2NCMA 3CX2A 5JW4N 5A43C 1S5IH 2C4XA 4C8XA 2W91A 1KBPA 3FQTB 4MZ2A 1PEWA 2W0FA 3MJ8B 3UABA 1NIAA 2B2XH 5HI4D 5KVFE 1IEAA 4IOSD 5DJ6A 3FKUS 3BSZH 2IDTA 3IS0X 4XCYB 4B50A 2XBZA 1NGXA 5DMJB 5JMRA 1A7PL 3AXIA 2GC7C 4JKLA 2X4OB 2HYMA 3LZPA 2UXGA 3IWUA 3WE1A 2KZKA 3CSGA 4JHAH 4JO3H 1OAQL 5LG1A 3ZTCC 3FT2A 4G43A 1X7QA 4IBZA 3DJZA 3AAZB 2DQDL 2HXAA 3SKNA 2R29A 5BOZG 4J39A 3P9WB 1A9EA 5DJZB 1IC5H 1J7VR 3P73A 4JFQB 4JZOA 1U4EA 2W5PA 3NCYP 2ZQKA 3KPTA 3KLAA 3MRGB 4DKTA 2AC0A 3EUUA 3BWUF 4TOYL 1WFMA 4DZBB 3LS5H 4KK5D 1K5NB 3LS4L 3EOBA 3H9YA 1A8JH 4UZSA 1Q9WB 1TFPA 2G75B 3GUTB 3L4UA 1DANT 1LQSR 1HZKA 3WEAA 1I8IB 1QYGL 4AGQA 5CILL 5E00B 3LTVA 4U1GC 3BPNC 1A6WH 3GS0A 2EEFA 3NIFF 2VQ1B 4YDVA 5L88H 4ODWB 1FNAA 4MGXA 3KLDA 4QPEA 5KN5B 3L1OH 5E7FA 2RAMA 1CLYH 4NCDA 5GGRB 43C9A 1BD2B 2OW6A 4NN6B 2Y5TB 3O0RL 4OGYL 4PJ8D 1XF5B 4ZFGH 1AIFA 4KKLC 2XKSA 4UQ2A 4OGQC 1E9OA 4U3XA 5GIRB 3MV9A 4LOUC 3WIHL 1FJ1B 5DTFA 2IQ9H 2BOCA 5INCA 3SBWC 2EDJA 4Y8DC 3TVMA 2F68X 5BQ7A 4LASH 3WHE1 1U8JA 4PUBH 4LARL 3ILQC 1MH5B 32C2A 3SE8L 4KJPD 4FXGB 4ZMPA 5D1QB 3TH3T 5AVRB 3NACH 3N06B 4U6YB 5FO9A 3M1OA 1NCDL 4WY7H 1NDGA 3MKKA 5LAXB 1INQA 5KSBE 5FB8B 4GS7B 2AEQH 2OA9A 5PCYA 5IWLA 1BDYA 3BP4A 5EUOB 3IBEA 3F65A 1I3UA 1NPNA 2X3BA 3KYKH 5DD1H 3CC5A 1E4HA 3VX0A 4JHAL 1TLKA 2EDBA 1KC5H 1N64H 1NEZA 4AC4A 1D2OA 4JE0A 2WJ7A 3MPCA 3QPQD 4NQCA 1YJDL 4Z7OB 4JPVH 1YPZF 5F88A 3T0XA 3O3BA 4A6YL 5LO7A 3KGSA 2X87A 4AENB 4L4VA 1N7ML 4PP1C 4KX8A 1TTCA 1P7QD 3G6JA 2WC7A 4LLWA 5CNHA 4FG6C 3EJTA 4JPKH 4LSSL 1A25A 5H4YA 4AW4A 3HNTH 4KXCA 2UY6A 4W9EC 5F1OB 3B2UD 1NDTA 3HFML 4KRNA 4U6XA 2FD6H 4ODUA 2VLMD 4G6ML 2X88A 1KTKE 5D7IE 1YY8A 4RETB 2RTTA 4MZRA 3RZCB 3KJ4C 2WWOA 4LF3A 4KJYB 4HBCH 1LO3H 5C8JB 2H0JA 5IROD 3ETTA 5D7IF 3B8SA 5J06A 2DYPA 4S1SH 3FRUA 3VFMB 3INUL 2NOYA 4F2MA 1INEL 1NMBH 3C5ZA 5IQLA 4Z6AT 5E56A 5CGMA 3GLAA 1XB3A 1ND0A 2FJSA 3O9WC 5I19H 5J5EA 2XVGA 5AW1B 4XMXA 3WAKA 5J56B 4BFIA 1Q9LA 4FNQA 3C08H 1SOSA 2OZ4A 3OHMB 4LKXB 3ZRFC 5F70A 3VXOB 5AB2A 2IXQA 4FD0A 4WHTB 4L3EE 2LVEA 3IDYC 4FQQA 1ED3A 4PJFE 4TQHA 1K4CA 4NQXA 2L8AA 4KO6A 1FFPB 4BSWA 1EJOL 5IFAH 4MA8H 5A1AA 3NEXA 5HI5C 3RX7A 1OWWA 3GK8L 3KDPB 3FU6A 1WV7T 1AY1L 5K5YA 1S7SA 3OX8A 3TJEH 4F3FA 2AAAA 1ES0B 3DETD 1GS7A 3MV9E 4A2GA 4NP4H 5ERWB 3NA9H 3QO1A 4YZWA 1Z6JT 2J1ZA 2CHXA 4XGZA 3NZUA 2H45A 1AE6L 1FN4B 1X7SA 5BZXA 4I77H 3NAAL 4WNSA 3U9WA 4LVEA 4BZ2L 4QLWA 2DBJA 1ETB1 1HXYA 4OZGF 1WTGT 1HNGA 4FHKA 1KIQA 4KXAA 4OFDA 4P9HL 1MSPA 3SPVB 3TT1L 1GAFL 3QORC 4XZUB 3ZSTA 4GRLC 2IPKA 2V2TA 1FYTD 2QDWA 4G6KH 1PKOA 3BAIA 5DK0B 3WIIH 2NSMA 3O3EB 4IYKA 3PABB 1EDYA 3DX3A 4LSTH 3C08L 4X5PA 2PO6C 4TQ8A 1UQSA 5C0AB 2ICEC 3OHXA 1X9UA 4LPTA 4P4KD 2G9HA 5FF6A 4AJYV 1XCTA 1SJXA 2Y72A 5JIDA 5H37H 1GXEA 3X1GA 1RJZA 1OLLA 1YEDA 4TVSa 2FATH 1GZHA 2BFVL 2EECA 2IAMC 4JDVB 1BW8A 5CJOH 3ATDA 1IEBB 3APCA 4O4YL 4E5XG 5LN8A 5IVZB 5FK9A 3F6JA 1K8DA 1P84J 4QCIB 3QQ9C 3VDBA 2UX6A 2YFOA 4HYTB 1J1XH 4R3SA 3BAXA 3KW7A 5AKTA 2IH1B 4UTCA 3K91A 4HKJB 4OCWL 5E9AA 3B43A 3U6RA 3NPZB 3IDIA 4NLHA 2N4IA 2HPTA 2YSTA 5FYJL 5CLXA 5GGTL 2Z35B 4OZFG 2HT3D 1WA2X 3KXFE 2ITDB 3V4VL 3J2PA 1A7BA 2XQYG 4K5OA 4JFYB 1U91B 3ARGD 4JFOA 3U6XA 3V4UH 4ZMVA 5F3FA 3RKDD 3RE0A 3NRQA 3BSGA 2HN7A 2QMJA 1U3NA 3WY4A 5ADOL 4OV6F 4LHUD 4FYRA 1A7RL 3U79A 2G5BA 2AJSH 4A37A 3GTVA 2FATL 3MNVA 5KYXB 2X4NB 3ECWA 3Q05A 4YPJA 1WAEA 1JHTA 2EIMB 2E27H 4MJIA 4UU9B 3I74A 5IBLC 3QDME 3QR1A 1UEMA 1NMCB 4UIKL 4OCWH 4HJIA 1BM3H 4BZ1L 2JKRM 4UOJA 5I26A 2XJKA 3NN8A 3NEOA 3WJMA 4XX1E 3TTYA 3OKMA 2YK1H 4HSQA 1H5BC 4XMTA 1CE1L 2CKBH 2CUMA 3VXSA 1THCA 3DX7B 4D94A 1A4CA 3BC9A 3NZHL 3HUJF 1LHZA 4NM4L 2IGTA 2G5UA 3H7BB 2X6UA 4CILA 3HVDA 5EU4B 3OMAB 3OXRB 3X1EA 3OGCB 4QRFA 2B0SH 4OZIF 3KWXA 2OXHA 5LG6A 2V4LA 1TZIB 5ADOH 5EO0B 2VN6A 3IDNA 2LFEA 4YLBA 8CGTA 3QWQB 1PY0A 4PJHA 1DJWA 4KO5A 5FO7B 2WK2A 1D9KB 2CSPA 4EVNA 4PRHA 1U8CA 4ONHA 2OMXB 4YLQT 5L88L 1RZFL 3EH2A 4BELD 5D96B 5GS0H 1KB9J 3N44F 4PJEA 1XFPA 2BS9A 1T20B 1JL8A 3MRBB 4GKOA 3QC6X 2QQKH 4PJ5E 3IU3B 1I8LC 1K6QH 4Q6IC 1G0YR 4PP2A 1MIEH 1B2WH 4HULB 2VISB 4LCWA 4PVNA 4AVIA 1E9PA 4FNSA 3FL7A 4LVHB 4M9OA 2A9MH 5D5ME 5ESVA 3UPCA 5KBLA 5IREA 4Y0GA 5I16B 6FABL 1AG0A 2NUTB 4LB8A 3FCBA 1JNHA 3KVPA 3SJVA 1T3FA 1A0QL 1IEAB 2FX7H 2YJLA 1OIOA 3HI6H 1RZ7H 3R06B 2P5WD 2WCPA 4IGBA 3HG1A 4JY5L 2Q8BH 1S2EA 4I0PD 4D9RD 1J05A 3SDDC 4LLUB 3WKYA 4JVUA 5IUSA 3C60A 4YHNB 1KGJA 4F27A 3OKYA 1DLFH 5ENWA 1AIFB 3IRZA 3BP6B 1LEIB 4LPYA 1AGFB 1HX0A 3ILQD 4JQVC 4H8UA 2ARJA 4OIIL 5F3BA 1VEMA 2HRLA 1I3RB 2P1YA 1I1YB 2J43A 4GRLA 3RZCC 3EHBC 4HKBA 5T1DL 3IFPA 3SDYH 1AFVH 1RI8A 2RHEA 4PJBE 5GZNA 2Z31C 3NJGA 1L9RA 4DGIL 4G5ZL 4H4NA 4EQ3A 1TCRA 4A6YH 4C54A 2C26A 3IWVA 5K1VA 4FFTA 7CGTA 1FO0H 3H3KA 1G4RA 3WDJA 3W82A 5T1KD 5HGHA 5CBEA 4G1MA 1RIVH 1ULVA 5IR1B 4K2UL 1NGYA 1IBBA 2X1WL 2AJUH 1C8QA 3H2WA 4P5TB 5E2VL 2BVUA 3WFDL 1VPOL 2EDMA 5EOTA 2ZXWB 2W9EL 2OMWB 2Z1KA 4UMGA 4U1LB 5AKVA 4G8FB 2VTFA 4LHUB 4N0CC 1NEZG 2VT0A 1MHHA 3N6YA 4M1DH 4KROD 3SPIA 3B6SB 3CQPA 4XO8A 3ETBF 4EOWH 2GABA 3VFRA 3MBXL 2NNAA 1HSAA 5JHAA 3WTYA 4UQ2B 2VN7A 5IVXF 3VFRB 2Q3XA 1CDCA 4MA7L 1XR9A 3CVIH 4EI5C 2CO7B 4Y2OB 1JGEB 4WU5B 2GJRA 3SGEH 2H1LM 1L5GB 4FTVA 2WBWB 1AMYA 1AI1H 3AQYA 3FXIC 2EYRA 1OQOA 4WEBH 2JCCE 3D4GA 3QYNA 5CBAB 4ZUUB 3CUPA 3I75A 5EU7E 1KCSH 1LVEA 3BWSA 5HDBF 3KJ6H 5DVMA 3WFDH 1DBAH 2I7SA 4ZXBC 4BK5C 3MCYA 3EF4A 4DKEH 1AQHA 1MJ7L 1ND0B 2FZ3B 3EKCA 3S36L 4A68A 4ZI8A 3ULVL 1FFQA 2B4CL 2NCEA 4KZEL 4E42A 4AX3A 2KHAA 3H54A 1S7WB 3NABH 3KPSD 3SGDI 1A1NB 4GSDH 1JZIA 4YX2L 1F58L 4AYFB 2HFFB 3NTCL 3UOAB 2OL3H 4FQJH 4H8QA 1CLVA 3MACL 1BF5A 4XMVA 3ECUA 2ZWLT 1IGMH 2F8IA 3IRPX 1ZSDB 2ZSWA 1YEHL 3CJJA 3PXHA 3QRGH 4PS4L 4XP6H 3GKWL 5GJSH 1HXKA 4N9GA 3JTTB 1QNIA 2UY6B 5E4OA 5IWLC 3WHE0 4EZMA 1BEYH 2WP3O 2BH0A 2CRIA 2DM7A 2VN5A 3LHPL 5CLWA 1GOFA 4FYSA 1AKJB 2BSTA 4JFFB 4NQSB 5GRUL 3QZWA 2EZ0D 4OZGE 3JTSB 4ZXBA 2DQGL 3IMSA 4GRWF 3ESNA 2I24N 4MMYA 4UF7C 1U8MB 3SDAD 3WMPA 3ZYJA 1OAYL 4QD2E 2P52A 3VRLF 5C0IA 1R3JA 3MR9B 5DZJA 2IBZY 4J3BA 4QRPD 4GKLA 3FMGH 4Z77A 4EDWL 4MLSA 4KFMA 5FYLE 1TO4A 4NYLA 2DBLL 4UILL 3BAJA 1XGYH 2BSSB 4BH7B 4RISH 4X6FA 2VABA 4KI1A 3ARFA 4RLDA 1R9FA 3HKZA 1UH2A 4AK1A 2YGQA 3RIAF 2DQEH 1QTYT 3OC8A 1XGQB 2IWFA 3F7VB 1VKXB 2X70A 1NBCA 2ZUVA 4J8QA 2D7PA 4AUJA 1RUQH 1RP8A 4XVUD 1PX8A 3FBQA 4MBRA 4QRTB 5E2WH 5IGXH 4YZFF 2APBA 3VXTB 4N8UA 1BBJB 2YUVA 4IOFC 2MNJB 1ZV5A 3U7YH 1TZAA 4ANVA 1WBYA 3H9SE 5FYKL 1R75A 4F3FB 4M8VA 3VXPB 4FJ6A 1WAAA 1C5DB 4BUHA 3KL0A 2GHWB 4YS4A 3KDMA 1B3IA 5A3IC 1J88A 2VDLL 3RWEB 4EDWH 4WUUA 5JA9A 1MIML 2F58L 5IT2L 4JFEA 1HCZA 5IBTH 4XCEB 2ICWI 4PGZA 5D70H 4LLQA 2CU9A 5DJ6B 2J25A 2VDPL 2Y69B 3L6FB 3R8BB 1NH6A 4PRBA 4OCNC 3S0PA 2KZ1B 1XBRA 4Y1AD 1E8WA 3VFSB 2QVIA 5CLTA 3GBEA 4LCIL 4XO9A 3LKOB 4YHKH 2WUBH 2UYLA 2NR6D 1ACYL 1TQBC 2G5BB 5KSAA 3PS6A 1FNLA 4OLXL 1KGXA 4G8IB 4JFWA 4UM8B 5EMYA 3V7AE 2IQ9L 3MFFB 3Q8AA 3D69A 1BXAA 3F7YA 3G04B 1JI2A 4K7FA 1RHFA 1FJ1A 3N85H 3ME0B 3RVXD 4DEWA 4FC3E 4JKMA 3Q6FA 4NX0A 4V33A 4WFFD 3EJQA 1BYOA 3OKOB 4NGHH 1KJVB 1UXSB 2H9GA 1YQ2A 4IJ3C 3UTTD 2IG2L 1DSYA 3I6GB 3RL1A 4GKNA 4I4WA 2AXGA 3IFNH 2MQGA 4J3OH 4BIKA 1A22B 1TVBB 1ZHKB 3LEYH 3OHXC 1SQ2N 4MMXA 4HOZA 3SY6A 1MVFA 1KXQE 2GCYB 4MMXB 4JZJA 5ABDE 3KR3L 3JUYA 4EN3C 4G8GA 2V5SA 3BWAA 1FL3A 4JGMA 4HJ0C 2DN7A 4OLVL 1OTTC 3QWRA 2FNWA 1YEWA 4LXFA 4QTIL 3V4PH 1NPJA 3CMOL 2AJVL 4F1ZA 3D4YA 4DAGH 1T21B 4KV5E 3ORJA 2DM3A 5TH2A 4ETQB 2MPAL 1ZT7A 3ESVF 3LIZH 1FH5H 4C56D 5AALA 4JHBA 1REIA 2C1PB 3L7FA 1OT2A 3NDYE 2YR3A 3HFMH 2YAFA 1XH0A 5C09A 4ZNEA 5IW6A 3BOVA 2FRGP 4PHZA 3FU9A 2E59A 1LXMA 4NQCD 1Q1PA 3IFNL 1CDUA 1QLFB 5DXWA 4FXGA 1GGCH 3LN9A 3T8VA 2PCPA 4KKZA 3O6FA 4X98A 1FIGH 5F0JB 1T2XA 2VKWA 1SUHA 4PWIA 5T3ZH 3BAEH 5FO8A 2R4RH 2E9GA 2I85A 3BZDA 2OCCB 4OSUL 1IU1A 3H9SB 3W38A 2ZKWA 2VERA 2DQDH 2X4RB 2ODHA 2F53E 3QQNA 4TQIA 2X4OA 1VHPA 3D34A 3V0EA 3HUJB 4XN2A 4UNVA 4HUNB 5IHUH 4XMLH 3T77B 4XOBA 3KYMA 1AGFA 3AG2B 5CD3A 3F12B 1FH2A 3K4DA 3V0WH 4MQXC 4Y88A 3GLEA 1GKEA 3KS0H 3SKNB 3RI5K 2GK0A 4AGNA 1KPRB 1U8LB 1A1MB 4LLMA 1X4YA 4GQ9H 2NY1D 3HLKA 4KKLD 3BH4A 3WIHH 3ZHNA 5H8DA 2V9TA 2O72A 3UTSD 1B0RB 2E6QA 3KEHA 4LL9A 3QSKB 1NBYA 3JSSA 3HG2A 4PFEA 1FSKC 4G1MB 3ZDZF 3KR3H 1YY8B 1EXGA 1F3DJ 3HC0B 3ZGHA 4PRDB 4TNWK 3JTBA 1NUFA 2YPKB 3KM2A 1ZS8A 4BKLB 1CFQB 4K3EH 1AKPA 1S8DB 1LO2H 2VMJA 1BQHB 1KTRL 1YYMH 1XL6A 2ZUYA 3O8XA 3TIDB 2YRPA 3DO7B 1XF2B 2BIHA 1N3NA 2IEPA 1M7IB 1BIHA 4HZ1A 5KBKA 1NFDA 2CD0A 3LPPA 3PABA 2V0AA 3T71A 3GTTA 3TO4D 1E7UA 3QUYB 3L3KA 4U1HB 1AG6A 1HE7A 3VRIA 4F58H 4NN5B