1AQKH

Three-dimensional structure of a human fab with high affinity for tetanus toxoid
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
226
structure length
226
Chain Sequence
EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB B7-15A2
publication title Three-dimensional structure of a human Fab with high affinity for tetanus toxoid.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 47
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 1997-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1aqkH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1aqkH01
1UJTA 2COQA 1XGPB 5BXFA 3BEVB 4LLMA 3D0VA 3VXRD 1BVKA 2HJKA 1J1OH 3ULVL 2A6IA 3S88H 4Z18A 4O51B 1D6EB 3HPJA 1GHFH 3QWOA 1D3CA 4FQCL 1LD9B 4WFHE 3J8F7 3SE9L 4FS0A 3VXMB 2NLJA 3O2WL 4Q9QH 1JF6A 1S9YA 2ZCLL 5DD6B 2Q8BH 4AL8L 3GBMH 1FL6B 1U92A 1CE6A 1REIA 4XVSL 5CEZL 4NKMB 1U91B 4TSBH 4OFIA 3MA7A 2NW2A 1YEKH 2VXVH 4G42A 5DJ2A 1K2DB 5BMFL 2EIZA 3MGAA 4FQLL 3E3QC 1WFOA 1AQKH 1DBMH 2BC4B 3TN0C 1TQCB 1W2KT 1YMHA 4NWUH 3TBWB 3F5WB 3PWUB 1D9KC 3ESVF 5DTFA 5F1OB 1ONQB 2AV1B 5CEXB 2HFTA 3OAYK 1J11A 5I17B 4RBPK 4IOFD 5J7CC 5IB2B 2BHUA 3H7LA 3HE6A 4LP5A 4MS8C 4PGCB 3QRGL 3I75B 3LKSB 3FOMB 3HMXH 1HNFA 2NX5B 1PSKH 2J88L 1IGML 3CNKA 1IM9B 2W9DH 5B4MD 3GBLA 4MNHB 4NQEE 1FNAA 1QYGH 2C7UA 3Q5TA 2OZ4H 2B4CC 2H26A 4PJFF 3MRDB 3IT8D 4XHJD 3MXWL 1ZLUH 1JN6B 3EGSA 1S5HB 4M6AA 1VKXB 2NY2B 3UMTA 1F45A 2Y06H 1EUUA 3WXWH 4DK3A 2UYLB 3ES6B 4M7LL 3J7HA 5EOCL 2JIXD 5GIRA 4LKXB 4Z77A 3WIFB 2VO5A 4WW2F 3H2WA 3GUTB 3WLBB 2DS4A 4WW1B 2DL2A 5B39G 2F54D 4YBQC 3SCMD 5E5RB 2NY7L 3HAEH 1S3KL 4NZUL 4OGXH 1FH5H 2YD4A 1HQRA 5JOFA 4RMQA 5I30L 1ZWIB 5HHVH 4NQXB 1A4JB 5TDNA 1S7VA 1AGEB 1T7XA 2E5EA 2X4UA 4TRPH 2AJXL 3LRGA 1GPOL 5KW9H 4LNRA 1AXTL 1MREH 1RJYA 3LMJL 1Q9KB 3S37L 1F3DJ 4J4PC 4M3KB 4QCIB 1NFDF 1PFCA 1FZJA 4J6RL 3V0WL 2ADGB 4UDTA 4UIKH 3KS0H 3WEXA 1BPVA 4S11A 1ZA3A 3H9HA 5FYJU 4Q6IC 1ZLSL 1VESA 2VUYA 4QXUH 3MREA 5E4EB 1I8LC 2W07A 2GUOB 1WWWX 3GMOA 3H7BB 3D3VE 4G3YH 5GZND 2NXYB 3KLHD 2VDRL 2DIAA 5DJCA 2C26A 1AJ7H 2X4SA 4J3UA 4G43A 3BPNC 1FL5B 4HKXB 1KPRA 5BV7C 3O2WH 2D7QA 2ZCLH 4MNQB 1A6PA 3O4LA 1X5LA 2DD8L 3D18A 4X83A 5CEZH 4JRYB 2V5YA 1J10A 4XP6L 1WIPA 3WJLC 1R0AH 4JY5L 3PABA 4ZQKA 3FT2B 3FFCD 3MLXH 3SKNB 3ARFC 3VXUA 2FJGB 3RWCA 3OJVC 4H1LH 4GXUN 3H9ZA 4PJXE 4YHKL 5JPNA 4KGLA 5KSAA 4AIZA 4P23D 2ZP0T 2XTLA 3TFKD 3TWCL 3WL9A 1HKLL 5IR1B 5K93A 4HBQA 1KGCE 3EHBC 5IEKB 4MAYC 1N5AB 3DUHA 4ZUSB 4LEOA 2YOCA 3VXTA 1LK2B 3WXVL 1NGWA 1NAMH 1RZFH 4TTDC 1UG9A 5FB8B 3GMNA 4WHTA 3RU8H 3QRGH 5MEQA 2PO6C 1DANT 2J88H 5IJVA 1EEUA 4AEIH 3FN3A 3FZUD 2DQGL 5HYJE 2NY3D 3T0AA 3BEWA 4Y4KB 4RGOL 5C0BA 5IJKA 4NT6B 3MXWH 3TNNA 2BHYA 5F96L 5A40E 5HYJA 3MYJB 4XPHL 3SGJC 3NCJL 1FFNB 2I5YL 1UCTA 2ZUWA 3QFJB 4M7LH 1B9ZA 2RJMA 4H20H 1W8OA 2LFGA 2W0FB 3OHXB 3D9AL 5C0AD 2J6EH 1ZS8A 5SWSD 1J9CT 3RI5F 7FABL 2YWYA 3B5GA 2CDFA 5DQ9A 2X70A 3D3VB 5T1DH 3IDJA 1DSFL 3SPVA 3TVMA 4MWFB 1I85A 4FFYL 4JQXA 3X13B 2N4IA 5DGRA 3BGFC 3ET9F 4AG4L 5I30H 3S35H 4JKPL 5ENWB 4JFQA 3H3KA 2X05A 4IOFC 2AJXH 4PJ8D 5IWLA 2OI9B 1YC7A 2OBGA 1EEZA 5TDPA 2PCPB 4U1JA 2OX5A 1GRWA 3FONA 3V0WH 1QR4A 3BZFB 1LEIB 3SO3C 3FHAA 3V8OA 1MVUA 3GI8H 3I3EA 5CD3A 2AJUL 4KVNL 4KK5D 2BVPA 2EICA 5B4MC 4GRLB 1CL7I 5AYUL 3BQUD 1I7TA 1P53A 4CU8A 2R23B 4XHJC 3GHBH 2EH7L 5CILL 2DQEL 4L5FH 3FB6A 1CFVH 2H8PB 2VDRH 2R0KL 4FQPA 2B20A 1A0QH 1UWXK 4EI5B 1S7RA 1FGVH 3CFKB 5SWZA 2A6KB 2VWEE 2VLJB 1YNLL 4X5XA 2WV3A 3MRPA 1H3PL 4JLRB 1QVOA 3OKKB 2DD8H 1BWWA 1U3HA 5ACZB 3ZT6A 3SCMC 4XP6H 4JY5H 1Q94B 5F6HJ 2FZ3A 4PJXF 4Y16D 2WP3T 4L4TD 4IRJB 3AC0A 5F21B 1OWWA 5E8NB 3MLTB 4M7JH 4N0YL 4YHKH 1KJ2A 1A5FH 5F1IA 4K9EL 4Z0BH 2E8ZA 1HIMH 2VJXA 3B2UD 2XXMB 3P9LA 2YPVL 2HVKA 4WUUA 5DMKA 1ZANH 1F4XL 3MLUL 3VI4E 2CLVB 5DO2D 2X4QA 5EBWA 4DVBA 2ICWB 4XNMA 5J1TC 4K3JH 4ZO7A 2CIKA 5C8JA 3N50A 4HJGA 2XIDA 4FABL 4OTXH 3C6LD 1JPTL 1YEEL 1CICB 1FFPA 4S1QH 1KTKE 4G8FA 3INUL 3T4YB 5MI0B 1V3JA 5EWIH 4P5TD 2AJ3B 4RGOH 4G8EA 3KLHC 5T3ZL 5DJ0B 1Q9WA 4GBXA 3G5VB 3PGFL 5F96H 3FKUS 1S9XB 1A9EB 1XIWB 5EU7E 5J11B 1EO5A 1SM3H 4XPHH 5IB5A 5LCVL 3NCJH 5A2KH 4JFYA 4EIGB 2I5YH 2VN4A 1BQHA 1QRNA 1HN1A 3MJ8B 4KTDL 3D87B 4JN1H 3ARDD 3S96B 3PQYD 3BW9A 1UB6B 2HTLD 1UZ8A 2BXZA 3QHTC 4NYLA 3B9VA 2XKNB 1QLEH 4PRDA 4U1IA 1RAMA 5HYSG 4JM2D 1OB1A 2A9NL 2H9GA 5HYEA 3ULSA 3RWEA 1CXFA 3TYFB 3WSQL 1S7TA 2XZZA 3FB7B 5C09B 4D9QE 3OKMA 1F4AA 4CNIA 1DSFH 5EO9A 1UXSB 3CAFA 4ZO8A 5TDOA 3KLAB 3C60A 3H8NA 5D7KE 4F58L 1FNEB 3HZVA 4U05A 1H0DB 5EBMA 2VZTA 4P23C 3TFKC 3G6AB 1DVFD 3Q6FB 3T04D 4EOWL 5IFHL 5EZJB 4NO0D 1ES0A 4WI2A 3IFPA 5D9SA 1J18A 2PW1A 2VH5H 1FZMA 4P2CG 4A2LA 4ODXA 1KCVL 1T0MB 3VE0B 1C5DB 3QJFB 3G5YA 3MJ6A 2AJUH 3I6GB 4LSPL 4TN9A 4ODBD 1FNGA 2IPUG 3BGMA 3KXFB 4HDIA 4KI5E 2VXSH 4RQQB 4GG6E 3FZUC 2NY3C 4P3CL 1F02I 1NCDL 3GMQB 1HH6B 4P9ML 2XFXB 1RK1B 1RQ5A 3MRLA 1LMKA 5ICZB 3L3DA 3VD7A 4OZHB 2R0KH 3U46B 1R3KB 4HLZG 2R1XB 1XF3A 4WO4A 2ARJQ 5KSBB 1T1ZB 5GS0L 5CSZA 3P9MB 3RWDB 2VZVA 4P2QA 4CVZA 1YNLH 5F70A 3GSXB 3BWAA 3FTGA 3WNNA 2YD8A 5EUOA 2WZPD 1AHWA 4I0PB 5HPOA 1QSZA 3O3UN 4QOKE 3O3DA 2M1KA 1GSMA 5J12C 1ZLWK 5EH1A 4FTVD 3MFFB 3BKYL 3CFJB 3A67L 3BDYL 4PJ8C 1HEZA 4XP9L 1MRCH 3VI4F 5DGQA 3ULUL 1UB5A 4I3SH 1K4CB 5ISZD 1F4XH 4G7VH 2MQCA 5D8JL 3RTQB 4G6KL 3GO1H 4N5UA 1AE6L 3JTSA 2B1HH 3D2UB 4XBEL 4PGBB 1VSCA 3OKOB 5CJBA 4KK5C 4FABH 5C6WH 1N6QH 1JPTH 2XN9B 1D5BA 3LKRB 3MV8A 5MEOA 4ZSOE 3BQUC 3MCKA 1GH7A 1LE9B 4J3VA 5HVWA 5CSGA 3OJ2C 5DZOA 4QKXB 5F9OL 4HWZB 5CS7A 5T3ZH 4DEPC 4NRXA 4F7MA 4FP8L 5C2UB 3EOBA 5LCVH 4PB9H 4ODSH 2UUDK 1UVQB 5E8OB 3K0WA 2YD1A 2YKLL 4JFHD 5B38B 4ZXBD 4IHOA 2AEWA 5JQ6H 2PTUA 2AS5M 2OJEB 3Q6GL 3HG1D 4OCYL 1F90H 3BPLB 3BWUC 4Y2DD 4Y16C 1JGVH 1D5IH 1KXTB 3AS0A 4LHUA 4PRIE 3VFPA 3TCLB 3DV4B 4F58H 4PGEA 4XRCA 3L5WA 4ACPA 2VAAA 5KANI 4XCCH 3B2UC 3SO5A 3WLWD 1I1YB 1KB9K 5F7MC 4NIKB 2PTTB 2Q1EA 2MKWA 5DO2C 1DE4B 5F7FA 1A4KA 5EB9A 5I9QB 3BSZL 3QZWB 1P84J 2YPLB 3C5SA 4N0FB 4BZYA 1OCWL 2VDNL 3C6LC 1NBZA 1DLHB 1KNOB 4XWGL 1INDH 5FYKU 2DBLH 3KR3L 4KI5F 4GG6F 4KKCD 5T1KD 2I07B 2WIMA 2AK4D 3WIHL 1GC1L 1RJLB 1NCUA 3UBXA 4F8TA 3KJ6L 4P3CH 1ZA6B 3EO1A 3BO8B 3IU3B 3KWWB 4J12A 3ARGB 3FQXA 4LLUA 5T1LD 2PYFB 4NFCA 3H9SD 1LP9E 5AD0B 4ZFZB 4HHAA 4KK8D 2YUWA 1AGFA 4E9LA 3ARDC 5GS0H 2HTLC 3ZKND 4MJ2A 4JM2C 3I3BA 5IMOB 3FHQA 3RGHA 2D7OA 4NJAH 3MLWL 1Q0YL 1O0VA 2R69L 2YD3A 2VXUH 4OI8A 5KZCD 4ZS6D 3F6IA 3E8UH 3N1QC 1UXWB 1DVFC 2JK5A 4NO3B 4OJFL 1OD7A 2ICEA 3BDYH 4P9HC 5D6CB 4WHCA 3CJJA 3O3BB 3ULUH 4Z7UE 5TF0A 4J7RA 4NGHL 3BN9D 4E0RB 3N1MC 4N1HB 5JO5A 1AE6H 1HYSD 3D85A 1VGKB 4PRIB 4Z7UA 3H3BC 4PJGA 3GIVB 2FX7L 4YFDB 3QUXB 1WZ1L 4I18B 3BJ91 4KDTA 4X99A 4HK0B 3H42H 3RGVD 5F3BA 5CMAA 4CMHB 3PDOB 5FDWB 4NBZB 3WUZA 5E1HB 3I6KA 2GYSA 1N0XL 4Q0XL 4GW4A 1OAUL 2FECI 5CD5D 1D7FA 5FKAB 3PHOB 1G6RB 1OP9A 1CK0L 2HVJA 3MUGA 2YKLH 4ZAKA 2O5YL 4K8RD 1FG2B 2PNDA 4RGNB 2WBJD 2PW2B 1DDHA 3ARPA 1B88A 4PD4J 2OQJA 3QXDA 1ZE3C 2YEZA 4NHUA 4OCYH 5DQDL 1U95B 4M43H 4PLNC 1DQQB 2YBRB 1JZ6A 1UC6A 5KAQG 4JJ5A 4O2CB 4PJCB 5E1AB 1CD1A 1GZPA 2QSCH 3X14B 4QRQA 1C5CL 1R24A 1R3JA 1G7LA 3RX7A 2R4SH 1FNFA 3QIWD 3X12A 5ICYA 5CBAA 2R2EA 4DZBA 1R5IB 1H3XA 3IU4H 1P7HL 3LDBC 1MIEL 3PWLB 3S5LB 4DK6A 1NEZG 1TZHA 4IRSA 3WKML 1OT2A 4LCUB 2VXQH 4EDWL 1RJCA 4YIQB 1NCBH 1A6TB 1YY8B 5HHOD 1GC1H 1FCCA 1OAQL 1BGXH 3HR6A 1KPUA 4P5MA 4GH7B 4P2YA 1N3NB 4L8BB 1LP9F 3T2OA 3LSOA 1NAKL 1WWCA 1KT2B 3SKJL 4U6TA 5JXEA 3FO2B 4ZXBC 5IK3A 3QO1A 1LNUB 4IRZL 4XT1C 4LPUA 3QI9B 4P2OD 3DSNA 1KJVB 2X1QA 3MLWH 4P59L 3E6FA 1U3JA 4PG9B 4LDEB 3WS3A 1F11B 1J0YA 4GXUM 3BKML 4GAJH 4Y2DC 1Q0XL 2HN7A 4IJ3B 2HFEA 3VGAC 4YK4C 5BS0E 1OY3B 1RZKC 2JJSC 3WLWC 5EU4B 1YC8A 4OJFH 2BNRD 2DLFH 1MJJB 3DLQR 2VZ3A 3MGOB 1HHHB 3QDJE 4Z7UF 3SDXE 2PXYB 2BY1A 4OZ4B 5IOPB 3OKDB 4C4KT 3L6FB 5GSVA 5C0IB 3WS6C 5ALBL 4MLIA 1CDYA 2ZG1A 4KKCC 3DVNA 2FIRT 3P4NA 1T6VN 4QHMB 3P73A 5MP6H 1WZ1H 5GRZA 4Y4HD 4NQDB 2GSGA 4PY7B 5HHQB 1K5NB 1NSNH 3MLYL 4LCWB 3D39E 2HG5A 3IJSA 5F7EL 1IKNC 2H32B 3WO3B 1A7QL 2R56L 4UDUB 3QAZB 3QUYA 1D5ZB 1N0XH 4KK8C 4HSQA 4Q0XH 2YRZA 1OAUH 3BH8A 1FYTE 4F9PA 5ITFA 1G6RL 3I9GL 4Y1AA 3ZKNC 2DQTL 4X9BA 1IAII 1PZ5A 1FZKB 4WI7A 3KHQA 2EDWA 4N68A 3M1BB 2O5YH 4OQTA 4NO5A 5F1NA 1VACB 4L3EB 4M1CD 1BFOA 1IC1A 3GMMB 4RGMB 3VRJB 2Z91B 5GGSB 3MV7B 4ZS6C 5DQDH 1Y0LA 5GISL 2F19L 2H2SD 1TZIA 4U1GC 4QRPB 3CSBA 2ZUXA 2UZIH 1T89A 1EMTH 5L2JB 4I48B 4DTGH 2VQ1B 5TGBB 5E8DL 4K7PL 1C5CH 5IM7B 1S7QA 5JTWA 3KPSE 4RA0C 3BN9C 1Q72L 2QSQA 5KN5A 3TLRA 5GRJH 5E24E 1HYSC 5FUOH 1LGVA 2NY6D 1MIEH 2BCKA 4BSVB 3WKMH 1ZEAL 3NPSB 5I1EH 3DURB 1OM3L 3RGVC 3GJFH 4PJIE 4G8GD 2Q7NA 4UBDD 4WUKH 1N6VA 3QDJB 1T3FA 5D72H 5F97E 1OAQH 4E41D 2BXYA 4MQXD 1E28A 1YUHA 3CK0L 2P8PA 1JV5B 2FATH 1EHNA 2IPUK 5I1AA 5CD5C 2GJ6E 5IF0B 5C0GA 1NAKH 3W0WE 1BZ9A 5DRWB 3ARBA 4EZMA 4HD9A 4X8XA 3UYRL 1IAOA 2GJ6A 3PHQB 4HH8A 4K8RC 2EDXA 1SMOA 4IRZH 5HDBE 3K80A 4NRYB 2WBJC 4BK5A 3PWPE 4MLSA 2VR5A 2BY3A 2D0GA 1U8NB 32C2A 3HRZB 3MRRA 4QTIH 3O11B 1V7ML 1U58A 4MA1B 5C0EB 1Q0XH 3R06B 4DFIA 7CGTA 5TQ2H 4KRPD 3PP3K 4PLJD 3UTTD 4M62H 4KHTL 4YHIB 2RAMA 4RDQG 4E5XA 3DGGB 5DD0H 1QBBA 3SDXF 4P3WA 2UZXB 1QUNA 2NY4D 1CDCA 3HZKA 4OLEA 1J87A 2MTPA 5DJXA 1UM4H 3T4AB 5IVXB 3QXUA 5FIEA 3QIWC 1PKOA 3C8KA 4CRPA 5CJ5A 1MWAB 5I71B 4TYUA 4K2UL 3STLB 3HLAB 5KSVB 5ALBH 3MBXL 4R7NB 3SJVE 4JB9H 3AS2A 1PDKA 4OD3L 4JFOB 3ILPA 1QKZH 1AO7B 3GSOA 3OGCA 5EO1B 4EXKA 1OGAB 3W5MA 3QULA 5L8LB 3MRIB 3BFOA 5CEYB 5TE6L 3VFSA 1ODAA 1BEYL 3MBEA 1F13A 1NEUA 3WN5A 3X11A 5HPMB 3MLYH 1LE5A 2C1PA 4X6EB 3BN3B 1KYOK 4OLYL 1Y6NR 4HIXL 5F7EH 3ZE2E 5JHDA 1OGTB 3ARVA 1A7QH 5LWYL 3KPNA 4R90L 2PF6A 1G6RH 1Q1JL 3I9GH 1FVDB 1ORSB 1NMCB 1SVZA 2Q76B 5T3XH 3G6JB 4P2OC 4FN0A 3ZLQC 1HI6A 4JHWL 1I3UA 2CLRB 4O2EB 4A6YA 1IC7L 3VWKA 4MB3A 5GHWH 2FH6A 3AB0C 4G6MH 2E7CA 2HRLA 4QO1A 1KTLB 3BD5A 1J8HA 3W0WB 3CH8A 2KKQA 1XR9A 3A6BL 5IEHB 4JO4L 3OKLB 4MB4A 3ZKMD 3NGBB 1CXKA 1R5VB 1WCQA 1MLBA 3QIUB 4U6YA 1KELL 4OAWA 5E8DH 1DL7H 3PE9A 1J1PL 2A6DA 3HNTL 4WV1C 1Q72H 2R9HD 1JNNL 4YDLB 1QBLL 4YEFA 4ISVB 5D1XA 2BVYA 1RIHL 4PLKD 4JZJA 4I2XA 4PJIF 4Y4HC 3OJDA 1T5XB 5HJ3A 1J1XL 4JRXA 4Z78A 1MHHB 1JHLL 4N9GA 4UQ3A 4F57L 4G9FA 4C83A 5I1LB 3PWVB 3VDAA 5FA3B 2WW8A 1TMCB 2H1PL 5FHAL 1MCJA 4JFEE 5HDBF 1W8NA 1L7IL 2WMPA 3EO0A 3EFFA 2DM7A 5ITBL 1QSED 2FX9L 1MJUL 3MGTB 3UC0L 4M1CC 1R6VA 1RUPL 5HHXH 3VWJA 2YXMA 1CFSA 5KVFL 5JA9A 2VXTL 5KSUA 1G9NL 3QWRD 1EHLH 4NKIL 2NY5L 4Z95H 1QFWH 4LLVA 2EH8L 2H2SC 4EQ3A 5I6XC 4WFFD 1MCCA 3EYOA 3QDGB 3IXTA 4K7PY 2UV3A 2FBJL 3MRJB 3OBAA 3ULVD 1D5MB 3RIFK 4YHYC 1NMBH 3B6SA 1BIIA 3V6ZB 3GMRB 1TVBB 5IB1B 3O4OB 2VQUA 2DB8A 1YMMD 4KGJA 2NY6C 4K2UH 4EUPG 5CEZD 3MBXH 5HGBA 3GMLA 4OD3H 4UBDC 2IFFL 1M7IA 4MX7A 4QRRE 1ZGLM 5MENA 1V7NL 5E4IA 4I1NB 3W9EB 5TE6H 4MQXC 1BEYH 1XCTB 3DX8A 5E2VL 2NY1B 4R4BA 3VDBA 3ZE2F 3BYYA 1JUFA 4WWKB 2C4FU 4XTRD 4HIXH 2DQFB 4LVNB 2H32H 5LWYH 9CGTA 2Z93B 4NZDA 1Z9LA 1ITBB 4Y19B 3QA3A 3LPWA 35C8H 4ZPVA 5E6IB 4NKDB 1Q1JH 2O5XH 1CIDA 2ZG3A 4XVTL 5BOZG 5D2NE 3ARWA 5A43C 2AI0L 3ZYIA 2DJSA 2ENSA 4URTB 4X4YA 3NZHL 3GSQA 1MLCB 3MUZ1 5ESQA 1EGJA 3WDIA 3WNOA 4RFEA 4XP5H 3U4BL 1A6ZA 1DQML 3JV6B 4JG0L 2DJUA 3HNSL 4ODWB 4KRPC 5E8EA 1C5BL 3N06B 4PLJC 3RAJL 1P2CA 4XXDB 1T1YA 4Y5VC 4JFFD 2BOCA 2DI9A 2X9WA 3FRUB 1JPFB 4CMMB 5DD3H 4X4XB 4HUKB 3CVIL 2WLYA 5GSRA 3U82B 1GIGL 1J1PH 2P8MA 1RZJH 4OCWL 1C7TA 3BD3A 5CUSL 3HNTH 1YJDH 3G5ZA 3CDGA 1JNNH 1JJUA 5EBLB 3QUMB 2X4TB 4OCXH 3GSVB 4DUXA 3HZMA 1NC2D 2HT3D 2X1XR 4MA3A 1M71B 4BFEA 5BVJA 4NQCD 3HNVL 1CXIA 3T0EB 1KEML 4F7CA 3KNBA 5EPMA 1J1XH 3DROA 1E27B 4EN3A 3DBXB 1NJ9A 5FGCE 4LLMB 5BOPA 1H5BB 1KIRB 2IBZX 1NFIA 1JHLH 1UH4A 4GKSA 1BVKB 3C09B 2A6IB 3HPJB 4I9WD 3G5XA 1T20A 4M6OL 5FHAH 3UO1L 5FUCC 3SGDI 4NN7C 5HGAA 4MD5B 5DR5L 1L7IH 1U92B 5ITBH 1CE6B 3WFZA 1FC2D 2W60A 4NNYA 4HF5H 4Z9KB 4DW2L 1MJUH 1FIGH 4BZ2H 4R7DA 3UC0H 4NPYB 5GGSY 3MA7B 2NW2B 2BY2A 4G42B 5DJ2B 1G9NH 2EIZB 4ZYKB 3MJ7A 2EH8H 1YMHB 3BP4A 1ULVA 4BZ1L 1ND0A 1IGJA 3ZKMC 3VXPA 1R3HB 5FYLE 1DUZA 1RK0A 2ILLA 1NBYA 3MLSH 4HS6A 4ELKA 1LWRA 2R9HC 4PV9A 1G7JA 4B50A 5C9JA 2FO1A 1MWAH 3QSKB 3HE6B 1WK0A 1G7QA 2MOVA 1P84K 4PLKC 4LEXL 5DURD 4MNGE 2IBGA 1JF1A 3GJEA 4CADA 1Z3GL 4XC1H 1X5AA 2Z8SA 1QG3A 1DR9A 2C7UB 4MNGA 2H26B 3T09A 2I9TA 1V7NH 4JR9H 1NCTA 2IBBA 4PGZA 3EGSB 3K81A 1BF8A 2KUTA 1KCSL 5B22A 3I6LE 4O58L 4X7EC 3BE1H 4JFDE 2Z0BA 1SJEA 3T08A 5D96B 2QV2A 5F6IB 5GIRB 1YYMH 4Z77B 5DUPL 3STZA 1X44A 2AAVA 4JFDA 1P7QA 1OPGH 1RZ7L 2NX5D 2OJZL 3SKMA 4BSWA 1BAFH 1IM9D 3NZHH 4YQXH 4AZ8A 2R0WL 5HDOA 4D0CA 2EECA 1JWMA 3LCYA 1WBXA 4Z7VA 5FUZL 3HNSH 1HQRB 1C5BH 3RAJH 3TH2T 5JOFB 3ULVC 1BVLA 1ORQB 1SJXA 5TDNB 1L9MA 1S7VB 2X4UB 1P69B 1NC4A 2QL1A 5J0BA 2NY2D 3NH7L 2P24A 3CVIH 4LNRB 1RJYB 1GIGH 4ESKA 4OCWH 5ANMA 3LQZA 4NN5C 1FZJB 5J13C 5D7SL 4UDTB 1PYWA 5EOTA 2ADIA 4APQA 1ZA3B 3H9HB 4WGWB 4PG2C 3RWHA 4UT9L 2JB6B 3HNVH 3MREB 2D7TL 2Z4QA 3OB0K 3ZHDA 1KEMH 4S1SL 3LB6D 2J4WL 4UOJA 3OR7A 3CFCH 3GMOB 3P0YH 1FFQA 5CP7A 1YDPB 5IMMA 4AJ0A 1AIFB 4XTRC 5DJCB 1FZOB 2X4SB 5IGXL 3EW3B 3IKKA 4W6YB 4RIRA 3CLEH 1TVHB 3RX5A 3KHOA 2XZQL 2YZ1A 1MY7A 2EDRA 3T77A 2EDOA 4KWUA 3O4LB 1MEXL 4AEEA 2FJHA 4HGMA 5BRZB 5IT2L 4PD4K 3ZT5A 1CG9A 1UFUA 3PABB 4J3WA 4ZQKB 1B3JA 5CLTA 3RWCB 5MERA 4YJZL 2M26A 1F58H 1IGFH 2NXYD 3KPRA 4FZEL 4NP4H 5JPNB 5KSAB 2KBGA 4O4YL 2A83B 3WL9B 3TJEL 3WFDH 2QTEA 4TUOB 4MZ3A 1CGTA 1I8IA 4XVUD 1F00I 2GY5A 5SV4A 3QCVL 2BVEA 3TNMA 4LEOB 1T1WA 4MNQD 4XNYH 3VXTB 2E6PA 1AKJB 1NGWB 4Q6IA 2DM3A 2HT3C 4LEXH 5EZOL 5MEQB 3OKEA 1OLZA 1YPZE 5HHMB 3E6HA 3HZYA 5H37G 5IJVB 4HULB 5ERWA 3BEWB 5DHXB 3IXAA 1YEHL 5AWNL 3CZFB 4W4OC 3MLVH 5C0BB 1G7IA 1MVFA 2UWEE 3TNNB 2NYYD 1PX4A 4GRMA 1JHTB 4PFEA 4O58H 1I8KB 5KTEH 3OG4B 4AY0A 1CDGA 2UWEA 5EFIA 4LARL 3S4SG 5HXMA 5DUPH 5JPMA 5GRUH 4EI6A 1ZS8B 2XI9A 5H8DA 1DN2A 2I9LA 1S78D 4OQ1A 1RZ7H 2X70B 1AI1H 4CVXA 5D5MA 2RBLA 3IDJB 4Y5YC 3TVMB 1CL7L 2R0WH 4FZ8H 1VFMA 1P6FA 3IDMA 4Y4KD 5FUZH 5T3ZD 3Q1SH 2Z8WC 1X5GA 2BSSA 1UM6L 2R4RL 4JFQB 3WBDA 5EDXA 4MAYA 1YNKL 2OMNA 4C59B 1GOHA 4LRNH 5E7FA 5ID0A 3QFJD 4B0MM 1A7RH 1EEZB 5TDPB 2F8XC 3LS4L 4ZUVA 4U1JB 5I1KL 1GCFA 3FONB 3FQTA 2FEEL 4UQ2A 3QUMH 5D7SH 3VXRE 2AJZA 2IAMB 5DHVA 3D3VD 5L0QC 3FQRB 2BVPB 3UZQA 5E2UL 2F5BL 4H5SA 1TQCC 4YXHL 4NQTA 1GJIA 2D7TH 5BO1L 4DGVL 1I7TB 4WI3A 1UACL 3MUHL 4I4WB 1F4YH 4XNQA 3QNXA 4JFZL 1HXYA 4PP1D 3FB6B 3NFSL 5LGKA 5F9JA 1CS6A 2WUCL 5IFAH 5I15L 1QNZH 1S7RB 5IGXH 3KYNA 2ATPA 5SWZB 5IW6B 5E2WL 2YK1H 2OL3B 4YFLF 4R97B 3ARYA 3U4EA 1A1MA 3KJ4B 1QVOB 1MEXH 1U3HB 1HHKA 2GQHA 4GRLD 3NACL 3S5LG 1GGIH 2FZ3B 3EAKA 3M17A 4HIHA 4XZUB 3BUTA 2CGRL 4R4FH 5CKGA 4K94L 1KGCD 4JZOA 3MTRA 4M6ML 1KJ2B 1T03L 3SDDA 2NY2C 4NUGH 2DTSA 2P42B 1CD9B 4EI5D 4WUUB 5IFJB 1GXEA 5DMKB 1U8PA 3FQWA 5GS0D 4ELMA 1MUJA 2X4QB 1FN4A 4MD4A 4DVBB 3QJHA 2VLJD 3QCTL 3QCVH 2IADA 4YGVA 5F6HI 4XNMB 1YPZF 2YXFA 5C8JB 2EC9U 3QHFL 5EZOH 1O5DT 1NEZA 4H0GA 3ZTJG 2NTFA 1FFPB 4FXGB 4G8FB 3LB6C 4OCRL 2VB5A 4IRJD 2UWEF 2ZCHL 4G8EB 4GBXB 5FK9A 2HMID 1HOCB 2JIXA 4LRIA 4PBVC 5IB5B 5JUEH 4JFYB 3WNKA 3ULUD 2F54E 1BQHB 1QRNB 1CTNA 4LARH 3QEQE 4PYGA 3V4UL 3BW9B 4NYLB 5DXWA 1UZ8B 5FF6A 4BQBA 4PRDB 1FO0A 4U1IB 4WFGD 1OB1B 2H9GB 1VHPA 1MCPH 3FL7A 1CICD 4JHZA 4KJYA 1L0QA 1CFBA 5E4EC 1IBGH 5EO9B 2JF1A 1CL7H 4JQVA 5TDOB 4BH7B 2NXYC 3RVTD 1RVFL 3HZVB 5EBMB 3P30L 3PXJA 2Q7YA 4UT7H 1UM6H 2R4RH 3GSWA 1XIWD 1BOYA 3DTXA 1B2WL 3PL6B 4JQIL 3N1GC 1L9NA 1YNKH 4XVUC 3MACH 1AGBB 4D3CH 3BKJL 5D9SB 1MHEA 1FZMB 5I1KH 1X5IA 4F15B 4PJDE 4QXTA 1I4FA 4ODXB 4OM0L 4WRLA 4M93B 4ORZC 1JIBA 1FAIH 3G5YB 2EKSA 2ZOLA 1FNGB 3BGMB 4HDIB 2X89D 1F4WL 2F5BH 3CX2A 3PWNA 4FNLH 1UACH 5J57B 4QT5A 1FVCA 4LQFL 4XVJL 1FLRL 4LAQL 3MRLB 4H8WL 2NYYC 2YSSA 4F7EB 3L3DB 4JFZH 4H88L 3ALWA 1CLYH 5GRYA 2WUCH 5I15H 1UCBH 1XF3B 3VRIA 1XZ0A 3FFCE 5CSZB 1J88A 4YR6A 4RISL 2FSEA 5E2WH 4PJBA 3P2TA 4P2QB 4CVZB 3DVFA 1S78C 3BWAB 4HFUL 3FTGB 1N64H 3QDAA 1QFOA 1T1XA 3KXFD 4R26L 5EUOB 1AHWB 4F7TB 5CJQH 4P23A 6CGTA 4JHBA 4Y4KC 3FB5A 5ADPL 4BFGA 3O3DB 3V5KA 2CGRH 3K3QA 3B2VH 5CSBA 4JO1H 1A7PL 2HH0L 1KJ2L 1QACA 4UI2A 1JZ8A 4M6MH 1T03H 4C55A 1HEZB 1OP3H 1N2RA 3DX7A 2Y36L 5F8RC 5DRZA 1UB5B 4I5BA 4M6NH 2FD6L 3HUJE 5CWSA 3GSUA 5F88B 1OAXL 1PBYA 4ZTOL 3LY6A 3OR6A 1CF8L 4I0PD 3QYCA 1D5BB 3MV8B 5MEOB 3MCG1 5L2KE 4F33A 4HBCL 1CN4A 4M7LT 3Q3GA 2IANA 2ZCHH 4PJEA 5C0AE 4ENED 1F8TL 5H2BA 5SWSE 2P48B 3P4MA 4WU7A 4F7MB 2OI9C 3EOBB 2AJVL 4MMXC 1NL0H 5DEGA 4NRZA 3RTQD 1V3KA 4D9QD 3IKCA 3MRHA 12E8L 3SGKC 3V4UH 4E42B 3D2UD 4TULL 4WFED 2D9CA 5IROC 4HH9A 2EDHA 4GRLC 3WFBL 2BP3A 2XN9D 4G6FB 1BD2E 1FBIL 5A1AA 3RUGE 4PJ8A 3VFPB 3OSKA 1RVFH 4PGEB 5IIEA 3L5WB 3PNWA 3P30H 1LO5A 2DRUA 3VFRA 2BSRA 1WIUA 2HLAA 4PRAA 1RI8A 3BP7A 4EI5C 3S3SA 1T80A 2Q3AA 1DN0A 5GS0C 3VH8G 1U8LA 2A6JA 2CLZB 1A4KB 3BGAA 4PJDF 5JXAH 3PWJB 3JWDL 3C5SB 3HR5A 3NMEA 1ZGLA 5ETUB 2DM2A 5GRVL 2WWKO 3TT3H 5DJDA 1F4WH 5C0CB 3UXFA 3UBXB 4AT6A 4IRJC 1NGXA 2JELL 4HC1A 3S7GA 5FM5O 4LQFH 2HMIC 2XWJA 4LLUB 4OFYA 4ODUA 5D7LE 1KCLA 4GQ9H 4H88H 5IW3A 3ULUC 5EO0B 4ORGA 3CCHB 3M8OL 3IDUA 1AGFB 1M4KA 1RURH 3Q48A 3UX9B 3OPZH 1KBGH 4HEME 4L4TE 2OL3H 4WCYL 1P4LA 2YPLD 2YA1A 4U1LB 5IVNA 3QEGH 2QLVB 4EVNA 5CBEA 3QNYA 1EPFA 5FO8A 2P49B 1CICC 5MEPB 3RZCB 2JE8A 4X6CA 2IGFH 2DMBA 1T2XA 3DYPA 3L9RA 4R26H 3T3PE 4HUXB 1WFTA 3RVTC 5ADPH 1BX2A 3GDBA 2EEDA 1NFKA 4TNWF 3ARGD 1XIWC 1SY6A 1W72A 2V7NA 4L8DA 4YHOL 3CUPB 1S7XB 4R96A 2Y36H 5JW5B 4QRTA 1BLNA 4DQOL 3F12A 3C6LA 3KPMA 5JO5B 4DUVA 3S35X 3LZFL 1MFBH 1OAXH 1CE1L 4M00A 4ZTOH 5A2IH 2F74A 3IAQA 4PJGB 4K55A 1CD8A 4RMRA 2G60L 5HGHA 4QXWA 3OB8A 4XNXL 4IOIA 1G0XA 3PJSA 4X99B 4HBCH 3RWIA 4TTGA 4L3CA 4WEUD 2OXHA 3PV6A 3TBSA 5JR1H 4HQQL 3I6KB 1IEAA 5CINL 1J0ZA 4KVCH 1JI2A 3PQYA 4GW4B 4YXLH 3WV0A 1QP1A 2HVJB 4KY1H 4N8VA 3KYMA 3W11D 2DYPA 4KK6D 4FQJH 4ZAKB 5FFLA 4PRID 1DDHB 2CK0H 3EYUL 2OQJB 3QXDB 5DFVD 3WFBH 3QUXD 1GC1C 1BVZA 1IEBA 2YEZB 4NHUB 2UZYB 4RBPH 1DVFA 3TJHD 1W0VA 3X3GL 3SY0B 1E4WL 3A6CL 3L3IA 4JJ5B 4NO0A 5KVEL 4YHPA 1CD1B 5F44A 4EXPX 1SBSH 3DUUA 1X5ZA 1GZPB 5F89B 5HY9A 1NLDH 1R24B 1R3JB 1G7LB 1JWSA 5CCKH 2LU7A 4UAOB 1U8KA 2ZSVA 1D5XA 3X12B 2W9LA 5T3XD 5CBAB 2R2EB 2OR7A 4DZBB 4ZD3H 3JWDH 1FSKB 1LDPL 4EUPA 4PJ5E 5C0DB 3MODH 4WTWA 4KXZI 3N1PC 2XKSA 1TZHB 4HIIA 4I0PC 4IRSB 3TIEA 5EU7C 1WF5A 1TETL 3ETBF 3K7UA 5TF1L 1GGTA 3OKYA 2JELH 2QADB 4ENEC 2C3HA 2XA8L 1VENA 3LSOB 2RB8A 4U3CA 3QHZL 3RTQC 5GGUA 3UP1A 3M8OH 2BVOA 3P0GB 2J7LA 2BNQB 1X4ZA 3F7YA 3WNPA 3QO1B 3BDXA 4N1CA 4WCYH 4JG1L 1GYAA 2IPTH 4FTVE 3E6FB 3T3PF 2P5WA 3WS3B 2OM5A 2YN3A 5ISZE 4M5ZH 4KDVA 3HPLA 2HN7B 2GTZA 4FQ2H 2FL5A 2HFEB 4GKOA 1PG7L 5E94A 1OSPH 3GNML 3ZKSD 3G04A 3RX8A 1XF2B 4IMLA 3RWFA 5IB4B 2GK0B 1BJMA 1J0HA 3LPFA 4G7YL 4PB0L 2VZUA 4LL9A 1JNLL 4KI5C 4LLAA 4DQOH 4QHLA 4I13B 5K9JL 3NPZB 3QI9D 3LZFH 3EYQD 1Z9SA 1LILA 3DVNB 2C9AA 3BPLC 2O93L 3P4NB 2G60H 3P73B 4OLUL 4S0TD 4YO0B 1TPXB 4XNXH 5JA8B 2GSGB 4JFHE 4JM2F 3HC3L 4OZGB 4ETQA 5L7XL 5I76B 2HG5B 4TVPE 5FXCH 4M61A 4NNPL 1GL4B 4OZIE 3HG1E 3CMGA 2PXYD 3QG7L 1KTDB 3GIZL 1XGYL 5I9QC 4Y1AB 2O5ZL 2W0KA 3HFMH 3O45A 3QPQD 3HG1A 4OZIA 5GZOD 2Q20A 4LSQL 2ADFL 3Q5YA 5F1NB 5LAXB 3EYUH 4Z7WA 4KAQH 4NQDD 3GEWB 3E2HC 1FE8L 3X3GH 2FGZA 4LCWD 3ARGC 5I73B 2DDQL 1KACB 2AABL 3RVVD 2NCMA 1T7VA 4P3DA 2Y7QA 2I24N 3HI1A 1WFUA 5FGBA 1S7QB 1MCDA 2AK4E 1LQSR 2LTQB 2WLZA 2X41A 1A21A 3JV5A 5KN5B 1H15A 4NOBA 3IDNA 5DSCA 1JWUA 1LDPH 4UV4L 4L3ED 5F1SA 4QNPE 3H9SE 2BCKB 4FXKB 3MV7D 1BQSA 4OFVA 4HCRA 5TF1H 1VCAA 1T3FB 1P6AB 1IKNA 4QRPD 4LLDA 4PREA 1E28B 4G9DB 4GW5A 5A16A 3LHPL 2XA8H 2V2XA 1S9KC 5C0GB 5JW4N 1BZ9B 5BVPH 3BZEA 3QHZH 5D71L 5I16A 3MRKA 4KK6C 4JDVB 4XXCC 1QHOA 3U36B 1IAOB 5DVOA 1MCNA 2XY1A 2JCCA 1VFAA 1UWEH 5GGVL 5BS0D 1J8KA 2NNAA 5DFVC 3QUXC 1AC0A 4I18C 3UEZA 4OBSA 4HWUA 5A2FA 2RGSA 32C2B 2X1OA 5B39B 3VD4A 3TJHC 4KJQD 1U58B 3DX9B 3QDJD 3MMEA 4CMHC 2ARJA 1LO3L 4JPIA 1UH2A 1K8IA 2DN7A 3S9DB 4E5XB 2VDPH 5EU6E 5AEAA 4Q9CA 3LV3A 5DJXB 3IFNL 2YA0A 4PB0H 2KQNA 3ZYOA 1JNLH 1IAIH 1KIQA 5DD5L 3BPOB 4KMTL 2GEEA 2W92A 3RGVA 4JCLA 3S36L 2ZNWA 4YZFE 5DJ6A 3ILPB 1TQBC 5E70A 2Y5TA 2Y1VA 3GSOB 1P9MA 3RJDA 1WV7T 3OGCB 1T22A 1MHPL 3QULB 1UWXH 3CSPA 1CGUA 4NM4L 3W2DL 1FYTD 3LN5B 3HC3H 3MBEB 3WN5B 3X11B 4LSTH 1LE5B 5L7XH 2C1PB 4OZIF 2VLKE 5IB3A 3RNQA 1A6WL 5JHDB 4NNPH 1EUTA 4J1UA 2DLIA 4ZOAA 2G75A 5B8CA 1VADA 3OMZA 3QG7H 5LXGL 3V5DA 1IE5A 2O5ZH 4ETYA 1NCWL 3MLRL 3M45A 4TNVK 4CUCA 4OQTL 1DQJA 1DUYA 4LSQH 2ADFH 3F7QA 3SOBL 1AO7D 3ZL4L 2C1OA 4X9FA 1J8HB 5D7JA 3UPCA 2XZCL 1FE8H 3T65A 4U33A 1XR9B 4G80B 4HGWA 1MLBB 4U6YB 4JPWL 5KVGL 2AABH 4YNYA 2PN5A 4OAWB 3DUSA 1MJ7L 2Z31B 4CKVX 2EXYD 2JB5L 5HHOE 2A6DB 1YYLL 3QI9C 4MDIA 3EYQC 1CLZL 3MNZA 4QNPF 1E6JH 3ARRA 3P4LA 2FHFA 3CC5A 3DXAA 3BIBX 2P8LA 4I2XB 4UV4H 4CL7A 5D93C 2XQYK 2X40A 4D0BB 4IJ3C 3OJDB 3RY5A 4N0UE 4JRXB 4Z78B 3HI5L 3W0WD 4KKLD 1XF5A 4PTTA 3W9DA 3QIUD 4N9GB 4UQ3B 1HNGA 2UVFA 4G9FB 4C83B 3LHPH 3O9WC 3UJIH 2P5EE 3PGDA 2PXYC 5E7BA 1DFBL 2EYRA 4MCZA 4TUKL 3ARQA 4P2OA 1L4IA 1U8JA 3S4SA 2OTWA 3QPQC 3RJQB 3L5XL 1XAUA 1L7TL 5GZOC 3EFFB 2D4DA 2Z92A 5D7IE 5I8OL 1TCRA 2BNRE 2VLRA 3ELAT 1CFSB 2APTA 4W70A 1A3RH 4HS8L 5KSUB 2VLKB 1A1OB 5D7IA 4LLVB 4JM4L 2GITA 5FCUL 3I2CL 3EYOB 3RPKA 1LO3H 3IXTB 3RVVC 4PJ7E 1R5WB 4M5YH 2F9BT 1INEL 1UA6L 5LGHL 3B6SB 3IS0X 1BIIB 1ZT4A 5DC9B 3U9UA 4EIZC 3FT3A 1MAMH 1A9BA 3RQ3A 3IFNH 1FV1A 4KZDH 4HKBA 5HYQA 3MRMA 1KN2H 4O5LL 3UYOD 1NUGA 5DD5H 4YZFF 4Y4HA 3DVIA 2Z35A 4RGMC 5HGBB 3S36H 1MF2L 3GMLB 5TJWK 1B0WA 4OZFG 4UIMA 1M7IB 3MV9E 1KLGA 1MHCB 2CKNA 3MCLH 4M7KH 5MENB 3W2DH 3QDGD 2WIIA 3DX8B 2X4NA 1A1NA 3D6GA 3GKWL 4AM0A 3U0PA 1NKOA 2B8OT 3MJ9A 4OSUH 3UZVB 5C6TL 1RZJC 5B3NA 5KBNC 1YJDC 2DQUL 3QA3B 4ZPVB 2X4OB 5LXGH 2VZOA 4PPTA 5GGVY 5BJTA 3EJJX 4WDIB 5HGGS 4Z5RA 1C16B 1A64A 1EHAA 1F6LL 1N5YH 3BH9A 2A77H 4A6YL 5GJTL 4OLZH 4X4YB 3GSQB 3NPSC 5ESQB 4RFEB 4L8CA 4KJQC 1SEQH 3BUYA 5D1ZD 1A6ZB 2A74A 3ZL4H 4YHMH 1KIUA 5E8EB 2XZCH 1P2CB 1R3IL 1T1YB 2NY1D 3TV3L 1ADQH 3AY4A 4UINH 4WWKD 1NGYA 5FOBA 1X5KA 4JPWH 3ZHKA 4XAWH 1OW0A 3U9PL 3VFGL 3UJTL 5JOPD 1RIUL 1MJ7H 5GSRB 4Y19D 2P8MB 3FMGH 5E6ID 3QEUA 5HHPA 4KV5E 1Q9OA 4G8GE 2ED8A 4DVRH 1YYLH 3CDGB 1BQHG 1EJOL 4E41E 3FN9A 5DFWH 1OQXA 1CLZH 4N90D 1J0IA 2VDML 3HZMB 5BVJB 4GKZA 4WJ5A 1G9NC 4GFTB 2ZCKL 4E41A 4NQVA 2CPCA 4MA1C 2D9QB 4F7CB 5EPMB 1GZQA 2EYTA 3DROB 5T5FL 4EN3B 3HI5H 2VDLH 3MR9A 1NJ9B 4ZNEE 3KDMA 2UUDH 1CVSC 2V9RA 3UJJH 1NFIB 4JFED 4GKSB 1A02N 4U7KA 2BERA 1MQ8A 4R2GB 4ZNEA 1WBYA 4Z8FL 4TUKH 1T20B 2QHRH 3MRBA 4PBXA 5I71C 5HGAB 3L5XH 5D7IF 5F72S 4CBPA 2BSTA 1TNNA 4OUOA 5ADOL 3UTTE 1SHMA 5FYJL 2W60B 3MV9B 5HYSB 1N0LA 3UTOA 4M1DL 4TVPH 4HS8H 3T0ED 3MJ7B 3BP4B 4JM4H 3RNKA 5CJOL 3TO4A 1ND0B 4PJ7F 1ZVYA 2DL9A 3OKNA 1FNLA 3LIZL 1INEH 1UA6H 2EXYC 1NBYB 4LFHG 1OAZL 3TT1L 4XPTL 1PD6A 4HS6B 3V4VH 4ELKB 1NMCC 3T0DA 4PV9B 4AYFA 1G7JB 5C9JB 3MX0A 1OAKL 2EDJA 1FFOB 1OTUD 1G7QB 2C3VA 2AGJL 2CRIA 3V4PL 4DOHB 4ZO9A 2BDNL 2VDQH 1XFPA 2IQ9L 4ZS7H 4XCFL 1YECH 4B7IA 3MNWB 2ZSWA 4KKLC 5F1KC 3Q5OA 2I9TB 1BJ8A 5D2LA 3NGBC 5EZIL 3QIUC 4LCYB 4M7ZB 3VFNA 3NN8A 4G6AD 3C9NA 3GKWH 4HEPG 5TPWL 4X6DA 1T7YA 3AU1A 1XH3A 4HK3N 1SJEB 2IFGA 1SMAA 3HMXA 3SDCA 4YDLC 5AZEL 5DQJA 3STZB 3SKOA 3V6OE 3N1FC 2NZ9D 1CU4L 1YEJL 2OZ4A 4UT6L 4BSWB 5GJTH 5A3ID 1KB5A 3VXSE 1EGJL 5SWQA 3P3YA 4OLXL 4R8WL 4D0CB 1JWMB 4HXBL 1WBXB 4Z7VB 1ZHBA 5I1IH 1AP2A 3BD4A 4FQXD 4AENA 3C2AH 4LU5H 1CWVA 1EBAA 1NC4B 1PEZA 3SQOL 5FO7B 2AEPL 1MY5A 4KV5F 3VFGH 1RIUH 3P9WB 3RA7L 2VL5A 1FORH 3P4OA 4QHKI 3VA6A 1II4E 4ODHL 5ANMB 1KXVC 2XWTA 3LQZB 1HYRC 2ZKHH 3SGDH 2QJDA 2RFXA 3BDBA 1U93A 2FNBA 1PYWB 2E9WA 5EOTB 3HAEA 4Z7NE 5JDJA 2VDMH 2NW3A 4APQB 3ZMRA 2GSIA 3QQ4A 3O2DA 1MCRA 3RWHB 5I8KL 2Z4QB 1B4JH 5C07A 5E9DA 5EBGA 5T5FH 2D7PA 1NANH 1L6XA 1QSEE 2E7HA 2QQNL 5CP7B 4LHUG 5IMMB 5FV2A 3QUZA 4UILL 3MSPA 5DT1L 1TVDA 1AD9A 1MQKL 1TXKA 4RIRB 5EORL 1UWGL 4Q7DA 3LQAH 3O6LH 4PRBA 4CVWA 2FO4A 1PJ9A 2E9JA 3RI5K 5ADOH 5FYJH 2PR4L 5FECA 2A0LC 2QQKL 3NA9L 3ULVE 1ZTXL 4JKLA 1URLA 1QHPA 2FJHB 2IH1B 4M9OA 1NCNA 2X1WL 1CG9B 4M1DH 5D1ZC 2EE2A 2IALB 2ED9A 3ESUF 5C6PB 4IIQA 2VRAA 1F5WA 1QOKA 2FH8A 1YMME 1BIHA 1IFHL 2NY1C 4UTAH 5CJOH 4P48A 1JZ5A 3KPRB 2H3NA 4WWKC 5CEZE 5I8CA 5LQBL 2B2XH 4LSDA 1ZSDA 3FO0L 4LLYA 4X9IA 1I75A 4M9PA 4P4RA 5C1MB 1I8IB 5E6IC 5LKNA 1OAZH 4LGSB 1S9WA 3VH8A 4Y5XA 1FRGL 3MOBH 3TNMB 2F53A 2JJTC 4PG2A 4Q6IB 5IESL 2AGJH 1RPQA 4YLQT 3U2SB 1OHQA 3ME0A 3JVGC 3OKEB 1MI5A 4PRNA 5BRZD 1EBPA 2BDNH 2WAHA 5A2JH 3FRPA 4KTEL 4DWHA 4Y4FA 3HZYB 3EBAA 4G5ZH 4X6DF 5ERWB 3IXAB 1AXIB 5TE7H 4CU7A 1N26A 1CFNA 2GCYA 3O41A 2MNUA 1G7IB 5KSAD 4AQ1B 2YD2A 2DICA 3X3FH 3BPNB 1FP5A 4GRMB 3IDXL 3QQ3B 1N4XH 4GAYA 1NAMA 4R0LB 4QXGH 4YXKH 5EFIB 5T1MA 4PJAE 5JPMB 3C6SA 4N0CD 1AKJD 4EI6B 1Z0NA 4JFFE 3WHXA 4HUNB 5TH2A 4LIQL 2I9LB 1EEYB 2J2ZA 5D5MB 1I1FA 4PJAA 4PJHE 5F7KC 3T0EC 3CXDH 2KZ1B 1ZT7A 3IDMB 3UTQB 3SE3C 4HW6A 1H5BC 3C09C 1F3DH 2JTDA 2MPAL 1I3RA 5I75B 5HGDA 1IARB 2J6EA 3VGDA 1AQDA 5INCA 1EV2E 5FHBL 3RA7H 2DTMH 5CGMA 4NOFA 4WEMB 4ODHH 1RFDL 1TJHH 1KCKA 1OTUC 4NQCA 4Z7NF 3FQTB 4YBHA 4UQ2B 4GUPA 2AJZB 5DHVB 3QP3A 3GRWA 3TVMD 2B4CL 4RA3A 4I9WE 4W4OA 5JHLL 3HC0A 5I8KH 1D6VL 4X7TB 5E00A 1IC4L 2V9TA 3BP6A 4MJ6A 4G6AC 4MXWL 1HXYB 4NBXB 2XTJB 4HKJA 3H0TA 4YHNA 4U0RC 5F9JB 1Z9OA 4UILH 1KB9J 4RSVA 5DT1H 1KCUH 2EE6A 3KYNB 2ATPB 1UWGH 2AK1H 4L1DA 1ZK9A 2W9EL 1QLFA 3QXVA 3ULVF 4Y5YA 2NZ9C 3U4EB 1A1MB 2PR4H 2IAMD 3NA9H 1ZTXH 1HHKB 3QCUH 4RFOH 5A3IC 3TM6A 5LBSL 4HMCA 2VN7A 3VXME 1M7XA 4QF1A 4OKVA 3M17B 4KK9D 4CW1A 1IFHH 1XEDA 1LD9A 3GGWA 4JZOB 4FQXC 2XPGA 2E9IA 5LQBH 3SDDB 1MCKA 2GY7B 4PRPA 1CYGA 4NNXB 5D96C 3FQWB 5F6IC 4ELMB 1MUJB 3IJYA 3JV4B 4QGTA 1FRGH 1FN4B 4MD4B 4PJFA 3OAUL 3QJHB 5C08E 4YGVB 1K2DA 2ZZUT 3IETA 4XMKH 5EU3A 1G0DA 3VCLB 4J23A 1U3HD 1S9VA 3PWUA 2V2TA 1NEZB 4YDVB 2AV1A 4KQ3L 4KTEH 2YS4A 3CSYA 2QHLA 1JFQL 4NO2B 2BX5A 4KKAD 1YEGH 3LD8C 2FX8L 4JO3H 4WW2A 5FK9B 4V2BA 3RKPA 2JIXB 2BJML 2NX5E 4RMTA 3TP4A 3VA2C 1QD0A 5BV7L 4WUUD 3IDXH 3HS0B 1NMAH 1FC1A 4PJAF 4HLZH 3DNKA 4XPAL 2XACC 4PJ9D 5FF6B 1WTLA 1IM9A 1CDUA 1FO0B 1U9KA 2CDGA 3BAEL 4OUUA 4PJHF 1NGZB 3EO9H 2XG5A 5DVKA 2FGWL 3AFLA 3RWJA 1JN6A 2LABA 3ARSA 4RNRA 3UTSE 4C56E 3IVKB 4WY7H 1NFDA 2SEBA 2MMXA 3MA9L 5GGQL 3ROLA 4DUWA 4GBXD 3LKNB 3ARED 2Q7YB 3WMSA 3GSWB 3OG6B 4L4VA 3MRGA 3WIFA 1DLFL 3AAZA 3K4DA 3GUTA 5L9DL 1DQDL 1QRND 1K8DA 1MHEB 5FHBH 3B3IB 3W81A 1RFDH 1KJ3L 1I4FB 4U3XA 1HQ4A 2EKSB 3W5NA 3DGCR 4LSSL 2ZOLB 1KPVA 1FFRA 5JHLH 1ZLVH 1HSBB 1B4RA 1A4JA 1QFWM 1D6VH 3PWNB 3DECA 1T6WA 1IC4H 1FVCB 2IPKB 5KSAC 2YD5A 5C0RL 2YSSB 1FAKT 4JANA 5C08B 2NXZB 1NGQL 5J9PA 1GGBL 3PL6D 2ADGA 1JZ4A 5IBUG 3VRIB 1ED3A 1XZ0B 4N0CC 4YR6B 3HN3A 2N56A 5DA4A 2FSEB 5FYKL 4AEFA 2NPLX 2OXGA 4IDJH 4PJBB 5J1SC 3ZTNL 4HT1H 3MZGB 5J6GA 4XX1E 2GUOA 2NQCA 3JUYA 1T1XB 3C5ZA 5LBSH 1JHKL 4P23B 1PAMA 1DEDA 3FB5B 5EA0L 4K3EL 2V5RA 1YQVL 4HPOH 4MNQE 2XOTA 3MOAL 4F9LA 2AJYL 3THMH 4KI1A 4L29A 2PETA 1JNJA 4JRYE 1A7OL 4PLOB 3U0TB 4YHLL 1JGLL 3V7MA 1N2RB 2GHWB 3RZWA 3CLFL 4NQEA 4ODVL 4WI8A 2I25N 4RWHA 5E56A 1G7MA 1CXHA 2FCBA 4I5BB 4LVHB 3O3EA 5FKPA 5CWSB 3GSUB 3OAUH 1YEFH 3UTSB 4C56B 3WD5L 3OR6B 2NY3B 1AR1D 3CPLB 2B0SL 1WEJL 3TVMC 3RHWK 2HKFL 1EAJA 4TSCH 3F7PC 4JQXC 4BUGA 3ZSSA 2APFA 2XWBA 1VDGA 4MVBD 5IR1A 3HC4H 2ADJB 3Q3GB 2FX8H 2IANB 4PJEB 5H2BB 4MA8L 4UTBH 3QEQD 4ZFFA 3P4MB 5IWLC 4WU7B 2BJMH 2EE9A 15C8L 3QQNA 2IH3B 4F3FA 4NRZB 4Y8DC 3LKQA 4XNUL 3IKCB 3MRHB 1LO0L 3QQ9D 4F7PA 5T3ZE 1FO0L 2IAMC 5SX5K 3BAEH 3K8LA 4HH9B 3TYGL 3O81A 2BSED 4XPGL 2FGWH 1JPSL 5K9KA 3QFJE 4F37K 1C12A 1JZ3A 4BELD 2YMXH 4KU1A 1RUKH 4PJ8B 1FFNA 3GJFK 1VEMA 1M7DA 4JPKH 5IIEB 3PNWB 4JREB 5EULV 4OT1L 1LO5B 3VFRB 4JGJA 2HLAB 4PRAB 5SX4H 5BQ7A 3BP7B 2W0FA 1DBAL 4TOYL 1DLFH 4ZFOA 3OHXA 4WHYG 4BUHA 1DN0B 2ESVE 3ULVH 1DQDH 1U8LB 2A6JB 1DBBL 2FYYA 3OL2A 5D1QA 5E95B 3D3VA 2C3XA 4FQCH 4R97C 3SE9H 3WFHA 3ILQD 3HR5B 2Q8AL 1PKQB 1U3HC 3X13A 3MLZL 4AL8H 3VFVA 4XVSH 4G6FD 4DKDC 1IL1A 5DJDB 2AV7A 4JE4B 4KKAC 4AT6B 4DEPB 2F5AL 1NGXB 5BMFH 4FQLH 2WM0A 2XWJB 5C0RH 2QKIA 4ODUB 3HCVB 1NGQH 4M1GL 4ORGB 1LEIA 4PJ9C 4PJXA 2G5BA 5FYKH 1P4LB 1CFQB 4KPHL 1C08A 5CBEB 3QNYB 2R23A 4X6CB 2VABA 3L9RB 2FB4L 5C0CD 2LU3A 1JHKH 1WUNT 1IGMH 5EA0H 1BX2B 2VLJE 1IRAY 1YQVH 5JMRA 4GBXC 3AREC 1W72B 1IAKA 2Y5EA 2HRPL 2V7NB 4L8DB 3A0OA 1A7OH 3AUVA 4YHLH 1DANU 4R96B 4Z7OE 4JVPA 1Q8MA 4KFZC 2MFNA 4QRTB 1BLNB 4EBQL 4P4KA 5E08L 4ZO6A 3OKKA 1U8OA 3V8CA 3F12B 3C6LB 5C0FA 3KPMB 4GW1B 1JMZA 3TPKA 5L2KD 5EOCH 4ZFGL 2ZUSA 3OX8A 1WGOA 3KYAA 1OVZA 3RZCD 2F74B 1J0JA 2B1AL 1W0YT 4GAFB 2MHAB 3GBNL 3MLTA 5E8NA 5HGHB 3ULUE 4XP4L 5JQHC 1MJ8L 4FA8A 3PJSB 2ESVB 3O6FA 4WFGE 2QBWA 2NY7H 4NZUH 1S3KH 5JNYA 2HT4D 3PL6C 3PQYB 4PY8J 1I9JL 1GPOH 3VFOA 3UPRA 3KYMB 3JWDC 4F15C 1AXTH 1SJHA 2DYPB 1BD2D 1LO0H 3LMJH 3GM8A 4M93C 3S37H 4F80A 1MCBA 3T4YA 1U42A 4J6RH 3P40A 3TYGH 2AJ3A 1IEBB 5DJ0A 1JPSH 1HCFX 2R15A 3C5JA 1DVFB 1B6DA 1W0VB 1ZLSH 3PV7A 1J5OL 4LSRL 1I1CA 3L3IB 2NZIA 3KPPB 4BH8A 1CBVL 4YHPB 2DAVA 2G9HA 4DJMA 1XR8A 3CFEA 3OF6A 3PUCA 5C09E 5B3JE 4DKEL 1KYOJ 2J12B 1DBAH 4TOYH 2A38A 1JWSB 1CZ8L 5ILTL 1U8KB 2ZSVB 3FB7A 4YH6A 2X89A 5L6YL 4DGYL 4ONHA 4MMZC 1AR1C 1OTTD 4EUPB 3MLZH 2FEEI 3KLAA 1AHWC 4EEEA 2MWCA 3BKCL 3TIEB 1H0DA 5D7LD 3MLPA 1QO3A 3G6AA 3Q6FA 4MVBC 4OZFA 2X2YA 5IVOA 3VJ6A 3TPUA 5I66A 4HC1L 5EZJA 1L6ZA 4RAUA 4OGYL 1S7WA 2HWZL 3KXFE 4M1GH 5GGUB 1T0MA 3TWCH 1HKLH 3QJFA 4OM1L 3I6GA 3QQ9C 3F7YB 4QHUA 1QLRA 2FLRT 1RUML 4X8JA 4NZRL 4D8PA 1JBJA 1NUFA 1TDQA 1QBML 4OZHE 1MFDL 3L3KA 3WXVH 2AEIT 2XFXA 4IRSD 4FQQA 2P5WB 1H3TA 4JDTL 5KSBE 1GVIA 5F8QC 2GTZB 2FL5B 2MCPL 1HHJA 5E94B 2AKRB 4DZ8A 3P11L 3G04B 2DQGH 1IGIL 4XMLL 2VDOL 1SY6L 1W72L 4WGVB 5KSBA 2FRGP 5GZNC 2AJSL 2HRPH 4Z7OF 3P9MA 4IMLB 3RWFB 1MIML 4EBQH 3CFDA 3DI3B 1QEWA 2BNQD 1ZVSA 3ILQC 3OB0H 3N85L 4QHLB 4P99A 1HCVA 3FOLA 4ZFGH 3ULUF 1M1SA 3D9AH 7FABH 3GBNH 4XP4H 5F3HA 4KH2A 1FNSL 3MFFA 5HDQL 1MJ8H 1V8HA 1KN4L 4ETQB 5I1JL 4FFYH 4WFEE 4LNVA 3GKZA 3PXHA 1ZAGA 5KOMC 4AG4H 3WNMA 2XN9E 3WNLA 4JKPH 3D2UA 4PGBA 3H3PL 1Z5LA 3T0WA 5EC1A 1JNHA 3UROR 4HMDA 3B8SA 3O45B 3DJ9A 1K4DA 4NC2B 1DQLL 4X9GA 4L8SC 4TVSa 2Y07L 4KXZH 4Z7WB 1YQ2A 4MDJA 4DAGL 2F58L 4KVNH 4JFXA 1GGCL 3NA4A 3T2QA 4PP2A 1J5OH 5AYUH 4P9HL 2J8UE 1CBVH 1UVQA 4P3DB 4GG6A 2J5LB 2Y7QB 5B38A 2EH7H 5CILH 3HI1B 1P5UA 3U48A 3OQ3B 4DKEH 5KS9E 2DQEH 4O9HL 4PJ5D 1EK3A 5FAAA 1MAJA 1M05A 1MRDL 1CZ8H 4Y1AD 3UTPD 5ILTH 2OJEA 4DFHA 4BQ8A 1L0YA 3RZCC 5DSCB 1FDLL 1JWUB 5L6YH 1RUAL 2YUVA 3DV4A 4G8IA 1H3PH 4ONGL 3BKCH 1UQSB 1VEPA 3HHRB 2WQ8A 1MCHA 2OTPA 2YPLE 2WBKA 3L3GA 4LLDB 4LOUD 1WFNA 2HT4C 4GW5B 5A16B 5ABDE 2APVA 4WI6A 1MCOL 3ARTA 2V2XB 4PYHA 2HWZH 4N0YH 4W6WB 4KTYA 4M4RA 5ESAA 4K9EH 4QOKA 3MRKB 2YPVH 2X1PA 3GB7A 5E6YA 3MLUH 3SDAD 4HWBA 4NZRH 4OIIL 2JCCB 4V1DE 3GJFA 1VFAB 3QO0A 5IVZA 4N9OB 1MFDH 4KROD 5I1DA 5KSBF 3IU3A 4U1GB 3P0VL 1YEEH 5DUBA 2AXGA 3MMEB 1P7KA 4BYHA 2HFGL 3OAZH 2ARJB 4JPIB 4U2YA 3INUH 2YRLA 5AD0A 3HE7A 2XZAL 3ZKXC 4LKCA 1IGIH 4XMLH 1CGYA 1I9IL 1SY6H 1BFVL 1W72H 2UY7A 4FRWA 4GO6B 2AJSH 5I1HL 4ZSOA 3LV3B 3PGFH 25C8L 4RFNB 1MIMH 5F9WB 1SYVA 2QR0A 2Z9TA 2EDBA 4JY4B 4G6JL 1NUNB 1KIQB 5IHBA 1XF4B 1JL8A 1HHIB 1OTTC 1YA5A 2E7LC 4KTDH 1KSRA 2OTUA 3QFDA 2J8UB 4TVPD 5DJ6B 2A9NH 2GT9A 4U6HA 2Y5TB 5ID1A 2QSVA 4JFPA 3LQMA 1BMGA 4Q2ZA 4OLWL 1T22B 4H0HB 3WSQH 5KS9B 1U8QB 4NC1E 3BP5A 1CFTA 5D6CA 1KN4H 3CFIC 1G9ML 3NCFB 3F58L 4B7LA 5I1JH 4E0RA 3O8XA 3K8KA 4J1UB 2B5IB 5B8CB 1VADB 1BZ7A 4EOWH 3H3PH 2BHZA 4PRIA 3V5DB 5IFHH 1CLOL 3DRTA 1FSKC 4I18A 1X4XA 4Z76A 5LJYH 1DQJB 1DUYB 1DQLH 4M3JA 4IRSC 5C0JB 3U7AA 1KCVH 1HXMA 5FDWA 1RZKL 4LSPH 2I26N 4DAGH 4AMKL 2F58H 2Q6WB 3AVEA 5T3XE 5D7JB 3RHWF 4QWWD 3T65B 3L3OA 3MBED 3ABZA 4NQUA 3VI3E 4HGWB 4RGNE 1NCDH 1RD6A 4P5TC 2V9QA 4MSWA 4P9MH 1I7UB 5BZDB 5JHDD 4YNYB 1QPPA 3DUSB 4V1DB 5J3HD 3NCYS 4O9HH 1FG2A 1MRDH 4BFIA 4OD1L 5GRWA 2ZUQC 3MNZB 4DCQA 4PJCE 1FIEA 4ERSL 3REWA 4ZMAT 2RHEA 4YDKL 3DXAB 4EUPH 1UKQA 2P8LB 1LP9A 1RUAH 2YBRA 2FBOJ 3FQNA 4Z7QE 4HCRL 2Q87A 1J8HD 5DHYA 3X14A 1XF5B 2ED7A 4PTTB 2NY0B 3JBG7 3W9DB 4F37F 1NDGA 2K3TA 4U0QB 3ZDXE 4EJ1C 1MCOH 1ZOXA 3AS3A 3PGDB 2Z31D 2EYRB 5AG8A 2EC8A 3BKYH 3A67H 4WU5A 1U8JB 5DF0A 1QSFE 4XP9H 3S4SB 2OTWB 4CJ0A 2DQIL 5L8KB 5D8JH 1YY8A 1A6TA 1RHFA 2Z92B 4OIIH 4G6KH 5C3TA 1TCRB 5TQ0L 1WISA 2VLRB 4XBEH 4LMQI 5FCSH 2BY0A 5EZLA 2AERT 4JRXD 5EU6D 2GITB 2E7BA 5DEFA 1U8HA 1CT8B 2HFGH 1KT2A 4GMSL 3VGFA 4EDXA 2LAGB 4G9FD 2XZAH 3MROA 1EVUA 1OT1A 2BRRL 2ICES 1BFVH 5F9OH 2WUBL 1LNUA 1S7UA 3I50L 1A8JH 3R8QA 4F9PC 1ZT4B 3QI9A 3FT3B 1I1AA 25C8H 4OV5A 1A9BB 1CR9L 4FP8H 1FV1B 2A2QT 3RPIA 2MJWA 4HKBB 3MRMB 5HYQB 1T4KA 5FYJD 4G6JH 1U6AL 4UUJB 2YA2A 3QB7C 4CAGA 1AGCB 5DZLA 3DSFL 4Y4HB 2DI7A 2Z35B 4MXQD 2XRAL 3O6ML 1MRFL 1KIPA 3DMMB 1MH5A 2VLKD 4CGTA 2VDKL 2ARWA 1HINL 4UIMB 3Q6GH 1KCRL 1IAMA 1IT9L 2P45B 4Q9RL 3O9WA 4LOUC 5I73C 1RUQL 1JYVA 1G9MH 2WIIB 4LPVA 4U3HA 2WWKT 1A1NB 3BX7C 4WIQA 4AM0B 1QA9A 2JJUA 3VGEA 3V0VA 3L6FA 1HDMA 3MRFB 4ZOCA 2BVQA 5C0IA 4K8RL 3TA3A 4NQDE 2G5RA 5E2TL 4GAGL 1CLOH 4R3SB 5BJTB 4HIJA 4LCWE 3SDAC 4Z5RB 4KROC 4NQDA 3BH9B 3BSZH 1MFNA 1OCWH 2VDNH 4XWGH 3BUYB 3KR3H 2JLLA 1YNTA 3VI3F 4AMKH 3MV01 2W0LA 3FO1A 3WIHH 4YHYB 1QSFB 4YDJA 1A22B 3KJ6H 3KVQA 4JCMA 3L5IA 5H35A 4L3EE 3VFTA 5LVEA 5IQ7L 1F97A 4NUJA 3CZJA 3MV7E 4JDZB 1RU9L 1NUDA 5HHPB 1Q9OB 3V52L 4PJCF 4QRPE 3O3AA 2K1MA 1BZQK 2R1YA 3MZTA 3V0AC 5IQ9A 4Z7QF 3WYRA 2ITDA 4RMSA 2XQBL 4BQCA 4NQVB 1Q0YH 5AYQA 5L2JA 2P5ED 2R69H 3LAFA 3LEYL 4I48A 1GZQB 2EYTB 1F6AA 3MR9B 3QIBA 3ZDXF 4P2RE 3KDMB 3UBXI 5C70A 2DQHL 2HA1A 4XCYB 3VXOA 1UEYA 2IBZY 2EDFA 1OARL 4GKNA 1FPTL 3F6LA 5I74B 1UADC 1WBYB 1WWAX 1FNHA 5BS0A 3LEVL 3FB8A 1A2YB 2BSTB 3BPOC 2YPKA 4LSVL 2GJJA 4NGHH 5TQ0H 3QDJA 1U3ZA 4MA7L 3SDXA 3KPLA 3FAWA 2IG2L 2O26U 4YWGL 3KLSA 3WO4B 1JRHL 3TIDA 4N8CL 1JV5A 4QWWC 2FX7H 4EN3D 3MBEC 4GJTB 3WN5C 3RNKB 3TO4B 5I1GL 1I3GL 2CQVA 3FN0L 5DRWA 3D69A 3OKNB 2BRRH 5DMGD 5J3HC 1PGRB 4R2GD 3I50H 4B53A 4UU9B 4KQ4L 5F9DC 1CR9H 4LPXA 4XI5D 1SJVA 1RMFL 3IF1B 1FHGA 2PYEE 1RZGA 3D39A 3MV9D 2C3VB 1CK0H 4IMKC 2EO9A 1ZHNB 3O11A 3DSFH 4UMGA 3RKDD 1RIVL 3O6MH 5IW1B 1FYTA 2CMRL 2DLEA 5IVXE 3OXSB 2VDKH 2H2PD 3DGGA 2ZSWB 1B90A 1KCRH 2Z8RA 5D2LB 2ZUYA 4Q9RH 2AEQL 1RUQH 3PGCA 3TEUA 3NN8B 3C9NB 3SGEH 3MJ9L 1I7ZA 2Z31C 4LCIL 1MWAA 3ALXA 4X6DB 3RDTA 1AO7E 2DIBA 3AU1B 4HS3A 3NCEB 1XH3B 1OGAE 2CRZA 5LG1A 3QDMB 3SDCB 5DQJB 4JFOA 3SKOB 1AO7A 2YZ8A 5IKCA 1NQBA 5JIHA 2G2RA 4K3DL 4P2RB 4NN6C 5A2LH 3KPSA 1KB5B 4P46A 5SWQB 1IGTA 4YGAB 4EDWH 3CXHJ 3G6JE 4QTHB 2CRYA 2ZG2A 3RIAF 3DV6A 2FLBT 4NM8L 1FVDA 4AENB 2A73B 3V5HA 5CAYB 1YN6A 1P4BL 4GRWE 3LQAC 1LK3L 4PJIA 2VL5B 3P4OB 1RU9H 2BVUA 3V52H 3SKJH 3V7AE 2RFXB 1U93B 4MXQC 4XB8A 2NW3B 4O02L 4WTZG 3W0WA 2GSIB 3QQ4B 2VUOA 1M6OA 1R5VA 4P59H 5C07B 5E9DB 2XG4A 5DZNA 3BKMH 5TFSL 2Y6SD 3PWPA 2DQHH 2PYEB 3GSNA 1H3VA 1E4KA 1NC4D 3SBWC 1CDIA 3K1KC 4OKDA 3QUZB 2YC1A 1WJ3A 1FYHB 1AD9B 1OP3K 5JW4R 3KYOB 4KDWA 2W1NA 4PRBB 2FO4B 3AS1A 1A7BA 2VR9A 2D31A 5FECB 1WAAE 1T5XA 4N1EA 4HX1B 4BQ6A 4APQD 1MHHA 3LS5L 3ORJA 1CD0A 1SEBA 4OF6A 2DWEA 1G1YA 4NQSA 4IIQB 3BZDA 1CXEA 3ARXA 3PWVA 1GHFL 4PRHE 5FA3A 5T33L 4NCDA 1I3GH 2H3NB 3FN0H 3SJVA 1ERNA 5F93C 5I8CB 4NBYB 2Q8BL 4POYA 1ZSDB 5EIVA 4LLYB 1RJZA 1DQTA 4U1NA 5IHUL 4P4RB 1CGXA 5J13B 1S9WB 3VH8B 4Y5XB 2R56H 4HXAL 4TSBL 2VXVL 1YEKL 2F53B 2VZSA 3LPGA 5GGRA 1NBVL 3QDGE 1EVTC 1DBML 2DQTH 4MJ5B 1H8SA 5K9QI 4OV6F 4IS6A 5IVXF 3B9KD 1MI5B 4PRNB 4X6FA 2C3GA 3FJTA 4Y4FB 1J05A 2CMRH 3BRFA 4GRWB 3B8YA 1A6UL 3V6ZA 3CH1B 1CFNB 1LEGA 2GCYB 2F19H 3KPRD 5GISH 2AEQH 2CKBA 4MJIB 5HVHB 4LCIH 5DRNB 4GAYB 1NAMB 5E03A 1S5IL 5MHSD 5T1MB 3HMXL 2BRQA 4K7PH 3VXSD 4HG4J 2W9DL 3C6SB 2RR3A 1IM3A 3HA0A 4ZODA 3WHXB 1UEMA 4IEFB 2BNUB 5TH2B 1X7QB 2OZ4L 5D1ZA 3FQUA 5I8EA 4J3OC 4K3DH 5ALCL 1F2QA 1I1FB 3TC9A 5JOPE 1KB5L 4Y19E 1BBJA 3G6JF 4EN3C 2UVEA 1ZEAH 2Z93A 2BMKB 1OM3H 4N90E 5I19L 1ETZA 1I3RB 4NM8H 1A6AA 2P43B 5HGDB 4R2GC 1QPXA 3CK0H 1TTGA 2JJTA 1AQDB 3W39B 3QG6A 5INCB 4X6BA 1EO7A 3AMLA 4XI5C 5DD1L 4MXVE 5CZVL 3BMWA 5ACLA 3JVGA 4X98A 4N8VG 2W38A 4GUPB 4RMWA 3QXAA 3UYRH 1XGQA 4OGXL 3RKDC 4PRHB 3L3JB 3MO1A 3O2DL 5HHVL 4MGXA 2H2PC 3ZTJH 3HC0B 4JFEA 5E00B 4CMMA 3L5HA 2K7PA 1WIOA 1MREL 4MJ6B 4WVRA 1V7MH 4Y8AA 3MXVL 3CFBB 5TFSH 3TZVA 3S34L 4HKJB 4YHNB 2IMNA 5EBLA 3SEPA 2F15A 4KHTH 3QUMA 3T0EE 2X4TA 4BKLB 5JLZA 1M71A 2KDGA 1IQWL 2PUQT 1G7PA 1WAAF 3ISWA 1QLFB 1IAIM 4Y5YB 4YHZL 1JK8A 4LCCC 1WCBB 1E27A 1OSZB 2E6QA 3DBXA 3LS5H 4G3YL 3SE3A 1H5BA 1KIRA 4XBPA 4QF1B 4ZUWA 1NLBL 4AQOA 4OKVB 1KJMB 1AJ7L 1EFXB 2ERJC 4NDMA 3LEXB 5KVMC 4M7ZC 4X7DC 4CW1B 3L7FB 3EYSL 3GGWB 5T33H 2XPGB 2XTJD 5H94A 4MD5A 4PRPB 1V05A 5IHUH 4OLYH 4QRRA 5DURB 3IJYB 4NPYA 4HXAH 5FYKD 4PJFB 5HI3D 5L0QB 2VLLA 4XAKE 4R90H 1NBVH 1ZHLB 3IETB 1R0AL 5EU3B 4YBLC 3NBNA 4ZYKA 3MLXL 1S9VB 2V2TB 2P1YA 4JEGB 1R3HA 3WE6A 4JHWH 3B83A 4HZLB 1WICA 3CSYB 1IC7H 1I3VA 2EIDA 5D2NA 4L9LA 1A6UH 2Y6SC 4XMPL 4WW2B 3NCMA 3SDDD 3A6BH 3P77A 4JO4H 1UJ3C 1NAML 1RZFL 1S5IH 5J8OA 4MJ4A 3RU8L 1WT5A 2NY4C 1KELH 3KPQA 1CGWA 4RX4A 3ZYZA 3U6RA 4AEIL 5CLWA 2CDGB 4APQC 4OUUB 4U6XA 1JF5A 1QBLH 1MCIA 5ALCH 2HLFD 3DARA 1RIHH 2V7HA 4U1MA 1KB5H 3RWJB 5BZWA 4RNRB 5GRVK 4FQXA 5J4MA 4FQHA 1NFDB 2SEBB 2DLTA 1XCQA 1AD0B 4AH2B 3ROLB 5BXFB 1CQKA 4L4VB 5I19H 3MRGB 4H20L 2E3VA 3AAZB 3D0VB 4MXVF 2J6EL 4F57H 2HJKB 3UCRA 5DJ8A 2NR6D 3ZO0A 1K8DB 2MSPA 3QUKA 1A14L 5DD1H 3QWOB 5CZVH 5T1DL 43CAA 2NLJB 2H1PH 1S9YB 1HQ4B 3B9KC 3GRWL 2FX9H 5E99L 2FWOA 5T5NF 3O2DH 2ZOKA 4U1SA 3S35L 1KPVB 5IBLD 1YEDA 1ORQA 1RUPH 5KVFH 2VXTH 2QSTA 2NY5H 4NKIH 2D4FA 1NANI 4U1KA 3MXVH 4JZNA 4JANB 3S34H 5DTFB 3V6OC 1ZHKA 3PIQA 5J9PB 3WUWG 1OWRM 1RV6X 3GI8L 2FBJH 43C9A 1ED3B 2EIEA 1Q9LA 3VXMD 1IQWH 2JB6A 2D03L 4X5LA 4YHZH 1ZV5A 2K9UA 5J6GB 3RBSA 3IAGC 1HHGA 5GS1A 3GHBL 4OLVL 3C5ZB 1TTUA 2CRMA 4L5FL 1YDPA 1CFVL 1AIFA 4K3GA 1NLBH 1FZOA 2HP4A 2Q86A 1A0QL 3O4LE 2IFFH 3EYSH 1FGVL 1U0QA 4L29B 5C08D 1TVHA 2NXZD 3CD4A 5BRZE 4Q9BA 4R0LC 5E2VH 4NKOA 4J3SA 4NQEB 3BRDA 5K59E 2GFBA 1G7MB 3T3ME 3VXUE 3O3EB 5FKPB 5BRZA 3TO2A 5C2BL 1OP5H 1ROWA 3A6OA 1R3LA 2DM4A 4XVTH 3T0BA 2AI0H 4M7JL 3GSRA 3TN0A 1A5FL 2XWBB 4UOW1 4Z0BL 1HIML 3ZZ1A 2A83A 1D9KA 3EKCA 4GRWH 4TUOA 4XMPH 1ZANL 1G1CA 4UNUA 3U4BH 5I75C 1DQMH 4JG0H 4ZFFB 3GI9L 1CGSL 1V3LA 2GW5A 1OL0A 1AKJA 4K3JL 5HHME 4F3FB 2VLMD 3LKQB 4OTXL 4TUJA 5C0BE 4F7PB 4C56D 4HLJA 3UTSD 1U8IA 4FQ1L 4S1QL 1QSVA 5CUSH 4OF0A 3KLDA 3OZ9L 5EWIL 3CZFA 3T1FA 3WEXB 1I1RA 1KULA 4FMFA 1T21A 5K9KB 1C12B 1CQYA 1SM3L 1JHTA 4QHNA 4LPTA 2ITCA 2X10A 2IAND 4TNWK 1I8KA 3RL2A 1M7DB 5IG7A 2ORBL 2XTJC 4JN1L 5BQ7B 3F7VA 1QLEL 2KQMA 3QH3A 4ZFOB 3R8BB 1HE7A 5D1QB 2FYYB 5HI3C 1ZKAA 1A14H 1RZIA 4G43B 3T8XA 3WFHB 3VG0L 4M6OH 1KPRB 3UO1H 3VFVB 5DR5H 3GRWH 4M4PA 4J3XA 5E99H 4DW2H 3D18B 4HIEA 1IL1B 2AV7B 1VERA 5IBTL 4KRLB 1YEIL 2FIKA 3SDDC 3BESR 2QKIB 3VXUB 4BZ1H 1KLUA 2VH5L 1PW3A 4AIZB 1JE6A 3BRGC 2X7LA 1QBAA 1LO2L 4J4PA 2IAMA 4P5KA 5DRXA 1NGPL 3FQRA 4I3RL 4PJXB 2G5BB 2VXSL 1C08B 2D03H 2VITA 5DMJB 2HLFC 2LQRA 5AUMA 2VABB 3GMNB 4I4WA 4OLVH 4WHTB 4JRYD 3VGHA 1I8LA 5SWZE 1Z3GH 1CIUA 1AXSA 3VFWA 2DKSA 1P5VA 4H25A 4LRIC 4OFYD 1IAKB 3DX6A 1YPZA 4JKWA 5IW6A 2OL3A 4GXVL 1LEKA 3EYFA 5K59F 1DBKL 3EOYG 4X7CC 5HYJB 1XGUA 2NR6C 3T3MF 3C2SA 3EOTL 1KCSH 4P4KB 1U8OB 5C0FB 1KG0A 3U79A 3QT2A 5C2BH 4JHAL 4WEBL 3GMPA 3OX8B 2XNAA 3QEHA 4JO2L 2DQCL 1NH6A 4XZUA 2HFFA 4N5ED 2AXFA 4WUUE 5IBLC 3WJLA 1G0YR 4P57A 2CDFB 5DQ9B 4JQVC 3IJHA 4XCNA 4XHQA 2OJZH 1X5FA 3SPVB 3ARFA 1JTPA 1MRCL 3BVNA 5IFJA 1AGDA 3O6FB 4I3SL 1KTRL 4J8RA 5GS2H 4G7VL 5JNYB 4X7SL 5HYFA 1VFUA 1CCZA 3GO1L 3GI9H 4HFWA 1CGSH 4PJ9A 3SN6N 1MNUL 2B1HL 1U8MA 3UPRB 3VFOB 3NH7H 2RCSL 1N6QL 4XNZB 3UAJD 3VD5A 1MCEA 1SJHB 2IC2A 2E6JA 5CHNA 4FQ1H 4FXGA 3VFMA 2PO6A 3ECBA 3OZ9H 1A3QA 5CD3B 1MVUB 1LDSA 3DOSA 1QRNE 3CVHA 3AREA 1HOCA 3C5JB 5FGSA 4PY8I 3QDHA 2ESVD 4UT9H 4I3GA 1JVKA 4V2CB 4Q58C 3VXRA 1IC5L 4PB9L 4S1SH 4ODSL 2ORBH 4BH8B 2J4WH 2NXZC 2G9HB 3SGJA 1XR8B 3CFEB 5EIQA 4ZFOL 5JQ6L 2VL4A 1C1EL 1IKFL 4PV8A 3CIQA 2VIRA 2DYPD 3C8HA 1Y18A 1F90L 2XXCB 3MOQA 3VG0H 4ONHB 2XZQH 1JGVL 4X5XB 1D5IL 3MRPB 2QQQA 4BH7A 4ZG1A 2AQ2A 2P44B 2HTKD 3KS0J 4XCCL 2ZWLT 1QO3B 4OZFB 5IT2H 1AY1L 3VJ6B 5IBTH 4DN4L 3TPUB 3PL6A 5I66B 1AGBA 4JKKA 1RZ8A 1YEIH 4RAUB 2VYRE 4LASL 5C3LD 1S7WB 4FZEH 1EIBA 4GS7B 5INDA 1P4IL 1ZXQA 5F1IB 4O4YH 4LVHC 1INDL 3P9LB 2DBLL 2HVKB 3TJEH 1LO2H 1ZVHA 5EN2A 1NGPH 4I3RH 1QLRB 4QHUB 4R4ND 4X8JB 5LGJA 4QRUA 5EBWB 3TBYA 4D8PB 1P1ZA 3K74B 3L3KB 2CIKB 4FQQB 4HJGB 3NABL 5IV2A 4MQTB 4YE4L 3G08A 4F7EA 3MC0A 4NCC2 1HHJB 3LKOA 4P2QE 3CXHK 4YFLI 4DZ8B 2P7TA 3MRQA 5GGTA 1YEHH 5AWNH 1QRKA 4LMQE 3U1SL 1Q9WB 2V5TA 4GXVH 5EUOE 4HV8A 4NJAL 3MNVA 1DBKH 3EOTH 4P0DA 4MZ2A 3CFDB 1QEWB 1ZVSB 2VXUL 5BCAA 4F7TA 3EZJB 4JHAH 4WEBH 3FOLB 5FEBA 3E8UL 4JO2H 2DQCH 2P5WD 2F54A 4X0KA 1EA9C 3SCMA 3E1F1 3ULSB 4OF8A 3RWEB