1AQKH

Three-dimensional structure of a human fab with high affinity for tetanus toxoid
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
226
structure length
226
Chain Sequence
EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords FAB B7-15A2
publication title Three-dimensional structure of a human Fab with high affinity for tetanus toxoid.
pubmed doi rcsb
total genus 47
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 1997-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1aqkH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1aqkH01
5ESQA 2GIYA 5CAYB 3ZHLA 2FSEA 4ZO9A 2IANB 1BAFH 4HUNB 1I3GH 4JZOA 1VGKB 1CK0L 2AEWA 4GW5B 4RQQA 3GSWB 1CTOA 5IVXB 3CK0L 4KROB 1IEBA 2ZUQC 1DQJA 1U8LB 4MNGE 4JQVC 3SDCB 4CDGC 1CGUA 1UZ8A 4LSSH 4Y4FC 2VQ1A 3L3DB 1NJ9A 5I1AA 5E7FA 1BQLL 3BWAB 5HDQL 4Y4FA 4A2MA 4AL8H 2FIRT 4XTRD 5GSRB 3OXRB 2PYEA 2VUYA 2F53A 4XVJH 3B8YA 2MSPA 5CS7A 3VFTB 4IDJH 4RFEB 1Q9WA 4Z9KB 1C7SA 3DGGB 1ED3B 5DD1H 1DBML 3J8F7 1XGUA 1OSPL 3MV7D 4HK0B 5HHNB 3KPMB 1LO4L 1U92B 3DRQB 5D1QC 5B4MD 4NQTA 3MLTB 1WC7B 5B39A 3PNWB 3X11A 1CFTB 1T21B 3WJJA 5ANME 2BRRH 2UZXB 5ISZA 2VITA 1HCVA 4QOKE 1D5XB 3VMOA 1KIRB 1GIGH 5J3HC 5FUOH 1P4LB 5B38B 3GSQA 2R1XB 4OM1L 1RZFH 2F74B 2VLMD 3H3PH 5E9DB 1E4WH 1QSEA 2YD7A 4PV8A 2M8XA 1NCAH 3WBDA 3K80A 3OQ3B 4K94H 4PRIA 4ZO8A 3LEYL 3AB0B 5J11C 5MENB 3SDXE 1S5HA 3U30B 5IVZB 1JN6B 1EFXA 2LAGB 2VNCA 4LLDB 5IROC 5GGTH 2ZUUA 5GGTA 5C07D 1MH5A 3JUYA 3S3PA 5IROA 2R0LH 3OB0H 3WUZA 4UNUA 4TULL 4Y5XC 1DANU 1MVUB 5CBAB 3MNZB 4MJIB 2HJLB 3RJDA 2IAMA 1TMCB 1QOKA 5FUCC 4WFED 3ARFC 4KKBD 1FL5B 4OF5A 1WSST 4HJGB 1F4YH 4EOWL 1KJVA 1T83A 1WWWX 1ZLSH 4LEXL 1FL6B 4LLVA 2C5DC 4FQ2H 3KAAA 4PJIB 3KPSD 4NYLA 1IQWL 1FSKC 2MQ3A 4K3JH 1DN0B 3OKMA 5HYIA 3WIFB 1RZJL 4I0PD 4L3EB 3JBG7 2B7DT 1VGEL 4J8RA 4PGCA 5A43C 1A3RH 4Y5YA 4Z0BL 2PYEE 2F53E 3S7GA 3RWGB 4OSUL 4KVCH 3GMOA 4GSDH 3D9AL 1L9NA 4GMTH 4RCAA 4HHAA 2RCSH 5B3JF 4Z78A 5CINL 4O02L 1NL0H 5IK3B 2N1KA 1BD2A 2Y1VA 2NY2D 1LDSA 5ISZE 2QSVA 4IRJA 4DZ8B 5JR1L 4PJFF 1T1WA 4AIXA 3DBXB 2VAAA 4QY8A 2QKIA 1S9VA 1HOCA 4NHUA 3BO8B 1MCEA 1U3JA 1MIEL 4H26B 3NFSH 3PQYB 4TUKH 4MYWB 4MMZC 1V3KA 3U9UB 1EDQA 4HT1H 3TBVA 3PHSA 4APQD 5L6YH 4XZUA 3TNMA 3L3IB 3VRJB 3MRKA 2HG5B 4Y16B 3K0WA 4LSQH 1KNOA 3KVQA 3GSOB 5I76B 4J3TA 4WFGD 4AY0A 4Z76B 2YSSA 1RURH 4ZO7A 4N0RA 5CJBA 1EEYA 5EU3A 3BYTA 3WO3B 1VFMA 2X1OA 4PJCF 5DJDA 1S9WB 4N8CH 5GRUL 4MGXA 1I85C 4M5ZH 1FPTH 5DD3H 5I1LB 2OL3H 2OL3A 1I85A 4XPHL 2X1PA 2VDML 4CGTA 1JV5B 3GIZL 3KYOB 1MY5A 3CLFH 5E1AB 3VGGA 2FWOB 5EN2A 2HT4D 4EI5B 1RY7B 2P5WD 3RU8L 1HYSC 4L8DA 3VXMA 1ZT4A 4G3YH 5JHDB 3QDMA 2Z8WC 2G9HA 3DIFA 2OP4L 5ERWB 5GS1A 5A2LH 3LRHA 2O5YH 2BSRB 1CXFA 1SEBB 2ADIA 4JO2L 3VXUD 5DUMH 1FFOA 2QHLA 2JCCA 3EHBD 5K93A 3CMOH 3EJZD 3ZSTA 4MA1B 5DJXA 3LS4L 4HPYH 4JFED 1S9YA 1K2DA 4NWUL 4YXKH 4GH7B 2YPKB 2J7LA 3GM0A 3CFKB 4NC2B 1BD2E 4ZO6A 4BA8A 1FNSH 2JIXD 5D96C 4YBLB 3RTQB 4Y5VA 4HEPG 1LO3L 4YHZH 3U0WL 4WW2A 4JZNA 5BQ7B 3AM8A 5I2IA 2PETA 4GBXC 5D2NB 4EBQL 4ZFZA 1RIHH 3N1GC 3WUWB 4GRLD 5C0JB 5IG7B 3W0WA 4DGVL 4QF1B 3QEUB 5DJAB 3GO1H 1FO0B 3JTSB 5E2TH 4HS8L 4JFFB 4GT7A 1RUAL 3ESUF 5D71L 4J3XA 3DOSA 4L29B 2NNAB 4I9WD 2NY7L 2BHZA 1U8JA 5IR1A 2A77L 5E5MB 5I74B 4YHML 5E8EB 1HHIB 3PJSA 4RSVA 1BVKA 3EOTH 1CK0H 4HKXA 4FQXA 3FZUD 3GDBA 1U8HB 5JW3L 1TJHL 3ZZ1A 4EUPH 4EUPA 5DDHB 2XTJC 3SHSA 4YFLF 3QT2A 4I13B 4LSTH 1Q1JH 4O51A 4FFYH 2R15A 5JQHC 2V2XA 5GQBA 4P57B 2IJ0C 5L2KB 1QZ1A 4H25B 5DR5L 4X80H 4RAHA 2IH3A 5HHOA 1A6UL 5L7XL 5BVPH 2D7PA 2DYPD 3QDME 1IFHH 2K3TA 4JRYA 5INCA 2NXYC 5IB5B 1DBMH 4C54A 1N3NB 2VKWA 3LN5A 1GL4B 3MLSL 4LKCA 4NBYB 2E27L 1OAUH 4GG8B 5BOPA 2JCCE 3FQXB 3Q1SH 5F21B 3NCJH 5J12C 4J1UA 2WZPD 4MAYB 4JFOB 1VENA 1MFEL 3MV8E 4R4FL 4YX2L 4JFHD 1UM6H 3U4EA 4R0LA 1VSCA 4JHAL 3SDDB 1I8LC 3CC5B 1ITBB 3TP4A 1KG0A 1CDCA 4PTTA 2A74A 1L6XA 4XHJD 3C2SA 4ZFOB 4GAGL 1UWGL 3RVUD 4A6YL 5GS0D 2ZUXA 5F1SA 2DS4A 2F15A 3W0WE 1GVIA 3MA9L 2X4PA 5CEXB 4KK9D 1P6AB 3QI9B 2HP4A 3TN0D 5C09A 1NAMB 3HUJE 2KZWA 4TULH 4GKOA 2BVTA 1A6AB 3VXTA 5FYJE 5CJOL 1SYSA 2FB4H 1QYGL 2Y9RT 3W82A 4N9GA 3RWFB 4DGIL 4KQ3L 5MEOB 3V0VB 4OZFH 5F3BA 4OZFA 4U7SA 1Q94A 3HR5A 1F4XH 1YQVL 3FCTB 4NGHL 1RI8A 3Q6GH 4LDOB 3S5LA 1RZJC 4PS4L 1K4DA 4J4PD 3FB5B 1I8KA 5DK0A 1IEHA 5DURD 3O11B 4GAJH 1RZJH 2VABA 3CFDA 2ZCHH 4L5FH 3VCLB 1W0WA 2P24B 1SM3H 4LP4A 4HXBL 4OZHA 4QRTB 3IDYB 5LG1A 4OSUH 2DMCA 2MKWA 1FRGH 2F19L 5ECJE 4O2CA 2HMID 1JRHL 3CFCL 4BSJA 2OTUA 4MNQD 5FYKE 1RVFH 2BSTA 2R29H 1FGVH 1IAIM 3BUYA 1ZHKB 5H94B 1I9IL 3QG6A 3VXPB 3QWQB 3S4SG 4Z7WF 2J2ZA 1VERA 4P59H 1G6RL 3O4OB 1S7SA 4G6FB 1CFVL 5K9JH 2IQ9L 5JW5A 3VXRA 1MIEH 3QAZC 1BQHB 2PW2A 1PZUB 1Z9MA 4D8PA 1JNLL 4PJ7F 2OI9B 3RVVD 3TA3A 4H1LH 5IMOB 4H1LA 1QQDA 4M8QB 3SE3C 4OZGA 2QQNL 2GSIA 3MRGA 4LSUH 3D39B 3KNBA 5EZJB 5J57B 3A6CH 3CSBA 4ORGA 3HA0A 3CU1A 5FIEA 4HS6A 1OAXL 3CDGB 2AXFB 4P4KC 1RJZB 3O3DA 4K9EH 5EBGA 5DQJA 32C2B 1TETH 3NIGE 3QRGL 4I77H 4MA8L 3TO4A 3FKUS 1RV6X 3WFEL 5GRUH 2EDWA 3JVGC 3Q5YA 4Q6IC 4W4NA 1F5WA 4HF5H 5EWIH 3MACL 4HWBL 3EYOA 5LWYL 3MPCA 3IRZA 4NQEA 5F9WC 5GGVL 1QRND 3SOBH 3S35L 1ZKAA 4MD5A 4MSWA 5DFVC 5TE6L 4NJ9L 2I9LB 5TPWH 3RU8H 3DX9A 5DK3A 1MLCA 4IOIA 2YC1A 4HW6A 5EO9B 4OIAA 4OZHE 4HK3J 5F7YC 4I3RL 4WNQA 5IHZA 3I6GA 4ZODA 3O3AA 4HWZA 3FQUB 1G0DA 4X4MA 3OKLB 3UDWA 3VD4A 1X5IA 5HGBA 4KJYB 3D3VB 3DV4A 3LD8B 4WU7A 4MD4B 3O2DL 5E8OA 4QTIL 3LS4H 2HVKB 3MLYL 1BECA 3CLEH 5I71B 3ARPA 4AH2A 1S7WB 4UUJA 3WE6B 3LOWA 2ZUYA 2P8MB 3ZYJA 1EEZA 2X4NB 4JQXA 2CD0A 1M7IB 2ZWLT 3V5KB 1JWUB 4N0UB 1B90A 1EBAA 4U1LB 4QRUA 2UZYB 1J18A 4X0KB 2YOCA 5CSGA 1QLFA 1VESA 3VXRE 2BY3A 4EBQH 1EO5A 1ES0B 1DQTA 1OF2A 3SGDI 3ARGC 2QADC 2OR9L 4HFUH 1J8HD 3ARGA 4DGVH 4RFNB 2YD1A 1NBYB 1MHCA 3IDNA 1RD6A 3CZFA 2R1WB 3PF2A 1LEGA 1GHFH 5D71H 3DVGA 1UA6L 3SGKC 3NA9L 3TM6A 3ULSA 4LLWA 4WHTB 4MVBC 1BFVH 5DQDH 1A02N 3RGHA 1CXIA 4YHMH 1UXWB 3KLDA 1N8ZA 5GGQH 4FMFA 3QQ3B 1QACA 1JFQH 1D9KA 3C2AL 1T80A 3T4YB 3CDYA 1C5DB 1HH9A 5JW3H 1V7NL 3IRPX 4PGBB 2R2BB 3ARDA 1WIOA 3TBYA 4HMCA 1J0IA 2ZSVB 4JCMA 5GJSL 3MOBH 1E28A 4UINL 3GMRB 3VU2A 4NQEE 4M7LT 3GBLA 3KGRA 4IRSC 5E6IB 3D69A 1ZWIB 4RMUA 3OKDA 5FHBL 1HQ4B 5C0DA 4NZRH 3SE9H 3EYQC 4LAQL 2WINB 3LS5L 4X6DF 3CFJB 2YWYA 1A6UH 5T5FL 2D2OA 1O7VA 4FQLL 4G8GD 5BRZB 5EUOF 2DM3A 3NCBB 4LMQI 4FQHB 4OKVB 5HHXH 2Y36H 3SEPA 4E41B 2H9GB 2XRAL 1FH5H 5GHWL 3LKRB 5IQ9A 3WNMA 4JM2B 2C4XA 1CLZL 3G5XA 3D25A 4GRWB 4I2XA 3ABZA 3E3QC 3O6FA 3SGDH 1N5AB 4PGDB 4TYUA 1RUKL 1HDMB 3C60C 3WN5B 4FQIL 2VDQH 2D4DA 2B20A 3JWDL 3MRHB 1Q9KA 2N56A 3HZYA 4QRPA 4K8RH 4ZSOB 4TOYL 2YN3A 1NEZA 5D7JA 4NHCH 5DEFB 3EDFA 1AGBA 1VKXB 5DZLA 2VE6B 3S36L 4PJGA 5C6TL 4H5SA 1N4XH 4U49A 3F62A 2O5ZL 1Y0LA 2X09A 4JFDE 1TIUA 1F3DH 1MQKL 1EAPB 3B83A 5ILTL 4M61B 4X6CA 1ZHLA 4P2OA 1GZPA 4ZS7L 1FFPA 1D6EB 3EKCA 5CEZD 3G5ZA 2VDLH 4F8QA 1AKJD 3VWJA 4YK4C 2VLLA 5FXCH 4KQ3H 2BVQB 3DYMA 5GGSB 2Z91A 2XWTA 1F3RB 5FKPB 1CFSA 1ONQA 3K2UL 3AROA 1IM3B 3LSOA 4X7SH 1KPRA 2NTFA 43CAA 4FXLA 2LU4A 1TJGL 5B8CC 2P7TA 4WTZG 5KANI 1AGCB 3U36B 1U8IA 4UB0H 4HXBH 4XB8A 4FTVA 3UZQA 4AIZA 1FZMB 2Z93B 1IM9D 4P9ML 4LCUB 3TH2T 3I2CL 5IBUG 4U6XA 5BO1H 1QFUL 5E99L 2AABH 3WFCL 2OZ4L 3VRIB 2LU3A 1RUQL 4HJ0C 5IHBA 5SWQA 1YN7A 3PGFH 3HRZB 3RDTA 3JTTA 1EV2E 2X4QA 1A0QL 4U3CA 1QKZH 1I9IH 1X5HA 1Z0MA 5C0NC 4JDTH 1P2CA 3SO5A 4KU1A 1G6RH 1G6RA 1KXTB 1FO0L 3K4AA 5H8DA 5F96H 1DEEA 4QRPE 4YXHL 1T4KB 2LAAA 2PW1A 3D85B 5DJCB 5IM7B 4OD3H 4V1DD 3BVNA 3QH3A 1KTRL 3ZTNH 1A4KB 5LCVH 5GRJH 1BJ1H 4F7PB 2IANA 2VR4A 2FX7H 3CVHH 3CVHA 2XA3A 2H32H 2H32A 3V4VL 4DKFL 4KROC 1AI1L 3HAEH 3HAEA 3SDCC 1ADQL 4CVZA 5IJVB 2ZUTA 3X17A 5EU4A 1QA9B 5D2LF 2DQGL 2X9WA 1V3JA 2VWEC 2MCG1 4NRYA 1OTTC 3ARQA 4XCFL 4XCCH 1BBJA 3UZEA 3K81A 3K1KC 5IMLB 2ATPA 2D7TL 2P4AB 1I1FA 2BVOB 3IF1B 1LE9B 4JGUA 4KI5E 5EOCJ 4YZFE 3V8CA 3MREA 4RMTA 4NZTL 6CGTA 3ALPA 2W60A 5IJKC 4GKZA 3TBWA 2P8LB 3MV7B 5IJKA 1AJ7H 2AV7B 4TNWF 1KYOK 1UACL 4F3FA 4FTVE 1CLOH 4OCWH 4EEEA 5B38A 3C09B 1T7YA 1NDMA 3DXAB 5I30H 5I19L 2F74A 4O2EB 1AD9A 2ADFL 2BNUB 4QTIH 4XPFL 3AB0C 5EA0L 4ZFOL 4TVPL 1WGOA 5IBTH 4YO0B 4U1JA 1D7FA 4X5XA 3NPZB 2XI9A 5IFJA 4QHUB 1G7MB 2BVEA 4J3SA 1NGXB 4ZOAA 4LCWD 5J6HB 2XQYK 1G7LB 1NAML 1E4KC 5F9JA 5HI3D 4EDWH 5DMIH 3UTOA 3Q3GB 1IGIL 1G0XA 5GXBB 4M43H 3L1OH 3UCRA 2HJLA 4H1LG 5I1CL 4KKCD 4LKXA 1CGSH 3UJJH 2BC4A 5F8QC 1FL6A 1QFHA 3ZL4H 3FFDA 3ULUD 5C0CA 3NA9H 4ONGH 1HNGA 1HIML 1ROWA 3L5WA 3S35X 3WEXA 4ODUA 3MXWL 1W72H 1W72A 4P48A 2W0KA 4PJFB 3AS0A 4QYOB 4I0PB 1MRFL 1JNHA 4XPTH 2VH5L 3QDGE 2HFGH 2ICWJ 1S9XB 4JY5H 3QJFA 3VFSB 2DTML 2CIIB 3BP6B 4JJ5B 4NZJA 1K4CB 5E4IA 2EE6A 1FORH 2YRLA 4XNMA 1D6VH 3BQUA 4FABL 4JLRB 1I9RH 4UILL 5DD6B 3ULUF 3ZSSA 2D4FA 3CCHA 3HC0A 5AUMB 2EYRB 3BGMB 3UO1H 3QG7H 3OB8A 3TNNA 3KG5A 2LTQB 3QFJE 3G6AA 4GS7C 3KR3H 2D03L 2CXGA 1EJOL 4GXUN 4L4TA 4ONFH 1PGRB 4H26A 2IFFH 1MFCL 4NRXB 2F54D 1T03L 3U9UA 3KPRD 3EO0A 5DEZA 3JWDC 1HKLL 2KQMA 1XGPB 1KLFA 1ZHNB 2X70B 5CFHA 4XPGL 3BDYL 3JWDH 4Y16C 3FQWB 4FFZL 1IC5H 4APQB 4NC1E 1KPVA 4Y16A 3IETB 3SPVB 1YC8A 4Z7VB 4HC1L 1KT2B 4K07A 3C6SB 5DC4B 4PRHD 3S36H 3MOAL 5MEQB 1JPTL 3U48A 2YEZB 4YDIH 4U6YB 1DVFD 5A3IC 1TITA 1GGIL 3ARED 5I18H 1UCBL 2IMMA 3GI9L 5J9PB 4EI5C 1TVBA 5GSVA 2Y4SA 3V95A 4JKPL 1E6OH 5FA4A 9CGTA 4PJ5B 2E6PA 1HHJA 2P5WB 3MRMB 3THMH 4B41A 3OG4B 2V2WB 2YRPA 4PJDE 1AXSA 1HNFA 1L4IA 4MA1C 2X4UA 3QUZD 1MCCA 1TJGH 3SBWA 2BHYA 1MI5D 5IB1B 3QUXA 3L7FA 4WUUD 5C70A 1JYWA 1J0HA 1FVDA 2WBJA 3GSVB 3VI3F 4YBLC 3RTQC 4JFEB 3TWCH 1MCIA 3BDXA 5BJTB 5EZIL 3S96B 1JPFA 3RIAK 4H0GA 3MV9D 2Z92A 2FBJL 1F3JB 4L4TE 5KSVA 1AC0A 4Q9QL 1ZGLM 1I1AD 5C0JA 4FQJL 3L95A 4FZEH 1MHPL 2A6IB 4KC3B 4XVTH 1INDL 2Y5TA 3DV6B 5HHPA 4GRLB 4HIJB 4HUUA 2JELL 4YXHH 1QO3B 3RKDC 2MJWA 4LDLB 2DQUL 3L9RA 5I74C 3RX8A 3RUGA 1LDPL 3MGTA 4C56B 4JHWH 1Q38A 2VZVA 3NIFE 2WM0A 1AFVL 5EU6E 2NY3D 1T5XB 1TTFA 5C8JA 2HJKB 3B43A 4QGTA 4L9LA 4EDXB 2R0ZH 1JIBA 5ICXA 5LQBH 4RISL 5IIEA 3P2TA 3FTGB 1KJ2B 2IH1B 2JJVA 5IBLC 1OB1B 1WWBX 4P57A 1B3JA 5LXGH 1BLNA 2UVEA 4OF6A 4YBQD 1R24B 4W4OC 1J10A 5DTFA 4W4OA 1R5IB 2W9DL 1YNKL 4IMKC 5HHMD 5F9OL 5EBWB 3GSRA 3V79C 3HNVL 4RX4D 4LVNB 1K8IA 1QLRB 2DYPB 2DL2A 4NQXA 5B21A 1YDPB 3H2WA 3LV3A 4MAYC 1YEJL 5CGYC 3PG2A 3ULVL 3STLB 4MAYA 3U82B 1INQA 3SDDC 4YHPB 4HK3N 1WBXB 4FRWA 4TQEH 3MJ7B 3QA3B 3MA7B 2NY4D 5CSBA 3BH9A 3CC5A 3VJ6B 35C8H 2E6QA 4H0IA 2ARJB 5LGHH 2HH0H 5IEHA 1XH3B 1R3HB 3LEXA 2EEBA 2PCPB 3GB7B 4P2RD 3VGBA 2CLVA 3RAJH 1B4JH 4HPOH 5JW5B 1OHQA 2BNRE 4UDUB 3QI9C 5F89B 1T3FA 2CK0L 1AHWB 2QSQA 4UQ3B 2PO6A 3I9GH 1AXTL 1KCVH 1IGIH 2VLRA 4M62H 3K8LA 1A6AA 4KDTC 3RUGE 3TN0B 4FQPA 3U6RB 4UBDC 4A2LA 2EIZB 1WAAF 2BY2A 4TSAH 2BERA 4XVSL 2CDEA 4KDTA 3PXJA 3HAEG 5DI8B 5MEOA 4BFIA 5DJ2B 3ARYA 1E6JL 3U1SL 1WBYB 4LSDA 4DN3H 1FIGH 4YH6A 3O6ML 4NO2B 2E7LC 1H9VA 4N68A 4G6AC 1GGTA 4LLMB 4TSCL 5KANG 1A21A 4BZ1L 3L3HB 4K2UH 1GXEA 5HTSA 3OGOE 3VA6A 4Z7WB 1YMMD 3WXWH 2CR3A 1ZLWH 4OLVH 1S7VA 2DIBA 3H0TB 2L7UA 1J05A 3OJMB 3P9MB 2I26N 2VH5H 2X42A 1XCTB 4M8VA 4OLUL 4RDQF 3QRFM 5K33A 3TEUA 1XZ0B 1T2QL 1QSFD 1QNZL 4PJ7B 1YEDA 3FOMB 3B9KD 3IDJB 1AH1A 1KCUL 4BQ6A 1WV7T 4QLRA 4QNPE 3FFCD 5B38G 1XGRA 3O4OC 2F8XC 1J7VR 3BW9A 1MCHA 1JI1A 3A6OA 3G08A 3TIEB 3ROOB 3FRUB 1EZVX 2YRZA 3PWVA 2EKSB 2AV1B 2D03H 2D9QB 3QO0A 4X7DC 2EEDA 3OHXB 5DD5L 3LQZB 5IFAH 4ZNEA 4R90L 1T03H 1P1ZB 1MCOL 4I0KA 4M6OH 3N9GL 1YEFH 5EZOL 5KG9B 5I73C 1U95A 2QQLL 2XICA 4WFHD 1MNUH 1T1ZA 4GG6A 1FP5A 3MRBA 1BHGA 1JTPA 4LNVA 1NC2A 1U8OA 1BX2A 1RJCA 3BZ4A 1G9NL 3UZVB 1SEQL 2AQ3A 5DJ0B 1MHHA 2NTSP 5KSAA 3CDGA 1L9MA 4ZFFB 1S9KC 4PLJC 5LAXA 1T20A 2VL5A 1S7QA 2VZOA 4LBEB 2Q20A 4LLYA 5A2FA 1EVUA 2G2RB 1QLEH 2JKXA 5E2UL 4WWKA 3B3IB 3V7MA 5IOPB 3MUHL 1YY8A 4OLWL 3MRPB 1XF3A 2NXZD 2MQCA 4XH2B 1KJ3H 2CH8A 1F2QA 1IC4L 4MS8D 1T04B 3RWCA 4JKPH 1QRNB 4XVUC 5D72H 4M93B 4IOFC 4Y4HA 1Q72L 1AQDB 1RMFH 4FQQA 3V8OA 1KEGH 3HB3D 4YDKH 1UVQA 3LD8C 2EDDA 5DJZA 1F4AA 3OKLA 4BYHA 1G9MH 5I71C 4U05A 3D3VA 1IGTB 5DO2D 1A2YA 1SBBA 1X3DA 2CPCA 5C0BA 2BFVH 2X40A 2YWZA 5JO5B 4L8SB 5T1MB 4LHUA 2VLKB 2DD8L 3K4DA 1YYLH 5D93B 3IAQA 1NUDA 1H0DA 1UM5L 3GNMH 2FBJH 1RHHA 4NNYA 1X44A 4ZNEE 3REVA 4RFNC 3MRLA 1KOAA 1T89A 4XBEL 4LRNH 5J8OA 4GG6E 3SE8H 4FXKB 1J8HB 2YKLH 1IAOA 3FO1A 2DQDH 2HKHH 2VISB 3EYFA 5KN5A 4F15B 4DFIA 2VXUH 4NDMB 4X6DB 3QUYC 4RAVB 1XR9B 1AY1L 3GKWH 5CJQL 4PGJA 5EUOB 2V5SA 4UT9L 1BZ9B 3QUYA 1G7QA 2IQAB 2BZDA 2FO4A 1FFNA 1EO8H 1T1XA 3P11L 3T4YA 2EXWD 4XP6H 2R2EB 4NZUH 2C9AA 3HMXL 3P4OB 4JDVB 5FOBA 1FV1B 3H8NA 4NM4H 1WFOA 2GK2A 4JR9H 4OFPA 1KN4H 1CGWA 3P0YL 3VW3L 5IGXL 3UTTA 2WINA 2VXSL 3MRQB 4XBPA 4KZDL 2D7MA 5HYSB 4J12A 3V6FB 3F6IA 1SY6L 2DQHH 4MQ7A 4U1SA 5F9OH 4G8GB 4QOKD 1KLUB 3D2UD 4JM2C 2F9BT 1S5IH 3LIZL 3W81A 3ULVC 3O6KH 3BP4A 1Y6MR 5HXMA 1T66D 4XRCB 1BIIA 4ODBD 3MRJA 3DI3B 5HPOA 4AQ1B 3WN5C 4UT6H 3LKSB 4PGDA 3GMPB 5D7IA 3IGAA 4OIIL 2DBLL 4R7NA 4HBCL 1HHHA 4JZJB 4QHLA 2J8UA 4U0RB 2XA8H 2XXCB 1EXUB 1LO2H 1NGYB 3LN9A 4W70A 4HWUA 2GEEA 1P7KA 1Q8MA 1ITCA 1PYWB 4WV1B 3WUWG 4POZC 4WUKL 2I25N 3I3BA 1HH6A 4MA7L 4U2YA 4KUCF 1T22B 3MRFA 4LIQL 1XCQA 5IESL 3AMKA 1H3TA 4KVNL 2VDRH 4YHOL 1JK8B 2QSTA 4XP4H 1DBBL 5MP6H 5CCKL 4CW1A 1FGNH 4M1CC 4MNHB 2DQCH 1YN6A 1ZA6B 2HFEB 3BSZL 4AT6A 4N1HB 4HWEL 4M61A 3BD3A 1AXTH 5E4EB 3WD5L 2VMFA 2V7NA 4PJXA 1KPUA 5HYEA 3IDIB 4XBGB 2RGSA 4JQIH 3R1GH 2P42B 4XVSH 4AZ8A 4ZUSB 2ESVE 5DMKB 3SDXF 5E6YA 1AKJB 2DQTL 1H3XA 1A6VL 2HKFH 2OJEB 4WEMB 2PYED 2F53D 1KB5B 1DUZB 3LKQA 4M7ZB 4QRQB 2A6JB 1EMTL 5KZCB 1F42A 1KTDB 2WAHA 3U79A 5HBBA 2GTWA 5DMGC 1CGXA 5CD3B 4ODTL 1TZIB 1E0OB 4P0DA 4TNVK 4NZDA 1OAZH 2KUTA 4IMLA 4N1EA 1T0MB 5HJ3A 3G5VB 4OJFH 1QEWA 5ISZD 4JGMA 2DBJA 3QIWB 1QNZH 4X5LA 1IM9B 5FO7A 1KFAL 4TUOB 1KCUH 1HHGB 3ILPA 5E95B 5EOQL 5TH2B 4PRDA 4YPGA 3BPCB 5GRVL 2Z8RA 5D7IE 2L0DA 5C0IA 5TFSL 5D2LB 2J8UE 4XCNB 5IW6B 1OPGL 4KRLB 3RA7L 1HINH 4AYFA 1T4KA 4MJ6A 5DD5H 2EXYC 2JK5A 1SJHA 1M1SA 1MCOH 1KENH 5IUSA 1GGCL 1LK2B 3P0VH 4OCXL 1BZ7B 1CU4L 5SWZE 3T65A 2FLRT 4NT6B 1IGMH 1XF4B 4RIRB 1G9NC 3VFMB 1U8PB 3NFNB 1HILB 4AK1A 4PJXE 1KJ2L 5L0QB 5KS9A 3O4LE 4JKLA 3M1BB 3QDAA 1MVFA 5E2UH 4XTRC 1Q9OA 4DAGH 1JI2A 5IW3A 5BOZG 1R5VA 1HSBB 1NCNA 2YUWA 1NMBH 3BUTA 3SKOB 4OCYL 4M5YL 1PY4A 4JFYB 1YUHB 5D7LB 1CE1H 2CMRH 5JW4N 1NCBL 5B4MC 2DB8A 5EC1A 4YE4L 3C09C 4G9FE 4AEFA 4XXDA 2CXKA 2EO9A 5ENWA 1BD2D 2V7HB 4IHOB 1RAMA 4IM8A 4IRJD 5HHQB 2GW5A 1HXMA 4I48B 4P46B 4UDTA 1WZMA 5JIHA 1ODAA 1NGPL 4NNXA 2QSCL 1C5BH 5FKAB 1UQSA 2VZUA 3GSNB 1KJMB 3P0GB 3SJVA 5E08L 4JG1L 5H2BA 2OS7A 2I60L 4MDJA 5DRXB 2W9EL 2WK2A 4LVEA 5F1IA 5GS0L 5DQ9A 2JTDA 1I3VA 1HXYA 1MUJA 2B0SL 2X4TB 4LFHG 5BVJB 1BEYH 5DLML 2J1KA 4MJ2A 5C07A 2R4RH 1DBJL 2GSGB 3FRPA 3WFDL 1A6ZB 4BZ2L 1A7QL 1KELL 1PSKH 3GJFH 3GJFA 4KKBC 4BFEA 3WHE0 4EN3B 4P4RB 4O4YL 4L1DA 3JV4B 2EDQA 2Z4QA 4P5TD 1LE5B 5DHYB 1J11A 3C5ZA 3KPSA 4G6MH 5KS9E 1F6AA 3QDJE 4HIIB 5MI0B 2J3SA 4I0PC 4OUUA 1MRDL 1M71B 4GXVL 1HN1A 4XPAL 2R69L 2H2SD 2XV6B 1S7TB 1ERNA 2WUBL 3W11D 1HCFX 3VFSA 5H35B 4JO3H 1SMOA 1H3PH 3QUKB 3QDMD 4HUXB 1RZIB 1HHKB 3HZVB 5IMMB 4F7MB 3VFPB 3HNSL 4CAGA 3RVTD 3VW3H 4PJ8D 3M07A 4XX1E 4ZXBD 4AEHH 2EYSA 1IKNA 5AUMA 3MXVL 1FYTA 2LTQC 3BGMA 4OQTH 4OQTA 3MV8D 3D0VA 5FB8B 5L9DL 3OZ9L 4C83A 4X9FA 1RK0A 1E4XL 3QEHA 4PJCA 4LHUG 1FNAA 5JXAH 3SJVE 4APQC 1DQMH 3DSNA 3NFPB 3KPRB 3W0WD 2NY0B 4APQA 2Q76B 3GMLA 1GC1L 4KK6D 1KLGA 2JCCF 3IFPA 1ZVHA 4NPYA 4PG2C 3IVKB 1N59A 3N1PC 1B0GB 4MXWH 1OLZA 1K6QH 3KXFA 4LIQH 5IESH 4KVNH 3LZFL 4U1KB 1CL7L 5FYJD 5EG6C 2YEZA 1IJ9A 3KPPA 5F88A 1CF8H 4YFLI 4KY1H 4PRHB 3QXWA 5TQ0H 3OAUL 1Y18A 4LU5L 4HWEH 3PHQB 4WW2F 1DVFB 1DQLL 4MD0A 3BH8A 3MV11 3IFOB 3FO9B 4NO3B 4UTAL 1ETZB 1CDJA 4NO0A 1U58A 2HT4C 2GTZB 3ZE0F 3AS2A 4BUGA 2AK4A 3UC0L 2DQTH 4PGZA 4XC3L 2AJSL 1CBVL 5C08B 1X6LA 4JFZH 5JW4R 1T0NA 3U46B 4ODVH 5J1AB 1CQYA 1ZVSB 4LSRL 5JNYB 5KOMC 4G7VH 4OIBA 3BHBA 2AK1L 1DZBA 3VXUA 3EJZC 1EIBA 3OL2A 5FYKD 2OJZH 1MI5B 4Q74A 3QUMB 4OBSA 4JRXB 4PJBB 3KPQB 4HIHA 1ZK9A 5HYQB 1FYTE 2AQ2A 4WUUB 4M1GL 5HI5D 4Y2DD 2N4IA 5D8JL 1C12A 4I3SL 3S96A 4L3CB 4PRBB 5SV4A 1GOFA 2KDGA 1IT9L 1CDBA 2O61B 4GAFB 2DQEL 1MRCH 1X5GA 2R23A 4G5ZL 2JIXA 1OWRM 3TCLB 4I5BB 2AJYH 2D0HA 1TXKA 5D9SA 1FAIH 3MV9B 3C5JA 4GRLC 4EVNA 4ONHB 1JYXA 1A5FL 3GSUB 4M6ML 4NJAL 1DL7L 4LPUA 3DURB 1OPGH 2ILLA 1DEDA 2P44B 2EDTA 3PP4H 1VFAB 1EEQA 4OD1L 3MUY1 5KJRL 2H41A 3GMMA 4Z77A 3VE0A 1OGAE 3DO3A 1HEZA 1BZQK 3ARVA 3KXFE 4B53A 2DL9A 4HIEB 1A4JA 5F1NB 5E2WL 4OCXH 5BXFB 2HT3D 2Q8BH 1F3DJ 3R06A 5ALCH 2E9BA 3INUH 2DDQL 2EYTB 4J6RL 5TE7L 3SQBA 3DVIA 3O3EA 4DK6A 3GMNA 3FZUC 3VH8A 1OOAA 4KJPD 4E0RA 3UTQA 3GBMH 2NY3B 5BS0E 2IF7A 4NNPH 5CZXC 2NCMA 5I8CB 1BQSA 1C7TA 3KYMA 1CFQA 4Z7UE 1OM3L 3OR7B 1R24A 4LF3A 2AK4E 1FNLA 4R26H 4NN7B 1Y6NR 3T1FB 2H3NB 5F9DC 1S3KL 3AU1B 4URTB 4BSVB 4M5YH 2FBOJ 1YNTB 4XNXH 4ISVB 3NAAL 5HHMB 3NIGF 5GPRA 2JB6A 5JIPA 1OAKL 3HZMB 2BXZA 3V4UL 5DWUH 3MRRB 3CFIC 1ZSDB 4DUWA 2GUOB 1Q9LA 3QPXH 4PTUA 1TZGL 1UH3A 3GHEL 1W0YT 1JHKH 4XAWL 4K3DL 1VPOH 3HMWH 2NY4B 1XH3A 3P4NB 5IW1B 2Q1EA 4XHJC 4X6BA 4LHJB 3VXRD 2ENSA 4OZHF 3RVUC 2D7QA 4H8WH 5GS0C 4JG1H 4MB5A 1DLHB 4IS6A 1AHWC 5ICYA 1NGWB 3QFDB 5E08H 4EI6B 4P2RB 4FOMA 4P2CG 3T8XB 4Q58C 1NBZB 5TDNB 2YD9A 1M6OA 1CCZA 1AHWA 4LRIC 4WWID 4KK9C 3TA3D 2V5TA 5EPMB 2VC2L 2B0SH 3TN0C 1OY3B 1IVLA 1E4XI 1MPAL 2GJ6B 3OSKA 4F9LC 3NVQA 4XT1C 3IT8D 2EIZA 5HVWA 4OGXL 5CEZL 1KELH 4YR6A 2HFFB 2NYYD 5DJ6A 3TO4D 2IPTH 4PYGA 2EDJA 1RJYB 4I18A 1LWRA 4F8TA 4Q9RL 5GGRY 4UAOB 5F7EH 3DWTA 1KB5L 3VXQA 1B0RB 1ZT7B 4RGOL 1U8MB 2WWMC 4NQED 4P3CL 3FT4B 1G7JB 1DUYB 4J4PA 4GXVH 4XMPH 4OB5H 4ORZC 4JDZA 4YIQB 2QTEA 4XPAH 4QHKJ 1M7XA 5C7XH 4OZGF 2WUBH 3WKML 2ICWB 1YMMB 4PRAA 2WNGA 5EIVA 1JZ7A 1Z6JT 1Z5LA 2HMIC 1N6QH 5EC2A 3ARTA 3O9WB 1IAIL 2MWCA 4TVSa 4ERSL 3LKNA 1Z0NA 2EDEA 1QSFB 3CFEB 3MLRL 4MNQA 1IQDA 3B9KB 4KH2A 5E8DH 5E00A 3K1DA 4EIGB 3BP5A 3TIEA 3FFCB 1JWMB 3O2VH 4QWWD 1UJ3A 5BZWB 5L9DH 3FRUA 1X4XA 3CXHK 3FN3A 1AQKL 1YECL 2P5EA 3RVXD 3QXDB 3KYNB 1E4XH 1QRKA 4NKQB 1X5LA 5JOPE 2XWBA 1A64A 5DGRA 4FG6D 3HI1A 3K4ZA 3P3YA 1GC1C 4ZOBA 5I1KL 3DUUA 3D87B 1AIFB 3QDHA 5BW7C 2VDKL 4JFDD 1XGQB 1S7RA 2QR0A 5MERB 5BW7A 4LPTA 5DJ0A 3W5NA 2WUCL 2BOCB 3HS0B 1PY9A 3EO9L 3PWJB 5FO8A 3MNVB 3UTZB 1P5VA 5JDSA 4YFEA 5SWSB 2B1AH 3MCKB 1RIVL 3MRCB 2IFGA 3H3KA 3PUCA 4LCIL 4XC1H 2GT9B 2XPGA 2XTLA 4MA3B 4Y1AB 2GFBB 2OBGA 4L9DA 3ARDD 3MYJA 4YUEH 2EDYA 4UTAH 1RPQA 4DKEH 3FO0L 3DROA 2NXZB 4M93C 4UV7L 5FFLA 4C4KO 4UT7L 1PLGH 5EFIB 4ZQKA 2F5BL 1J5OL 4MCYB 2IG2H 5KW9H 1TTUA 1NFDA 3G6JA 3QO1B 4DKAA 3ET9F 2XNAB 1WBZA 2VWEE 4RMSA 3GHBH 5FCUH 2YZ8A 1MCWW 2RFXA 1B6UA 4WI2A 3LN4B 4D3CH 2K7QA 4L8SC 4U1HB 3C87A 3MLXL 3GSNL 3UX9B 1A1NA 1A7NL 5D93C 3RNKB 3CXDH 2YPLA 3STZA 5JZ7C 1S8DA 4GW4A 1ZGLB 4ETYA 1WCBB 4OM0H 1I7RA 5GRVK 2P5EE 2D0GA 4QRPD 3T3ME 4Q9BA 4NKOA 4B5EA 4HZLA 5D7JD 3WLWD 4FFVD 5MEPB 1A5FH 5E6ZA 1JMZA 1OARH 4NJAH 2Q6WA 1CFNB 1MWAB 12E8H 2AAVA 4F15C 3ZTJG 3H9SB 1NDGB 3PGCA 3TYFA 5C0EA 2EIBA 5IB3A 3L6FA 4P2OD 4M7JL 3RP1A 3SDAB 3ULUL 3DMMB 3EYUL 1QR1A 1PQZB 1V5JA 3MFFB 2AJZB 4LNRB 5CIPH 1L0XA 5CIPA 3MTRA 3VWJD 3W5MA 1CI5A 1U8QA 4J6RH 2F8OA 1AD0B 1B88A 3IU3A 4XI5C 4YHNB 1IGJB 1TFHA 3ROLB 5IF0A 3VRLE 2A0LC 1EPFA 2H26A 3LY6A 4Y19A 5FF6A 2JF1A 2E9IA 4KI5D 2EECA 3E6FB 1TCRA 3JV6A 4YXLL 4PJGF 1HWGB 4PJIE 3MUGB 3OG6B 5AZEL 3VXOA 5I66B 1TVHB 2W59A 3BWUC 3MRQA 3H7BB 3IJSB 4P5KA 4Z7NE 1BWMA 2QJDA 3TBTB 1NSNH 4YDJA 3QULB 4X6CF 1NFIA 4L3EE 4FTVD 1NANI 1NFDE 1JGUL 3G6JE 4Y88A 2VZSA 1QHOA 1U2HA 5ANMB 3VFVA 1NKOA 5INDB 2BCKB 4XRCA 4QOKB 4OLZH 4KRNA 3AAZA 3D2UB 1ZLVH 1MFBL 1P7QD 4WI9A 4J23A 4NN6B 4JZJC 2MKLC 4XNQA 4U0RC 1NGZB 5BZDB 5I15L 3RDTD 3O3BB 1PG7X 1KEML 1CN4A 4NN5B 4KI5F 1WFUA 3C8KB 2K7PA 5DUBA 4YZFF 4WV1C 2XACC 2YUXA 4ODWA 2ZCLL 4XAWH 2YPLE 1IAII 3UJIL 1U93A 25C8H 1FZOB 1J87A 1X7QB 1F11A 3BE1L 2OMNA 1IEAA 4HS3B 3NCYP 5DHVB 2CJUL 4JFXB 1F4WL 1MEXH 5GISH 4D2NA 1NBVL 1ORSA 5ITBL 3VWKD 2M2DA 3PIQB 5ESVB 3TYGH 5ESQB 3CH8A 1EGJH 1EGJA 2VZ1A 1UH4A 2XWJA 4F2MA 1NPUA 2DLHA 1MPAH 4KJQD 3NTCL 3WNOA 4JZOB 2ZOLA 4OTXL 4OGXH 1KV3A 4M4PA 5IFHH 3A67L 3VH8G 1DQJB 3EDEA 3TJEL 1T5WA 5EO1A 1UZ8B 4M7ZC 3RY6C 2VQ1B 1NJ9B 5I1AB 2KKQA 3QDGD 1ORQA 5T3ZH 4D0DA 1HYRC 4Y19E 4QRQA 4Y4FB 2A6JA 2Q86B 4PJ9D 4HCRH 2NY5L 4HCRA 2PYEB 2F53B 2WQ8A 2V9RA 3WIHL 3LB6C 1Q9WB 2X41A 4JPVL 3IDGA 3QUML 1WZKA 1XGUB 1U42A 2QQKL 3QIWC 4D0BA 4ODSH 1YYML 2AI0H 3TZVA 3DX6A 5B39B 2G60L 3X11B 2DQIL 3FB7A 1IAIH 4B50A 3DGCR 3QFJD 4CN6A 4OLYL 1OW0C 5ISZB 2VITB 1NCCL 1V7ML 5DD0H 1QP1A 4S0TD 3GSQB 1Z9OA 3BIKA 4N1CA 4F7TA 4O5LL 4PV8B 1NKRA 1YJDL 4XCNA 5IB2A 2G5BA 4PRIB 1S5HB 4I8DA 1R5WA 3BD5A 4ZYKA 1EFXB 3J7HA 5CKGA 4V1DA 5I1HH 3MJ9H 1RIUH 3MJ9A 3CIQA 2XZAH 2AKRA 1OTUD 3HI6H 1HSAA 5KVFH 5D2NE 4ZTOH 1REIA 1XF4A 2R0KL 2XKUA 4HV8A 4J3OC 5L0QC 1CYGA 1EUTA 2IAMB 2V17H 1CT8A 1OSZA 2XZQH 4FQ1L 1KJVB 4QXWA 4LLVB 3P9WB 3IU4L 3UPRA 8FABA 1LEIA 4M4RA 4NYLB 3I02A 1NMCB 5AWNL 1YEEL 2J8OA 5GS2H 2FRGP 2XN9A 4CADB 4BQBA 5BV7B 1MIML 5T3ZE 3MLVL 4J8RB 4DN4L 5CZVL 4JFYA 1XFPA 4PGCB 4Y5YB 3G9VA 4LEOA 5GJTL 2OTWA 4OLXH 3Q5TA 5FM8A 3BQUD 3GMOB 1KC5H 1F58H 4JO1L 1J5OH 4HHAB 4Q0XH 4GMSH 1H15A 4R2GD 2V7HA 4Z78B 4NWTH 2J88H 2W65B 3TBSA 4HJJL 4FZ8H 1AR1C 3DARA 3T2PA 1BD2B 2ZKHH 4IRJB 4L4TD 1T1WB 4LVHC 2VAAB 1IC1A 3GSNH 4XP5L 3VXSE 4EIZC 1S9VB 3BKMH 1HOCB 4IRZH 4NHUB 1AE6L 4PJDF 2X4SB 3EDDA 2EICA 1EK3A 5HHVH 5JQ6L 2I5YL 4U2ZA 2X4TA 4X83A 2BVYA 5HI3C 3TBVB 3RGVA 4HUWB 4LCWA 4XZUB 1I1RA 3TNMB 2AW2A 2GSGA 4QCIA 4LARH 1OP5H 3MRKB 2FJFA 2O5XH 4KKCC 4EN3C 1KNOB 2LU7A 4PREA 5EU6D 4HDIA 2YSSB 5DT1L 3GJEA 2H6PA 1EEYB 3ULUC 3SGEH 3TV3H 5DHYA 1C16B 1YY9D 3ULUH 5MI0C 5DJDB 1TPXB 3QCUL 5M95B 4K7PH 4HIIA 4WCYH 3U7WL 3WFBL 3BKCL 1SJEA 1M71A 2OL3B 4ZFGL 1N7MH 3D18A 4NP4L 4M6NH 5T33H 4HUMB 1QBLH 5EN2B 1KB9J 3UBXA 2XN9E 5CJ8A 4HUXA 4L8DB 1U6AL 3HZVA 1INEL 5IEKA 1UZ6E 4CN1A 2CGRH 2WANA 4OT1H 1OCWL 4YXLH 3NIFF 3VXMB 2W0PA 1JGVL 1HQRA 1ZT4B 2R56H 5AZEH 5JPNA 3QDMB 4GFTB 2G9HB 3DIFB 5GS1B 3ZE2E 3Q6FA 2ADIB 5F70A 4KK8C 4M7KL 2R8SL 1FFOB 3DLQR 4JN1H 1N64H 3RQ3A 2JCCB 2EZ0D 2XG4A 5FB8A 1H5BB 3HI5H 3GK8H 5DJXB 3MGOA 5F7DA 1S9YB 1K2DB 1UXSA 5FM5O 4E42A 2A73A 4CVWA 4DW2L 1CDUA 1MFBH 4NKMA 4BKLA 3MC0A 2N7BA 3T2NL 4Y5VB 1O0VA 2ZJSH 3FB8A 3OKOA 4KTEL 1H3GA 2NY0C 4JPKL 4WW2B 2F54A 3VFGL 4JZNB 5MHSE 1TNMA 5I2IB 1ZHBA 2YXFA 3VFWA 4NCC1 3Q5OA 1JJUA 1R3KA 3BEVA 4ZFZB 1F6LL 4Q2ZA 2NX5A 2ED8A 3W0WB 5FM4A 4RMWA 2H1PH 3MQIA 1F4WH 4X9HA 4MAUL 1XF1A 4HIXH 5I1GL 3DHJA 2X4RA 1DVFC 1RULL 3ZDXE 1WEJL 3AREC 1U8JB 5IR1B 2F58H 4Z7QE 4RAUA 4X7CC 3AREA 1JGLL 3PJSB 4NO3A 1BVKB 5JLZA 1RQ5A 1Z2KA 1ETZA 4FQXB 4RGMB 5IHUH 3EYSL 1WIUA 3BN9D 3A67H 2FDBP 4EUPB 3B6SA 5C2BH 2DWDA 5IQ7L 2V2XB 3BJ91 3U46A 4RWYH 2NY5C 2HTKD 3RWHA 1PX4A 3DYOA 3RUGF 1LO0H 2NY5H 5HHOB 3GUTA 1MREL 1H3VA 5HYSG 3BP7B 4LAJH 2HT2C 3QUZA 4JRYB 2DJUA 5INCB 3JZ7A 3PWLA 2EH8H 4OFVA 4BK5A 5C9KA 3LN5B 5EU7C 3S37X 3HLAA 4LKCB 1Z3GH 3IDUA 4OGYL 5IBUB 1C1EH 4U1NA 1YYMH 2V2TA 4NM8L 3WSQL 4J1UB 4UTBL 1JUFA 5J12B 3F58L 3DRTB 5DSCA 5F7HA 5C0RL 1JVKA 4R0LB 3P30L 1YJDC 4PTTB 4M7LL 2A9NH 1I1AA 2A74B 4X9IA 4BH7A 1LILA 4JPWH 3V4PL 3ECBA 2NX5E 1ZT1B 3T0VA 2AEQL 5C0AA 2R39A 2PO6D 4GLRH 2X4PB 4QNPF 2VLRD 1AO7A 5C09B 3MUZ1 1MFDL 2EO1A 3NOIA 3NCEB 1NAKH 5T1KD 2NY3C 3VXTB 4M1DH 2BVPA 1NMAL 1HZHH 1SYSB 4TNWK 5EDXA 3ME0A 4XP1H 4B7IA 1DJSA 4TUJA 5GZNC 4N9GB 4FQ1H 2VDOL 4D94A 5FDWA 3R0MA 5F3BB 4OZFB 5EO0A 4N0FA 2NR6D 4NN7C 3M8OL 1CR9H 3S5LB 5E03A 3VFNB 1K4DB 4YBQC 5D6DC 4ESKA 3KLHC 1I8KB 5DK0B 1FQ9C 2FEDC 2VABB 1SYVA 3CFDB 2YA2A 5EOCH 5D6DA 1YMHA 3FO2A 5FGCB 2DKUA 4PP2A 1QPXA 4JHZA 2XT1B 4OZHB 4PJAA 3MCLL 4WI3A 4QRRA 1NCWL 4RX4A 3OAYK 2ITCA 2PTTA 4O2CB 2DN7A 4RMQA 5DA0B 3PP3K 1AGFA 2ICWI 2OTUB 4X5WA 5L8KB 2B2XH 2NY4C 1JPGB 4HJJH 1LO5A 3L3GA 3P4NA 3REWA 1YNLL 4ENED 3QG6B 3SO3B 5KVMC 3TT3H 5A16A 1UEYA 3PABA 4OCRL 5I17A 2OLDA 1S7SB 3QIBA 3HG1A 4OV5A 1MFNA 4DQOH 4LVOB 3VXRB 3N85L 1NBZA 1LNUA 5HDBE 4KI1A 1DSFL 2PW2B 4GRWE 4D8PB 4WTXA 1A47A 1KIQA 2VRAA 3SKMA 1U8NB 1NC2D 3TA3B 3HHRB 5C0AE 1BAFL 2ZPKL 4FFWC 1I3GL 5SX4H 1MHEA 1DN2A 4OZGB 3RWDA 2GSIB 3MRGB 1AO7E 2DQJH 5KSAD 4ZSOE 1RUPL 4UAOC 3MRDA 4ORGB 4WI7A 2JJTC 4HS6B 4HLJA 5IMKA 5F3HA 3O3DB 5JHLH 1I7UA 5DQJB 2JJTA 4WWKD 5T1DH 3TO4B 1FFRA 4AL8L 4PB9H 3PL6A 4XVJL 4OCLC 3CSPA 4X98A 3U7WH 3WFBH 5LJYH 2KPNA 5GIRB 3EYOB 4IDJL 4GG6F 2YXMA 3U7AA 1PFCA 4YIQA 4NQEB 5DD1L 2BSSA 4MD5B 4MSWB 5CILH 3UAJD 3SE4A 1N26A 1CD9B 5L8JB 3DX9B 3TO2A 1MLCB 3O8XA 4IOIB 2YC1B 1MFAH 4D9QE 2W91A 5SX5H 1RJLA 4QRRE 2YPVL 3B9KC 4JY4A 1CDHA 1GIGL 5IHZB 5FUOL 3I6GB 3O3AB 4HWZB 5E8NA 3GRWH 3GRWA 5EB9A 1RZFL 5HGBB 3ZDYF 3H3PL 1E4WL 1QSVA 3DV4B 1AGDB 2VAJA 4WU7B 3VI4E 5E8OB 1IAKA 4RA3A 4UUJB 4K94L 5DD3L 2BK8A 1EEZB 4LPVA 2FGWH 2IBBA 3T2NH 5GGTL 1WUNT 3E8UL 1UG9A 3HG1E 5TDPA 3U4BH 1QLFB 1YEKH 3CZJA 4X8JA 2JJWA 1H8SA 1KXQE 2FATH 3BPOB 3ARGB 1T7ZA 3LPGA 4JFDB 4ZOEA 1MHCB 4WO4A 3MO1A 1CICD 1ZLSL 5D1ZA 1IE5A 3W2DL 3CZFB 2YHGA 4NIKB 1LEGB 2ED9A 4FQ2L 3MR9A 2ESVD 3DVGB 2YBRA 3ULSB 4LLWB 4MXVE 4JFPB 4MA3A 1N8ZB 5BV7L 3SGJA 4P3DA 1JGLH 3H42L 2EDBA 1D9KB 2NXZC 3EJJX 3U0TA 2XZCH 4PB0H 1A3RL 1FAKT 4LGRB 1HH9B 3ARDB 3TBYB 1E28B 4KVCL 1RHFA 5E5RB 4GSDL 4ONOA 3UBXG 4GMTL 3D69B 4CN4A 3OKDB 5C0DB 2IBGA 3HB3C 2WLZA 4GJTB 3N50A 5CP7B 1MREH 1OQOA 1NL0L 4C4KT 4C57C 4XXCC 4NBXB 1CE6B 5DO2C 4PJHA 5IQ9B 4OGYH 3IAPA 1RZ8A 1JZ4A 3G5XB 3GFUA 3D25B 3NFSL 4I2XB 4NM8H 3WSQH 3O6FB 4TUKL 1CD1A 4ALAH 4BK4A 3DI2B 3F58H 4DJMA 2D3VA 4NQVA 1KCRH 3OPZH 5L6YL 5DVNA 1Q9KB 3HZYB 4QRPB 3DXAE 3RWJA 3O2WH 1WICA 1B9ZA 1TCMA 1NEZB 5D7JB 4S1RH 4OZIA 3S9DB 2K9UA 3V4PH 2VERN 1HI6B 1AGBB 1RURL 3RWEA 4PJGB 3SDAC 4X8XA 1MCFA 3DMMC 4H5SB 4N8CL 4LOUD 5D7IF 1IKFH 4OCNC 4M5ZL 3O4LD 1FPTL 4G6JH 1DDHA 2ZSWA 4MNGA 1MFDH 4X6CB 1ZHLB 4P2OB 1GZPB 2J8UF 2ZZUT 1FFPB 2OL3L 5EH1A 3G5ZB 4YHNA 3RPIA 4JCLA 2EXWC 5AD0A 1VA9A 5E8PA 3CLFL 4JKMA 1NC4D 3P77A 4LSPL 4X99A 3VWJB 3GBNH 2GI7A 2VLLB 3MLWH 2VDPH 4JHBA 5TF1H 2Z91B 4HXAH 2XWTB 2DJ4A 1CFSB 1ONQB 1IGFH 1LD9A 4MCZA 3CX2A 3LSOB 1KPRB 4G3YL 2NTFB 43CAB 1QVOA 2CLRA 4X4YA 1ZEAH 2CUHA 5DUML 1KCLA 2CUMA 2P7TB 1A6TA 4G9FD 5JIIA 3CMOL 3P4LA 4HFWA 1H8NA 4P23A 4PJXF 3WS3A 1U8IB 4HPYL 1KXVC 2EDRA 2KH2B 3QQ4A 4NN6C 3MCLH 4TRPH 5CUSH 4FTVB 1T66C 4AIZB 3ELAT 1G0YR 1FNSL 1BVLA 4U6XB 2X6MA 1MCQA 3PDGA 4MXQD 5ALBH 4YHZL 5DUPH 3DVNB 1B4RA 1JTOA 5SWQB 1YN7B 1D5MA 3RDTB 5EIIA 3JTTB 1RIHL 2X4QB 4LASL 3SDXA 1MCSA 4HGKC 1G6RB 3HC3H 5DHVH 5DHVA 3GO1L 5GGVY 1DEEB 4I3GA 5E2TL 1DSFH 3BVNB 3QH3B 3KLAA 1DBAL 5FYJL 4NRZA 3SKJL 4OZIE 4ZUTA 2CDGA 4G8IA 2ZPKH 3BKYH 3CVHB 7FABH 3EOTL 2C4FT 2H32B 2BNQA 3HAEB 2VXTL 3FT3A 3MBXH 1BM3H 4YFDB 4CVZB 1ZLUH 1FNHA 4Z7VE 3QDJD 5EU4B 1A7RH 1L7TL 1PZ5B 1RUPH 2JE8A 4OD2A 4LSTL 1OAQH 1Q1JL 4ZPVA 5D1XA 2X7LA 4FFYL 1OWWA 5J89A 4NRYB 8CGTA 2Q86A 4X80L 5HYFA 4NKIH 2YK1H 1BBJB 3KWWA 5D7KE 2ATPB 3B9VA 2XQBL 4M3KB 1I1FB 5BVPL 1T0PB 5K59F 1JMXA 1MCNA 1IFHL 1IL1A 1PW3A 3L3JA 3HC4H 3MREB 1C8PA 1YEIH 2W60B 5FYKL 1OAUL 5SX5K 4GKZB 3WJJC 3TBWB 3VGAB 3Q1SL 3NCJL 3VFUA 1VEOA 1X5AA 5KS9F 3WJLA 3UPAA 4PJ5E 2YPVH 4ETQA 4F3FB 1ZV5A 1UM6L 4PIRF 3EIFA 1BREA 2AXJA 3O3UN 5E70A 1NDMB 3TT1H 4HQQH 1T2JA 4ZDHA 4K94C 1AD9B 3SJVD 3WO4B 4QTHA 4D9LH 4DTGL 3V2AR 4U1JB 4X5XB 1I3UA 4UV4H 5J0BA 5IFJB 3E8UH 4JJHA 5F9JB 5C92A 1NCDH 2Q7YA 3F7VA 2HWZL 2IAMC 5KOVC 4IBLT 4WU5A 1U91A 5CSZB 1T83C 2FB4L 1QFWH 4LKXB 1R3JA 5AAMA 2BC4B 3BX7C 2FD6H 3FN9A 3W2DH 2BNQE 1TJIH 4RDQG 1NMCC 3FFDB 5CWSA 5JXEA 1F4XL 3C5ZD 1JHTA 3ES6A 5C0CB 5TF0A 2CRMA 4E9LA 3Q6GL 4ZTPL 5HY9A 5BV7C 4C56E 1HK6A 3L5WB 4GAJL 3WEXB 2I24N 4CADA 5BV7H 4ODUB 3H42H 1W72B 4Y5YC 4GAYA 2ZCHL 3P73A 4L5FL 5J1TC 2UZIL 1SM3L 4JB9H 1JNHB 3VG0H 1WQVT 2COQA 15C8H 1UB5A 3QJFB 1FRGL 4PJDB 4D0CA 1UWEH 1PG7W 4XNMB 3BQUB 1RVFL 1FYTD 2R29L 3T0XA 1FGVL 2W65A 4IRJC 4F57H 3X14A 5AG8A 3CCHB 3HC0B 4R2GB 3IXAA 2YR3A 3O0RL 3TNNB 2CRZA 1BPVA 4P59L 3FONA 4X7TA 3WFHA 5K9JL 3G6AB 2D7NA 4L4TB 1KTLA 2H45A 3CNKA 2F5AL 2FGZA 4GS7B 2X4SA 5EBLA 1NLDH 3EO0B 4Q9CA 1FE8H 4HUWA 4I4WA 1A14H 4OF7A 4QGYA 3VG9B 1KPVB 5CEYA 3KXFD 3ZKXB 4LSUL 2J4WH 1UWXK 2JB5H 1BGXH 4R3SA 3VDAA 3A6CL 1S7XA 3IKKA 1MCJA 3QPQD 4K9EL 2W38A 4UIKL 1TPXC 1TETL 4I77L 1C16A 5BS0D 1WFTA 2DIJA 5EU5A 4ZUUA 2QADD 4P5TA 3HE6A 4HF5L 4QKXB 5EWIL 1JHLH 4J3UA 1VDGA 4OCSH 3ZKQD 3MODH 4NO0D 5DS8A 3SOBL 3QXAA 2XKNA 1TVBB 4O9HL 2AK4D 2H2SC 4LSPH 2HVJB 5GSVB 3WS6A 3SDYH 3W11C 1LMKA 2BMKA 5TPWL 4RGNE 5FA4B 5GS1C 1HHJB 3DSFL 1J0YA 2A6DA 3RVTC 2DAVA 4JRWA 4PBVC 2CK2A 1AXSB 1H5BC 1I7TA 2X4UB 3K3QA 4PJ8A 3T0AA 1EHNA 2C3GA 3EGSA 4ZXBA 2WWKO 1H5BA 5I1JH 3QUXB 3L7FB 3CLEL 5F7WC 1IARB 1FVDB 2WBJB 5BCAA 3MV8A 4AG4H 4FXGA 1GGBL 4Y5VC 1CXKA 4WW2C 4HD9A 1JZ5A 3AM8C 1JPFB 4LGPB 2LE9A 3VGEA 4PJ7E 2FIKA 4YHLH 2Z92B 5KSVB 4L8CA 4MQTB 3ESVF 4JAMA 4TSBH 3BEWA 4XGZA 4KK6C 4LASH 3L95B 4HFUL 3QJHA 2Y5TB 4UU9A 3DECA 2BDNH 5HHPB 3KPTA 4YEFA 4HUUB 1J0KA 3HUJA 2EDOA 5DRNB 1GHFL 3L9RB 4CRPA 5FYJH 1DBAH 1MCLA 3RUGB 3HZKA 3SQOL 3MGTB 3SKJH 2UYLA 4NFDA 1BFVL 5DQDL 1LK3L 1U0QA 1JWSA 1XGYH 3AVEA 3BI9X 5GGQL 4M48H 4RGMC 4FQXC 1JFQL 3S3SA 2ZNXA 5C8JB 4WVRA 4L9LB 4J2XA 2VXTH 3A6BH 3CVIH 5D5MA 3DYPA 3DJ9A 1RZ7H 1L7TH 3MOBL 3MJ8A 5ICXB 5IIEB 2DMKA 2AGJH 2C3VA 5EZLA 2NZ9D 4JFQA 1BLNB 4WDIA 4NZRL 3SE9L 2KQNA 1EZVY 4D9RE 1GAFH 2APBA 5DTFB 2XQBH 1SQ2N 3BP7A 4QHMB 5HHXL 2Y36L 2CRYA 4RZCA 3GSRB 1FH5L 1K8IB 3PV7A 1XIWD 5FYKH 4NQXB 3LV3B 3MRNA 4Y2DC 5ID0A 3P4MA 3PWUA 4ELMA 1FNFA 1FG2A 4GXUM 3ARBA 4Y2DA 3RI5F 4R0LC 1INQB 3SCMA 1KGCE 3DRTA 3AY4A 4KHTH 2VDQL 3HRPA 3BH9B 1WTLA 3CU7A 5JOPD 1UKSA 4K8RL 4TPRH 5IEHB 4Z7OE 3RIFF 1V3MA 3LEXB 1QTYT 1FHGA 2VTFA 4NHCL 4R7DA 2CLVB 4DTGH 3TIDA 2VQTA 5I1DA 2V9TA 1A9EA 2X5PA 1ZT1A 2PN5A 3NH7L 4HJ0D 5I8OL 4P5MA 4KDWA 3OB0K 1T3FB 3TPKA 1N4XL 4XWOD 2JJSC 2VLKE 3QP3A 3KHOA 2A2QT 3FQNA 2HT3C 1L0QA 2JJSA 2PO6B 1JYVA 2HWZH 2VLRB 3C6LA 4MDIA 5LBSH 2VDLL 4LLUA 1DQQA 5ACMA 4KJPC 2GQHA 3BOVA 2CDEB 3BJLA 4YAQA 3KS0J 3L5XH 3LMJL 5HDOA 4W81A 5FYJU 3O81A 4BFIB 1MCWM 3HCVA 3QHZH 4PFEA 3MBEA 2FO1A 5D5ME 4X7SL 3TLRA 1K8DA 4ZTPH 3VFNA 4KROD 4X6DE 3RVWD 3UP1A 2LABA 4YHYB 1VADA 3SDCD 1D3CA 1XF2A 4S11A 4WY7H 4UB0L 2UZIH 1S7VB 1S78D 1J05B 4JO4H 3WLBA 3OKEA 3OJ2C 5ETUA 1EHLH 7CGTA 3NN8A 1G84A 5BO1L 2AABL 5B39G 1YEDB 4E5XA 4XWGH 4X6FA 3PGFL 1JPGA 2PF6A 3HNTH 4BSWB 3SO3C 4ELME 3I50H 1QKZL 2MNUA 5FYKU 1XGRB 5HI4C 3O0RH 1D5BA 3BW9B 4JDTL 3G08B 2P5ED 4PPTA 4LVOC 3RY5A 3PWVB 5F96L 3QO0B 4PUBH 4OD3L 5HYJA 4U33A 2ORBH 2F5AH 3V0WH 3TA3C 3ZTNL 1KF9B 4KZEH 5LCVL 5GRJL 1U95B 4OZ4A 2YMXL 1U8NA 1T1ZB 4GG6B 2FX7L 5I73B 3CVHL 3MRBB 2NW2A 3QXVA 1NC2B 5GGUB 1U8OB 1BX2B 4X4XA 1MCDA 3BZ4B 4K9EC 1MHHB 4ZUVA 5KSAB 3TO4C 4DEPB 5LAXB 1T20B 3CGTA 4UIKH 2VL5B 2EH7H 1S7QB 4LLYB 1TQBB 1G7IA 1UKTA 4CVUA 1XT5A 4XCCL 4WWKB 3DTXA 5GIRA 1YY8B 1XF3B 1LHZA 1CD0A 4O9HH 3EYVB 3F7YA 4MX7A 3RWCB 3NABH 1OAYH 3OKKA 2LV4A 4WEBH 1NBQA 4L3ED 4Y4HB 1AJ7L 1P69B 3DSFH 3LHPL 4FQQB 5D70L 1P53A 2VXQH 5CJXA 1CLOL 4OCWL 3UDWC 5T1LA 2HLFC 1UVQB 3QWOA 5AYUH 4ZPTA 5DJZB 4OGAD 4G8EA 1RZKH 1GZQA 5I30L 3VRLF 4EZMA 1AGDA 3X12A 3KDMA 5A40E 2W9LA 4IEFB 1A2YB 5C0BB 4JQXC 2YPLD 2Q8AH 1GGBH 5IBTL 3RVXC 1CDIA 1N0XL 4LHUB 2GAZB 4UOW0 4QXTA 3TPUA 4Z7NF 4X4ZA 4ZOCA 3OF6A 1H0DB 4FG6C 1FLTX 4N0CC 1RHHB 5DMIL 4EDWL 4NNYB 4CNIA 1YQ2A 5F1OB 1NFDF 3G6JF 5HGAA 5HYJE 4M43L 3REVB 3BPOC 1A1MA 3L1OL 3WXVH 3RZCA 3L5HA 3MRLB 2X44D 5KSUA 3MSPA 1JZ3A 3S6CA 2EDNA 1CGSL 3UJJL 4KAQH 4RFOL 1PEWA 4JFDA 1MSPA 1P7HL 3ZL4L 1IAOB 1UKQA 3FO1B 3EYFB 4ONGL 5KN5B 3JUZA 3SQOH 2EIDA 2DRUA 2J5LC 2P49B 1D9KC 1LK3H 4JFPA 4EKXA 5C0FA 5FECA 1OL0A 1FNGA 1UB6A 1DQDH 2ICEA 1W72L 3QUYB 2C26A 1G7QB 3B4NA 4PLOB 2FO4B 1S7UA 1FFNB 3ARDC 1SBSH 1T1XB 1GCFA 4Y19D 4RA0C 3BPLB 1XF5A 4XPTL 3EDJA 2HFGL 4FQCL 3T0EA 5H37H 4JY5L 43C9B 2FEEL 1VEPA 5FOBB 3NPSB 4MQSB 1FORL 3EUUA 1D6VL 5EORH 3IXTA 3UTTB 4UQ2A 1CXEA 5CP7A 1I9RL 1F90H 1I75A 4XBPB 3SKUD 3V6BR 4EI5D 1A7OL 4MWFA 3UO1L 3QG7L 4MQ7B 3F7PC 4U1SB 4LSVH 1CE6A 4HUVA 2GY7B 2AEIT 2YA0A 4PR5A 4YQXH 1X5FA 5D7LE 2SEBA 3O6FC 3BP4B 1TTGA 3KR3L 5BMFL 4ONFL 1BIIB 4OAWA 2IFFL 3MRJB 4FP8H 2GHWB 5GGSY 2A1WH 3IGAB 1FN4A 4R7NB 5D7IB 1HHHB 4QHLB 5IVNA 2J8UB 2CIKA 4K8RC 1KIPB 1YPZA 1IC5L 1P7KB 5D7JC 3WLWC 3FT2A 4FFVC 4PV9A 1LGVA 2FECL 4UZGA 2Y07H 1HH6B 1PKQA 3S3JA 3S37H 3MRFB 1HI6A 1XCQB 3V5HB 4U6VH 3NH7H 5I8OH 1OVZA 4CW1B 4YDIL 1YN6B 4P2OC 2R9HD 3UROR 4AT6B 3RY4A 5L8LB 5I18L 2ADJA 3HPLA 2RQ8A 4AJ0A 4PG9A 2V7NB 3IJYB 4PJXB 3VWJC 1KPUB 1XR8A 1MCPL 3RKDD 1W0VA 2PXYA 4U6HA 1GJIA 4KDVA 3LMJH 3GM8A 2AJ3A 4IDLA 4Z5RA 1E6OL 4KI5C 5TGBA 4EUPG 5T3ZD 1J12A 4JPIA 2I9TA 1EEUA 4LQ1A 3THML 2W07A 3T0EE 1RK1A 2WLYA 5KVGH 3LKQB 5FM5M 2C1PA 3U7YH 1VB9A 4IIQA 2QHRH 2VR5A 2GTWB 1V3LA 1OD9A 3CJJA 4OFYA 4L4VA 4IMLB 4G9FB 3TZVD 5HJ3B 4DZBA 3TWCL 4QHKI 1QEWB 1P7QA 2GK0A 3RDTC 3DVNA 5FO7B 3VXSD 4YGVA 2DQFA 3ILPB 3WYRA 5CBEA 4PRDB 4YPGB 2XFXA 4FZEL 4G80A 5KTEH 3H9HA 5C0IB 4XVTL 3AS1A 1YPZE 2QQQA 2IALA 1NUFA 2VIRA 3T1WA 1BOGA 5FGBA 4MJ6B 1R3IL 2E7HA 2JK5B 5ICZA 1SJHB 3IDXL 1PKQE 5DJ8A 4QEGA 3VWKA 4JHWL 2YMXH 1X4ZA 4O58H 4KJQC 3RL1A 3L3KA 3T65B 4KKLD 5IV2A 1TLKA 3CAFA 1J86A 2R0ZL 1PZ5A 4MMXC 3BESR 5LQBL 4DUVA 1I9JH 5KS9B 3TVMA 3QEQA 3BMVA 5J7CC 3MLZL 5LXGL 4OZFG 3H9ZA 5GS2D 3W9DA 3BKJH 2XN9D 4YHIA 3B2UD 1Q9OB 3QDGA 2GJZA 5DRWB 3S5LG 4K7FA 1R5VB 1ZS8A 4PJ9A 2VN7A 1T1YA 3V52H 3VGAC 4LCCA 1WK0A 3VI3E 1J8KA 2C1OB 3OKNB 5EC1B 3QWRA 4XB7A 3IJHB 5F7UA 1H3UA 4G6AD 4L4VE 2EDHA 3UYOD 5C08E 3LHPH 5D70H 1DE4A 2X4OA 4S2SA 4TQEL 1U3HA 2B5IB 4ODHH 4XXDB 2FEEI 3V5DA 5ENWB 1FDLH 4OI8A 1QD0A 35C8L 1BFOA 1CIDA 2RIKA 3QFJA 4N90E 3N1FC 2DM2A 5LGHL 1HXMB 2HH0L 1IBGH 3WO4C 4UDTB 2XIDA 5MHSD 4NNXB 1UZ6F 2A9MH 1UQSB 3RAJL 1B4JL 4MJ5A 4JRXE 3D48R 4HPOL 3L3OA 4PJBE 3SJVB 1N0XH 5IT2H 5H2BB 1JNNH 1KBGH 4MDJB 3ZE2F 3JXAA 5F1IB 5DQ9B 1F97A 3RGVD 4P9HH 4NQSA 3QHFH 4WTWA 5T5NG 1HXYB 4ZMAT 3BN3B 1MUJB 2R0WL 5E2VH 4OF0A 5I8KH 3I9GL 1KCVL 1OTUC 4ZS6D 4M62L 5C07B 3QCVH 4HWNA 4XMLL 1Q0XH 1XGTA 4EJ1C 1UT9A 5CSZA 4TSAL 5I8EA 3ETBF 2AS5M 3F12A 1FLRL 4RFOH 3GJFB 4N9OB 3O45A 2I27N 3N0PB 2FECI 4DN3L 2Z4QB 2ADGA 1FIGL 3PV6A 1AP2A 1BBDH 3FB6A 1TVDA 3ARXA 3C5ZB 3KPSB 1F6AB 3QEQE 2FR4B 4K2UL 4OUUB 3WXWL 1UYWH 4OLVL 1MY7A 3GKZA 2OQJA 1P9MC 1MJ8H 3PHOA 3QEGH 4FQCH 2HFTA 2CLZA 1P9MA 4PJDA 3ZDXF 3BQUC 1A1OA 3GMQA 4Z7QF 1BQUA 4WW1A 5TDOA 1ACYH 3KJ4B 1WZLA 1JPSL 4F7EA 4PY7A 4R2GC 2AJVH 3HPJA 5D7SL 2EYSB 2BY1A 1A7OH 1FYTB 3PDOA 4XVUD 3OWEA 5LVEA 3D0VB 3JWNC 1A6WH 2NY2B 4C83B 4G7YH 5BMFH 1GOHA 4JM4H 2XY2A 3UYRL 4CBPA 5IFAL 5L2JA 1RK0B 3G6DH 3QEHB 4M6OL 4PJCB 1YEFL 5HSFA 4QHNA 2ARJQ 4UOW1 3VG9C 3QNYA 1MNUL 5J13B 2NX5D 2ZP0T 3RRQA 3ZKXC 3V6ZA 3GMLB 2DM4A 5C6PB 1MAMH 1KLGB 4NQDA 3IFPB 3EOYG 4NPYB 1N59B 5CJ5A 3KXFB 3LRGA 5CGTA 3B2VH 5EU6A 3UPCA 3KPPB 5F88B 3RWIA 4Z6AT 1QLEL 1YY9C 3MJGX 4LPWA 1Y18B 5ADPH 3RL2A 5J56B 4MD0B 3WDIA 3BH8B 2GJ6E 1MCPH 3BRGC 5DZOA 1KJ3L 1UGNA 2HVJA 4BH8B 2EDLA 4AENA 4NO0B 1U58B 2VZTA 1IILE 3M17A 2EC9T 5D72L 2AK4B 1I8IA 5H37G 1A3LH 5JW4M 4X6EA 1DP0A 1RMFL 2WSKA 1P84J 3WDJA 1T0NB 1KEGL 3SBWC 1TZHA 4YDKL 4XAKE 2F8VA 2CRIA 4G9DA 1BP3B 3QUXC 1G9ML 3BHBB 4Z8FH 1J0ZA 2WBJC 2EZ0C 5E6ID 3VXUB 4O2FA 4GQ9H 2BFVL 5IKCA 4HIHB 3OXSA 2D31A 3OAZH 1C12B 4KK5D 4Y4KA 1YYLL 2WWKT 2R23B 1RZGA 3GNML 3ZE1E 1PKOA 2JIXB 1ULVA 4JM2D 4DVBA 5D9SB 4LK4A 4ACPA 1PBYA 3C5JB 2BNRA 4HKBA 4EVNB 3S36X 4LRNL 3SE8L 1NEZG 5C0AD 3PWPA 3CXHJ 2W0FA 1R3IH 2YKLL 5DRNA 2AEPL 3SY0A 3BISA 2DQDL 1CXLA 2HKHL 3GMMB 4NQDE 4Z77B 3VE0B 1AO7D 3IDXH 1X5JA 1HEZB 2VXUL 3HR6A 2L4OA 1TENA 4F9PA 1GGYA 1A4JB 3GKWL 3EO1A 2ERJC 2B8OT 3R06B 4L9LC 1EO8L 3O3EB 2NLJA 3JV0A 4XP6L 2DKSA 3GMNB 1UM4H 3VH8B 4E0RB 3UTQB 5HDBF 3BN9C 4NZUL 4M1CD 4K3EH 4DOHE 1LP9A 4NSKA 4NM4L 3MLZH 3HN3A 4JR9L 3KYMB 1KN4L 1B2WH 2HTKC 4NFCA 1CFQB 1OP9A 3W39A 4LF3B 5SWSE 5EOTA 5I16A 2YD6A 2VL4A 4XNUH 1KN2H 4QHMA 2DQHL 4D9QD 4Y1AE 4QRRD 3CFBA 1IZKA 1R3LA 2R2HA 1D5IH 2X05A 3GSXA 3WIIL 5CLWA 1S5IL 1N5YH 3BIBX 4X7EC 4KV5E 3O6KL 6FABH 2JB6B 2AVGA 3OX8A 4AIOA 4UT6L 3QNXA 1Q9LB 5DMGD 4PTUB 2XA8L 1LO2L 3MMEA 4BJLA 3QIBD 3RNQA 3HG1D 3CX5J 4X6BB 1ACZA 1C5CL 1J1XH 4HG4J 2B4CL 2VDRL 4PJAF 3I84A 2Y06H 4XP4L 5FK9A 5MP6L 4IS6B 5ICYB 1FZJA 1FGNL 5FV1L 2DQCL 2PO6C 1M6OB 5TE4H 5I1EL 1FG9C 2R0WH 3PWPE 2MHAA 3VI4F 1FCCA 3UJTH 3D85D 1TQCB 4XMLH 3NZ8A 2E3VA 2OSLA 4JQIL 3R1GL 5IVOA 1NCUA 5T1KA 1FLRH 4YR6B 3V6OA 2UUDH 2VZ3A 5DJ6B 2Z9TA 4N0YH 5ADOH 1IGCL 4I18B 3H9SE 4U1MA 3MFGB 3BT2H 2DMBA 2HKFL 5L88H 3LPFA 3PL6D 2NR6C 4YHYC 3VXQB 1N0LA 5IB4A 1LP9E 5M7QA 4KRMB 2DICA 3BFOA 2D0FA 5DURB 4JDZB 1OAZL 4GUPA 4JQVA 2FL5A 3O8XD 4YDLB 4PRAB 4OJFL 2HN7B 1KSRA 1Z5LB 5EC2B 4MXVF 4F33A 2E5EA 2EDFA 4JN2A 2J8HA 2AP2A 1JPSH 1MF2H 4HH8A 2XXMB 4HH9A 3LKNB 4MZ2A 1OLLA 2P8PA 5FYLH 3D0LA 4MNQB 4BSWA 1IQDB 5D7SH 5CHNA 4XNYH 2GCYA 5E00B 5SV3A 4ENEC 3BP5B 3UTSA 4OBRA 5I1IL 1UJ3B 5D1QA 4XPBH 1HINL 4DGYH 3UYRH 2P5EB 5A1AA 3DXAD 2OXHA 4G8FA 1G7PA 1DBKH 4W6XB 3IFLH 2VLJA 1KENL 2XWBB 5AZ2H 3S4SA 4UIMA 1WITA 3P0VL 3HI1B 2E9JA 1IGML 3DUUB 1EX0A 1MCBA 5GGUA 5KSAC 4WO4D 5D1ZD 4DEPC 1S7RB 2DLFL 2QR0B 1CWVA 3FHQA 3B5TA 3CH1A 5HD8D 1TQBC 4R8WL 2N7AA 1QFWM 5FO8B 4WWKC 1QSZA 4K71B 3ZKND 5KSBA 2DI7A 3V6OE 3X3FH 5JDSB 4F7CA 1MJ7L 4DAGL 3K46A 3O6LH 1SHMA 1F45A 4FS0A 2XPGB 4Y5XA 3X3GH 2ICES 1FVEA 1NMBL 3MYJB 1WJ3A 3ARFA 3DROB 3EYVA 1CE1L 2CMRL 4HAGA 3RJQB 3UAJC 4Y4HC 5F6IB 4CJ1A 2PUQT 3ZKSD 4ZQKB 5CZKA 2AJUH 1AGEA 2OXGA 1G9MC 1NFDB 3G6JB 3IKCA 5CD5C 3NCCB 1WBZB 3DX7A 2J6EH 2J6EA 3VD5A 2B1HH 2RFXB 4MHHG 4O00A 1ZMYA 2IC2A 3OAZK 2DTSA 5FA3A 5DK2A 5FYLE 2QBWA 3G04A 4X7FC 1C5BL 1I7ZA 1P4IH 1A1NB 3IDMB 3B9DA 3OTTA 2ATKB 2OR8A 2GAZA 2YPLB 3STZB 3UTSE 1S8DB 4GW4B 1GPOH 4TTDD 1F02I 1I7RB 4QRSA 1BEYL 2VDNL 4NKOB 1T89C 2R4RL 2VLJE 4HZLB 2IADA 1M05A 1QSEE 2Q6WB 3LDBB 3AC0A 1PSKL 3IYLW 1VFBA 1JZ2A 4PJHF 1CICC 3QXUA 4PRIE 2AEPH 2OM5A 1CGYA 3PGCB 3TYFB 5C0EB 1CICA 3I6LE 4LCYA 5IB3B 1J9CT 3L6FB 2ESVA 2BOBB 1F8TH 4MQXD 5DC0A 4G6ML 5F1KC 1QR1B 2RJMA 1T7WA 4CU7A 2C3HA 5CKAA 3BPLC 5CIPB 1U8QB 5DRZA 5HGDB 3U9PH 5KSBE 3UYPA 3IU3B 1I3RA 4YHKH 3VFRA 2DI8A 5D7KD 5IF0B 3VXNA 3NPSC 43C9A 4KKNA 2H26B 3U4AA 4Y19B 4KTDH 4R9HA 5FF6B 2Q3ZA 4JO3L 4V2CB 5CLTA 1H3PL 4OZIF 1TCRB 4KUZL 5FUCE 3JV6B 1KCSH 2CDFA 2WBWB 4FNLL 3VXOB 1I1CA 3T3PE 2DIAA 4AEHL 2VKXA 4G6KH 4P23D 4P5KB 4ZG1A 4YDJB 3C5SA 4PJ5D 4Z7VF 1NFIB 1ZGLP 4OQTL 4KGLA 3WIIH 1L7IH 3VFVB 4AMKL 3AAZB 3B5HA 2E7BA 4CUCA 4DCQB 4XNQB 4P3WA 4OF3A 5E94A 5CP3H 5A2IH 5CP3A 5JXAL 1BWWA 3ZYZA 1DQML 1IC7L 5DUBB 1KIPA 3BD4A 2P48B 2CKBH 4ODWB 2CKBA 4GKNA 5C0GA 2FJHA 3U2SA 1U93B 2PR4H 2B4CC 1F11B 4MXWL 5C2UB 5T3XH 1U3YA 2EE9A 1IEAB 1C5CH 1K6QL 3V5HA 2B4CH 4MLIA 3W9EA 5SWZA 4KRPD 4Z95H 1ORSB 1CF8L 4KY1L 3KPNA 3S88H 5I1EH 2YS4A 5TQ0L 3WCYA 5GZOD 3LCYA 2R4SL 4GBXA 4JKWA 4LOUC 3I75A 1JF1A 2BNQD 2AJXL 2XWJB 4F2MB 1I4FA 3HFMH 3IJYA 3MZTA 2HTLD 2UUDK 3O4LA 2ZOLB 2ZCKL 4WJ5A 4C56D 4K55A 5D1XD 3BZEA 4YNYB 1NC4A 1T5WB 5EO1B 4PRPA 3QIUD 5ESAA 1IGCH 4LLQA 4WI5A 4JFZL 1ORQB 1X5KA 4ODVL 4D0DB 5B3NA 3ZT5A 1EJ6A 3CPLA 1ZLWK 2V6HA 4G7VL 4U1IA 3BRFA 3CK0H 3NGBB 2VN4A 5CZXD 3KPOA 3GGWA 2OJZL 3MROA 3QZWB 3IDGB 3CDCA 1JGDA 3F5WA 4G9FA 3EOAA 2P45B 4EQ3A 4L3AA 4HLZH 4D0BB 1BQLH 4RMVA 5DEGA 5HDQH 3TZVB 3DX6B 2APXA 3ZMRA 4WTZA 3FB7B 4MLSA 4MXQC 2FYYA 1MRCL 1UADC 3VXME 4RNRA 2AJYL 2EEAA 2Z31D 4R96A 5JIKA 4QT5A 1MELA 1FAIL 4KKAD 1OSPH 3VXSB 2X2YA 3BIKB 4F7TB 1LO4H 2MOVA 5F8RC 4L4JA 5I1IH 5IB2B 3QXTA 1KULA 1IMHC 2G5BB 2EE3A 3PP4L 2E6JA 2OX5A 3PWNA 5K9KB 5EBMA 1R5WB 4ZYKB 5T3XE 4OM1H 4V1DB 1I8LA 3LKPA 2Q8BL 4NKDA 5EUKA 1QFPA 1B0WA 2AKRB 3NIDE 1E27A 5ALCL 4JANA 3INUL 3BXNB 1X6NA 1HSAB 3DX8A 5CGMA 4LP5A 1OD7A 3LEYH 1VHPA 4HV8B 1FVCA 4ELKA 2DLFH 3GBML 4OCMC 1CT8B 3P9LA 4CU6A 1OSZB 4NNPL 3ZE0E 5JXED 1T2XA 4R8WH 3ILQD 1HE7A 3QDJA 3UPRB 8FABB 3R4DA 1LEIB 4DK3A 3I02B 1VFOA 1MJ7H 5JPMA 4PRNA 1CG9A 4RGND 5DRWA 4PRPE 3BZFA 4R26L 4P49A 5CMAA 1KB9K 3FJTA 1LQSR 2XN9B 1OTSD 1BFSA 4EOWH 4LEXH 4XNXL 3FQRA 4XNZB 1CTNA 4LEOB 1A9BB 1OGTA 5E1HB 2C1OA 2OTWB 3OKNA 4BQCA 1IQWH 3IJHA 4NO5A 2B5IC 2OK0L 5DWUL 1FJ1A 1LEKA 2WWMD 3QPXL 2XTJE 4P99A 5ITFA 1H15B 1VGEH 4L8BA 1JHKL 2UWEA 4Z0BH 3TBSB 4H0HB 5HHOE 1VPOL 3HMWL 3AXLA 1BVZA 3DO7A 4K7PY 3ORJA 3D9AH 4JRYE 3WNPA 3DPBA 1VACA 4H8WL 4JY6A 3MRIA 4LVHB 3X13A 2A83A 4HGMA 4YWGL 5CINH 2ZUSA 4KJWD 4O02H 1ND0A 1IGYA 4NUJA 4NQCA 2GKIA 1U8KA 2VDNH 3RGVB 4CDHA 5JR1H 2AXHA 4LCWB 4YC2B 1CDYA 4QCIB 2NW3A 1C08A 5LGKA 2IBZY 2FJFB 2ZG2A 1UH2A 1MOEA 4NUGL 4PREB 4HDIB 5F72S 2IPTL 3GJEB 2H6PB 5A2KH 1R0AL 2B39A 3C5ZC 2HA1A 4ZAKD 5F7EL 5D6CA 3SKNA 3HE6D 3O41B 4XCYA 5HVHB 1I1YA 4IOSD 3LKOA 2FR4A 5C09E 3SE3A 1SJEB 1ZA3B 2ED7A 4XMPL 4OB5L 2I07A 3D18B 4OFIA 5C7XL 2VB5A 1YC7A 4N8VA 4D9RD 4BUHA 3UBXB 4P4KA 4J3WA 3EFFA 4HAFA 4P2QA 3KJ4C 1N6QL 4KUZH 5IEKB 4FNLH 3WDHA 1HQRB 3JVGA 4Q6IA 3UTPE 5JPNB 1IKNC 3QNZA 4XPHH 2VDMH 3Q6FB 3GIZH 4K23L 2O26U 5E8D<