5BQ7B

Crystal structure of chikungunya virus-human fab 5f-10 fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
214
structure length
201
Chain Sequence
b'VLTQPPSVSGAPGQRVTISCTSSNVHWYQQLPGTAPTLLIYVNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYGSAVFGGGTKLTVLGQPLAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 5F-10-Heavy Chain
publication title Structural Studies of Chikungunya Virus-Like Particles Complexed with Human Antibodies: Neutralization and Cell-to-Cell Transmission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 201
sequence length 214
ec nomenclature
pdb deposition date 2015-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bq7B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bq7B01
1R3HB 2X4RB 1JL8A 3PWUA 1R0AH 2XY1A 2IPKB 4D9LL 3PF2A 3O41A 1IJ9A 1YEKL 5F3BB 4LK4A 3V6ZB 3MLTA 5ICZA 1HIML 2ICEB 4QHKI 5FYJL 4ENED 1INDH 3DGCR 2NX5D 4FFYL 1VERA 5DRWA 3EAKA 5IW6B 3F7YB 3TESA 2EDLA 2COQA 3Q1SL 2JJSC 3QI9B 1W72H 4WU5A 1I9RL 2V5SA 4ONGH 2ICWB 4JQIL 2R29H 1NCUA 4N0YL 4XCYB 2NXYB 3HC3H 4HS6A 1JTOA 4U1LA 1KNOA 1MNUL 4U1HB 4HUUB 5C6TH 3MMEB 5E7FA 4Z7NE 3OBAA 1YEGL 3VWJC 2OTWB 4MSWA 4TVPE 4I3RL 4U1JB 3CFKA 2ZG2A 3SKMA 3V6OE 3EJZD 2Z31C 5MERB 2BVPA 5C3LD 1UB6A 1AFVL 3N85L 1DBML 1KJ2B 3EDJA 3MREB 4P99A 2PKDA 1H3PL 3ARVA 3O3DB 1F4WH 3SKNA 1YEDA 5GGTA 2CDGA 1QVOA 4X6CE 3WNKA 3CZFA 1UT9A 4EQ2A 5IBUB 3R0MA 2BZDA 5DGRA 1NEZG 3VD3A 3DI3B 1AXTL 1HYSC 3QHTC 4H26B 2GYSA 1G9MC 2DDQH 4Z6AT 3RVVC 4RGNE 2HH0L 4S1RH 3FO1B 3BIKA 3BESR 3TA3A 1JPTL 4TVPD 1YECL 3RIFF 5D5MA 5I74B 4KRNA 2VXSH 4UU9B 4WO4B 3T3PE 3WN5A 1OWRM 5TE7L 3VRJA 2FR4A 2J8UB 2P45B 5T1MA 2BSTB 4MAYA 4LIQL 2DIAA 4YHOH 4EKXA 1RHFA 1U3HA 1U8HA 4PJGA 3RA7H 3ROLB 4QTHA 2Z0BA 4PJXB 4X7EC 4L8BB 4NQTA 5DRXB 3QHZH 4NO3A 2EE2A 1JK8B 2EH8L 5EIVA 1GGYA 3HZYB 4LDEB 3OF6D 4LKXA 3P9LB 1SY6L 4U0RC 4RGND 3WFEH 3WDHA 2NW2B 1MCOH 1UWEL 3VXQA 3TBTB 4XWOC 5DFVC 2D9QB 3AXLB 1JPGB 4UOJA 3QIBB 4XCEA 4CJ0A 4MAUH 3KLAA 1BOGB 3WCYA 5E6IC 2W0LA 1RURH 3STZB 4XP5L 4OZGE 4GRMB 4PP1D 2YD5A 5CMAA 4XZUB 5GGVL 4Z7WE 5FOBA 1H9VA 4M03A 4WI5A 4QRUA 3KPTA 4LRNL 4WU7B 3VG9C 5BVPH 4FABH 1LK3H 3ZTJH 4UIKH 4NZUH 2NTFA 3CDCA 3QJFB 3UX9B 5EOQH 4L8SA 4JB9L 2N7AA 3VRIB 1J1OH 2YEZA 2CDFA 4BSWA 2W9EL 3V4VL 5IR1A 4XXDA 3MOBL 3VXUE 1NCWH 3VGHA 4UTBL 1BZ7A 2MSPA 5EN2B 3PDDA 1YYMH 1U95A 3D87B 3U9PL 1D5BB 2E9WA 3O3BA 4RNRB 1IEHA 3P4NA 5IFAL 3S7GA 3MRJB 4UZGA 5DHVH 2VXVH 3BIAX 3THMH 1TENA 2X2YA 3MUZ1 2W9DL 2X7LA 3W2DH 3GMOB 1W8NA 2VZUA 3RI5K 4M6OL 3O8XC 4U05A 1A7NH 3REVA 1VGKB 1MH5A 3HKFA 3MQIA 4XBEH 4QRQA 4HKZA 5IESH 1YC7A 1F3RB 2FZ3A 1LP9A 1CQKA 4LEXL 3VFVB 2OQJA 4S2SB 4YHLH 3VXUD 1T80A 1YYLL 4F2MB 2FGWL 3SDXA 4ZAKA 2OJZH 2FJFA 4OLWH 4GKOA 2LV4A 4BK5A 1DVFC 3CSBA 5ADPL 3ZYIA 4HV8B 5LBSL 2GQHA 2Y4SA 5FXCH 3TO4A 1S8DB 1LO4L 4X5WB 1ZA3A 2V2XA 3QAZB 4X5XA 5L7XH 4BZ2L 2VB5A 3SDAD 5F1SA 1T2XA 2JK5A 4XWOD 2J8HA 3GGWB 1LE5A 5E6ID 1A2YA 4HX1A 4PJAB 4NRYB 5LXGH 4XNUL 3QXDB 1HHGA 1MUJA 4KTYA 5TQ0H 4QRPB 2CKBL 2SEBA 1S9VB 2D4DA 4XVJL 2QR0B 1BEYH 4ODUB 5I8OH 3H3BC 4YPJA 2RFXA 2I25N 3MRFB 4GG8A 3EFFA 4JLRB 3JV4B 3RZCB 1IC4L 5EO0B 1E4XH 3WJLA 4C83B 3AU1A 1X5XA 4JQXA 5T1KA 4P59H 5A16B 2A74A 4FQCL 4WI2A 4LPUA 5I15H 2YN5A 4Y5VC 4LNRA 4HWNA 3RX7A 1G1CA 1RQ5A 2MPAH 1EAJA 3WEXA 3EIFA 4PRBA 3I6KB 3V95A 4HXBL 5FUOL 1N0XH 1OAQH 4MQ7B 5CEYA 3VXRB 5D1QD 3L5WB 2FEEI 1CGYA 1ZT1B 4NKMB 1A14L 5LAXA 4GAJH 4X6EB 4Z77A 4KJWC 2UY7A 3BW9B 4LLUB 4NKIH 3CVIL 1W0WA 2EZ0C 4XGZB 1A4KA 1H3WM 1YMME 4DKEL 1IGIL 2J7LA 4MA1C 5HI3D 1EO8H 2Q7YB 5CSZB 5FO7B 1UVQA 3D18A 3QG6B 1IC5L 1NBZA 4JPKL 3O0RL 5IVXE 5JXAH 1NDGB 3GHBH 4OZ4A 2HP4A 1LQSR 1XCTA 3GSNH 3ELAT 5IGXH 4OCSL 4QTIH 4M43L 4YFEA 3FOLA 4TSCH 2GCYA 3PL6B 1A6WH 5F1KC 4MQTB 5E8EA 3VD9A 4HIHA 4KK8D 2ZOLA 3TZVD 5EZOL 4ZNCD 4PJFE 1KLFA 4FZEL 1NFIB 5EO9B 1HXMA 3MLSL 1KTDB 1B0RA 1HOCB 1YMMD 5T5FL 2VLRB 2DI9A 1KFAH 5IOPB 3O11B 1T5XA 3S35H 4L4VE 1JGUL 1LNUA 1ZSDA 3JBG7 1UCBL 2CRZA 1UM4L 2BK8A 1L6XA 5IG7A 5F9OL 3VXMB 3PDGA 3UBXI 4M1DL 4BZYA 4NZTH 4KRMB 5AYQA 4YR6B 1MLBA 3O6LH 3ARXA 4P5TC 4I1NB 1JHLL 3Q6FA 4OBSA 4N0RA 1VKXB 5GZOC 4YHPB 3FRUA 1HZHH 2YK1H 1CGUA 1WLHA 4PRAA 3DYPA 3UTSB 3ULUE 1T83A 2WMPA 4L4VD 3HCVA 4E5XA 3MODH 5B22A 4M3KB 3D6GA 5EUKA 1CE1H 1R5VA 4IHOA 2VDPL 4V2BA 1PD6A 1WT5A 5F88A 1S7RA 2D7MA 1IL1B 4Y5YC 3TYFA 2A6IB 3VMOA 4HEME 4ZQKB 4AM0B 3NGBC 5L2KE 5H2BB 1TCMA 4KJYB 3RL2A 4F7PB 3GSQA 3L5JA 3SQOH 3OAYK 3Q48A 2VDQH 5E4EC 4HIIB 2G9HB 3NZHL 3QIWA 4HKJA 1DQQB 3T1WA 1GZQA 4RWYH 1QFWH 4GG6E 3VWKA 4E41B 5ANMB 4L9LA 3SDCA 3ULUD 3QCUL 3FCTA 3D0LB 2XTJC 1CDHA 5D1ZD 3GM0A 3OTTA 3VFWB 2HJKB 1F90L 5TE4H 4XNMA 1R24B 1T7ZA 3JV5A 3G5YA 1R3HA 5DK3A 5L2KD 5EORH 3VDBA 3ARFC 4XC1H 4U2ZA 4G7VL 4F7TA 3ZKNC 3LKQB 3DLQR 3MBEC 5IW6A 1RUPL 5I1LA 3F7YA 5C0BE 1VDGA 2RB8A 3SGDI 3QI9A 1LEKB 1XGPB 4Q6YA 1ZMYA 2N7BA 4PJ8B 3HMXH 4XCYA 5E08L 5I1CL 2VSCA 3O4LB 2WBJB 4KXZI 4U1HA 2YRPA 4CU7A 3WYRA 4RZCB 4PJHF 3O6FC 4AEIL 4YXLH 4XPTL 5DK2B 2LABA 3QPXL 1YNLH 4K94H 1AGEA 4RGOH 4U1JA 3QWOB 5C71A 2GUOA 1LO2L 4JHBA 2WAHA 3FQNB 5MERA 2JELH 1KBGL 4HT1L 4HFWA 4HZAA 4JN1H 4RMRA 1MHEB 4LRIA 1H5BC 1Q9KB 3MREA 4MDIB 2YWYA 5C0BD 4QXGL 3O3DA 1NGQL 1G9NC 1GAFH 2WV3A 4Q7DA 3QHFH 3UMTA 1FGNL 4D8PB 3VW3L 4LSSH 3D85B 2C3WA 4HLZG 4U1KB 4H26A 5KG9A 3BWUC 3DGGA 4OFPA 1T7VA 1LO0L 1SM3H 3Q6GL 4XNZB 1YUHA 2YPLE 5C0RL 4CGTA 4YDJB 3MA9H 4UU9A 3D3VE 3NPSB 5FA4B 4XPAL 4FMKA 2DWDA 2NY6C 2YKLL 5KSUA 4YDIH 4GXUN 2FL5B 3X3GH 5HYQA 5DVLA 4ZFOL 4Q74A 1QFUH 2HWZH 2VZOA 1J88A 1GGIL 5GRWA 2QJDA 3ROLA 4PJXA 4L8BA 4YGVA 3K1DA 1FV1A 3QH3B 1JK8A 5TPWL 3O2VL 5DC9B 3U0PB 5I30H 1C1EL 2VLJB 3HZYA 2ZUUA 3MACL 5DURD 4JFXB 2NW2A 4X6DA 1HKLH 3QZWG 3TBTA 3EJYD 2D7TH 2Y7QA 3ARGC 2YPLD 4KJQD 1JPGA 4G6FD 5IT2H 3QIBA 4LKCB 1AGFA 3D3VD 5TGBB 4DFIA 5IROC 4Y88A 4WEBH 3UC0L 3DV4B 3ARFD 2ICWJ 4GRMA 3V79C 4PP2A 3K81A 4QRSB 2F53B 4M1CD 4A6YA 3ZKND 1DBKL 4K3DL 4M7LL 5JHDA 3IXAA 2BNRE 3T09A 1RZ7L 4JFQA 4L9DA 3HE7B 5DQDL 4LSPH 1UA6L 3TH3T 1UJ3C 4WW2B 3SCMD 2BFVH 2KQMA 2F5AH 1NGWA 5DJXA 4U1IB 5IVZB 3UO1L 3VRIA 4NN6C 4LCWA 3F5WB 1W0VB 4Q2ZA 3BN3B 2D0GA 1YZZA 2P46B 2XKSA 4R0LA 1U8PB 3Q0HA 2OP4H 5IB4B 3BXNA 5EN2A 3ZYOA 1XR8A 2E7LC 1MJ8L 1D5BA 3VFNB 3BD3A 5BXFB 2O5ZL 4HPYL 4RNRA 5DJCB 4DUWA 1AP2A 4XPFL 4Z7VE 3BPLC 4GOSA 2BNRD 4PRIE 3DETC 3MRJA 5L2JB 1ZAGA 5GJTH 1T0MB 3WKMH 1LEIB 1SEBB 3LQAH 3BOVA 5JQHC 1JNHA 5I1GL 2F58H 4M62H 1VGKA 3L1OL 3OAUH 2DQDL 3FFDA 4UV7L 1J10A 2Z4QA 3VFVA 2ZCHL 3LS5H 5EOTA 4F2MA 3DRTB 2NY6D 3SE4A 4D3CH 5IV2A 4JAMB 5TDPB 5EUOA 3L3GB 4M7LT 5IK3B 4XCCL 3AREB 3O9WD 3P4LA 4DGVH 5I2IA 3LHPL 4PRID 5IMMB 2J6EA 1MIEL 3G04B 5I1KL 3BWAA 4N90E 5CBAB 3KPMA 2GJ6A 4HV8A 4XAKE 5E2WH 1LD9B 4HS8H 4U0QB 3R0NA 4ODVH 3TCXA 1FG2B 2DB8A 1NGPH 3BPCA 4QNPE 1P84K 1S8DA 4X5WA 1KXVC 1FE8H 1YEIL 1JV5B 3T0AA 3TGXA 4RFNC 3NA4A 3IT8D 1P7QB 2QQLL 5CILH 3O81A 3JTSB 2N1KA 4H0HB 5DD6B 5I6XC 1NEUA 4MX7A 1EMTL 3TNMB 1ZVYA 4PJAA 1YEEH 3QXDA 4FQJL 4NWUL 4P2OB 5J06A 4DAGH 3LKOA 3RWDA 4NQEB 1OL0A 4LFHD 3UROR 2DQEH 1S9VA 4MJ6B 4MS8C 5KSBB 4JPWH 4JO4L 4G9FB 5IB2A 4N90D 3BN9C 4XAKD 3WO3B 4KPHH 3MRFA 1C08A 4GLRH 1PQZA 1T04B 4I48B 4JLRA 4DKDC 1U0QA 1F00I 1NCDL 3QQ3A 1NGZB 4NHUB 5A16A 5T33H 3CLFL 3GRWL 2R4SH 3W9DB 4PJDA 4J6RH 5FYJE 5I1AB 4MQ7A 2V7NB 3L5WA 3C5ZB 3HS0A 2X41A 4P57B 4X6EA 1F3DJ 4LLUA 2VZVA 3BW9A 5C2BL 3GIVA 4HWZA 5D7KD 3UPAA 3OKEB 1C5BL 5FO7A 4DKFL 3DETD 3CMGA 3H9HB 1JJUA 3OKOA 5DLMH 1NDGA 3FQRB 5E03A 1JZ4A 1NMCC 1IM3A 2ITDB 2D7PA 3OQ3B 5HVHB 5I1EH 3D39E 3LMJL 2W0FA 2R56L 4JPVL 3G5VB 1IGYA 1DBBL 5FYJD 3PL6A 4M7KL 3NTCH 1A6AB 3HMWH 3RUGA 2VDNL 4F15C 1NC4B 4P2QE 1NFIA 3QXAB 2WUBL 4ZMAT 1KTDA 3C8KA 3T4YB 2X6MA 3RWEB 1TTGA 2BNQE 2HKFH 1U8JB 4B7IA 2VISB 4OGYL 3B9EA 2IALA 5KVFH 5EFIB 3RHWK 1I8KB 4IIQC 4ZFZA 2NYYC 3IFNH 3RQ3A 5IHZB 2EIDA 4LLYA 5E2VH 3VXMA 1RV6X 5JQ6H 3D39D 2CUHA 1JI2A 1U8IB 3ARBC 4PGBB 4BA8A 4UDUA 5A2KH 4YR6A 2FECI 2AK4E 4LIQE 3RGVB 5BMFH 4P2QD 4CVWA 2FECL 3BP6B 3ZE1F 3GUTA 3T0EB 5D8JL 1GYAA 1VKXA 4YHPA 2EDDA 5DMYA 2BNQD 3CFJB 3MV8B 1A22B 1KCVL 1CBVH 3V7AG 5EBWB 3UTSA 4NO5B 5I18L 1MIMH 2FHFA 3FB8B 2IPUK 1RUKH 1Y6MR 3BN9D 4OLZL 4HWEL 3EYFB 1H0DB 4L4TE 3FN3A 1F8TH 1NKOA 2FATL 4OCMC 4PIRF 2R0KL 1IL1A 2A6IA 4UMGA 3OXRA 4ZQKA 4AM0A 3DUHA 1WEJL 4Y4HB 4CDGC 1NLDL 1YEFL 4KJYA 3MV7A 5ADOL 4JQVC 2I07B 2X4NB 1HHKB 1NMAL 2E6QA 2AK4D 3T8XB 4G3YH 3VGEA 4XCFL 3GSUB 3OAZK 4POYA 4OFVA 4HIIA 1BAFH 2G9HA 4XB8A 3RIAK 3VG0L 3UYOD 1DQQA 4KUZH 1AR2A 3BPNB 4KAQH 3EYUL 1CLZL 1QSFA 3N9GH 4P3CH 3PWLB 3DSFL 5TFSH 1LO5A 4K3JH 4M3JA 5F7LB 4XVSH 1OTUC 3VFWA 4L4TD 1V8HA 4P23C 3QUMH 1R24A 3VGBA 3OG6B 4Q97A 1F3DH 2NY3D 5IKCB 1NCBH 1D6VH 2OYPA 1KG0A 4GJTB 3MROB 1A5FH 4H25A 4QHNB 4DUXA 2A73B 3DROB 3OAYH 1MCSA 1DE4B 5E5MB 3U4BH 4Z5RB 4DWHA 4NJAH 4AIZB 4EDWH 1UM6L 3B6SB 4LCIL 1U93B 2R23B 1SJHB 2H1PL 2J8OA 5F70A 1LEKA 2KQNA 4PJ8A 1D5IL 1T22B 4Y19B 2WBJA 1P4IH 4RZCA 2DLFL 3HRZB 3ES6A 5D93C 1CFBA 1BQHG 4O5LH 2FNBA 2DQIL 3RBSA 1RJCA 2DQTL 1G6RL 1D9KB 2NW3B 1ED3B 1OTSC 2AQ1A 4LPCA 4Y4FA 1AHWB 3BH8B 3L3HB 1A4JB 4J12A 1MHEA 4GXVL 2J12B 4FG6C 1RZJL 5INDB 4MDIA 5BO1H 4U6HB 4HDIB 3BE1H 5ESQB 5SWSB 5H8DA 4MJIB 1U8LB 4D8PA 1YJDC 3RY6C 3VFUB 4WUUE 1WIUA 4LQFL 4XP1H 5GXBB 3LEVH 5HHOB 3V6FB 1R3JB 5F1OB 4GRWF 3CXDH 5FA4A 4RSVA 4MJ2A 1A6UH 4N0CD 3JV0A 1I75A 4YHIB 1H8NA 3BYTA 1JF1B 3V0VA 5J7CC 3QUZC 3WIHH 4EQ3A 3DNKA 1SVZA 2FX8H 1SYVA 4XCNB 4XTRC 3WKNA 2V5RA 3GNMH 5F97E 4ZOBA 3U0PA 4IRSB 5E8NA 4OTXH 4YDKL 4WUUD 3RDTD 3BHBB 4AL8H 3LSOA 4L29B 1DN0B 3P40A 1OTUD 5KBNC 3EJJX 1X5ZA 1P84J 4OCRH 4ZTPH 3HN3A 5TGBA 2AKRB 2VZTA 4NHCH 1CLYL 5DJZA 1UWGH 3TBYA 3CLEL 4F80A 3DV4A 1MVUA 2WK2A 1D5XB 3EYSL 2F53A 3PP4H 4N9OB 4G6MH 4KRPB 5DK0B 5A43C 1M6OA 1GVIA 1GGBH 2IBZX 3NZ8A 4B50A 3FO0H 2R0ZH 5JUEL 4WW2A 2Q7NA 2OZ4L 1WAAA 3RKPA 3HUJE 4KHTH 4U1IA 2AV7B 2YZ8A 4PGZA 5IVZA 4PB9L 4K23L 5C3TA 2VAAB 4B53A 3QEGL 2A77H 1BM3H 1BBDH 4WWKD 3ESVF 3F5WA 2H32H 2P24B 3P4MB 3V6BR 4JM4L 5EC2A 1U91B 4Y8AA 4WGWB 2IANB 4QOKE 5FYJU 1U8PA 1I9IL 3IETB 3U46B 2DWEA 3JVGA 4O2CB 4NO0A 1UADC 1GHFH 2C4XA 4PJ9B 1BJ1H 4YUEL 2IG2H 3VFNA 2VKWA 2OR9H 5DJCA 3RL1A 4PRPA 4W81A 1QO3B 4TPRH 5BW7C 2FIRT 3A67L 1IAOB 4FA8A 1VEPA 2A9NL 2BDNH 5DVNA 2D31B 2NY5C 3GKWH 4AMKH 4NFDA 1LEIA 2G75A 1PZ5B 1Q0YH 3G6JA 4OZIE 3RKDC 1T20A 1FL6A 3WIFA 2VITB 5IIEA 3EO9H 2C5DC 4IOFD 4XNXH 3D25B 4QOKD 1AR1C 3C6LC 3U4EA 3KR3H 4BQBA 1WBYA 4TUOB 4D94A 2XA8L 3DRTA 4KHXL 5TDPA 4CW1B 3HZKB 3L3GA 4KKLC 2NX5B 3AREA 3L5XH 4R97C 1QEWA 2P8MB 1QBLH 1PDKA 3G04A 5CBAA 1LD9A 1GGUA 4Z7UE 1FG2A 1LMKA 3ZSSA 2C4FT 5IF0B 1JRHH 1OB1B 1YQ2A 2WQ8A 5D5MF 5F1IB 3VRLF 4Q6IB 4KZDH 1FYHB 2DD8H 5J89A 1RU9L 4NJ9L 4OIBA 3S34H 1QSZA 3WFDH 3ZDYE 4M93C 3JTSA 5DD6A 4HGWB 3NCJH 3UDWA 2ORBL 2UZYB 5AYUH 2EDKA 1AE6H 4P2OA 3KPNB 4AYFA 2GY7B 2GK0B 4NQSB 4LLWB 4NQEA 1Y6NR 4DUVA 1GPOL 3B2VL 4Y4KC 1FPTL 3QEQD 4G9FA 2XQBL 5EWIL 5IUSA 4NN7B 4KTDH 2GFBB 4I48A 2DLEA 1WZMA 3X11B 1MRCL 1ZLSL 4P48A 4LHUD 4M6MH 1QRKA 2VN4A 1P4LA 4FTVA 1S5HB 1SVCP 3SDDA 4KROB 2IF7A 3HZMB 5I1AA 3OGOE 1KCSH 3FTGA 4ERSL 1I4FB 1BREA 1R5IB 2BX5A 2R8SH 3RBGA 4UOW1 4PLNC 3EYQC 2AEPL 4RFOL 3OKEA 3MRQB 4YNYB 3EZ8A 5E9DE 2VRAA 3GSNA 2OL3B 4X6CB 1I3UA 4FXGA 4PJBB 1NGXA 3FQRA 1ZHLB 3B8YA 2C9AA 3RJQB 4LVHC 3HG1A 2ITDA 3LAFA 3AUVA 4PY8J 1FIGL 4RGNB 2R1YB 5SV3A 2GT9A 1DANU 3GMQB 5F9AC 4TTGA 1XF3B 3G5VA 4OI9A 1NCCH 3QWRD 3NMEA 4PGEB 1NC4A 4TOYL 1MJ7H 1UZ6E 1BVLB 3CZJA 3FJTA 3QXAA 3NH7H 4YHZL 5FHAL 1J1XH 1ZT7A 3RY4A 4AENA 1GH7A 4LBEA 3ULVC 4UAOB 3T4YA 35C8H 5IEKB 3RWEA 2UZXB 5CJ5A 5CEZL 3MBXL 4NQVB 4HUNB 3LD8B 5EFIA 3PIQB 1WV7T 1MHHA 3L5IA 1LILA 2ZJSL 4OGAC 5GSRB 4ZNEE 2HT2C 4M00A 2Q6WB 3LRHA 3CMOH 3W81A 1FDLL 2V2TA 3LKSA 3V0WL 4DCQA 1QKZL 3T0VA 1U8IA 4GUPB 4PGBA 3SDXF 4XPGH 4X98A 2WBWB 3RGVA 4P4RB 1OM3H 5F96H 1M4KA 5EOCJ 1ORSA 2Q8BL 4OZGB 5FYKH 3H3KA 1YY8B 2AJSH 2DBJA 5CINL 4Z7WB 5BV7C 4JFYB 3D69B 5LGHL 4XHQA 3CFJA 4FQIH 3MV8A 1J05A 1RZ8B 4POZC 4NO5A 4IJ3C 1TQBC 4HC1L 5MENA 4Y4KD 2H6PB 5GISL 4EVNB 1T21B 5GGSY 2P8PA 2WW8A 2XFXB 3EYFA 1H0DA 3GBNH 5J13C 3P0YL 5I1JH 4P4KD 2HT4C 2HRLA 5M95B 4NUJB 4EJ1C 5FYLE 1MVFA 5GRUH 5JDSA 5F7EH 3IDGB 4O4YL 4S0SD 4WW1B 3TA3C 2I07A 2X4NA 5D6CB 2P47B 4DEPC 2WWMC 3ETBF 3SDYL 3MLZH 3VXUB 1QBMH 4ZXBD 4MNQA 4I0PD 4AH2B 4Y2DD 5HHVL 4N0FB 1OP3K 1NSNL 4F8TA 4Z95L 4MCZB 5B39B 3QDAA 2IADB 3SEPA 4KQ4L 1CT8A 4KVNL 4G80A 1MPAH 1U3HC 5CJXC 2WSKA 4FFWC 3HZVB 2N56A 1ZV5A 4WI4A 1FH5L 4FQ2L 1UWXK 2B5IC 1OF2B 5FYLD 3INUL 4I9WE 2XZQH 4LARH 4WY7H 3VD7A 1HQRB 3SDAB 1SJVA 1MF2L 3KDMA 4QHNA 4R4FL 4OIIH 3HMXA 3OAZH 1DE4A 5DQJA 5E5MA 5E6IB 2EDOA 1IEAB 4PLOB 5HGGS 5JPNA 3BZEB 5JA8B 4EZMA 1U93A 3ZYJA 1SJHA 3LS4L 4LCCC 1BZ9A 3HNVH 4Q0XL 3G08A 4AEEA 3VFOB 1T22A 1GGTA 4MDJA 4MLIA 1ZTXH 5E95B 1INQB 4LSUH 1RSFA 3CVHB 1BGXL 2R1XB 4PV8B 2YD1A 2NW3A 4I9WD 1HH6A 4LVNC 1Z6JT 2XG5A 4ELMF 3BZDA 4YH6A 3BH8A 1HHIB 5DD5L 1AIFB 3L3HA 1A4JA 4PJ7F 3MLXH 2ESVA 1N5YH 3PG2A 2R69L 3T0DA 1GIGL 2AW2A 1MRDL 4HUMB 5INDA 4HMDA 5CGTA 5D1QB 2DLTA 4U6HA 3ARZA 2PO6A 2X1QA 1LO3L 4HDIA 5ESQA 1Z3GH 3RNKB 3SGEI 3ZL4H 4MJIA 1NFDF 5D72H 1L9NA 1XGTA 4CVUA 4R4BB 3VFUA 4ZS6C 3U48A 4PJGE 5I66A 1UQSB 3K46A 5HHOA 1N7MH 3V6FA 3TBSB 3CSGA 4XMPH 3B5GA 3BKJH 2HT4D 4C55A 5EOCH 4KTEL 3WIIH 2O5XH 5CIPH 4YHIA 4XH2A 2Z93B 3TZVB 3TBVB 5CJQL 5DXWA 3MRNB 5IVOA 4PBXA 4DGIL 5CFHA 4LSQL 3F6LA 1AC0A 1HIMH 3FQUB 3SE8L 5FYJH 5HVFB 1T03L 5ICYB 4FFYH 2C7UB 1YMMB 1OD9A 4IRSA 4MAYD 4NIKB 3Q1SH 1KB5B 3GMRB 2Q20A 2NY2C 3RTQC 3RVWC 1I9RH 2B4CH 3BP7A 4JQIH 4L29A 4ODXB 3NOIA 4N0YH 1DN0A 5IVXB 3BVNB 4AK1A 4OZHF 1RFDL 3TO4C 2DI7A 5HHPA 5FM4A 1ERNA 2AKRA 2AQ2A 4C56A 1G84A 1KPUB 1R0AL 4I3RH 4XHJC 2PF6A 2Z8WC 4P9HL 4PJFB 5DK0A 4E42B 1UEYA 3KYNA 2CH8A 3HB3D 4O9HL 1AJ7L 1AFVH 2FHCA 3N85H 1JZ6A 1P7KB 3QQ4B 3I84A 1W72L 1H3PH 4YHML 3HC3L 2AV7A 2EIEA 2A0LD 4Z7OF 4L4VB 3OZ9L 2VAAA 5D71L 4ODBD 1AXTH 2P24A 1RJZB 2CLZB 3MNVA 2RQ8A 1J0ZA 3WJLC 3TCLB 4O2CA 4JQXC 3OB0K 1ZWIA 3T2PA 4PJ9A 1NBVL 1PAMA 1JPTH 1YECH 3GSRB 3B9AA 1GZPB 2FGZA 5CGYD 3HLAA 4E0RB 1GC1H 3N1PC 5TE7H 2ITCB 1F4WL 2P43B 4QY8B 1U8QB 2WUCH 1JPFA 4GMTH 2CGRL 3RWFA 4QXUL 4K9EC 5D1ZB 2EH8H 3WUWB 1IGML 5C7XL 4YHNA 2I26N 3O2DA 1I1RA 1SY6H 3D25A 1EAPA 1UWEH 2XXCB 5EBGA 5L2KB 4G6JL 4JZOA 2VXSL 3TP4A 4DQOL 2EICA 1ZEAL 5T1LD 1A6PA 4U6VH 4ONOA 3BFOA 4ZAKD 5GGVH 1HN1A 5CUSL 4Z76B 1FO0B 4F8QA 4BFIB 3VD5A 1WTGT 4MZ2A 1OB1A 2NY2D 4NZJA 4J4PD 1PYWB 3RWHA 3P73B 4U3HA 4Q6IA 3WD5L 1CDIA 4WJ5B 5E2TL 4IOIA 4HGWA 4LVOC 5JW5B 2J8UF 3OPZL 4MAUL 1IZKA 2PTTA 1RURL 1MFDL 8CGTA 2ZCKL 3MOBH 4XX1E 2OBGA 4UTBH 5LQBL 4HGMA 4LLWA 3T04D 4K7PX 3GK8L 3SKUD 3QNZB 4JGMA 1HHJA 5C0BB 4L8DA 3U9PH 2DQUL 3ARWA 5HDQL 2X40A 4APQA 5IFAH 5I17B 2GFBA 5TDNB 1MQ8A 1G7JB 5L9DL 1T83C 2C1OB 1LK2B 3X11A 3BDYL 5BZDB 1OQOA 2GTWA 1J1OL 5K59F 1OVZA 3QCTL 1WT5C 4KKAD 2OTUB 3V6OA 5LWYL 3MLVH 2ED7A 1NCWL 5GSVB 3NGBB 1R5IA 4LEXH 1RIUH 2B0SL 1NJ9B 1YYML 2Y06L 1J5OL 1YYLH 3L3JB 4HJGA 2B1HH 1IGTB 2LQRA 3O6ML 3MRQA 1G7PB 4YNYA 3QIWC 3PGCB 3IDNB 5B3JE 4LMQI 1JYNA 3PWJB 2IQ9L 3VWKC 1JZ3A 4PJBA 4KV5F 3THML 1S7SA 1H3GA 4L9LC 1D5ZA 3SDCC 4DN3L 2IGFL 5DURB 5LBSH 2FX7L 2R1YA 1RZGB 1N8ZA 1RZIA 4MA7L 4U1SB 2FB4L 1Z0NA 1LO4H 2YPLB 4G6FB 1QR4A 5C6PB 4BZ2H 3WMSA 4FMFA 3D3VB 4KUCF 5IBUG 3FB7A 2I9LB 1ONQB 3M07A 5D9SB 1JGVL 2VABB 2V5TA 3ARFB 3MJ7A 4H0IA 2OJZL 4ZTOH 3RGHA 2BRRH 1ZVSB 4PD4K 2MCG1 1T7YA 3MV9A 3QI9C 4NQVA 1DP0A 1TNNA 2CKBH 2NXYC 4JHWL 3SCMB 4XVJH 5GSRA 2Q6WA 1JHTA 4IMLB 5JW4N 1P7HL 3VU2A 1X4XA 3DTXA 1TZIB 3RIFK 4GUPA 4ZSOE 3UZVB 4LP5A 2VDLL 1IC4H 4PG2A 2NY1B 1H3VA 3QEHB 2YD9A 1ZLWK 4UIMA 5DUBB 1NC2A 4MB3A 4OZGA 4HXBH 5FUOH 1KN4L 4JN2B 4LRIC 1KIUA 1H5BB 1A14H 4R7NB 4S11A 1F6AB 2BNRB 1NCNA 5TQ0L 1K4CB 3CVIH 5E1AA 4EVNA 1T21A 4JKKA 4CNIB 2XKNB 2X5PA 5ABDE 5FB8B 4DKEH 1MY5A 4HH8A 1BEYL 1E4XI 3LB6C 4HXAL 5DUML 3IDGA 4X99A 1MWAL 4ZFFA 4UQ3A 1E4XL 4WW1A 2QEJA 3K0WA 5I15L 1XF5B 1IKFL 4PJAF 1BIIA 4JGJA 1EH9A 4OCSH 5I74C 4WO4C 1N0XL 4M43H 1FNLA 3P4OB 3EO0B 4X4XB 1BD2A 4X4ZA 3SKOA 1FYTA 2VDKL 4O2FB 5EZOH 2HN7B 3C8DA 4NSKA 4ZUSB 4FS0A 2IADA 4Z7VB 1SQ2N 5AWNL 3A6BL 3QUMA 3O9WB 1WBZB 3MLSH 4PRIB 2VIRA 1RZFL 5JPMB 4NGHL 1EO8L 3IKCA 2Z91B 5FGCE 2A2QT 5T5FH 3UEZA 3SE9H 1S78D 4PRHE 4OGZA 1R3IL 5E8OB 1TTFA 4R4NC 2GK2A 5F6IB 3QR2A 5IQ9B 5F7KC 3SDCD 1JGUH 4J3WA 5EC1A 3IYLW 1KELL 1P9MC 4K8RD 3SDAA 4DZ8B 5F9OH 2A6JB 4M1DH 1UH3A 3QIBC 1KC5L 4RAHA 2Q3AA 3F58L 4LPXA 4P2YA 1UJTA 1IEAA 4NC2B 4OCNC 4KKBC 4OLUL 1OP3H 1OSZA 3VJ6B 3BZEA 1KT2A 4HIEB 2HFGL 3W9EA 2YD8A 1F6FB 1ZHKA 3GHEH 3MJ8B 1N3NB 5ITBH 5DD0L 2M1KA 1KFAL 1T66D 5IQ7L 4PRHD 1INQA 1UWXH 3ILPB 5E70A 2R1XA 4LF3A 2MJWA 4PV8A 4IS6B 1BMGA 1G7LB 2YUXA 1Q9LB 1WITA 3EO1B 1AGDB 4NZTL 2ADIB 3I75B 5C0AA 3O6LL 2HTKD 3SKJL 1U92B 1T6WA 4OLEA 3EOYG 5I0ZA 2H2PD 3IJYB 4CJ1A 1CFVH 3NZHH 5ELIA 4R4BA 3STLB 5BOPA 4JHZA 3U7YL 1UQSA 1S7QA 4S10A 4TNWF 3MODL 3QCUH 2EYSB 4Q9BA 3FKUS 2FX9L 4UDTB 3WIHA 2VR4A 4OUUB 3WBDA 4JVPA 4NC1C 4X6DE 5DJYA 3EOAB 5DJ2A 4ZD3L 5HGBB 3QIUD 3WHE0 1ZANH 2VXUL 2Z93A 5T5NG 1YPZB 3TZVA 4TTDC 3TBVA 5IWLA 3MRNA 5DFTA 2BMKA 2DOCA 3SQOL 4YBLB 5HGHB 1OAKH 3SE4C 3LDBB 4LLQB 3CDFA 4G7VH 2F74A 5ICYA 2C7UA 5BQ7A 3MOQA 4OKDA 1YMMA 4RWYL 1RUPH 3I9GL 3GMRA 3HPJB 5JHDE 1BQLL 5F7DB 1RAMA 3IDJB 2GJJA 4ODXA 4XBGA 1T1YA 5IVXA 5I1CH 1R6VA 4EBQL 3BP4B 4IRJD 4AEIH 5HI5D 1MHCB 4RDQF 3QAZC 3D39B 4OD1L 3QPXH 4ZYKA 4RFNB 1XR9B 4LCWE 4MB5A 1EIBA 1LO2H 4NM4L 1FLRL 2CR6A 3OKKA 4PJFA 1Z9SA 4P2QB 1KBGH 4HT1H 3K8LA 5JORB 1DLFL 2EIZA 5B4MD 2JB5L 3AC0A 2BNQB 5K9QI 4QXGH 5C09D 4CU6A 1NGQH 4EN3D 5JHDD 3QULB 3KPOB 3O3EA 2AK1H 4L4VA 3KPLB 4JFPB 4HUVA 5DA4A 5IEHB 2EDFA 3RZCC 2CLZA 3IU4H 2NPLX 1LO0H 3TCLA 3Q6GH 2JB6B 4PRNB 3P0VL 3NIDE 5IHUL 1I7ZB 1HEZB 1OWWA 1FNEB 5C0RH 4LCWD 2X4OB 1D5MB 5DMIL 4JKLA 5C86A 4MXWL 2HFFA 3K4DA 2AK4B 1FZOB 4I5BB 4XPAH 3UCRA 1RY7B 4PRDB 2O61A 2EXWC 4DW2L 4QT5B 1CR9L 4YDVB 1FBIL 1F3JB 1S3KL 1CGXA 5EUOE 3QUYD 4QY8A 3QHFL 1U8QA 1X6NA 4IM8A 3P9MB 1CXFA 4YE4L 5D1ZA 5TPWH 1CLOL 3O2VH 3QFJD 2GJ6E 4L4TB 1C1EH 4OIAA 4CAGA 2OSLA 1DJSA 3TO2B 5EULV 4QYOB 3SGKA 5HBBA 1I8MB 2NY3B 3OGCB 5L2KA 2CLRA 3MA9L 4K7FB 4F33B 1RJLB 3BRDA 3PL6C 2APVA 4PLKC 3S97C 1DEDA 3TNNA 1G9MH 1G7QB 3JWNC 3UC0H 1QFUL 3S4SA 4F15B 4EUPH 1MOEA 1HYRC 2UWEE 3KPPA 1K6QL 1M71B 3V8CA 3MCLL 1DBKH 3KLDA 4M7LH 5F7HA 4TULL 1RZ7H 5I30L 2P7TB 4PD4J 1UA6H 2EH7L 2GJ6D 3CFEB 1HKLL 2IPTL 2R0WL 4MQXD 4WJ5A 5HD8C 2D7TL 2YC1B 3PQYE 3UO1H 4TYUA 5I1DA 4GKZB 2I5YL 4PJDE 1CU4L 2X9WA 4WEBL 5DO2D 3UZQA 5I16B 4PJEE 3UJIH 5A2LH 2LVCA 4PJCF 1V3KA 2AJVL 1MJ8H 3HAEB 3SQBA 2O5ZH 3T65B 4HPYH 4ZUVB 3VI3E 3NN8A 2HTLD 4XPFH 2NZIA 4HPOH 5I17A 4LSPL 1G7JA 2XQYG 1GXEA 2C1OA 1LK2A 5JMRA 3IFLH 5I76A 2ADFL 5J3HD 3S3JA 1D6EA 1XF2A 2E27H 5I1GH 2MKLC 3PQYD 3L1OH 5F72S 4PYHA 5HDOA 3VCLB 4KK9D 3W11C 1QLFA 4WNQA 4UV7H 1RJYB 1IZJA 2ERJC 5ITFB 1KSRA 2ZCHH 3BDXA 4ZG1A 3C5JA 3L3JA 3RUGE 1FZJA 2GHWB 1G7PA 4KKNA 4HKBA 4QHMA 4WW2F 2EXWD 3M45A 2XYCA 3PWJA 4HKXA 3D0VB 4XCCH 1INEL 3LHPH 3VGGA 4J3TA 1MIEH 4G6KL 3WHXB 4WUUB 5I1KH 4EIZC 2VUYA 3RDTB 5GS0L 1G0DA 2UYLA 4K2UL 3MLUL 1P1ZB 5EZLB 3OAUL 2YPLA 3E6FB 5MEOB 2Z35B 4OZFH 3OG4B 3D3VA 1QOKA 1SJEB 2I9LA 2QQLH 4NFCA 1ONQA 3CXHK 5D9SA 3HHRB 2CKBB 4YXHL 1EMTH 4WI8A 3S36X 1AY1L 4RX4D 4HZLB 2NMSA 1DUYB 4FQJH 4NWUH 1RK1B 2Z92A 4KJPC 3MUJA 3GJFB 4YZFE 4DGVL 2APXA 2MFNA 4PJ8C 2NLJA 4NQXA 4UNVA 2WBJC 4JO4H 4X4YB 4IMLA 3AROA 1DFBL 5D7IF 1NGPL 4I4WB 2PCPA 1LHZA 2VDRL 3S6CA 1TZIA 4WV1A 5INCA 3V5KA 1CICD 4WWKB 4NFBA 3PWVB 4LSVL 3EDEA 5IHLB 2HJLB 3CLFH 4N8PA 3GRWH 5JXEA 5DUBA 1AO7A 4YX2L 5FO8B 1ZLVK 3KJ6L 1PLGL 1CD1A 2CMRH 3D5OF 3W5MA 3RVTD 3MV7E 4JN2A 1FNAA 3NIFE 4R7NA 1F6AA 2BNRA 2X4QB 5ID0A 4QXWA 4Y16D 5FM8A 5IM7B 4LGPB 1QR1A 2DQEL 5K9OA 4CNIA 2XKNA 2BVQB 5ACMA 1QSFE 4DKFH 4G8IA 2R0LL 3JWOC 3HUJB 4JDTH 4JO3H 4C4KO 3MV01 3ZTJG 4HQQH 2ICWI 1IC7L 3WS3B 3VI4F 5BRZE 3DX6B 1H15A 4XNZC 3NIGF 1XF5A 3U2SB 2R4SL 3C09B 1ZLWH 1EGJL 1PSKL 1DTUA 5IMOA 4QOKB 1FNHA 1BVKB 2NR6D 3NPSC 3LMJH 3MUY1 2R56H 4JPVH 3P4OA 1DBBH 4X4XA 2CIIA 4M7KH 5H35B 2KKQA 3MV7D 5KSBF 1DEEB 1URLA 2YD2A 2D0FA 3MLYL 3B43A 4Z7VA 4CMHB 2V7HA 2E6PA 3PNWA 2WUBH 2EXYC 4KKCC 1FNFA 1Y18A 3DARA 4FQQA 2XZAH 4H20L 3NA9L 1QSFD 1KJ2L 4MD4B 5E8OA 5IQ9A 3S5LB 3UBXB 2OJEB 4RA3A 5BRZD 3I3BA 4OZIB 5MEPB 1VADA 4J8RB 5CGMA 3DWTA 1P6AB 5GS2H 3BH9B 2D9CA 4Z0BH 4CDHA 2JJWA 4FOMA 4Y5XB 3NTCL 4PTUA 1KLGB 5A3IC 3HMWL 3VJ6A 4D9RE 2WIIA 1CFNB 2AS5M 5ETUA 5A2JH 3GB7B 1FL5B 3PHQB 3VFPB 4HUKB 2ZUTA 3QEQB 2VERN 3MJ8A 1N3NA 3DMMA 3HE7C 2A1WL 1J0HA 1CGVA 4Z7UB 2EECA 1KCVH 4WW2C 3QEUB 1Y0LB 2FEDD 2YA2A 4OLZH 1G7LA 3PV6B 4HWEH 4LHUB 3QO1B 5LGJA 5JQ6L 4QCIB 4XP9L 2AXGB 3I75A 4LEOA 2FATH 2R0KH 4LQ1A 5KSAD 5EU4B 4U2YA 4F7MB 4H5SB 4NCC2 3RWJB 3JVGC 4D0DB 1YEFH 3OXSA 4Y4FD 4Z7QF 4D9RD 5ADOH 3H6JA 1NMAH 5ICXB 1I85A 4S1DD 3G6AB 1XF1A 5LGKA 4M1GL 4XCFH 5DRZA 2BSRA 1G1YA 3VG0H 1T0PB 2ZSWA 4RIRB 2AV1B 3EYUH 4WTXA 4RQQB 5D7JA 2AJZB 3KGRA 2ICES 5CIPA 1LEGB 1MIML 4WHDA 3DSFH 3U36B 3OKDA 1BJ8A 4WFHE 2FJGB 5IJKA 2XPGB 4FNLH 1HSAB 5EU5B 5HGBA 4JANA 1IGFH 3MLWL 1YPZA 1NAMH 3C6SB 3KYMA 4ZOAA 5KVGL 1G7HB 2X89D 1BF2A 1XAUA 5TF1H 2CJUL 4G3YL 1EZVY 5HGHA 1TDQA 1CCZA 4LOUD 4LLQA 3FHQA 4QWWD 2Y9RT 2F53E 4JZNA 3AREC 4KAQL 1UM6H 4LCIH 3P9WB 5E8PA 1C16B 2H1PH 2WP3T 3NCMA 5F7DA 3IDJA 1T1WB 5F3HA 5JIKA 1D5IH 1EEYA 1ZHNB 1JF6A 2B1AL 1WAAE 2DLFH 1RUAL 2NY4D 3QUML 2BSSB 1V3MA 3D39A 5A40E 4JCLA 3DVNB 1LWRA 1T1ZB 2DQIH 1IKNA 3CDGB 2DQTH 3QDGA 5GPRA 1G6RH 1XR9A 1NQBA 1NCTA 5DHYB 4NPYA 5JW4Q 4ISVB 3GMMA 4M93B 4R90H 2W0PA 3UDWC 1QHOA 3CUPB 2QTEA 4BUGA 1K5NB 4GXVH 4NJAL 4P2OC 3RPKA 1RZJH 4LMQE 2CUMA 1HWHB 4PRPE 3N0PB 1BHGA 1KIQB 2BNUB 3QULA 2ATKA 3KPOA 3SO5A 1JWMA 3G5XB 1P4IL 4R6UA 2APTA 1FORL 2GEEA 3TT3L 2DQJL 4TNVK 1HNGA 5IEHA 4P4KB 1KULA 2EEAA 2JB6A 4PTTB 3G6JE 4QHLB 5FK9B 1D5MA 1JGLL 1QBAA 1IVLA 1FZOA 2CLVB 4NBYB 3MA7A 1BBJA 1L0YA 1FVEA 4ZXBB 2YUWA 3C5ZC 4H1LB 2BCKB 3GSWA 4I0PB 1EXUB 4Y2DB 5HDBF 1ZE3C 4NO0D 4BK4A 4JJ5B 1F3JA 4OFIA 4OJFH 4ZUWB 3JTTB 1TCRB 4PRPD 4JFOB 2IEPA 3UPCA 1KJMB 1SY6A 3MCG1 4R2GD 5GZNC 1MEXL 4JDVB 4P49A 3GO1L 1V7ML 3SOBH 5EZIL 2DJUA 4L4TA 5DDHA 3BO8B 4YDKH 4OCXL 3L6FB 3TO2A 2FYYB 1J12A 1I8MA 5HVHC 3OGCA 4EUPB 5E6ZA 3HI1B 4K7FA 3CXDL 5E6YA 4F33A 1RJLA 2JJTA 5CKGA 1A6UL 2VQ1B 1G7QA 1CLYH 5CHNA 3PWUB 5F1NB 3CLEH 3AS2A 1OW0A 3O41B 1CDJA 3EYSH 4CADA 1TVBA 2FX8L 2FBJL 5DRWB 3WL9B 4FQPA 2DL9A 2P7TA 4G9FE 5JUEH 1MJUL 2OZ4H 3OKYA 1RVFH 1EBPA 4LNVA 2YC1A 4M7JL 4PB9H 4K23H 3QEGH 1YQVL 1KUMA 4CVZA 4F9LA 4OCRL 4M6AA 4FTVE 4NHCL 4JM4H 5GRZA 2UUDH 5DD1L 4MSWB 3RGVC 3IU3A 1JCKA 1FJ1B 3LN9A 3SKMB 3HAEA 4YUEH 3PWNA 2AP2A 4WVRA 3T65A 3TWCH 1UB6B 3RX8A 3IXTA 5ESVA 2GW5A 4BQCA 3W82A 3A67H 3SBWC 4XWGH 1YNKL 4P46A 2JCCF 4KK5C 3SKNB 4KHTL 1YEDB 4D0CA 5MP6L 2K1MA 1WGOA 4KDWA 3ZE0E 2HKHL 1V7NL 2A77L 4AEFA 1S9YA 1BM3L 3BEWB 1BBDL 3VMNA 3KLHC 4I13B 3QUKB 2ICCA 3VCLA 3HG1E 3K74B 1PGRB 1CIUA 4Y4HC 1RK0A 4FTVD 1RJYA 1DDHB 5ITFA 2BVUA 1GHFL 3DVIA 4P2RE 3S9DB 5FM5O 3SDDD 2IG2L 4G6AC 2XA8H 3WN5B 4TPRL 2BY3A 3LEXA 3BPNC 4LDOB 2FSEB 4ONFL 2FR4B 2BDNL 4FXKA 2PW1B 5T1MB 2WWKT 3AVEA 4MAYB 1MCNA 1L0XA 2IAMD 4OZFB 4WUUA 3GKWL 1U8HB 2XWJB 4PJGB 3RDTA 2AI0H 4TQEL 1XIWD 4MWFB 3U82B 1P1ZA 2FRGP 2DTML 2HLFC 3E6FA 5GGRB 5MEOA 2Z35A 3DSNA 3HG1D 1QBBA 4NQCD 4XNXL 1X7QA 1SJEA 4HFUL 5J9PB 4MVBC 3VXQB 1RU9H 4P2RD 2Y5TB 2CKBA 4XCEB 3BT2H 3OWEA 2Z8SA 4HZLA 1RK1A 4UILH 5DI8B 2VWEC 1F13A 4C54A 5CMAB 3OL2A 2ZPKL 3REWA 1OARL 1Z9LA 3TN0A 4YO0B 3B2VH 1KCUL 4K94C 1FPTH 4JDZA 2XQBH 1JRHI 4KMLB 5EWIH 3BPOB 4X80H 4I4WA 3I6LD 5MENE 3CFCH 1JRHL 4GSDL 3CFDA 5FOJA 4WWKA 2QQQA 1U8MB 5IFHL 1ZLSH 2HJLA 1L9MA 4Q9RH 3S34L 4HMEA 5K33A 3WFDL 4N1HB 3ZYZA 5C0NC 4L8SB 1AHWC 2AXFB 2YEZB 4BSWB 2DQCL 5IR1B 4XXDB 5I75B 4X7CC 3H9ZA 3SO3B 2X4QA 4MNQE 2DJ4A 3MXWH 1W8OA 2BVQA 4HK3J 4MXVF 5C9KA 4MQSB 4NOBA 3TJEL 1OTTC 2NCMA 1FVDB 3HUJA 1E4KA 4OLXH 5MEND 5HY9B 3DX6A 1I7RA 4XVTL 1ZA6A 2V17L 4O58L 2X7LB 3U2SA 4M6ML 4ZO9A 3QWQB 1CK0L 1FIGH 4QOKA 3CU1A 1ZLVH 5H35A 4QRQB 1QACA 2AJUL 2XZZA 4TOYH 5T1LB 2OQJB 5CJ8A 4YHZH 4MNQD 3RNQB 5F6HJ 2FDBP 4ZO6A 4WEMB 4ZAKB 3DRQB 4F9PA 5GS1A 1RZKL 5TQ2L 4Z7NF 4IRSC 2MQ0A 5CEZH 4CN1A 3OV6A 3S5LA 3UBXA 2NY2B 5KANI 2OJEA 1CZ8L 5MEPA 2ZJSH 4J8RA 3BH9A 3A6CH 4Y5XA 3V0WH 1QKZH 1T0NB 1JI1A 3JWOL 1MJ7L 2XKUA 3MR9B 1U6AH 1WWCA 2JK5B 2PYEE 3NH7L 5DJ8B 1CFNA 1BLNA 5C70A 2ESVE 4KRPC 4X6CF 3MRHA 2Q8BH 1FL5A 35C8L 3PHQA 3VFPA 4HX1B 3IKKA 3QEQA 5CINH 5DC0A 1MUJB 4Z7UA 2BJML 4LCYB 2WIMA 3QEUA 2SEBB 5GISH 1Y0LA 5KAQG 5SWQA 3PV6A 3FAXA 3CMOL 3QO1A 3NAAH 2DLHA 3T3PF 4QCIA 1QG3A 4GG8B 3EFFB 2L7JA 1KJ3L 5EU4A 4H5SA 4O4YH 3RWJA 1I7UB 2A6DA 2A74B 5C0ND 4PJ9C 5ICXA 2PYED 3SDYH 3G6AA 4WI6A 5FYKL 2ESVD 2R9HD 5HHVH 5K93A 5CEYB 4U1NA 3LQZA 3MYJA 4Z95H 3BRFA 2PO6D 4FQIL 5LAXB 1J18A 3I85A 1D3CA 2AV1A 2EE9A 4O02H 4RQQA 1A1MB 2AJZA 4KQ4H 1W0WB 2MWCA 5SX5K 1JFQL 1A4KB 1LEGA 5KVMC 4KVNH 5JZ7D 5DVKA 4QRRE 2F9BT 3GBNL 2JE8A 4MXQD 4JM2D 3VE0B 3WV0A 1U8OA 1VHPA 1FH5H 1MCDA 1UVQB 2FJGA 2EO9A 1KPVB 4GAFB 4ODSL 2F15A 1HSAA 4L1HA 3INUH 4OZ4B 3KHQA 1OT2A 3C6SA 4Z7WF 3LVEA 3MLZL 4FZ8L 1I9EA 1MF2H 1QBML 4C56E 1S7TB 4OD3L 4R4FH 3FOLB 2G5BB 2GCYB 4LVEA 4IBLT 5E8EB 3SE3A 4ENEC 4HIHB 4PG9B 2ZOLB 1PY9A 2OS7A 2ID5A 4JPIB 1C16A 2IJ0C 3H9SA 3LS4H 1HXMB 5FCUL 4Q0XH 1T1WA 1QFPA 4C57C 1B0RB 1ZHNA 4LHJB 2YD6A 4TSAL 4UTAL 3M8OL 2BHZA 5HYJE 4QRRD 2BSSA 5H37G 4XRCB 3VFRA 3ECBB 4GS7B 1T1ZA 3MZGB 3ZT7A 4Q6IC 4WY7L 3JZ7A 3CDGA 4AQOA 4HJJL 1IMHC 5JA9A 5DHYA 3DO7B 4PB0H 2QSCL 4OIIL 3EJZC 3LZFH 3P11L 4PR5B 4RCAA 5DD5H 4PREA 3CUPA 4C56D 3E3QC 1IGCL 1K5NA 2LAAA 5FV2A 2R69H 1GIGH 1BVZA 3RAJL 5B8CB 1SYSB 3BJ91 1KIQA 4M02A 1O5DT 4PY8I 2BNUA 3HNVL 3N06B 1P6FA 4G42A 4HD9A 1FNGB 3G5XA 5L0QB 1JTTA 1UM5L 3L3OA 3MLRL 1BZQK 3FRUB 3SGEH 4NN7C 2K7PA 4P4KA 5GS3A 5HYJD 1AGBB 4LSUL 4XPBL 3IF1A 4Z9KB 3HCVB 4ZSOB 4E5XB 4QHLA 4ZFOA 4U1GB 3NFNB 2O93L 2GY5A 5I8CB 5EUKB 5MI0B 1DUZA 2CLVA 4KROC 5IMKB 4KTEH 1MAJA 1K9TA 5F88B 3V6OC 3GSOB 4ZXBA 4I0PA 4H1LA 4ETYA 1EXUA 5C0DA 4ZUWA 4EEEA 1VENA 4DGIH 2J1KA 1Z3GL 4XC3L 4YC2B 1XF4A 5E2JA 3SE8H 2VC2H 5GS0D 1S9KC 4HKJB 5FHBH 1GZQB 1HXYA 2ILLA 2ZG1A 3BIBX 1A9BB 3MRPA 3BO8A 3AAZA 4XNQA 1CDGA 3L6FA 4L9LB 3SDCB 1JYWA 3H8NA 4XMPL 3BKJL 4RGNC 5CCKH 3IDXL 3HR6A 5EOCL 5HHME 4EUPA 3BQUD 3HI1A 5E99L 5EZJA 2DM3A 4GMSH 3TM6A 1RFDH 3KXFD 1R3KB 2BY2A 2O5XL 5CJOL 2OCFD 1NUNB 4NM8L 1EPFA 3G5YB 5F1NA 1OCWL 3DO3A 4UB0L 5I71B 1UEMA 5KTEL 4PP1C 3E3QE 5KW9L 4P9HH 4G8EA 1U3JA 2VTFA 2BSED 4UAOC 4F7TB 2J88L 3WL9A 2MCPH 1VB9A 4O9HH 1AJ7H 1FCGA 5I1LB 2VDOL 5TJWK 4PJ5E 4MZ3A 5FGCB 2NY0C 2VMFA 3LD8C 2B4CL 2MTPA 4PRHB 4LPYA 1KCKA 4YHMH 4LP4A 1YC8A 1K8DB 2YSSA 5B39G 3OZ9H 5D71H 2EYRA 5HHMD 3CSPA 1TQCB 3RWIA 1K8IA 2QSVA 1NUGA 4PG2C 2H8PB 1AGEB 2GUOB 1FJ1A 1NBVH 3DURB 3MRIA 4HFWB 1NEZA 5BJTB 4WWID 4MHHI 2W65A 4HF5L 4PJ5D 2MHAB 3C2AH 5DHXB 4APQD 1OAZL 4IDJL 2VLME 4H8WC 2ZUXA 1Q72H 4PJBE 2CO6B 4ZUUA 2CGRH 3BEWA 4QXUH 3QUKA 2EKSB 5KG9B 2FLBT 1IGMH 2ZKHL 3DGGB 3ORJA 4JHAH 2DBLH 5C7XH 4JVUA 4BSVB 1DDHA 3FONB 1EEUA 3QDME 3IS1X 1IGJB 1YUHB 1F58L 3O3UN 3QIUB 5F8RC 1PJ9A 4KROD 4LLMA 4G6JH 4P9ML 5I1IL 4PY7A 4TN9A 2DWDB 5KSUB 4DQOH 5DVMA 1M7DA 1ZEAH 1X5KA 1GC1L 5HYQB 2UY6A 4J3XA 1NBYA 2FSEA 1PX4A 2I9TA 2PW1A 4OZFA 2E8YA 2RBLA 3RU8H 2XWJA 5CUSH 4DVRH 2WUCL 3MV9E 4GMTL 4YGVB 4MWFA 3UJJL 5J0BA 3ZDXE 2VLMD 1FV1B 3HFML 4JKWA 5GGRA 3AFLA 4IRJB 4MGXA 2E5EA 3O8XA 1C12A 3N1MC 3O3AA 3WD5H 5J9PA 4X6DB 4JRWA 5FKAB 3SDAC 5GRJL 3QDMD 2Y7QB 8FABB 4U33A 5E2TH 4PJHB 2Y5TA 4YAQB 3E2HB 1JIBA 3OPZH 2W9LA 1AGFB 4PJIF 4EOWH 1ORQB 2BHUA 1MFDH 5DI8A 2ZCKH 4U6VL 5LQBH 2YOCA 3TH2T 4PP2B 4NZDA 5EPMA 3GK8H 3OKLA 4FRWA 4YO0A 5C09B 4A6YB 2DQUH 4EN3B 4A2MA 5JHDB 3IXAB 5HDQH 3GRWA 4JFQB 3MV9D 2NY0D 4RMQA 4MYWB 5L9DH 1U8MA 4NYLB 4R9HA 3BDYH 5T3XL 3QQNA 1NGWB 5CZKA 5DJXB 1MAKA 2AXFA 4CBPA 4LCWB 4R8WH 1R5WB 3QCTH 4Q2ZB 2CXGA 3JWDL 4R0LB 5LWYH 4GG6F 5D1QC 3BXNB 2B0SH 1XR8B 1NC2D 2Y06H 1BD2E 1MJJB 1J5OH 3KLSA 1C8PA 1FYTE 5HDLA 1AP2B 3O6MH 3QUYB 3BGFB 5E00B 5HI3C 3TYGL 1FVDA 3TBWA 2IQ9H 4GRWH 3TPKA 5HY9A 3QFJB 1N2RB 2DMCA 1RMFL 4W68A 5DC4B 4DN3H 2IGFH 2KBGA 1RUMH 2FX7H 1JNHB 3LIZH 3BYYA 4MA7H 4LGRB 1AQDA 2FB4H 2APBA 5DZLA 3MLVL 3BZFB 3FFDB 1C7TA 2Z4QB 4KK8C 3R1GL 3TZVC 1RIUL 5T1LA 5LCVL 1CXIA 3S96B 1K4DA 3KS0J 4DN4L 4M61B 5M94B 1JYVA 1JGVH 5EOTB 3RNQA 2EDWA 2B1HL 1BD2D 5IV2B 3DRQA 3ZE2E 1FYTD 5EUOB 3RP1A 2BY0A 1CWVA 3UP1A 3KJ4B 1X5YA 3PWPA 1AC6A 2VR9A 5I2IB 3MRGA 4J3OC 2RAMA 4F37F 4IDLA 2KUTA 4J4PA 4KWUA 4JHWH 2Y6SD 5FUCE 3BWAB 43CAB 3KPMB 2GJ6B 5GJSL 4K7PY 1UCTA 3BPCB 3UTZB 1T0NA 2VDLH 4U3CA 3MR9A 3QPQD 3B83A 1AI1L 5DJ8A 5C0AE 3WUWG 3F7RA 1F11B 4MX7B 3B3IB 1JZ7A 1KN4H 4ZTOL 2BRRL 5HHNA 2UWEB 3I2CH 3LN4B 4GQ9L 3FRPG 3U0TB 4L8CB 1AD9B 3FQTA 4U49A 5E24E 3EFDH 4LCYA 3LKOB 3LKRB 3RWDB 1RIHL 2AAVA 5L8JB 2F8VA 5KS9E 4L3CA 1FAKT 1FLTX 5IB2B 1FRGH 1J11A 3T0WA 4GAGH 1C08B 3TPUB 1PQZB 2YWZA 4JRYE 3PQYB 5DUMH 4HXAH 1MWAH 3QQ3B 1I7UA 1IKFH 2OI9B 3K3QA 2BC4B 3EDKA 4M48L 4PJDB 2AEQH 3B9KD 5C0AD 4PJEB 3WSQL 5AUMB 1N6QL 1E4WL 1Q1JL 5HGAB 4Q9CA 2WM0A 3HS0B 2VDKH 3VDCA 1A1MA 3X3FH 3GIVB 5AWNH 3A6BH 5DSCA 4DJMA 4HWZB 3QFDB 1MFAL 1RZFH 4NGHH 4NQDD 1NUFA 3ULUC 1NAMA 3VE0A 1ZHBB 4LU5L 3TIEB 1KPVA 1R3IH 4UQ2A 1SJXA 5D1ZC 3OKOB 2BXYA 5BV7H 2BXZA 4JRYD 4ZPVA 4MCYB 3ZDZE 4WTWA 5CSGA 5ISZA 1IM3B 1NCAH 2HLAA 1KELH 4Y5YA 4YFLF 1KIPB 4FHBD 2Q8AL 3RX5A 1KEML 1U3ZA 4YEEA 2W0FB 1S7TA 1EFXA 1IGYB 4P5KB 4OCLC 3TV3L 2G5BA 1KC5H 1XCQB 4DFHA 1F4YL 9CGTA 1HI6A 1HHHA 3F58H 4PG9A 1N0LA 4UNTA 4OLUH 1ROWA 3RUGB 4OI7A 1KOAA 4JPIA 3HNTL 1OP9A 4YQXL 2HFGH 5SX5H 1PBYA 3C8KB 3B5HA 3OR7B 1G6RA 3SE9L 1MCPL 3PP3K 2D7OA 1QHPA 5DD0H 2YUZA 1A6ZA 5IQ7H 4XRCA 3ECBA 3EUUA 3N1QC 4GW1A 2IALB 4NNPL 5C0IA 2N4IA 3RFZC 1CICB 4ZFZB 3KS0H 5SX4H 2DICA 4LLYB 3DO7A 1TIUA 1XEDA 1T2QL 4PR5A 3F12A 4YBQD 2WZPD 3C5SB 1FHGA 4TUKH 4UDUB 5JW4R 4U6XA 2IMNA 5B8CA 1SYSA 1I8IB 2DKUA 3SKJH 3MBEA 3GUTB 3WS6C 4Y16B 2AJXL 1FNGA 4M9PA 4X7TA 3LOWA 3GHEL 5CSBA 1YY9D 5ITBL 4LSRL 1CQYA 3S37X 4KFZC 3D2UA 1LE9A 1AGBA 3ARDD 2X44D 3U7YH 5D96B 4WI3A 3O6FA 1AQKL 1PG7X 4ZSOA 1F4HA 3NFNA 1BFVH 5I8CA 3MRCB 4LSDA 4QKXB 2FX9H 5DUPL 5IMKA 1T89C 2W07A 4NT6B 1VFBB 1VFOA 3GSOA 2DRUA 3OXRB 4ZD3H 1TPXC 2AQ3A 2VXUH 3MRKA 3MV7B 5HHXL 2ERJB 4JFZH 1JZ5A 1WQVT 1RULL 5CD3B 5J1TC 2BVOB 3EYOB 3MPCA 3X17A 4D2NA 1CFVL 3TT1H 4MD0B 1A9BA 5GGQL 1EO7A 2DQGL 3I9GH 3VXSA 4FQLL 1QSFB 1BQLH 2CPCA 4X8XA 1DQDL 1LO5B 3QA3B 5BRZB 3EJYC 4EBQH 4S1QL 1E4JA 2FD6L 7FABL 4KJQC 1B88A 1R3KA 5C9JA 3FL7A 1ZANL 2EDYA 4OD1H 4JR9L 1IAII 1M1SA 4NM4H 1FLRH 1OAKL 2P48B 1DBJL 1W72B 1KG0B 1IAIL 3PE9A 4H25B 2OZ4A 2DLIA 5I19L 4M1CC 2EYTA 1DLFH 4OV6F 1MCKA 3K2UH 2JB5H 3FMGL 4LSTL 4M6NL 3IS0X 5DEFA 5M7QA 4PRHA 4HIXL 2ZNWA 3SCMC 5IW1A 1E27B 2H2SD 1K8DA 1FFNB 3TIDB 2AEWA 3ES6B 4WRLA 1B0WA 1OSPL 2OL3L 4NCC1 1CFSA 1VACB 3ARTA 5CWSA 4R26H 2LU4A 1QSEA 2NY1C 2H8PA 3BKCH 5KSAB 5B38B 4NOFA 3P0VH 5IHUH 1GGCL 2APFA 3DURA 4Y4FB 3EHBD 5DMIH 4MXWH 3UPRA 4HUXB 3VFGL 1JNJA 5BJTA 5SV4A 2YZ1A 3X12B 4DW2H 1CR9H 1FBIH 2FCBA 1S3KH 1OAYL 2MHAA 5C08A 2AK1L 4X8JA 5D2LE 2F19H 5I9QB 1FIEA 1D7FA 4YE4H 2EKSA 1CLOH 2HMID 1QTYT 3IU4L 3CX5K 4LFHG 1U8NA 1ZT4B 1HDMB 5IVNA 4BSVA 3CAFA 5KSVB 3FONA 5SWZA 1IGJA 3QIUA 5D6DA 1EBAA 5TF0A 1KYOK 1FFOB 5DVOA 3KPRE 4LAQL 2E7LA 4ZDHB 3VXNB 3S37L 2WANA 3V0VB 4AIXA 4B0MM 3O9WC 1JN6B 1MI5A 3CPLA 5J4MA 1PG7L 1K6QH 3UTTE 3MCLH 1SYVB 4PJCE 4G5ZL 1Q94A 4TULH 5IBTH 3C60A 2ENYA 2W60B 4IRJA 5F6IC 5D7SH 5E8NB 3T4AA 3BDBA 2NY4B 3CC5A 2EH7H 1HKFA 1J0YA 2BVTA 4CKVX 3LSOB 2IPTH 2R0WH 5FKAA 5FYKE 2AGJL 8FABA 4FQXD 4PJHA 4PGJA 4YAQA 1WFNA 1T1XA 3DBXA 3KPRD 4OCWH 4K9EH 1AO7E 1G9ML 1ORQA 2I5YH 5DJZB 1CU4H 4I8DA 3U79A 4BZ1H 3TBYB 2QKIB 2CO7B 1MVUB 4DZBB 2AJVH 3OR6B 2J2ZA 5C09A 4EN3A 4QXTB 4XI5D 3ALPA 4TNWK 1M6OB 3UTTD 2GITB 3NZ8B 2J4WL 4KDTA 2R2HB 3E8UL 1BFTA 4NYLA 1CF8H 1Y6KR 7CGTA 2D2OA 1RHHB 2FO1A 1FP5A 5EIIA 2ADFH 1GL4B 5FYKD 1KN2L 1R5WA 1L7TL 2R4RL 2NY1D 4WEUD 5EC2B 1Z5LB 2LTQB 4N5ED 3RJDA 2V5YA 3UJIL 1CXKA 4P3DB 2DWEB 1AO7D 5JXED 2X4PA 4NO0B 1WWAX 2YHGA 1MJJA 5DHVB 3KWWB 3WFHA 4WHYH 3RL1B 4PRPB 3QUYA 2EC9U 1ZGLB 2V9TA 5E00A 4HPOL 4R2GB 4BKLA 1WFOA 4U1MA 1INEH 1X5GA 3QFJA 4G6KH 1N2RA 3IFLL 3QRFM 4PGDA 1YDPA 2G75B 5GS0H 2XTLA 2E27L 2PXYA 4K2UH 3G6JB 1X4ZA 3MLUH 3QQ9D 1T20B 1FL6B 3BKYH 3WIFB 5GGUA 5IMLB 3BZFA 1LDPH 5D7IE 2KH2B 4LLVB 3CVHL 5EG6C 5IIEB 3S96A 1QFHA 3U4EB 4M61A 4U7KA 1B9ZA 2WQRA 1WBYB 4YBLC 3LDBC 2PW2B 4WFFE 5CBEA 4PLJC 3HR5A 3U9UA 4YXHH 3QXUA 3W39A 5DYOB 1A64A 1AY1H 2HJFA 2Y23A 3D48R 4NBZB 4BSJA 4AEHL 1EA9C 3GM8A 4YHKL 5F44A 1QEWB 3HNSL 3F65A 3GBLA 43CAA 1CFQB 4HHAB 1UXSB 2XQYK 1WBXB 1JWSA 1DFBH 2BVEA 5FCSH 2VDRH 3UTZA 4OQTL 4W4NA 1HH9A 3ARPA 5KN5B 2V9QA 1IKNC 4LSVH 3UAJC 1TJGL 1KCRL 2NZ9D 4YX2H 1EEZA 3KJ6H 1PLGH 25C8H 4HC1A 1F11A 3B3IA 4WFFD 4R7DB 2UWEA 4OFDA 1MREL 3RZWA 3LN4A 1AKJD 3U0TA 4L8CA 1AD9A 3LKRA 5D7KE 1QPPA 2UVEA 3DMMD 4F7CB 4NBXB 1S9WA 4BQ9A 5HVWA 3TPUA 2R0LH 1A7QH 2G2RA 3PQYA 3MRMB 1CXEA 1IC7H 4EI5A 1C7SA 1KB5L 5DEZA 1X44A 5DZNA 4Z78A 2GJZB 1MAMH 4RGMB 4FTVB 1P4LB 2BC4A 1EGJH 1PSKH 3WO4B 2CMRL 4PJEA 3OKNA 3FN0L 5AUMA 3SDDB 1YPZE 3ARSA 3FZUD 3WJJC 3FTGB 5HGAA 1WK0A 4F7EB 1KV3A 5JW3L 3MLYH 1JNNL 4XVUD 2XOTA 1HCFX 4KI5E 5CD5D 3AMKA 5IB3B 3QFDA 3SN6N 2IAMB 1OAUL 2JLLA 1IAMA 1ZHBA 5C8JA 3GSNB 3TIEA 1XIWB 4JDTL 4JO3L 4H20H 3NA9H 5D7JD 3HAEG 4IMKA 1KJ2H 4HQQL 4RWHA 4FXGB 1NGXB 4MCYA 5FUZL 3U4AA 1QD0A 1IQDB 4OT1L 3IDUA 1TVHB 4CRPA 3HG1B 4TNVF 4X6BB 3V4UL 4NQCB 3F7VA 2NY3C 1KIPA 2GT9B 3MRBA 4P5KA 4P2RB 2X1PA 2JJTC 3QDGE 1XCQA 4JQVA 4YDLB 3L3IB 5DEGA 2ZG3A 1X5HA 1FG9C 1TETL 4W6WB 1RIVH 4RX4A 1JGDA 1G0XA 2DM4A 4NUGH 4PLJD 1ZT7B 4KI5D 4N8VB 5CZXD 4AENB 3OR7A 4LBEB 4YEFA 5IJVA 5EU7E 2XZAL 3LCYA 3D9AH 2A1WH 4ZOCA 1MHHB 1EZVX 4B5EA 1CICA 1ZS8B 4P23A 3JXAA 5DFWH 1O7VA 3DX8B 1IQWL 3LRGA 5FEBA 1MRFL 3VA2C 4EI6A 5CP3H 4Z0BL 1HQ4A 3ARUA 2XI9A 2PTUA 2V2TB 3LKSB 4DCQB 4F9LC 4XP9H 3C5SA 4YGAB 3QDGD 3S36H 3UAJD 4X98B 2W38A 2GI7A 4W4OA 1XGQB 1I8IA 5IBLD 1KIRB 4Y16A 1ORSB 3HE6D 4M1GH 3MXVL 5I0DA 2I24N 4OZIF 1T6VN 2XN9E 1J05B 4WFEE 3IFPB 4P46C 5MENB 1O7SA 4OQ1A 4RISH 2P8PB 1B2WL 1FO0L 3MRCA 1LDSA 1GOGA 4NT6A 1VFBA 1HK6A 1F4AA 2E3VA 5JDSB 5J6GA 4J3UA 3CX5J 4JFED 4N0CC 3MLWH 2AEIT 1XT5A 5KVGH 3QISA 5CD3A 4FFVD 2CJUH 3FHAA 1KYOJ 2BVOA 4Z7UF 3UTPE 4MNQB 5FGBA 1NUDA 3EYOA 4L5FL 5ID1B 4FXLA 4MD0A 1E6OL 4Z8FL 4Y1AA 1HILA 2XN9D 3L7FA 1BQSA 1CT8B 2OTPA 4WFED 5KVEL 4G80B 1DQML 3QA3A 3ZDYF 3RDTC 5BRZA 3T2QA 2B1AH 1RUAH 2ZUSA 3MUGB 3DIFB 3K80A 1DR9A 5D1XA 4FNLL 5FYKU 5F8QC 1IGFL 4GRLD 3BMVA 1NAML 2VQTA 2IMMA 1NAKH 4UT9L 5TF1L 3QT2A 1DZBA 1W72A 2J3SA 4KU1A 3KDMB 2XV6B 3VXTA 5DQJB 3UTPD 3ZZ1A 1KF9B 5JPNB 3TVMD 4Y7MA 5FDYA 1PKOA 1F6LL 1BZ9B 4OM1L 3G08B 5HDBE 5ILTH 1E27A 5F89A 4MDJB 1FFNA 3TIDA 5H94B 1FORH 3TT3H 2DQJH 1VACA 4PGCB 4WWKC 3LKNA 4HJ0C 1CD9B 2O5YL 1JNLL 4F57L 5KSAA 3VGDA 5B38A 4JKMA 5BS0D 1HH6B 5JNYB 2RGSA 4R90L 1JGLH 3IDIB 3S5LG 1A6TA 2PYEB 4M9OA 4HUXA 4JRXE 3UBXG 1BJMA 2GTZA 2ESVB 2NNAB 3X12A 4O51B 5HYSB 3CH1A 1S5IL 2PO6B 3CK0L 2Q76A 1MEXH 1XGTB 3GO1H 1E4KC 4JM2B 1V7MH 5E8DH 5KZCD 4P46D 5EZIH 5I66B 1ZT4A 1T7XA 1HDMA 1UZ6F 3BGAA 4OCXH 5KSVA 1VFUA 2WBKA 5DJ6B 3C09C 2AVGA 1U3YA 4IOFC 1FFOA 1QQDB 4XMKL 2X89A 3T3ME 1SEQL 5C07E 3ZHKA 4JRXD 4ZDHA 3VXNA 4LHUG 4XH2B 2ATPB 3L7EB 4CMHC 3W0WA 4OJFL 1OGTA 3GI8H 3DYMA 3WDIA 4MMZC 1JN6A 4F9PC 1AD0A 1FFQA 3OMZA 5FA3A 1II4E 2FBJH 3SOBL 2W60A 4QRRB 3VA6A 4OF7A 1MJUH 4GBXD 3BP7B 2F5BH 4H88H 3B2UC 4CVXA 1G9NL 3MRDA 5C92A 1DL7L 5A2FA 4M7JH 1YQVH 4Y5XC 5HHPB 2HYMA 5C07D 3LV3A 4C56B 3QXTA 5DD1H 2QKIA 2UV3A 2NXZD 1NL0L 4DZBA 2V2WB 1ZKAA 3OR6A 3DUUB 3T2NH 2QQNL 4QXTA 3KYNB 1I3GL 4P2CG 1MFBL 2GITA 2R2HA 2Z8VC 3NCFB 1X5FA 1YNKH 3TN0D 5HYJB 2EDBA 1N4XL 1RVFL 1RHHA 4U3XA 5MP6H 4XP4L 1IEBA 1G7MA 1T5WA 2HKHH 1V7NH 3UTQB 4HJ0D 3S3PA 3MNVB 1Z5LA 2P8LB 3LQMA 3QJHA 4P3DA 3U30B 3ULVF 1ZWIB 3S3SA 1CVRA 3HI5H 5DHVA 3KWWA 2JTDA 3TWCL 4BYHA 5BZWA 1EERB 3MFGB 1G0YR 1ZGLA 1ADQL 3GBMH 3HLAB 1DQJB 4XWGL 4DK6A 4ONFH 3GKZA 5E2UL 4LCUA 3ALWA 5DJDA 2HVKB 4TQEH 1JPFB 3RWFB 2OM5A 3QUXD 4UT6L 3BQUB 2DTMH 2RHEA 5IMLA 4YHNB 4GQPH 3KXFB 4ODHL 5DWUL 3LN5A 4LLVA 5L6YH 2VH5L 4HFUH 1EAPB 1F4XH 4OZHB 4JO1L 1JBJA 4JZOB 1YEHL 2PW2A 2YRZA 1G9EA 6FABH 5DYOA 3SE3C 1A9EB 2B8OT 4MB4A 4ORGB 4ODTL 2FO4B 1WSST 4OSUL 1JGEB 4K3GA 3QEQE 1UKTA 2ZPKH 2CXKA 1OARH 4H1LG 5IB5A 1CFQA 4HHAA 2AI0L 1UXSA 1KCUH 1WBXA 4NP4L 2CR3A 4YBHA 4OF0A 4R96B 1NLBL 3ARQA 4GSDH 3CFBA 4XMLL 4HIJA 5KN5A 5HHMB 3WFBL 3RWHB 2VLLB 4TUJB 2LFGA 3SY0B 3B2UD 1A7RL 5IFHH 2I60L 4JY4B 4IOIB 3SGJA 3BT2L 1JHKL 2DQCH 4IRZL 3WDJA 5D7LA 2PTTB 4R7DA 4KC3B 4HMCA 5A1AA 4UILL 4PJGF 2EDJA 4EUPG 4KK6D 3OJVC 4JFHE 3FO9B 1WC7B 4FQHB 4G8GA 1HHJB 4L8DB 1MWAA 4PJ5B 4F7CA 4ZPTB 4X80L 4APQB 3CFCL 3TJEH 2A9MH 4P4KC 1I1AA 3DX9A 3MRMA 4KMTL 3QRGL 1DQLH 4M8VA 2V17H 4O58H 4XVTH 2GJZA 1MCBA 5T3ZL 4Q9RL 5FGRA 4QGTA 1G6VK 2GTWB 1CK0H 2DM2A 4ZXBC 2PNDA 4I0PC 4F7EA 2RR3A 4Y2DC 2AJUH 3SJVA 5FIEA 3MXWL 4JFHD 2XZCL 4XT1C 5IB3A 4HJGB 3FQWB 1XZ0A 2IAMA 2C3XA 4GT7A 3BSZL 1RZKH 5TQ2H 3H9SE 5J8OA 3PXJA 3UJTL 3VXOB 1XIWA 1YMHA 2X4TB 4M7ZB 4OLXL 2OK0L 1B4RA 4B41A 1S7SB 2HT3D 3CNKA 4HWBL 4KRLB 1D5ZB 1IQDA 1CZ8H 4RAUB 2EDHA 5DR5L 1TVHA 4X6BA 4NQCA 4G43A 4CU8A 3LY6A 1N8ZB 1RZIB 2VXQH 3MRLA 3QDMB 4HBQA 4P2RA 1BPVA 2DM7A 3L3IA 4Y0GA 3BP5A 3JWOH 5EDXA 1HSBB 3QDHA 1Q0XH 5ALBL 2DIJA 3FB7B 2HG5B 2V9RA 5DMGD 3GSVA 3DXAA 3MJ7B 4N8VA 4ZS7H 3JV6B 4OBRA 1BWWA 4RAVB 3TF7C 4M8QB 1YEJL 3F7QA 5CJXA 4NQUA 3H9SD 3MOAL 3FO2B 3MV9B 1TJHH 2BJMH 2NY0B 5JHLL 2KZ1B 4K71B 1ZS8A 5F7NC 2QHRL 1EHLL 3DX8A 1JHTB 1LP9F 4ESKA 3A6CL 4WIQA 3DTXB 4OZFG 2Q87A 3KPSA 4EIGB 1KJ3H 1U6AL 1XGQA 4UIMB 2XWBB 1KIRA 4AG4L 3AMLA 1F42A 1NC2B 3AS1A 4DTGL 4LCCA 1V5JA 4MMXC 3HRPA 1UXWB 1KPRA 5F7UA 3IFPA 5E1AB 1JFQH 1J86A 1FN4B 4ZO7A 4POUB 1Z9MA 3BJLA 1OLZA 3NAAL 5TDOB 4ODSH 3Q2CA 4X99B 4ZFFB 1UKSA 4UQ3B 3SHSA 2D3VA 1NANH 3VWJD 1BX2B 3GI9L 5JIPA 1BIIB 4FZ8H 4YK4B 4OD3H 5ID1A 2HFEA 2Z31D 3WN5C 4DKAA 1BD2B 1B6UA 2H9GB 2ADJB 4I3SH 3SKOB 1FYTB 3IFOB 5E56A 4O02L 4NSKB 3EZJB 5B3NA 3E0GA 3IJHB 4MAYC 3QUMB 3LRSB 5FCUH 4JZJB 2VIRB 1QYGL 4F58L 3IKCB 4UTAH 1IBGL 1N64L 4TSAH 3M8OH 3LEYH 4QHUB 1F45A 3MUGA 1M7XA 3DIFA 3K4AA 1IC1A 1HYSD 4GXUM 2UZIL 5DGQA 1E28A 5EC1B 3ZKQD 3RVVD 5DD3L 3RVUC 3BGMB 4HJJH 6CGTA 3MUHL 4QF1A 2QSCH 3P11H 2YBRA 1JF5A 4Z0XB 1IGCH 3HB3C 4KGLA 1OSZB 2VN7A 1KT2B 2AXHA 5K9KB 4U6YA 2B39A 3RAJH 4CMMB 3L3KA 1DBAL 3W9EB 1UM5H 3BPOC 3RTQA 3MLRH 1ZHKB 3V0AC 2A0LC 4GW4B 5H94A 5HJ3A 4C58B 5DMJB 3QNXA 2ZUWA 4PGCA 5HI4C 1CD8A 4XPBH 1VEOA 4LF3B 5F6HI 2E7HA 2X9YA 3KHOA 2ZZUT 4Q58C 4PB0L 5JNYA 4L8SC 3FFCA 3IDIA 1N59A 2D0HA 2PYEA 3LZFL 5DFVD 1KXQE 5B3JF 4HCRL 2OMBA 2H26B 5C0AB 3B9KB 3WFCH 1OLLA 2NNAA 1DANT 5I75C 4O51A 3IGAB 5CGYC 3SO3C 5HYSA 4L3EA 1WZLA 3E6HA 4XC3H 1HCVA 3AGVA 3RWCB 4NQDB 1A7PL 2IQAA 5KS9B 1Q8MA 4JFDB 4JM2A 4LPTA 1QPXA 2CRMA 3B9DA 1S7QB 1XGRB 1UFUA 4GO6B 5DJ6A 4JRYB 2DLGA 3IDXH 3FQXA 1QQDA 2IBBA 5E99H 3UZEA 3AM8A 2VAJA 3PGDB 3DUSB 5DJYB 5DJ2B 5CJOH 5JOPE 4NM8H 2ATPA 3L7EA 3OHXB 3I50L 1OCWH 2GAZB 2BMKB 4UB0H 4KZEL 5E94B 3ZLQC 2FBOJ 5KTEH 5KW9H 2HA1A 2FEEL 3GMLB 4ZAKC 3ROOA 2VC2L 2F74B 2J88H 5BQ7B 5FHBL 1CN4A 4JEGB 4HBCL 4QRRA 2VDOH 4XX1G 1IM9D 4I18B 4WENB 3VFMA 2P5EE 4LAJH 4X9HA 4J4PC 5T1DL 4XBGB 1T1YB 5CCKL 2R2BB 4GMSL 4OAWA 2EIBA 2ZUVA 3O8XD 3V5HB 1YJDL 3PABB 4ZYKB 3RVUD 4UINL 3CU7A 3PJSA 5JOPD 1P69B 2DMBA 2V2WA 4GKNA 3DUUA 3OKKB 4ELMA 2CIKA 1CL7I 2YRLA 5HXMA 1MCEA 2Y36L 2MCPL 4PJ7A 1CL7L 2EIZB 4UV4L 4DVBB 2HVJB 2HRPL 4HF5H 2H32B 5HYJA 1FVCA 3ARDB 4GAYA 1DVFD 2P5ED 3MNZA 1CGTA 3O3EB 1NFDA 1OAZH 4IDJH 3KYOA 2CQVA 5J1AB 3UTQA 2G60L 4HUVB 3G9AB 4KDVA 5HI4D 1ZGLM 5C0EA 3V52L 5EB9A 4JO2L 2ZKHH 4KKAC 4WI9A 2P8LA 4WUKH 5KVDH 3BX7C 4GW5A 2PYFB 1F58H 3DPBA 3WNLA 4NNYB 2ZUQB 5DA0B 2HFFB 4P9MH 5I1IH 43C9A 1AXIB 5CZVH 3R8BB 1DQJA 2O61B 3WNPA 2DJSA 2OXHA 4PJIE 3C2AL 2L0DA 2FWOA 1S7WA 3PWPE 1BFSA 2HVKA 1Q72L 2EO1A 3UJJH 1QLRB 5L88L 3KG5A 3BQUA 3HFMH 4BH7B 1WIPA 4NKDB 2E8ZA 4JHAL 5MEQB 2DBLL 3KXFA 1J8KA 2OSLB 4OLVH 3MRRA 2ZSVB 4BJLA 1QRNA 4V1DE 4RMUA 1IFHH 1G7IB 4OZHA 5GRJH 4WDIB 2CLRB 1AXSA 3IJSA 1U58B 1A9EA 4N0UA 4ORGA 5I8EA 3TNNB 4JY5L 2FO4A 3EOTL 3S4SB 1JGEA 1B0GA 5DQ9A 4KJWD 3RU8L 1KLUB 2EZ0D 3KPPB 2VR5A 4DVRL 1XGUB 3TEUA 2B2XH 5GS2D 3PWPD 2F54E 4R96A 5E1HB 2EDXA 2IC2A 4NO2A 4GS7C 3CCHB 1VGEL 2VLLA 4TUJA 1MFNA 3SY0A 5JO5B 1RZJC 3MSPA 5T3XH 4MLSA 3MJ9H 2NY5L 4JY4A 2X4RA 4V1DD 5LKNA 3VFTB 3P0GB 1N5AB 4YIQB 1X9QA 2IPKA 3NCYP 5I1DB 1CDYA 2ADGB 5F3BA 1WFTA 4XNYH 4EOWL 3V6ZA 1FZKB 2R2EB 3JWDH 2ICEA 4PJXF 3FO9A 5B8CC 1WC7A 3UTOA 4FQHA 4PJ5A 5L0QC 3FAWA 4ZPTA 2ICWA 3NN8B 4KVCL 1QZ1A 1EGJA 4X6DF 3TYGH 2F54D 2DIBA 4HUUA 2KPNA 3MMEA 5DT1L 3X14B 2P5WE 4N8CL 5I76B 1RMFH 4RMWA 3K8KA 4U1GC 3T08A 5MI0C 2OTWA 2P49B 1D6EB 1FFPB 1XFPA 1XF2B 5ISZE 4R8WL 1Z2KA 1P4BH 2QHLA 1QLFB 3ZKXB 1TPXB 4WNQB 3R1GH 2NY7L 5LCVH 4DN4H 1KJ2A 3C5JB 3FQWA 4YC2C 4P5TD 3NCYS 1FZJB 1MLCB 4NDMB 4HKBB 4QHMB 3H7BB 3VXOA 5GZOD 2X4TA 1WUNT 4HKXB 1S78C 5D2LB 4AIOA 4JKPH 5HGDB 1GCFA 4LL9A 1OAXL