5BQ7B

Crystal structure of chikungunya virus-human fab 5f-10 fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
214
structure length
201
Chain Sequence
VLTQPPSVSGAPGQRVTISCTSSNVHWYQQLPGTAPTLLIYVNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYGSAVFGGGTKLTVLGQPLAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 5F-10-Heavy Chain
publication title Structural Studies of Chikungunya Virus-Like Particles Complexed with Human Antibodies: Neutralization and Cell-to-Cell Transmission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 201
sequence length 214
ec nomenclature
pdb deposition date 2015-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bq7B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bq7B01
5CILH 2Q6WA 4U1HB 4PY8J 1MY5A 3CCHB 3N9GH 1YEIH 3QDJB 1IZJA 3SKJH 1QNZL 4UZGA 5HGDA 5ID0B 4H1LB 4MCYA 1T1XB 1AFVH 1CG9A 1FC1A 5FM5M 2X40A 4O5LL 4JN1L 5I8CA 1DP0A 3EYUL 2QQLL 2HG5A 2YMXL 4HV8A 4YDLC 5FECA 5I1KL 3WDHA 2HJLB 4OI9A 2IQ9H 5ACZB 1CFQA 3BPLC 2R4RH 3LV3B 2VDMH 3P4NA 1JF1A 1ACYH 3RA7H 1ZVSA 2KPNA 2AEQL 3LKQA 1GC1C 3RY6A 5CMAB 5BZWB 3K4DA 4IRJD 4MDIA 1A7RH 1MHPL 5F96L 5TH2B 5DJZA 3KNBB 2YWYA 1BGXL 2BVUA 4L8SC 1Y18A 4N8VB 1MIEL 5C0CA 4X98A 5EZJB 2XQBL 5DQDH 1HDMA 3QCVL 3CLEL 1RZ8B 1M71A 5T33L 4S1DD 2EEDA 1TQBB 2BNUB 3G04A 1NCDL 3T8XA 4G6KH 4HK0B 2JIXA 4M5ZH 4JG1H 5GZND 3I85A 1CDIA 3BPCA 4G9FB 1QSFB 1KPUA 2FGWH 2CJUH 3DMMB 1P7HL 4GLRI 3CU7A 3T0AA 1AGBB 3S37X 1GGTA 4AL8L 5DUBB 2IQAA 3TBVB 5I1IL 3SJVE 4HPYL 1N64L 1T1ZA 4HUVB 1NAMA 2VLLB 1B2WH 4P9HC 2GEEA 2ED8A 2NTFA 1UADC 3QUMB 5KSBF 1IC5H 4JN2A 1I3RA 1IL1A 2AJUH 4C56B 2HVJB 4G6JH 1AP2A 4XPAH 4KK5C 3BDYL 3JWDC 5DO2D 3CFDB 3MBEB 2VABA 4Q2ZB 3GBNH 1FZMA 4J4PC 4TUOA 4FNLH 2ED7A 2D2OA 1PX4A 3ALPA 4OUOA 3QQ3B 2VAAA 4A6YB 2ATKB 2CQVA 5A43C 5J8OA 3C9NB 1TNMA 3GMOA 3WFEH 4KXZH 3KPTA 1QLEH 1BD2A 1XGYH 1U95A 4PTUB 5C0BD 1YNTB 1QFUL 2IPKB 3AVEA 5BRZB 4XC3H 1XGTA 3L5XL 3HRPA 4Y8DC 4R4FH 3JTSA 2VDRH 5D7LE 3UBXI 7FABL 4P4KC 2NY5C 3Q3GB 5F3HA 1P9MA 2IGFL 1R0AL 1A9BA 3K2UL 3RAJH 3LRSA 1U8OA 2BNQE 1VKXA 3X13A 2F8OA 3JUZA 2ZOLA 4FQHB 1TENA 4PJCB 1YZZA 3MLXH 4PJEB 4HIHB 4U2ZA 3O3EA 1NBVH 1OP5K 5DD1L 1RAMA 1MFBL 3BPLB 1B4RA 1H3VA 1V7NH 2AABH 4QXTA 4M1GL 3D85B 2XKNA 3WDIA 4J8RA 1AD0B 4RFOL 2R0WL 3PWNB 4N1HB 4TOYL 3O3AB 3HI5H 4ETYA 4L8SB 4K9EL 3CVHB 4OZGA 1G9NH 1A7QL 1PVHA 5D7KE 3TH4T 3EYVA 1VFMA 1FYTD 4LLQA 4LSVH 4XNUL 1QBMH 4ZNEE 3K81A 5KSAD 4QNPE 4MAYC 4G8GE 1A7PH 3MLUH 3O0RL 4AQOA 3TVMC 5IVZB 1TJGL 2W9DH 2A1WH 4P5TA 3V7MA 1FE8L 5DD6A 3V4VH 4HBCH 3T0ED 4TVPH 1KUMA 4HKJB 1P7QB 5GPRA 4WDIA 4MX7A 5CEXB 3NN8A 1QPXA 2OTUA 3ARFD 3UAJD 4YGVA 2BVEA 5C2BH 4OCSL 1P7KA 4R7DB 4PGJA 4AG4H 4DKFH 3EO1A 4M7LL 3W5MA 3EJYC 4O9HL 5TQ0L 1SJHA 3VA6A 1IVLA 1SEQH 1CLZH 3QZWB 1C7TA 2OR9H 3MOAL 3Q6FA 1O7SA 1D5ZA 3G5YB 4Z7WB 5C9KA 3TT3L 1BAFL 2B20A 2WBJC 5DR5L 3VFWB 4DVBA 1G7IB 4LBEA 1IT9L 4YXHL 1RJCA 4WIQA 3HAEB 1ZLSL 2WQRA 3WYRA 4P4KB 4LOUD 1HKFA 1KLFA 1XCTB 2CDEA 3AS2A 3W11D 2X89D 4OFVA 4X9BA 4QRUB 5JMRA 3JV6B 5I0ZA 3MNZB 4NCC1 1HNGA 3R0NA 1S3KL 1IEAB 4EDWH 4H88H 5DF0A 4J3XA 2YD5A 3NOIA 1MRDL 2DDQL 2BP3A 1FQ9C 1T89C 1N59B 1T1YB 5HD8C 2H26A 3U2SB 4M1CD 3C6SA 4R3SB 4WU5A 3BMVA 3VXUD 4FFZH 4NQCB 3CVIH 3PE9A 2HTKC 1BFOB 5E2WL 3FT4A 1DSFL 1F4HA 2QHRL 4HIEA 4JZNA 4QF1B 4PBVC 2GY5A 3KLDA 5F7NC 7CGTA 2FIKB 4PJDF 3N50A 3SDXA 4OI8A 1B4JL 5EOCJ 1OW0C 3RVTC 3OKEA 4JRXB 2X4NB 4EN3A 4K3EH 4MAYB 5T1KB 1GCFA 4R8WH 1JHLH 3HZYA 5C0CE 3BGMB 4G6AD 4QCIB 3LPWA 3TVMB 2X4OA 2X4UA 3X12A 2YUXA 4LF3A 5CZXC 2NY7L 5DGQA 3SQOH 1KLGB 3KJ6H 2XRAH 1AGDA 2D3VA 1VFBB 4XP4L 3W81A 2HKHH 4LSRH 4E41E 3LCYA 3D18A 2NY6D 5FK9A 5ID1B 3Q1SL 4KY1H 4JQIL 3NFNB 1IAMA 4ZPTA 2D4FA 2ZNWA 1ITCA 5IF0A 3DV4A 4YH6A 5HDQL 5DFTA 2C1PA 1FGVH 1IBGL 3G6JE 1OAYH 3RVVC 4Y0GA 4OAWA 1VGEL 3H3PH 4JANB 4MWFA 1JGUL 4QHNA 1WBYA 3QJFA 1BREA 1ZLVH 1YJDH 3L5WB 4KI5D 4F80A 4JFDA 3VU2A 3CSGA 5CWSA 1NJ9B 1JJUA 2WBJB 3MCKB 1L0QA 4IOSD 3VFNB 1A02N 2YOCA 3I6LD 3KYKL 1CFNA 3P30H 3MRRA 2FJFB 1LEKA 2F53A 3KPRD 4ELMA 3K3QA 2EDXA 4MNGB 4WJ5B 4HBQA 5HYJE 3ECBA 1KTRL 3AREA 3DX7B 1UCBL 3WEXB 1XR8B 3GIZL 3ULSB 1T83C 3IFLH 3MRIA 4LLAA 1G1CA 3BDBA 1HINL 3ILPA 5F7LB 5SX5H 3RX8A 2CDGB 1QR1A 3VMOA 5MENA 1EERB 4M7KH 4CJ0A 5KS9F 1RU9L 4YR6B 4FTVA 1OB1B 3HZVB 1G7MB 2HJFB 4PY7A 1QRND 3ALWA 5BVJB 1EAJA 5D2NC 1CE6A 2NNAB 1HOCB 3GSVA 4JY6A 1C5CH 5E24E 4EUPA 4YHOH 4YDKL 1QSED 4FS0A 1PFCA 1NFIA 3W2DL 3FZUC 3IDXH 3LMJL 3B6SA 2DKUA 3LS5H 2APBA 1SM3L 3LN4A 3P73A 1INDL 1WAAF 4LNVA 1U36A 4OBSA 1X4XA 2A6JA 1RZKL 5I71B 1QACA 1NEZB 3IFOA 5EOQH 3RTQA 4AK1A 4M6OH 3QWQB 4U1IB 2ZCLL 2NW3B 4NKMB 5IG7B 3RWEA 4XCFH 2C1OA 5T1MB 5DJCB 4NNYB 4NM4H 3D39E 3PDOA 5D4QA 3T3MF 2CIKA 1HHKA 2JLLA 4LIQE 5H2BA 4OZ4A 3CDGB 1LK2A 5JMOC 1OARH 1WZ1H 3GHBL 3OX8B 1FJ1A 4PJDB 2O61B 1OAXH 5JXAH 3MRDA 2GTZB 1EGJL 1C12A 2FATL 3SDCC 3O81A 4PRIE 5LGJB 1GPOL 5A2FA 5EULV 1F4YL 4HCRA 5I76A 2GJ6D 3WNLA 3QNXB 2BVQB 4EOWH 5LVEA 2ZZUT 3OR6B 2WLYA 2MQ0A 4R7NB 4TSCL 4ZAKD 2DYPA 4M9OA 1F90H 5D7IA 4KVCL 4EZMA 4WFEE 1IMHC 1MNUL 1JNNL 3OKMB 1E4KC 1GGIL 4Z76B 1ZA6A 4BUHA 1FNHA 3KPNA 3MXWL 5F72S 2Y07H 4O51A 3O11B 3H9SA 1M1SA 3ARUA 3EGSB 2QKIB 4PJBA 3FMGL 5J06A 2DJUA 5CIPH 4UT9H 4KK9C 4UIMA 3TO2B 2R4SL 5CKAA 4L1DA 2R1XB 4OD1H 3E6HA 4HWBL 1JPGB 2VDQH 4Z95L 3OG6B 4RFEB 1KEGH 3VJ6B 2VDLH 1HE7A 5HHNA 3UBXG 4MQ7B 25C8L 4KJYB 2OJEA 3QUXD 2ZCKH 2G75B 2ADIB 5BQ7A 3OJVC 1I3GL 3B9EA 1WJ3A 3JVGC 2ZPKH 5JTWA 3BPOC 4ZD3L 1ZE3C 1ZK9A 3DYOA 3PP3H 2BJML 4X4XA 5DMKA 5EU5A 1U41A 5D2NB 4EBQL 1WEJL 4KJPC 4OV5A 2ESVD 3ABZA 5DMIH 4KK6D 3RWFB 5MHSE 3MV8D 3FT3B 1KCLA 2E9WA 5DJ8A 5KSUB 3VXPB 1JZ4A 3HZMB 4IS6B 1LO4H 3O4OC 5EBMB 3QDGD 3R06A 5JQ6L 2B1AH 1BF2A 2Z92B 4PJ7F 5KS9B 1YUHB 5IB5A 5E9DB 1A6VH 4N0FA 4MXWL 4PP2B 1CN4A 1D5BA 4RBPK 4Y5YA 3E3QC 1EEUA 3BISA 1R5IB 4GSDH 1A21A 4JFPB 1WWCA 5IMOA 2DM3A 2G5RA 2X4RB 2C9AA 2Z35A 4NOBA 3PWVA 3SDXE 4BSVA 3AU1B 3STZB 1FFNB 4U6TA 2CLVA 4NO3A 4Y2DC 1M4KA 1B0RA 1FORH 5I1GL 1MJ8H 5ALCL 1QO3A 4HWNA 4OZHF 5HI4C 4KUCD 4LKCA 4P5MB 4OTXL 4D8PB 2B8OT 3SDCB 1MCOH 1HEZB 3QDJD 4WEMB 1E4WH 4JPVL 5F7WC 4UTAH 2FEDD 1FFOB 3QXDB 3HE6C 4XB7A 4YBHA 2OZ4A 4P2YA 3WFZA 5DD3L 2FX9H 5DJ6A 2F58H 5FYJU 1G7QB 3DVIA 3VXQA 4YC2C 4Z7UF 4HDIA 2VE6A 5GS2D 5IQ7L 4U1SA 2XNAB 3PHOB 2BSSB 2CSPA 3NCFB 4HJJL 4TUJB 3IU4L 2UZIH 3C2AH 3WIHA 4F57H 3FQUB 4JPIA 4MNQE 2EYRB 1D5IH 4LHJB 4AT6B 3OR7B 4JFDE 5T1LA 4Z7VE 4CVWA 4Y4HB 4LFHG 1QOKA 1NMBL 2R1WB 4LAQH 4YIQB 4BZ2H 1TJIH 4PTTB 4R0LA 3FFCE 5GGVH 4NT6A 5AG8A 5D7SH 3RL1A 3WXWH 43CAB 2F53E 4JDTH 2NX5B 4MYWB 4R6UA 1RV6X 4RGNC 1CK0H 1PAMA 5C07E 3RWGB 5CINH 1W72B 4G9FD 3GGWB 1QSFD 1Q9LB 1PZUB 4KJQC 3KPLA 2UVEA 3DMMD 4M61A 3RBGA 4XMLL 1U8QA 1MLBB 5BVPL 4FTVE 1CQKA 4JFOB 4GS7B 3O4OB 3U83A 2R0KL 4MJ5B 3EOTH 2CXGA 4RAVB 5ICZB 4MJ2A 1YYLH 1S5IL 4XBEL 4W6WB 4K3HA 2JJTC 1DR9A 4K8RC 3RY5A 4C56D 2FL5A 2V2WA 2ZJSH 3SGEH 2X1XR 5FOBB 1U3YA 3W39A 1ZLWH 3MBED 1KCUL 2N1KA 4JHZA 1U2HA 5JW3L 1JZ6A 5HGAA 5CLTA 43C9B 4POZC 1JK8B 4Y1AB 4Y2DB 2EIZA 2ZG3A 3F7PC 4LPVA 4CN6A 1FNGB 5HGBB 3E1F1 1KENH 1LILA 3REVA 3T0EE 1KCSL 3KPMA 3TPUA 4PJ7B 3VFOA 4P3CL 2RCSH 3U9UA 3GI8L 4ONGH 2OSLA 2YBRB 3HE6B 1G0XA 2FIRT 3TWCH 3T77A 2R1YB 5CP3A 2W65A 2YRZA 2FB4L 2ADFL 5F1NA 2AJSH 2HFGL 4YC2B 4M4PA 4NQSB 3PWJA 2QSQA 4WEBH 2X10A 4JO2L 5LGHL 4CRPA 3NA4A 3D9AL 4MMZC 5F9DC 1JNLH 4YFDB 5DJAA 4NIKB 5BMFH 3B3IB 3D85D 4LGPB 2H32H 1K5NB 3B2VH 5ICXA 3N1FC 4H0IA 3FFDB 1CXKA 1MVFA 3TJEL 3AGVA 2Q76B 5BV7H 1RFDH 1P4IH 1NGYB 4U6YB 5I1AA 3VWJB 4HMEA 4E5XA 2FYYA 3WS6A 3C08H 4JFZH 5CJQH 1MJ7L 4QYOB 1G84A 1B3JA 2UVFA 4GBXB 1ULVA 4Z7UB 5SWZD 1OD9A 1BBDH 4M6AA 4QRRA 4RMWA 5HDOA 3G08A 3A67L 1VEMA 3O9WC 1YQVL 3TA3C 1FDLL 4JFXA 4RGNB 3JWOC 3MNVA 4PJXE 3UO1H 3C5ZB 1QSVA 5I1CL 2P8LA 5CBAB 4X7CC 1TTFA 1O5DT 3KPSE 4JAMA 1EEZB 3CSBA 4F7PA 5E1HB 1P7QD 4H20H 5JHDA 3EYSL 4PUBH 4B5EA 1G7LB 1L0XA 3K74B 3IETB 4P57B 3RNQB 3MUY1 4I5BB 1J5OH 5AZ2H 3IYLW 3SKNB 5C0IB 3G9AB 3QUYC 3QUZC 4DKEL 1BJ1H 1FZOB 3QI9C 1I7UB 4KTDH 4ZSOE 2VLKB 1LO2L 5FF6B 3CFEB 2P8MB 4KK5D 5F1IB 1WSST 2JJSC 4K7PY 2NPLX 3L3JB 4J4PD 4PIRF 5EBLB 3MMEB 1DE4A 3RVXC 4M1DH 2X05A 3ZTJH 1PG7W 3NFPA 4GRLC 4LLVA 1LEGA 1T2QL 2FHCA 4FQXA 4G7VH 4PRAA 1A6UH 4KZDL 5E7FA 3D1MC 2D4DA 4I3SH 5EC2A 5CILL 1ZMYA 4NHUA 5DRNA 4MS8C 4JJ5A 3N9GL 2NY4C 1YEIL 3RKDC 3SKJL 4D9QE 3IDGA 1HHHB 1MAML 4P4KD 5JW5A 3BKCH 3P0YH 5ANME 1AFVL 3EDJA 1HSAB 4JR9L 1RK0A 3V52H 5KOMC 4HUKB 2YPVH 4HULB 3QXVA 4ODTH 5DHVH 1VA9A 3MYZA 4WTZG 2DQFB 2IQ9L 2WBKA 4AY0A 3K4ZA 2R4RL 2E9JA 1X7QB 2VDML 1ACYL 2YD2A 3B9AA 3BZEB 4HKXA 3CC5B 3S4SA 2JB6A 5DHYB 1A7RL 4YNYA 5DA4A 3GSNA 3QEQB 2A6KB 4NQCD 2MHAA 5EIIB 4HS3A 1BVLA 3EDKA 3OKYA 1JTTA 2ARJQ 1UB6B 2ATPB 2X9WA 3I6LE 4YHLH 5EU6B 2ARWA 5CEYA 4HK3N 5DQDL 4HS6A 5E4IA 4D0CA 1I8KB 2FJHA 4LLYA 1MRFH 3MROA 2I9LA 4OF5A 1SYVB 3C8KB 3VE0B 2D7QA 4J23A 2HT4C 4G6KL 2IH3B 4M5ZL 3UTTA 2ARJA 4JG1L 4JRXD 5EC1B 3ULVC 4MAYD 5T1KD 4Z0BL 4IHOB 3VMPA 4NN6C 5DUPH 5DI8B 5EO9A 1BFVH 1I7RB 3TVMD 2FGWL 2R2EB 4Z8FH 4X0KB 5J9PA 3FQWA 4U1JA 4F15C 4J12A 4N90E 4X8JA 5CD5C 2JCCE 4LCCC 3I6KA 3BYTA 3T2NH 3BH8A 1A2YA 3GSWA 3C8HA 5F7UA 4FQLH 1QRNE 4XVUC 1NFDA 4OZGF 2JTDA 3KHOA 1LP9F 3VFRB 1BIIB 5FYJE 2VRAA 2XQYG 1QSZA 3QUZB 3QUYB 4ODWB 5EU4B 1IC5L 2X4PA 3F5WA 3QI9B 1Z9OA 1ZHLA 3WNNA 4G6JL 5TDNA 5ILTH 3MUJA 1YN6B 3L3OA 4ONHB 1KIPA 3GBNL 3EJYD 5GXBB 2CRYA 5IP4A 3SDDC 3SDAC 4ISVA 3WFEL 4HS8H 1TIUA 1QLEL 2GITB 1XGYL 2X4QB 5J1SC 2FHFA 5FOJA 4GRLB 4L3CA 4YHKH 4XC3L 2WBJD 2FX7L 6FABH 3T0BA 1U0QA 4R4FL 5HVGB 2VDRL 5IMMB 4NO5A 4MXVF 1AO7B 1XH3B 3RVWC 2NY4B 4LP4A 3NZ8B 4GXUN 5DJ2A 1S7QB 1S7RB 2MFNA 4XTRC 1IM3B 3QXUA 3RAJL 2DWEA 1WFTA 5ERWB 3O2DA 3S98A 3DTXA 5E2UH 3RZWA 3VFGH 2VXSL 4Z7QF 2ZUUA 1AXTH 4TULL 1M7IA 2DS4A 3RJQB 5E8OA 4WWKC 1MCWW 1V7NL 3U36A 2AABL 3QPQC 1AGCB 5DRZB 3VI3F 4Y4FA 5ECJE 5HD8D 3HRZB 3LQZB 4G8IA 4LKXB 1ZHKB 3ARBA 2VDKH 4EXPX 3EOBA 1IGTB 4GMSH 1RJLB 3RI5K 3B8SA 2FR4A 3IJSA 5DVLA 3C6LA 2HTKD 1G9NL 4HXAL 5F7MC 4TPRH 4PJ9C 1EBPA 4HMDA 2UZYB 3TIDB 2F9BT 3GSUA 4LSVL 1QBML 3G5ZB 1OTUC 3LEYH 5F7EH 1UM4L 3RVTD 3GKWH 2YRLA 2C5DC 4OLUH 4UUJB 3MLUL 4FA8A 5ISZB 1ZTXH 4NN6B 2A1WL 3GZKA 1HKLH 3UYRH 3WE6B 3HI1A 3V4VL 4EVNA 4HBCL 4Y8AA 4TVPL 4RZCA 5CZXD 3NCJH 5C86A 4F15B 2V5MA 1F97A 3U48A 4LCCB 1E28A 2G60H 2BY1A 4IBLT 1JGLH 1UENA 3DJ9A 4LCIL 4U6HA 3HR5B 1JFQH 2Q20A 1D5MA 3IS1X 4F9LA 2ESVE 3OB0K 3U46A 1CYGA 5C2BL 5DQJA 4WUKH 2ENYA 3CH1B 4DKFL 3BP6A 5LWYH 4LVOB 4PJHE 2EDHA 1LNUB 3FB5B 2CRZA 3TBYB 5KAQG 2FBJH 2X9YA 3IKCA 1FBIH 3ZE1E 5T5FH 1PLGL 5I1DA 4J1UB 3RVVD 1FIGL 1N26A 1SEQL 3BP7B 1CLZL 2X4TA 1DQQB 1YQ2A 3SDDB 3PL6C 2MMXA 2OR9L 3SBWC 4ERSH 1A5FH 2HYMA 2KH2B 4OCMC 4S1QL 4MVBC 5A16A 3V0WH 4G43B 3V0VB 4JFQB 1LP9B 5H94A 5DJDA 3TLRA 1I8IB 1Z0NA 4F7CA 3O8XA 5IKCB 1YEKH 3ROLA 4NZJA 1B6DA 3KWWB 2E27H 4QT5A 1OOAA 4K3DH 4OCWH 1FAIH 1H5BC 3CFJB 5D7JA 4U31A 1MI5A 2HLAA 1L4IA 3DARA 1A4KA 5E08H 4EDWL 3MRBB 3QDJE 1S7VB 2R23B 3P11H 2VWEE 1U58A 4X5XA 2CGRH 3MV7B 1QLFB 4WWKB 4UV7H 1ES0A 5C08E 3W0WB 5GJSH 5DFVD 3LEXB 3TIEA 2QSTA 4FFZL 3CVIL 3DSFH 5C6WH 4MCZA 2DWDB 3FZUD 1M6OA 3SCMC 1WQVT 3GSOB 4PJ9B 1DL7H 3CMOH 5C0FB 4NM8H 3E6FB 5EOTA 3ZHLA 4LCWB 3TBTB 5AAWA 4YWGH 2DAVA 5HGHB 1U2CA 4K3EL 3VFTA 4DK3A 4R8WL 1JHLL 5K9JH 4DW2H 1UXSB 4OJFH 4BH7B 4N0UA 5D2LB 3SQOL 3K80A 2XRAL 5B3JE 5B39A 4GKNA 1XZ0A 4JREC 3QXTA 1CDYA 3FQTA 2NQCA 2HKHL 4NQDE 4LSRL 3RUGE 1L7IH 5JPNA 2BK8A 4KY1L 4LSUH 4GW4A 3U7WH 3MRFA 4RGMB 3GIVA 4XP9H 2J4WH 1T5XA 2KKQA 3QFJE 2AS5M 1NCAH 1FGVL 1KF9B 3GKZA 5CIPB 3SDCD 3P9LA 4HC1H 4HK3J 1QA9A 3FOLB 4W4OA 2J8HA 4L4TA 3EO0B 3LEVH 4GKSB 5DK3A 1JRHI 5FUCC 3RWJB 2X1OA 4S0TD 4CNIB 1VB9A 5JOEA 3MV9B 3H3KA 1TPXB 1TVBB 5FYLL 4YO0A 3OHXA 1YJDL 2OTWB 15C8H 1HXMB 4M3JA 4HAGA 3VXNA 5I8OH 4XNQA 3BP4A 3GMPB 3P30L 4RGOH 5JORA 4NRYA 3GBMH 2HTLC 2ZKHL 5IT2L 3KYMB 1K9TA 3MODH 5EUKB 5IEHA 3PHQA 3IFLL 3N0PB 4KK9D 1H5BB 4PJFE 1CDCA 3MV01 3VGHA 3QIUC 2ZCHH 4NQEB 5D7IF 3L3IB 5I2IA 1PKQB 1FN4A 1A6TA 1X9QA 4M7KL 2NX5D 3BIAX 1D6EB 3QRFM 3G6AB 4CVXA 4I8DA 1KOAA 2VL5A 2D9CA 1MWAH 2CLZB 2D0GA 1C5CL 1PYWB 1YPZA 4YHOL 1V8HA 3VXTA 1IM9D 3OKKB 4QHLA 5DQ9A 3O6FA 4PJBF 4KJPD 3IDXL 4IOFC 1L9MA 2EDNA 3LS5L 5FA3A 4XAWL 5DT1L 3SCMB 4L8BA 4KAQH 4MQXC 5IB2B 3VWKC 1CVRA 1H15B 1RSFA 2CK0H 1RUQH 3T4AB 4XX1G 3RPIB 2VN4A 3SE4C 4KC3B 4M6OL 1AIFB 4Q6YA 4LSSL 1YECH 1D9KA 5EZOH 3KYAA 3NIFF 4XCFL 3V5KB 5SWZE 3MTRA 3IXAA 3T4YB 3OSKA 1KULA 4JREB 1B0GA 5I1EH 2OJZH 3OMZA 4MDJA 2EE2A 4WI3A 4Y1AD 4Y2DD 4PRPA 3L3HB 4P4RB 5IM7B 1WZ1L 1Y0LB 1OAXL 1W8NA 1XF1A 5JXAL 1CLOH 1BM3H 1WTGT 4AEIL 2XN9A 4OFKA 5HI4D 4OLWL 2ITCA 5KG9A 1HSBA 5DUMH 2O5YH 4L8CB 4QEGA 3VW3L 3CSPA 4EOWL 1UYWH 1Q9KA 1HYRC 4U7SA 1F00I 1F90L 2YPLE 2NY1C 1RMFH 3HE6D 2LAGB 3TCLA 5JOFB 3UPAA 3QQ4B 4N0CC 5T3ZE 4R4NC 5I16B 3PQYA 2CXKA 5INCB 2LABA 4QGYA 2OL3H 3S3JA 2NCMA 2Y07L 3HPJB 4HLZH 4MJ4A 1BVKB 4PJIB 4RSVA 3P77A 4OFYD 1FFPB 3VXRB 1CLYH 3S34H 3F7YA 3PP4H 3RFZC 3L95B 5LCVL 2P1YA 4UT9L 4NDMA 4X7SL 2EDJA 5DD0L 1M05A 1AD9B 3ZE0E 3TO4B 5EUOE 1KEGL 4JKWA 1KB9J 4PG9A 1JYWA 4FZ8H 3AXLB 1ZGLM 3OB0H 3I9GH 1MH5A 2ZCKL 3VXOA 4PGCA 3VCLB 4YE4L 1RZGB 5IVXA 4X5WB 1QLRB 3TM6A 5BS0E 3B2UC 3H0TA 4RGND 3UDWA 1F2QA 4MD5A 1DLHA 5B8CC 4JHBA 5DMIL 2Q8BL 1QFPA 5L2KE 2VIRA 2J8OA 3UTPE 4KJQD 4UV4H 1NGXB 3MFFA 1ZOXA 3GB7B 1LO4L 2UWEE 2B1AL 2DBJA 4ACPA 3VWKB 4JFFE 2DMKA 4JE4B 4O2CB 2D7NA 5D5MF 1IAOB 1RUML 4KPHH 2QQNL 5F7DB 2VLKD 4GSDL 3TNNB 1MAKA 3SDYH 3FB7A 3DX8A 4C55A 2M1KA 3DUSA 4QXGH 3AY4A 3MRCA 3L9RB 1T1WA 1ODAA 3K46A 5HHQB 3U4EA 4POZD 4XNXL 1NANH 5E00B 1TCRA 1DCLA 1H0DB 4JY4A 4MJIB 1FL5A 2YUWA 32C2A 1MCOL 2P5EE 5BV7B 1E4WL 3PV6B 1I8MB 5IV2B 4UTAL 1MPAH 2KZWA 4ESKA 3RGVC 1A22B 4UDUB 1FIEA 5AYUL 2FX9L 3DO3A 5TE4H 3MO1B 3PJSA 4ONFH 1XGUA 4GXVL 5FUZH 5EIVA 3L7FA 3TT1H 1IGIH 2XWBB 5E70A 1AGEA 1NCUA 5E8NB 1XR9B 5J13C 5FO8A 2JK5B 3V6OC 2X70A 5F6IC 2UZIL 1WGOA 3C2AL 3V95A 1BJ1J 1YDPB 3M17A 1D5IL 4XNMB 4XNZB 4JKPL 3QEQD 1EFXB 2SEBA 2XWJB 1ZA3B 1HQRA 4LAQL 4V2BA 4WW1A 5EU6D 4WHTA 1TJIL 4GFTB 4OFDA 5D7SL 5DD5H 3WXWL 4YPGB 1X6NA 1MQ8A 4JDTL 1BVZA 4I4WA 4KKNA 1HHGB 1ND0B 3HA0A 4P23C 5GGTH 4HQQH 5HI3C 4HD9A 5I1HH 3IDNB 1JHKH 1CK0L 5D1ZC 4Y5VC 3O9WD 3TA3D 4GW1B 3H42H 5FA4A 2APTA 4ZO7A 3WNMA 3CFBB 2K1MA 1X3DA 5DVNA 3V6FB 5B8CB 5GZOC 1IRAY 4Y19B 4ZFGH 2VLJA 2AKRB 3KDMA 3BKMH 3EOTL 1CT8B 3CFKB 1FVCB 4GG8B 4OKVA 3V6BR 5IWLA 1YYLL 1J88A 5EWIH 3QUYD 1IAKB 3QUZD 5L6YH 4FMKA 3QI9D 3MLWH 4JKKA 4JFEA 4ODUA 1KJ3H 3MNWA 2ZJSL 1J0JA 4JRYB 4ALAH 4WTWA 2QQKH 1R24B 3PGCA 4K55A 1IEBB 3IJYA 3Q5YA 4WY7H 3WLWC 4XCYB 1K2DB 3F65A 3DVGB 1ZHBB 4FQIH 2FO4B 3RVXD 2EZ0C 4AIXA 2FX8H 3GMMA 1KENL 3NMEA 4GRLD 4I0CC 3WSQL 3WUWA 2DMCA 5D5MB 4LIQH 5IHZA 2EEBA 5DZLA 1KYOK 3SE9H 3INUL 4JLRA 5EIQA 5INDA 3B43A 2D7MA 1FYTA 5FYKU 1AO7D 5I8EB 4PR5B 4MS8D 2RCSL 3O2VH 2NY4D 1NFKA 3RKDD 4F37K 3QO1A 5DJXB 3TNMB 4WW2F 5HYSG 3ESVF 2WMPA 3CZFB 4XCNB 4ZFOA 3ARDC 2DIBA 3RGVB 1CGUA 2OR8A 4P2OA 2AJSL 3UJJH 3OG4B 3OAUH 4WEBL 5C0DA 4L8DB 3WIIH 2KDGA 1KTDB 2EYTB 4NNPL 5J13B 3SGJC 3FQRA 2C26A 3ARFA 4LHQB 1JNLL 3IDUA 5B4MC 4PGEB 4HMCA 5F6IB 1NBZA 3JV4B 3PWLA 3BPNC 3B2VL 4PLKC 1AHWA 4WW2C 5BV7L 2KL6A 3QCTL 1RFDL 5IHBA 3U0TB 3ZYJA 4GRWE 2NTSP 3C08L 4JFZL 2BVPA 5CJQL 4N5EC 4NKDB 2YD4A 1CFTB 4XCEB 2VZOA 3L5JA 2J8UE 3VGGA 1BBDL 2IFGA 3ZZ1A 4WCYH 3RU8H 1S7XA 2HT4D 4P23B 3UROR 1F3JB 1HXYA 3L7EB 1U8NB 3ULVD 4BZ1L 5D1ZB 4Y5VB 5ISZD 1NAKH 3UO1L 2DQTH 1OM3H 1ZHNA 4NRXA 1C5BH 2X2YA 5IVOA 1X5GA 1QRKA 3SE8H 1NDGA 4PUBL 1EO8H 2F74A 5TFSH 5CD5D 1HZHH 4XVUD 4H5SA 1I1RA 1J5OL 1NUNB 5AZ2L 2MPAH 3F58H 1N7ML 4KTDL 3MRMB 1J8HB 4OBRA 1QKZH 1J9CT 5CP7B 1NQBA 3UTSB 4BQCA 4U1LA 1U3HA 5I9QC 1A6AA 3QEGH 2YKLL 1WV7T 4FXGB 1DEEA 4PJGB 4P2RE 3SDDD 2PYEE 5K9QI 4M5YH 4OZIF 3Q5OA 4PB9H 1OLZA 4DAGH 5C6TH 3HLAA 5A3IC 5SV4A 2IANB 1NCBL 5JXEA 1T21A 4F58L 1I1YA 2R0ZH 4K07A 2OZ4L 4WI2A 4I3SL 5DS8A 4ZXBA 1A4JB 4GG6A 4I48A 3WLBA 1ZWIA 5DC0A 3O4LB 4IM8A 1FGNH 4NZDA 1BFTA 4X6DE 1SEBB 1SYSB 3RVWD 3BKCL 3P0YL 1GZPB 2WIIB 2UYLA 3WN5A 1RURH 1GYAA 4HUUB 3VRLF 2E8ZA 4XTRD 2YPVL 5KZCB 3ARDB 4ODTL 5E8PA 1KN2L 1LE9A 3QISA 2RHEA 3WIHL 2H9GA 5B3NA 2YPKA 5C1MB 2CKNA 5C9JB 5F7KC 3PABA 3MV7D 3OKOA 3D0VB 4WWKD 4IDJH 4I18A 1BFSA 3BUTA 3HUJB 1HILA 3W0WD 3QPQD 4XHJD 1CD9B 1MVUB 3SE3A 3BPNB 5E99H 1NCCH 5FKAA 3CXHJ 5GQBA 2R0LH 3DV6A 4WW2B 4CN1A 2C3VB 4YHLL 4MLSA 3ARGA 1AJ7H 1DBKH 2Y06H 4PJ9D 3C60C 1CQYA 4LCWD 1OTUD 2E7CA 4NGHH 1X5AA 3WO4C 3B9VA 4X6CA 1R3LA 4Y16A 5DUPL 2PW1A 1RIHH 2EDEA 3QDHA 4RCAA 4RIRA 4Z8FL 4X6FA 1KLUB 5IJKC 1X6LA 1F13A 4NUJB 1AXIB 3KPRA 3T2NL 3BO8A 4FQLL 1BQHG 1JUFB 3DGGB 3MC0A 2EIBA 1ZSDA 4D2NA 5IOPA 4X6EA 3ZHKA 2FH6A 5JR1L 3V5DB 1SMAA 4WHYG 4I0PC 3U82B 4PJAE 5D1QC 1JHTA 4PRDB 2OMBA 5DK0A 2RQ8A 3F7VB 4YHZH 4HZLA 5I9QB 4KDTA 3Q6GH 3U7YH 3QNYA 2VLJE 1TZHA 2FCBA 3OKLB 3HC0A 1CFBA 1NGWA 4P46C 3ZE2F 5K9KB 1U92B 3PL6D 2OXGA 5I17B 4G8FB 4X7DC 1QSEA 5D8JL 5IFJB 3BUYA 1RD6A 1MUJA 2CUIA 4MVBD 3AROA 4YHKL 6FABL 4LL9A 1C5DB 2VSDA 5HPMB 5EFIA 2D7OA 2XTJE 4QNPF 2HN7B 1JPST 3GRWA 3QXAA 5CD3A 1IGFL 2DQHL 2XY2A 4UQ2B 3KXFE 5EBWA 3MACL 4O58L 1NCWL 4GAYB 4C83B 2D31B 5TF1H 2XFXB 3QCUL 3HG1A 3T0VA 4G7YH 3HS0A 4HEME 4KGLA 2IALB 4HKZB 5F1SA 3RJDA 3ZKMC 4NBYB 3MLRH 5HY9B 2H3NA 4NQED 5E2UL 3MYJA 4LHUG 1ONQB 5DMJB 3TC9A 2HMIC 1AXTL 1F5WA 1LMKA 4KRMB 1QYGH 3OJDB 3FRUB 5C8JB 4HKBB 4OZFA 4Y4KC 2JJUA 2J3SA 1RZFL 4GJTB 3ARVA 4QRSB 4UQ3A 3FQNB 5IBUG 2FHBA 2VDKL 2EKSB 4GMSL 4WWID 2Y5TA 1BLNA 2CDFB 2PXYA 1YY8B 2GJ6A 2ZUYA 4TPRL 1VSCA 3HCVA 3SCMD 4CU8A 2GK0A 4ZAKA 2VNCA 3C60B 3QIWB 3LEYL 5C0GB 4PREA 5F7EL 1MCFA 4X99A 4U3HA 3SJVB 3P4MA 3MQIA 1RHHB 5BZDA 3GSRA 3WO4B 4GW5B 5L9DH 5E5UB 3V5HA 3K4AA 1CGTA 1ZTXL 3HE7C 1VPOH 3QEHA 1CU4H 4BZYA 1HKLL 4UOW1 3UYRL 5C92A 5FYKE 1K8DB 3O45A 4O2EB 4M6ML 2HFFB 3NCJL 4MB4A 3QB7C 1CXLA 5EO1B 1EH9A 2BFVH 2G60L 3FCTB 1CDUA 4YLQT 1S8DA 4R4BB 3GK8H 4P5KA 3GMQB 1JFQL 1YMMD 1KIRB 4WUKL 4OD2A 4LRNH 3LZFL 5D7LB 2FBJL 3DBXA 3QUXA 4HUXA 1T04B 4I0PB 3MJ7A 5D1QB 5T5FL 4GXUM 2DTML 4RQQA 1HWHB 2H8PA 4XRCB 5E03A 2D7TH 1ZT4A 1S9YA 3GJEB 4P46B 5EA0H 1P5UA 2X09A 5C0AE 2BNQB 4N1CA 4F7TA 2GSGB 4RA0C 1R3HA 3MV8A 5ALBH 2DI9A 4JM2A 1MWAB 5D93C 4HGWA 4MNHB 4YBQC 5F9JA 1CIUA 3VXRD 2E27L 3ZKSD 1JGEA 3ROOB 4K3DL 4OCWL 2HTLD 5DRXA 1FAIL 1LVEA 3HPLA 1R3KB 1T7YA 3B8YA 3FRPA 4FMFA 1KPRB 5E95B 2P46B 4OF0A 2HFEA 2X1QA 3QIUD 5CBEB 4LQFH 3RL2A 1KG0A 1FL6B 3P11L 5CCKL 5HHOB 5GSRB 2CGRL 1UJTA 3BH9A 1MHCA 1U91B 1CS6A 4UV7L 4G8GB 4OF8A 3FTGB 4Y4KB 4KHTH 5IB3A 2YK1L 4R26L 4HX1B 1KSRA 3DRQA 3SPVA 3DXAE 4BM7A 5GRJH 3CCHA 3IDYC 2IMNA 2E9BA 4IOFD 1DL7L 1S7SA 1MHHB 5ID0A 4H1LA 1T1XA 4NM8L 4MQXD 3VWKD 4YWGL 1P4BH 5EU6E 5K9JL 2HJLA 5ACZA 2OK0H 4DW2L 4OJFL 3LV3A 3S8WA 4KRNA 5D9SA 3HE7B 1C08B 2VH5H 1QFWH 1IC4L 5CMAA 1L7IL 2AQ1A 5TH2A 2H6PB 1T0PB 3EKCA 2BCKB 4JCLA 3KNBA 4LSUL 3LQAL 4NKOB 3SKMB 3MCLH 4DZ8B 4N8VA 2VYRE 3G5VB 2IWGA 4XP9L 5EZJA 1KPVA 4MA1C 1S7WB 1NCAL 4MJID 1RZ8A 4HC1L 4IJ3C 1PD6A 4NO0B 2BNUA 1G9MH 3LEVL 4HK0A 5E6IC 3KLSA 1HCFX 4YX2H 2NY1D 4OF3A 4G9FA 1CWVA 1QSFA 4K3JH 15C8L 4PLJC 4KRLB 3S97C 1PQZA 1HH6B 5I8OL 1GH7A 4N0CD 4R4ND 4AEHH 4ZDHB 5DVKA 4X5LA 1AGBA 1F6AA 3H9ZA 4RGOL 3FO9B 1KXQE 1KC5H 5DUBA 5D93B 3TBVA 1UC6A 5FUOH 2B5IC 1CG9B 3GBML 5IHUH 5I8CB 4L4VE 5TDOB 4HUVA 2BHUA 2VLLA 5K9QG 4OM0H 1CFVH 4JFYB 3QUMA 1TZIB 1EFXD 4HV8B 4OF6A 4C56A 1A7OL 3DROB 2HVJA 3HNSH 2AGJH 4OZFH 5TGBB 4Q2ZA 4U1GC 2FLRT 3P4NB 1OF2B 4QXWA 4OF7A 3VRIA 3LKQB 4A6YA 4XWGL 3BGFC 4Q58C 4X80L 4MDIB 1YMHA 2XT1B 4OUUB 1TVHB 1AXSB 4G5ZL 4PTUA 1YNTA 3HG1E 2IPKA 3B2UD 2AXGA 3CFIC 5BRZA 4XI5C 5C0CB 4ZTPL 5DSCB 1RIUL 1T80A 1ZXQA 4NYLA 1SBSH 3C8DA 2O5ZH 3G04B 3Q3GA 3IDYB 4QXUH 5FO7B 3SOBH 1CD1B 4KAQL 3DYMA 4E41B 2CK0L 1RUQL 4LSPH 5FFLA 4KUZL 4X9HA 5AZEH 2VR9A 4FQHA 4PJCA 4PJEA 5IW3A 1YECL 3EYOA 5EZOL 4HIHA 5IVXF 5DVMA 3G6JB 5I0DA 4JRYD 2VQUA 5IBTH 2XA8H 4H8WH 4S1SH 4S0SD 3U6RB 4HH8A 5DXWA 5I1EL 2OJZL 4K7FB 3ULVE 4UTBL 4AMKL 4G6FB 3FT2A 2NTFB 4JN2B 1CLOL 5ADPH 3CVHA 5C0EB 2KZ1B 3UYPA 1AP2B 4MA1B 4LLUA 1JZ2A 5DUML 1E4JA 1EK3A 4OCYL 4IJ3B 1UYWL 5ESQB 1ZAGA 1WWBX 5HYJB 5E6IB 1T0MA 5E5MB 1RULH 2NY2C 4LU5H 1RMFL 1TITA 5IVZA 3RGVD 3NPSC 3OAYK 5HVWA 2VL4A 2B0SH 1G6RH 5IB4A 2BOBB 4HKJA 1P7QA 2BVYA 2OL3L 3JV0A 4ZFZB 3IXTB 4X7TB 4M6NH 2EXYC 3BQUC 5CEXA 4HEPG 2X4SB 1FL3B 1CLYL 3S34L 1Q94B 5F70A 2B5IB 4MA8H 5F6HJ 4R7DA 1MSPA 3X13B 3UJIH 3HB3C 4MXQC 1EV2E 5LQBL 3A6CH 5TPWH 3P4LA 3MRPA 1LEIA 1LDSA 4TTDC 2WUBH 4H25A 4U1GB 3I9GL 2DQIH 4ODSH 3QZWA 4HIXL 2G9HB 3BGFB 3VGDA 1Z9SA 4XC1H 1YNKH 2HT2C 4P23D 3G5YA 4UNTA 1WCQA 5I18L 5HI3D 3ZDZF 1I75A 1IGMH 4H1LH 5D1ZD 1QPPA 4GKOA 3VFWA 5I8KH 4Q9RH 4GAJL 4MHHG 1RUPL 3MJ8B 4OV6F 4BYHA 3HNVH 5KSBA 3QHZH 3HAEA 4UV4L 2X5PA 3D39B 4P4KA 2XZCH 4ZPVB 1YYMH 1XCTA 4J7RA 5GS2H 5C0JA 2HRLA 4EN3C 5GZOD 1KFAH 4OGZA 4KPHL 4XX1E 4KV5E 4C57C 4HPOH 5CSGA 4NUGH 1J8HD 3BVNA 2WSKA 3M07A 4PRIB 3HZKB 3UTSD 3W9DA 3SDYL 3BOVA 4JRWA 3B5HA 1N59A 4WDIB 4WHDA 4MX7B 2P5WA 4P3DB 3U2SA 4Z7VF 3QDAA 4YGVB 1T3FB 3PIQB 3WLWD 3PUCA 2A9MH 4M8QA 5KJRH 1BFOA 4YZFE 2EZ0D 5IW6B 4PJ8C 1BOYA 1KCVH 2IAND 1Q0YH 4QF1A 1OT2A 3FAWA 5GGSA 3F6LA 5ICYB 1R5VB 5AD0A 3ZMRA 1RZJC 1EGJA 3O4LD 3IFPB 4PGDB 4U1KB 3GI9H 1EJOH 1J86A 4NBXB 3OTTA 2ZUXA 2X4NA 5EPMB 3QA3B 1MPAL 4ODXB 5J6HB 2AQ2A 2V2TB 2NY2B 3BGMA 3BESR 3P9MA 4KZEH 4QCIA 3ARDD 2MCPH 1UM6H 4ONFL 1Q0XH 3OWEA 3NPSB 5FUZL 4BQBA 4LASH 4YK4C 3K8KA 1L9NA 4XXDB 1IGIL 2IPUG 3QUMH 1VFBA 1X5YA 3AREC 5ID1A 2GCYB 3BQUB 5GRUL 3NFNA 4JHAH 1NCTA 5GS0C 5B4MD 1UEMA 3NCYP 1X4ZA 3PXJA 4JVWA 4PLKD 2PW2A 5GGQH 3QULB 4ZYKB 1N5YH 2IC2A 1AC0A 1CZ8L 5BOZG 5H35A 1JV5B 3MPCA 3R0MA 4ZUSA 4N5ED 3BZDA 2BOCB 5GGTL 4HQQL 1OP3K 3QUKB 5JIKA 1MLCB 2P8PB 4WU5B 4AIOA 3BHBB 4FOMA 1F11B 3L5WA 4RX4D 1JHKL 4F8TA 2WBJA 3MCKA 3H42L 1EA9C 4PLOB 1T03H 1E4XH 1QTYT 4K71C 1I9RH 2DL2A 2AQ3A 1F2XK 4PGZA 4FQQB 2FJFA 4Q9BA 4XNYH 1NUFA 1RHFA 3SDXB 4MNGA 1SJXA 4WJ5A 3UTQA 2FSEB 3RTQC 3WEXA 1P84K 1XR8A 3ULSA 1U8IA 5CSZB 1RJZB 3VXSE 1K6QH 5FDWB 1OGAE 4LPXA 3DX9B 1FO0H 5L6YL 1GC1H 2X4UB 5EG6C 4BFGA 1UG9A 4LF3B 1UWXK 1KJ3L 1JGVL 1S7UB 4ALAL 3NIDE 1AGDB 2QQKL 3LKOA 4ODBD 4YR6A 5EN2B 2DM2A 1OT1A 1OB1A 2ICWJ 3HZVA 1G7MA 4WY7L 2FEEI 3T2QA 4PFEA 4B41A 5BVJA 4ZPTB 1BEYH 1HOCA 5M94B 3EOYG 4FQIL 3MLTB 3MJGX 3DV4B 5IB1A 3CFCH 5A2KH 2FX8L 4OCRL 3AUVA 5A3ID 4PJ8B 5CS7A 4LIQL 1KT2B 4OAWB 1UVQB 2R2CA 3NAAH 2D03L 4CJ1A 4PJXF 4MNQB 4QHNB 1NEZA 1WBYB 1YMME 3GEWB 4LPUA 4U1IA 3JTTB 2VXTH 4R90H 4R97C 4JFDB 2BXZA 3BX7C 4Z7VB 3X11A 5IG7A 2V17H 4CADB 3DLQR 2QQQA 2VXUH 3FFCB 3UJJL 5KTEH 4YK4B 3OAUL 2F53B 5C09D 3WIIL 5I75B 4DUWA 3ECBB 4TN9A 3AREB 5EZLA 3OX8A 4PJDA 3S6CA 5HGGS 1PY4A 2O61A 3LH2L 3QAZC 1UB5B 4HT1H 1MFEL 2GTZA 5C07B 2X9XA 2MJWA 4DK6A 2MNUA 3QWRD 4PJIE 1EMTH 2Y72A 3QNXA 2EO1A 3OR6A 5D96C 4JO4L 1J05B 3WXVH 4R7NA 2BX5A 3DGCR 1EHAA 4FTVB 3C60D 3RU8L 2GKIA 4IOIA 2EH8H 3SJVD 5J1AB 4P9MH 2JE8A 3OKMA 4JY6B 3RDTC 3L5HA 2NY5H 1NAKL 1BQHA 2DQTL 3O11A 3VFUB 1C5BL 3B6SB 3LN4B 4RMUA 1XF4B 3OAYH 3E0GA 3EGSA 2QKIA 1FNSH 1EO8L 5TFSL 4HFUH 1AQDA 1HZHL 1NH6A 3IFOB 3TO2A 1WVZA 3GSXB 2R1XA 3BWAB 1T83A 2I25N 1Z5LB 1JPGA 3F58L 3T3PE 3VJ6A 3T0EB 4MQ7A 5KSBE 4KJYA 2PN5A 2G75A 2JELH 2ADIA 4I0PD 5KVEH 2ERJC 5D1QD 1NC2A 1W2KT 2CIKB 3QEGL 5H2BB 5A2IH 1FJ1B 5ENWB 4M5YL 4P46D 5D2NA 4WNQB 4NCDA 4DAGL 5C6TL 4RMVA 2BNQD 3UYOD 3RWFA 4U7MA 2R0ZL 1FZKB 3FT3A 5I76B 2E9IA 2B4CH 3VXPA 3HZMA 4IS6A 5EBMA 1AGFB 1M7XA 1H3XA 2VJXA 4CN4A 4LHUA 2DYPB 4K7PL 2I60H 5KS9A 1YUHA 4M03A 1A1NB 1RURL 5E9DA 5J6GB 4PP2A 4XVTL 2BNRE 1FV1A 3QP3A 4R97B 1R5IA 4LPYA 1DVFA 1VHPA 3NTCH 4JFPA 2JCCF 4GLRH 4C54A 3ZKMD 4HFWB 3QFDA 1NUGA 4O51B 5D7KD 2Y6SC 4YUEL 4LPCA 2X4RA 2CO6B 1RVFH 3S5LB 2LU7A 1W0VB 1WZMA 3AU1A 1FFNA 2HMID 5HHOD 3MJ9A 4UDTB 4PLNC 4IDJL 4G8GD 4WI4A 1BZQK 4UIMB 1KXTB 3NZHL 4Y4KD 3QAZB 5E99L 3G5XA 2QV2A 1NCCL 3E6HB 2BY2A 4PJXB 3B5TA 4D8PA 2R0LL 4K23L 4ZO8A 3OKNA 1LE5B 3SDCA 1ORSA 3KPSB 1HEZA 4M00A 2OJEB 1AJ7L 1DBKL 2Y06L 5BQ7B 5JLZB 3IVKA 3QJHB 3RBSA 4M4RA 4PPTA 4N9OB 3QNZB 5D72H 5D96B 1K3IA 1FFOA 3QXDA 2YD1A 2CKBB 1CR9H 5B21A 4GQ9H 2AV1B 2CLRB 3MRQB 1G7QA 1NMCC 4C4KT 3NH7H 3W82A 4OV5B 3RDTB 1ED3A 2J6EH 4ZSOB 2OI9B 4LPTA 3VDAA 4U1NB 1RIHL 3HE7D 3PHOA 2BSSA 1OLLA 5DJ8B 3TESA 4EUPG 3R06B 3FQUA 2EYRA 5C70A 3OR7A 3MGAA 2MQCA 4N0FB 4OGYH 1T0NB 1KJVA 4Y4HA 2I27N 1LO0H 2R1WA 4YIQA 3ARTA 3CGTA 1BP3B 4PTTA 1VADB 2VQ1A 2NZ9C 3MUHL 3GDBA 3VMNA 43CAA 5GRVL 3UP1A 4NO0D 5SX4I 4BSVB 3ES6B 4YHZL 2ERJB 1RZIB 3JVGA 3Q6GL 3U7YL 5ANMB 1KTLB 1FNEB 4NFBA 3LN5A 4L5FH 5KVFH 3GGWA 5IIEB 4LKCB 2V5YA 1D6VH 2IBBA 4HAFA 2Y25A 3EFFB 1MLBA 2JF1A 4GO6B 2RR3A 3LRHA 3IKKA 4FZEH 2QEJA 4YBQD 5FO9A 4N8PA 2P7TB 4MJ5A 4Q6IA 4RAVA 5TF1L 4N1EA 4G7YL 5GGVY 2DLFH 2VLRE 3CAFA 3VXQB 1P2CB 4XPFH 3MA9L 4HDIB 1F58H 1Z2KA 5FOBA 2EDYA 1KCRH 1OP9A 4XPTH 4LSQL 4NPYA 5JUEH 3I2CH 1JNHB 43C9A 1JK8A 4Y1AA 1QYGL 4Y2DA 2EE3A 1DDHA 1LO3H 2AXFA 4LAJH 4PJHF 3WIFB 2GT9B 5HGBA 4JO1L 1SY6A 4TNVF 3ZE1F 3BWUC 3Q2CA 5C0CD 3WS6C 1NGPH 4PJ7A 3SKOA 4NT6B 3RL1B 3N06B 2J88H 3IF1A 1OD7A 3JBG7 1IZKA 4Y88A 3UC0L 5HBBA 2JCCB 3CX5J 1A6PA 4E41D 3L1OL 1QRNB 2OX5A 4WU7A 2YBRA 4M02A 4ZUUB 3WHXB 4OQTH 2GQHA 5IBLC 2R1YA 1U8JB 3THMH 3CDYA 5D70H 1NMCB 5L9DL 1BOGB 4QRPA 3MXVH 3KPLB 1VPOL 1CU4L 4MD4B 4UINH 1ZGLA 1IC7H 3JUYA 1T4KB 1U8QB 4OZHA 3BIBX 4PYHA 3RIAF 4CDHA 3B3IA 4KUCF 4HWZB 1TLKA 2BFVL 1K5NA 5SWSE 3FOMB 1MF2H 1EZVY 4PS4L 2Q76A 4G6FD 1NGYA 4U6YA 5ITFB 2E6JA 4XZUB 3VWJA 2FL5B 1GZQB 4D9RE 4AH2B 4RISH 2IG2H 4QYOA 4CVUA 4GBXA 4Z7UA 4LRIC 4WFHD 1A7NH 1BZ9B 1G7JB 1N6VA 3RPKA 5F9AC 3SKUD 4EIGB 3IB4A 4FP8L 5E6ID 2D7TL 5LGKA 4DGVH 3VA2C 5EA0L 3C5ZA 2HFTA 4QOKA 1DQDL 5CBAA 1BZ7A 3ILQC 3KPMB 4PLJD 3N1QC 1EEZA 2UUDH 2FECL 1J1OH 2VWEC 1QHOA 1NLBH 5ALBL 1JBJA 3IETA 4JPWL 4P57A 4NHCH 2OSLB 4I5BA 3SKNA 2FJGA 5C0IA 2CRIA 1N4XH 1FZOA 4EDXB 3IT8D 1ADQH 4GAGH 3Q5TA 2F54E 2WQ8A 3HN3A 4OLYH 5E8EA 2AJYH 2VLKA 5B3JF 3L3KB 2X42A 4IDLA 5FF6A 5F1NB 1IC1A 3CFEA 3RUGF 2P8MA 3MJ6A 4LQFL 3L3JA 5EBLA 2VXQH 5IR1B 2BERA 3LKSB 4N68A 1IAII 4BQ9A 5I1AB 3EO9H 4XI5D 2OTPA 4UI2A 4ZUWB 3WNPA 4UB0H 1JPFB 1OSZA 3D39D 4GT7A 1KIUA 2HWZH 1I1AC 2XKUA 4B53A 1UWGL 3WFBL 1WAAE 1P4BL 2F8XC 4JQVC 2ESVB 3MNVB 4FFVC 1CXEA 2DQFA 3KPPB 1OY3B 5TE6H 2OK0L 5IJVB 4PB0H 2Y1VA 1S9WB 1F8TH 1X7QA 1DBML 4LEXH 1GOGA 4LLMA 2VH5L 2DBLH 2DL9A 1QFWL 2YC1B 4NZTH 4PJFF 5D1XC 5GJTL 2NZIA 5DHYA 3DUUA 2F19L 4QTHA 3QEQA 4WFED 1JZ5A 3BKYL 3CIQA 4YHPB 5EIIA 3MCLL 3FB6B 1UB6A 1ZV5A 4OCXL 1J12A 3O41A 1IGYB 4TQEH 1I8KA 1E0OB 2EO9A 1W72H 1PW3A 3H2WA 1SYVA 3C8KA 3VE0A 3NACH 1VEPA 3ULUC 1G9ML 1SVZA 3EDEA 2IH3A 4HIJA 5J57B 4UIKL 1F6LL 2XZAH 5EC1A 4IHOA 1YEJH 1F42A 4YX2L 4LLVB 1U8HA 2NY2D 5DI8A 4R96B 2DLEA 1I7RA 1WIOA 4K3JL 2WV3A 4X0KA 3LDBC 4QY8A 2M2DA 1CDBA 3JV5A 4AEHL 5ABDE 5MERB 1ROWA 1KC5L 2EXYD 3BQUD 3ARZA 5IHUL 1RK0B 1BIIA 5C08B 5CEZD 3FONB 1CFVL 3QUZA 3QUYA 4Q74A 1CGYA 4ODWA 1X5FA 5EU4A 3M1BA 3GNML 2IH1B 1YN6A 1JWUB 2VLME 2AGJL 1OWRM 1RUKH 1YN7B 3RNKB 3HB3D 4FQ1H 4MXQD 1SY6H 5MHSD 3QIBA 3HR6A 4JQXA 4TTDD 1EBAA 3GSQA 2IPUK 5FB8B 2EDKA 3I3BA 4JB9H 2GITA 2X4QA 2HT2D 3GSNB 4GRLA 1W0WA 1BVLB 2R8SH 3D5OF 3PDGA 1I3VA 5IMMA 4HS6B 5C09E 4B0MM 1ZLVK 1AO7A 1SBSL 1XH3A 5HJ3B 4M7LT 2ZWLT 4QXUL 4NQDB 3RUGB 3NZ8A 5CGYC 1S7QA 1S7RA 4F3FB 4LSPL 4PJ5A 4EN3D 1I1AB 1IM3A 3CDCA 5TE7H 5ERWA 1ORQB 3QFJB 1BPVA 3NABH 4F2MB 1CBVH 4Z7WF 3SGKA 5IBTL 2XA8L 4H8WL 4S1SL 3I6KB 3WHE1 5SX5K 1A2YB 1A6WH 1AGCA 2LE9A 5DRZA 4X7FC 5D1XB 3HRZA 3LQZA 2R2HB 3ZE0F 2Q8AH 4LKXA 5EUOF 4F9LC 5JIPA 5HHPB 1IGTA 5B38G 1RJLA 1P1ZA 2VN7A 4RAHA 4NFCA 2X4PB 4QRPE 4DEPC 2DD8L 3D3VA 1ZHLB 5TDNB 4PJ8D 1DN2A 4HWEL 4OZHE 1UWEH 3TIDA 1EUTA 3VXMA 4Z9KB 5JZ7C 1FH5H 2P47B 4QHKJ 3G5ZA 5CUSH 1OPGH 4ISVB 4MNQD 5H37G 3UMTA 1JN6A 1RULL 1VEOA 4LU5L 4QHMA 4CAGA 4JFDD 4JFHE 3EDDA 4L3CB 4PJFB 3WL9A 4WFGE 1O7VA 2B0SL 3WE6A 1G6RL 4G3YH 3O8XC 4M43H 5FGBA 3FFCD 3LDBB 2A6IA 1A3LL 1NDMB 2F53D 3RHWF 4M6NL 3VH8G 4LCCA 1T7XA 3F6IA 4K8RH 3O6LH 3ARED 2BVTA 3HR5A 5D7JC 5GS0D 4Z18A 4MA8L 4DOHE 4PRHA 4QOKE 4N0YH 5C07D 3CH1A 3I6GB 4YDLB 1LNUA 3FB5A 1OWWA 3TBYA 3BXNA 3UJIL 4E42B 3MR9B 3I84A 2XPGB 4LSDA 3A6CL 5TPWL 2YN3A 3VG0H 3D2UA 3BP7A 2DQIL 3BE1H 4ODSL 1FO0B 4FTVD 3SDDA 5J1TC 1QVOA 5JHLH 3FO1B 4XC1L 1YNKL 5FHBH 3GUTB 5E94B 4TVSa 4MSWB 3V0VA 1IGML 4JFQA 1LP9A 3TH2T 2PNDA 1I8IA 3H9HB 3S4SG 4WEUD 3SHSA 5HHOE 3BEVB 3QHZL 3QDME 5SWZB 3KWWA 1KJ2H 3CK0H 4I2XE 2XZCL 3NCEB 1AY1H 1CD8A 2Q3ZA 1OAKH 2B4CC 2E3VA 3FQXB 4IMLB 1IGCH 4P0DA 3ZKXC 4OIAA 3RTQD 2PR4L 4H26B 5GGRA 5KW9H 1U42A 2O26U 3V4UH 4NUGL 5LAXA 3VDCA 3MRBA 4NWUH 1HH9A 2R23A 3ELAT 3MV7A 1U8LA 1QLFA 3VFVB 4WWKA 4XP1H 1D5XB 4WUUE 1E28B 4ZUTB 3W0WA 1C8PA 1DQMH 2GTWB 4U6HB 2YPLB 3LEXA 1K8IB 3U46B 3LB6C 2A9ML 5DQJB 5KJRL 2YA1A 2DWDA 3U4BH 3N85H 1KCVL 4DEPB 3PP3K 4W4OC 4YAQA 3GSOA 5C0FA 3JWOH 5J3HC 3E6FA 1MCJA 2BRRH 4LCWA 2H1PH 5ESAA 3TBTA 3GI9L 1EJOL 2DYPD 5DYOA 3TN0C 3IRZA 3UZEA 3T0DA 2W9LA 1J1PL 3F7RA 4UAOC 4KZEL 2MCPL 2V9QA 3SN6N 4BH7A 1Q0XL 5EUOB 5H94B 5TQ2H 4LASL 5DJDB 5HHVH 5AG9A 1G7HA 2AJZB 4F7CB 3H9SD 2IADB 3O8XB 3QUML 4CW1B 1MCSA 2H41A 1OGTA 2XZQH 3BD3A 2AJVL 3MUGB 3T04D 4JHAL 1JYXA 5T5NF 3I02A 5BS0B 5A1AA 3IDIB 1YC8A 2EH7H 4WENB 1VENA 5GGQL 4A6YL 4UU9A 4JY5H 5CIPA 3UCRA 1A4KB 2Z8VC 3FOLA 5L2KB 3KPSD 5E7BA 3EO0A 4GKSA 4X5XB 3I75A 3RWJA 3KYNB 4NBZB 4CNIA 2E7MA 3MV9A 2UWEB 1GIGL 1CL7I 1ES0B 1NPUA 4NSKB 4ZS7H 1TVBA 4JFFB 2RFXB 2OTWA 1J0IA 1HXMA 3LQMA 4HGMA 5GRYA 2BMKB 4DFIA 4MCZB 3RDTD 1INQB 2V5RA 3UXFA 1KXVC 1E4XL 4XNYL 4KDWA 3PGFL 5T3XD 1RIVL 3ZDYE 3E8UL 2ID5A 4U49A 3KYMA 5F89B 5EUKA 3VFTB 4P3WA 3P0GB 3ZKXB 1K6QL 4HIIB 1D9KC 1EVTC 2NLJB 2WUCH 3PHSA 1PKQA 3TYGL 1GL4B 1A6ZB 5F71A 4JDZB 5B39B 2P5EB 4GQPH 1XZ0B 1D6EA 3FQTB 4XCCH 2W0KA 3G6AA 3CVHL 4D9QD 8CGTA 4OSUH 4GW4B 1BGXH 3MRFB 4WV1A 3P3YA 5MEPB 1MIEH 1PYWA 5HHXL 3BJLA 5FAAA 3QCVH 1NSNL 1UKQA 3GMLB 3HHRB 3ULVH 3SCMA 4S1RH 5IB2A 1H15A 4Z78B 5A40E 3VDBA 3T4AA 1FP5A 4JVPA 4X4YA 1C16B 3NAAL 4KJWC 2DI8A 4ELKA 3PG2A 2AEIT 3TN0B 3WD5L 5CHNB 4YO0B 1CICA 1MHEA 2VXTL 4R90L 3D3VE 1WLHA 5FKPB 3BT2H 2V17L 5DC9B 5DRWB 4UAOB 4I3GA 2ZG2A 4WFHE 2BY0A 2VXUL 3B4NA 3T4YA 3VXME 2Y6SD 3MRGA 4P9HL 1CE1H 3UBXB 4WI9A 4HPYH 1BD2E 3L3HA 4P4RA 5IM7A 1ZLWK 3KVQA 1Y0LA 3JWDL 1KB9K 4HT1L 2IEPA 4FFYH 5T1LD 1XGRB 3BDYH 3WFDL 5FYLE 4OCNC 1OTTC 3TV3H 5I2IB 4L8CA 5F93C 3SEPA 4HLZG 4N90D 3MA7A 5DEZA 3SGDI 3WXVL 3SO3C 1I85A 3DUHA 1NL0L 1ZKAA 4E0RB 2EH8L 4P9ML 4PRHE 1JTPA 2GW5A 3L5XH 5FYJD 1QFWM 2WK2A 5I16A 2P24A 1WWWX 4L3EA 1XF2B 4OD3H 4X6DF 3HPJA 2DQUL 5BXFA 2B1HL 1BVKA 5FA3B 1MJUL 1ETZB 4L8BB 1FFPA 2P48B 3VXRA 1MJJB 3BGAA 1CTNA 4YHIB 2NXZC 1ZT7B 2MKLC 3KLAB 3BFOA 4OZGE 1AD9A 1P84J 3TO4A 1D9KB 1ERNA 3AXLA 3NFSH 2NZ9D 2JELL 5KVEL 1GGUA 1K4CB 4TSAL 1VGKA 3W5NA 3VCLA 1RZGA 1B0GB 2ED9A 1QLRA 3V7AG 4KHXL 5M7QA 5B39G 1QD0A 3ARXA 4F9PC 1A7QH 4KQ4H 3QR2A 2NMSA 4KGJA 5KG9B 4FQCH 1FPTH 3OKDB 4XNUH 1DFBH 4PV8B 3U9PH 1JCKA 2MOVA 3LAFA 3VWKA 2XZZA 2ZSVB 4O2CA 5EOCL 4MXVE 1IAOA 4NP4H 1P4LB 5F7DA 1TJGH 3SE4A 1FE8H 3NIGE 2J5LC 3NTCL 1VDGA 3TNNA 4GRWB 5I73C 1AQKH 1SMOA 1KELH 5J56B 1XGPB 3P77B 1RVFL 2EDWA 3L9RA 4K7PX 4PV9B 1QQDB 2J8UB 3F7YB 3BEWB 4UT7L 3BN9C 3VRJB 1H3GA 5E00A 3WJJA 4PJAF 4N0RA 3WKMH 1XT5A 5JO5B 1CLCA 3VI3E 4M7LH 3EFDH 5GGUB 4UOW0 1M05B 1H0DA 4MJIA 3CXDL 2H32A 3D48R 2IMMA 3RVUC 1MH5B 4RAUB 5L88H 4YXLH 5CEZE 1WFUA 4K94C 3SO3B 1XGQB 1CR9L 3H0TB 4UDUA 4P48A 4PP1C 2IFFL 5IBLD 3NH7L 2X1WL 2J6EL 1RJYB 3AAZB 4JDVB 4OLXH 4X8XA 2VIRB 4EI6A 1ZLSH 1XR9A 3MFFB 3O3DB 5JHDD 5IHLB 2JK5A 1REIA 2BHZA 1PGRB 2KBGA 3MLZH 4NNXB 4TRPL 3X3GH 4P2RB 1AR1C 1JWSA 4OB5H 5IWLC 5ELIA 1A64A 2PYEB 4RNRA 1EFXA 2XWJA 4OGYL 2RIKA 5I66B 1ZA3A 2W60A 3QHFL 1LQSR 5GIRB 4XXCA 2XV6B 2QHLA 2XTJC 4U3XA 1Y6KR 3DX8B 4L9LA 4XVJH 2DQEH 4YPGA 2VQTA 1FVEB 5IW1B 1HHGA 1ND0A 3MRCB 4DN3L 2KUTA 3RIFF 2W9EH 4NJAH 4WO4C 4X6DB 2RAMA 5L2JA 4WI5A 4L5FL 3WUZA 2XACC 1YEDB 4GW1A 4HLJA 4GMTH 3CFBA 1A0QH 3D25B 4L29B 2VDNL 3V6FA 5B8CA 3JZ7A 1I3UA 5KN5B 1WBXB 3ILQD 5HSFA 1FLTX 3TGXA 2CIIB 1VFAB 4Y19A 1OAUL 4FZEL 4IMKA 3T1FB 2AKRA 5F9WC 3CFKA 1FVCA 2AXHA 5C08D 1X4YA 1R3IL 4B50A 3LKPB 4P2OC 2CD0A 4XPFL 1H3PL 3AM8C 1F58L 3L7FB 4LGSB 2J5LB 3QYCA 5IGXH 1ZT1A 1KCRL 1R24A 3EW3B 3UAJC 5FO8B 1Y6NR 5JUEL 5DHVA 1DBBH 3Q1SH 2X70B 3IU3A 3I2CL 1K2DA 3V79C 3DVGA 1TNNA 3DVFA 1AHWC 3U1SH 3LRGA 2FO4A 1LO3L 2HJKA 2AJ3B 2VZUA 2SEBB 3WFCH 4CU6A 5D5MA 5BJTB 1U93B 1GOHA 1NGPL 3LPFA 2JKXA 1VGEH 4ELME 1UJ3A 2BZDA 2J88L 4PR5A 4I4WB 4KQ3H 4DUVA 3LS4H 1I9JH 5DJXA 4NQDD 3BPOB 4U2YA 3TNMA 2V7NB 3CZFA 1I1AD 4S2SA 3F12A 1IM9B 1ZEAH 4OIIH 4LVNC 3THML 5FA4B 2YSSA 5MENE 2C3XA 3QFJD 4FFVD 3KYKH 4QHUB 4U0QB 4PJAB 4UINL 4FHBD 4L8DA 1IC7L 3H3BC 1KTDA 2EYTA 3BZ4A 2MWCA 3V6OA 1KNOB 1UCBH 2VLJB 3JV4A 5D1XD 4QGTA 4XAKE 4O02H 3UPRB 1QEWB 1A14H 1Z9MA 5BCAA 4L3EE 1MQKH 3U0TA 5I19H 2K7QA 1Q8MA 1U3HC 4NKDA 2XTJB 4RISL 1MREH 2IG2L 4XCEA 1DEDA 1CGVA 2G5BB 3ZTNL 1A7NL 3DX6A 4NQTA 5HHMB 4D3CH 3IAQA 4HUNB 3ULUD 4Q9QH 2GFBA 3MRNB 3KXFB 1WTLA 4WO4B 2X44D 3L7EA 3S88H 4DGVL 1U8NA 4Y5VA 5KVMC 5JXEC 5HDLA 3WJLC 2HVKA 4ZXBC 3KPOA 1INDH 1J1OL 3QG6A 2VITB 1MFDH 3FB8B 2EICA 1NLBL 1WIPA 4RMRA 3G6DL 1AH1A 3QO1B 4OLZL 3WN5C 2DJSA 5AEAA 4B7LA 2Y5EA 1ADQL 3IFNH 4GAGL 5DTFB 1J8HA 3MJ9L 4OLYL 5CP7A 3UTSA 3RP1A 1E27B 1WBZB 4MD0B 5D7IE 3C2SA 2VXQL 3R4DA 3CXHK 3GHBH 3SE3C 4JHWH 4HH9B 2EDDA 1JI1A 5K33A 3BKJH 5HXMA 4IIQC 4OIBA 3STLA 2FZ3B 3ARGC 4LLDB 3EO9L 1F4YH 2BHYA 2ICEA 3H9SE 5FV2A 3HFMH 1A4JA 1JRHH 2A74B 3OF6D 4PJBE 4TSCH 1AKJA 4UILL 1SEBA 1SYSA 4JPKH 1CXIA 2WIIA 3TP4A 4XMKH 3BRDA 1MNUH 1NC4B 1JNNH 1HQ4B 5CGYD 4HUUA 4Y16C 3WNKA 5CZVH 1S7TB 4TTGA 4LVNB 5TE6L 2PTUA 4PB0L 5B38A 5MEQB 5I1LB 2DI7A 1U8KB 2C3HA 5C9JA 2IAMC 3ZT5A 3NIFE 5SWQB 3D0VA 2F74B 2HH0H 5JW4R 4NZTL 3M8OH 2F5AL 1T7WA 2NW2A 2BC4B 1UZ8B 5ACLA 1MVUA 3HNTH 4H5SB 3VFMB 2YPLD 4PYGA 1FYHB 4HWBH 4Z95H 3QWOA 4ZTOH 3X14B 5C0AB 1I4FB 4WW2A 2C3VA 5T3ZD 5JPMB 4Z5RB 3CUPB 3VI4E 3RWCB 5T3XE 1U3HB 3PGDB 4KDTC 1W72L 1IKNC 3NACL 2AK4A 4F7EA 5JZ7D 5F44A 2XZAL 4RX4A 4ZG1A 2PO6A 1Q9OB 3VH8A 4EBQH 1WEJH 1YEJL 2C4FU 5LJYH 1FHGA 2P49B 4H0HB 1I1YB 1I9IL 2ADJB 4N5UA 5IESH 4LMQI 4NUJA 3O8XD 2EDLA 1H3TA 3ZO0A 4Q97A 2APWA 2D7PA 2Y23A 2ITDB 3WUWG 3WN5B 1JUFA 3DGGA 2ADGB 5CGTA 5BS0D 4BK5A 3D87B 4EQ3A 5KSVA 1KJ2B 4ORZC 3V5DA 4FABH 4NFDA 3S35H 1LE9B 3L3DB 4LDEB 5L2KD 2X7LB 3DXAB 3UTPD 3F7VA 4FQ1L 3RA7L 1SY6L 4YFEA 1A7BA 3ULVF 3PABB 1IQDB 4LSTH 4AM0B 3O6MH 3OKLA 4NO2B 2I9TB 5L0QC 3H7BB 4YQXH 1D3CA 1G0DA 2BVOB 1U92A 1MEXH 4JFFD 5K9KA 5I17A 5ALCH 1HWGB 4JB9L 4G8EB 3LIZH 4OTXH 2R8SL 4FFWC 4IIQB 2PXYC 1C5DA 3ARGB 2JB5H 1UEYA 1ZGLP 1HIMH 4PY8I 4XPBH 4UQ2A 2DKSA 3F7QA 2AV7A 2D31A 4ZOBA 2X41A 3O9WB 3TA3B 2EE9A 4HKZA 1N5AB 5TE7L 1IJ9A 4NQXB 2PW1B 5IQ7H 2HLFC 3ZDXE 2CJUL 4OZIA 3FO2B 1IE5A 1JIBA 1N3NB 1ONQA 5CJXC 1CBVL 1TETH 3IU4H 1U8PB 2P5ED 2V6HA 4RRPA 5H8DA 1V5JA 2IAMB 3OJDA 5DGRA 1A6WL 1GGYA 2UY6A 3FRUA 5C8JA 4HKBA 4BUGA 1YY9C 3MRJB 1PEZA 1UXWB 4M8VA 1B2WL 4JKLA 2Q8AL 4QRSA 3FQNA 4X6EB 3MOQA 2EKSA 2AJUL 3LB6D 4XPAL 2ZP0T 4XHQA 1UQSB 1EIBA 2PCPA 4ZUVB 2CDFA 1YY8A 4FNLL 5DK0B 1UWEL 4HZLB 3LSOB 4U6XA 1SVCP 1SJEA 1XF5B 1FH5L 2W38A 3DVNB 3QIWA 5J3HD 5CUSL 1OPGL 5C0GA 4HC1A 3S3PA 3SJVA 3TYFA 4L4VB 3TN0D 4LARH 2GHWB 3D69A 4DKAA 1PG7H 4GW5A 4WHYH 3P4OA 4W4NA 4JEGB 1WT5A 3ARWA 2XI9A 4JM2C 1N0LA 4G3YL 4XMLH 4M43L 4O2EA 4AYFA 5BVPH 2HFFA 2EXWC 1T20B 5EO1A 3TBWB 2R0KH 5DMGC 3FCTA 1K4DB 1S5IH 1JGDB 2OBGA 3HG1B 3HS0B 1YNLH 5HTSA 3PNWB 1BQSA 1KIRA 3WS3A 4N0YL 1DZBA 4KMQA 3MLXL 2EE6A 2H3NB 3BZFB 5D7LA 1NBVL 3MYJB 4HG4J 3QSKB 2ZUWA 1MAJA 1HI6A 3BE1L 4YZFF 1U8MB 3AB0C 5B22A 1F3RB 1WITA 3GJEA 5D2LF 4P46A 5KANI 5L0QB 3NGBC 3HI5L 5FHBL 2I24N 3IJHB 5DJYB 2BNQA 3RWDB 2GSGA 1KCSH 2NR6C 4CL7A 1X5LA 1BLNB 2PXYB 4K9EC 1MWAA 1RI8A 1KJ2L 2FGZA 3CK0L 3ROOA 3RGHA 1AY1L 2VISB 3SO5A 3QO0B 4PREB 2A9NH 4X99B 5JDSB 1OCWH 1A7PL 1IGCL 1BIHA 3V2AR 5KW9L 1OSPH 2W9DL 3I50H 2ADFH 3V4UL 2HFGH 1D9KD 3QEHB 3S36H 1IILE 5CBEA 4NWUL 4JO2H 1FL6A 5LGHH 3O45B 2W0FA 5DK2B 3D9AH 2VZTA 3LKNA 5GSRA 4QRRE 1I7TB 4IRSA 1TZGH 1U91A 2EYSA 4X83A 2W59A 4G8GA 3R1GH 1S8DB 3TJEH 4P5KB 3FTGA 4AG4L 2UY7A 1XF3B 4PGBB 4APQA 2XN9D 4MAUH 3CPLB 2IBZX 5JHDE 3CMGA 1MCCA 4LCYB 1MHHA 3EOAB 4RQQB 3JWOL 3P2TA 3SDAB 2H1PL 4U33A 4CMMB 1OAZH 1YQVH 2Q7YB 1X5KA 3PXHA 4KJWD 1WWAX 2FWOA 4YXKH 1A1OB 1KEMH 5I1CH 1XCQB 1NKOA 3T08A 4F7TB 1C08A 2XYCA 5TQ2L 4JM2B 4LFHD 5F9JB 2R2BB 5HYFA 1NBYB 2D0HA 1CGXA 2H6PA 1LDPH 2OL3A 3SKMA 4DKEH 5HI5C 2FDBP 3G5VA 2MSPA 2EH7L 3NIDF 1LO2H 2FLBT 3QEUB 4AEEA 1KN4H 3DI2B 3GJFH 1S7WA 2HFEB 4H88L 4JY5L 1S9KC 3OGCA 1OTTD 4NO0A 3UTZA 3EYFB 4A2LA 3GM8A 5DJ0B 2CO7B 4X4ZA 1BQLH 2EDRA 3PWPA 3AB0B 1MCPH 5F7FA 4D0DA 1HH6A 4IRZH 4KZDH 4ZDHA 2EDOA 2V7HA 4OZFG 3FO9A 2VZVA 1MAMH 2VZ1A 1S7SB 3OAZH 1BJ8A 1HHIB 4V1DA 1F45A 1FFQA 4JR9H 5TDOA 2APVA 4P2RD 4CDGC 1J8KA 3TFKC 4I9WE 2PYED 1EAPA 4JFYA 1TZIA 4NQVB 2NXZD 1PZ5B 3DROA 1EXUB 3EUUA 5TGBA 2WUCL 5D9SB 3I3EA 3KJ6L 2VUOA 1OF2A 1KV3A 4JZOB 2DJ4A 4XCCL 4YHNB 3UTTE 1TDQA 1CFSA 4OUUA 1TVHA 1AXSA 3H7LA 4OSUL 1GHFH 1FVDB 4PJIF 5CJ8A 4OGXH 1I7ZA 5DSCA 4AIZB 1KPVB 4OZIE 1OAYL 5IK3B 5TDPB 5DVOA 3IDJB 3ULVL 4NKQB 5FO7A 3H3PL 5AYQA 4LNRA 1CD1A 1TMCB 4S1RL 1NFDE 4E41A 2N7AA 1MCHA 3GMRB 1C1EH 4HSQA 4MJ6A 2Z31C 3PL6B 5C0NC 3AC0A 4Z0BH 4EIZC 2WW8A 3BN3B 3FL7A 4F33A 1PQZB 2DMBA 3BT2L 3VRLE 3G6JA 5DZNA 2VDPH 1RY7B 2V5SA 1F6AB 3ULUE 3U6RA 5CFHA 1MY7A 4X6BB 1CE1L 1YC7A 5DEFA 4KKCC 4J3WA 5GISH 5L8KB 4TSBH 1IQWH 4CBPA 4K7FA 3T3PF 5CZKA 2EIDA 3ZSTA 3BN9D 2YZ1A 4FFYL 3LOWA 1EO5A 5C0EA 3VFPB 1YA5A 3TV3L 3VRIB 3RVUD 5JNYB 5ESQA 5JW4Q 2V2XA 3FRPG 5HYJA 5E6IA 1YMHB 5E5MA 1WK0A 5F9OH 4DZBA 4FXKB 3VXSB 1UM5H 2Q7NA 2AXGB 1OGAB 1B0WA 2FX7H 4ODVH 4PP1D 5GGTA 5D6DA 2BOBA 4OD3L 3DNKA 4ZFZA 3IXTA 4WI7A 3GHEH 4NYLB 2E7LA 4X7TA 2GYSA 4L9DA 1FFRA 2X4SA 1FL3A 2H2PC 1Q94A 2F8VA 2VLJD 2FRGP 5EOQL 1OQOA 3K0WA 1AR1D 5DFWH 2FD6H 1ZS8B 3MGTA 1RZKC 4H1LG 3EYOB 2VXSH 2WANA 4JFED 5FIEA 4NM4L 4TULH 3TZVA 2WINB 3NFSL 4YDVB 2XTJD 4P2QA 4L4JA 5HHMD 2G9HA 5IQ9A 1OARL 2BSRB 3KXFD 4WO4D 4CVZA 1GOFA 3WFHB 1YMMB 3FT2B 5JOPE 1KIQA 3ZE2E 4HXAH 4Z77A 4KQ4L 3MJ8A 4O00A 1PEWA 1ZANH 2A83B 1S9VA 1UKTA 4FQCL 1FPTL 2QTEA 4LLUB 3F8UB 3D39A 4G42B 5F3BB 4MA3B 1KB5H 4ZPVA 2GUOA 1DFBL 4N8VG 3WCYA 3U9PL 1UM4H 2MQ3A 4WGWB 2QSCH 1NGZA 1T0MB 3S96A 4NP4L 1JWMB 2Z31B 1T6VN 4PRNB 3DIFB 1F4WH 5HYQA 4HWUA 5MEOA 4P2OD 5IB4B 4PRIA 3HZKA 2OP4H 4MZ2A 1TTGA 1AQKL 3CJJA 4BK4A 1YEFH 2Y9RT 1KELL 4BJLA 3Q0HA 4P3DA 5K9OA 4LCIH 1T3FA 3PIQA 4LDLB 4ZOCA 5EU7E 4U3CA 1Z9LA 5K93A 4OD1L 5IW6A 2VDQL 3WKML 3EFDL 3QIUB 2VDLL 5LG1A 1PLGH 3QH3B 1FZJB 3MZTA 6CGTA 1LEIB 3MRPB 4ORGB 5ICYA 1FIGH 1R5VA 3FAXA 4H25B 5FYKD 3IFPA 4PGDA 2ZPKL 4U1KA 5L88L 4YXLL 1O0VA 4L3AA 4BSWB 5EPMA 3QA3A 4ODXA 5J6HA 1NC4D 5E56A 4MB5A 4S1QH 5IMKB 2V2TA 3KR3H 1WCBA 1MI5E 5J89A 2IBZY 1KGCE 4OLXL 4XXDA 4YFLF 5KSBB 1NMAH 4QRQA 1VERA 2GCYA 3BQUA 3MLZL 5C0JB 3X3GL 3PWPE 4OB5L 4LP5A 2Z4QA 1A6VL 5KANG 5BO1H 3QULA 4NRZB 5C0AD 4ZYKA 4K8RD 3BVNB 3TBSB 3W9DB 2EDTA 3BD4A 1U3HD 1JV5A 4XVJL 2DQEL 4MQTB 2D9QB 3UJTH 2BOCA 3HTLX 4RDQF 4IRJA 4V1DE 1ZLUH 2P5WB 3TJHC 1XEDA 2W9EL 1FORL 4NJAL 3QUKA 4NC0B 2MCG1 1MLCA 2P8PA 1MJ8L 4U7KA 3BHBA 1F11A 3RWIB 2JJVA 5FCUH 4M8QB 3STBA 2BNRB 3V7AE 4DWHA 4N0UE 5HYSB 4GMTL 5JXED 1A0QL 4HJGB 4FQQA 5GGSB 35C8H 4Z7NE 4ZXBD 4BFEA 5AD0B 4PG2A 3O3BB 3QHTC 2FSEA 1P69B 4GAFB 5I71C 4ZMAT 5CSZA 1BX2B 1RJZA 2R9HC 2NY1B 2F58L 5FDWA 2PTTB 4BFIA 3DX9A 3P9MB 3OBAA 4L4TE 1NAMH 1N8ZA 1FG2A 1S7UA 5IGXL 3DXAD 5EN2A 2C7UB 1IGJB 3SY0A 2CPCA 4F57L 1DBBL 5GRVK 3KLHC 2PYFB 3OXRA 3MLTA 1C7SA 3U1SL 3RZCC 4LCUB 5DWUH 5FM4A 2PW2B 2XA3A 4BZ2L 4PJ8A 3WFCL 2ICWA 5GGVL 1KT2A 3ARGD 1G7PB 4XBGA 1UVQA 5H35B 4ZUSB 3MRLB 3HMXA 5IEKB 2XICA 1S9XB 4KQ3L 3LS4L 1I9JL 5IROC 4POYA 2Z8SA 2Z93B 4MNQA 5C0BA 5FYLH 1T5WB 1BF8A 3JTTA 3GMNB 3LY6A 5CINL 4Z7VA 3A0OA 1ZEAL 1MCBA 4OIIL 4Y16D 4CADA 4PJGF 2GAZB 1MCEA 3L3GB 3QZWG 3FFCA 8FABB 2WLZA 2A2QT 5LKNA 3IGAB 3JSSA 1PX3A 2ZKHH 2COQA 5IT2H 1DQLH 3UTQB 4DGYH 4HUWA 2IAMD 1QZ1A 4BH8A 4LEOB 5BOPA 1U8IB 1UB5A 1YPZE 4O02L 5C07A 3HAEG 4PRBB 1R3JB 3PWUA 1A14L 5IMLB 1MQKL 2FH8A 5I19L 3EJZC 4GRMB 1MREL 3LKOB 2PTVA 1J05A 3LKRB 4ZQKB 4D3CL 1J1XH 5DFVC 4Q9QL 5J1AA 2WWKT 1V7MH 4L4VD 1CIDA 5BW7A 2ZOKB 4POUB 1IFHH 4QO1A 5GRXG 3S88L 5IB1B 3MREB 2VLRB 1N6UA 3HUJF 1N2RB 3VFUA 4RMSA 4XAWH 5DT1H 4P2QE 1XF4A 3QBTB 1MFDL 5E2JA 5KSAA 1HHJB 4ONGL 4PRPE 2YUVA 3MRKA 4MLIA 3GSXA 5EZIH 3BWAA 3TWCL 1Z5LA 4LSSH 3HG1D 2XN9E 1DVFC 5F1KC 3IFNL 3X11B 3T0EA 3RWHA 1DUZA 1FNAA 4JZJA 1A9EB 4FG6C 5BMFL 3W9EB 4Y2OA 2Q86B 4ODHH 1CD0A 5EZLB 5F7HA 1OP5H 5JQHC 5ENWA 4JHWL 3NA9H 2QR0A 1TVDA 4WNQA 5LXGH 4ONOA 4AEIH 3PQYE 1P4IL 2XG5A 3RZCB 2YD6A 3BKJL 5E1AB 5LBSH 4OLWH 4UNVA 2PF6A 3DRTB 1FZKA 3WHE0 4FFWD 2PXYD 3HFML 3VW3H 3L6FB 1JRHL 4CGTA 1PDKA 1AGFA 4WI8A 4WGVB 4BQ8A 4JPKL 4GUPA 3N1MC 1A1NA 4IOIB 4XMKL 5SWSB 5L7XH 1UCTA 5J6GA 3BW9B 5D6CA 4XGZB 1DQJB 5CZVL 1BQHB 4HFWA 5CEZH 2HLFD 2A73B 1KTKE 4H20L 3S5LA 4LVEA 1W0VA 2I07B 5IVXE 4C59B 2HH0L 4UDTA 4AEFA 3M8OL 1MELA 2X89A 4ZS6C 5LCVH 1AQDB 3RKPA 2Y36H 3HNTL