5BQ7B

Crystal structure of chikungunya virus-human fab 5f-10 fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
214
structure length
201
Chain Sequence
VLTQPPSVSGAPGQRVTISCTSSNVHWYQQLPGTAPTLLIYVNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYGSAVFGGGTKLTVLGQPLAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 5F-10-Heavy Chain
publication title Structural Studies of Chikungunya Virus-Like Particles Complexed with Human Antibodies: Neutralization and Cell-to-Cell Transmission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 201
sequence length 214
ec nomenclature
pdb deposition date 2015-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bq7B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bq7B01
5DUML 4EQ3A 4S11A 5GIRA 1NCBH 1G6VK 5GRXG 1G6RH 4XHJD 1U3ZA 3HNSL 4PRNA 5EU7E 1S7UA 4L3CA 1A7QL 4MNGA 4NZTH 1AJ7H 4XP4L 4G6FD 3QUXC 1XF4A 4I3SH 2VH5H 3T2NL 3PHQB 4O2CB 1U8IB 1PD6A 5DD3L 5GS1C 1KIUA 3H42H 1X7QB 3QXDA 2J6EL 1F4YH 5C70A 3EJZC 4XVSH 3VFTB 3IDGB 1MWAL 3E2HC 3D5OF 3BH9B 4R97B 1YC8A 4YDVA 1U2CA 1EK3A 1IZKA 4X4YB 1CL7L 1JZ7A 1I8LC 1OAQL 5HI4C 1HDMB 1H3XA 3DSFL 1QSED 4Q9QL 5F97E 4RMVA 1F00I 2OJZH 4P9MH 1P5VA 4DVBB 1AIFB 3PDGA 2GQHA 1N6UA 2I07B 1WIOA 2DQCL 4L3EB 4YO0A 1IFHH 2F53D 2JJSA 3KS0H 2IPUG 1OLZA 4CN6A 1P7QA 2WUCH 1KIQB 3MRMB 1FSKB 2NZ9D 3DX9A 1N3NB 4FQLL 2DL2A 5ELIA 2VIRA 4QHNA 4BFBD 4M9PA 1MSPA 3BUYA 4XCEB 2Q3AA 4Y2DD 5ICZA 4WW2A 1DLHA 3VFRB 4LCIL 4G9FE 2DQEH 3O2DH 1MFDL 2BMKB 3QFJE 5FKPA 3CH8A 3O3UN 5JNYB 3U4BL 3SO3C 5I30H 3H7LA 4LMQI 1NGYB 1L9NA 3A6CH 1JTOA 4YPGB 3VXMA 3BGFB 1PBYA 2H9GB 2DQFA 5KG9A 4EDXB 3G6JA 3MC0A 4ZD3H 5JXED 4L8SB 4Z18A 1XFPA 3KPRD 4OGZA 4NBZB 4YBHA 1TJIH 5CGYC 1CLYL 5DTFA 5KSBA 4XP9H 5D1XC 2YUWA 1KXTB 1E4KC 4MB3A 5E4EC 1IGTB 2BY2A 1EBAA 2H26A 4WY7H 3WFCL 1W72L 2P42B 5F6IB 5JW4Q 1F3DJ 3BW9A 4ZUVA 1DSFH 1C08B 3H9YA 2BZDA 3HS0B 5CJ8A 1CS6A 4E9LA 3DXAE 4KVCH 3OKDA 5TE6H 3MLRL 1WUNT 3OR7A 4W4OC 5GGRB 1DBML 3IKCB 2MFNA 1UC6A 1UQSA 2AJ3B 1KCRH 2OBGA 5IBUG 1PEZA 2ITDA 1S78D 2F54E 3L3KA 4ZPTA 4U1SB 1AGEB 3QBTB 3L3JB 1V3KA 2OJEB 4FMKA 1ZT4B 4OJFH 4TRPL 3MRNB 4DGVL 1FNGA 2AQ2A 3RIAF 3RWFB 4G5ZL 4FFYH 4PJAF 3FMGH 1T1ZA 4RMWA 5DDHB 5TJWK 1H3UA 4PJBE 3CXDL 3FCTB 4R7NA 1CGWA 4CVXA 1AXTL 1KTLB 4LSDA 4Y8AA 4QGYA 5HGBA 2B0SH 1A21A 4H0GA 5JUEL 3CSYB 1FVCB 4Z7WA 3FO2A 4OV5B 2DWEB 3AC0A 3UPRA 1UM5H 5HVHC 2DIAA 4JQVA 4EUPB 1EEYA 4KRLB 4KK6C 5AAMA 4P4KD 3R06A 3AFLA 4RISL 1GOHA 4TOYL 3WFBH 3QDGD 4BH8B 4M61B 1R5IA 5IW6A 3IJHB 5I1CL 3V5DA 1O5DT 4MB5A 4F7CB 4PJHE 4K3DL 1X44A 2AI0L 2VDLH 1K3ZA 4Y4HD 5IVXA 2A6DB 3RVUC 3ZDXF 4CVZA 3S4SB 1FRGL 4M5ZH 3MLTB 2GFBB 4JZJC 2VZ3A 3BP5A 1RUAH 4E41D 1YEGL 5L9DH 4JM2C 2FECI 4BZ2H 5A2JH 2PR4L 3OF6D 4HMEA 2R9HC 1FVDA 3BVNB 4IDJH 3EBAA 3IDMA 4AIXA 2BSSB 5J9PA 1MJ7L 1NUFA 1NFDB 1KIPB 2BERA 4F33B 1IM9B 4FQXB 2F15A 5F7MC 1T0PB 4LPYA 5B8CA 2W9DH 4Y5VC 2DQDH 5DVKA 4Y4KA 2X4OB 4HT1L 1IKFH 2IPTH 4Q6IB 2EYRA 4LVNC 4V1DD 5E8PA 1P69B 3QEQE 4KHXH 3V5KB 2DN7A 1KT2B 3OTTA 4RGOH 3H7BA 2LAGB 4NFCA 1PSKL 3S34H 5JPNB 3QWRA 4HD9A 4Z77A 2W0PA 4NN5B 4ONHB 2EXWD 3MRKB 3KPLA 3UJTL 4OF3A 1CGSH 3B8YA 2ZSWB 5EZOH 3LN5A 3QB7C 2XFXA 3QCUH 4QRPB 5C0NC 2V2XB 1AGCA 4HIJA 3RIAK 3KPTA 3T1WA 1AHWB 4Z76A 2JIXD 5IEKB 2HKHH 1AKJB 5C0DA 1OLLA 1NUGA 3FO9B 1UM6H 3W9DB 4YH6A 3RRQA 3T04D 3QNXA 5J57B 1RFDL 1U95A 3EKCA 1JV5A 1G7PB 2R1XA 5IHUL 3ZL4H 2VERN 1NPUA 4MVBC 4U0QB 4EDWH 3BRFA 5T1KA 1W0WB 3B3IB 2CXGA 1AP2A 1QLRA 2DKUA 5C3TA 2JK5B 3WO3B 3BPLC 2GJ6A 3JWDL 3V7AE 3LVEA 2OTUB 5D1QB 1FFOA 4M6NL 2BVYA 2Y6SC 4Y4FB 3BEWB 5EOTB 1BQHA 3MLZL 5EUOF 1HN1A 3EZJB 1NLBL 4U1HA 4ELMA 2QQKL 3O3EA 4LPWA 4HS6B 5FUZL 3RY6C 5DVOA 3KYKL 4M4PA 5DFWH 5IB4A 4QTHA 3TO2A 2B7DT 4CU8A 1U8HB 4MNQB 4GFTB 2VSCA 4LFHD 2ADGB 3BHBB 1TFHA 5KN5B 4YXHL 1D9KA 3Q6GL 4WWKA 2RB8A 4WTZG 4TQEH 2I24N 4UT6L 4R2GC 3DVGB 3MLUL 5KZCD 3TBWA 3PDOA 3JUYA 2B4CH 5L8LB 5IB5A 3CVHB 4D9LL 4XVTL 4APQB 5ACZA 4JZNA 5LCVH 5E1AB 4XP6H 4EN3A 2YEZA 1BQLL 4LRIA 1KPVA 3RDTD 4I0PD 4MAYD 5JZ7C 4DN3L 2APXA 4L4VE 4HKXB 5KOMC 4JM4H 3P4OB 3HZVA 5KW9H 2A9NH 1ZTXL 4R4NC 5KSVA 3MYZA 1FV1A 1I4FA 2G5RA 5AZEL 1QSFB 4X4ME 1R3LB 4NYLB 1HYSC 2R4RH 1JE6A 3K0WA 4HK0A 2AV1A 4HWEH 3ULVH 2NXYC 5E2UH 3HA0A 4I4WB 1I9IL 1NDMA 5J0BA 5SWZA 3L3IA 3IS0X 4N0YL 3Q0HA 1YEHL 3UTPE 32C2A 4MA3B 1GGBL 2VAAA 3MREB 4DUVA 5D7LD 3X12B 3EYSL 1ZVYA 1F3JB 5J6GA 4F9PA 2APBA 4GW1A 4M48L 3RI5F 5E24E 2NY0D 2OR9L 3ROOA 5I18L 4OGYL 3S36L 1NC4A 1OAUH 4Y16C 4XPAH 3CU1A 1IQWH 1C5BH 4WCYH 4UT9H 2EEDA 4PJ5E 2VXTH 3RIFK 4XPBH 2ESVA 4OZIF 3FOMB 4OLWH 3O4LB 4PJ9B 3EO0A 3D85D 2MQCA 3MGTA 4KH2A 5C71A 4YK4C 5HI3C 3MX0A 5T1LD 3CC5B 4KKLC 5EIQA 4PRHE 1INQA 1W8NA 3KPMA 4NQCA 3I75B 5CD5D 3TF7C 1T2JA 1AD0A 2C7UB 4XWOD 5GS0L 4OGAD 3OR6B 4KZEL 4X7CC 2AAVA 3R1GL 5F9WB 5FCUH 1OW0C 4IIQB 4P5TB 1U3YA 5H8DA 5JQHC 2ZUUA 5GS0D 2ARWA 2OP4L 3K46A 4LSQL 4Z7VF 4HFUL 3THML 2WIMA 3MLSH 1Y6MR 1RZGB 3FQRB 1T22B 4PJXA 4LLYB 2B4CC 1MF2L 2OL3B 3OJMB 5F3HA 2IJ0C 4JFFA 1T5WA 2X4NA 5HDQH 2XZQH 1XR9B 2UZYB 3NABH 4NFDA 4U1JA 2EH7L 2VDKH 3HE6D 1FNEB 4MXWH 3LD8B 3QIWC 5SX4H 2IF7A 3MV9E 3IXTA 3IFPB 1XCQB 4AM0A 2Z35B 1LEIA 1KFAH 1KBGL 4G3YL 3VCLB 3QRFM 1GAFH 4S0SD 4LCWD 2K7PA 2GW5A 5FGSA 1FP5A 4G42B 4GKOA 3PP3H 3IB4A 4Y8DC 2VLME 1VFAA 3S97C 2ID5A 1XGQA 4OIIH 4X6DA 1MEXH 1WGOA 4J12A 3UTZA 3ULVC 4G7YL 3WIFB 5FAAA 5IFJB 3S3PA 1T3FA 1G7HA 1I9JH 4WU5A 2H6PA 5HJ3A 3UYRH 4IRJC 2EE6A 5D6CA 2ERJB 4M8VA 1RPQA 3MA9H 2VXSH 4JPKH 1I8KB 3GK8H 4DCQB 4C56B 3F12A 3OX8A 1WC7B 4QEGA 4L9LC 3RI5K 4YHOH 3T1FB 4TTDD 2VDML 4AL8H 5TE4H 3WFDL 5FV2A 1ZHBA 4O58L 3O45A 1J0KA 5FOJA 1WAAE 1YEFH 4MLIA 1IL1B 1TXKA 1KGCE 1JGLL 5D1ZB 2IGFH 5KS9E 3VD3A 4LGPB 3V4UH 1IT9L 1WZ1H 1SY6H 4XH2A 4Z8FL 5FV1L 1GRWA 3RKDD 2ICEA 3HI1A 2UWEE 3VGHA 1YDPA 1IM3A 5IBTH 5EZJB 4MD4A 3BKJL 2A74A 2YN5A 3WV0A 3OZ9H 1JHLL 4NCC2 1PQZB 2A73A 2P1YA 3V2AR 4BK5A 3TYFA 1Q0YL 1WCQA 4KTDH 3FN0H 1K8DA 1KTKE 1FAKT 1BFOB 4UV4L 5ICYA 2EDKA 1Q0XL 2LU4A 3QUXB 3ARBA 1HXYB 4R4FH 3JWOL 5ANMA 4X6FA 1ZVHA 1TETL 3DSNA 5GS1B 3RU8L 1MI5D 4OGXL 3BPCA 1DEEB 5HHMB 3U4AA 1J88A 2QADD 1A0QH 2X05A 5HYSB 5IKCA 3E2HB 1H3PL 1HHGA 1KLUA 1TZHB 3GDBA 2E9JA 1KCLA 4HX1A 3DMMA 2P8PA 2OTWA 5IROC 4PGCB 4ODHH 1I9RL 5HHXH 3PQYD 2XWBA 5IFHL 1FC1A 1ZANL 4ZUUA 1ZLSH 1RZFL 2EC9T 2EYTA 4I48A 1FAIH 1T7YA 4YNYB 5LGJB 2C4XA 4NO0A 3L3DB 2PN5A 1K2DA 5C0CA 3QFDB 5C09B 1UH4A 1FZKA 4KJWC 3L1OH 3RAJH 2R56H 4HV8B 2NX5A 3D39B 1A6TA 1DE4A 1JN6B 2RAMA 2OS7A 5E2WL 5KTEL 3PWLA 4JCLA 4U1MA 1W0VA 3D3VA 1EAPA 4I77H 3V7AG 5BW7C 1GOFA 3RVXC 3QEGL 3V6BR 4JFEA 4L4TD 2Z31D 4WFEE 2FR4A 4LAQH 3RQ3A 4HH8A 1X4YA 1OARL 4PJCE 3CDYA 3SO3B 2DM3A 4EI5D 3MACH 2V2TA 2AEIT 1HNFA 1QRNE 2W0LA 1R5VA 3QAZC 1LILA 5CZVH 5EU7C 1MCKA 5IJKA 3N1QC 4ONFH 1V7NL 5KVEH 4R90L 3S88H 4KGJA 5GGTL 3VA2C 3BGMA 1CDYA 2ZUQB 1JJUA 1MHEA 2RGSA 4HKJB 5D1XB 4FTVB 5E4EB 2DBLL 1WZKA 3VRJA 1IC5L 4X4XB 1OAKL 3AS3A 4FQ2L 2ADFH 3X3GH 3BN9C 1JP5A 1UCBL 1AQKH 3MNWB 3SDAC 1VFOA 5DK3A 3TVMD 3HZYA 1JPTH 3SGKA 1BD2E 2BC4A 2DYPA 4JY5H 3HUJE 3SCMD 2P49B 43C9A 1I75A 3MV7E 2P8MA 5I17B 1UA6L 3BEVB 1G6RB 2XZCH 4P5MA 2FLRT 5IQ9B 2IADB 1B3JA 1JI1A 1MHHA 1XH3A 3VDCA 1J0JA 2GSGB 3B8SA 3FQXB 3I02A 5C07A 2XOTA 3ARGC 4P5KB 4AH2A 3GGWA 1QPPA 5C08D 1CF8H 1O7VA 3QUYA 5J89A 2HYMA 3CFBB 3D0LA 1ADQA 3ECBA 4PJDE 2ZCHL 4HIIB 5HVHB 3H9SE 3NACH 2A6IA 4NHCH 3TJHD 4KI5D 2IQ9L 4GW5A 4HJJL 5AUMB 2OK0H 4JFOA 3DETC 3GJFA 1NUDA 3VFPB 4AEHL 1ACYH 3T0VA 2HFEB 4OLUH 4RGND 4JGMA 3KS0J 3S35L 5HXMA 2A1WH 3PWVB 4HWUA 3T77B 3O9WC 1IGIL 2V7NA 5DJ8A 4N0UE 4LSUL 4N1CA 1I1YA 1S5HA 3ES6B 4LLVB 1QLEL 4OD2A 3DIFA 1NFIA 1OSPH 2AKRB 4LASH 3W0WE 2OX5A 3V8OA 4FQCH 5DMKB 1XF2B 3VFUA 2GEEA 4BQCA 2PCPB 2AJUL 3FT3B 3WUWG 2P24B 3MJ8A 5JA9A 4JM2B 1CE1L 2AVGA 2E6QA 5HGDA 4KU1A 5T3ZH 2IPKA 4LKCA 1B88A 3ORJA 3GSWB 5TFSL 4NC1E 1WTGT 3MRGB 3FFDB 2GYSA 4X0KA 4NSKB 4YC2C 3GIZH 3TJEL 4XWGL 5HVFB 4OZIB 2K7QA 3QWOA 1A64A 3P2TA 4UINH 4ZPVB 3TO4C 4Y5VB 3O3AA 1A6VH 2C9AA 2D9CA 4XPHL 3IU3A 4QXWA 5F7FA 1P5UA 4LVNB 3ROLA 4U33A 3PHQA 4O2CA 1KB5L 4J6RL 3EFDH 3IRZA 3MBEC 1X7QA 2HRPL 4LARH 2FD6H 5EZLA 3IDGA 1KEGH 3BH9A 2WIIB 5F88B 2W1NA 4X4YA 3H6JA 1X9QA 1DN0A 1Z0MA 3N1PC 4JG1H 1PFCA 3BXNB 1N0XL 4BUGA 4OZFB 4BELD 1VESA 2BSED 3MV8E 1OT2A 1CYGA 1AIFA 5C0GB 4E5XB 3L3HB 4L3EA 2ZCLH 4OLXH 4MYWB 3HAEG 1L9MA 2Y07L 2YRLA 4P2OC 4GMTH 4GG8A 2WANA 4H20H 1N3NA 4C57C 1NLDL 4N68A 1CXHA 5TGBB 3TZVC 2GTZB 4GRLD 4KPHL 2FJFA 3U36B 3H3PL 1KSRA 3VFSB 1MFAL 4Y19D 4YX2H 3VFRA 5HPMB 1LO4L 4U1NB 4PRPD 2YKLL 4R6UA 4FQXD 1M7DB 1OB1B 2WQ8A 3QZWG 2YD8A 2Z0BA 2R69H 4OCYL 1WISA 4MJIB 3SJVE 2RJMA 3KLSA 4YHZL 3BPLB 1U6AL 4BSWB 1DANU 3IAPA 4NRYB 4XMLL 1CFNA 1FN4B 1FJ1A 1MCOH 3CXHJ 5HYQB 3RGVC 3BKYH 4MQSB 4WTZA 4N9OB 1BFVH 4EOWL 4HBCL 4X9FA 2H9GA 3G6AB 5B39G 4UQ2B 4EDXA 2BY1A 3VGGA 3MJGX 3QDJA 4TVPL 4Y1AE 5I1AA 4HW6A 5LWYH 4OCXL 1X5JA 5DUPH 3ZT6A 4KK8D 3KPNB 5IG7B 3L5HA 4NWTH 3EOAB 2X4PA 5E6IC 5I1JH 3GIVA 1MCDA 1I8IB 1IGTA 1DEDA 5EN2B 2AJYH 4JREC 4TVPD 4XNQA 5EZIH 4HZLB 2CMRH 7FABH 3O6FC 4XB7A 4QRPD 5F7WC 5F7UA 4R2GB 3PGDB 2WP3T 1JNLL 1RMFL 1S9YA 5GGRA 3IKCA 1Y6NR 4LGSB 4ETQB 2SEBB 5DYOA 4M00A 2BNRE 1DBAL 3DX6A 2C1OB 3IF1B 3SGDH 3JV5A 1UT9A 1ES0A 2A77H 5BRZE 3QUZC 1G9NL 1QR4A 5LQBL 5BOZG 1NAMH 4LSTL 2X44D 2VZTA 4HEME 3MRNA 1TMCB 5JHDD 3MXVL 4FZ8L 5SX4I 4MQ7B 4CNIB 3QO1B 5I1HH 3NFPA 4UQ3B 2UV3A 4XRCB 1BBDH 1UADC 1AR2A 1X5HA 1SYSB 1IZJA 4G7VL 3QHZL 1N2RB 1Z9OA 4PJFF 3F6LA 1YMME 4OV5A 5E2VL 3PL6D 1J1OL 2NXYB 2IMNA 4NKMB 5C0AB 3SDXA 1KXVC 1QBAA 1V3MA 1EGJH 3F8UB 1T1YA 2CRZA 1DL7L 4BH8A 4M61A 4YAQB 2DMBA 4MNQD 2G2RB 3IJHA 1KJ3L 1CK0H 3JTTA 3P11H 5GQBA 4HG4K 4YBQC 1QSVA 4XNYL 1NGQH 2ADJA 3WHE0 5GISH 5MEPA 3A0OA 2A6DA 5I1DB 1MNUL 3VU2A 2A6JB 5BQ7B 2EC8A 5K9KA 3O6MH 3MLTA 5JMOC 3BAEH 2GFBA 4Y16B 1PGRB 3PJSB 1KJMA 1FDLL 1IAIH 4UTAL 4FFVC 4R96B 5B38G 2CLZA 2EE3A 4P2RB 4P3CH 1CBVH 2MPAL 3PWNB 5HVWA 1MIEL 1NFDA 1KIPA 3BZEB 1C7TA 5J1AB 2WSKA 2KH2B 2DQUL 1NCTA 1IBGH 1N5YL 3HAEH 1NJ9B 1LNUA 1I3UA 4IOIA 4OKVB 2Q7YB 1KT2A 5CEZL 1ROWA 1UACL 3MJ9A 2HRLA 2EC9U 1RULL 2G9HB 2F5BL 3IFNH 3NZHL 4BKLB 1P7QD 5IMOB 3OAUH 4ONHA 4ZDHB 3LKOB 3MRKA 3QNYB 2V5TA 1KCKA 2JE8A 5CEZD 1ZHNB 4D9QD 4BFGA 3CFJA 3MLVH 3B5GA 5HYFA 1X5GA 2ATPA 1T6VN 3C6LD 4KMTH 3ZE2F 3CZFB 1DQMH 1AHWA 4IMKC 5DJZB 4ZTPL 3QIWB 2EIBA 1W0YT 5AAWA 1F58H 4GO6B 5DD0H 1UM4L 1AKJA 3VFWA 3VXMD 2QHRL 4H26B 4UUJB 3FO9A 3HB3C 2DMKA 1NAKH 2L7UA 2ZCKL 1FZJB 1MREH 3FB5B 3PWPD 3EW3B 1G7PA 4FQQB 3NPSC 4AEEA 3RVVD 2JCCA 1BGXH 2F74B 5CP3A 1GGCH 4K3JL 3UZQA 3B3IA 1HSAA 3EAKA 1DBKL 3MRCB 2YSSA 2OTUA 1MOEA 1BOGB 3S96B 3OXSB 4IRJB 4NP4L 3RBSA 4M7LT 3I6LD 4P5TD 5FKAB 2H32A 3BEWA 4Y4FA 1T5XB 3FHAA 1JFQH 1JGDB 4KAQL 1MCPH 5DJDB 2CGRL 4U1LB 3TV3L 1U8OB 3Q1SL 1TZGL 3K2UH 3DHMA 3PG2A 2BCKB 1E28A 2HG5A 3LDBB 1UH2A 4L9LB 3B5TA 3UTTB 3WLWC 3IFLH 3HG1B 1NBZB 3BHBA 1DVFC 1A3QA 4OCSL 4UT7H 1U92A 2LAAA 2Q6WB 3CFDB 2X4SA 4OCWH 4ZXBD 5EDXA 4UOJA 1AY1H 4PD4K 3GMLB 2F8XC 1OM3L 3TYGL 5ETUB 3FL7A 1YEIH 3QRGH 1NBVH 1T6WA 4AMKL 1OCWH 4APQA 4NQED 1X6NA 4HF5L 4R8WH 3BRDA 2AK4D 5E1AA 1D7FA 2UY7A 5D71H 2L0DA 4YDKH 5FM5O 4HKXA 5AWNL 3P4OA 1EFXD 5E9DA 4CL7A 1OTTC 4K7PX 4XPGH 3GKWL 1MELA 3LKRA 1QSFA 1D5ZA 1R3LA 3CH1A 4QHUB 1Z9LA 2VQTA 2J8OA 5DD6B 2AJZB 4X83A 4QY8B 2YD2A 4C56D 4JHZA 4M7LL 5KAQF 4H5SA 4PG2C 4WTWA 3JSSA 4Q7DA 4GLRH 1UGNA 4FP8L 1E6OL 3GSUB 3K4AA 3P0YL 4MA3A 4OZGE 3MRRB 2DKSA 3MREA 1SBSH 4ELKA 4K7PY 5D5ME 4X6CB 3PP4H 2FBJL 1J0YA 4K7FB 3TIDB 2WBKA 4J4PA 4XB8A 4JAMA 5F7DB 5FYKH 1MFCH 3RBGA 4HG4J 5F1NB 5HYJE 2PF6A 4QXTB 3VXPB 4RFNC 4YHLL 1QFUL 3ZO0A 4JLRB 3O4LA 1K5NA 4S1SL 1YYLH 4YDIL 3VXUB 3LEVL 3VG0H 5JOFB 1N4XL 5FYLH 4ACPA 5D2LE 1SJHB 3QUXD 5JW4N 3VRIB 4PJGE 3QAZB 1FE8L 4W6WB 2Y36L 2EIEA 1QG3A 2ENYA 1HZHL 2R4SL 4ODXB 5HHMD 3MUGB 3EJZD 3OKKB 4PB0H 3QIUC 3SGJA 1XGPB 4A2LA 3BO8A 1WFOA 1UB5A 2YPLE 1RZGA 1KYOK 5IJVA 2VDRL 2WZPD 5EWIL 4X7EC 2DLTA 4GW4A 4MCYB 4A6YH 2OL3A 2Y72A 2EIZB 1XR9A 4HQQL 4XPFL 1RUPL 2EXYC 4FOMA 3SKJL 1DQDH 2JKXA 3SDAB 1Q9WB 3C08H 5GRUL 3DUUB 2DTSA 1FPTH 3RA7L 4RQQB 1E27A 2KQNA 1PZUB 3UBXG 3ZTJG 5EO1A 1E4WH 1O7SA 1Q1JL 1JGEA 4KQ3H 4PRBA 1SVCP 5D9SB 5DA4A 3WFHA 4HXBH 4NKDB 4ZFOA 4G80B 3L7EA 3ARGB 3JWNC 4NO2A 1OGAB 1RZJH 5BJTA 1I7UA 1WF5A 4P2QD 43CAB 2NPLX 2ILLA 1LK2B 2H2SC 4PJAA 3NA9H 4X7TA 1LMKA 3D18A 4DJMA 5CBEB 5FM8A 1YNLH 3FFCE 1D9KD 3D1MC 1L0YA 4NJAH 1LO0L 3WN5C 1DUYB 1XIWA 4PREA 1IARB 3JV6B 4X9BA 4MAUL 4PJFB 1H0DB 3Q48A 3TA3C 3STLB 1RV6X 3PHOB 1XGRB 2VL5B 5I8CB 5D1XD 2XKNB 4FTVD 1JWUB 4BH7A 2V2WB 3O9WB 4D0CB 1TZIA 3KR3L 4YHML 2WUBH 1UVQB 3EOTH 1KJ2H 5IOPA 2XN9D 2VYRE 2OTPA 3INUH 1CLOH 2K1MA 1KNOA 4WUKL 5J4MA 3HE7C 3OJDA 5IESH 5L7XH 5D1ZA 1CFQA 5F96L 1N6QL 3V9FA 3WS3A 4YHYC 4R26L 1FGVH 3ZKNC 4Q74A 4QRTB 5DHXB 4HBQA 4OF8A 3SGDI 3D87B 5E5RB 1FNLA 4HZAA 1ZLUH 1IKNC 1MAMH 3S3JA 1YYMH 4PD4J 4OM0H 3VFGH 3B9KD 3WHE1 1K6QH 3TO4B 1JI2A 3NCYS 5HI5D 4IRSC 2W91A 1HXYA 3IFOB 5ITFA 3AS1A 5ENWB 4KK6D 3ISWA 3M45A 3T3MF 3MBEB 3A67H 4I9WD 3RPKA 2QKIA 5D7IE 4D3CL 4MCZB 4U6VH 4M03A 1QYGH 4JFDA 3RJDA 3V52L 4YIQA 5JHLH 3OKLA 1TIUA 2HJKB 1B0RA 4KHTH 2YD5A 1A7PH 4LCUB 4PGCA 3RL1B 2BRRH 4JRXA 5C0IA 1YECH 3CDGB 3CLEL 2R1YB 5FHBL 4FABL 1U3JA 4YNYA 5GS2D 5MEQB 2EZ0C 1ODAA 4OB5L 1SYVA 3L3DA 3S37X 4F7MA 1P84K 1P4IL 5T1DH 4JM2D 4OQ1A 2I9TB 1PKQE 2HVJA 1TNNA 2J8UE 4HV8A 1WCBA 3U7YL 4EVNB 2R9HD 3D39A 4NQXA 1RZJC 2G60H 3TZVB 3DRTB 4H1LH 1VSCA 2DIBA 2VABB 4DZ8A 4OFYD 3UTSA 3B9AA 4Z6AT 5E70A 4I13B 1J9CT 4HCRH 4Z78B 1IAII 1PKOA 5INDB 3P0GB 2NYYC 5CLWA 1IAKA 3MRLB 5L0QC 1FL5B 4TVSa 4NM8H 5ALCL 5DQJA 2W0FB 4ZQKA 1A7OH 1TQBC 3QG7H 3Q5OA 3FB8B 1BJ8A 1S7TA 5EBGA 3TFKC 5KS9A 1LGVA 4NOBA 3C5ZC 1I7RB 4LPUA 3UAJC 4I5BB 2DS4A 3ZTJH 1ZGLP 4JRYD 5FIEA 3EHBD 3EDKA 3F5WB 3QEQB 4QOKE 5EUOA 3NMEA 5E6IB 4J3SA 4X99B 3WXWH 4JREB 5DSCB 1OAXH 1AI1L 3W2DH 4X4XA 3Q3GB 3O6FB 4DZBA 1T0MB 4XI5D 1H3TA 2ZWLT 3UJJH 3HZMB 1JNHB 2XQYK 4NZUH 3QUKB 3MNWA 3T0EA 2H2PC 4JO2H 1NMBH 1NL0H 1KB9K 5L6YH 1LE5B 3QUZB 5BZDB 1ZKAA 3FT4B 4L29B 3K1KC 4KMQA 4YWGL 3I50L 3GM8A 2DDQH 5FYJL 5FUCE 1BX2B 1G6RA 3SBWA 4LNRB 3U0TB 2R0WH 2IADA 5JLZA 4M8QB 3HCVB 3FQXA 1NBQA 3JZ7A 1DUZB 5FYJD 5MEOB 5TDPB 3HC3L 3B4NA 2CUMA 4MJID 4P5KA 4XAWH 3BESR 5IWLA 5IT2H 5CFHA 5IFAL 3FAXA 4YLQT 1OAZL 2H45A 2Y6SD 4M93B 5AYUH 4GBXA 1VADA 1BQUA 2D7TL 5DUMH 4HIIA 4DK6A 3FO1B 5I0ZA 4FQ1L 1QFPA 3HNSH 1PG7L 1A7QH 1UEYA 4XP4H 1S9XA 3QJHB 4GSDL 2FZ3A 5BVPL 2RFXA 1S9WB 4LBEB 4BZYA 4XBEL 3VWJC 1MIML 3NPZB 1WIUA 3SEPA 5DD3H 4JO4L 3PWVA 1YEEL 3KNBB 4PJIF 4YE4L 2J6EH 2W65A 5DC9B 4R2GD 3H9HB 1YNTB 5C6WH 4GAFB 4ZSOA 1EPFA 1MWAH 1CL7H 5DVLA 4X7SL 1CD8A 2AKRA 2R0ZL 1OAQH 4WUUA 1QRNA 3NOIA 1SEQL 2K9UA 3DSFH 4Z7OF 1IRAY 2HTKD 1RZKL 3TNNA 2NY1D 2Q86B 3ARBD 2MHAB 4JFXA 2WBJC 2DQCH 1KG0A 2C1PA 1CVRA 3J8F7 1LO5B 5EFIB 5SWSB 2E27L 2MWCA 1MFNA 3FFDA 3P73A 3EJYC 4OZIA 2IFGA 4FQLH 4MJ5A 1NDGB 3WNNA 4R4ND 3BWUC 2YPVL 4PGZA 4JJ5B 3HMWL 4L4VB 5BVJB 1QKZL 4LCIH 2ADIA 1BD2A 1DBJL 4G43B 2NXYD 4ZO9A 1MFDH 1JRHL 3KYNB 3U4BH 2EKSB 3ARFD 4MHHG 1GGYA 3GI9L 1BEYL 1AQDB 1JUFA 3MOAL 3QI9A 4KQ4H 1BVLB 2R2HB 4POYA 2WIIA 4HGMA 2BVQA 2CDGB 4S2SA 3ZE0E 1BPVA 2Q20A 4Z7VA 4OZFA 1AO7E 4LHUG 3I2CL 1OL0A 4GLRI 1LO2L 1EV2E 3L3HA 4JFED 4XNZC 1NAMB 4HSQA 5GXBB 2X4RB 1SJEA 1W72H 3L95B 3H9SA 2R29L 4WEMB 4Z0XB 3RVTC 3CLFL 3GBNL 1ONQB 3MLRH 1BZ9A 4GKZB 4CW1B 1DBMH 1PZ5A 3RY5A 4P2RD 2CLVB 3EDDA 2GTZA 5JW3L 4WFHD 3T3PE 3F6IA 4JFHD 5HI3D 3NPSB 4PTTA 4PJ5B 3BQUD 4PTUB 3HR5B 2GSIB 1M7DA 4XZUA 3CCHB 1P6AB 3CMOL 3IJSB 4KFZC 4TRPH 4IEFB 4DEPC 4DGVH 4WFFE 2P47B 4U1KA 4G5ZH 3WUWB 5FDWB 4BQBA 4LPVA 1T2QL 4M62L 1QOKA 1AXTH 1RUKL 1HILB 1NBYA 3G6AA 3ARPA 4UDTB 3TH2T 5CIPH 2VQ1B 5JUEH 1KEML 5D70L 5JIHA 4RAVA 1IJ9A 4HUWA 1YQVL 1UWEH 5B4MD 5KSUB 2FHFA 4AJ0A 1DVFB 5EN2A 3NZ8B 4RISH 4HZLA 4TOYH 2C26A 1JPFB 3ZDYF 3PGDA 1ADQL 3WDIA 5I1CH 4GG6E 2RR3A 4U1IA 2SEBA 4K3DH 4HH9A 5DT1L 2AI0H 3QIBD 4X80L 3I9GL 2ZPKH 2Z91A 1FRGH 4RFOL 5IEHB 2MQ0A 3MOBL 4CNIA 1G0YR 5FA3B 4YHNA 4J7RA 1YEGH 3HAEB 3RGHA 1XZ0B 3AREA 2PR4H 4NIKB 3ULVD 1KB9J 3W5MA 2O61B 1U8MB 1SYSA 4NKIL 4RGNE 2VR5A 1KJVA 2OXHA 3AU1B 2VLRB 1MJ7H 1FYTE 5MP6L 2I5YL 4I18B 5IM7A 3MFFB 3ZE1F 4N90D 4NKMA 3ARYA 4RZCA 4KJYA 2R2BB 5TDOA 5KBNC 4HT1H 5CUSL 2VB5A 1PY9A 4M7KL 2PW2A 4HIXL 4B50A 3F58H 1BFSA 3RWJA 4YXLH 1PSKH 3MUY1 3WEXB 3KXFD 4Q0XH 5I1LA 5JORA 3WNOA 3IGAB 5GRVL 5BQ7A 1IEHA 5CMAB 5IHZA 2EDTA 4G8IA 4N9GA 1T20B 4UNTA 2LU3A 3VXOA 4HWZA 3VH8G 4ALAL 4Y16A 1FL3B 1QR1B 5FFLA 1WSST 5I74C 3DGGB 1I1AB 4R96A 3IETA 4JQXC 5E08L 1YEDA 1LK3H 2EDHA 4LPXA 5FDYA 1EJ6A 3GBML 2YD4A 1HE7A 5FK9A 3BZEA 5J1AA 1RFDH 4QGTA 5E8EB 2XPGB 2C3XA 3REWB 5IHUH 4YGVA 1ED3A 2XTJE 4WW1B 2E6JA 3EOYG 4GRMA 5DGQA 5GGSB 4JFYA 5BS0B 5GGUB 1S7SA 2CKNA 4OIAA 2BOCB 1QFWL 3JWDH 1NC2A 2QHLA 1ZLUK 4P46D 4Y5XC 4M6NH 2BVOA 3DX7B 4PRIE 4RIRA 3I3BA 4Y4HC 5IMOA 4ZDHA 2FX9H 4JANA 3P9MA 4NGHL 5J6HA 3MLZH 3QNYA 3VXRA 2N4IA 5HY9A 1MFBL 2C4FU 3C8DA 4KRPC 1NLBH 4OQTL 2QQKH 5FUZH 3SDYL 1Q9LA 1TENA 5FUOL 5JO5B 3ZSSA 2UY6A 4Y19E 3CZFA 4PRPE 4E0RA 3GKZA 3ZKMD 2BOBB 4KJWD 4YXHH 4MQXD 4YPJA 2DQHL 3QIWA 1VENA 2Y4SA 3Q6GH 3C2AL 2AABL 4UT6H 3MLUH 3MNVA 2VLJE 3QDME 1GGUA 2J88L 1R0AL 3CVIL 1WWBX 1FZJA 4MD5B 1I3VA 3P77A 4LHJB 1BJ1H 1B0WA 4FQQA 3RVXD 1Q38A 4XVTH 1CFVL 1BP3B 1T83A 4M02A 3WN5B 1TTFA 4TVPE 4DN3H 3EIFA 5J06A 4PJCB 4WO4C 5FKAA 1ZTXH 3DNKA 4U1LA 5E5UB 1QEWB 3ZHDA 1BIHA 2OSLB 2QQNL 5AZEH 2J5LC 2O93L 4L9LA 1XF5A 1FVEA 1T04A 3UTTA 1BZQK 2IH3B 2DJSA 1EEZA 5F1OB 3DROA 4KMLB 3SY0A 1NBZA 4EJ1C 1I9IH 4OBSA 1N59B 2CPCA 2VDOL 3T0AA 2FEEI 3GSQB 2DTMH 2HFFA 4N0YH 3RWGB 1YEHH 1P2CB 2Q6WA 3HE7B 4ODUB 2PTVA 4Z7NF 3PABB 3JTSA 1GGBH 1S9VB 3D25B 3KWWB 4U6XB 5BZWB 5I76B 1VEMA 3ELAT 4KZDL 4XVUC 3EYSH 4YHYB 1T1XB 4RWYL 4X8JB 2XKSA 4M48H 2OR9H 1YN6A 5I18H 3BH8B 4OGYH 3S36H 3MV7B 2O5ZL 5EO0B 3K1DA 4HUXA 1C5CL 5HHOB 1CT8B 1AFVL 4OZHF 2QSQA 4G9FD 5JW4R 4IRSB 5D6DC 4CMMA 4F3FB 3JWDC 2X42A 2J3SA 3QFJD 3EGSB 1G7JB 3AM8A 4QHUA 4UOW1 1IGYA 1HSBB 2AJZA 4O02L 5I16B 4NDMB 4RDQG 1G7IB 3AB0C 4XNXL 4DWHA 3QWQB 5F7LB 4A6YB 1W8OA 4PJDB 5GS0H 4KZEH 4OZ4B 3R1GH 4L8CB 2ZUSA 5ICXB 2VJXA 4MNGE 1UENA 4XNUL 2D31A 3O9WD 3VI4F 3RTQB 4LVOC 4EKXA 1A6WL 4WJ5A 4BSJA 3GSUA 4Z0BL 3IU4L 4HJGA 2H41A 3LEYL 3KDMB 2OP4H 4LSQH 3U7WL 4HFUH 3THMH 4AT6B 2MSPA 3LKSB 3BIKA 4HGKC 5F89B 3TIDA 3DXAD 4HC1L 3D2UD 1NCAL 1MF2H 5LBSL 3C60A 1FIEA 3MJ9L 3RWHB 3W0WB 1CL7I 2EH7H 1T03L 5F1NA 4QXTA 3VXPA 2CR6A 4MLSA 2A6KA 4ZTOH 2LE9A 2F54D 3FONA 1JBJA 3RJQB 3DUSA 4WHYH 3VXUA 5C0RL 1KBGH 4G3YH 5L0QB 4YJZL 2V7HB 3ME0A 3TO4D 2IWGA 3ULUE 1QVOA 4C59B 1ZHKB 3QQ9D 1SJHA 1TQBB 4GQ9L 4LLWB 3VRIA 5ERWB 3C5ZB 3DO7B 3OXRB 1K8IB 3ARDB 1YY8B 4G7YH 3N06B 4ODXA 2CUIA 3MUGA 5J8OA 1DN2A 2PETA 4YZFF 1A4KB 5EC2B 1I7TA 1KJ2B 1TJGL 3VE0B 4XCNB 4LCCA 1JZ3A 5IMMA 4TSAL 2EDQA 3BN3B 1V8HA 2EYSA 3VXME 1DP0A 3C6SB 5KVGL 4CDGC 2NY0C 2BNQA 2I60L 5DHVH 4XTRC 1ZVSA 2EIZA 1U8LB 1R3JB 3G6JE 1A9EA 4PLNC 3VMPA 5DJ2B 1OPGL 3BWAA 5E03A 3SDAA 3V95A 2VDMH 4YHKL 1VFUA 2IFFL 1Q9WA 5DK2A 3LQZB 3MV8B 3WFDH 3EO9L 5D72L 3UJIL 4O2EA 2D4FA 2HT4C 2VZUA 4P2OD 1VGEL 4O58H 2WAHA 5D96C 1UKSA 3O3BA 5TDNB 5J1TC 1RVFL 5FO9B 3TBSB 3TZVD 4P57B 1JGLH 1N0LA 4XVJL 3I6LE 1FQ9C 5CD5C 2Z4QB 1IT9H 4NKDA 2WV3A 1T7WA 1NCDL 3TBVB 2Y5TB 4Z8FH 3ARGA 3ZYIA 4X5LA 3RWDA 1U91B 4MWFA 1QNZL 5DZOA 2PTUA 3BKJH 4ZUTA 2VSDA 3GRWH 3RGVD 4D9RE 1JHLH 5GS0C 1KTDB 4PB9L 1Q0YH 1DUYA 25C8L 1D6EB 3QEHB 3U0PB 4WVRA 4XXCA 1J0HA 4PJFA 4LPCA 4UV4H 2PYEA 3FB6B 2HN7B 3KPPB 5HYJA 1Q0XH 2X89A 4LNVA 3PHOA 3QEQD 3MZTA 3GMOB 3JWOH 5I8CA 1TETH 3VWJB 2FGWL 1M6OA 1F5WA 3RU8H 3AS2A 4Z7WE 4OGXH 4Y1AB 1DQQA 3UZVB 1UVQA 2R2EB 5GGVY 3MRPB 4P49A 5C0BA 1H3PH 3V6FA 2ED9A 4H1LB 3JVGA 1VGKB 1GVIA 4PV9A 1YMHB 1HHHB 1J1XL 3HLAB 3QUZD 5DJYB 1I9RH 2FB4L 2MQ3A 5IFHH 1ZANH 1A6AB 1X5LA 4XCFL 5IB3A 5IVXE 4ODTL 3NFSL 4DQOH 3OKOA 5DZLA 4F8QA 3FRUA 3AAZB 2NW3A 5FUCC 4WV1C 1P7KB 3KYOA 5E2WH 3P9LB 5KTEH 3GMMB 3TNMB 3UBXB 4NT6B 4PRDA 1A1MB 1EH9A 4RBPH 3QEGH 5JXAL 5ENWA 2FHCA 1OARH 4Y89A 3QQ3B 3MBEA 5ISZA 1YMMB 4J4PD 4TTDC 3GSXA 1UB6A 4MCZA 4UDUB 2D03L 4PGBB 1A7RL 1ORQA 4NWUL 3HTLX 4YBQD 4NUJB 1FL6B 1U8PB 1KENH 1V7NH 2R39A 4R90H 4J2XA 5GGTH 4LCUA 3BDBA 3MRIB 3BPOC 4KDWA 5GSVB 1OP3H 1BWMA 1U3HA 1S7RB 5LAXA 4UU9A 4XNZB 4GKSA 2R1YA 3HNVL 2DBLH 2W9EL 1IC5H 3OG6B 1HOCB 1OAKH 1OF2B 4FQ2H 5CKAA 1CXFA 3NGBC 2YA2A 4M7JH 2I9TA 1A1OB 1G7MB 1UCBH 2AV7A 5I9QC 3L7FA 3DRTA 2FECL 5A2FA 5E99L 5H2BA 2HTLD 4HPOL 4D0DA 4G6FB 4Z78A 4Z7QF 2OL3L 1YPZF 4MHHI 3MYJA 4WHTA 5EBWB 4JDZB 3MRLA 3QSKB 4WFGD 1FL5A 3P4MB 2ZKHH 2W0FA 3BP4B 1TVBB 4L4VD 4LK4A 5E00A 1OQOA 3FB8A 3ILQC 3WHXB 3BI9X 3JWOC 4QRUA 1R5WA 2J7LA 5ADOL 1XCTB 5CJQL 5C2BL 5I15L 1Q9KB 4RCAA 3MXWL 3V0VA 4KDTA 5E8OB 1MWAB 4ZFOL 2ZCHH 5E6IA 2GJ6E 1J8HA 2IQ9H 4HJJH 4NC2B 2E9BA 1V5JA 5CWSB 2F53B 4HS8H 3BT2L 2E9IA 4AEHH 3TC9A 3O6FA 3UTPD 4WDIB 3L3GA 3MO1B 1P4BL 3B9EA 1XT5A 3S35H 1VEPA 4YEEA 3S98A 3HZMA 4M1GL 1JMZA 3QUKA 4ELME 1XEDA 3W9EA 1S7WA 1IGIH 2AEPL 1RHHA 1LE9B 3D48R 3CX5K 1NCWL 4LSUH 4N0FA 4Y2DB 2IANA 3NCBB 3QH3A 1QLEH 5BZDA 3X14B 5HDLA 1CD9B 1D5XB 1ZGLB 4POZD 2XG5A 1S7VB 4QNPE 1J0ZA 2DLFL 4PJ5D 4UZGA 1W2KT 2AJUH 4EI5C 1NCCL 4M8QA 3T08A 1DUZA 1CE1H 3KGRA 5MEOA 5TDPA 3C5JB 1ZEAL 2DOCA 1T1WB 1N6VA 3UPCA 5TFSH 5EB9A 4PRHD 1WBZB 1A5FL 1ZHLA 3TJEH 4XWGH 1DR9A 4OZHB 2J12B 2X4QB 3BX7C 5EU6A 3IRPX 1J1PL 1RU9L 1WBXB 3T4YA 1DLFL 3E8UL 4XPHH 2YZ8A 4DVRL 2VE6A 3RVWC 3WLWD 4LBEA 4HIEB 1L7IL 3NCJL 2FSEB 1KB5H 4J6RH 1HHKB 3C5SA 2HRPH 1W72B 4GXUN 3H9HA 4PJ8C 2OYPA 3SE3C 1CXIA 1N5AB 5SWZE 3KPSA 1NCNA 1X5AA 3EYOA 3NH7L 1A4JB 1N0XH 4P3DA 2UVEA 1I85A 2Q86A 2MHAA 1WT5C 2M8XA 2QLVB 4KC3B 2HVKA 2LTQC 1B4RA 2MKLC 1TDQA 3MV9D 1L4IA 1FORH 2Y07H 3U6RA 3WFEL 3G9VA 3BKCL 1LO5A 5FGCE 5SWSA 4QF1A 4R0LC 4S10A 5FEBA 1RZ8B 1T7ZA 2YBRB 4U49A 4NC0B 4RWHA 1NDGA 1OTTD 2VLMD 4KPHH 2XZZA 5CIPB 4W6YB 4MDJA 1OVZA 3ALPA 1MFAH 1A3RL 2ESVE 1LO4H 1A1NA 1MLCB 5J13C 3QDGB 3QA3B 4GKNB 4BZ1L 3WJLC 4RGNC 2LU7A 4OCYH 1YN7A 2RCSL 5DEFB 5I19H 4YHZH 1U6AH 2IBZX 1IVLA 5EA0L 4XMLH 4Y5XB 4NQCE 3LKPA 1B2WL 4Y4HB 4NQSA 2LVCA 3OHXB 3ZKSD 2R2HA 4PJEA 4EOWH 1YQ2A 4HBCH 2CDGA 4NHUB 4FQHB 1JWSB 4KRPB 4TVPH 5F1KC 1JHTA 1A7BA 1REIA 4OCXH 3G5YA 2RHEA 4XCYA 4JQIL 3ILPB 2F58L 4QKXB 4E41B 1E4JA 3B9VA 3VA6A 3V6OA 3GMRA 4F9LA 3UX9B 2IAMC 3L95A 4P48A 4K71C 3VI3F 2IBZY 1KGCD 4Z0XA 4G6AD 3MRQB 1JNLH 2FX8L 3AGVA 4KVNL 1RMFH 4PJXE 3K8LA 2D7QA 3OG4B 4GKZA 4CW1A 3D6GA 4JFFE 4PJ7F 2N7BA 3BP6B 1DBAH 1HXMA 2OZ4A 2X4UB 5F3BB 3TPKA 3QJFA 1T4KA 1QBBA 3DLQR 1G9NH 4R7DA 5DEGA 5LQBH 2E3VA 5DURD 2WW8A 4LSTH 2HJLB 1G0DA 1VPOL 1H8NA 4JVWA 3MXVH 2PYFA 5T5FL 4FZ8H 5FDWA 2QV2A 1OQXA 1T21B 3EYQD 4LHQB 4HK3J 3VW3L 4MZ2A 4M3JA 2I25N 2VDQL 4QXGL 4QRRE 3QIUD 2VQ1A 4G7VH 3QHZH 4HJ0D 1YEKL 4X6DE 2FYYA 2XTJC 4HUUA 2J5LB 5E2VH 4O00A 1AE6L 1HHIB 4EXKA 1I3RB 1J1OH 1EDQA 5T5NG 3ZDZF 4JGUA 1AGFB 3U82B 2BVPA 3WNPA 3O2WL 4M1DL 4YR6B 1DVFA 2UZXB 4MXVF 1DL7H 2EXYD 5DRZB 2YUXA 5ILTL 2X4TB 5ID1B 1KJ3H 1T0NB 4FQIL 3CFEB 4XNYH 4GRLC 1H15B 3G6DL 1LP9F 4MD0A 4JVUA 4OLYH 4EIGB 3FB7B 2Q1EA 5L8KB 1MNUH 3ESVF 4P9ML 2AGJL 4OLEA 4RRPA 3M8OL 2XWTA 5DRWB 5IEHA 1IFHL 4Q2ZB 1M05A 4IOSD 2R0LL 5HDBF 1R6VA 3SN6N 1FDLH 1OT1A 4UTAH 4OFDA 4XBPB 2H2SD 2EECA 3GUTA 3CX5J 1F90L 4YDLC 4W70A 5DD5L 2MPAH 5D2NA 1B4JL 1ZA3A 2VLRA 1MIEH 1KXQE 4I18A 4KK8C 3MFFA 3TA3D 2FJHB 2PXYA 2EDLA 3AB0B 3FFCB 2DQUH 1QRND 2C3WA 3VWKC 5E5MB 5I30L 1N5YH 4LVOB 5KZCB 1CFTB 3A6CL 1II4E 2NW2A 5ANME 5CEZH 1UACH 1RULH 2F5BH 5HHPA 2OI9C 3WEXA 5K9JL 1BBJA 1WZLA 1P9MA 5DJXA 2AERT 4E42A 1BJ1J 2ZUWA 4GT7A 3WS6C 4C83B 4X5XB 4JDVB 5LVEA 1XGUB 3C8KB 4MAYB 1FL3A 3ZKND 3LH2L 1IGJB 3WIHA 1BD2D 3KHQA 1I1AA 5FOBB 1MCIA 3OKMA 1Q94A 1R3IL 4ZTPH 3V79C 3MV7D 4KI5F 2X7LB 3VG9C 4HHAA 1UM4H 3OL2A 3DJ9A 1KCRL 2QHRH 5DJAB 3QI9D 5C0CE 4GQPH 3HFML 3PL6C 4KKNA 2ZCKH 3TIEA 4LLDA 4IRSD 2NX5E 3JV4B 4X6EB 5HGGS 2WQRA 1P7HL 1U0QA 1YPZB 2DICA 1N26A 3MROA 3MQIA 5GGSA 3D3VE 4K3JH 2VC2L 2X1XR 5BS0A 3FTGB 1PYWB 1DBKH 3H9SD 4NQDA 2UZIL 1BQHG 3CFCL 4NP4H 5D7LB 4UI2A 4PFEA 2WNGA 2A38A 4KI1A 4TNVF 4KAQH 1MRDL 3TV3H 5GRJL 3Q1SH 3U9UA 2NY0B 3DECA 3DTXA 1CICA 5JDJA 1TLKA 4Y5YC 4RBPK 5C0FA 5JO5A 2ED8A 4WIQA 2EZ0D 1QLFA 1FFNA 3MLYL 4CADB 5EU5B 2AQ1A 3FQTB 4OCSH 1ZSDA 5D96B 3D85B 3VXTB 2JJVA 2FATL 1U8KA 4QLRA 4QHMA 5DGRA 3CPLA 3O8XA 4O2FA 4MD5A 3TYGH 1CZ8L 1H5BA 3L5WA 5INCB 2NYYD 2BFVL 3DV4B 4KUCD 4NZDA 5TF1L 1OWWA 4WHDA 4HKZB 4WI4A 1OP3K 3HPLA 4HF5H 3TT3L 4LQFL 5L9DL 4RA3A 3VH8B 4BZ2L 2GITB 2QR0B 4TUOB 4IDJL 1X5ZA 1R24B 3WN5A 4RFEB 3W11C 5DLML 3PWUA 5AWNH 3UAJD 4PGDB 5DJ6A 1AC6A 4X6BB 5FM5M 5C07E 1QEWA 5D8JL 4HXAL 3GKWH 5JPMB 2PW1A 2W9DL 4P0DA 4G8GE 2YC1B 4FFWD 4WW2C 3ZYJA 1KOAA 2V6HA 2V9TA 3LKQA 4XX1E 2MCG1 4IS6A 3ZKXC 4M7LH 1DQTA 1YC7A 3FT2B 1AD9B 4G6ML 3LMJL 5L2KA 2H2PD 4PJIA 3ARED 1CFSA 3MV8D 1E6OH 3P0YH 5DHYB 3KWWA 5I76A 5AG8A 1V3LA 4HMDA 1NEZB 1CGSL 1MLBA 1MCHA 2XACC 3GM0A 2BSTB 1I1FB 2OXGA 3ARUA 4NPYA 2FBJH 5C6TL 5CEYB 1T1XA 5D93C 2N7AA 3QHFL 2B1AL 4X8JA 3SKOB 3H0TB 4ERSL 2VZOA 3VXQA 1DFBL 1KULA 3C9NB 4WV1B 3QG6A 3BZDA 3RX7A 3SOBL 5CLTA 4YHLH 2OQJA 1IAIM 1QFUH 4QYOA 5IR1B 4ESKA 1Z5LA 2BHYA 3WE6B 5DUBA 1ZLWH 4S1SH 4YDIH 5H35A 4L5FL 1ZMYA 3SJVD 1G7JA 3LEVH 5FGBA 2EDOA 4P2CG 4TNVK 4CUCA 5K59E 4OM1H 3QDMA 1N4XH 4RA0C 5E8NB 3RUGF 1G7IA 2QL1A 5I71C 5DHVB 4OZ4A 1F42A 4L8CA 3U79A 2P5WA 1IC7L 2Y36H 4Y1AD 3RTQA 4PP2B 2R4SH 4CN4A 4ZXBC 1BMGA 5HSFA 5MENA 1EZVX 4YHIB 6FABL 3BPOB 2B1HL 4K3HA 2GJZB 3NAAL 1X4XA 3MLXH 3LKSA 3O3DB 2VDRH 5SWQA 1U8QB 4JQVC 3BIBX 2WBJD 3NGBB 3OGCB 3RWHA 3HRZB 1H9VA 3MCLL 2BNRD 4XPFH 1RUPH 5EC1A 3SKJH 5I9QB 2P5EA 3WSQL 3SDDA 2VLKA 4H0IA 5GRUH 5BRZD 4FXKB 3EJYD 4L3EE 5K33A 4NQVB 1MHCB 3RA7H 4G9DA 1EZVY 1PX3A 2LFGA 4PJ7B 3T4AA 3GB7B 5KSAD 3AMLA 1D5BB 1Q1JH 2V7HA 1OHQA 1M71B 1CR9L 1VA9A 3TGXA 2UYLA 4LLWA 1BAFL 4F7TA 5ERWA 4I2XA 4HFWB 4NN7C 3C5ZA 3DO7A 3RY4A 3OXRA 5F7YC 4KROC 3NN8B 1YMMD 3ARDA 4BJLA 4ISVB 5DRXB 3BFOA 5SV4A 5EC2A 1HIML 1LO0H 3PHSA 3NIDF 4K55A 4QHLA 1H8OA 3V5HA 3DARA 1AGDB 1CE6A 5DMYA 4MAUH 4HIHB 3ET9F 4FA8A 2I9LA 2O5XL 3HZKA 1BJMA 5B8CC 1U8LA 3N50A 4Y4KC 3QDJE 3KAAA 4GUPB 3LQZA 3KR3H 4YHMH 4N8VA 1AO7B 4ZUWB 3RVTD 2E8ZA 4QO1A 5ESAA 4P57A 4JDTL 4WUKH 4L4TB 2Z31B 3U4EA 2EDBA 5FYKU 1LP9B 2YUZA 5F96H 4IOFC 2NTFB 3N1FC 4O51B 4EI5B 3TBVA 2ITCA 4EBQL 1UKTA 4R26H 1JYXA 4FZEL 1IQWL 1GXEA 1U91A 4NM4L 1INDL 2ZG2A 2X1WL 2HMID 1KTDA 2DI7A 2VOTA 2ARJB 1D6EA 1QO3B 1JZ4A 4LU5L 1OSZB 1K9TA 3DVNA 2PO6A 3RX5A 2BJML 4XC1L 1KELL 3QUMA 3KPPA 3FAWA 4K7PL 1WFTA 3QQ4B 3VXNA 4ZNEE 2KQMA 4MDIB 4ORGB 4B7LA 5EBMB 5JIPA 3UROR 3VWJA 5EBLB 1NUNB 5KANI 2Z8WC 1QUNA 4P23A 3TVMB 4QRSB 2Q7NA 1FCCA 4TSBL 4KWUA 3X3FL 4PJ8B 2R2EA 5GSRB 2VDPL 3SDXE 2FIRT 3B5HA 3SCMB 3GSOA 1B0GB 4PY7B 5EOQL 3HMXL 5IMLB 3V52H 3STZA 1MFEL 3KPOB 4K9EL 5K93A 4LEOB 15C8H 1E6JL 5GS2H 1YMHA 2V9RA 4CAGA 3KJ4C 1HHHA 2KDGA 5KSBF 3S3SA 4HCRA 1UZ6E 2VR9A 3QYCA 2LTQB 4GG6B 1A6AA 3U1SL 3CLEH 4JFPB 4FABH 1CU4L 5C08B 3EYVA 3PE9A 4U7KA 5AZ2L 4OB5H 1IEBB 1HK6A 4R0LB 1NH6A 3AAZA 4WWID 1D9KC 3U7YH 3PDDA 1UWXK 3DO3A 2Q76B 1P7KA 4LLQA 5CHNB 3P9LA 2W60B 2XY2A 4LVHC 2YRZA 1FIGL 1VFBA 5J13B 1A1MA 2AS5M 4OKDA 4RGNB 1T7VA 5F9DC 5CJOH 5C8JB 4ODWA 3QQ3A 2IMMA 3M17B 4OIIL 1FYTB 1G7LA 1NFDE 4MA1C 2QQLL 4EN3C 1C7SA 4OCMC 3IDJB 2HJFB 3KPQB 3L5XL 2D7MA 4LRIC 4JB9L 4F37F 1KPUB 3DRQB 3HC0A 4UDUA 4HUVA 2DWDB 4GRWE 3MRJA 4HWBA 4NUJA 1FL6A 1B9ZA 1U8PA 3WJJC 1BVKA 4GS7C 2B8OT 2XQBL 1MCNA 1WV7T 3MRIA 3PGFL 1KF9B 3NFNA 3ZHLA 2GTWA 4PYHA 4WU7A 3T8XB 5E7BA 3LS4L 5IB2B 3BDYL 3L3OB 2IAMB 1ZT1A 3FQUB 1AI1H 1HOCA 4K71B 1OF2A 1QZ1A 4YUEL 4K8RL 2CIKB 3PGCA 3X11B 3RZCD 4U6TA 4P4RB 1SJVA 3B9KC 4ZS6C 1BLNA 5HI5C 2AQ3A 4YWGH 5AD0B 3I50H 3F7YB 3GI8L 3REVB 5FYJH 4DK3A 5K9OB 1D3CA 2DLGA 2XRAL 1KN4L 1NGXA 3P4MA 2IBGA 1CIDA 4LKXA 5GGRY 3DURB 1FZOB 5JW5A 4F9PC 4NO5B 3TBYB 1QA9A 2X2YA 3HC3H 4LSVH 1CGXA 4OUUB 5TQ2L 1KB5B 4KTDL 3VJ6B 4EZMA 3O11B 2DI9A 3BMWA 5IFAH 5DJ0A 4XX1G 1OAZH 2JCCE 2XTJB 1QSEA 3NIFE 5T33L 1TVHB 2D7TH 5EU4B 1A6PA 3QCTH 1DQJB 4KRPD 4LIQL 5CWSA 2F53A 4YHPB 5D7JA 2IH1B 4PRIB 1FG9C 3RNKB 4WDIA 4GSDH 4JY4B 3MO1A 5BVPH 4TUJA 1R3HA 4XBEH 1YJDL 1MIMH 3IDNA 4JO4H 1YEEH 2M1KA 4YE4H 1D5IL 4GRLB 4HMCA 4Y2DA 1S7QA 4Y19B 2JJTA 4HGWB 3LIZL 4PRPB 3BE1L 4X7SH 1N8ZB 2R0ZH 2DM2A 3G04A 3RWEB 4J8RA 3WYRA 3DX8A 1SEQH 1ZLSL 1S8DA 3QR2A 1RZKH 5HYJD 3CK0H 4MJ2A 1BREA 4NNXB 4NN6C 5GJTL 3GSVA 1RJCA 4LMQE 4YDLB 1JF1B 4HS3B 5JXEA 2HFGL 2E27H 4F37K 1WBZA 3MLWL 4K94L 2RQ8A 2A83B 1RJLB 2BX5A 3KPRA 4NJ9H 3EHBC 4WO4D 3S6CA 4ZG1A 3IXAB 4OZHA 5DRNB 2X4QA 2CKBA 3LCYA 3NIGF 2HWZL 2YPVH 5DJCB 4J1UA 3MA7B 1QQDA 1QKZH 5D7SH 3W82A 1XGTA 3OAYH 4DTGL 4XI5C 1FNSL 5FF6B 5E9DE 3E6FA 1DBJH 1UWGL 3RUGB 2LQRA 1KN2L 1JRHH 2IQAA 1QSFE 2CH8A 3ABZA 3MCKA 5JDSB 3O6LL 2OI9B 3GI9H 1JPST 4PY8I 2YPLD 1BEYH 3GHBL 3RWIB 3HI5L 3MOAH 4OCNC 4ODSL 3QNZB 1HI6B 3IKKA 5FO7B 1P1ZB 4LCYA 1N5AA 4DGYL 4RAUB 3WLBB 3ZMRA 4MJ4A 5JHDB 2ZOLA 1GIGL 4Z7UF 4XVUD 1NSNL 1WTLA 1KCSL 3NCCB 3VGEA 5F70A 3MUHL 3I2CH 3G08A 1RJZB 1OAYL 3X3GL 1LO2H 1U58B 5HHQB 2Z93B 4F2MA 1C16B 3LKNA 4HPYL 5CZXC 3VFMB 5A16A 1LEKA 4LHUD 1A9BB 4ZOBA 2R29H 5F7EL 3S37L 3VG9B 4OCRL 3CLFH 3GBNH 4NO3B 4UILL 4OBRA 5TH2A 3BP7B 3PL6B 3PWJA 1JVKA 4YFDB 4S1RL 5JW3H 5HGHB 3FZUD 4FNLH 1OGTA 4P4KA 4UIMB 1CGVA 1MLCA 2E5EA 3QDGA 3QA3A 3O4LE 5IF0A 3U2SB 5FB8B 3CMOH 1U3HD 2E7LA 2VKXA 4JHAL 2UUDH 3FFCD 5DEFA 3C09C 3D0VB 4IHOA 1UXWA 1YA5A 4U6HB 3W5NA 4Y4HA 1T2QH 3IS1X 4M62H 1RUKH 5F9OL 2ATKB 9CGTA 3Q6FA 2NNAA 1JWSA 1KEMH 5D70H 4CRPA 2HTKC 1S7UB 4L3CB 4W81A 4Y5YB 4MNGB 5IK3A 2NY1C 1YQVH 2VXVL 3ARBC 1CGTA 3G5XA 3ILPA 4YEFA 4E41A 1U8NA 2X9WA 1JPSL 3OF6A 4QRQA 4DAGL 3TN0A 1MQKH 3QXDB 4WFGE 1RZKC 2GUOB 2VXQL 3DBXA 4HLZG 1ADQH 4YDVB 1JYVA 3QXAA 3BP6A 2FO1A 5HTSA 5DT1H 2VWEE 5GJSL 2N1KA 2X4UA 5F3BA 1OTUC 3GJFH 3ZKQD 3KHOA 4X80H 3I9GH 4XAKE 4ZAKD 4RMSA 4YGAB 4V1DA 5JIKA 5IGXL 3A6BH 1G1YA 4NQUA 4JKLA 4RFOH 1I7ZB 3U83A 5CAYB 3ARFC 1T21A 4JFZL 4WNQA 3P4NB 3X13B 1P7QB 1FNFA 1BF8A 4N8PA 4NKIH 2VIRB 4BQ6A 2X70A 4QHNB 5MP6H 4PJAE 4MJ6B 2J1KA 4L4JA 5ICZB 4WW2B 2I5YH 1HHIA 3RPIB 1I3RA 2VZ1A 3QXUA 4JM2F 1FZMA 3C6LB 3O6KL 4XCCL 1AGFA 1VFMA 2CDFA 3BYTA 4YR6A 3ZKXB 3GJEA 4XTRD 3QPXL 2JIXA 5CUSH 4KGLA 4M7KH 12E8L 3IJYB 4FQJL 2FD6L 4HIXH 1CLCA 3VXMB 1IAMA 4LDOB 2X4TA 3WIIL 3BJLA 2GK0A 1T0NA 2HT4D 3CFEA 4NRZA 3PWPB 4RX4D 1H15A 3RWCA 5IJKC 2ICES 3P4LA 3G6JB 4OAWA 1BFTA 1JF5A 3FB7A 4JN2B 4M6AA 3I3EA 3BQUC 2EO1A 5D93B 1DCLA 2P7TA 3BSZL 5H37G 3R0NA 5DTFB 1EA9C 5KSBB 1J11A 3TESA 2WBWB 3EFFB 2H26B 2HKFL 4ALAH 3FRPA 4ZUVB 1S5IL 4PIRF 4XBPA 2NY4C 3M07A 3OKDB 4R3SB 5IV2B 1SQ2N 1EHLL 4OFPA 3ZDXE 4TULL 4F15C 3VFOA 3SGKC 3LV3A 3GBMH 2DLEA 2ITDB 4R4BA 3L3KB 5B4MC 4ZPTB 2AXGA 5MERB 5E2TL 1NGWA 1ZGLM 3DOSA 4CJ1A 5I71B 1FNGB 3S5LB 5CP7A 1M7XA 1HCVA 1T1ZB 3ARZA 1TVDA 5J1SC 5IW3A 1CFTA 3BKYL 4R7NB 4ZXBB 2FJGA 4QOKD 1QFWH 1HH9B 5ALBL 3C87A 5CD3A 3QIBC 3QUYC 4Z7WB 2APVA 1NCUA 4NQEB 3DVFA 5DUPL 2AK4B 3UPRB 2XXMB 1MFBH 3DUHA 5B3JF 4ZFFA 1FGNL 2FNBA 3CX2A 1EEYB 1K4DB 4OQTH 4QRRA 4K23L 3RDTA 3R06B 4X5XA 5EIIB 1V7ML 4I0PA 4JDVA 4JFDE 3SDYH 4MAYA 4JKPL 5FUOH 1IGJA 2FO4A 3EYFA 5EO9B 2R1WA 2YPKA 3OQ3B 2V17L 1EFXB 4FHBD 4JRXE 2DQHH 1QHOA 1LD9A 3D9AL 3C2AH 2AABH 4GMSL 1F6FB 1IGFL 5IBLC 3CSPA 1EXUB 2J88H 1R0AH 3CVIH 5DJAA 4F7EA 1JPGA 2YN3A 4AEFA 4PY8J 1OTSC 1FFPB 5FECB 3D39E 3KLHC 1YPZA 4KKCD 1ITBB 1CFVH 2VDNH 4FFZL 3UTSE 3L6FB 3G5VB 5EOCJ 4KROB 4WGWB 2BVUA 2DL9A 1J18A 1FVDB 4LVEA 1MCEA 3GSNA 3AROA 2OZ4L 5HBBA 4DN4L 3WKML 5J9PB 5D7LA 1OP9A 5CEXA 4TPRL 2LV4A 5EORL 5ADPH 3MRBA 3VXSA 2VZSA 4NNPL 2QQNH 3QISA 5B8CB 3LAFA 3VRLF 4Y4KB 3FQNA 5CGMA 1KLGA 4M1CC 4FMFA 4NQTA 4OF5A 5DK0B 5EUKB 1UZ8A 1U8JB 2PUQT 4KTEL 5EU5A 3FQTA 4HLJA 1SBBA 3MSPA 5EUOE 1AXSA 4I0KA 2VDOH 1RK0A 3H7BB 3D85A 5GISL 1EIBA 1HKLL 5T1LA 4HKBA 1U42A 4F58L 3KPLB 3CUPB 3IDIA 5INCA 1AXIB 3T0EE 4JRWA 3GNML 4KZDH 5T3XL 2XFXB 4RWYH 4D8PA 1VACA 3ILQD 1CDHA 2GITA 1FFRA 2QR0A 4TUOA 4MZ3A 4OSUL 2O5ZH 1GJIA 1R24A 3BD3A 4P46C 4RFEA 1C5CH 4BYHA 1AFVH 2EDYA 4QTIL 1MCWM 3OB0H 4N0CC 2CQVA 1K4CA 1JV5B 4I0CC 2R1XB 5H37H 2PTTA 1LDPH 2YC1A 3R0MA 2EDNA 1JGVL 4XMKL 4PRAA 4XNXH 5E94A 3HE6A 1AP2B 4P9HL 3ZKMC 4RNRA 4MQXC 5I8EA 3UO1L 1EUUA 1WICA 3OAZH 3FT2A 5DFVC 1FFOB 4XNUH 2E7HA 3BOVA 3CXHK 3OAUL 3LN4A 3IU4H 1AO7D 3LEYH 5DHYA 4LCWA 1GPOL 3QEUA 3KJ4B 1RAMA 4TUKL 3U7WH 4I8DA 1EO8L 4X9GA 4GRWH 4U1HB 1I1FA 5A3ID 4ELMB 3O3EB 1F4XL 4Q9BA 4P2QB 3TO2B 4ZSOE 4HC1H 4Z7UB 1NCAH 1QP1A 5LBSH 2R8SL 1DQML 3MJ9H 1FLRL 2VQUA 5F6IC 4WUUE 1D9KB 2X1PA 3LQMA 1F58L 1T03H 4X98A 4O5LL 3TPUA 4LVHB 3TBWB 1L6XA 1KTRL 3PDOB 4OF0A 3WE6A 35C8L 1GH7A 2L7JA 4WFFD 5C0RH 4F57L 5ACZB 4JZNB 3WIHL 5C9JA 4MA1B 4EN3B 3TBTA 4OZIE 4GQ9H 3LY6A 2JB6A 2P46B 3RVWD 3ZT7A 3BUTA 2GY5A 2XN9B 5L2JB 1X5YA 4CDHA 2VTFA 2IPUK 5B3NA 4GS7B 4MSWA 3GMPA 4PJ8D 5JOPD 3MNZB 1TJGH 1U41A 4TSAH 2CR3A 1JRHI 4U0RC 3VMOA 3O3DA 2WINA 4HK0B 2AV1B 2FX7L 2AJSL 5KVGH 3ULVF 1HHJB 4AENA 2I60H 4QT5A 3OGCA 5SWZB 1D6VL 4Y2OA 4Z7VE 1OPGH 2M2DA 4YHKH 2IFFH 2H32H 3B9KB 4G8GA 3WL9B 3EO9H 32C2B 5D72H 1JNNL 3UJIH 3GRWA 4ZOAA 4FXKA 4Z5RB 1VGEH 2VAAB 2DIJA 3G5ZA 3JV0A 4DKAA 1MHCA 1RVFH 1QBLL 4PJ7A 1NBVL 3CDFA 5FGCB 1KC5L 4R8WL 5CCKL 1CG9A 2Q3ZA 4ZFGL 1MI5A 2AXFB 4GW1B 2OMBA 1BZ7B 1NCDH 3ROOB 1I8MA 3MFGB 1NC4B 4YXKL 3IDYC 1FYTD 3NN8A 1QNZH 5CINL 3NBNA 2ESVB 1RURL 2BK8A 3TEUA 4PB9H 4XNMA 3MRDA 2NXZD 3EO0B 25C8H 3PQYA 3MGTB 3ZTNL 3DI2B 1MJ8L 3EOBB 3HPJB 1SMAA 4XC3L 3SDCA 1R3KA 3C8HA 3O8XD 4NQCB 4JZJB 4IJ3C 2NY2C 1H3VA 1AD0B 2FLBT 2FGWH 2IAMD 3BGAA 2XNAA 4JHWL 1J12A 4GUPA 2YA1A 3NTCL 1ORSA 4F7PA 3HC4H 3V8CA 5CJ5A 1FO0L 4L4TA 2Z31A 1NQBA 1LP9A 3KYMB 3EUUA 1A7NL 4KV5F 3QQ9C 1J1XH 3FOLB 4O51A 4PJXB 2FB4H 4EI5A 1RHFA 4WI5A 5FYKL 4NN6B 2X4NB 3E6HB 1U8IA 1K85A 4ODTH 3NFSH 1VB9A 4ZYKB 4JRYB 5MHSE 3VFTA 5F21B 2ARJA 3IXTB 1QO3A 4MA8L 1LEIB 4X6CF 3DI3B 1HDMA 4MS8D 2XTJD 1KIRB 4BSVB 3I6GB 5GGTA 4M6OL 4DVBA 3F7VB 1XAUA 5EBMA 2I07A 3SE9L 3LHPL 1KV3A 5EBLA 4F8TA 4AYFA 1G1CA 4LQ1A 4PV8B 4XGZB 4KJPD 3ZHKA 4PRID 3TVMA 5HYSG 3UTZB 4OFKA 2DF3A 2VUOA 1T3FB 5CJXA 1KIQA 3MRMA 5GSRA 5C0AE 2D03H 1A7RH 4WU5B 2H6PB 5HJ3B 3SCMA 4NWUH 3A6OA 5D6CB 3RX8A 4XCEA 1WT5A 3SKMB 4K2UH 4OV6F 5TPWL 3ALXA 3F12B 3OX8B 4A2MA 3HNVH 2BMKA 1Q8MA 4JFPA 5C08A 3QDMD 5JNYA 2VLJD 1IEBA 2C3VB 2VO5A 5JMRA 1NGYA 4YPGA 3QDAA 3T0XA 1ZHBB 2EE9A 5HYEA 2Q76A 2X5PA 5CHNA 4PP1D 2GI7A 3WNKA 5E99H 1E4WL 2YD3A 4L8SA 4RMQA 5KVDL 1WIPA 4U1GC 4XH2B 5DMIL 4APQC 3C09B 3HI1B 3VWKD 5HDOA 1YDPB 2YXFA 3PXHA 3U7AA 1IM3B 1C08A 3NA9L 4MD4B 3KPQA 2QJDA 3HS0A 1KPUA 4J3UA 1F3RB 3IYLW 4OI9A 3TYFB 2DWDA 5CJQH 5I1EL 5C2BH 5I15H 2AJ3A 1K8DB 5GPRA 5ICYB 1IQDB 3MXWH 3SE8L 2NY1B 1H3WM 1NGPL 3ARBB 1C8PA 4U1SA 4UNVA 1AGEA 3T8XA 4X6FB 3L3JA 2OJEA 5EU3B 1ZT4A 1LO3H 3RZWA 3FQUA 1QFWI 3BT2H 3RWFA 1Z3GL 5DDHA 3VXRE 2CIKA 1P4BH 3FCTA 1K3IA 3X11A 4ZNEA 5IKCB 1KTLA 1KLUB 1LWRA 5DS8B 2AEPH 4HX1B 5IESL 3CSYA 1FVCA 1NCWH 2P8PB 2DWEA 5AD0A 2XWBB 3N9GL 2QTEA 4EUPA 4ZUUB 2JF1A 4I48B 1FGVL 5I8KL 3ARFB 3PP3K 2DLFH 4J4PC 4ODBD 4F80A 1DBBL 4K3GA 2ZNWA 1FZKB 5FHAH 1TJHL 1ZEAH 5B22A 1DE4B 4F7CA 5GGVL 3GZKA 1EX0A 4UV7L 4B53A 1A5FH 4U1MB 1W0VB 1CIUA 1EAPB 1TVHA 5EU4A 3S4SA 4JFEB 2FR4B 1J1PH 1RU9H 5DMGC 2XKUA 3T09A 1CGYA 2IH1A 4BUHA 1DLFH 3E8UH 2JJWA 1F13A 1JTTA 3LRSB 4AIOA 4DVRH 4MMZC 4JY4A 2V2TB 1CI5A 1L7IH 3OV6A 3NCJH 5LGHL 1P6FA 5F9WC 3QDHA 1R5VB 3BVNA 3UZEA 5GZOD 4PBWD 4YK4B 2BSSA 3QUML 4PJBF 2YMXL 3UTTE 2HTLC 3HG1E 2C3GA 4F33A 1A7PL 3BGMB 1IM9A 3BQUB 3ALWA 4FQXA 3SGJC 4XT1C 4H8WL 3PIQB 5IBUB 2PO6D 1F4HA 4C54A 1FLTX 3NH7H 1X5IA 1A3LH 2FL5B 2X4OA 3NCYP 4Q6IA 5CBAB 3ULUL 5T1DL 4NNXA 4N5ED 3V5KA 4PLOB 3LS5L 4K3EL 4F15B 3BKCH 5CSZB 1JZ5A 4LGRB 1FNHA 5JPNA 1G9ML 3W11D 3ULUD 2BC4B 3F62A 1WWCA 3Q5TA 1RJLA 2DYPB 3EO1B 3T0BA 4U3CA 5DRNA 43C9B 2DKMA 3HN3A 4PJHF 5DJCA 2D3VA 3MA7A 2ZSWA 4DW2L 4P5MB 3NCFB 4QRPA 4ZFZB 2V2XA 1MHHB 5FF6A 4BZ1H 3RUGA 2RCSH 3K8MA 5FCSH 2QQQA 3GGWB 2FEDC 4U2YA 2W92A 5IEKA 5JDSA 5EA0H 1M4KA 3TCLB 1B2WH 3QIBB 3QUYB 3BZFB 5IVNA 3W9DA 3ECBB 1XIWC 4OZFG 2A6IB 4POZC 4GW5B 4RAUA 3TM6A 1OY3B 2E8YA 1OAXL 1Z6JT 5DWUL 3DPBA 4JQIH 2F58H 1W0WA 2Z93A 3VFMA 1UH3A 2JK5A 1A9BA 4HWBL 5BV7L 5I6XC 3P40A 5D1QA 1C1EH 1WEJL 5DJ8B 2FX8H 4CU7A 2GAZB 4KVNH 3VMNA 1I1YB 5EOTA 4OD2B 1U9KA 3PL6A 1MCBA 4X4ZA 3AY4C 4HS6A 3VFUB 4J3WA 1U8HA 5FB8A 1EO5A 4D9RD 5HHNB 4MNQA 1VPOH 2ADGA 3SE4A 4S1DD 5KN5A 5T5FH 3VXUE 3D0VA 2JJUA 1SEBB 3KXFB 5JR1L 3DVGA 3VW3H 5DD1L 3QT2A 3VGFA 2VDQH 2ZNXA 3FN3A 4QXGH 5GS3A 1EMTL 1T89A 4PUBL 4ZUSB 3QWOB 1DJSA 4DUXA 2BVTA 1YEKH 2ZOKB 1B90A 3O3AB 3CVHA 4Y5YA 2O26U 1AE6H 3UDWA 3IU3B 4M6ML 2XZAL 3ROLB 4BFIB 3O2WH 4M1DH 3UTQB 4U4BA 2GUOA 1N64L 3M1BB 4N0RA 3E3QE 5ILTH 5I1IL 2F8OA 3FHQA 4GAGL 5EZLB 2BNQE 4FQIH 4KKBC 2D9QB 1DN0B 3G6DH 2KUTA 4JKMA 2P43B 4NYLA 4WEBL 2AGJH 4LRNL 2BHUA 3M8OH 2B39A 4I4WA 1I7ZA 2YA0A 1MHPL 2NY3D 5D7JD 2R0LH 2Y06L 2KPNA 4P46B 1JHKL 3P4NA 3X13A 4KROD 4GG8B 1F90H 4LSRL 2CRYA 3EYUL 5DD5H 3V0WL 1B4JH 5DO2C 4XP1L 1OGAE 4LIQE 2FJFB 4RMUA 4C4KO 3CIQA 5I1GL 2M26A 3X12A 5A43C 4MJ6A 1P53A 5GGQL 1WQVT 3ARSA 3RPIA 1F3JA 5KVMC 3C6LA 3IAQA 2F19L 1IGCL 2NR6C 4Y4KD 1CXKA 3WO4C 4PJFE 1CFNB 2PYEE 3IJYA 1FJ1B 1NFKA 4G6AC 5H94B 1EO7A 2EDDA 4KQ4L 3RFZC 3FOMA 2CKBL 3PWPA 4PJ9A 4JG0L 3QWRD 3QDJB 5K9JH 5TE7L 5I1AB 4JN2A 3CC5A 1Z9SA 3BD5A 2X40A 1IILE 5BMFH 2XG4A 2ZUQC 4IOFD 3I75A 2Y23A 2X4PB 5C0BE 3GIVB 2MCPL 5E6YA 2C7UA 3EFFA 5L8JB 4EQ2A 4OD3L 4XNQB 3OR6A 3LH2H 3EYQC 1I9EA 3EJJX 4IIQA 1A14L 4PYGA 4P5TA 3DGCR 4R3SA 5IV2A 2GKIA 1R3IH 1GGIL 1S9YB 1X5XA 3T0EC 5KJRH 5DYOB 4CKVX 4HJ0C 3O41B 4OZFH 3DX6B 5I2IB 2KZ1B 1ES0B 3HFMH 3FQRA 1T22A 5MERA 3CFIC 4LLYA 3S5LA 3SBWC 5F71A 3QPQD 4RGMC 5T1KD 1RI8A 2F5AL 2VC2H 2VLLB 3NFPB 3D69B 5M95B 4DFHA 4ZXBA 1FNEA 5IWLC 1HH9A 2GJ6D 2ZP0T 2UZIH 3IFPA 1XCQA 3CFCH 2Z35A 5C7XL 2H1PL 5ISZE 5F8QC 1DQLL 4AIZB 4NQEA 4U0RB 1CLZL 2E7BA 4GBXC 3MODH 3VCLA 1UWEL 1MRDH 2AK4A 5GRJH 3HKFA 4G42A 3SDXB 3MRFB 1K4DA 4OLZH 5DMJB 5EIIA 1U2HA 4JR9L 1T1YB 1TCRB 4G6JL 5EO9A 2XA3A 3MLYH 3WIFA 2YD7A 1EFXA 4G9FB 5IFJA 1L0XA 1T2XA 3JTTB 4WWKD 1CTNA 2ADJB 2NMSA 3QFJB 2FATH 5MEPB 2Z92B 1EXUA 2ZPKL 1I8KA 2IBBA 3ZE2E 2AEWA 1ZS8B 1FFPA 4DCQA 3OJ2C 8CGTA 5FECA 5HPOA 2Q8BL 1CZ8H 4C56A 4QHKI 5TF1H 2BFVH 5K9KB 1WC7A 3I6KB 4YFEA 3L6FA 1KJMB 3G5VA 3IDYB 4LQFH 3TT3H 3T1FA 5J3HC 4EN3D 5J56B 4KK5C 2NY6C 2CLZB 1TTGA 3TN0D 2NLJB 3N1GC 5DLMH 4X9HA 2VMFA 1IL1A 4M4RA 5D7KE 3DXAB 5D8JH 1IEAB 4HXAH 4J3OC 5ITBL 3D2UB 4IJ3B 2NY2B 2VRAA 4UB0L 4GRWB 2Z9TA 1U93B 2DI8A 5DK0A 2GT9B 1SVZA 5EUKA 1LNUB 1U8JA 4IOIB 4KXZH 3K7UA 5EZJA 3WNMA 2FHBA 2F54B 1J8HE 3F58L 1PQZA 4XPTL 4YC2B 5SWZD 3P3YA 5EG6C 4G6MH 3LMJH 4YXLL 1RIUL 1J5OL 4Q0XL 2CD0A 4ZS6D 3QI9C 2EE2A 1MVUB 1BFOA 3CUPA 4PJBB 1CN4A 3ARWA 5DR5L 3QUXA 4XMPL 5A40E 1CD0A 5T3ZE 3CFJB 3TLRA 1S9KC 5C6TH 1CDGA 2ATPB 3QHFH 2B1AH 5GS1A 2IANE 4ERSH 1DEEA 1TTUA 1DFBH 1M7IB 5HYSA 1LK3L 1NC4D 1TZHA 5I8OL 3SOBH 1I8LA 3VFWB 2ESVD 2A9ML 3LPWA 3P9WB 4CVWA 4LAJH 1WAAF 4L5FH 4PJHB 5KS9F 2JCCB 4B41A 4NQCD 5LGJA 4CBPA 3QFDA 5C09A 1HSAB 3RIFF 2AEQL 4P2OB 2YSSB 5EU6E 1JN6A 2UWEF 1IC7H 4W68A 1VCAA 2FX9L 2H32B 5E56A 5CZKA 2BDNL 3VFNB 6FABH 2B1HH 3NAAH 1E28B 2HG5B 4NC1C 4P2QA 4H0HB 1PDKA 4Z7UA 1Y6KR 4JZOB 3RGVB 4JFFD 3KPSE 4KRNA 3MCLH 3TWCH 1U92B 4JCMA 4GOSA 5J12C 3WSQH 5HGAB 4YDJB 2X4SB 4JPWL 4JPVL 1I1RA 2IG2L 2VKWA 5FM4A 1RIHL 3WNLA 4S1QL 1C12B 4U1GB 4HKJA 2BVEA 5D1XA 5SWSE 4FTVA 1E4KA 4FFWC 1GSMA 3FQWB 1CR9H 1FH5L 4X7DC 2X09A 3OBAA 1BAFH 4QRRD 3STBA 4PS4L 4BA8A 4IBLT 2XN9A 4W4OA 5L2JA 4XP5L 4LEXL 1MY7A 3WJJA 1JWMB 3AREC 2YWYA 1NMAL 1HQ4B 5E9DB 3MNZA 1HIMH 1F4AA 5DFTA 2D0GA 4NZJA 3LKRB 1D5ZB 3CH1B 1YNKL 5I17A 3BEVA 5MI0C 4XBGB 5IQ9A 2O5XH 4PJEE 1HHJA 5DQ9B 5TQ0L 2CK0L 2GSGA 2EDXA 3GSNL 5CZXD 4G8FB 1NMCC 4H5SB 2DTML 4PJCF 2V5MA 3SQBA 2XV6B 3B9KA 3WL9A 5FXCH 1G9EA 4Z5RA 3V6OE 3CFBA 2ICWI 3IVKB 4MX7B 4ELKB 4AY0A 4ODVL 4JDTH 5AUMA 5DZNA 3VFPA 2AXFA 3VXSD 4JAMB 1BZ7A 2HFEA 3T2NH 4EBQH 3O2VL 5C2UB 4FZEH 2ZUYA 3T77A 1A22B 4I3GA 4LPTA 4NM4H 1INDH 4Q58C 2G5BB 3VGDA 3ULSB 3ES6A 4LLVA 1K5NB 3GHEL 4LU5H 1CDIA 1HCFX 3EOBA 2BJMH 3HPJA 4UOW0 4XC1H 1KELH 3K4DA 3U0WL 5DMKA 1IMHC 4Q9QH 1XF2A 4M5YL 4K7PH 4JZJA 2PCPA 3HUJF 1MCWW 2P24A 3FT3A 3O0RL 2HT2C 4JM2A 2YD1A 3X17A 4DGIL 3O2DA 4QHKJ 3GSWA 3KLDA 4TSBH 3X3FH 4OFYA 2BY0A 3MRGA 3ZSTA 3S8WA 2VDPH 4NSKA 4TSCL 5EOQH 3HMXH 2KKQA 1MFEH 3P30L 4K9EH 5KSAC 5T3XE 1QPXA 3BO8B 4ZPVA 1UB5B 1DANT 1E6JH 1OTUD 3DMMD 4Y5VA 3KYMA 5IJVB 3GO1L 4PLJD 2NY5L 3FOLA 1BVZA 2V9QA 2E7CA 4GW4B 4PJDF 3U1SH 3E6HA 1KLFA 1CU4H 2K3TA 3LB6C 5AZ2H 4D2NA 4NO0D 4ZTOL 5C0CD 4U6YB 4ZYKA 4JRYA 2NX5D 3AXLB 5F88A 1E27B 5EO1B 3BXNA 3OWEA 4UIKL 1BM3L 1JGEB 4PRBB 2YXMA 1FIGH 1KIRA 4BSVA 3KLAB 3I6GA 1F8TL 3U9PL 3D3VD 3WFHB 1ZOXA 5C0GA 3F7VA 4ZFOB 4E5XA 1CLYH 3L7EB 1PLGL 5D2NE 2VLRE 2DD8L 4NO2B 3WFCH 1I7UB 4PV8A 4XGZA 1GHFL 5BJTB 5BO1L 2QQLH 4PJAB 4N8CL 1OP5H 4X7TB 3L5XH 1T83C 3D18B 4JB9H 4CGTA 2UVFA 4KUCF 1XIWB 5TGBA 1ND0B 4PREB 3U36A 3T3ME 3VFSA 2XQBH 2N56A 1Q9OB 3PGFH 4JFQB 4LSSL 5HPMA 4U1NA 1EHNA 3SKMA 1F4WL 1OB1A 3LS4H 3BDYH 2BRQA