5BQ7B

Crystal structure of chikungunya virus-human fab 5f-10 fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
214
structure length
201
Chain Sequence
VLTQPPSVSGAPGQRVTISCTSSNVHWYQQLPGTAPTLLIYVNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYGSAVFGGGTKLTVLGQPLAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 5F-10-Heavy Chain
publication title Structural Studies of Chikungunya Virus-Like Particles Complexed with Human Antibodies: Neutralization and Cell-to-Cell Transmission.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 201
sequence length 214
ec nomenclature
pdb deposition date 2015-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bq7B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bq7B01
3O3BA 2D4FA 3OKLA 4PLOB 1BP3B 1G9EA 1DQQB 4HUKB 4MHHI 4XBGB 2C7UB 1LEGA 1MQKH 4J4PC 1N3NB 4PRHD 1CL7H 1VFUA 3VXMA 2O5ZL 4U3HA 3ULVF 1P4IH 4MD5A 1PVHA 4C4KT 4UT9L 4PGJA 3L5WA 3ULVC 2BOCB 5IBLC 4K3EL 3LPGA 3HA0A 4XWGH 2FX9L 2XIDA 3KPPA 1OM3H 1FHGA 2BSTB 2H8PA 2HFEB 4OM0L 3MRHB 1BOYA 4PJEA 4R26H 3JVGC 1NC2B 4U1SA 5DVKA 2VDQL 2XQBH 5H37H 5CBAA 5IEKB 3FHQA 3VFTB 5L88L 3WFCH 4XVSL 3GB7B 2YA2A 1MCFA 3AFLA 4K7FA 5HY9A 3M1BB 2P24B 2EE6A 3KPNB 1CLZH 1HKLL 5GGUB 4LOUD 3MRKA 1R5IB 1NGXB 1ZT4A 4M62H 3HUJF 3WNNA 3V5KB 4JO2H 2BFVL 4K7PH 4MB3A 2BX5A 5KVGL 3QFDB 2Y6SD 5CZVL 1IGML 5MP6L 4ZUWA 4D9LL 2LU3A 1W72B 4JFED 1I1FB 1NMAH 3O8XD 4XB7A 4OLZH 3BKJL 5B8CB 5CD5C 2EZ0D 3BZFB 1BM3H 5C6WH 4N9GB 3CFDB 2ZPKL 4PB0L 5IB4B 1MFAH 5DRZB 3F12A 4YZFF 3JWOL 3BP6A 3EOAB 4NO0B 4OLVH 4P2YA 3L7EB 2CR3A 3J8F7 3X12A 4RISL 1M4KA 4B50A 4JFZL 3SJVA 5IMKB 1WBXB 4N90E 3CUPB 3ARBB 4ODHL 4PGCB 5LJYH 1TVDA 3MFFA 3O81A 3MRDB 4O4YH 5CZXD 5DHYB 1DVFD 1OQXA 4GW1A 5T3XH 1NDGB 2ORBL 3LEXA 1E27B 3A6BL 1YMMD 1YEIH 4OZFG 3HR5A 4Q9QL 5F7EH 2BVEA 5FCUH 4CKVX 4DK3A 2JB6A 1XF2A 3MGTB 1L0QA 4ENED 4NHCL 4G42B 2VQ1B 4LLUB 5HHQA 4P5TD 4M7JH 1AGDB 4ZSOE 3OMZA 5JDSA 4WEBL 2AXFB 2OX5A 3LHPL 4KDVA 4LMQE 1A7QH 4YDLB 5EUKB 2KZ1B 5GZOC 2IPUK 3T0DA 2VDKH 4HIIA 1BQHB 3RGHA 1JI1A 1MWAH 2E9JA 1LE9A 4BKLB 2DI7A 3KPRE 3V6ZB 3K2MC 3QUKA 4XH2A 1KENL 1CU4L 4YHMH 4MA3B 3T04D 2D7OA 4NWTH 1H3UA 1T20A 3L1OL 4NQXB 3TT3L 1JPGB 3QXTA 1LE5A 2FX8L 4HUXA 3WDIA 5CIPA 4CU8A 2HWZL 5TGBA 4QXUH 4ZDHB 5JOEA 5SWSD 3VA6A 2F8VA 2QHLA 2CLVA 4U3XA 1NBYB 4QHLB 1U8IB 1F11A 4L8DA 5BQ7A 5JTWA 4NBXB 5HHNA 4CNIB 1MHEA 3P4OA 4CMHC 1U58B 3F7VA 2Q20A 4FFVC 2OZ4L 4S11A 1N5AB 1FORH 1PX4A 2CMRL 4NT6A 3JV4B 3VFOA 4JJHA 3LKSA 1EHLL 2B1AH 2P8MA 3BW9A 3MUGB 1ZSDB 5ICXB 5LWYH 1P6AB 3CNKA 3OG6B 4X5XA 3Q3GA 3R0NA 5E03A 5EBMB 4NWUH 4S1RL 1MRCL 4XPBH 5FUZL 1HINL 4PJCB 5DZLA 3HNTH 1IAII 3L3OA 3BQUC 2OM5A 4OZHE 2YK1H 1P4LB 2IQ9L 4D94A 2RQ8A 3MRRB 1T66C 3DURA 1UA6H 4R8WH 4WGWB 2Q86A 2ICWB 2GITA 3B9KA 4LNRA 5JW3H 3MOAL 5TH2B 1S7SA 4DTGL 4M61A 3B2VH 3RL2A 1FH5L 2HTLD 2ADFL 1JCKA 4QRQB 3F62A 1IGTB 4JDTL 4JO1H 2R15A 2DQJH 4FXLA 4DVRH 5E6ID 1H5BB 1VA9A 2DMKA 2PW1A 2B4CH 2EC9T 1UWEL 4MQTB 3C6SA 1WWAX 5I8CA 4YXHH 3C8KA 1BFOB 5I8KL 1JNJA 4YBLB 3M17B 4CVZB 3CDYA 3LN4A 3OF6D 3BHBA 4UU9A 3VFWA 1KJ3H 1TETH 2ZG3A 3DX8B 4U1KB 2VLJD 3HNSL 3V6BR 2DMBA 5L8LB 1S7WA 4DN3H 2ZOLA 4ELMF 2F74B 2XFXB 4L4VD 2DQTL 4FQLH 3VRIA 3T8XA 3CPLA 4XRCB 3MR9B 3TO2A 3WS3A 3KYMB 4YO0A 2ZKHL 5T1DH 4CJ0A 2WM0A 5IW1A 5C0JB 1KYOJ 1RZJL 3N1QC 4P5TB 5HYQB 3PL6D 3HZKA 3KLDA 5IVZB 2X4NA 2ERJC 3KLHD 3WXWH 5KSAC 3E6FB 4FQIL 1CDIA 3EFFB 4AQOA 2PO6A 4JAMB 4CN4A 4JFOA 1NSNL 1BWWA 1E6OL 4J3UA 4OLWH 2OR7A 2CIKB 3MCKB 4CUCA 4DKFH 4QRTA 3VXUD 4AH2A 3ULVH 5BZWB 4PJIE 2A9NL 3H6JA 3GO1L 1JTPA 3QWRA 3P9MA 4MAUL 3CK0L 4ORZC 2GIYA 1ZEAH 4AENA 2V2TA 2EC8A 1JK8A 3A6OA 3MRQA 4JN2A 3MJ8A 3ALPA 5I1GH 3D18B 3QNXA 4JPVH 4JQXA 2W92A 4HJJL 1ZGLB 1MLBB 4MCYA 3HZMB 2CDEA 2BSSB 3N1PC 3Q5TA 3S36X 1TZIB 5ACMA 3PABA 4GBXC 3MNVA 3MJ9H 1LWRA 4UBDD 1G7JB 3H7LA 2D0FA 4JQVC 1S78C 3IDXL 4DGYL 1YYLH 3T0XA 3HAEG 3U6RA 1L7IL 3OXSA 1H3PL 4JRYE 4N0UB 3HNVH 5FYLD 3DJ9A 5H94B 1J8HD 1RJZA 2XYCA 3EZJB 4P4KA 4HMCA 3QHZL 4JCMA 3E6HA 3GBNH 4FQ1H 1NGZB 1FZOB 4P9ML 5GGRA 3K81A 3D0VB 5TF1H 2D2OA 2UYLB 5TPWL 3G6JE 4AL8H 4DN4L 1H8OA 4GMTL 3OB0H 3V5DA 4TPRH 1T5XB 4BUGA 1RK1A 3MA7A 4MJ6B 5I8EA 5JHLL 2CXKA 1FZJA 4UQ3A 2XN9B 1H9VA 3INUL 1AXSB 2VLRA 1DP0A 1QBML 5HXMA 1NFDE 3QPQC 4MSWB 1RJYA 3ZTNH 1T4KB 5E6IB 2X89A 3TH4T 1FP5A 1P7KA 3IJYB 1A14L 4JQXC 3L95A 4KI5F 1CICA 2VAAA 4MA8H 4PYHA 3BP4B 1ADQA 2G9HB 5MEQB 2YPLB 2VDPL 1Q0YL 2PXYA 4CMHB 3U9PL 4ZS6C 5EULV 5IMOA 3U0PA 1HH9B 5EWIH 1BLNA 3U46B 4K9EC 4LVNC 3I6KA 3TVMA 1AO7A 3CLFH 4KV5E 1FGNH 1X5GA 4C55A 1WSST 3VWKD 5HYEA 1FFPB 3R8QA 3L5XH 1B0WA 4Z7OF 3H9SE 8FABB 2FCBA 1RZKH 2VLJB 1FNFA 4NPYA 4GFTB 4OFKA 4M5ZL 5B38G 1XIWA 1U95B 4S1SL 2EDRA 1G7IA 4F2MB 1I3RB 3BH9B 2X41A 1LQSR 1R3JB 4L4VB 1A1MA 4L8SC 4CN6A 1VADA 4N8VG 3NOIA 1ZHNB 1BQLL 1QFUL 1DFBH 1HSBA 3FB6B 3S7GA 7FABH 4JO4L 1QA9A 3BQUB 4H0GA 3UJJH 3HI5L 2M26A 4P23B 1TPXC 3O41B 4HV8A 3N9GL 5AYQA 3RWIA 3TCLA 4HK3N 5E2UL 5F7NC 2A6IA 4JFXB 4WEMB 5D1ZC 4HF5L 4M8QA 2P5EE 3LKQB 3WFHA 5EU3B 1CD9B 2LVEA 1OPGH 4NKMA 4NP4H 4Z77A 4GXVH 3BPLC 2XRAL 4MYWB 3SCMA 3O0RH 1FZKB 3OWEA 3VXUB 1FJ1A 4JHAL 5KSBA 2BRRH 5CKAA 1D9KA 4P2QD 1JPTH 3GRWL 3C87A 4ODTH 5FK9A 4HJGB 3IDGA 2HRPH 1U8KB 3CJJA 5EOTB 1FYTA 2OP4H 5IFHH 3SDXA 2WV3A 1CICC 3MLTB 1FCCA 5HI3D 3LY6A 2IADA 4DGVL 4HGWB 4H88H 3AXLA 3MRPA 3QIUA 2PXYC 4X83A 2DQCH 2OL3L 2VDOH 3DV6A 1AGCB 5DO2D 1A02N 2NZIA 3F5WB 4OUUB 1XGUA 2VLME 3EJZD 3TBSB 3U0WH 4EBQH 5I30H 1EEZA 4LGRB 3O3EB 1ZLVH 1V7ML 4M93B 4RGOL 2F58L 1TITA 3QNZA 1XGTA 1CE6A 1ZVHA 4LPUA 3TYFA 5CIPH 4IMLB 4HS8L 5C3TA 4HH9B 4LRNH 3SGEI 3MRGA 1GXEA 2P47B 2XICA 2PYFA 4V2CB 3W39B 1J8HB 1L6ZA 2ERJB 5KSAB 3O6FA 4P3DB 5BRZD 1WF5A 3NTCH 3TPUA 1MEXH 1XH3B 2JK5B 1I8MB 2RIKA 1GIGL 4L4TA 5KSBF 4K23L 1EVTC 1DSFL 4XNUH 1GOHA 2R0KH 3RPIB 1D9KC 1NLDL 2WINB 4W6WB 3SOBH 1F3RB 4J1UB 5F6IB 1BHGA 3SDXF 4OD1H 1E4WH 3TT1L 3BUTA 1CDBA 4NDMB 2G60L 4KJPD 3RVTD 4NQCD 3GIVB 4X6DB 2RJMA 5C6TL 3UC0L 1CBVH 4NM4L 3TNMA 4PRBB 1QHPA 3D3VA 3QIUC 1W0VA 2ENSA 3NAAH 5EOQL 4L1HA 2P8LB 3HC0B 3O3AA 4Z8FH 1XZ0B 3IJSB 4GBXB 4NUGL 4Q7DA 1QR1B 1B4JH 3QA3B 3IVKB 2DD8H 3CX2A 1GSMA 2ADJA 1IGFL 3S34H 3VWKB 5C0DA 3ULUD 3DI2B 3DX6A 1PQZB 2ITDA 4ZTOL 1OAYH 3MJ6A 3SGDI 4PJDE 4WO4A 1B90A 4U1GC 1DE4A 1TZGL 1UM4H 5E4EC 3REWA 4GG6E 3H0TA 4KPHL 3IFNH 2EDFA 3QCUH 3WO3B 4KQ3L 4JN1L 2VXQL 4AIXA 2BY2A 1ETZA 3O6FC 1LDPH 1WEJL 3G5VA 3LDBB 1PSKL 4GKZB 5IESL 3UTTE 4XVJL 5KOMC 1LO2L 4OTXH 4WEUD 1KACB 1W0WB 5EZLB 4M1DH 4PRPA 2A6KB 1C7SA 4XMLL 1UT9A 4GS7C 4JG1L 3ZZ1A 2YC1A 4NNPH 4RBPK 1ZV5A 4XMKL 2VISB 3MV01 5ANME 2YKLH 4EVNB 2CO6B 2IPTL 3Q6GL 4P2QB 4ZAKA 4LHJB 1BD2E 4P3CH 4X9BA 3RWDB 2C1OA 1HHGA 1INQA 5FM5M 1OSZB 1HH6A 1C12A 5GXBB 3RY5A 3NFPB 1R3IH 3EFDL 5DMJB 1YC8A 5B3JE 1QSFA 1QVOA 5DHVB 1I8KB 1LNUA 2PTTB 5FKPA 5AD0B 4LVNB 4ZUSA 4HSQA 1A47A 2D0HA 1RFDL 3BDXA 3FCTB 3N1GC 5KVEL 5BZDB 1EA9C 3PP3H 1RZ8B 1A9BA 3KYOB 5HDQL 4R4FH 3BDBA 3JWDC 4P2CG 4AIZA 1FGVH 4N1CA 4XHQA 4L8SB 2XT1B 3FRUB 1F4HA 3ILQC 3AREC 2CKNA 4M4PA 4PRIA 3JTTB 2CRZA 3E2HC 1RVFL 1TPXB 1ORQA 2BNUB 5GRUL 3AU1A 4AYFA 4FABL 1BQSA 1PAMA 5D1ZB 2HT3C 4CVXA 1GC1C 1KIQA 1I9RH 2ZOKA 3AM8A 3VFUB 5BRZB 3FFCB 5IB1B 4JZOB 5TFSH 1U36A 5FKAB 3BPLB 4HULB 2R1WB 2NCMA 3O9WD 3MRLB 2PYED 2NPLX 2ESVE 4W6XB 4X4ZA 5FO7A 3HMWL 1INDH 4GAYB 1RJLB 4HQQL 3VG0H 1TVBA 3DYOA 2CUIA 5IVXA 3R1GL 2FL5B 3CZFA 4XP9H 5D7LB 1Q9WB 2EXWD 1IGJB 3FB5B 3VU2A 5IGXH 2X1QA 4PY7A 3RAJH 3WFDL 5FHAH 3VWJA 2DWDB 5BMFH 5HYJE 4H26A 3RHWK 4XNXL 3SDDD 1UM5H 3F7PC 1MQ8A 1TJHL 4K55A 1MF2H 3O2WL 3LIZL 3MRBA 4WDIB 3VXQB 1CXFA 3OAYH 4R96B 4PR5A 4RMRA 3U79A 9CGTA 5C0BA 2CIIA 1LP9A 2ZSWA 4KTEH 4KK9D 1AD9B 5DVMA 3DLQR 1F4XH 4JFPB 5D1XD 4P59L 5EIIB 3V7MA 3KLAB 1WITA 4HAGA 3W9DA 3IDIA 3MX0A 1FSKC 3C5JA 3HFML 5DUML 4QOKD 1I7UB 2JIXA 1ADQH 2W1NA 2X4QA 3S98A 5DEGA 2QQLH 5E1AB 1DQLL 3QDGE 5FA3B 3QB7C 4M00A 3AM8C 4JANB 1JF1B 3UTZB 1T1XB 2H32B 1EJ6A 4LSPH 4Y0GA 4UILH 5DJ0A 5C6PB 4CVWA 5IVXF 5SWZE 2VH5L 3BSZL 5CBEA 4PJAA 2NY4D 1AIFA 4QLRA 5GSVA 3U1SL 3O2DL 4OCYH 2OSLA 1KBGH 4JCLA 1MJJA 3PV6A 3D69A 1DQQA 1UEYA 2JCCB 1SEQL 2FX7H 2WLYA 5K9OB 1G7QA 1X9QA 3OR7B 2OLDA 4YIQA 4EN3D 4F9PC 4XI5D 3VWJC 3D0LA 4JDZA 1EO8H 4IDJL 4R6UA 4XAWH 4HKJA 2YWZA 3BEWB 1LP9F 1AR1C 3D9AH 4LCUA 4M6NH 2BOCA 1OLLA 1JV5B 35C8H 5IROA 4NJAL 5D2NB 2BNRB 2DQDL 3GMRB 2W0PA 4WUUA 3ROOA 5DEZA 3DUSB 3X13B 4M7ZC 1IGCL 1U8OB 4U1GB 1XCTB 5IEKA 4KJWC 1UYWL 2BVOB 2FHCA 1K8DA 3M1BA 5EH1A 1LO0L 1CFQB 5DJCB 3KXFB 5K9KB 5F1IB 2ATPA 1AKJA 3NCJH 4JREB 2P8PA 4M5YL 4O2EA 5FUOH 4BSWB 2DLIA 5F89B 1C08A 3QWOB 5DJ6B 4ZQKB 3WIIL 4PD4K 1B6DA 1NGQH 4AEHL 2HTKD 2Q76A 4PJAF 3QYCA 2VLKB 2A38A 4Y2OA 3ULSA 4LHUA 3BPCB 4PGBA 1ERNA 4WHTB 4WFFE 3F7YA 4OZ4B 2WBJC 1MFEL 2V2XA 1WUNT 5MEOA 1BZ9A 2VTFA 1CD8A 3ZDYE 3HPJB 4QRRE 1OTUC 1HKFA 4N9GA 1I85C 1CLOH 3B3IA 4XNYL 4WRLA 4Z0XB 5CEYB 2ICWI 5B39G 4QXTB 5D7JC 1P4IL 4BH7A 4OSUL 1B0GB 2D31B 2FZ3A 5IB2B 1FRGH 1IBGL 1R5WB 1V5JA 5HD8D 1FZMB 3P9LA 4MAYA 5EZJA 2WWKO 4Z9KB 2WP3T 1A2YA 3FQWA 1OM3L 3WNOA 3SDDB 1XR8A 4K8RH 4R26L 4MXWH 1BMGA 1GGYA 2E6QA 3L6FB 4MJIA 1OAUL 1TCRA 4RFOH 3FZUD 1AI1L 4YDKH 5IEHB 1N6QH 4FFZL 3MGTA 2HKHL 5BXFA 4FNLH 4H5SA 5IG7B 4FQXD 4EI5C 4EUPG 3HG1A 5D1XB 3AREB 4XPFH 1DLHB 4M62L 4XT1C 5JHDA 4K7PL 5GS0C 4X99A 2MCPL 5L7XH 3OR6A 3MV9B 4M9PA 3DMMD 2AEQH 3GMQA 2DJUA 4RQQB 3RL1A 1JHKL 3K80A 4HUVB 3LN5B 1D5XB 2YN5A 3A67H 3SGJA 1BM3L 3VW3L 4NQXA 4ODSL 3MRFA 5C0ND 3ARGA 1NLBL 3ZL4L 2HJLA 4AQ1B 3WV0A 4LDOB 4ALAL 3DVGB 2NY4B 3CU7A 3FJTA 4G8IB 2IAND 5JUEH 3ZYIA 5GGSA 3DNKA 4ZOBA 3SQOL 3VGBA 2XPGB 1MFBH 5DZOA 5JO5A 2FBJL 4B0MM 4G8GE 3KYAA 2L7JA 4O4YL 4EN3B 1KUMA 3O2VH 1ZWIB 2M2DA 1F4YH 4PRHA 5F72S 4MAYC 4F33A 2DM3A 5E8NB 5D5MA 3VXSB 5FCUL 1DLFL 4J8RA 3MLPA 1Z5LB 5FXCH 4ZODA 3TO4C 3SKUD 3STZA 1FN4A 5EBLA 4M7JL 4M1GH 5IFAL 3FO1B 4OGYH 5D7IA 3FQNA 3C09C 4L9DA 5J11C 4I18C 4PJFA 1FSKB 1GZPA 2VDKL 5AWNH 1WV7T 4JY5L 1OT2A 2XTJC 1MWAL 5GQBA 3PP4L 2DOCA 5DD5H 2NY3D 1NANI 4JFFE 1GGCH 4KKLC 4NRXA 2D7PA 4EI6A 3I50L 3SGEH 4RA3A 5ACZB 3S37H 1UH2A 4PP2B 5DUBB 1MPAL 1AGBA 2FJGB 1S7QA 1Z3GL 2BNQB 2CK0H 4K94H 5TH2A 2VXVL 3SGJC 3QXDA 1ACYH 3OHXB 2NXZC 4JFEA 5IW6B 2LABA 4WHYH 1KLFA 3OG4B 3O8XA 3K2UL 2AJ3B 5B22A 3MLVL 1YY9D 5HHXH 1QNZL 2AEIT 1DCLA 4MJ4A 2AGJH 4P5MA 4D9RE 4HLJA 5D5MF 3VH8G 3QHFH 5GSRB 2RGSA 1BFTA 1B0RB 5DMKA 1F4AA 1H15A 1AD0B 4OF0A 3MV11 1BREA 3KPRD 3LKNB 1ZLUK 1Q1JL 1JGUL 1QTYT 2OYPA 4BFIA 1VACB 4Y19D 3E3QE 3LKPB 3MBXH 2HFFA 3B83A 2O5XH 4OF8A 1IGIH 1KNOA 4NWUL 4QHKI 3HZVA 3IYLW 1DVFA 5D7IF 3MXWL 2GK0A 3RWCA 1SYVB 3FT4B 1YMMA 4PJFF 3C08L 4YR6B 2FH8A 4BA8A 4DFIA 2FO4B 4M7ZB 5KVDL 1X5ZA 5E8DH 1RULL 1DN0B 2WQRA 3CLEH 3HNTL 1IEHA 2Y07H 3MLWL 2XY1A 1KJ2H 3KPSD 3KYMA 2W60B 2AJUH 3MODL 5E2TL 4Q2ZB 3VXTA 5EPMA 1QBAA 2HLAB 1YPZE 5EA0H 1UA6L 4R8WL 5KG9B 5ID1A 4I0KA 4U2ZA 2CPCA 4HUMB 4H1LB 5ENWA 1UWXH 2OJEB 5JW3L 1B6UA 1KCRL 1MFCL 5ADOH 3EJYC 5KJRL 1KELH 4ONFH 5HHPB 5I1DA 4PJXA 1B88A 4PGEB 5F9AC 2YEZA 2FIKB 3L3GB 2DQJL 4DVRL 2UUDK 4ZFOL 2WBJB 4NKIH 2B4CL 4C83A 4UDTB 2XZCL 2PF6A 4KU1A 4LKXB 1HQ4B 3RKDD 4R0LB 1CTNA 1NUFA 5C0AB 5AUMB 3QNYB 4JR9H 4PUBH 3LEYL 1JBJA 5D72H 2EO1A 3CFKB 4XVTL 4W6YB 4JKWA 5D7JB 2IANB 1KJ3L 3PWVB 1YN7B 4NC1E 4CW1B 5SWSA 2LAGB 2ZSVB 1GGBH 3HZYA 4FZ8H 2YSSA 3SPVB 3L5IA 1HIMH 1TZIA 2NY5C 2ZUSA 5BJTB 4Q58C 1T1WB 2PCPB 4X98A 4GKSB 1E4XI 2G5BA 2C5DC 5E00B 5F8RC 4PJGE 3MV8D 5BV7H 2XWBA 1LGVA 2JB5H 3FQRB 4LCCA 5HYSA 2EYSB 5T1DL 1N6VA 1A4KB 1JL8A 2R2CA 3CFCH 5GS2D 5K9QG 2G75A 4N0UA 4POZD 5F88A 2WZPD 3QG6B 4EI5B 3WXWL 3GUTB 2J4WH 4IHOA 1TFHA 2H2SC 5D2LA 4OLWL 2UWEE 3RGVD 2EDJA 4KK5C 4Z76A 1BQHG 3KPLA 4LPXA 2J8HA 3GKZA 4I5BB 3VXPA 3BPOB 3MCLL 1JZ2A 2E8ZA 3MMEB 2R1YA 2O5YH 5FYJH 3CH1B 1JZ4A 1EXUA 1ZEAL 2HG5A 3D25B 2GKIA 4MJ5A 5HJ3B 4A6YB 3PQYB 4MSWA 3GSQA 2R2EB 1T4KA 1FDLH 3MRJA 4BH8A 2BJMH 2FBOJ 5GJTH 3VGGA 4OZIE 3QI9A 2NX5B 1Q72H 3H7BB 4I3SL 3EYVB 1NGWA 1S9WA 2AEPH 1JNLL 3N50A 5FCSH 1KLUB 4AY0A 1N0XL 5J1SC 3S9DB 4RNRB 5E94B 1A1OA 1YYLL 4ETYA 5DTFA 3SO3C 4LF3A 2BVUA 4Y19B 4CU6A 3S3JA 1ZLSH 5J7CC 4LCCC 1T0NA 4NJ9L 4PJ7B 3GHEH 4PG9A 1ZVSA 4WU5B 1XF4A 3W11D 5D2LF 4FQ1L 5J11B 3C09B 5HDLA 4I18B 5E8PA 3QZWB 1D5ZA 1XEDA 4PV9A 4IMKC 4X7TB 1HZHH 5GRYA 4C4KO 2XTJB 4YLQT 3KPSB 1A6VH 3HCVA 1WAAE 4MNGA 4AL8L 4IRSD 3FOLA 5KVFL 2AEWA 3WSQH 3PL6A 1LO5A 5T3ZH 4HJ0D 4OIAA 4AEIL 3L3HA 2UZIL 2V17L 4KHTH 1TVHB 1FBIL 4KGLA 1JJUA 3N06B 2NYYD 4RDQF 3T65A 2Q8BH 1FZKA 3LN9A 1BEYL 4XPGH 3ZTNL 1G84A 2EE9A 2R2BB 4X6CB 2H45A 4JRYD 3GMLB 4Z7QE 2IAMD 1RMFH 2RBLA 4MA8L 2VKXA 4PY8I 4PREB 5IBTH 3W0WE 2FWOA 4GJTB 1DZBA 4Y2DD 3VDAA 3MLTA 4I8DA 3QI9C 4UV7H 5EZOH 1JGEB 2X9WA 4JZJC 4RWYL 1QBLL 5DQ9B 4OGXL 4N1HB 4G6KL 4YC2C 3TA3D 2EIZB 3VCLB 1T7VA 4N68A 1QRKA 3GSNA 1ONQB 5J0BA 3V0VB 5I66B 2EIDA 4DW2H 3TCXA 3GSRB 4XP4L 5HDBF 3KWWA 4WW1B 4X9HA 3MV8B 5HHMB 3IKCA 4UTAL 4MNQE 5IMMA 4HH9A 3UJJL 3I75B 3MV7E 2GY7B 2AJYH 4PJBA 4G3YL 1ZA6B 1XF1A 3E8UH 3MGOA 3VMPA 5I8OH 4OF7A 3QEUA 3M07A 1G7MB 4GXVL 5ACLA 3O45B 4ZS7H 3RGVB 3UTSE 3G5ZB 1OTSC 2V6HA 3WN5A 1LO3L 3QQ4A 25C8H 3GGWB 5JW4R 5IB5B 2ZNXA 2AK4B 4JM2D 4L29A 3MYJA 3H9SD 1X5LA 5H2BA 1NAMA 2DTSA 5CGTA 2GFBA 3QFJA 5IOPA 5IFHL 1T2XA 2O26U 1IC5L 4U1JA 4V1DB 1WGOA 4LNVA 4H88L 5BS0E 3V4PL 4OJFH 4QRPE 3D48R 4GW5A 5DI8B 1G6RL 5C3LD 4OFVA 1WISA 2P5ED 1KJMA 3RUGB 5DQJB 4HPOH 1ZMYA 3U0WL 1KEMH 2CDGA 1FL5A 2H1PL 3T4AA 1OVZA 4Y16C 3QA3A 4WW2B 1OGTB 3NZ8A 2LV4A 5IB3A 3QULA 1MI5E 4NQSA 5C0CA 4LRNL 3VWKA 1S7RB 5JPNB 1S9YB 1L7TL 1RK0A 4PJBF 3SQBA 2X70B 1I7RB 1YEKL 2GSGB 4QTHB 2NTFB 4CADB 5JXEC 1KULA 4JM4H 1ED3B 3DSNA 4KKCD 1GZQA 3F6LA 1DEEA 4YAQB 2HJFA 1A64A 1E4JA 3NCEB 1MEXL 1JZ7A 3NCYS 1ZA3B 4YNYA 4ISVB 4X6FB 3SE8H 4DWHA 4KMQA 3AS0A 4XNUL 3IF1A 4ODUA 4BM7A 2R0KL 4OF6A 2NY5H 3P4MA 5I76A 4KKBD 1IGYA 3C6LD 2OTWB 4ZXBC 4OD3L 1U8JA 3EUUA 4Z7UB 3BIKB 3MQIA 3CMOH 5ADPL 2Y23A 4HCRA 1U8NA 3D2UD 1LEIB 1B4RA 2BSRA 4DZBA 2H2PC 2FSEA 2IAMB 1CE1H 3FO2A 3HRZB 4QF1B 5T1LB 1QP1A 4NC0B 3SGKA 4Z8FL 3LB6D 4D3CL 2EYTB 1SY6L 4HKBA 2HJKB 5B4MD 2DI9A 4KHXL 5FAAA 3LPWA 2WQ8A 3PGDB 5DA4A 1SYSA 1IQWH 4HGKC 1G7PA 1CLCA 4M7LH 5FO9B 2DD8L 4GRWF 2VLLA 4BYHA 5TDOB 4L3CB 1R5VB 3KAAA 2XWJB 3SO3B 4LP4A 2D7TH 3OQ3B 3GHBH 1OAYL 4HWUA 4ZFFB 5FB8A 1V3MA 3VDBA 4XC3H 3T0EA 4BQ9A 3DX7B 3V4UL 3IFNL 3GI8H 3WLWC 2BC4B 1F00I 4D0DB 5JA9A 4LPYA 1AE6H 2B2XH 2R2HA 1J0JA 4RMQA 1QRND 3U83A 2AABH 3ARFD 4OCRL 5C08D 4OTXL 3U7YL 2J7LA 4F7PA 1JGLL 1OSPH 3K7UA 1QBBA 1QFHA 4M1DL 3IFPA 1OAQH 3VFPA 3VFUA 5BRZA 4NNPL 4JZOA 3BXNB 2ED9A 3FT2A 4XCCL 3REVB 3MRLA 4WTWA 1QSEE 1ZT1B 3GMNB 1P7QB 1XMWA 4JM2B 3MBED 3MRCB 3IU3B 4ODWB 4NKOA 4NO5A 4WI5A 2GYSA 4OF3A 4Y4HA 1KB5A 5F3HB 3ORJA 2EKJA 5L0QC 1FNHA 4W70A 2HN7A 4JRXE 4PLKD 3PNWA 2FJHB 2P45B 4LCWA 4NQCA 4JZJB 4L4JA 1VGKB 3TWCL 3UTTD 2MKWA 4ZOCA 3ESVF 4YDVB 4YC2B 2F5AL 3DHJA 4MVBC 2E27H 4GLRI 1FVEA 1FC1A 2DQGL 3C5ZC 4XWOC 1JPFA 4R4FL 4XXDA 5DVOA 4YHYC 3T0EC 1I3VA 5C0EB 2V9RA 3Q5OA 4C56E 4HD9A 1J0HA 2A83B 1FIGH 1R3LA 4XP6L 4LEOA 1NEUA 2CDFB 4YHNB 1BD2D 5I73C 3M8OL 3O3UN 3EW3B 3EDDA 3NCYP 3U30B 3NABH 4TNWF 2QJDA 1FPTH 3WHE1 4WWID 1IC4H 1MAKA 5TQ0H 1IAIL 2AAVA 2EYRA 4DK6A 5IWLA 3WS6A 3FL7A 3WL9A 3QUMB 4FQQA 3MO1A 2H26B 3QXWA 1MFNA 1LDSA 4UDUA 5DMIH 1OGAE 1BIIB 1MCLA 4KTYA 2H32A 3MZTA 2DM2A 3C6LB 1OCWH 1GOGA 4Z7NE 5HHVH 4Y4HC 4Z78B 5KN5B 2CR6A 5EORH 3RAJL 3QDJE 5FHAL 3D2UB 5F1NA 4HUUA 3I9GH 4JY4A 1CLYH 3WO4B 4I48A 1YEGL 3T0WA 3E1F1 1EHNA 1JWSB 4XPAL 3IDYB 2DKMA 4LLYA 1PG7W 3U4EA 3TBYA 3ARDC 1A6AA 3BE1H 5D6CB 3IFOB 3SKNB 5LGKA 1AHWB 4R4ND 4HIEB 4HW6A 4KKAD 3QDMA 5ALCL 4KTEL 4Y16B 2NY1C 1I7TA 1F4XL 3KDMA 3G5YB 3ESUF 2XWTA 2EDNA 2OI9C 4P4RB 2E7BA 2EECA 1IKFH 1YUHA 1J1PL 2CQVA 5I1EH 3O6LH 3TLRA 3NFNB 3L7FA 3IXAB 4GKOA 1E4XH 1NCDH 2X4RA 1OTTD 2QQLL 2Z93B 1IC7H 5IV2A 4GRMB 1G9NC 4Z5RA 3RA7H 5HYJD 1DUZA 5A40E 3WS6C 3FONB 43C9A 5DRXB 1QRNB 5F89A 4PRNB 1MVFA 2ZZUT 3ARFB 4LSPL 5C08B 1A4JA 5CLTA 3GSNH 3CX5J 3PJSB 1UZ6F 4YHIB 5CGMA 1JN6B 2XZAH 5DJ8B 4ZXBB 4UIMB 1RZFL 1T1ZA 2UY6A 4OCYL 1KBGL 4LEXH 4O51B 4OQTH 4XB8A 3O9WA 1EEQA 4NCC1 1Q0XL 2PYEA 1RHFA 2FX7L 4R2GD 3MBEB 2AQ1A 3QQ9C 2GJ6E 4YDJA 4YBHA 4KUZH 3QIWD 3CVHL 5F9OL 2AXHA 2MNUA 1UXSA 5I6XC 2VL4A 2VITB 5GGTL 4Y5VA 4Z7VA 5FYLH 2E9IA 5F9DC 4XAWL 6FABH 3SDCC 2GSIB 3QDGD 4KXZH 4BSVA 3QQ3B 3W5NA 3WDJA 3SE4C 2C3GA 1IEAB 5IJKA 3QPXH 3OKNB 4X4MA 4DQOH 1DANU 4HX1A 5CLWA 2Q87A 3U48A 4WCYL 4GKNA 4ONGH 2CUMA 4U1MB 2DLEA 1UB6B 4AMKH 4L1DA 3EOTL 2D7QA 4ZPVA 5E7BA 3WIHL 1NAMH 3UJIH 2Z35A 1UCTA 1CQYA 5E8OB 4LSQL 3MUZ1 4PIRF 5TF0A 3DX9B 4MNHA 1WWWX 2AKRA 4X4YB 1QZ1A 1UXWA 3G08B 1QO3A 4JZNB 4PJ8D 2VABA 4LFHD 2F5BL 5E2VH 1NGQL 3QO0A 1MOEA 1UVQA 4QOKA 2BVPA 4P2OD 4JB9H 1YZZA 1TTUA 3TV3L 5EU4B 4X4XA 1PFCA 4I0CC 3ZSTA 4DZ8A 1F3DH 3UTQB 1HHKA 1SJEB 3FN0H 4GRWH 2CLRA 4IRJD 4PJHB 3MXVH 2UY7A 1UJTA 3NIDF 1X7QB 1KT2B 3VE0B 1D6EA 3GJEA 2IMMA 3ZKMC 1CLOL 4G8EA 1TZHB 1AGEB 4Z7VF 5AYUH 3LKRA 4Q6IA 4N0FB 3TEUA 1U92B 5EU7E 5L0QB 1Q94A 4Y5VC 5ESAA 1FRGL 4NZRL 2KKQA 3BP5A 3PWJB 1RZIB 4M6OH 2NR6C 5DUPH 5IJKC 4TTGA 3JWOC 4RFNC 4YE4L 4EN3A 1KLGB 4GW4A 4K8RL 1RI8A 4MXWL 1JUFB 5I75B 4PLJC 5E08H 3P3YA 4EDXA 3C5ZB 3HLAA 2XZQL 4NBYB 4NN7C 2IH3A 1RU9H 5DF0A 4UINH 3H9YA 5FYJE 3VI4F 2XKNB 4ZNEA 2OZ4A 4HC1H 4E5XB 4WFFD 4YHYB 1K85A 4FNLL 1JPSH 1HEZB 1U2CA 3IU4L 3O6MH 1F90H 2C4FU 3ZE1E 3EDEA 2IPKB 5JNYA 4O5LL 3PXHA 1JHLH 5I73B 1XR9B 1DBBL 4QRRD 1WK0A 3P11H 3F65A 4R9HA 4ZFGH 4IIQB 4MQXD 3F58L 4X80L 1F8TH 2ZG1A 2JJVA 5A16B 4WI2A 4HMDA 3QUZD 3BPNB 3VXRB 2AEQL 4HKZB 2WWMD 5IQ9A 1IZJA 5DHVH 1UJ3A 3K8LA 3R06B 4XPTL 4TVPE 5DJ2B 3QRFM 4UT7L 2C3HA 4PJ5B 4KDTA 5IT2H 4BFGA 4M9OA 3BO8A 4HMEA 3UO1L 1CT8B 1G9MC 1CF8L 3IDJB 1U3HD 3WD5L 4H25A 5DJYA 5L9DL 3WHE0 1UWGL 3OAUH 2VUYA 3BOVA 1V7NL 4ZO6A 1YEHH 3QJHA 4Q6IC 3MLZH 4BQ6A 2BHUA 3V2AR 3PIQB 3ZMRA 4D8PA 2YPVL 4OBRA 5MENA 3O2VL 4R97C 4NKDA 1IM9D 4U1NB 5C0GA 2YZ1A 3VFSB 1CCZA 3DO7B 3ARDB 3UROR 5DMGC 2YD8A 3WIFA 4MXVE 2Z8WC 3LKNA 5M7QA 3NN8B 2D9QB 2OQJA 1A7BA 1PEZA 4Z7WB 2FEDC 2NY1B 5HVHC 4DGIH 1EUTA 1HILB 2R29H 1BECA 4UQ2B 2GJZA 3O11A 2OI9B 4HZLB 4URTB 3ZKXB 2NY6D 5EU5B 1YMHB 4TNVK 4QTIH 4YK4C 4FXGA 4LMQI 4HFUH 1N8ZB 4RBPH 5EC2B 1P7HL 1HI6A 3VFMA 2IQAA 1PLGL 4NN5C 5F9JB 2K1MA 4X7SL 5ESVB 3L9RB 5D71L 2YUZA 3KPMA 4FQXA 3HC4H 2FEEI 4G8GD 5GJSH 5ILTH 5FYKE 1NEZA 2FATL 3S5LB 3TBVB 2Q7YA 3S37L 1KN2L 2J3SA 4ETQB 5FO8B 1DBJH 1AGFB 3RWEA 3S8WA 4K94L 3VMOA 4HLZG 4LAQL 5HHPA 4KDTC 3W2DL 3HI6L 3DMMA 4XP1H 1I1YA 4OZFB 1UFUA 5HHOB 4I2XB 3JWNC 4JPIB 4LKXA 5LVEA 3DGGB 3ULUH 3UPRB 4R0LA 3QHFL 1XT5A 2IH1B 2E3VA 3OL2A 5BVJA 3PWNB 1QFWM 5F93C 2OTUB 4KQ4H 3K4DA 3BRFA 4NIKB 4FP8L 1NCBH 2AI0L 3DUHA 5GS1A 1RIHH 4HBQA 4NQDB 3SPVA 1W8OA 4XXCC 2O5XL 3SBWA 2E7LA 1WQVT 2PN5A 5C92A 3KJ6L 2H32H 4JFYA 2WBKA 3NA9H 5E6ZA 2CKBB 5E8DL 3OTTA 1U6AH 5T5FL 2Y07L 1I7ZB 1KJ2L 4N5ED 4PTTA 2QADC 3FZUC 2D9CA 12E8L 5HGHA 2XA3A 4LCYB 1KCVH 3FQXA 4QY8A 4PJCE 5I2IB 1WTLA 1M7DA 5EA0L 2EICA 4LSSH 1HYRC 4JFDB 4WI9A 2VSDA 3V6FB 3W82A 3DSFH 4S2SB 1UENA 1JYNA 4NHUB 1CXKA 3OKEA 1RZJC 4KUCF 4PS4L 4XX1G 1KELL 2E8YA 2HP4A 3TN0D 3QUZB 5F6HI 2Y1VA 2XNAA 1Z9MA 2GTZB 3QH3B 4UT9H 1ES0A 3QO1A 4KWUA 3MMEA 3AS1A 4K3EH 1RY7B 1AC0A 4LP5A 2FX9H 4PUBL 3WXVL 2IC2A 1T22A 5D72L 4A6YA 5I16A 4OM0H 4OCNC 1WBYB 2F54D 3MPCA 4KJYA 2VDQH 4ODVH 4FZ8L 4ZSOA 3GMMA 5L88H 3WCYA 4XVSH 1RUML 2DQHL 2R4SL 3VGAC 5CJXA 4RFNB 2CD0A 5GS1C 1IM9B 2PR4H 4NM8H 3EYVA 1S8DB 1HKLH 3SBWC 2NW3A 2IBBA 2E7LC 4LVOB 2DLTA 4B41A 3S3SA 2RHEA 4NN7B 2LVCA 2BFVH 3KPRA 4TTDD 5ID0A 4Y19A 5E24E 2IFFL 1IGMH 1XGQB 1FFNB 2VZUA 2KPNA 4GLRH 1U91B 2V7HB 1DDHA 3NVQA 1JGDA 4LSUL 3P73A 4JY6B 4RGND 1CGVA 4HXBH 4X7TA 7CGTA 5DC9B 3WKML 2W0FB 3C5SB 1RUAL 2ZPKH 4JDVA 5E5MB 1NGYB 3JWOH 3HB3D 3OSKA 1RQ5A 1S7UB 1QG3A 1VCAA 1C5CL 5FYJL 4RISH 1RPQA 2I5YH 1T0MA 4ODHH 4ZPTB 3MRNB 4RSVA 1IAKB 1D6VL 1FG9C 1MIML 1WZMA 1BVLA 2V7NB 4E41B 1SVZA 5DWUL 4OCMC 1IMHC 3BD5A 1ZHLB 4NHCH 3GRWA 4U6VL 4G43B 4X5WB 2WUCL 3TZVC 4R97B 2AEPL 4PV8A 4WEBH 1R3KB 3LHPH 3BGMB 4OZHA 4J12A 4TVPL 1W72L 3BZ4A 3CSPA 4GQ9H 4HT1L 4YH6A 4PRAB 5EO9B 3VG9B 1T7WA 1LO4L 4TN9A 2OL3A 1CFSA 2NY0C 1JZ5A 3IAGC 1MVUB 3TNNB 4YHOL 2CLZB 3TPKA 5C07B 1CU4H 2BOBB 1QQDA 4YK4B 5CSZB 4BZ1L 4N0UE 4XTRD 3DVNA 4PGDA 5J6GA 2MQ3A 3DETC 3L1OH 4FFWC 3DV4A 4LSDA 3TT3H 1A6VL 5INDB 3BEVB 4NN5B 5I1CL 3L3KA 4OKVB 4YBQD 2HWZH 4XBEL 3WSQL 4ORGB 3Q6FB 1YEDA 4I1NB 2MPAH 3EYSL 5JXAL 4H1LG 2VDML 1NKRA 2I9TA 1U8HB 3G5ZA 1MJUL 1R6VA 1ZS8A 3TN0B 5DD0L 2Q8BL 1KOAA 5BW7C 1BBJB 5FV2A 2OZ4H 1C1EL 1KTDB 1J7VR 2XN9E 5A2JH 2CMRH 5J3HC 1EHLH 1JYXA 5JORA 3HAEB 3EKCA 5F3BA 5FGCB 3FFDA 2DYPD 3PWPD 1QSZA 4UV7L 4OZHF 3WEXB 4F3FA 3SKOA 1XF5B 4S1RH 4U7SA 5FYKL 2F54B 1MRCH 3CCHB 3QEHB 4QHNB 2B39A 5FUZH 1HINH 2YPLE 3UBXA 4MD0B 2H3NB 3GSVB 1I1AA 1CFVH 1F58L 3T4YB 3MJGX 4GG8A 3KJ4C 2IQ9H 4RMSA 3JUZA 1UB5A 3WE6B 5L2KD 4C54A 5GZND 2VLJE 3FAWA 4LAJH 2HVKA 5D96C 1JHTA 3KYNB 1IEBB 4PJIA 3MOAH 5JPNA 4DTGH 5AZ2H 1T21A 4L4VE 1FH5H 3CXHJ 2AJYL 4JDTH 4YUEL 4QYOA 4CADA 3E8UL 3TP4A 1FVCA 5IR1A 3UP1A 1MCQA 4U1IA 2ICEA 3P4NA 3CXDL 2LTQB 4FXKB 4RGNB 3OKDB 4ZS7L 2I9LA 4U49A 4ISVA 2NZ9D 4Z0BL 5I8KH 3D39D 4U6XA 3C60C 2WIIA 4IRSA 1A9EA 3NA4A 4ZUVB 1R3HA 1OAXL 3ZT5A 5ICZB 3LV3B 3K1KC 4GMSH 4LHUG 3U0TA 2EIEA 3VFNB 3VXUE 2QKIA 4XCFL 3ZTJG 3HNSH 5B38B 1X5XA 4P2RD 5CJOL 2G2RA 2E7HA 4G6JL 5CS7A 3IXTB 2AV1A 4B7IA 2YUXA 1Q38A 4P5KB 4OJFL 1NQBA 3T3PE 2DQTH 1CXLA 2ZCHL 4JRYA 1P1ZB 5BO1H 2QSTA 4OAWB 3T0BA 3VGAB 5DR5L 4OM1L 3P77A 1RZJH 4Y2DA 1I1AC 3QJFB 1BZ7A 2V5MA 1CFTB 3K0WA 3UTSD 4PJIF 1BF8A 3G6JA 4FQIH 2X4TA 5DK3A 3TA3A 1NUGA 1NSNH 1E6OH 2WLZA 4LVEA 1EBPA 4LCIL 2AXGA 4HKXA 4M7LT 4MX7A 2HLFC 5F7FA 3DX7A 4F37F 2A9NH 1IL1A 3PHQB 3GBML 3QEGH 4JM4L 2X05A 3GO1H 3AAZB 1MLCA 1JE6A 1J0IA 1NFDA 4NSKB 1ZAGA 2L0DA 1U8LB 4MAUH 3CK0H 3UTOA 3FO9A 1J8HE 5E5UB 1P2CA 2R0ZL 5H8DA 3UPAA 4R7NB 3CIQA 4PYGA 4IRSC 1QLRB 3MLXH 3JBG7 1N59B 4L3ED 2VXSL 1ITCA 1HSAB 2X2YA 1KCLA 4ZUUA 3H9SA 1DQJB 2FYYB 2NTSP 5I1LA 2Z4QA 3EYUH 3NPSC 5F7MC 2QBWA 4U6YB 1DTUA 1M71A 3IDXH 4DGYH 4PG2A 2DQFB 1OW0A 3E0GA 4X6DE 1L7IH 3OKOA 4M1CD 3JZ7A 3ILPB 3VFRA 2P7TB 1HHJA 3TZVB 1H3PH 3T0AA 3PWPB 5IHUL 4M7LL 5C86A 1ZOXA 4QHUA 5IF0B 5EUOB 3G6JF 2BCKA 3QHZH 4EXKA 4EIZC 4P9MH 2VL5A 4XCNB 1IKNA 5FOBB 3BMVA 2P5EA 5LGJA 2NY0B 1XCQB 4DN4H 5CAYB 4GMTH 5L2KB 1NFDF 3RNQA 2MQCA 3G5XB 2QQKL 1MCWM 1DBKL 4HZAA 2A6JA 1JTOA 1AE6L 4A6YH 4UB0L 1EEYB 1MAMH 2B2XL 5EFIA 3RVVD 3INUH 3L3JA 1QBMH 3BISA 3VXNB 1ND0A 2Z31C 3ZHDA 1MCHA 4GRLC 5IKCB 4XCYA 2CGRL 4HK0A 4UOW0 3RVUD 1A14H 1IT9L 2FR4B 4KV5F 4F7MB 2FGWL 1T0PB 3D39B 1QEWB 2VDPH 1QLEL 3OX8A 5DK2A 1A7RL 3U9PH 1CG9A 3QEQD 4GT7A 3F6IA 1JWUA 4AM0B 5ECJE 4P2QE 1KPRA 4Q9RL 4R3SB 3DROA 4KJQC 1HDMB 4JPKL 1OW0C 4M5ZH 4P2RB 1K5NB 3D2UA 3O2DA 2AVGA 1CWVA 1N5YL 3LSOB 4WV1B 1BQLH 5TQ2H 1QFUH 3X11B 4JO4H 5I17A 1HHIA 4ONHB 3BZDA 3VD5A 5C9KA 3HI5H 3IDNB 4QEGA 5IP4A 3V52H 4XNQB 4QWWD 3KJ4B 2I07B 4ZD3L 4B5EA 4HF5H 1J0KA 1F4WL 1KJVB 3NCBB 1QSED 5J1AB 5D96B 2DQEH 1Q8MA 3U36A 3FOMA 4Z7OE 1I8LA 4Q0XL 2XRAH 5F97E 1LK3H 1CFNA 5E7FA 1U8QB 1T6VN 4JHAH 3NABL 4KRPD 5J6HA 4G7YL 4WWKA 5TQ0L 3CSYB 4KKCC 5LGHL 1KG0A 2DF3A 5DMIL 4JVUA 5ETUA 3C60B 5BRZE 3ROLB 5E70A 3FFCE 1I8IB 4YFEA 4DGVH 5C08A 5C70A 4S0SD 4W4NA 5DEFB 5E2WH 1E28A 2OL3H 1GVIA 1OCWL 2BVQB 4GAGH 5DJ8A 4HPYL 2V2WA 5D1QD 2XKUA 2IBZY 4ODXB 4JJ5B 4PJ9D 4L3EB 5EN2A 5ISZB 1C16B 1J8KA 1MNUH 4EQ2A 1V7MH 1KXVC 3STLA 1SBSH 2F58H 2MHAA 5D7LE 2PW2A 3D85A 4WU7A 4PJDA 3FN9A 4I3RL 4MWFA 5GS2H 1P9MC 4HS8H 4LLAA 3FTGB 5DS8A 4GG6A 1RAMA 2MFNA 4U0RC 2I25N 3LB6C 1NCWL 4LIQE 4LLQA 1GAFL 1EFXD 1OGAD 3UTTA 3VGEA 4E0RA 4XNZC 3SDAA 1IKFL 1I4FB 1GIGH 5E8EA 5FECA 1TMCB 3WHXA 4NZTH 1VEOA 5HYSG 1DSFH 1DUYB 3QUYA 2WWKT 2BMKA 1OY3B 1NCDL 5GRZA 1DEDA 3OJ2C 1NLDH 3QDJD 1JGVH 3FB8A 4X6EB 4WWKC 5CWSB 1JNNL 5EBWB 4ESKA 4AEEA 1BD2A 1A6TB 4YPGB 5SWQB 3TT1H 4NO3B 3RZCD 1HCFX 3IDMB 2G60H 3JTSA 4HIJB 4YXKL 5D70L 1CZ8L 1BF2A 2ADGA 4Y5YB 5EOQH 3CC5B 3BGFC 4LEXL 1G0XA 2APWA 4OQTL 1Y0LB 1WIUA 2GT9A 4WVRA 3IAPA 4NUGH 4PJDF 3QUXC 4KUZL 3QEQB 3KNBA 4RDQG 2OS7A 1Q9LB 3NH7H 1UZ8B 4TULH 2GI7A 4XAKD 1AGEA 3FQTA 4BUHA 4GG6F 1IGFH 1VPOL 2JCCE 1XAUA 4YJZL 3TIDB 3V8CA 4ZTOH 4NRYA 1KB9K 3WNPA 2AV7A 4CBPA 2H9GB 1TZGH 2MJWA 4LLDA 5SX5H 2J8UF 3B6SA 5IK3B 3LKOB 4KQ3H 5K33A 4JPWL 4JN1H 1INEL 2VXQH 2YBRA 2FDBP 1KCUH 3BUYB 3BH8A 4XCEA 5DJAA 4N8CL 1WEJH 4TUJA 2BY3A 2Z92B 3KHOA 5J12C 4I0PC 3LRHA 3SDAC 1K6QH 1PSKH 5F7LB 8CGTA 3PGFL 5IESH 4XVJH 5D2NE 4F58L 2BNRE 5I1JH 1LO2H 2D0GA 3QUYC 3VXOA 2KQMA 1MHHA 1MREL 2NY2D 3ETBF 3EO1B 3QIBD 2ESVA 4GXUM 2GJ6D 1VFAB 4JG1H 3U2SA 5CD3A 5HGAA 1PEWA 1M6OA 3DI3B 1IILE 3UAJC 3KS0J 4OCXL 5CJ8A 1CDUA 5GRJL 2B5IC 2Q6WB 2J5LB 3KXFE 2IPTH 5B3JF 3Q6GH 1YA5A 4L8BA 3EYQD 2Z31B 4GRLB 3QWQB 3B8SA 2H6PA 3LS4L 1FL6B 5DQDL 5HYJA 5DRWB 2P42B 1VKXB 5HGBB 4ZFZB 5KTEH 3R06A 2W9EL 1LEKB 2VLKE 5DJ2A 4WTZG 3QAZC 4YHPA 3DVFA 1RJCA 2BXYA 2IGFH 4LU5H 3EOBB 1RFDH 4Y4FC 5JOFB 5KVEH 5D1QB 5EU6B 4PJ9B 2ZUTA 1NAKL 2HT4C 4OFPA 4RFEB 5HDQH 4Y89A 1YDPB 2GUOB 4X6BA 4JE4B 4XNMB 4M6OL 5L6YL 5DUPL 2D7MA 4AG4H 3PIQA 3QIWA 4RZCA 5T1MB 2VRAA 3S96B 2GW5A 1HXMB 1P4BL 3BI9X 3RVXC 2ATKB 1MHCA 3RWJB 5E08L 1K9TA 2VN4A 1FVDB 4M4RA 4ACPA 4UINL 5GRUH 3QDGA 1A22B 4HC1L 4FABH 5JLZB 4FS0A 1U0QA 3K3QA 1LD9B 4W68A 4Z7WA 2AW2A 5JR1H 3W9EB 1EFXB 1A6ZA 3PGCB 3AROA 1JHLL 4UQ2A 2W9LA 4U6HA 3ZE2F 1ZT7B 2GAZB 2VR5A 5SWZA 3GJFK 3NMEA 5GIRA 3HMWH 4I9WE 4HBCL 4HQQH 3H3KA 4JFQB 2Z8RA 4KH2A 2J12B 3RX5A 5IHZA 4XX1E 5HI4D 4NYLB 3MV9E 3KPQB 3RZCB 4PJ8A 3OJDB 1S7XA 3QXAB 4HGMA 1FNAA 1EZVY 3NGBC 5TE7L 1G7LB 5L2JB 4OLXL 2XA8L 1KEGL 3N85L 4P2OA 3Q1SH 3OAUL 1TJHH 4HXAL 2OXGA 3S4SA 2W07A 1NC2D 3O2WH 1Q9OA 3LIZH 4KAQL 2XXMB 1T6WA 4M43L 1K2DA 4O2CB 3QHTC 4IRJA 3RU8L 4ZFOA 1NGPL 1U8PB 3AY4A 3RIFK 1WCBB 1YN6B 1C5BL 2XV6B 3O4OC 3H9HB 4HIHA 4PBWD 2R56L 4MS8D 3DTXA 4L9LA 4IRZL 3GSOB 3HFMH 1A0QL 5K59E 4XPHL 3SY0B 5DUMH 4TVPD 3VXSE 4G7VH 2R29L 5F7DB 5KS9B 5ITBL 4R4BB 5GGQL 1T80A 1MUJB 3I6GB 1HOCA 4LGPB 3R4DA 1G0YR 4N1EA 5D9SB 4KDWA 4LCYA 2MCG1 4MDIB 3Q2CA 3GJFB 4NO0D 2QLVB 5GJSL 5EO1B 2PNDA 5ILTL 3IRPX 3TJEL 4QRRA 5DRNA 2GTWA 1DBJL 4YHKH 2RFXB 1C5DA 5DDHA 4PJ8C 2COQA 2F15A 2OR9H 4LIQL 5LXGL 5KSVA 4XP1L 1MCNA 4G8FB 5IVOA 2DS4A 2F53D 3IETA 4IDJH 2BNQE 3BGFB 4P2OC 5FGBC 2YRPA 3DXAB 4UUJB 1T04B 3W81A 3QUXB 3U9UB 4NQVB 5LCVH 3ZO0A 2FRGP 1U3HA 3AY4C 1FV1B 2B4CC 2R0WL 3EDFA 5DT1L 4RCAA 3V6OE 3I02A 1IGCH 2ZUUA 5FHBH 4RA0C 3PDOB 1A1NA 3P0VL 5FYKD 1RIHL 3RWHA 1UYWH 4W4OA 3G9VA 4PRDB 1T5WB 4DCQB 5KSUB 3ARSA 3VFVA 1U2HA 3GMOB 1D5IH 2J8UB 4IOIB 1CGXA 4M5YH 4N0CC 1U6AL 1J5OL 2Q8AH 1DQML 3WIIH 1BOGA 3DRTB 3BAEH 3VGFA 1NBZB 3WUWA 1XGQA 4G9FD 3EO0B 5JPMA 2PKDA 4D0BB 3JSSA 3DSFL 5DFVC 2QR0B 1MFEH 2HFGL 2PTVA 1MCCA 4LLWA 4QNPE 2B5IB 2ARJA 1EJOL 1F13A 5A3ID 3L3IB 3VH8B 2W0FA 1CXIA 1HQRA 4LDLB 4XNYH 5HGGS 2JJTA 1YYML 4G8GA 2J6EL 5A2KH 4HHAB 4NUJB 4OSUH 3SKMB 2Y7QA 4OLYL 1IBGH 2VDLL 3QAZB 4P9HL 1EERB 3T1WA 2DL9A 1IAOB 3SE3C 3GSUA 4LPTA 1FG2B 4AT6A 5A2FA 1ZVYA 3LOWA 4Y4FB 4JLRA 1U3HC 4JVWA 1KTLA 3FB7B 5F96L 4ODVL 2X09A 3MZGB 1OAUH 5C0AE 3OGCA 1AI1H 5JMRA 1KIPA 4FFZH 1BVKA 2HKHH 5AAMA 4X0KB 3V5HB 4ELKB 2IANE 2LU4A 1NJ9B 4G43A 2YD4A 1OD7A 2HKFL 2PR4L 4NM8L 4W4OC 4WUKL 4X5WA 5ICYA 1MH5B 2ADIA 2DQIL 2QQNH 1GPOL 1XF3A 1NDMA 4JFFA 4Y4KD 2MCPH 2NXYC 4MA7L 5EO9A 1AQDA 3RI5K 4PTUA 5HGDB 2CRMA 2GCYA 3MRIA 3T1FB 4NNYB 1NBVL 3K46A 1JHKH 1ZTXH 4HS3B 4AJ0A 4RAVB 4HXBL 3AC0A 4QRUB 3VW3H 3IKKA 2IALA 1A7NL 4ODSH 1J86A 3ECBB 3BEVA 4J4PD 3HE7B 1NLBH 3ZL4H 3BZEA 4ALAH 4U7KA 4XBPB 2KUTA 3S5LG 4YGVB 3HI1B 2VO5A 1J05A 2C1PA 3SQOH 2HH0H 3WBDA 2FBJH 3ULVD 2X4UA 4NOBA 3X14A 1NCCL 2I5YL 3NGBB 5IBLD 3KPOB 1MRDL 1TLKA 4PJEF 4DVBA 2FGZA 4JGJA 2F53B 1IM3B 4IOSD 5ITFA 3ZE0E 1AXTH 5GS3A 3VJ6A 2FD6H 3V7AE 5C9JB 5TE6L 1DLFH 5FGRA 4TSAL 3PQYE 1D5MB 4EOWH 1W2KT 3A6CL 4HWZA 5KAQG 5IFAH 3LD8B 1YNTA 3O4OB 1GH7A 2NX5E 2WK2A 1JTTA 4GQ9L 1NFIA 5IFJB 1YPZA 3MROB 4JY5H 1EO5A 3OZ9L 3GSVA 3PP4H 5F1OB 1BPVA 1FNGB 1HXYA 1G6RA 4YFLF 3HPLA 1JNHB 3I50H 1EAPA 4Y19E 5CD5D 1QLFA 2BY0A 1RZKC 4ZOEA 4PJ7E 1MPAH 1Z3GH 4EEEA 3MGAA 2VXVH 1ZHKA 1CQKA 1UQSB 3RY6A 2X4PB 1WC7A 3HS0B 2A0LC 1K3ZA 4G9FB 4R7DA 2R23A 5GRVK 3VDCA 2ID5A 3LQAL 1XGPB 2MPAL 1SJHA 3IT8D 2XTJE 3KPSE 3K2UH 2R0LL 4NNXB 2FLBT 1HHHB 3DUUA 3MLVH 5D8JL 1KIRA 1QNZH 2A73B 1FCGA 2YPKB 5D4QA 1JZ8A 3BN9C 1FO0B 1BX2A 2SEBB 3MA9L 2O61A 2A6DA 4U1HA 2APFA 1N2RB 5MEPB 3FHAA 3HC3H 3E3QC 4OCSH 1Q1JH 1JGUH 1T3FA 2W65A 4X6CE 3MLRL 5ESQA 4PJGA 1U8MB 2WUBL 3QP3A 4Y1AB 3MXWH 1JIBA 2W0LA 4MD4A 1T03L 3C08H 3LAFA 3JV6B 3GSXB 1JWMB 1YPZF 4MZ2A 1FFRA 4N8VA 3RIAF 5KVDH 5GZOD 1RULH 1XGRB 4WI6A 1R0AL 5TDNA 3BKCL 1CFVL 3MLWH 4OZGB 4FOMA 3EYOA 1Z0NA 3LRSA 3MODH 3P40A 5E2TH 1S7TB 3LQZA 5JIPA 1H0DB 2UWEA 1M05A 2XQYG 4TUOB 2X40A 1WFTA 1SY6A 2BVYA 4LBEA 43CAB 1MJ7L 2HA1A 5E2JA 4Y4KB 2EKSB 1KPUB 1KCRH 1MFCH 5J9PB 4HK3J 2XN9D 5AZ2L 5KJRH 1S5IL 1CDHA 4OZFH 2C3VA 3MV8E 5TE4L 5I9QC 4MCZA 3BP7B 5HHME 3RY6C 3MLSL 1FFOB 3ZYZA 2DM4A 4Z95L 1X5AA 4WJ5B 1LK2A 2XZCH 4F8QA 4X8JB 1UADC 1VFBB 3SJVD 2YPLD 3RWFA 5CJ5A 2Y4SA 1MY5A 5LAXA 3LEYH 4FFVD 4NC1C 5JQ6L 2Q3ZA 5C09B 3WFZA 4PGZA 4OZIA 4MA1C 4XVTH 1K3IA 4GMSL 4ZYKA 1T83A 2AK4E 4I4WA 4PJGF 1Z2KA 2NY7H 3ET9F 2OBGA 4FTVB 3SHSA 1HSAA 4QKXB 2F9BT 3GEWB 5IMLB 4V1DE 1NC4D 1RURH 5BO1L 3BQUD 4DEPC 4P23D 3QCTL 1N4XL 2UWEF 1OP5K 4QRSB 2DYPA 5C1MB 5J13C 2F19L 3JUYA 1G7HB 4EDWL 1T66D 5DURB 3RUGE 5J57B 1WAAA 1BFVL 2Y36L 3PHOA 5MI0C 2WIMA 1VERA 2NXYB 4KK8C 3DRQA 3FO0L 3B9KC 4X9GA 4WI8A 4HFWA 3HUJB 4FG6C 1WBZB 3QEGL 3MCLH 2X4OB 4G9DA 3ARYA 3GSWA 1FIEA 1ZHBA 4CMMB 3FMGL 4WNQA 3O3BB 3OKLB 5F9WC 1OF2A 2HVJA 1QFWI 2YZ8A 4HWEL 3ZDXE 1LEGB 4NO2A 4YX2L 2O93L 3W0WA 4KROC 4NCC2 3VXMB 2DIAA 1P84K 3MLXL 2EH8L 4MD5B 3T77A 3L5WB 3C9NA 4I3SH 5BCAA 3D39A 4IS6A 4E42A 1JNLH 4Z7UE 3KPPB 1N0XH 1S7VA 3PWUA 4HS6A 3EYUL 3EO9L 4DJMA 2H8PB 1AR2A 4HG4J 4PJEB 4U1SB 3S35L 3KVQA 3IDUA 2AJVL 1UKQA 5CBAB 4OCWH 2FECI 3RJQB 1CK0H 3KS0H 4YPJA 3WLBA 2BDNL 4K7FB 4NJ9H 4P2RA 5GS0L 4HEPG 1WAAF 3MJ7A 4MNQA 5EC1A 4L3AA 1S9XA 5KSAD 1MCDA 3MV7A 3MRKB 3EYFB 3VD4A 4OFIA 4A2MA 2YRZA 5IHBA 1ZT4B 3X11A 4U0QB 2PO6C 4YDIH 5DJDA 4KZDL 3CDGA 4G6ML 4ZUWB 1ZLVK 5KVFH 2YA0A 3UTSA 5ABDE 4AEIH 2VXUL 4G6AC 2UZIH 2V17H 2P1YA 1QR4A 3DBXA 4A6YL 4Z7QF 2DDQL 1MAML 1FBIH 4GO6B 3EGSA 3V8OA 5CEXA 1U8QA 4LVHC 4LLVA 1BEYH 4N5UA 3WDHA 4APQA 2DBLH 5DZNA 3BP6B 1CGSL 3V9FA 1NEZG 5BS0A 4E9LA 4QRPA 3SJVB 2FEEL 4GBXD 1F3JA 4M3KB 4KI5C 2NZ9C 3MFFB 5INCA 1Y6KR 1RZ7H 1X5FA 3I85A 4GW1B 4RWYH 1QBLH 3LEXB 4OGXH 2AJSH 2GEEA 1S78D 3HR5B 4G6KH 4PP1C 3SO5A 2MMXA 3BWAA 3AB0C 1XF2B 2JB6B 3CDFA 1MI5A 1AH1A 3L3DA 5HHQB 1U93A 4F7TA 3QG7L 4XP4H 5JDSB 1NMCC 4C58B 4P4KC 5TQ2L 1K8IA 3RDTA 1NC4B 5DYOA 4UTAH 4JO3L 3CVHA 3V52L 4IBLT 4HIIB 4MJ2A 4W81A 1ORSA 2R4RL 4G3YH 1LE9B 5GGTA 1GOFA 2C3XA 2B1HH 2DQEL 3QUKB 4WFGE 4UOJA 4XH2B 4QHMA 4JHWL 3FQUA 3QWRD 1LK3L 1T20B 1LO3H 1VEPA 3QPQD 5I71C 1LE5B 4N8PA 4HUXB 5CIPB 3HAEH 4XGZA 5TGBB 2CK2A 3CFBA 3WIHA 2W9DL 2E7MA 2VZ3A 4APQC 2CLVB 1KXTB 5BQ7B 1IC5H 4L8DB 1Y18A 5HHNB 4ZS6D 1MHEB 1H3WM 3P4OB 3O3DA 3V4PH 1P5VA 5E2WL 1PX3A 3F7VB 3BYTA 4D0CA 1K4DA 3UMTA 1FNEA 4LLMA 4GAGL 4D9QE 1G6RH 3TVMC 1AJ7L 5E56A 4NT6B 2AJZA 2Z91A 4DAGH 2BHZA 4Y5YA 3VFOB 2JJWA 3LKSB 5IIEA 2P8MB 5MERA 3BW9B 4DKAA 1QKZL 1MNUL 3OXRA 4X5XB 2H1PH 1AFVL 1SBSL 3Q3GB 1XIWC 1OAZL 1IQDA 4LRIA 5CUSL 1A6UH 3BVNA 4XZUA 4ELMB 3O4LD 3TIEA 1L7TH 3RDTC 3L3OB 3D87B 2QV2A 5J13B 4CL7A 1YEKH 5D1ZD 1FL3A 4Q6YA 3IJHA 2A1WL 4Z6AT 3FFCD 3DURB 1T2QL 4CVUA 1SM3L 3BUYA 4OUOA 3ZKNC 4DOHB 5JZ7C 3B9KB 2Q86B 4LNRB 3UYRL 4NZTL 2YD3A 2DJ4A 1S7SB 4TRPH 4M61B 4NQUA 3RL2B 3SCMC 2VLRD 2XZZA 1F2XK 3ARVA 2X4SB 1JGVL 2GQHA 1QSEA 1AP2A 4OD3H 1QUNA 2PW1B 5D7LD 5ADPH 2QSCL 3C6SB 3MACL 5I8CB 1CICD 1V05A 3C8KB 1M7IA 4XVUC 1T1YA 2JF1A 1BGXH 4RAUA 2JELL 2PXYD 2R9HD 4KROB 2A9ML 1II4E 3LN4B 3BHBB 1QRNE 4JRXA 4UU9B 3RY4A 3VFWB 4F80A 3TBTA 1AO7D 2P43B 5C08E 1FL6A 4NZUH 3RVUC 1H8SA 5C0IA 4D3CH 1SY6H 5C2BH 5I19H 4KHXH 3V95A 3Q48A 5I0DA 1S7WB 3NH7L 5ELIA 3CFJA 2ZOLB 4TULL 1ACZA 3MREA 4AZ8A 5CFHA 3VRIB 3T8XB 4OKDA 4LRIC 3CPLB 3HE6A 4C56A 2BZDA 3VRJA 3TO2B 3WS3B 2N4IA 4YO0B 1YNKH 3THML 5IW1B 3V4UH 3D5OF 3HZKB 3MNZA 4YQXH 5H35A 1JP5A 1KCUL 1ZKAA 1HXMA 3NFSH 1S3KH 2PO6B 3RWJA 5EO0A 4JFOB 1K6QL 2DWEA 5HBBA 4FQJL 5FF6A 3OAYK 5I1JL 4OCRH 1PYWA 5HI5C 3U7YH 4QRTB 2VE6A 4AH2B 4K8RC 1JGLH 4QWWC 4S0TD 2JTDA 1OGAA 4S1QL 1RZGA 3P9MB 4XCCH 5GPRA 1IAMA 1FYTD 3AUVA 2WSKA 4AENB 2V2TB 2X1WL 1I1RA 1JK8B 3MRQB 3WJLA 3MJ8B 3QNXB 1KC5L 3GIZL 3QIUD 3QDJA 4HDIA 4L5FL 1PZ5B 4MCYB 5B39A 5I1KL 2CDEB 2YMXL 5KTEL 2XKSA 2HYMA 5DSCA 1S5HA 5I74C 3PABB 1F5WA 1RHHB 3B9VA 3MNVB 3KG5A 1EHXA 5AZEL 2IGFL 2GHWB 3TWCH 4LU5L 2AERT 1V3LA 2BNRD 1J1XL 4AIOA 1YNLL 4PJHE 1TQCC 2F5AH 4P99A 3LH2H 1TNMA 3AB0B 4Y5XA 2DQGH 4O2FA 1YJDL 4ZUTA 3U6RB 3HE6C 3OXSB 4WO4C 1CIDA 4O2CA 4AG4L 4RMVA 5IM7A 1OB1A 4K7PX 1RJZB 2WAHA 3G04A 4P4KB 3CFEA 3KXFD 5CGYC 4XP6H 3E6HB 3OKMA 4EUPA 1TJIL 3M8OH 4OD2A 5GGRB 3O4LB 3UBXG 5CHNA 4C59B 4L4TD 3G6AA 1XGYH 2NLJA 3GSOA 3K4AA 1UH3A 1F6AA 3V5DB 2VLKD 5JR1L 2M8XA 1IAIH 3HHRB 1RK1B 3EAKA 5I8EB 5KZCB 3LVEA 4MDJA 1FZJB 4Z7NF 4UQ3B 1SEBA 3ALWA 5I71B 1QHOA 2Y5TA 2AQ2A 3RKPA 3RTQA 2VLRB 4LKCB 5T1KA 5JW5A 1RJYB 4ZAKC 3SDYH 3IAQA 3QIBA 3BT2H 1P7KB 5I1AA 1KJ2A 2GJ6A 4PBXA 1RSFA 3L95B 1CICB 1DBAH 2VAAB 3VXRE 4HAFA 3SKJL 3EJJX 2PXYB 3ZKQD 3X3GH 5IMOB 1YEGH 3U0PB 1BLNB 4XPAH 3TH3T 2LQRA 3Q1SL 3I6KB 3TVMB 4PJ5E 1AO7B 1Z9SA 5DJZA 5L8JB 4K94C 2ITCA 3CAFA 1HCVA 4MQ7A 5CP7A 2HRLA 5DD6A 2P5WD 4NPYB 4Y7MA 1EAJA 5ALCH 1XIWB 4B7LA 2YA1A 1G7IB 1IE5A 1KYOK 1A1MB 4I9WD 2X7LA 3ILQD 3ARED 3UDWA 2FJFA 1HSBB 3DIFA 1QA9B 1J1PH 1G1CA 3MV9D 2HT3D 4HV8B 3QUML 3RWIB 3TCLB 4G7VL 2A6IB 4M8QB 3WFHB 4DCQA 4PRPD 4FQHA 4NKMB 4Z7WE 1EUUA 4Z77B 4OGAC 5K9QI 2ICWJ 1EZVX 1EFQA 4GUPA 3DRTA 5B21A 2P46B 3SCMB 5FFLA 1FJ1B 5KSBB 1YQVL 4L8CB 1D9KB 3RTQC 5EZIL 3BYYA 4QCIA 1O0VA 1RZFH 5FK9B 3RWGA 5C8JA 3IDGB 4MXQC 4P46A 2A74B 4YHKL 1FYTB 1Q0XH 2D03L 4XBGA 3SDXB 1QSFD 2OR9L 2C7UA 3B9AA 3HMXL 2IADB 5F9OH 3CVHH 3AXLB 5K9JL 1N3NA 3MRPB 3QIUB 2LE9A 2VZTA 5GGTH 3VXSD 1TQBC 3DV6B 5HTSA 4WFHE 1I9IL 1XGUB 1JMZA 1EEZB 5LCVL 5HHOE 4WCYH 4I2XE 2ARJQ 1XGTB 2KZWA 2YD9A 3QNZB 3TYFB 2BSTA 2HFEA 3EHBC 3S36H 3MRHA 3EOTH 1NC2A 3WIHH 3MRGB 5FHBL 3VFTA 5E4EB 2Y5EA 3BGAA 2PYFB 4LSQH 1B3JA 4YWGL 3GB7A 3IS0X 3PXJA 1QACA 2P24A 4POYA 2P48B 3KPNA 4X9IA 5GGUA 3O6FB 1R5IA 3TPUB 1D5IL 4NQDE 3O6KL 1NGXA 2Q8AL 4L4TB 2QSVA 3V5KA 5ALBL 2F5BH 3RQ3A 1CN4A 3BAEL 4PLNC 2BNQD 3MLUH 3QFDA 1MHPH 4O9HL 3R0MA 1W72A 1I1FA 2VKWA 1DR9A 1D5BB 4GS7B 5BV7C 3TV3H 5B8CA 2HMIC 1VSCA 3T2NH 4P46C 3UJTH 3BZFA 1GGTA 3BWUC 2E9BA 4JFDE 4O58H 3VWJD 3CFDA 5GGVY 5IB4A 5DRZA 3NIGE 4NO0A 3EOAA 3TNMB 3L7EA 3D3VB 2K7QA 2YWYA 1P5UA 1W0VB 4XBPA 4QGYA 3O3AB 3ARTA 4NZRH 4KVNL 1AR1D 5I74B 4B53A 5IMKA 5J4MA 1WBXA 3CUPA 3ARBA 4RX4D 4PGCA 4YE4H 5C0BD 3MRDA 5IJVB 5DHYA 5IROC 1NDGA 1HYSC 1E27A 1TQCB 2VMFA 3ZE1F 2ADJB 4GAJL 2J88H 5C0DB 2HT2C 2XTLA 2XZQH 2YD2A 2K7PA 3DX6B 2ITDB 2DQUL 2P5WB 4KJWD 4WO4B 3QQNA 1ULVA 2QQQA 4G42A 1DE4B 2UVEA 4JKPL 3IU4H 3V0WL 5DD3H 3REWB 4YEFA 4XP5L 1OP3K 2VQ1A 4LLUA 2ARWA 4IOFC 1AGDA 5C2UB 2AXFA 2QQNL 4O5LH 2YXFA 1NCTA 4HWNA 1DBBH 3OPZH 3E2HB 3RVWC 1ETZB 5EUKA 3G5VB 3OGOE 5C0FB 5B3NA 2DLGA 3F58H 4X80H 4MS8C 1BQHA 4BKLA 1HN1A 1WZKA 3V6ZA 1ZTXL 4PRPB 1Z6JT 2WBJD 4MA3A 1UKSA 4XPTH 2YC1B 2X9XA 1WZ1L 3RPKA 5B8CC 4UT7H 3VI4E 1JPGA 1OTUD 4KVCL 3UO1H 5GHWL 5C0AD 1CF8H 4ZAKB 2EEDA 3HS0A 3WD5H 4ONOA 5L9DH 2C1OB 1HHGB 1INQB 1YEJL 1UWGH 5D7JD 4ZDHA 1V7NH 1HH6B 1C12B 4QHKJ 4NNXA 1HHHA 2HH0L 4ODBD 3TFKC 2XG5A 1NBYA 4QHLA 1QSFB 1U8IA 1QVOB 3I3EA 4MXVF 2YPVH 1LNUB 5FKPB 4CNIA 1FO0A 3ARBC 1U58A 4ZUSB 3K8MA 5FDYA 5IBUB 4FQCL 1N5AA 1AXTL 1SHMA 2FD6L 3JV4A 1A9BB 2ED8A 2EXYC 4F57H 5HPMB 1EHAA 3MUGA 1MJ8L 4EOWL 1ZSDA 5ICXA 3S6CA 4AIZB 4E41E 3D1MC 2Z8VC 5EBMA 4EI5D 1IJ9A 1UGNA 4G5ZH 4NCDA 5JOPE 1AKJD 2CO7B 5GS0D 4M48H 4S1DD 4PRIB 4PJCA 4YDLC 3EDJA 1ORQB 3AU1B 5BOZG 1PLGH 4TOYL 1P4LA 4KRMB 4X7SH 4CVXB 5D71H 1KIQB 1RV6X 3MRRA 2FATH 4LHUD 1KN2H 1BAFL 1B2WL 2ICWA 5F1SA 5J9PA 4LPWA 3FRPA 5E9DD 1H3XA 3K4ZA 5FO7B 4LAQH 5C07E 3V4VH 2PETA 3W2DH 3HI6H 1TVBB 3PQYD 4QRQA 1IGTA 3ARGC 3UTPE 5H37G 5JIKA 4WI7A 2VAJA 5IVXB 1H5BA 4EUPH 3BN3B 4DKEL 2NX5D 1BFOA 3VWJB 4H26B 4J4PA 3M17A 3WMSA 5A3IC 4MAYD 4CVZA 4U3CA 1Y6NR 2EDBA 3WNKA 3HC3L 4N0YL 1TQBB 4OCSL 2F8XC 3MRBB 4HWBH 4QT5B 1AY1L 3DX8A 3I84A 4FP8H 4U1KA 2AI0H 4PR5B 3TO4D 3VRLE 4POUB 5T5NF 5C0BB 2CIIB 1LP9B 2ZSWB 3VI3E 4QGTA 3KJ6H 2F74A 2XFXA 5FGCE 3S88L 4PJCF 1HWHB 2R39A 1LILA 5IMLA 2I27N 5T5FH 3W9DB 5JHDD 3IDIB 4XRCA 3MR9A 5I1IL 3GJFH 2XTJD 4QXGL 3C5JB 2F54E 2DICA 5E0QA 12E8H 1KV3A 4I77L 4KKLD 5C0JA 4P5TA 5HYQA 4UNUA 2JIXB 5IVZA 2X4QB 5DEGB 3SGDH 1DANT 4BQ8A 1YECL 4LOUC 3E6FA 1WVZA 1WFUA 3EFFA 4JAMA 1WLHA 4PS4H 1IFHL 2CIKA 3MCKA 1CD1B 5F70A 1CGTA 5DJ0B 4OQ1A 3GI9H 2Y6SC 3RJDA 5BZWA 1WBZA 3KR3H 1ZLWK 5BV7B 1BZQK 1MFDH 5CBEB 4PJAB 1ITBB 5F7WC 2VDRL 4OBSA 1AIFB 2X4OA 4GXUN 5GSVB 4C57C 3O8XC 4UAOC 2OSLB 1OAKL 2EZ0C 1MJJB 3PV6B 3D69B 4DUWA 1CVRA 4WFED 1G7QB 4YIQB 5FUCE 3CZJA 3WXVH 4RGNE 3D18A 4YBLC 3D0LB 4GAFB 4JDZB 1PG7L 3WYRA 1ZGLA 1MLBA 4M03A 3HZMA 2BSSA 4HKJB 2NY7L 1RUMH 2DQHH 2R4SH 2ED7A 2CKBL 4LCUB 5DLMH 3QT2A 1OQOA 5CZXC 2MKLC 2L4OA 1F3DJ 1DVFC 1G7JA 4WUUB 3ROOB 5HHMD 2RB8A 1EIBA 1RURL 5F71A 1J11A 1YQ2A 2IFFH 4ENEC 1K8DB 5H94A 4RIRB 4P5TC 3IFLH 4OV5B 3ARWA 3SN6N 1O7SA 1CXHA 2ATPB 3EYFA 5I18H 1AKJB 1FZOA 1NGZA 3WNMA 4LSUH 2P8PB 3D0VA 4O2EB 4PJXF 3MOBL 3EJYD 1C08B 5IQ7L 2UYLA 3WKMH 3IS1X 4OGZA 2AK4D 1RUAH 2Q76B 4PY8J 5SX4I 3ULSB 1T5XA 4LHUB 4PGBB 2E6JA 1GJIA 2C4FT 1SJXA 4MJ6A 5GGVH 3F7YB 1YEEH 1C5CH 2V2XB 2XN9A 5MEOB 5E9DB 1BZ9B 4V1DD 1AXSA 1D6VH 3N0PB 1MIMH 3B3IB 3GM8A 3KHQA 5E6IA 3IJYA 5DWUH 1N0LA 3IGAB 3OAZH 4BH7B 2FZ3B 4BZ2H 1KSRA 4U6VH 3BP4A 4LFHG 3X3FH 2G9HA 1BJ8A 3P2TA 2WUCH 4NN6C 5MEQA 2YPLA 3P9LB 1WWBX 4MAYB 5EZJB 2R8SL 1A2YB 3FQWB 4P0DA 1HH9A 3OF6A 1XR8B 3U46A 4TVPH 1W72H 3S4SG 4HT1H 4BK5A 5KANG 3W5MA 4OCWL 4MJIB 1FFPA 1TCRB 1LO4H 3TO4B 8FABA 2VLJA 1CK0L 5BXFB 3NIFE 4H5SB 4YHOH 1U95A 1LVEA 1I3RA 4F2MA 3BH9A 3ALXA 1R3JA 4L4VA 3HG1B 4BZ1H 3MSPA 3PWPE 1ZHNA 2H2SD 5JHDB 4RRPG 3T09A 3FB6A 1OLZA 5EUOE 1NC4A 4KK5D 4YDIL 3BQUA 4X99B 4YXLL 4P23A 3OR6B 5I1CH 3O41A 4XBEH 4JFXA 3GMQB 3EYSH 3LKQA 3RL1B 5D7KE 5JXAH 5EU3A 1G9ML 2VDMH 2JJSA 2VWEC 2EDQA 5DGQA 2BK8A 5L2KE 1MJUH 2N56A 5DD0H 1H8NA 2NXZB 3MRFB 3VXUA 3ARGB 1TTFA 2HTLC 2EEBA 2HJLB 1C1EH 2WANA 2DBLL 4BQCA 3GK8H 4HJGA 1S9KC 2FHFA 4JGMA 5E6IC 5T1LD 5EOCH 4KZEH 5GGSB 1U8KA 5EOTA 5JO5B 3T2PA 3I2CL 1RZ7L 4HGWA 4PRHB 5FYKH 4F33B 2AJSL 5D5MB 3D39E 1AGCA 3F5WA 4OUUA 1F58H 4J8RB 3TBSA 3N1FC 1JI2A 5BVPH 3STZB 3O3EA 1FN4B 5EBLB 5SV3A 4OQTA 1NMBH 4JKKA 4P2RE 3PWLB 5D7IB 3FQNB 4IMLA 4ELMA 4PJFB 1GZPB 2EDDA 1Z9OA 3W39A 1EPFA 3QDAA 2VNCA 4HUWB 4P23C 4NRXB 4YUEH 1J8HA 3TH2T 2FHBA 1QYGL 2B1HL 3PL6C 1WTGT 4EI6B 5KSAA 4P3DA 1N6UA 3KLHC 1TCMA 1FO0H 2X1XR 3CXDH 1XH3A 2JK5A 1I8MA 1AGBB 2JJSC 1S7QB 1TJGL 4Z0BH 1P7QD 2Y06H 1EDQA 4NFDA 3QXDB 5E95B 3WUWG 2C26A 4JFEB 3RPIA 1OAXH 2CJUL 2X4SA 2WINA 1F02I 3O8XB 4UAOB 3T3PF 4J1UA 3DHMA 4TSCH 1A3RH 4XCFH 3QRGL 1RUQH 4NDMA 2YOCA 3QI9D 5CJOH 4P5MB 3B2UD 3GIVA 4G6JH 4XHJD 5I15H 4X6DA 4OI9A 2QEJA 5EIVA 4KC3B 4U31A 2ZCHH 4GQPH 4PRBA 4NKQB 4DAGL 5DMKB 2CH8A 1H15B 2P8LA 3HC0A 4WIQA 4BFIB 3F8UB 1XZ0A 5DR5H 4WFGD 4OM1H 3K1DA 2HFFB 3IJSA 2YR3A 4GBXA 1NCAL 1QR1A 1KNOB 2Z9TA 3IVKA 3CSBA 3HZVB 1DVFB 4M93C 4L3EE 5ISZE 2GK0B 3RWCB 1YMMB 1A6UL 2JE8A 4JQVA 4UBDC 3AMLA 4IJ3C 1PQZA 3LMJL 1DJSA 4LCIH 1P6FA 1P53A 3GBMH 1OT1A 1WIOA 3VXTB 4RGMC 5EPMB 2MSPA 1QOKA 3L5HA 5ID1B 3T3ME 5ENWB 2R0ZH 1OTSD 4D9QD 3MUHL 4TRPL 1WFNA 4GKZA 2B0SL 5I1DB 4PJXB 3WN5C 3QISA 1W0WA 2YEZB 5EZLA 4H8WL 2A6KA 4HC1A 5IHLB 4TUKL 4C83B 1SJVA 1JYWA 2VISA 5F6IC 4EVNA 1UM6L 2VXSH 1RUKL 4GSDL 4X6DF 1BGXL 2OMNA 4P2QA 4K2UL 4JG0L 3RWDA 1FAIH 1OSZA 4NZUL 5SWSB 1PZ5A 3NCMA 3HZYB 3NFPA 2N7BA 5C2BL 2Y72A 5I19L 4M3JA 2Z0BA 2YSSB 4NN6B 3N1MC 5IHUH 5DHVA 1QD0A 1I8KA 4NBZB 2PTTA 1RHHA 4Y16D 4X98B 5AD0A 4CJ1A 4JQIH 2G5BB 3FCTA 5BZDA 2APVA 2XWBB 3QEQE 1RZ8A 3KYOA 3TBWB 5ERWB 3VWKC 5JIIA 4LCCB 5HYSB 1YNKL 2YD6A 5JXED 1VHPA 2G75B 4YQXL 5F88B 5F8QC 4L8SA 1GHFL 2QQKH 1DBKH 3FRUA 3NFSL 3QXUA 4IHOB 1S3KL 1MSPA 4UB0H 3WFEL 1SMOA 3O4LA 5D2LB 3JTTA 5LBSH 1JF5A 5JIHA 2BNUA 3VD3A 4Z76B 3KPLB 4YFDB 1VEMA 1BJMA 3LDBC 5D1ZA 3VXPB 4MHHG 2D4DA 2CGRH 4K71C 4ZXBD 1IT9H 1UKTA 3FFCA 5IB1A 2DKSA 2R1YB 4PD4J 5FKAA 2FGWH 1NANH 3BD4A 3QFJD 5C7XL 2R1WA 1EXUB 3D6GA 2HG5B 1QLEH 4CAGA 5I1HL 1A7RH 4GAYA 4MJ5B 1RJLA 2H2PD 3GSQB 4LKCA 4JKMA 4WY7H 4NC2B 1CR9L 3MRJB 2FL5A 4Q9RH 5D7LA 4BH8B 1Q9WA 1IGJA 3SGKC 3FB5A 4JPKH 3QI9B 3OKYA 1OP5H 1P69B 2DWDA 4OFYD 1NGWB 1S9WB 4RAHA 5HI3C 1N5YH 1TXKA 1JFQL 1A1OB 3LH2L 2QSQA 4ZTPH 1FYHB 5GGRY 4WDIA 5DTFB 3MLYL 4LF3B 5C0CD 3VXQA 5DO2C 4R96A 3EJZC 5DFTA 1T0NB 2EDOA 3FT3B 4ZD3H 5EU6E 1F4WH 4PG9B 4OI7A 3TJHD 4ZOAA 4R90L 1ZVSB 1FAKT 4MB4A 3WLWD 2ICES 1AD9A 1J12A 1XF4B 5CP3A 4JFPA 5E8PB 5EIIA 1D5ZB 3KLAA 4Q0XH 4PV9B