5BQ7B

Crystal structure of chikungunya virus-human fab 5f-10 fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
214
structure length
201
Chain Sequence
VLTQPPSVSGAPGQRVTISCTSSNVHWYQQLPGTAPTLLIYVNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYGSAVFGGGTKLTVLGQPLAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Chikungunya Virus-Like Particles Complexed with Human Antibodies: Neutralization and Cell-to-Cell Transmission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab 5F-10-Heavy Chain
total genus 31
structure length 201
sequence length 214
ec nomenclature
pdb deposition date 2015-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bq7B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bq7B01
1RIUH 2ADFL 3D3VE 3HMWL 5J1SC 4PJIB 4UB0H 3KPSE 1I1RA 3VXNB 2E9BA 3FT4A 4N90E 4XPGH 3T0EB 1MCPH 1OGTB 2R0LH 3GDBA 2VLMD 1Q0XH 3QCUL 1KENL 3V5HA 3LKNB 5GS2H 5DFWH 4QRUA 1LNUB 1NCBH 1UENA 4K07A 3CFEB 1IEAB 3L1OL 4AIOA 2APVA 3EJYD 1U8PB 3IDMA 3IDYC 3QIBC 1DQJB 1EO8H 2K7PA 2VLJE 1T4KA 4I4WA 4IRJC 3LQMA 4HK3N 1T1ZB 2NY6C 3RUGB 1NCCL 5FKAB 4BKLB 1WC7A 4QXTB 4JGUA 3CFBA 4XVTH 3ESUF 3MV7A 2BX5A 5FYLD 4KUZL 5GZND 1YYMH 5FGCB 1CF8H 4F57L 1UYWL 1U2HA 4JHAL 4TULL 4KPHL 2VABA 3MROA 1EEQA 3QDJE 5DJYA 4YXHL 5SV4A 2R0LL 3OTTA 3VXSD 1KCSH 4JN2B 1FPTH 1RI8A 4MD4B 1JK8B 4NT6A 1CXEA 1XFPA 3KS0J 5JUEH 3OKLB 4JFEE 4L4JA 3V0VA 1AGFB 4ZNEA 5E00B 2ITCA 4ZXBC 2OTWB 3RY4A 1ULVA 4WI9A 3IFNH 2WP3T 1NGYA 3IDXL 4MHHG 4MNQD 3TPUB 3T1WA 1PEZA 4MMZC 4NQTA 4ODBD 4ONOA 4UV7L 1NMCB 3O41B 4L9LC 4ZUWA 3GMOA 4XGZB 2XFXA 4PJDA 3OAUH 3V8OA 2AI0H 1NKOA 4ZAKA 4QNPF 3BIAX 3S35H 1OAXL 3UO1L 1WTLA 4P23D 3AAZA 3NAAH 4OQTH 3FB5A 2ZG1A 5EULV 1EHAA 4HULB 4JY5H 5C0FB 1A64A 5D72L 1BF2A 3C5SB 4MXWL 4Y4FA 3NABH 3VD7A 4PJHE 1Z2KA 5J11B 1H8OA 15C8H 2RR3A 4AQOA 3T0EE 3SDDB 3KPSA 2NX5E 1R5VA 1OSZA 1KFAL 3CC5A 5T1MA 1F4XH 4OCXL 5J3HC 2J8UB 4DUVA 1ZHBB 1AE6L 2D7PA 3L7FB 3SDXB 4OUOA 5DMGD 4XVJH 5IBLD 1I3VA 1G9MC 2VLRD 4D0BA 2OR7A 5C0BB 8FABB 3GJEB 1BM3H 1I7RA 2OL3B 3DROA 3BEWA 4N0FA 1JTPA 4I5BA 1J8HA 1S7XB 4QRSA 4X0KB 4Z8FL 5LGHL 3T0ED 4WW1A 1DP0A 2R15A 4EDXB 3UXFA 2HG5B 2VLRA 1FVCA 1NFDF 1F11B 1KF9B 4C55A 5HI4D 5D1ZD 1UM4L 4PJXF 3VRJA 3VXRD 1GGIL 3V6BR 3RUGA 5HGDB 5F3BB 4WU5A 4RGND 1CXKA 3ARXA 4HWZB 3KPOB 1AR2A 4WW2F 4Z5RA 3QUMH 4XNUL 5EC1A 4Q0XL 3MJ8A 5FK9B 5IB5A 1J8HB 4MDIA 1TJGH 5DJZA 4BSWB 4PREB 4XHQA 3O2WL 1XF3B 1FL3A 1WCBA 3V4UH 3QUKA 2AP2A 2FEDC 4WJ5B 1TCMA 3ARBA 4RFEA 5I1DB 3VXMB 2QSCL 2EZ0D 4MHHI 4YXKL 3ES6A 2HTKC 1WAAA 4X6CB 5TFSH 3U83A 4N9GB 3B9DA 2E9IA 3UTTE 1M7XA 1FN4B 5AD0B 3WS3A 3LRGA 4GBXA 3RWFA 1MQ8A 3IDJB 4BH7A 2BMKB 3QH3B 4LPVA 3TNNA 1D5BA 1IKNC 5HGHA 4KRPD 6FABH 3OPZL 4Q0XH 5DJ2A 1RD6A 1JF5A 2W0LA 1G6VK 1VFUA 1K8DB 1NCWH 5B39G 1NFIA 4YHKH 1CLZL 4Y16D 4KZEL 5DD5H 1AKJA 1QZ1A 2R29H 1VB9A 2RFXB 2H6PA 4YHYB 5CUSH 5MHSE 3RWIB 3EZJB 5MEPA 2I25N 3RNQA 1B0RA 1I3RA 4NDMB 4X4YA 4PIRF 1X5KA 3GI9L 1MAMH 2BVTA 4CMHC 4MS8D 3L6FA 1HH9B 3NPSC 3SJVA 3TP4A 3LCYA 3RTQB 1N64H 3HS0B 4YFDB 3MLRL 3L7FA 1EO7A 4J12A 3DI2B 4ONHA 1JP5A 1NCUA 1IC1A 4WO4C 2DQFA 3BPLC 3RWIA 1NLBH 2EECA 3BKCL 4OFDA 4WUUB 1HI6B 4P99A 4NZUH 4WW2B 3VCLA 3MR9B 4PRBA 4KRPB 3HTLX 2BNQB 2JE8A 1QR4A 2HJLB 5FYKD 3PP3K 3ISWA 1F6AA 3SKJL 2YRZA 3P4LA 3OXRA 3OAYK 4NN6C 3T0WA 3RY6A 4HPOL 4LLDB 2X4OA 5JW4M 5HDQL 5J7CC 3R8QA 3JZ7A 1F5WA 1MAML 2AJ3A 4KY1H 2BXYA 4RISL 3KYMB 3WKMH 4RWHA 3VFUA 1RIUL 4QHUB 2H1PH 3GMMB 4I8DA 2DWEB 3QUYB 4WY7H 4DZBB 2VUYA 1JF1B 1WUNT 3PQYA 1ZT4A 2OTUB 1FZKA 3DV6A 1HNFA 1XR8B 1DBJL 1MHEA 4GRLA 3GJFA 3TVMD 4NRZB 1OP3H 2JCCA 3MRDA 1ZHLB 3GSNH 3RPIA 2PR4H 4XCYA 1I7TB 1OGAD 2AJYH 1XCTB 3OKKB 5CJXC 3IVKB 5HHOE 4OFYA 4U1KB 3ARDD 4OCWH 2FX7H 5INCB 2C26A 4ACPA 1FH5H 1FG9C 2YUXA 2DDQL 3BJ91 4CVXA 4TNVF 3JWNC 3IKCB 3SE9L 3L3KB 1OM3L 3QUZC 2G5RA 3L3GB 4FQ1H 4WGWB 4CGTA 3PXJA 3MBEC 2CDEB 3QG7H 2WWKO 5FKPA 5JPNB 1MLCB 2ED9A 2C5DC 5TE7H 4UOJA 3JXAA 2OYPA 4J3WA 1U6AL 4GW1B 3VG9B 2DIAA 4MNHB 4WU7A 1G9NC 3GMNB 5F8RC 5JDSA 2ZPKL 1QUNA 5IK3A 3RVXC 5CJOH 3GO1H 5DMGC 1PKOA 2AEQL 2OP4L 1YJDC 3LKQA 4MNGE 2RJMA 4LLVB 3Q1SL 4FS0A 2G9HB 2EDOA 4X4YB 2P8MB 3FFCB 3TO4B 5KSVB 3W9EA 1UJ3A 1EAPB 1YMME 2VZUA 3LKOB 2FRGP 3B4NA 1RIHL 4L4TB 1WT5A 4S2SB 4XNMA 4ELKA 3LEYH 1MHPH 1YA5A 4TUOA 4DN3L 3UPRA 3GM8A 4F58H 2FH6A 4PGDA 4Y19B 4K7FB 4JDZB 1BFOB 1B90A 1JWUA 4Q6IB 2QTEA 4APQC 2NY2D 3D0VA 1S9YB 3ZDXE 4P5TD 4OGAC 1I1FB 5FUOH 4BSVA 2Q86A 3BKMH 5J1AA 5J57B 5JORA 3H3PH 1MFBH 3QJFB 4ODTL 1J0IA 5E2UL 5M94B 5CBAB 3GSVB 4P57B 1O5DT 5IROC 4ZUVA 1N5YL 1QBLL 2CXKA 3OJVC 5FYLL 2BVPA 5F7LB 1TETH 1X6LA 2XPGB 5IMKA 3EO1A 4QOKA 3EW3B 5C08B 3EYQC 4F7EB 1JUFB 3QR2A 3FMGL 1AFVH 1S7VA 3O3BB 5C09D 4MD4A 2XTLA 3BIKA 2ZJSL 1GGYA 3MJ8B 1UWEH 3MXVL 3O8XB 3X3FL 1MRFL 2FWOA 4XVJL 3X17A 2PYFA 4WWKD 5ERWA 4XCEA 4FQQB 4IRZH 4Z76B 4NQVB 1QD0A 3GSRB 5GIRA 4GW5A 1I1AA 4XVSH 4QRPA 2CD0A 2ILLA 3CXHJ 2ZG3A 4LBEB 2PW2A 1KEML 3GNMH 5TE7L 2DJSA 2VDRH 4FXGB 4N5ED 1D6EA 2X1XR 5F7EL 4M00A 3WO3B 4H26B 1T1XB 4P5KA 5I16A 5H35B 4LASL 2XQBH 4OTXL 2BSSB 5EO9B 3HZKB 3QXWA 3VFTB 5AZ2H 3ULVH 3T2NH 3MO1B 4X80L 1BD2B 3RP1A 1MCDA 1KCVH 2K1MA 4RFNB 4MA3A 4N0CD 2IANB 4KUZH 4PD4J 3IRZA 5ESAB 5IQ9A 4PRHA 3WO4B 4EOWH 1PZUB 2PYEA 4F3FB 4W68A 4YEEA 4Y2DD 1BJ1J 2EDHA 3HRZA 4Y5XA 2HT4C 4H8WH 4L8SA 3KPSD 1HINL 4DUWA 3PWPA 2J5LB 2J8UA 3L5IA 2R56H 3UTQB 1GAFH 1MCNA 4RDQF 1BF8A 4QWWC 4P2QE 5K9QG 4M48L 5ESVB 2PYEB 5FDYA 2Y72A 3QDAA 5BRZA 5CJQL 5DUML 3V5DB 2I9LB 2C3XA 2GK0B 4KK9D 1RU9H 3SPVB 1HHGB 3MLWL 3LS4L 2IAMD 3S35L 5KTEL 4J3XA 1P4IH 4P2RD 4P9HC 1AD0B 4KXZH 3DI3B 5TDNB 3HI5H 1KCRH 3D5OF 2IGFH 3EO9H 2GY5A 4OCMC 4PJBE 2NY5C 1WAAF 2EDWA 3SDCC 2DTSA 1NLBL 3BKCH 4XPHL 1QPPA 1U91A 2HMID 4PJCE 2PR4L 4W6WB 3PIQA 4Y8AA 1J8HE 3U9PH 3WNMA 2EDFA 2ZOKA 4QNPE 2B1AH 3LKQB 4K2UH 1Q1JH 3UMTA 4H1LB 1MIEL 3MJ9A 1U8HB 2BY2A 4WI7A 5D2NC 5GGVY 1P4BH 5DZOA 5TQ2L 2PKDA 3L5XL 4GG8A 4YXHH 3B9VA 4LSQH 2B39A 1CFSB 4O2FB 5J6GB 3WKML 2JF1A 3UTSD 1RZJL 1WBZA 1CD1A 2VQ1A 2EIZB 1R6VA 4UAOB 2DWDA 3GZKA 1XGUA 2VXUL 1MHCA 5HYSB 2OSLA 2XRAH 2CKBH 3FO1B 4JFQA 5ENWB 4E41E 5HGHB 3FONA 2WUCL 1HQ4A 3CDGA 4UQ2B 3CU1A 1KCUL 3LH2L 3MRQB 3KPQA 4FFWC 1RZGA 1UCBL 1C1EL 2VSCA 3HE6D 1MCLA 3MLTB 2NY5L 3OF6A 5HHVH 1BVLA 1RUAH 1AGDB 3GI9H 3UTSE 1NFDE 1JPST 5KS9E 3QHFH 4EN3C 5C0IA 1OTTD 1TLKA 4RGMB 1MOEA 1FGVH 2GTZB 1NLDH 4FXKB 4WEMB 3BGFB 4ZFFA 4UTAH 5SX5K 1CICD 2WV3A 3O2WH 1TZIB 4NQDA 4K23L 4JRYA 4G6FD 2O93L 2HFFB 2YPVH 5HVHC 5E70A 3WLBB 2EIDA 2FZ3A 3BP7A 5DHVB 4M1CC 5CD5D 2W60B 1K6QH 4O00A 4HDIB 2EXYC 1D9KB 3GBNH 3H7LA 5CBEA 1NAMH 4FFWD 2IFFH 4MJIB 5DMJB 3GSRA 1ONQB 1YN6B 4PJEE 3M45A 1BVZA 4HS8H 4PYHA 3FO2A 3MLUH 4KU1A 5HJ3B 4OQ1A 4L4TE 1WWWX 3WIHL 5ESQB 4NSKA 3G6AB 4UT6L 4TOYH 2V2TB 3I85A 3K1KC 5E4EB 5FFLA 2AJXH 3TYFB 3MRDB 4DQOL 3I02B 1I8IA 2EIEA 1MHEB 4GRLB 4GS7C 1TPXB 4MDIB 4AIXA 4OCRL 5IFHL 4GRLD 1UZ8B 4BSJA 1QOKA 3U2SA 3OKKA 3NIFE 5IHZA 1S7TB 2LE9A 1HZHH 1HXMA 2A73A 2BVQB 3NN8A 4JFOA 2D0GA 2B20A 4NQSB 1CGSH 4P5TB 1CD0A 1C7SA 2E27L 1JYWA 1M7DA 3O3UN 3X13B 3TA3B 4PS4H 3CLEL 4YNYB 1ITBB 1RZIA 2CDFB 3GSQB 3H7BB 3MRLA 5KSAD 3PHOB 1LILA 2XZQH 1PLGL 4EI5B 1H9VA 4V2BA 2W9LA 3CSYB 4LRNH 5D2LB 4LSVH 3KPTA 3V0AC 4IRJD 4H88H 3JSSA 5AUMB 5T1LB 2GK0A 2ZCHL 1Q9KB 4S1DC 3ARGA 1BQSA 2Y6SC 3FRUB 4P3CH 5C0BA 3DLQR 1FVDB 3UTSB 4OF5A 3U48A 1P7KA 3LPWA 1NDMB 3RI5F 1W8NA 5EZIL 3ZE1F 1LDPL 3QDGA 4I2XE 3FB7B 2Y9RT 1FNSL 5HGGS 4KMTL 3TZVA 1U58A 4KFZC 4FA8A 3RGVD 2IH1B 4U1SA 1OSZB 1QFWL 4PJGE 5TF1L 4PY7A 1YNLL 4HXAL 3RTQA 3FZUC 4NQXA 2WWMC 1P7QD 1DQDH 2PXYB 2YD8A 3VGAB 2EEAA 4MCZA 4C57C 3EFFA 3TZVB 4PJFF 2F19H 2EE2A 4MB3A 5FYKE 1JNLH 3DMMA 4LSUH 5GRUL 1GGCL 1G6RA 1Y6MR 2H2PC 2I07A 3IDIB 1E6JH 3TBSA 3MGOB 4AJ0A 1WZLA 1FNSH 1TNNA 2AS5M 3Q5YA 4JFFB 4MQXD 1EAJA 3W0WB 3WIHA 4JDZA 4XVUC 3B9KD 2YUWA 1DBJH 1TTFA 5EPMA 2ARJB 1R5WB 2DLEA 3DYOA 4O2EA 2PTTA 1ZT1A 4IJ3C 1DBAL 2HTLC 3OKDB 4B7IA 3IDJA 1T20B 3SKNB 3R0NA 3NCYP 5K59F 1T1YA 1KOAA 3DV6B 4FZEH 5CMAA 1AQDA 4N8VB 4HKJB 1HHKA 4PJHA 4IDLA 3GMQB 3CGTA 4ODUB 2OK0L 4O2EB 4KPHH 1XIWC 5GGSY 1UZ8A 2DRUA 4J3VA 1A14L 3U4BL 4Q9RL 4YGVB 1DDHA 4PJGA 4M7JH 4LLQA 4QOKE 2KQMA 3TF7C 4W6YB 4HS6B 4KRLB 5DK2A 3DX9A 5FGBA 1VFBB 2Z8VC 3WMSA 1EO5A 4JFZL 1F8TL 4IMKC 1N0XL 3OAZH 5LKNA 4N1CA 4XP1H 5LCVH 4Q97A 5GS1B 4MA1C 2JLLA 3GKZA 3ZL4H 2OQJB 1OT2A 4YK4C 1DANU 2B5IC 3OKEB 4KUCD 4PG2C 1JV5A 1KCVL 1UWXH 3MNVA 3GKWL 4G5ZH 1OTTC 2ADFH 4X9GA 2R0ZH 3FT4B 4Z7QE 3DBXB 4WWKB 1A7NH 5D96B 1S9WA 5HXMA 2CIIA 5J6HB 4F7CA 5HYEA 5D9SB 2AEPH 1MFBL 4PS4L 4RNRB 5FA3A 2DI7A 2Q8AH 1T2QL 2GJJA 2D2OA 1DEEB 3DTXB 3IYLW 3IJYB 4O02L 5I74B 2FIKA 2BSTB 4KZEH 5KSUA 3IU4L 1AR1C 1P5UA 1EGJA 3N1PC 1F4HA 3UP1A 4YFEA 4XBPB 3DSFH 2MJWA 1PG7X 4TSAH 4YDKL 3CFBB 1U8LB 5DVOA 3KHQA 2J6EL 4G8FA 5DVKA 4I77L 3P3YA 5TDPA 3LMJL 1DUZB 4PD4K 4NO0A 5FO9A 2HJKB 3KNBB 1CE6B 4FXLA 4GUPA 4KK9C 4RMUA 4GRMA 2FSEA 1F4YL 2AJ3B 4HT1L 4L3CB 4UOW0 5E2VL 4PJAB 2XG4A 2D9QB 4MXVF 4YDJA 2GTWB 3O6FB 1F2XK 4UMGA 1HKFA 4TRPH 3QUYC 4LLYB 1ZWIB 3UYRL 1S7QB 1YPZE 3PV6B 4FTVA 2PTVA 2OTWA 4JFXB 3RIFF 3ARFB 1LK2A 4P23A 1MRCH 3QIWC 1CDHA 2VL5A 4ENEC 2IQ9L 3PWPD 3MV7E 1RZ7H 4DK3A 2NMSA 1BPVA 4MQ7A 2APBA 4G43B 5IG7B 4R26L 2R69L 4AM0A 3PWVA 5GRXG 4NKMB 3X3FH 3S35X 2BVPB 4KKBD 4KKCD 3A6CH 5C9KA 4KROB 1YQ2A 4PBWD 5CFHA 4FQHB 2M1KA 1IC5L 4OT1L 4NGHH 3KXFA 2R0WL 1KULA 4HBCL 3BE1L 1IFHH 3EYFB 2X1PA 5IK3B 5E8OB 5E08L 2IAMA 1IEBB 4DAGL 1S7UB 4LRIC 5F1NA 2OZ4H 1DFBL 2D0FA 1G7IA 1KB5H 3B3IA 1B4JL 4L4VA 3Q5TA 4FFYL 2X4UA 5DD3L 1LP9F 1T5XA 4TSAL 2OL3A 3DROB 1WQVT 4GH7B 5CIPH 4YDKH 1EHLH 1FLRH 5DMYA 5IT2H 1GOFA 4QTIL 3RU8L 2GUOA 5B39B 1R5IA 5FO7A 4EI5D 4LCUB 3PGFL 4I3SH 3BKYH 2YK1L 1EEYB 3IKKA 4M7JL 4WEBH 1CL7H 1IAIH 1YEFL 2YHGA 4YX2L 2B8OT 4F7CB 1HN1A 3GMRA 3M8OH 1F90H 4JY5L 4PJ5E 3LY6A 1CGTA 2GUOB 2H2SD 1H5BA 2GAZB 1DBMH 4JM2C 4U3HA 5HTSA 2HWZL 3QWOB 2X4UB 1IKFH 4OGXL 5F3HB 4GLRI 5DJ8B 1YMHA 3QEQD 2DQTL 2NXZB 2P8LB 2HVKA 1MJ7L 1ES0B 4NHCL 3U0WL 3FB8A 4AL8H 4WV1B 4P4RB 2F8XC 5CD3A 1LQSR 3GHBH 4FABH 2BCKA 3AVEA 3MC0A 3O2VL 3OX8B 3ZO0A 3WCYA 2VH5H 2R2EA 4JO2L 3WJLC 1LE9B 2W60A 3KPLA 4H1LH 3V5DA 3LPGA 1UFUA 3ZHLA 2IGFL 3EO9L 5JUEL 2Z91B 3ARED 3QQNA 15C8L 4EUPH 4PJ8D 1BWWA 3IETA 1OOAA 4NPYA 4X7SH 5EUOA 2X4PB 3IB4A 4N0YL 5HDBE 5CD3B 2I60H 2BK8A 5CEYB 3QXVA 5FM4A 5ACMA 4Y4FC 3DGCR 4G8IB 1HK6A 1Z6JT 4N8VG 4M1GH 4M8QB 3B2VH 1W0WB 4BQ6A 1FN4A 1A4KB 2FJFB 2WIIA 2IEPA 4K2UL 1JNNL 4JZJC 2R9HD 3IAPA 4UIMA 1P5VA 3I75A 3CFJB 1A6ZB 2VDMH 3JTSA 4HC1A 3BPCA 1WK0A 3BMWA 4QRQA 3GI8L 1F97A 3O8XA 2Z9TA 1HDMB 2FO1A 4U1MA 1T66C 4LEXL 3NFSH 1N2RB 2H8PA 3K4DA 4NHUA 4Z7UE 4U0RC 5EBMA 1JUFA 2AJUL 3U7YL 5EZLA 2QADD 4ZPVB 2Z93A 1MCFA 5HYIA 2R0KH 3CVHB 1I1CA 3L1OH 4PRID 1MFNA 2RFXA 1MWAH 2CSPA 4U0QB 4J3TA 5A3ID 5IUSA 2IWGA 1DJSA 2VDQL 5HD8C 3NIGF 4YPGB 4G8FB 3VXUB 3ZYIA 1JHLL 3KYNB 2EC9U 4XTRD 2YOCA 3RWHA 3GSQA 3H7BA 5BZDB 4HMEA 3EYUL 4UDTB 5A2JH 1RU9L 1RFDL 1G7IB 1A3RL 5F1OB 3EIFA 2Z31A 4ISVA 4PP1C 2B0SH 4P46A 5C0RH 4YBQC 1JNHA 4GBXC 5C2UB 1X6NA 4JZNA 3VFWB 1BREA 5ETUA 3HNSL 5BW7C 2Q7YA 2DQFB 4XP6L 1YPZB 3PP4L 5C8JB 3CH1A 1N59A 2O5XH 5L6YH 2NY4C 2Z31D 3BW9A 3QNZA 3LEVH 2XYCA 5D7LE 3QDGD 4M62H 3WXWH 4Z7QF 4G43A 4G3YL 3W2DL 2FB4H 2XWTA 1FO0H 5FKAA 4BKLA 3LN4B 4Z78A 5C6WH 4OZFG 4DTGL 3MRGB 1S9VA 3B2UD 4MAYD 4YHPA 4IRJA 3ULVE 1IT9L 1FGNH 3K80A 3IDIA 5KG9B 4OZ4A 4JM2A 3ARDA 4PGCA 2GQHA 4YJZL 4E0RB 5F88B 1M71B 2GJ6E 5E94A 3MFFA 1H3GA 3VMNA 2O61B 2OBGA 5FOBA 5IB4B 2FR4B 3GNML 5KVMC 1DQQB 1KJ2L 1FNEB 5FGCE 5EBLB 4Y16C 1GGTA 3QZWB 5CCKH 4FZ8H 4EUPB 5IBUG 1FJ1A 4ZUWB 1S7RB 1GVIA 5FIEA 4P5MB 4OCXH 1XGPB 4E0RA 4Q7DA 4LAJH 3VWKC 1QSED 2A6KB 1J12A 4Y4HA 1S9VB 2X9YA 4J23A 4XNYL 3TIDB 4PY8J 1NUNB 3GMQA 3TH2T 3L3IA 4KKAD 1BLNB 1T89C 3VGGA 4IOIB 2R0WH 3OB0K 4QGTA 2C9AA 5CP3A 5CMAB 1JZ2A 5FK9A 4IDJL 5ADPH 3MLSL 1WSST 1Y18B 3KPSB 5LBSH 5IMLA 1I9IH 5MHSD 3NFNB 3QHZL 4G9FB 4JFDA 4WU7B 4QCIB 3QZWA 5EG6C 5E9DB 1QP1A 3P4NB 1VSCA 3MRPA 3TCLA 3BEVA 2GJ6B 4JRYE 2Y07H 1BBDH 3CX2A 3ZL4L 2FL5A 3BAEL 5K9OB 2DYPB 2YBRA 3WJJA 5E5RB 1UZ6E 2DWDB 2HVJB 3CDCA 1SEQL 3W9DB 4BM7A 4HMDA 5IHUL 1DUYA 4JG1H 5GS1A 2VDML 5KJRH 3L9RA 5F6HI 1F02I 2LU7A 4BZYA 4OF7A 1D7FA 1C08A 4MS8C 3C2AL 2J88L 3SOBH 3P40A 1AGCA 1FFNA 7CGTA 1MVUA 2DYPA 2YD6A 2ICCA 2ITDB 3OMZA 5IVZB 1L4IA 4P2OA 1D5ZA 5EIIA 4ONGL 3STLB 3SE3A 5IVXA 1QSFE 4U6VH 2RHEA 4Z8FH 4QF1B 1FL5A 5E2TH 4WWKA 5IV2B 1A9EB 3KDMB 3PWUB 3OJDA 3EYOA 1E4WL 4G8GE 1YEEL 2FB4L 1K4DA 3B43A 4HH9A 2H2SC 4F37K 3RGVB 5FA3B 3O4LE 2X4SB 3H6JA 3QO0A 1A0QL 4WW2C 4ODSH 4DW2L 4LARH 5I2IA 2OP4H 3P4OA 4OLXL 2GFBA 3PGCB 1Q0YL 1KGCE 5K59E 3EJZD 1B0RB 2Y23A 4KI5E 3U4BH 4QHNA 2W9EH 3IDNB 3PWJB 5HYJA 5JIIA 5H94B 2F8OA 1MVUB 5GS0H 5CINL 1NCAL 1V3KA 1UM6L 5IESH 5T1LD 3JV4B 4P0DA 2KZWA 4G8GD 5F7UA 5LJYH 2FSEB 1FIGH 1EGJH 1E4XL 2OMNA 4OLZL 4KJQC 3QSKB 3LDBB 3FB8B 1A1OB 4OZIA 5FM8A 4QRPD 2ATPA 3FO0L 4QRUB 3B5GA 4X6EB 3RX5A 2HT3D 4OCYH 4R4NC 1JTOA 3NMEA 2QQKH 3V52H 4PGZA 4TYUA 2NY1D 3RWEA 1ZT1B 3S37L 5F89B 4I48B 4JFDE 3KPPA 5DJDB 5BS0E 3O2VH 1JK8A 4NT6B 3W0WD 2XN9A 3BDBA 4PGEA 1ZT4B 4MA7L 4TUKL 1J0JA 1AO7A 5HHQB 4M7ZB 5GHWL 1TZHA 2BDNH 1II4E 4WV1C 4YXLH 1VGEH 4JO3L 1K2DB 5E03A 5IW1A 4H26A 1MCWW 3UTPD 4XCCH 2I60L 1JPFA 5I1AB 4UTBH 3WIIL 1X5AA 4NO3A 2XXCB 1R24B 3VFMB 2CKNA 2ORBL 3AU1B 1UC6A 1I1YA 3I6GB 2IPUK 3X3GL 5C08D 3VWKB 4K94H 4HUXA 1VPOL 5CHNB 2EDKA 4G6MH 2ERJC 3INUL 4ZTOH 2VH5L 5ABDE 3O6KH 1ZHKB 5DA0B 1KTLA 4LDEB 2O61A 1NSNH 5KOVC 4WTZG 4I0CC 1GAFL 4JFPA 5KZCD 2EE3A 3REVA 4XBGB 4J4PD 4IMLA 1EUTA 5E99L 4JRXA 4NO5B 5HDOA 1U3HA 2WQRA 4XC3L 3I6KA 4IIQB 2XA8L 2XG5A 3P73B 2IBGA 3FMGH 5I30L 1OAZH 4MA8L 2LFGA 4LQFL 2ZCHH 3BEWB 1JPTH 4M61B 3TWCL 5JQ6H 5EO0A 3N1GC 2VLJB 3MLXH 2YS4A 4ZXBB 1HQ4B 2WBJA 3CDGB 3QIUD 3DVNA 2F54A 3DMMC 1W0VA 5HHNB 3ET9F 3RTQC 2Z0BA 3BYTA 3H3PL 5IW6B 4J3SA 4MCZB 4G7YL 1JRHI 5E8DL 4PR5A 3X11B 4LCYB 4YDVA 2HJKA 2F54D 1V3MA 3C8KB 5F7FA 1XZ0A 4S2SA 2ERJB 5DD0L 1FFQA 1IM9A 1KC5H 1TFHA 3DX7A 1GJIA 3BX7C 3PDGA 1YQVH 2HFGL 1X5XA 1WFUA 3F5WB 1EVTC 1T5WA 3QUMB 1KTDB 1OCWH 4NQDD 5FHAH 4RWYH 1AI1H 2EEBA 3AREA 1AD9A 2PETA 3VDBA 5KVEH 3OL2A 4WO4B 1UWGL 3SDDC 3VD9A 1DTUA 3ARUA 4NFDA 1CVSC 4EBQL 4JGJA 1CXLA 4HCRL 5F9DC 4F9LA 1EBAA 1IGYA 5JORB 3UZQA 3S88L 4ZFZA 5C0JB 1XMWA 3O81A 4R0LC 1IBGL 3JTSB 4PUBH 2FO4A 4HD9A 4WI5A 5D71H 3DUUB 3O0RH 4U1JB 3LDBC 5DJ6A 1L9NA 1GL4B 4QKXB 2O5ZL 1DN0A 1NEZB 4HSQA 4J1UA 1FE8H 3LSOB 4PJBA 5ICZB 5D5ME 4Y16A 1YEGH 5DJXB 1ZANH 4YC2B 3WE6B 2BVQA 1ND0B 3MJGX 1LO2L 3MNVB 3I6GA 1CG9A 1FVEB 4FQJH 3FQWB 3T4YA 1NLDL 3HI6H 2QSTA 4JFEB 3TVMC 5LGHH 3FQUB 1NUDA 2QQNH 4XC3H 3QEGH 2FNBA 1XF2A 4JRYB 5I30H 1GHFL 3E6HA 4JO3H 2LVCA 2NY6B 1ADQH 1MREL 1NJ9A 5KW9L 5I71B 2FJGB 1KLUA 4WTZA 4X5XA 4H0GA 4OUUB 1OGTA 4WCYL 2J6EA 1A6VL 4XWGH 1AE6H 4Y0GA 5DR5H 1X44A 1IQDB 2IBZY 3LKRA 1F3JB 4XT1C 1I7UB 5EU3B 3O4LD 3L3JA 3LS5L 1MCJA 4NNYB 4BA8A 1RZ8A 1DVFB 4HIHB 5JHDA 4PG9B 3LRSA 2VN4A 3B9KB 4YUEL 3NACH 5F88A 3FB5B 2D9CA 4M43H 1KGCD 4MJ6B 1CWVA 2P7TA 5KG9A 1DSFL 1QBBA 1DBAH 2HJLA 5ANME 3VXMD 4WI2A 1RUML 1U2CA 5TDPB 1Z9OA 1IAOB 3L5WA 4NQEA 2BNRD 3LOWA 3KYNA 3N9GH 1NUGA 4K7PX 4P2QD 3MUJA 2FBOJ 4XVTL 4YHZL 4Z9KB 4O2CB 3MV9B 4X6BA 4LSSH 3S37H 3OKYA 1WWAX 1HINH 3HHRB 5ACZB 4JPIA 3GJFB 3IJHB 4JLRA 4HLZH 1NCBL 2CGRL 1A4KA 4JFED 1VFMA 2AV7A 4HF5H 1MRDL 1FORL 3KS0H 4PTTA 2DWEA 4XXCA 3CFJA 4X6BB 5BOPA 3SDAA 1P7KB 3A67L 2H32A 4P2CG 2N56A 5JR1L 3ZDYE 5FKPB 3FB7A 5F97E 2DDQH 1ZLUH 5EU5B 3OG6B 1BD2A 1YYLH 1RULL 4ZS6C 1WBYB 4GT7A 2F54B 1H3VA 4M6OL 3MRPB 4JANB 3BRGC 3MJ6A 5D4QA 4EEEA 2FX9H 3GMOB 5IJKA 5C2BL 3DETC 3HCVA 4HUUB 4MNGA 5A1AA 5C08E 1H3XA 1YY8B 3NZHH 3K74B 1NC2A 4NN6B 1JPFB 3V6OC 3K7UA 4JHBA 4EDWL 1XGUB 1DBBH 3BWAB 2YSSB 3BP4B 5BVJA 1FYTB 4Q6YA 5J12C 4Z7UB 3A6BH 1A22B 2G75B 1HHIA 5ICXA 3FB6B 1QO3B 1MCQA 2CKBB 2WQ8A 4RIRA 1Z9MA 2X89A 1MCHA 2YUZA 3CAFA 5DK2B 5I1HL 3BQUD 4L8SC 4XMLL 3ZDXF 4P48A 5GRZA 3I50L 5FEBA 2CLRA 3ECBB 3ARDC 1T66D 3QNZB 1ZLUK 3D69B 1CE1H 5AG8A 2IJ0C 5EO1A 3N85H 3GFUA 1ZTXL 2X4QB 3KGRA 3PGDB 4K9EL 1H3PL 1MF2L 4H5SA 1BEYH 1KN4H 4IS6A 1J1PL 5CKAA 5E8DH 3CZFA 5TDNA 2P44B 2HLAA 3WLWC 4NM8L 3QHZH 4JHZA 5HD8D 4PJ8C 3RI5K 4JKLA 5HGDA 2Q3ZA 2D0HA 4M7KL 2V2XB 3QG6A 4F58L 2ZOLA 5GRWA 4RFOL 1I1AC 1M71A 3TNMA 5KS9A 2A1WL 1AHWC 4P2OD 3NTCH 5MENE 5JW4Q 5HHXL 1CTOA 5H8DA 4F7PA 2E8YA 4GSDL 5GJTL 3BN9C 4DGVL 1D9KA 1U9KA 1CGSL 4MSWB 2YMXH 2C4XA 3GMLA 4L8BB 5C07E 4Z7VF 1F6FB 3NZ8A 2VDOH 3MRBB 2Z4QA 3DV4A 5DFVD 1MY7A 4U1MB 4NM8H 1N0XH 4G7YH 4EN3A 1ORSA 2VO5A 2YPLA 3QI9A 2EIBA 4WGVB 1URLA 5ID1B 2ZPKH 3M17B 4PJGF 3I75B 1A7PL 2EE6A 5T1KA 3FFCE 2DM7A 3SGEH 4K3EL 2CLVB 3HNTH 5EU7E 3TNMB 2ZUQC 1DBKL 1FIEA 1MCEA 3OXRB 4JE4B 1C7TA 3FJTA 2DMCA 2DM3A 4JDVA 3MRFA 3WDHA 4XBEH 4YPGA 1AO7D 3WIFA 3ARVA 3T0DA 4WFHE 4KV5E 3BGMA 1AGDA 3JV5A 4B0MM 1C12B 1SJHB 4N0RA 4H0HB 4L9LA 1QFUL 1DBBL 3X13A 1RZFH 3MLZH 4PRHE 3NIDE 4MAUL 3KJ4B 1TVDA 4L3ED 1XGRA 2V17H 4GW5B 4YO0B 1AXTH 2HRPH 2VLME 1FNAA 1CU4L 4LSTH 3RWDB 3UJJL 1I3GL 3CNKA 1NKRA 1CQKA 2NW3A 1AO7E 5E24E 1TJHH 4N0UB 4XPFH 3REVB 3I50H 1NGZA 5EU6D 5T3ZL 2X70B 2CKBA 3BWUC 2FYYB 1GRWA 3VI4F 4ZG1A 3O45B 4MJIE 1AHWB 2DS4A 2MHAA 3KG5A 4M8VA 5CWSB 4AEIL 1B88A 3V7AE 4HWEH 2CJUL 2AEIT 4X6CF 1K9TA 3U7AA 4E9LA 5IV2A 3VGAC 4PJBF 4JKPH 5ADOH 1NDMA 3IF1A 3S96A 2ZP0T 3O6FC 3LN9A 4FFZL 1P2CA 2A9MH 2NW3B 5D1ZA 3UC0H 2RCSH 4ZO9A 4EUPA 1H15A 5GHWH 1JZ6A 4EDWH 1NCAH 3AAZB 3MNZA 5C86A 3MACL 2R1XB 2F53B 2L7UA 3GSWB 5IFJB 4HC1H 1I8KB 5IW1B 1OP9A 3KYMA 1QQDA 4RQQB 3TT1H 3QDJA 4H25A 5L2JB 4YBLC 3JWDC 3LH2H 2CO7B 2R8SL 3O6MH 5CP3H 1H0DB 3MSPA 2AK4B 3OHXB 4LLMA 5IIEA 3ARDB 1AGBB 4HWUA 4JCLA 2ZOLB 3BP5A 3HZMA 2VC2L 4P2RE 4KH2A 4BFEA 3ARBD 1XAUA 4ZNEE 5FGBC 1XR9A 4EOWL 2IAMB 4NC1C 1S7TA 3K4AA 3IAGC 4U1GC 1ERNA 5DJ8A 2JTDA 2DQDL 2BC4B 3TM6A 4AY0A 1OL0A 4LSRH 2P24B 4IRSD 5KSVA 5FUZL 3W0WE 4U1LA 1JGEB 5C0ND 4XP5H 3TBYB 3X12A 3QXAB 2OJEA 4NUJB 4HXAH 4LSPH 12E8H 3OKOB 5EC2A 3PF2A 3SKJH 3B5TA 1ODAA 1XH3A 1IGYB 1NCCH 4KRMB 2MQ0A 1T20A 3SKNA 4LCUA 2FX7L 4ORGA 3MRCA 3IDUA 4YBHA 3UBXB 2OXHA 1ZLWK 4M6NH 1DZBA 4XPFL 4QTIH 3ILQC 4FP8L 1IGMH 3BP6B 1MAKA 2PO6D 2PUQT 3KPRE 4LFHD 1AKJB 1ZA6A 5C0AD 1FBIH 3PL6A 3W9DA 3RY6C 4HJ0D 1MIMH 1G0XA 2G2RA 1FZJB 4IDJH 1GH7A 4PJGB 5ADPL 1QFWI 5FOJA 4MB4A 5J6GA 1S9XB 2BERA 4PLOB 4HH9B 1IFHL 4D94A 2DJUA 4PRPB 3NA9L 3HE7A 5TFSL 3ULVL 3RNKA 2DQGL 4LCWD 1RUKH 5T3ZH 1MJ8L 5AD0A 4I0PB 3WFBH 4QRSB 4HHAA 1S7VB 3IFLL 2MKLC 1FFNB 1NCDH 5IHUH 1A6VH 2FGWL 2EH8L 3HE6C 4L1DA 3CDFA 4JG1L 5EZJB 5DR5L 1U3HB 2HFFA 3E6HB 4WFFD 2X70A 3VFSA 3HLAA 3S36H 3F58L 1BVLB 3QNXB 4JFFA 2CIIB 1FNLA 5J6HA 3PWPE 2X4PA 4TRPL 4XPAH 3EGSA 4L29B 5EIQA 4ELME 2OZ4L 3SCMD 1I9IL 2P7TB 1CD8A 2ZCLL 3MLYL 4WUKH 5JW4R 2RQ8A 4HQQL 2NR6C 2IAND 1DBML 4I13B 1Z3GH 4TVPL 5K9JL 1R3HA 1YMMA 2VOTA 1JPGB 4PLNC 3R1GL 2Q86B 4KVCH 2K7QA 1YQVL 1UXSB 2R2BB 4OI9A 5DDHA 1A5FH 4XAKD 3L95A 2DBLH 2E7MA 3SE3C 4LCYA 3BPCB 3VXMA 3ALWA 4HPYL 4R97B 1J0HA 1S5HB 3D0LB 1TVBB 1A4JB 4L4TD 1XIWB 4K3GA 1H3WM 4X6FB 4L8SB 1ZTXH 1FC1A 2X4RA 1CGVA 3QCTH 4CN4A 5IB2A 5IB3B 4GKZB 1J1PH 1OY3B 3VE0A 5IMMB 4PJFA 5I1DA 3MMEB 2R2HA 4DQOH 4EIZC 4NQCA 5IB1A 3HC0B 2VN7A 1AO7B 5HHQA 1JGEA 2UYLB 3D6GA 2HJFA 4JM2D 4PJ7A 4GKOA 5DRZA 1NC4A 4NSKB 3NA9H 3VXRB 4X6FA 2DICA 2VITA 2N4IA 4KVCL 1DLFH 4YC2C 3ROOB 5CP7B 4PGBB 3P0YH 5IVNA 3OR7B 5TPWH 5KVEL 5F6IB 1CLYH 1JI1A 1WFOA 4RAUA 4Z7VE 4NRYA 3H9SA 3BDXA 2R0ZL 1T21B 4CMHB 1JZ5A 4X7TA 4HWBH 5J8OA 3IRPX 2PF6A 3VFRB 2QADC 3HAEG 4PJDF 3KXFB 5DC0A 5C0BD 2O5XL 4P3WA 3LKSA 4FQHA 4G6JL 1Y6KR 4JQXC 3W5NA 3RWCA 3W11D 5FV2A 3MBEA 4MD5A 5EA0L 1A7OL 3VWKA 4KK5D 1JRHL 3CZJA 3PDDA 1NCDL 5DI8B 3KJ6H 3UX9B 2X1WL 5E6IB 4N0CC 3SE4A 1SY6A 3VA2C 3PJSB 4M1DH 3SDDD 5F1SA 2ZNXA 3MLWH 4Y7MA 5C0EB 2F5BH 4CU8A 4ZFOA 3S4SB 4KJPC 1FGNL 4LNRB 2XWJB 3OJ2C 1HHIB 2ZSWB 4GRLC 1H3TA 2GT9B 2HKHH 5FHBL 4WHYH 2P24A 2IH1A 3QEHA 3BQUA 4UZGA 4OQTL 4JLRB 3V5KB 3SO5A 2QR0A 5DD6A 3FL7A 2Y5TB 1VKXA 2IQAB 2BJML 1IGJB 2QLVB 3C5JA 4ERSL 1RUQH 3MGOA 1QKZL 3MV8B 5D1ZC 4ODWB 2QQLL 4U2YA 3VXME 2BFVL 1EK3A 3QJFA 1A0QH 4LHQB 5I19H 1KFAH 4WWKC 3P0GB 5GS0C 4M3JA 4JFDD 1BZ9B 2VDNH 4FQLH 1HHJA 4D3CH 1FZMB 4OM1L 2NY3C 2Q20A 3I9GH 2CRMA 3B83A 5KTEH 1OM3H 4N5UA 1AGFA 5HYFA 4IOIA 3HNVL 3H9YA 2BDNL 2FL5B 1VESA 2YN5A 5TE6L 5MI0C 1FZOA 5F21B 2NY4D 2Z31C 3ZDYF 1MWAL 3VFPB 2D7TH 1D9KD 4ZFZB 1T22B 1RZKC 5I9QB 4CL7A 3DV4B 1AR1D 3HR6A 3IJHA 1PDKA 1FHGA 1LP9B 2OL3H 4IHOA 2V2WA 1QR1B 2QSVA 1AGCB 1JGVL 2BSRA 3TN0B 2JB6A 4YGAB 3TC9A 2FHBA 1ZSDB 4GAGH 3DRQB 4K8RC 4XTRC 3WHE1 3NVQA 1FZMA 3UJTL 4HBQA 2R4SL 4NBXB 4CNIA 4R96B 2XZCH 3QCUH 1FO0B 1A9BA 1ZEAL 3GUTA 2VAJA 2A77H 3ARRA 3ZYZA 3FO2B 1OWWA 4UT9H 2DQCH 2Q3AA 1BFVL 1UEYA 1RZJC 4HK0A 4DAGH 1N6QH 1QBLH 5FYLH 1CXFA 1PLGH 3HMXA 1IEAA 3V6OE 25C8H 4TVPE 1OP5K 2KUTA 1DL7H 3O4OC 4X4ME 1AP2A 5L0QC 1I8MA 3T2OA 1VENA 3WDJA 4JB9L 3MTRA 3QO0B 3HPLA 3LRHA 1D9KC 3UTQA 1ZVSB 5L9DH 5CEZE 3SHSA 4DW2H 3QUZB 4R2GB 1ITCA 4EN3D 3FQXB 1KLUB 2ADJB 2HH0H 2GJ6D 5GQBA 4MMXC 2DLIA 3RVUC 3EDDA 2WIMA 4FTVD 1IMHC 3EOAB 1AHWA 2MHAB 4ZOCA 4HKBA 5JIPA 3EDFA 2I9TA 1QSVA 1UJ3B 2YA0A 3T09A 1I9JL 3LB6D 1INDH 2YD3A 2DAVA 3MUGB 4RA3A 4CU7A 2H6PB 1XIWD 35C8H 5EU6A 3ULUH 5IMOA 2DQJH 2UZIL 1F42A 4G9FE 4D9QE 4YXKH 1OTUD 4ONGH 3EDKA 1MWAB 5I16B 4UQ3A 2NX5D 4LDLB 3HMXL 1LD9A 4HQQH 5AZ2L 3CVHH 3WDIA 1ONQA 1VCAA 4N8CH 4FXGA 5TDOB 3DVFA 3C2SA 1QFOA 4NQDE 1EMTL 4TTDD 1Y6NR 3KJ6L 3LQZB 5KAQF 4OLVH 3C5ZD 1JBJA 4LU5L 3CSGA 3IFPB 5DQJB 4MVBC 5DHVA 1I8KA 5E5MB 2EC9T 3QRGH 3GBNL 4GUPB 5FO9B 1Q9LB 2EXWC 3VW3H 1HCFX 5HYJE 3CUPA 4LVNC 1R3LB 5CSZB 1CDIA 2AV1A 1W72A 4QRTB 1NAKH 5IW6A 1UXWB 1PG7H 3MJ9L 4JM2B 1FYHB 2Q8AL 1CLOL 1P7QB 5FV1L 4O02H 1MWAA 4PJ7E 4OF6A 4MJ2A 1K2DA 3C8HA 1CZ8L 3BPNB 1FG2B 3MV9D 4K3JH 3VCLB 2COQA 1HYRC 1ROWA 4XCNB 2XZZA 3GBMH 5BMFH 4BK5A 5DC4B 4MQ7B 2ZCLH 5E6IA 4Z6AT 3OZ9L 1DLFL 1UXWA 2ZUVA 2W1NA 2HFGH 2J7LA 1UH2A 2JKXA 4LF3A 4RGNE 4HW6A 2OTUA 5ILTH 3ARFA 1RUAL 4I77H 3MA9L 1A1MB 3VFOB 3LMJH 3FKUS 2JCCB 3GMPB 1RY7B 4JDTH 5DRNB 1BM3L 1VFAB 5EORH 3C60A 4OLEA 1MCRA 4ESKA 1IM3B 3S9DB 4K9EH 2ZSVB 3LQAH 4WI8A 3E3QE 1FZJA 4PRNA 1PY4A 4XP6H 3TA3A 4H20L 5CJBA 1FAKT 4ODVH 4JFZH 4YIQA 4K23H 2FEEL 2PW1A 1J18A 1VEPA 3WUWB 3ZDZF 3X14B 1O7SA 3GK8L 5KSBE 4HK0B 1JWMA 3PDOB 1QFPA 1F4AA 3MNWA 5I9QC 2LTQB 3VH8G 1F4WH 2VLJA 5SWSE 1CDBA 4NQUA 1BQHG 3TA3D 3VXUD 2AXGB 2CIKA 2ORBH 1Q72L 1FO0L 3ULUD 3C6LA 3SDYH 5EU6E 1MCSA 4JRYD 5ESVA 5H2BB 3BDYH 1ZLVK 2E6PA 5CIPB 1NPUA 4HHAB 1N3NA 5JLZB 1J05A 1QYGL 1Y0LA 2NNAB 5DJAB 3T1FB 5L6YL 1KBGL 4I3GA 3P11H 4EQ2A 4Y2OA 3BOVA 3C6LD 3MRMA 2C1PB 4TPRH 3ZYOA 1H5BB 3SJVD 1RUQL 4OI7A 2UWEB 4XPHH 4ZFOB 3BT2L 3S36X 2X4NA 3VGFA 3MBXL 2CUMA 5HJ3A 3MODL 3GJFH 3RY5A 4RDQG 3ORJA 4RFNC 4KK5C 4GG6B 2ZCKH 2D4DA 2ENYA 3QIBA 2B7DT 1UH3A 3I3BA 1N4XH 2HG5A 3IETB 2BOCB 3CVIH 2VKWA 3G08A 4JG0L 3SOBL 5BOZG 2CMRH 3VJ6B 4Z7WB 3KPLB 5JNYA 4HF5L 2DQDH 5H94A 1J11A 4FQCH 1T1YB 1XGQB 2ESVE 3I3DA 1IAIM 4MA7H 4QHNB 3TCLB 4D0DA 2UWEA 1RZKH 5F9OL 4PP2A 3BT2H 4CVXB 1RHHA 5L2KE 2A6IB 4MJ5B 5J3HD 1RVFH 5JW5B 2NXZD 2WIIB 1N7ML 5E4EC 1C16B 5EU4B 4XX1G 4TVSa 4K8RL 1J0YA 1NGWA 3RBGA 4ZQKA 4DVBA 3ARBB 3RDTC 4QXWA 3MLRH 3TESA 4D8PB 1V8HA 4UB0L 1IC4H 1D6EB 3OXSA 3GSXB 3AS2A 5I1LA 3HB3C 5J9PA 4XPGL 2ENSA 4YX2H 3WUZA 3ARGD 3C2AH 1C08B 3BH9A 1GC1H 3FONB 4PJEF 4Z7OE 3SDCB 3KPMB 3AC0A 2XFXB 2BNQA 3I2CL 1MFEH 5FUCC 3H9SD 2BFVH 4JEGB 2R1YA 4N1HB 3D2UB 3U1SH 3QXTA 1N7MH 2YD7A 3P4OB 4MWFB 2JIXB 4G6AC 4UDTA 3TZVD 5BZDA 4NWUH 3E1F1 4U1SB 4ZFGL 1MJ7H 1FO0A 1XGYH 3UTTB 4U3CA 4ZO8A 1KELH 2DKMA 1AXSB 3SGEI 1HXMB 2A73B 5LGJA 1F3JA 4HPYH 3JWOH 1E6JL 2X5PA 3RWGA 5I0ZA 3RAJL 1DEEA 3DTXA 4HZAA 4JDTL 3LKOA 1KENH 3QNYB 1S8DA 3DX8A 4YZFF 1FZKB 3OB8A 1PAMA 5ISZA 1OTUC 1MCWM 4U6VL 4A6YA 5T1MB 1YEFH 4XBPA 3G6DL 2GY7B 1G9ML 4YZFE 4KROD 4XCNA 4UT6H 4KTDL 2VDRL 3L5WB 1I4FB 4G3YH 3ARGB 1OTSC 1IGCL 1QHPA 4DCQA 1NC2D 3KYAA 3Q3GB 4WCYH 3MCG1 3MBED 1CXHA 3C5JB 2W9DH 3T0BA 3NFPB 1VDGA 2L7JA 4BQCA 5JXAL 1HHJB 4HWBL 5E1AB 3WJJC 1G7JA 1DUZA 1BFOA 2X89D 1UH4A 3O3DA 4C56D 1JPGA 5FM5O 4JRXE 5B21A 4K7PL 1WC7B 4QXTA 1D5XA 1Z0NA 1FFOB 4HLZG 2G5BA 4JPKH 4MZ2A 3ZT5A 4X4ZA 1FYTD 5DS8B 1G7QA 1XF3A 4LQFH 3CFDB 4QLRA 1N6UA 4QYOA 2EDQA 2RGSA 1M7IB 2DYPD 1D5IH 1U8NA 2JJTA 3QBTB 5SWZE 4NZRL 5FECA 2W9DL 1KIRB 2AVGA 1XGYL 5IHBA 1T1WA 2XWJA 5E00A 4X4XA 1FYTA 4HKZB 2EDJA 4KMQA 4K71B 3Q5OA 3V8CA 3OKMA 5C0NC 3ZKMD 1M6OB 5HGAB 3LKPA 3Q6FA 4DN4L 3EZ8A 5DEGB 1T2QH 3FAXA 1HWHB 5DJ2B 4YPJA 5KSBA 1AY1L 2PTTB 3CVHL 1MHPL 3AB0C 5GZOD 1HSAA 3MRIA 4PV8A 4YWGL 3CXDH 4I1NB 4WUKL 1QSEB 1NBQA 2EYTB 3S7GA 3KYOA 5DJ6B 1QFWM 3DXAE 1YJDH 4CW1A 3EYUH 2ARWA 3L3HA 4S1SL 3EFDL 3JWOL 5J1TC 3K8LA 5I8OH 4G8GA 2XY2A 3TO4C 3U6RB 4WHCA 2Y36L 4LHUA 4P3DB 1NAKL 1IGFH 1U8KA 3AXLB 5IBUB 3V5HB 4Q2ZA 1IZKA 1MJJB 1QLEH 4BZ1L 5JO5A 4KC3B 4MD0B 3DRTA 2H8PB 3ZDZE 2AJZB 3PP4H 1FFPB 1IM9B 5CGYD 3LEXB 3PWUA 1UKTA 4YO0A 3BD3A 5D7KD 4LNRA 5FXCH 1A8JH 3MX0A 3OKNB 3QDHA 3PHQA 2WWKT 2GTWA 3O6FA 2HWZH 4N0UA 4YHNA 2H9GA 4FRWA 5HVGB 1JNNH 3L5XH 3GKWH 4G5ZL 5AYQA 4P9ML 3G5YA 1R3JA 5E9DD 4R3SA 4S1DD 2IADA 3C5ZC 2R4SH 3QHFL 3H42L 2NY0D 3VWJC 2AJUH 2LTQC 3U7YH 3F7VA 3LRSB 4OJFL 5EIVA 1YMMB 4OGAD 3W11C 4GAYA 4YQXL 4R3SB 3TV3L 3F7YB 5F7HA 4CADB 7FABL 3QIWD 5JOFB 1JI2A 3IDXH 3IGAB 3THML 5DQDL 4NJAH 5D96C 2EH7H 4O51A 1U8LA 2XN9B 4AG4H 1ZLSL 4BQBA 4EVNB 1B6DA 4GQ9H 3QDMA 4O4YH 2HJFB 4PJ7B 5F9WC 2MCPL 4JVPA 4J8RA 3QI9C 3RWEB 2FECL 4M7ZC 2V2TA 3MV9A 1FL3B 1WCBB 2XA3A 1T3FA 3I6LE 4JHAH 4PRIB 4TULH 5FCSH 3VDCA 3LQAC 1NAMB 1SJVA 3QO1A 4ZD3H 5CZXC 5CINH 3K3QA 1ZOXA 4DKFL 1DCLA 3SCMC 2IALB 4FQXD 1EO8L 4CN1A 1T89A 4YFLF 4NZUL 5F1KC 1G7PB 2J2ZA 3QUXB 1FVDA 4ERSH 3IKCA 3EHBC 2QQLH 1BBDL 5KW9H 4PRNB 2NQCA 4A2MA 4OD3L 4PJXB 4ODSL 2NY2C 1HQRA 4D9LL 3BUTA 4IRSA 5I8OL 3QT2A 4K71C 5DHYB 5JW3H 3EYSH 3IXAA 1G1CA 4JG0H 5TH2A 3HI6L 4LGRB 4X6DE 1J5OH 4KVNH 3WXVL 2WLYA 2XIDA 5JLZA 1BBJB 5C9JA 1BX2B 3U4EB 3NCJL 4XMKH 1KB9J 5CZXD 2I24N 3HG1D 1JRHH 3BP4A 4NRZA 3UTSA 3GIZL 3AB0B 4YBLB 2LQRA 3O6LH 1M7IA 3C9NB 4GXVH 5FGRA 5I1IH 5IR1A 3M07A 5DTFB 3D18B 2O5ZH 1KYOK 4JQIL 1A7QL 5D7SL 2W65A 1FLRL 3KYKL 4Y1AE 4Z7UF 5D8JH 5BV7H 1L0QA 3DOSA 3P9WB 3FN9A 4HK3J 2C7UA 4YDVB 2SEBA 5D7IB 1DQQA 1MQKH 4PRAB 3G6AA 2DIBA 3MPCA 1IE5A 1QRNA 5DEGA 4J3OC 2KZ1B 3BZFA 4ELMB 5CBEB 1OB1B 1KIPB 5JA9A 5EOCJ 4LGPB 2OX5A 4Y5YB 1ZAGA 4ODXA 4HBCH 3E6FA 5EFIA 5JHLL 1QLRA 4S1RH 1BHGA 3JTTA 3BP6A 2IMMA 2B4CC 1FL5B 3O8XD 3W2DH 4K3JL 5C7XL 2JB6B 4WFHD 4KJYB 4ORGB 4Z0BL 3MRRB 1U92B 2CXGA 3HNTL 1C1EH 3SDXA 2HTLD 5EBMB 5F93C 1KELL 3EFFB 5D8JL 5GRVK 2DMKA 2C4FU 3LIZH 4KJPD 1TTGA 5DRWA 1EH9A 2GITB 4U0RB 3VW3L 4OSUH 1DVFC 4R4BB 3W39B 5C0CE 1J1XH 3VD5A 4CKVX 3RPIB 4QXGH 5MEND 1OW0A 1CFNA 2H2PD 4FFVC 4ZD3L 4H1LA 3T04D 5T3ZD 1OB1A 1LDSA 1MCCA 3QIBD 1U6AH 3FOMB 1S5HA 3D0LA 2L4OA 3MYJB 4JZOB 4P46B 2UZIH 5C07D 3KPMA 1GZQA 3V6ZB 2NXYC 3TBTA 1K8DA 4ZS7H 2VXQH 3WXWL 4TSCL 1C5CH 4OFKA 2VZTA 5GGQH 2CLVA 3UPRB 3G5ZB 1NAML 3BEVB 3TO4D 3HAEB 3S5LA 1K5NB 4HFUL 3SDCA 4N90D 1TJIH 1JMZA 5DJ0A 5C2BH 4RMRA 5E8EA 2GW5A 2P4AB 2B2XH 5E6ZA 3VG0L 4N68A 3WIFB 5I66B 1CE1L 5BJTB 1J1OL 5AWNL 4GXUM 3QNXA 2EDEA 2X42A 4YGVA 3CJJA 4Y5XB 3ZHDA 2CRIA 4NQXB 1KUMA 3ZKMC 5DRXB 1MSPA 5F7WC 4OI8A 4Z77A 2QHRH 5IVXF 1JGUL 1C5DA 3IJSB 1TZGH 3A0OA 2DF3A 5HYQB 3WL9A 5D9SA 2GCYB 1NDGB 3NCFB 3TVMA 4NFBA 4NPYB 2BNQD 1CF8L 4OCLC 4F57H 1MIML 4ZUSA 2FX9L 4R7DA 5FAAA 1JCKA 5HYSG 3QJHA 4OM0H 1RJYA 3AUVA 4UI2A 4HUWB 1MI5D 4HZLA 4N0FB 3VGDA 1S7SA 2D03L 3RZCB 5EOTA 5B8CC 3PNWA 2F5AH 1MCOL 2P5WA 4WW1B 1RUPL 2V5YA 3K0WA 1HHGA 2AEWA 1ZLWH 5GZOC 2VR9A 5T33L 3FN3A 4RAUB 4LVEA 2A83B 3ALPA 1M05B 3HUJA 3BGAA 4KDTA 1DL7L 3BW9B 4WWID 1EEUA 4MYWB 4HX1A 5CP7A 1OF2A 4GMSL 4R7NB 5L2KD 1IKFL 3FO0H 2VITB 4FZEL 4WUUE 1CDUA 5HGBA 3CK0L 4W4OA 1N4XL 5C6TH 3VXPA 3CXHK 3KPPB 4KAQH 3CVIL 3OKDA 5SWSA 2Z8SA 5GPRA 3MA7A 4YHIB 3L5JA 1QHOA 5GGTL 5C9JB 4R7NA 2R0KL 1EUUA 4U6XA 3SDDA 2R23B 4Y4HD 3O4LB 2VIRB 3EHBD 4UDUA 4JANA 3L9RB 4UAOC 3ARSA 4D0CA 1IC7H 4ZS6D 4YR6B 5E0QA 3DARA 4WUUD 3AM8C 4AEHL 3GB7A 1RAMA 5GRUH 1WGOA 1MUJB 2EIZA 5MERA 2EYTA 2EKSA 5ILTL 4APQD 3B8SA 1A6TB 4P5TC 4OFVA 4S1SH 1KXTB 3NCCB 5D2LA 4XMPL 5IOPA 4PLJC 2AAVA 2IQAA 4XVUD 4YEFA 5DK0B 1C5BH 4YUEH 3G9AB 1LP9A 4IHOB 4HS8L 5GGTA 4JY4A 4K7PH 2XZQL 4U1HA 4OT1H 4NNXA 4APQA 1BAFH 1KB5B 1RJZA 1XF4A 4M48H 3V4UL 3FT2B 3F62A 2F74A 3BUYA 2YEZB 1FFPA 3HUJE 1IZJA 3D39B 4IMLB 3HR5A 4QHMA 1RZ7L 5CLWA 2W38A 1PKQA 3MRHA 1KG0B 3VXRE 4C4KT 3MXWL 2BRRL 1I75A 4U1HB 4Z95H 2RIKA 5IFHH 4FQIL 2WZPD 1KJ2A 2DQUL 1QO3A 3UAJC 2DD8L 3HE7C 2VYRE 1TVHA 4WTWA 2XKUA 3NGBC 2Z91A 4WU5B 5LXGL 2VDKH 4HT1H 4RMVA 3SGKA 2H9GB 3BIBX 4J6RL 4ZUSB 1BQLH 3QWOA 1F3DH 1CL7L 1IAIL 1I1FA 2F54E 1J0ZA 2R29L 4H20H 3NFPA 4NO0D 1RIVH 3HC4H 3VFVA 4AEEA 3EGSB 5ENWA 4V1DE 2Y6SD 5T5FH 4PB0L 4NN5C 3KLAA 2JJSC 5EU6B 5IT2L 2YN3A 1MRFH 1T03H 3Q48A 4UQ3B 4WFEE 4KTEH 3UJIH 2P8MA 3FFCA 5B8CA 1YEIL 4LLWB 4LPYA 3INUH 5HHMD 2BHZA 1LE5B 1NGWB 4EZMA 2CQVA 2VL4A 1JF1A 3WIHH 4XMKL 1BQLL 1N6QL 2BNUB 5E2UH 1T1XA 3FFCD 4P5KB 3DURA 4NYLA 3RZCC 5B8CB 1DE4B 2BXZA 3VFVB 2DIJA 1Q94A 4OFIA 3CMGA 3HC3L 3O9WA 1KC5L 3R06B 1GPOL 1PYWB 3HPLB 4M7KH 3E3QC 4DGIL 4U49A 3KYKH 3Q6FB 2WWMD 3V7AG 1PX4A 5D70H 4PJXA 5INDA 4U1JA 1QFHA 2HH0L 2OL3L 1LGVA 3D3VB 4K94C 4FQXA 4JGMA 5TQ0H 4NO0B 1DE4A 3KLHD 3U7WH 2IBBA 5ALCL 3L3KA 2VQUA 5J11C 3L7EA 1HQRB 1T83C 5I76B 1BOGB 1J8KA 1B0GB 5AZEL 2NPLX 2EDNA 2X4SA 1LNUA 1VACB 32C2B 2AEPL 4YFLI 5EO0B 2DLGA 2UZYB 1LVEA 3QDMD 5F70A 5GSRA 1CBVH 4OLUL 1F6AB 3NABL 5F96L 2O26U 1L7IH 3PGCA 4OZHB 3HMXH 4HUMB 4WW2A 2ATKB 4P2RA 4PY7B 3FT2A 1QPXA 1SEBA 3C08L 2ID5A 3B5HA 4M93C 2A0LC 2ICEA 4PJ9B 1UCBH 2DQUH 3GHEL 2FJGA 1TVBA 1S9WB 2R2CA 5F9JA 5C1MB 2BZDA 5CWSA 1X5IA 2DBJA 1P9MC 4ISVB 1JN6B 3S36L 3U9UB 1XGTA 4XPTL 3Q3GA 2W59A 1UA6H 4NFCA 3PWLB 4J2XA 1NSNL 4FG6C 2UUDH 4X6EA 1KPVA 3O3EA 5FCUH 2AK4A 3TN0C 3NBNA 3MRNB 3V7MA 4DZBA 3QEQA 3C6SA 3QFDA 2AERT 2WBJD 3L5HA 2NTSP 1E4XI 2D7OA 1BECA 2HFEB 2I27N 4E42B 1IGJA 1I7ZA 2V9TA 1A1NA 5JMOC 2NY3B 4JY6A 4UNTA 4U6HB 4M1GL 4KQ3L 4U4BA 2J4WH 4HIIA 5C6TL 4U1KA 1IM3A 3ZE1E 1ZLSH 5CILH 4UNUA 4NZDA 3LS5H 3H8NA 1UYWH 2ESVB 3HZYB 1KN2L 4BFIB 1EZVY 3NFNA 2C3GA 3BPOB 4LSSL 4NRXA 3W39A 4DKAA 4ZXBA 5ALCH 5IB5B 4NNXB 3U36A 1MJUL 3I6LD 4KKAC 2V9QA 4PB9H 5BRZE 3MYZA 4XWOC 1KCRL 4HX1B 5GS2D 5IP4A 5DJYB 3V6FA 3WNPA 4RFEB 4KK8C 3IDGA 1S3KL 4JQVC 3C6LB 5JW4N 3RWCB 4WNQB 2K9UA 4OB5H 1BQHB 4OGXH 4M1CD 2NTFA 4PJHF 3IT8D 2EXYD 1CLYL 1KTRL 1JZ8A 2C3HA 3SDYL 1EHXA 1V3LA 2CJUH 4FQLL 4PJ8A 4M1DL 5CAYB 1ZA6B 2DQIL 2IFGA 3V4VH 5L0QB 2SEBB 2DTML 1J7VR 4NM4H 3RVVD 5EUKB 1CGYA 1CN4A 3MRCB 4M5ZH 4WRLA 5EU4A 4UUJA 3BZFB 3MJ9H 3S8WA 2X4NB 4I3SL 3K4ZA 2R56L 1DR9A 4PRIE 1KLFA 1CLZH 4L8DA 3FQNA 2DOCA 5EBGA 2C1PA 3OXSB 1I7UA 5EU3A 3FAWA 4FMKA 3DVNB 3JVGC 3HRPA 4NKIL 3O0RL 1B4JH 3ECBA 2CLRB 1MRCL 3N1MC 2JELL 4Z0BH 2VXVL 4PJ7F 3AGVA 3GHEH 3K8KA 1F3DJ 1MJJA 3NOIA 1T7WA 1AP2B 3EFDH 2OR8A 5IBLC 1E27B 4XXDB 5IQ9B 1KNOB 3TBVB 2F74B 1OPGH 4JQVA 4PLKD 4U6YB 4BSWA 1TMCB 1IAKB 3TO2A 1CDGA 4ODVL 1FJ1B 4L3CA 3QG6B 3PWLA 4HUKB 5GSVB 4PV9B 5IJKC 4YHKL 4KHTL 4NKIH 3S3PA 1G9EA 3HI1B 5IF0A 2PNDA 1RURH 1TQBC 3Q6GH 4X5LA 3TN0A 5BW7A 3GO1L 3AREC 4XAKE 1IAKA 4NP4H 3RGVA 1CFQA 3OGCA 2LU3A 3B6SA 3N1QC 2HT3C 4AZ8A 3MUY1 4NQCD 3CH8A 3V0VB 1NGQL 4HGMA 5E2VH 4GRWE 1G0YR 5J06A 3AY4C 2X4RB 3UDWC 3QA3A 4HGWA 5DHVH 3ULUL 1E4KA 4U6TA 3GMLB 5TF0A 5E2JA 4OZHA 5T3ZE 2IMNA 3V9FA 4HAGA 4QHKJ 5SWSD 3HI1A 4XPAL 4FQ2L 2NY4B 1K6QL 1A7PH 1WBXB 2BOBA 3ZYJA 3RNQB 4Z95L 4OF0A 4NWUL 1E6OH 3QNYA 1RPQA 2MPAL 4OSUL 4EXPX 2Z35A 2OCFD 2NZ9C 3G04B 4GKSA 4OZFA 4DGYL 5ICYB 1JF6A 2AXHA 4XX1E 4QHLB 3U9UA 4ZTOL 4MXVE 1A5FL 4IRJB 4D0CB 4L3EB 3C5SA 1A1MA 3H9ZA 3DURB 43CAA 4ZAKB 5MERB 1S5IL 4HV8B 4NC2B 1C5BL 4PGBA 1OPGL 3LKPB 5DC9B 2HVJA 1S7WA 2JB5H 5JPNA 4H0IA 1IAMA 3SE4C 4UTAL 43C9B 4Y2DC 2CDEA 4I4WB 4O58H 1T1WB 4XC1L 4HUVA 5I8KL 3P77A 3MLYH 4NQEE 2WBJB 3OKOA 2VXVH 3MJ7A 3ZTJH 4WVRA 5I2IB 2B1AL 2QKIA 2O5YL 1AIFA 5CEZH 5DI8A 1BVKB 1MIEH 2BRRH 5DMKB 3D87B 1H5BC 3VFWA 2G60L 3TT3L 2AK1L 4XB8A 5CZVH 5C6PB 5E7FA 3HNSH 3OKLA 4MX7B 3OJMB 2A6JA 2JJSA 1S7WB 1T0MA 3JV6A 4WTXA 4TSBL 1PBYA 1NC2B 1BVKA 4IOSD 3ULUE 1PZ5B 1OP5H 1A7RH 2G2RB 4CN6A 2OJZH 3GSOB 1JE6A 3NCJH 1W72B 1DSFH 5I71C 2NXYD 2E5EA 1NMAH 4YHPB 1FIGL 3BP5B 3TJEL 1LK3L 2HRLA 4QXUH 5E8OA 5IBTL 2ADIB 1ZGLM 1I1AD 2X6MA 3PHSA 4URTB 1RJYB 4G6AD 2ICWJ 5I1CH 4P4KC 2FATL 3B3IB 1KSRA 1KPRB 3FQTB 4K8RH 1G7HB 3MV8A 5GJSL 4O9HL 4DWHA 3PG2A 2XKNB 2VLRB 5CZVL 1FAIH 2OJEB 3MLPA 3VG0H 4PB9L 3LZFL 1UA6L 4G9DB 1V7NH 1KXQE 1RK0B 4X6CA 5LAXA 5DF0A 3BHBA 3MV8D 3QCVH 1QNZL 5F89A 1HSBB 3K2UH 3BRFA 2XPGA 5IMKB 2EZ0C 3QUKB 4D0DB 1YEEH 4NKMA 3SGKC 1SVCP 4P57A 5FYKH 4PGJA 1XR8A 1SHMA 3HAEA 4LSUL 3S5LB 1UQSA 1YY8A 4XPBL 4TUJB 2XN9D 3MLVL 3TBWB 4MAYC 1VERA 1ZANL 4D9RD 4Y5YC 1LO2H 3OSKA 4RCAA 4OBSA 1MLBB 1S5IH 4K3HA 2YWYA 1JL8A 1G7LA 1VFOA 3AMKA 2V2WB 1QR1A 3LZFH 3RBSA 1J88A 5HDBF 1RZIB 4HS3A 4I18A 2GJ6A 3QRFM 4NQVA 5CSBA 1V7ML 4YHOL 4R8WL 2Y07L 1MREH 1IQDA 3LKRB 4NCC2 5EWIH 1HH9A 5CEZL 4FQ2H 5CSGA 2VXQL 4YHNB 4HEME 1SQ2N 4GG6E 2B1HH 2D31B 2DLTA 2EDXA 3ULSA 4PJEB 4PFEA 1SMAA 4G8IA 3CD4A 4J4PA 5DEFA 4RAVA 3P30H 1QEWA 4JRXD 3BZEB 4CMMA 1YEGL 4L8DB 4NZTH 2X9WA 5EOQH 2J88H 2Q6WA 4P2OB 3RZCA 2NCMA 4KDTC 2YK1H 2W9EL 3RKPA 4KDVA 2YC1B 4XP9H 4X8XA 2XTJB 1QBMH 2A6IA 3QJHB 3LV3A 4NIKB 2BSED 5D7JC 4PUBL 3RL2B 1HILA 1BFSA 3ARFC 2GSGB 4H8WC 4EUPG 2VABB 1CU4H 1M1SA 1IEHA 1S7SB 3L95B 4Q9CA 4OFPA 5KS9B 4H1LG 3QH3A 1OAQL 4M02A 3WNLA 3IFLH 3EJZC 4ZSOB 1JZ7A 1UB5A 3DWTA 2FCBA 4X5WA 2ADIA 4QTHB 3SEPA 5I1LB 4HUXB 1IT9H 1F00I 5ID1A 2ZKHL 5GSVA 1BFTA 3S4SA 2J8OA 3MLUL 3PUCA 4DVBB 3SQBA 5C0JA 3PE9A 5IG7A 2Z4QB 4HJGA 2MQCA 3QO1B 4QEGA 1I9JH 2Y7QA 2OR9L 3BQUB 3L3IB 5C0DA 1NGPH 3C09B 5C3LD 4BFIA 3QXDA 5GS3A 5D2NE 5LG1A 1MFCH 5I1GH 3QEUA 1FG2A 4K7PY 3DSFL 3I6KB 2AKRB 5DEZA 2YA2A 4R8WH 4W70A 5T5NF 4LLMB 4IRSB 4R90H 2YXMA 2VWEE 4I48A 5HI3C 1OT1A 1CK0L 5DYOB 3QUXD 1FL6B 3X3GH 3HG1A 3BESR 2NZ9D 4DGVH 1A7NL 4OZGB 3SE8H 4NM4L 5EOQL 5C0FA 3DUSA 2WUBL 3JBG7 5D72H 3SY0B 4LOUC 3VXUA 4Z7VA 4LOUD 2DQJL 4XI5D 3OKMB 1CD1B 3DYPA 3WUWA 4C83A 3MREB 1GZPA 1DQML 4HH8A 3PL6D 5D7JB 4LEOB 1A6WH 5A43C 2APFA 4KK6D 3BUYB 3AS3A 4ZOEA 3WNOA 4ZFGH 3ME0A 3S3SA 3ULUC 3OWEA 5D1ZB 1A6UL 5DJAA 3T1FA 3FZUD 4U1NB 5BZWB 1UEMA 3VD3A 2VWEC 4K3DL 1YN7B 3TA3C 1AKJD 3P4MB 2OZ4A 5EUOF 2X2YA 3UDWA 4QF1A 3ZKQD 2BRQA 2DLHA 3QQ4A 1Q0XL 4G42A 4G9DA 3G5ZA 1EERB 5DJCB 5SX4H 5HHOB 3UYOD 3U36B 2ICEB 1UG9A 3IS1X 3QPQC 4JREC 3EAKA 3RGVC 5DFVC 4LSRL 5EBWB 2JK5B 4NQEB 5D1QD 4IJ3B 1H8SA 1NMAL 4N0YH 2VXSL 4PV9A 5B38G 1JZ4A 1S9YA 3GSNB 5E1HB 1QG3A 3A6BL 4XNMB 3MOAL 3NGBB 4GMSH 4L4TA 1HWGB 4NJAL 3AY4A 5F72S 3UAJD 4OCWL 5HI3D 3WN5C 3O8XC 1EAPA 1TJHL 4TUOB 5K9OA 3CFKB 2PCPA 1ACYL 1NL0H 5C07A 3U0WH 1ORSB 5GGRB 2ICWI 1IGFL 2IH3B 2N7AA 4PRDB 2NW2A 5KSAB 1WZKA 3TPUA 3B8YA 1G6RH 1LE5A 3REWB 4I0PC 5GS1C 1PYWA 2DLFL 1T22A 1BZ7A 5B3JF 2LABA 4E41B 1EGJL 3I84A 4XH2A 3MCLL 2V7HB 5D1XC 5EZOH 3EOTL 4F7PB 5BQ7A 1F4WL 3TJEH 3VXQB 1JHLH 3L3HB 1DQDL 4YWGH 2FJHB 1HNGA 1TXKA 5KSAA 4OV5A 1OAYH 2OQJA 1CK0H 2VDNL 2BVOB 4MDJA 3V4PH 3TYGL 4AENB 5I76A 3B2UC 5T3XE 1LWRA 3MRKB 4ONFH 5D6CA 4IRZL 1GGBH 1VGKB 4M5YL 5GISL 4P4KB 2NTFB 1DEDA 2XNAA 4JPVL 5DVLA 4RGOL 1DN0B 5JMRA 1IGTA 4HIXL 4P9HL 3G5VB 1CI5A 4CU6A 1MNUL 5HYQA 5DK3A 1RMFL 1OP3K 3D2UD 5CJ5A 4B53A 1A6WL 3FOLB 4PJIA 1UVQB 3B2VL 4NWTL 2XQBL 1FCGA 1YJDL 3NTCL 9CGTA 4LHUG 1WEJH 1T0NA 5TPWL 3MOQA 1NBZB 5HDQH 3H9HB 3RJQB 2I9TB 5GXBB 4NRYB 5DT1L 5FDWA 4PRHB 5FUOL 5F7YC 5AZEH 1KEMH 4KKLC 4ETYA 1CT8B 4HKBB 2VL5B 2YWZA 1GHFH 5IOPB 1T0PB 3I02A 3CDYA 2EDYA 2YEZA 2BY1A 4FZ8L 2V17L 5EN2B 1B3JA 3OB0H 1JGLL 3C6SB 1ZS8B 1KB5L 3VWJA 3LKSB 3MOBH 4LLDA 5GGQL 3ULVF 1AFVL 3B9KA 5KANI 5HYJB 4AYFA 5FB8A 4HGKC 1A1NB 5ITBL 4HG4K 2BVYA 4U33A 3DETD 3PABA 3RVVC 2ZKHH 3FQRA 2AJVH 3D85B 4KTYA 4DCQB 3QEHB 35C8L 5D2NA 1FRGH 4RSVA 3BKJH 4QGYA 5T1KB 3IU3A 3B9KC 2AJSH 1X4YA 1N6VA 3TIEA 2WUCH 1RQ5A 2APWA 3AREB 1KLGA 4NO5A 4ZUUB 3E6FB 1W2KT 2YXFA 3MQIA 2VLLA 1KEGH 5C09E 1UM4H 3T77A 4KQ4L 3OGOE 1N8ZA 2CO6B 3A6OA 4QT5A 5I15L 1CFTA 3KLSA 1CGUA 5DHYA 1YEJL 3LAFA 4YIQB 1LEGB 4KI5C 2EKJA 4HLJA 3T3PF 4JDVB 1QBAA 3BO8B 1LO5A 4M03A 5JXED 5IM7A 1SBSL 3C9NA 2Q7NA 5DURB 4R4FH 3F12A 2P46B 4LVHB 3VI3E 4O5LL 2IPTH 5J4MA 2IPKB 1RURL 1IGCH 1PGRB 1KPUA 3VI3F 3MUGA 2E7HA 4R4ND 1I7RB 2BCKB 2V5MA 4L1HA 2EYRA 5IW3A 1ZHNA 3BI9X 2OLDA 1OGAB 1X5FA 2DQIH 2WBKA 3KAAA 3GI8H 1RZJH 2G75A 5HPMA 3MRMB 1LP9E 4IOFC 4KV5F 4CW1B 5CGYC 1KPUB 2D31A 5I66A 5EOCL 2KPNA 4L3EE 4XP5L 1BFVH 3UYPA 2AK4E 1U8MB 1O7VA 4WENB 4HFWA 4LHUB 2GYSA 4MJIA 5LCVL 5D2LE 1MVFA 5I73C 1JWUB 4OLYH 4OD3H 4M6NL 3UTZA 1MFAH 1KIQA 1MAJA 1R3KB 2AEQH 1I85C 1XIWA 5D2LF 5E9DE 4A6YH 2KQNA 3VWJB 1NEZG 1TIUA 1WBZB 1IQWL 5EO1B 4CUCA 4NJ9L 5JZ7C 2GSGA 1U3HD 4M6OH 3F6IA 4EJ1C 4Z18A 2ZUSA 2XT1B 5J89A 3R4DA 4GG6A 1MCIA 3WE6A 2VLKA 5BRZD 5AG9A 4UNVA 1FDLH 3KR3H 4R0LA 1ZGLP 3SKOB 3O3BA 3O3EB 5KSBF 1N5AB 4HDIA 3VXRA 4QOKB 5C08A 2EDDA 3TBTB 4OKVB 1JN6A 1Q94B 3EOTH 4LIQH 3VFOA 3CXDL 2RAMA 3NPSB 4JHWH 2ZUQB 3G5XA 3RZCD 3TFKC 5FO8B 1WF5A 3C60D 1A3QA 4O51B 4CVZB 1RVFL 4K3DH 4PRDA 4GAGL 4X5XB 1IL1B 1M05A 4CADA 2MCG1 5IROA 1I7ZB 5KVDL 4AL8L 2M8XA 1CYGA 3U7WL 4PJFB 3NFSL 1TJIL 3OPZH 1Z0MA 3QUXC 2XN9E 3QDJD 3QUZD 4HIIB 1HOCB 3JV4A 4Q9RH 4H8WL 4I18C 4XZUB 4PYGA 4FQCL 5T3XD 4OZHF 2QQNL 3DUSB 1BMGA 4GBXD 1P6FA 1SJXA 3QULA 3HE7B 4XHJC 5EO9A 5J9PB 5EOCH 1E4XH 4HUUA 5H37H 4GG6F 4M43L 1G84A 3GSUA 3MGTA 2XACC 3P2TA 4J4PC 2R1XA 3BGMB 1TETL 4QHLA 3CSYA 4AENA 4JFDB 2R23A 4EI5A 3STZA 3TZVC 4PP1D 1CFVL 4UBDD 4LL9A 2CDFA 2UWEF 5FYJD 4P23C 4ODHL 4MX7A 3PV7A 1L6XA 1YEIH 4WHYG 1MHHB 2XICA 2R69H 5EDXA 3IFOA 1Q0YH 2VB5A 2MKWA 3K81A 5FGSA 2QQQA 5IFAL 1OAKH 4W81A 4B5EA 1LDPH 4MA3B 4Y1AA 2BC4A 1RSFA 4KZDL 1BQUA 1NGPL 4F80A 3NCBB 3RWDA 2FX8H 1HKLL 2PO6A 1SBSH 3HC3H 3LEYL 1HHHB 1Q9OA 2BOCA 4XHJD 2B4CH 1BZ9A 3HC4L 4BFBD 1JTTA 1FNEA 4ZXBD 4P59H 3RDTA 3T0EC 4QRTA 3S6CA 3V0WH 2VMFA 5J1AB 2LV4A 1HE7A 4PG9A 4X98B 4XNZC 4X8JB 3VRIB 4BUHA 5JTWA 4UBDC 4HWEL 2YD5A 3GSNA 1XZ0B 3HPJB 1ZHKA 5DO2C 4PRAA 3K2MC 2DL9A 1OD7A 2R1WB 2HVKB 2VUOA 4LGSB 4LCWA 3UTTD 3WFEH 5AWNH 3TO2B 1H0DA 3OHXA 5IIEB 5I8CB 1UM5L 1YUHA 2HT4D 2NYYD 5A2IH 3IVKA 4YR6A 3GJEA 1T04B 1SVZA 3QP3A 1KNOA 4XCFL 3TBVA 4MA1B 5IJVB 3SDCD 4M4PA 4O2FA 3IDGB 4POZC 3DRQA 3I2CH 1MEXH 2VXTL 2YKLH 4TTGA 3D25A 1U8HA 1ZK9A 1XT5A 3MUZ1 5FA4B 2M2DA 2FJHA 3FN0L 3T4AB 4AMKL 4PJIF 3KLAB 4JKKA 1WVZA 4P23B 5ITBH 3KHOA 4RWYL 4GS7B 3KWWA 2VZ1A 4HKJA 1CD9B 1DUYB 3V95A 2NY1B 3RAJH 3QIBB 4HS3B 4OGYL 1AGEA 4KJWC 5CGTA 4NN7C 3MNWB 1EA9C 5BVPL 4UUJB 2YD9A 1QVOA 3QZWG 1BEYL 4XCFH 1FNFA 2QSQA 2D3VA 3E0GA 1T21A 3HG1B 3FRPA 5CCKL 2CUIA 4GBXB 1KJ2B 3G5VA 3NH7L 4JRWA 1GCFA 4R96A 1C12A 3TH3T 2FATH 1YYLL 2GEEA 4YHLL 4NZJA 4NKQB 4BH8A 5C0RL 5TGBA 1ZSDA 2H45A 4RZCA 1E4KC 3VWKD 1F4YH 2GFBB 5DEFB 4ZMAT 5DD6B 4LSDA 3O45A 5HVWA 1PG7W 4KVNL 5E2WL 1ZEAH 4JO4L 4LPXA 2PXYC 4DKEL 4YAQA 2F53E 3OKNA 1VGEL 2ZSWA 1ZVYA 2GKIA 4MAYA 4X9HA 2C1OA 3RRQA 4YDIL 5IF0B 4XH2B 3P4MA 3DGGB 2BY0A 2HLFD 3ULUF 5B22A 3EOBB 3ZSSA 2E7CA 3EJYC 5DQDH 1IC7L 3D0VB 2YD1A 3M1BA 4X5WB 4NDMA 5DD1H 5C92A 4GAJL 5A16A 2W07A 1R3LA 5CSZA 3H2WA 4PJAA 2E7LC 2ATPB 3D2UA 3V4VL 4ZYKB 4BH8B 3RX7A 1OGAE 2P5WB 1AQKL 3MRKA 3J7HA 2HKFL 3GEWB 3CFEA 1KCSL 3BPLB 3WEXA 4Z78B 2ZUYA 5JA8B 2A77L 3H42H 1IC4L 4XI5C 5FB8B 4WI6A 5EB9A 3S5LG 3ZE0F 2RCSL 3GJFK 3MV01 3QPXL 2NR6D 4AIZA 5JIHA 4WDIA 1P4LA 5DXWA 3TEUA 3WHXA 3D9AL 1KIRA 5FYLE 3OQ3B 2AQ1A 2DLFH 1RHHB 1RUPH 3DGGA 2A6DB 2WSKA 4YXLL 3ZT7A 5DD5L 4GG8B 4J8RB 4ZTPL 1LO4H 2P8PB 2FWOB 3TBYA 4MB5A 3BQUC 3ILPA 3ZTNH 3MBXH 3VXSE 4S0SD 3UJJH 5DTFA 1R5VB 1EHLL 4XAWH 1BJ1H 1KLGB 5SWSB 3FO9A 4NOBA 2R2HB 2B2XL 2A6DA 3T3MF 2DKSA 4FNLH 5ITFA 3ARTA 4QOKD 5IB2B 1QFUH 3AS0A 3O3DB 5E4IA 5I73B 1ZGLA 1JHTA 5B38A 1BOGA 4M9PA 3FCTB 5C0AE 4LRNL 1FSKB 1NBVH 3TPKA 3WLWD 1PW3A 1G7MB 4AH2A 4M3KB 4L8CA 1HXYB 5EFIB 1RJCA 4RGNB 3IXAB 5CJQH 3QISA 5DUMH 1KJVA 4GKNA 3WNKA 3PHOA 5HI4C 5EZLB 5BS0D 3QFJA 4X98A 4POYA 3VFRA 3U9PL 2FBJL 2YBRB 5ANMB 5D5MB 5DVNA 2G60H 3H0TB 4OZ4B 2DL2A 4LNVA 3GHBL 4X4XB 4OZHE 4Y16B 4FABL 1ETZA 4OM0L 1XF5B 4PJHB 2AV7B 2DM2A 2NY1C 4Y8DC 2YD4A 1TITA 3RUGE 3EYVA 3PWPB 3BP7B 5IR1B 5F7MC 2H26B 3VXTA 1NUFA 3D69A 3KJ4C 5HPMB 4F8QA 3D39A 4BYHA 1F90L 1JFQH 3TIEB 2FYYA 1G7HA 1XF2B 4C56E 2VLRE 3CFKA 2GSIA 4LLVA 5CUSL 4APQB 3KYOB 3W0WA 8CGTA 4PTUB 3MOBL 1NCTA 1SJEA 3CC5B 3KPQB 5I1EH 1LE9A 4XNYH 3DX7B 1GOGA 1YY9C 5ALBH 1NFDB 3QUYA 1J1XL 4MGXA 3F7YA 1QLFA 2VZSA 1TQBB 3CX5J 4BZ2L 3STBA 3EYFA 3JUYA 2A38A 6FABL 2CH8A 2WP3O 3CCHB 3VFGH 1KACB 2NY3D 3C5ZA 5E9DA 3PWJA 1U93A 5GGSB 3S88H 1TDQA 5H37G 1M4KA 2UVFA 4R4BA 4MDJB 2BSTA 2GITA 1ED3A 3S97C 5HPOA 2J8UF 3S4SG 1INEH 4CVZA 3V0WL 2J1KA 3M17A 5K9QI 2JJWA 4V1DB 5DVMA 5IEHB 3UO1H 2Y25A 3B9EA 5KVGH 3VFPA 3X12B 5JXAH 4JCMA 3DECA 4EI6B 4UIMB 4FFVD 3VXOA 4DN4H 3DXAD 1FZOB 4A2LA 1XF1A 1UB5B 4X99A 3RL1A 5IVZA 4L4VD 3QCTL 1F8TH 3EYQD 5JW5A 3MRQA