1P5VB

X-ray structure of the caf1m:caf1 chaperone:subunit preassembly complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
136
structure length
136
Chain Sequence
VEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone, structural protein
molecule keywords Chaperone protein Caf1M
publication title Structure and Biogenesis of the Capsular F1 Antigen from Yersinia pestis. Preserved Folding Energy Drives Fiber Formation
pubmed doi rcsb
source organism Yersinia pestis
total genus 26
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1p5vB00
3DOSB 3DSNB 4AYFB 1P5UB 1P5VB 1Z9SB 3DPBB 4AZ8B 4B0MB 1P5UC
chains in the Genus database with same CATH superfamily
2YD9A 2PETA 3PAZA 1FFNB 4QOKB 4PGEB 4BKTC 1IGCL 2BM3A 3QO0A 5FKAA 2RQEA 3MGOA 1K3IA 1E4KA 2ZCHL 4PS8A 4K7FA 3Q9QA 3SDXB 5C0EB 4GJTB 3T0EE 1JN6B 2BY1A 3TV3H 3MV7E 5FYLH 3QC6X 2XNAB 4JS7A 5DZNA 4CJ1A 2A77L 3HPJB 4K5LA 4MYPA 3KWWB 1R3KA 5H37A 1CXHA 1B4JH 3BQUA 1MW0A 3C9NB 1HHIB 4S0TD 2IQ9L 4G80B 4J1UA 2FWOB 3HE7D 4WI7A 4ZSOE 1ZA6A 1UM6H 1OCOB 2X6BA 4ZMNA 4PRNA 3T2LA 3GUTB 4YSCA 2FLMA 3LAFA 3OR7A 1G4MA 3CQFA 2ICWI 4D0BA 2QVKA 2EYTA 5JZ7D 4FG2A 5JOPD 1OF2B 3D25A 4YN3A 3BDBA 1AGEB 3VGAB 1KNOB 4HETA 4IRZL 3HBGA 4R5VA 5FYLE 2C1PA 1NMBL 5D7LD 2XJLA 5DEGA 5DVKA 5B1JA 1E27B 3ZDXE 4PBVC 4YHNA 1OHZA 1SQMA 2ITCA 4S1QL 1PEWA 3S5ZA 1ORQA 1BZ7A 5SWQB 2EQDA 3LH2L 3OKEA 3QI9D 3F05A 2NX5E 2ISDA 4WEMB 1UJ3A 4JFFB 5EORH 3KHQA 3T8XB 1BCIA 5IBUB 4BSWB 1SMOA 3MRLA 3WNKA 3P4LA 2H6PA 1P7QB 4KC3B 3WD5H 1RI8A 4GW1A 4TSBH 4PJXE 5D1QE 4LZKA 4M3KB 2PP7A 4UOQA 1GMEA 3FJTA 1VA9A 3OD3A 3H9SE 3Q8AA 3GRWA 3EOTH 2X4TB 2X9XA 4ZMOA 5GZOA 3REWA 4UIMB 5TE4H 4OIIH 4R7XA 4C56A 3WUWB 2HA1A 3F00A 1IGML 4D7BA 2WNGA 1C5CH 4JFOB 4NOBA 2VL5A 5K33A 3A24A 4Y5XA 3QNXA 1XZ0B 5DD0H 5CLWA 3MR9A 4S10A 4XZUB 4ANXA 3MRBB 4RETB 5F97E 2G30A 2C4FT 1PW3A 1WGOA 4G7QB 1QI4A 3NZHL 1ND0B 3S97C 1UWGH 1E50A 4JRYA 2X09A 4NENA 4YHZH 5C9JB 1M57B 1XL4A 1KLFA 1JGDB 3GIVA 5I0XA 1QSEB 5IEKA 3S4SG 3CDGB 4UBDD 5FA3A 3V7AG 1UVQA 1JZHA 2WUCH 1E8WA 2H3NA 1ZHNB 3L3KB 4KVPA 5CD5C 4MXQD 3DI2B 3G5XA 4EN2A 4LBEA 2C9UA 3IMVA 3ZHKA 2X3AA 5MERA 2G2RB 4KTEL 5GGSY 4M8RA 2BZDA 4UDTB 1NMAL 1JZ5A 1K8IA 4X0NA 4NKQB 1GGUA 4LK4A 2EDQA 2IDSA 1O6SA 3SODB 4ZNEA 5KVDH 3BD5A 2CHZA 2OYKA 5IJKC 3NSYA 5MHSE 1WD9A 1GJWA 1IGCH 2VL4A 3MJGX 1RCYA 1FGNL 4LSUL 4OM0L 3WNJA 4XVSL 2VJ8A 4JM2B 1KTBA 5C0BE 2OZNA 1DVZA 2MSPA 3DYPA 4G8IB 4WWID 1V3JA 2ZCHH 3ARUA 4U7KA 1TR7A 3QUKA 2GHWB 4MJ6B 1G9ML 2A77H 4WTWA 3WKNA 3BX7C 4LOEA 1XR8B 3CSBA 5D6DC 4ZI8A 2EE9A 4DCQA 3BC9A 2HP4A 3GGWB 3L3OC 3FFCA 4ODBD 1FV1B 3NYKA 1A5FL 4LLYA 1BYOA 5HHOE 5ITFA 5JNYA 2W07A 1AZZC 4DPRA 4KJPC 4IU3A 3O11A 2HZHA 3ZLQC 1OO2A 1NA8A 3HAEB 5DEZA 5EO0B 3P9WB 5J3HD 3FT1A 3U2IA 2IF7A 4IRZH 5IEHA 3VJ6A 1EJ6A 1KCKA 2ZYIA 3EBHA 3QAQA 3VXQB 1EVTC 1YMMA 5D7JD 3CQPA 2D31A 1IFGA 3CVHB 4ZQTA 2XG5B 5DXWA 5FLUA 3ABLB 3EIFA 3ISWA 3QT2A 3MJ8B 5LAXB 1A7NL 3UTTE 3TYFA 1XF4B 3ABGA 2NXZB 4QAWA 2PTVA 2AS5M 4D0DB 3QCVL 1ZJBA 4P23A 3L1FA 2F7QA 3ARWA 1Z6JT 3JWOH 4XXWA 4IRJC 1CBJA 1MCHA 3QZWB 1GCYA 2ED7A 5E70A 3CH1B 4OCYL 4KZDL 5F7FA 3QDJD 4YLQT 1MJJA 5I73C 3L17A 2EDOA 3PGCB 4RMTA 4MTMA 1IGMH 3GMNB 4QHUA 3UEZA 2YAOA 5J1SC 3BH9B 3G5VA 3APMA 3QUMB 5MEQB 4NRXA 2ITDB 4ELMF 1BVKA 3U4EB 1T1WB 4XP1L 3OVUB 1TEGA 2C9XA 1G6RL 2BNRD 4M6NL 1PY9A 1C5BL 1G7JA 2N4IA 3VQMA 3MROA 5I9QC 4IJ3C 3FMGL 3ABKB 2DF3A 4P5KB 3WS6C 4HWZB 1IGTA 3QZWG 4WKZB 4L37B 5K9QI 4QY8B 1CLVA 1T4WA 3II3A 4LHUD 4WO4C 1DFXA 5ANMA 2CKBL 2FDBP 3BEWA 5ACLA 1JXKA 4LRNL 1QBAA 2WAHA 4S1SL 5IHWA 2ZCKL 4MS6A 2RIKA 3QJUB 4P07A 4H26B 4K9EC 1NCBH 5HDLA 1VLXA 5SWZB 1NSNH 3O3DA 3Q6GH 5TTRA 4KTEH 1GW0A 4KROB 2R0LL 4KMQA 2BHUA 3DRTA 1SXSA 5ENWA 5MI0B 1I8AA 2OJEA 1H3XA 3KPSE 3IVKA 1KPRA 4GKZB 4LSUH 1FGNH 1GYVA 5TDNA 3BVTA 4XVSH 4XBMA 2WTPA 3WMPA 3OMAB 2YD5A 1HHHB 2XBDA 4UT6A 5DO2C 2OMVB 2YQBA 2WXLA 4PRPA 1FFQA 4ODVH 3N43B 1G9MH 2VWEC 5D4HA 1FO0B 2NTFA 2ILLA 2OULB 3AUWB 5I17B 3MV9A 5L8JB 2LFEA 1R3LA 2YUXA 1GGBL 2AQ1A 4WW2A 1XB8A 1G6VK 2RBLA 1J1XH 5GGRY 1MG2C 5E8NA 2X0UA 1JE6A 3BPOB 3IU3A 3T3MB 1A5FH 4QWWC 5EU3B 4PD4K 4BFKA 2ZUYA 1RZJC 4FNRA 4B5EA 4Z95L 3P3SA 4LOVA 5IHBA 5JO5A 1GIGL 3DGDA 3KYMA 3LX9A 1W8OA 2WZ0A 2FUTA 4C47A 2EIZB 2ZG3A 4MMZA 3VYOA 3ZGIA 1G9NC 3L54A 5I1EL 2VRKA 2K3TA 1KYDA 1PIFA 1QWUA 1B88A 2AZUA 2BSSB 2FQGA 3ATFA 2V33A 4BSJA 3T04D 1A7NH 3ET9F 1XF2B 4F2MB 1CMOA 3PF2A 2VGLM 3WJMB 1FFRA 5SX4I 3K8KA 2A6IB 3B83A 3QCVH 3UPCA 3QISA 2EIBA 3MMEA 1UXLA 2FYYA 2NY5C 3QXDB 4M8UA 4MZIA 3K4ZA 3MLYL 2H41A 3MCKB 2A38A 1BAFL 4GAFB 1I9IL 3B1UA 1PG7W 4MX7A 5E6RB 4RWYL 3CTTA 2WCPA 1CICB 3SPHA 3RTQB 5CN3A 2DL9A 3ML9A 5HJ3B 5KVFL 4G8GE 2H6UA 4GW4A 1YEEL 1JCVA 2WINB 1SUHA 2AXHA 4W9FC 3JV6A 3C5ZA 4MJ5A 3UDWA 3ES6B 4GKLA 4M6NH 4FQLL 3SO3B 1C5BH 3TBSA 3WN5B 2WO2B 1IGJA 5HYQA 5JPNB 1JV5A 1J9SA 3BHBB 1U3HD 4N2KA 3FUNA 4KZEL 3HCVA 3KLQA 3QQ4B 4PJ5D 2CKBH 2WXJA 4LRNH 2JSFA 4DN3L 2PABA 4S1SH 5DJ6B 1DEEA 4NJAL 4PLOB 4EI5C 4XCNB 2VQ1B 3G6JB 4NO3B 4BZ1H 1KJVB 4DGWC 2CCWA 3LV3A 3KNBB 3CIAA 3MGTB 3LH9A 4E41A 3CZGA 4HJTA 3NUKA 3ZIYA 3KL3A 4HZLB 1V54B 5ICXB 2E9IA 5CLXA 3FT9A 1N5YL 2WLHA 4KKAC 2VM3A 3PL6C 1QACA 2AXGB 1SDYA 4L8SA 3TEXA 3KYNB 4XODA 3I9GH 1QTPA 4LPXA 3INUL 4PRDB 1MQKL 1ED3B 5DK2A 1OSEA 3MLRL 2CDEA 3FOMB 2PO6D 2EUVA 5E8EA 2FD6H 3TNNA 2AK4B 2ICWJ 1ADWA 1OTTD 1VERA 1XQ4A 4HOMA 2EO9A 3FQUB 3H9YA 1A9EA 2W9DL 5J11C 3UYRH 1SEBA 3ME0A 2YSTA 1AXSB 1XTMA 4R5TA 4CC1A 2FJFB 4U1GC 4NZDA 3UTQB 1KXHA 1NBVL 5DFVD 2NT0A 1SN0A 3WTXA 1P1ZB 1PZBA 4Z95H 5CZXC 4XO3A 4Y1AD 2OTWB 3GKWL 4J6RL 1WFOA 5KSAD 3LNGA 3TF4A 1I7UB 4HGWA 3R1GH 3PRZA 5I1EH 4AJVA 1FCGA 4XHJC 2DWYA 2V2XA 1CLZL 4J12A 1K9TA 4XH2A 4YDNA 2VLLA 3POCA 1HDMB 1DBKL 3GM8A 3ILQD 1KZYA 1E28B 1FAKT 4HIEB 5AVVB 4L29B 2PN5A 2IH1B 1HL5A 4I2XB 3LYRA 5DS8A 3GIZH 3RQ3A 3RX5A 1KGUA 3FF7A 4JBSA 4Z76B 4YHIB 3CVDA 4I0PA 4P2RE 3FSOA 4RGNB 3QUZC 3L5WB 4D9RD 2OFQA 1E5AA 2QPFA 3MLYH 4FLRA 2JKXA 1KCUL 4BFRA 4TVPD 1I9IH 3CLEL 3QIUA 2AQPA 1LP9F 2Q76A 1MCWW 5D1XB 4FQQA 1QRNA 1GL4B 4NQCD 2ZYRA 3BAKA 2OXGB 1D5ZA 2KZ1B 5F9JA 3O6LL 3MRDA 5D5MF 1PY4A 5KVFH 5C0IA 4MDJB 2NNAB 1I75A 4N8VA 1PNDA 4RGMC 3OR6A 3BP6A 4F33B 3KWXA 2QELA 3AY2A 3WOVA 1F1DA 4GINA 3OSKA 4JFDE 2PYEA 3FZUD 1E90A 3QUHA 4OZHA 2E59A 2G75A 3VX1A 1T7YA 3CSYA 5F7LB 4TL5A 4I8DA 2R56L 3DUHA 5HI3D 5I1KH 35C8H 5I76A 1QOKA 4LQ1A 2EZ0C 2Q7YA 2PTUA 2Z7UA 2P7TB 3MFFA 4WENB 2IADB 4UV7H 4NJAH 3QZBA 3L95B 5KVFE 4U3XA 4BFBD 5CP3A 1KPVA 3GSNL 5F70A 4GQQA 4Z3IA 1EANA 1CYGA 1RURL 1F8TL 4B9JA 1P4LB 5E99L 3FN9A 1F5WA 1FI8C 2ZICA 3DX7B 1H15A 2R27A 3BLBA 4APQC 3V52L 1N5YH 2QMKA 4Y19E 5AD0B 2EABA 2H8PB 1N6QH 3ZMNA 1ACYH 3L4UA 1DBJL 3RWFA 4PUBH 5CZRA 3E2HC 4QNPE 2Y5EA 1MQKH 3ELAT 1G87A 4Q97A 1P7KA 2JI3A 3RVWC 3DVNA 3T71A 1IKFH 2XZZA 3GTTA 3MLRH 5MEND 3QC5X 1RH8A 3I6GB 4Z7WA 4JFPB 2O5ZH 3JV4B 3P11L 3QRLA 3R4DA 2AXFA 1QFWL 3DVFA 3AG2B 3UBFA 1PZDA 4MAUL 1FC2D 2J21A 4EQ3A 4FMKA 4X9FA 3UTSB 4X98B 1GJUA 5F9DC 3ECBA 3U46B 4CU8A 3MZGB 4YHPA 4WWKA 1INDH 1NBVH 4RMWA 1QX1A 1IEAA 4J7RA 3GHPA 5ID0B 3QE5A 4Y5VB 5FO7B 3GBNL 3N9GL 2OL3L 4AM0Q 4L4VB 3TZVA 2A74A 4LCWA 2Z7ZA 5KZCB 4J6RH 5C2UB 2HFEB 3GSRB 4ZXBA 3S2CA 3EBAA 4L1TA 4M4RB 1WWWX 4KDVA 2H2PC 3O81A 3OGCA 2KZKA 5IB4A 1LK3L 4ZSOB 1CLZH 5KUMA 3IPFA 4LPTA 1OP5K 1WPCA 3TM6A 1DJWA 5IG7A 1YEDA 1UACL 4C56E 4V33A 4PJDE 1F3DH 2YSSB 3KPNB 4E36A 3FUMA 2PYFB 1EEZA 4UT7H 5C7XL 1G7LB 5BVPH 3D2TA 1IM3D 4OKDA 1CDHA 3ZRCC 3CLEH 1ADQA 4MKMA 5BS0D 3FUHA 4JRYE 5E95B 3GSQB 1UXMA 1A4CA 5EZLA 4OZIA 1Z0MA 1FVDA 4QRUA 3STBA 3MODL 3IETA 4LSVL 1PG7X 2QQQA 3D69A 4WJ5B 1AZRA 1Q0YL 1IC5H 4P46B 2CSPA 4QXUL 4JY6B 3MXWL 5HI4D 5TK4A 5JHMA 3IFNL 4PJFF 3A67L 1RVFL 5D1ZD 4AZUA 4OLVL 2JLLA 4N0CC 3LXBA 3V6OA 2KERA 2P5EE 2YUVA 3US9A 4AQ1C 4DKFL 4IBSA 2ZF8A 4B9IA 5CR1A 3UABA 2R69A 2R56H 2WXFA 3Q48A 1WZ1H 1XCTA 2OMXA 2G5BB 3DUSA 2PW2B 2VOTA 2WZ6A 4RFNC 2PR9A 3TPKA 1YEKL 3U25A 2P5WE 5BZZA 5CM1A 3GSNH 4KO5A 3HG3A 4MJIE 3D4ZA 4FFZA 4EOWL 3GWJA 3UAJD 1RURH 4NPYB 5GZND 5HHVL 1KJ2L 2CO6A 1FZOA 1YEFL 1D5BA 2AJZA 3TH4T 5FOJA 1IAKA 2Y5TB 1KYFA 3Q5OA 2XZCH 4MD5A 2OSYA 3BUQA 3TYGL 1MCBA 3WTUA 4NNXA 5B8CA 5F8RC 5EZJB 4WK2B 2HWZL 3SYOA 1I7TA 5KS9F 5DRZB 3TA3B 5D7KE 1QBMH 3CZFA 1QUNB 3APNA 1JRHI 3SDAC 4Y2OA 3P11H 2VKXA 5GS1A 1WFUA 2E75C 4MAUH 4AM0B 4MJ2A 1EMTH 4GAYA 5M94B 1JPEA 1P0SE 1U95B 4RSVA 2E7LC 1NDGB 3NDZE 4B3EA 1BFVL 1U21A 1YMME 4LASL 4MXVE 4P57B 4PJHA 3U9PL 3GBNH 5DD5L 2A4EA 2OL3H 1J0ZA 3ZUCA 4CADA 2BHZA 3NQKA 2EC8A 5EO1A 4OZGE 2COQA 3KVPA 2Q86B 25C8L 3V6ZA 5CIPH 2FX8L 1L7IH 1SHMA 2GB2A 3I75B 1LK3H 1FE8L 3MQIA 4QIRA 3D0AA 1X6NA 4OVUA 4GBXB 3KPPB 4JUSA 2QQKL 5JTWA 5HVFB 4ODTL 4ODWB 4DEPB 3RDTD 1D5MB 2FEJA 3QR0A 5I23A 1UZ6F 3TEYA 5C7XH 5CLZA 4NC1C 5DZVA 5BQ7B 3KLHC 1JK8B 4LOUD 5IHZA 5GSRB 3AG1B 4PS4L 3W56A 4NUMA 4QRPA 4A1RA 3QUXA 1N7ML 2LLNA 2NQDA 4MB1A 3R7RA 3QO1B 2JV6A 3EOAB 4HW6A 3TBBA 1DANT 3RRQA 4B53A 3R0MA 3VH8B 3SKNB 5AOKA 1B6UA 4UMSA 1I8MA 4GS7B 5KYYB 1MRCL 3MODH 3X3GL 4LSVH 4UU9A 4XNBA 3QYMA 4CVUA 3JWDL 4MJJA 4UT6H 3D4YA 1Q0YH 4ZOBA 5DGQA 5CLTA 1GH7A 3HS0A 3O3EA 1I1AB 3MXWH 4QYOA 3IFNH 5TE6L 1OT4A 1MRDL 4I3RH 4NM4L 1PZAA 3QEQB 5EA0L 5F71A 4AW4A 1S3KH 1SN2A 1TJHH 2HG5B 4FFYL 1T3FB 5C0FB 4WUKL 4QOKD 2IALA 4KDWA 3CMOL 3V6ZB 3KPLA 4N25A 1B90A 4N0FA 5F88B 1A6VL 1ZLDA 3L7EB 2KPWA 5INDA 4BEIA 4FGMA 1HZHL 1YEKH 2J8UB 4ONFL 2NDGA 3ILEA 2MMXA 4UCFA 2HPTA 2IBZX 1K5WA 4TNVK 2OCJA 2XC8A 4GRWB 5I6LA 4JO3H 3VXTB 1MFAH 2WBJA 3KCPA 4FQPA 5DS2A 2AK1H 1KJ2H 2YJQA 2MPVA 1J8HB 3B34A 4JB9H 1S4IA 3EFOB 3WAJA 3PP4L 4GSUA 1G43A 3PWJA 4PWKA 3KM1A 2HT4D 3TYGH 3QWNA 3D05A 3KDMB 3L3IB 1NPNA 4M7JL 2HWZH 2IGFL 3CPUA 1U8IA 4XNXH 4Y4HC 1N2RB 4KJYA 2AFNA 3NCYP 1KT2B 3U9UA 3WFCL 3UGEA 3O0RL 4WW1B 5KSUA 3UG5A 2Q20A 1S7SB 4AYSA 3QIWC 2WLYA 3G04B 2WLIA 3LNEA 3Q43A 2WMPA 2ZX6A 1F45A 2AJ3A 3QJOA 4UNUA 1QG3A 3OBAA 5E00B 4W9KC 1WYJA 1AGDA 4JFFD 1BFVH 2V5SA 5HVHC 3WHE1 4LASH 4CNIA 1J0HA 3OJMB 2OZ4A 1VACA 5DR5L 1P7QD 2Z92A 3K46A 4PI2A 2ADFL 2XJKA 4FX5A 1X5GA 4JJ5B 5HGDA 5IJVA 2XICA 25C8H 4G8FB 2ZD0A 2DEYX 1VFBB 3QJFA 2FX8H 4P3DB 4U6TA 4DQOL 2AEIT 1BJ8A 1VFAA 4Z7NF 4N6RA 1FE8H 1EZVX 1AC6A 2SODB 2NSMA 1XD0A 3GI9L 4DK3A 4OI7A 2FTAA 2F53B 4F7CB 1WLHA 2BSRA 3OZLA 1UADC 4ODTH 1IEBA 4S1RL 4PJGA 1HXKA 3ZDZF 3K72B 3QUYC 3BIKB 1Q72L 4XOBA 2ED8A 1BX2B 1N7MH 3QA3A 3SKUD 4KUZL 1PZUB 3A6BH 4MCNA 4YOKA 5IQ7H 5IVZA 4F8LA 3RWIA 5F72S 1QSED 3CHXA 3Q13A 1NPJA 2IAMC 3OMZA 5IR1A 8FABB 3O3AA 2ZOLA 2YZ8A 3X3GH 4AWJC 4H25A 2DQDL 1CPUA 3LQZB 3JWDH 1ZV9A 4J23A 1FC1A 4WHTA 4H8PA 1TTRA 5DZJA 4OUUB 4CRPA 3IPEA 1ILUA 1ZWIB 2NPLX 4NKOB 5TE6H 2WWMD 1MRDH 5EA0H 3NIGF 4FFYH 1ZXKA 3ZT7A 5ALCL 3QQDB 2C9SA 2W59A 3CMOH 4JFEB 5DJYA 4JM2D 1FJ1A 5EBLB 4KXZH 4KO6A 1A6VH 1Q9KA 1FO0L 4B9GA 1KJMB 4EKXA 2V2WA 1NGQL 1TZAA 2DTML 3FTVA 4WU7A 3LN4A 3L2LA 2DQTH 3SPCA 3QG6B 2VERA 1NINA 3RVXC 3TT3L 4JM4L 5A2CA 5IBLC 3HE6A 1DLHA 2G3ZA 5EOCJ 3CDZB 2EDXA 4DP6X 4JO5A 3UACA 1R9FA 1LO0L 3KYKH 5DD3H 2GSGB 3PP4H 4RMRA 4B7IA 2BVOA 4EMZA 2X1XR 3CK0H 3V9CA 3SPVB 2NYZA 3ECQA 1DCLA 2P8MB 4L0PB 4M7JH 4UTCA 2W1NA 4QRRB 4DP1X 2OI9C 4ZMWA 4YVUA 2EDTA 2H1PH 1UB5B 5F0LB 4A2LA 4F7EB 2R2HB 1WV7T 3IMTA 4E9VA 4NQDA 2BY2A 2P49B 1Y6KR 4LXFA 2FUQA 4NZJA 3WFCH 2VDLB 4AL8H 2CGYA 3O0RH 4PI0A 4R4FH 5IMLB 4I5BB 4R9HA 1H5BA 4FQJL 3GLDA 1QEWB 2KMWA 1ZLUK 2A73B 1M7IB 2ZP9A 3VD0A 2VABB 2ZF9A 2JJTA 4M5ZH 1IBHA 1CDIA 2VDRL 3AM8A 3UCRA 3QCTL 4JDVB 4QDGA 4YFDB 4NN7B 2VDKB 1JMZA 2ZQKA 3MUGA 4G9FB 1T83C 1MCCA 5T3ZL 1XF5A 4H1LG 5DR5H 2ZT9C 3FH7A 3ETSA 5DJAA 4KK9D 4NI6A 5AG9A 3EF7A 1DQMH 1YAIA 4PVBA 2DIAA 1A6UH 3PFUA 4R8WL 3MJ9L 2HYMA 3HZMA 2G0LA 3BFWA 3LZLA 4LCUB 5JIDA 5C09D 4GAAA 3L4YA 2Z8VC 2YA1A 2ATKA 3JWNG 1JPSH 1IAOB 5I6OA 3OXSB 2HFFB 3LKRB 4GUPB 1H6UA 4S1RH 4K5NA 4TNGA 3LMJL 5AAMC 4MWFA 1A6AB 1V55B 4LGPB 3RIAK 1Q72H 2XXCB 2JCCF 5EH1A 1NEZA 2QL1A 3GXDA 5CP3H 2NY4B 1YNTB 1S7QA 3C08L 4FQ2L 3RJQB 4BK4A 4DW2H 4KUZH 5K9JL 1CU4H 4NZFA 4RVBA 1T03L 3TN0B 2PYEE 1OE2A 4PCKA 3NVQA 4TQEL 2C3VA 3NN8B 2DQDH 2QSCH 5SWZD 2Y69B 3SGKA 4GKNA 3L4ZA 1Z9MA 3NPZB 5DHVA 4XVJH 1CQKA 4KROD 4NKMA 4HCGA 3H7BA 3QIBC 3AREC 4HKJA 4LFHD 2X6MA 2FE0A 3IS1X 1J9CT 5ALCH 2YXMA 1TEFA 3G5YB 5TF1L 3RGBA 4AUYA 3QQNA 4IW4C 4X5PA 3VI3E 5FOBB 1BGXH 1XIWB 3P73B 1R3JB 4J8QA 5EUOF 5IMMA 5F1NB 1U8JB 3P4OB 1E6OH 5ADPL 3R19A 5C3TA 3NIFF 4KRLB 4F58H 2E8YA 3BWAA 2DTMH 1NKGA 1G4RA 4JFDB 4JJHA 2D73A 1XHHA 2WQAA 5L4MA 4JM4H 3CXHK 5EFIA 1KTDB 5E9AA 1UH2A 4OQ1A 2X4NA 3RWDB 3U7WL 4Z7WE 1U6AH 1MF2H 5AOIA 1RL1A 1VENA 4R7VA 5CSZA 4DQAA 4HJ0C 2CUAA 2HXAA 4WEUD 4XO5A 2Z4TA 3QO0B 5FKAB 1B2WH 4HJ1A 2E47A 1SJMA 4OGQC 3MGOB 1QFOA 5I28A 2KS0A 1YNKH 4KJQD 1A21A 3MBEC 1A65A 4K7FB 1Y6MR 3B1TA 1UOWA 4U2ZA 1ZDSA 3NCCB 1UYWL 2NDFA 2Z8WC 2CUHA 2X4PA 2NTSP 2DIEA 1RPKA 3DGGA 4LCWE 1BVZA 5FO8A 2DL2A 3KYOA 3ULVL 2DM2A 1EDYA 4BINA 2QKIA 5LXGH 1OALA 4OLYH 4RAVA 1R75A 2Y5QA 2A6DB 2ZAIA 3QCTH 3QWQB 4HGKC 4J1UB 4YSOA 1EGJA 3DSFL 5FCUL 1ZA6B 1ZMYA 2YC1A 1RJLA 2WTRA 2LV4A 2F1AA 3OR7B 1LEGA 4PHZA 4G1MA 1UZ8A 4W70A 4D0BB 4F93B 4BM7A 1F4AA 4EE2A 3D25B 3DIVA 4FL4B 4R8WH 5T3ZD 2UUDK 1JZ2A 2P8LA 3TVMC 2C1PB 5DEGB 2O6CA 2X4UA 2ZUQB 5D71L 4PH8A 1BA9A 4LVHC 1SZNA 3HNVL 1CICD 4N8CL 4WI8A 1FRGL 1GS7A 3RTQD 4YHNB 1YEHH 2ITCB 3WSQL 3EYSL 1H0DA 3VXOA 4ONHA 4J3BA 1ORQB 1BZ7B 1O5DT 4DKTA 4LSRH 5BV7C 3UBXI 3K6SB 3OKEB 3S37X 3LMJH 4OZIE 3P30H 4AJWA 5EZIH 1F6FB 2B0SH 5ESVA 1DN0A 3QEHA 2Y7LA 4HX1A 4DAGH 3MRLB 2IANA 1F4HA 1UEMA 2H6PB 3WNIA 4KI5C 1QYGL 1QLRB 4FFZH 4LCCA 4GW1B 4CMHC 5I8CA 5AB1A 1NWPA 3DOIA 3AMLA 4NKIH 2GBAA 3QJHB 1F86A 1KCBA 2BC4B 2UVEA 2JKNA 5HPMA 3REWB 4OUOA 1P7BA 4QR7A 4XMPL 5F7KC 4UIKH 1QNIA 1B4LA 3VFOB 3FQYA 2VL5B 1OGAE 5K1NA 4NZTL 1KIQA 4Y5XB 1QTYT 1Y1DA 3K6FA 4OGAD 1F58L 4NENB 1E67A 2JIXD 1GAFL 1JXFA 1NC2A 2RCSH 1KLFB 1V3KA 1JHTA 4RMVA 2F15A 3LRSB 4UILL 3GIVB 1NAMA 4KDTA 5IEKB 4Q6IC 3WTSA 1KULA 1A6PA 5ADPH 5I16A 1UVQB 4S2SA 1TJMA 4KGLA 1YYLL 3RI5F 2C9PA 4XBEL 3G5XB 1SLUA 4LBEB 2CK0L 1E2WA 3LZRA 1VGEL 2AK4D 5C0CA 5MERB 4YLCA 3NFSL 3X17A 3ABMB 1A3ZA 1K8IB 3U7WH 1HQ4A 3TC9A 2VC2L 2BDNH 1OE1A 1QWNA 4WFEE 1DQLL 1VADA 3EOBA 3BE1H 4WI4A 3KL0A 4M56A 3QNFA 2PW1A 2BIQA 3UTPD 3OKLB 3UL4A 1OHQA 3J27A 1FA4A 5F1IA 3IKCB 5IB5A 3QXVA 4MB3A 4DCQB 3B5HA 2AJYH 3M1CA 2VERN 3FFCB 3MOQA 1IX2A 4G6KH 3L5XL 3ULVD 4OTXL 1IFRA 4NERA 5FCUH 2JK5A 4LLYB 1WGVA 2Q7AA 4G6JL 5GISL 5ITFB 3ZRFC 2MH4A 2XA3A 4ANWA 5JNYB 4XNMA 3O11B 4RGND 2BSTA 5EC1A 1FSKC 1T66C 1YDPA 4GG6F 3Q0HA 4OI8A 4MBRA 4DNLA 4TSCL 2FATH 5IEHB 3U2SA 3UMTA 1CYXA 5LN4A 2KLSA 3VJ6B 3OAZK 5IUCA 1S7UA 4YBLB 5D1XD 4ZX3A 5FB8A 3HNVH 1JJUA 1FRGH 4GXVL 3TASA 4FQXC 4K3JL 3BPNC 3WSQH 2Y7NA 3M7OA 2D31B 5F6IC 2EEBA 1JZGA 1KMGA 4KKRA 1DHKA 2WQXA 5FF6A 4LPCA 3TYFB 2B4CC 4LSSH 1ORSA 1JNLL 3LRHA 2AP2A 5DC9B 3VFVB 4P23B 5FW6A 5KANG 1JUFA 3FRPA 3NCFB 4P3CL 1GW6A 2EEFA 4NBYB 4ZUUA 3VVWA 5CJXC 2LVEA 1IIKA 1G84A 3JVGA 4YHMH 2DPKA 2FLRT 4FYTA 4UINH 3ZO0A 1RU9L 4P59L 4EKJA 1O9WA 1PSKH 4BBWA 3EJRA 2ALAA 4QHUB 2E46A 2LLLA 5MEPA 5AFAA 4XX1G 2IV8A 4FLSA 2FSDA 1MLBA 4XP4L 5C7ZA 4Z3HA 4NRXB 1BVKB 4Q14A 2ID5A 2KUTA 4G82A 2VDQL 1F58H 3DSNA 4XXCA 5DMJB 2ZNWA 1G7JB 3EYVA 3KPQA 5C0GA 3MROB 4HJEA 2K9UA 4H13C 2G9KA 3EW3B 5D9SB 1IGTB 2A1WH 5A3ID 1AYRA 4U6YA 3V0EA 3O9WA 4UILH 2J71A 1OQXA 4ALAC 4XWGH 2K1MA 5ANMB 3BEWB 3P0YL 1ILSA 4M7KL 1LTXA 4TN9A 5DJDA 3V2AR 4GT7A 4XBEH 3TBTA 3UJTL 2CK0H 1HHJB 1MCRA 1VGEH 2LABA 4GYBA 3EJYD 3O3DB 4AZ8A 1JNHB 2XXGA 4X6FB 4CVZA 4NC0B 4YSRA 3N1QC 3UTSD 1UD3A 3DRTB 4UNIA 1TPXB 4HEMA 1KXVC 4FC3E 2YEZA 2FWLB 5ENWB 1A7OL 2OJEB 5IVXE 1KDJA 5DMIH 1E7VA 3IVKB 2R59A 2VC2H 3KPRE 3C2AL 4RISL 2MRYA 3S3BB 1DQLH 1PS3A 5GRUL 5TDNB 4ICWA 1PFOA 1E5CA 3DOHA 4NZUL 3NSCA 4L4VD 3EUDA 4PGCA 4UTBL 2AJXH 1QR1A 3B37A 3HB3D 4PRPB 5KZCD 3U0PA 3UTZA 4XI5C 1UKSA 2NTFB 1EHXA 3MV9B 3HE7C 1RFDH 1R3LB 3ZMEA 4HG4K 2PCYA 4WW2B 5CGYD 1KELH 3VG9C 4UZUA 5JZ7C 2W9LA 5E8NB 2W81C 3IU3B 4ORZC 1CIUA 4OTXH 3ZGHA 1VFOA 3EGDB 2CUIA 3J8F7 1DJZA 2NUPA 5CZVH 3IDYB 5GISH 2XWTA 4LSQL 4AEFA 1V5JA 1Z32X 1Q1JH 3ZE2E 3KYMB 4DGVL 1GY2A 4LAQH 4EIBA 1XGPA 3QI9C 4MMZB 2DS4A 5LBVA 1OP3K 1J86A 1RP8A 4CN6A 3HLAA 1RZKL 5IJCC 2ZWSA 3D0LB 1OCRB 4P46D 3E6FA 4KAQH 2XFXA 1ULVA 4DETA 1JNLH 1GHFH 4H8WC 2FJUB 3FO1A 2MEJB 3B4NA 3MMEB 1WRFA 2VLJA 2FYYB 2K6WA 4CSZA 1YG9A 2CAKA 2YPKA 4WAFA 5SX4H 3QDAA 4P3CH 4PJ8C 1I85C 4P2OA 1FP5A 4MX7B 3GRBA 5DA0B 4G6AD 2J20A 1QBLL 1RU9H 4P59H 2MCMA 1P6FA 1GS8A 2Q3AA 3CFCL 3A4FA 5DU7A 4D2NA 3BAIA 1J7VR 5GJSL 3WTYA 3BDYL 4AMKL 4KK6D 4GW4B 4JRXA 4XP4H 2ICEC 3UX9B 2Z7YA 3C5ZB 4MJ5B 4F57H 2VDQH 5E03A 3OLIA 2Q2EB 1BIIA 4XCFL 1HT6A 3TBSB 5DMGD 1IGJB 5HYQB 3CU7A 2BZCA 3CN1A 4GUCA 1JV5B 3MLTB 5AW3B 1H8NA 3V9EA 4MXQC 3HRZA 5KSBE 3O45A 2YN5A 3I6KA 4HK0A 4PY8I 2YFNA 4B9FA 2YUZA 3TA3D 3AB0C 3SCMA 1DEEB 3UJTH 3N42B 4YSUA 1JWSA 5IQOA 4R4ND 3MLSL 4PJ6A 4JDEA 3BUIA 4E41B 3ARGA 3TEWA 2QDVA 1WBYA 4BQ8A 4NN6C 1QABA 5JIHA 2E27H 1VHPA 3C2AH 1WA0X 3UBXG 2QQNL 1P2CA 5GRUH 3WNOA 1SHWA 4NZUH 2C34A 4JL2A 1MDAA 4UTBH 2GTWA 4Y4FC 3NSDA 1NL0L 4JM2F 5DK2B 2J5LB 1DVUA 2VITA 2CDEB 1BMWA 1GYWA 5A2FA 3EYQD 4OFYD 1IU1A 3TNNB 3AS1A 4IBUA 4ELDA 1U8CA 5EOCL 3DMMD 2EDDA 2WLKA 3BPLB 3RIFF 1A9EB 1SEBB 3FH5A 2Q10A 3ME0B 5J13C 4GBXD 1RK7A 4PGZA 3ARXA 5ESAA 4LQFH 3HRPA 1KJ3L 3EJPA 3DHMA 1ZDQA 5ACZA 5BW7C 4FFWD 5KOMC 5D2NA 3NZ8A 4LSQH 2LFGA 4JM0A 3RNKA 3EFFB 4UB0L 4P2QA 4DGVH 4BFGA 1Z7JA 3AGWA 1PKQB 1N19A 1KC5L 5AKTA 3S3CB 1JZ3A 4HGWB 4GEJA 5F7DA 2XXFA 2A7BA 2M8XA 1PD0A 1X5MA 2XVBA 3L3DA 2V2XB 4XH2B 2VLLB 1BWWA 3IDMA 2ATAA 4PJ7A 5CINL 4FXTA 4IGBC 1VJSA 3UZEC 1FYHB 3IBOA 1I1AD 1KGCE 3VFTA 5J6SA 5FIEA 5KBKA 3QEQD 4WEBH 1Y6NR 1D6VH 2TRYA 4I0PB 3H2WA 5F0PB 4O2FB 5I6XB 5LO7A 3LEYL 4N2OA 1LWJA 4LRIA 2VXQA 2WSPA 2M2DA 4PCYA 4UOW1 4PIBA 1L6ZA 2GYSA 3DJ9A 2ARJA 3GM0A 2Q76B 2BIHA 4L3EA 4FQQB 1QRNB 2Y7QA 4PMFA 3NCYS 1MCPL 2DW5A 1D5ZB 5F9JB 5GJSH 3MRDB 4R7NA 3NIDB 3BDYH 4PG9B 5C0IB 4AMKH 1A7RL 2ITFA 3DHPA 1BM3L 4N8VB 2BRQA 3D6GA 3OR6B 1YO4A 3BP6B 7FABL 4KKLD 4WNJA 2EUWA 4IDLA 4R2GB 1J8HD 3JYCA 2PYEB 4OZHB 2G75B 3CSYB 3FU7B 3SKMA 1AS6A 3MYZA 4ZYKA 5I76B 2HB0A 1I3RB 2W8CA 4WI3A 2Q7YB 3MFFB 4NM8L 1LO2L 3FBKA 4NT6A 1EJOH 4PU2A 1EGJH 2DMKA 2DWEA 4ADGA 2BIIA 3LEVL 5IBTL 4BRJA 4GFXA 4G43A 1IL1A 1AYOA 4N8VG 2B14A 3MLSH 4TOYH 4GQ9L 3QS3A 2VXSL 4U1LA 1PL3A 3Q6FA 5E6YA 2D4FA 4HS8H 3F83A 4UDUA 3LN9A 1NUDA 3B43A 4UNTA 4U1HA 4GRLC 4FNLL 1KG0A 4FABL 5FHBH 1PDKA 4YX2H 4DHLA 3RWFB 4FXLA 1WS7A 4QXVA 3W11C 1PAZA 3F6IA 4LNRA 5AVSB 4MQXD 3SQOL 1NL0H 4X83A 3RFZC 1G9MC 1P7KB 1TNMA 3E38A 3RL1A 4DSYA 3MRJB 4ZFOL 1MVFA 2AXFB 1F42A 2GSIA 3N43F 3GINA 3HHMA 3ZE1B 4ADIA 5ABZA 3X3FL 2F53D 1KN2L 5T1KD 3GHBH 4Z3GA 3ECBB 5EU6A 5A2KH 3INOA 4HQQL 3T8MA 4AEIL 4WWKB 3RDJA 3ESPA 3HTLX 1IEAB 3TX4A 2O61A 3ILDA 3T3MF 4EF3A 1N6UA 4Q9BA 5JW3H 5IJDC 2WO4A 1RUQL 1X7QA 3ARSA 4UB0H 3TZVB 2A74B 3V4UH 4DN4L 1BXUA 3FQ4A 3FRUA 3HMWH 3CBJB 3MJWA 4ZXBB 4PJFA 5HD8D 3DKHA 1KC5H 4WQOA 2YD1A 3TS8A 4JK0D 1FNAA 5D96C 3OGCB 4MA3A 5IB4B 4LP5A 4TTDD 2VZ3A 4YFLI 2YMXL 5AKRA 4XC3H 3IJ7A 1NAMH 5IG7B 1YEDB 4IBTA 5A6LA 2WPGA 3I3BA 2OP4H 1S46A 3GF8A 1EEZB 1RJYB 5K93A 3T1WA 2RACA 1E40A 3LRMA 1GJIA 1MCQA 3MFGB 1MCFA 2X1WL 3Q9PA 5C08A 4JFED 2VM9A 4FDWA 4HJJL 4HWEL 4OM1L 2O4EA 1Q9WB 3VG0L 5EZLB 2QGBA 4GI9A 1FVDB 2CGRH 2YKLL 3PJSA 2X28A 5EN2A 1S7TA 5F1OB 4B3VA 4DKDC 3IETB 3DJTA 3U30C 3CE1A 1BM3H 4QCIA 4LDOB 5K69A 2X0WA 3BGAA 4NQQA 2R4SL 4LKCA 3VFRA 5GRVL 4EUPA 4WFFE 5JOFA 4XNZB 1P84K 1UHVA 1MCOH 1SMAA 4H1LH 4NN5C 4BKSC 1SY6L 1LXMA 1I8IA 4D0CB 4Q0XL 2OM5A 4K7PH 2IPUG 1N0XL 1UXSB 3ARQA 3DTDA 4IBZA 4QRRD 5DJ8A 4BFEA 1XCTB 1LO2H 2OMXB 1DDHA 3K0YA 5E4IA 3AQXA 2H7WA 4MAZA 3LEVH 2EXYD 1OTSC 3QVAA 3JWNH 3BW9A 1RMFL 3P9LB 3QG7H 3V0HA 5L7XL 2DQUL 3HC4H 5HDRA 2VXSH 2WXKA 5J12B 2CO6B 1FZOB 1I1YA 4JZOA 2AJZB 1JGUL 1S7RA 2VLKE 4LP4A 5JW4R 4FNLH 3MLZL 1IAKB 2JXMA 3F8UB 3EO9L 4MD5B 2FECI 4PEEA 2PO6C 1ETJA 2D3VA 1DQKA 4FQ1H 4G9FD 5E1IA 4RBPH 3ZQ9A 3KLKA 4JFVA 1AZUA 1CGVA 1WTLA 2D7TL 2J72A 4YBQD 3W0WB 1I7TB 4IBWA 2D2OA 1FH5H 4FZ8H 5D72L 3CZFB 3QS2A 1HNYA 3MV01 1KWKA 4HS6A 4XPBH 4RIRA 2WN3A 3JWNE 4NDMA 5GS1B 3IB4A 5DFVC 3NGBC 1JRHH 3ZE0F 4DOHB 2EH8H 2H2SD 3AADB 3RVTC 4UV4L 3C09C 1J9TA 3X3FH 2JKTM 1THCA 4BE5A 4HQQH 4AEIH 4NYLB 5ICZB 2GJ6A 4OF0A 4W9CC 3VXRA 4AQ8C 3FB5A 5D6DA 2R39A 3TT1L 4HCRL 2ADGA 3L3OA 4PJHB 1W2KT 3ZL4L 1MRFH 3GI8L 4JG0L 4CADB 4DN4H 3GSXA 4NO2A 5GRXG 3UPAA 5BXFA 3ILQC 5HYEA 2OMUA 1AGCA 4RCAA 4W6YB 3TN0D 2UY7A 3OLEA 4L1SA 2KLRA 4OLUH 1ASOA 4OLWH 1CLOL 3FN0H 5DEFA 4NXKA 5FGCE 2PPFA 2YMXH 3MUY1 3MV8A 2YBRA 5JHDB 4ZO6A 5D93B 3J7HA 3P2TA 1UD5A 5TH2A 1KTRL 5IHZB 4I18C 3SY0A 2Y23A 4QRPB 1NBQA 1X5FA 4D9QE 4GB9A 4DZBA 1T2QL 3PWUA 1ZKAA 2YFOA 1XIWD 5EOTA 5DTFB 4RDQG 2CXGA 5EO9B 5HJGA 4HJJH 3TJHC 4HWEH 4W9DC 3VM7A 4WSKA 2VDNL 4IRJA 2HVBA 2YKLH 1I8MB 3SBWC 4TS6A 3SE4C 4JFDD 4UU9B 2DLTA 5H2BA 2DMBA 1XGTA 1Y1UA 2HAZA 5B3NA 2DH3A 2Y0SA 1AS8A 3HS0B 3O3EB 4PGDA 5HI3C 1T0OA 4QYOB 2NT1A 5DMKA 2HRPH 4N26A 4OCNC 4X2UA 4XTRD 4Q0XH 2IALB 2FIKA 3PFQA 3NSJA 3GXPA 1SF5A 3D9AL 2GAZA 3KPLB 5HGBA 3N0PB 5C1MB 4LSDA 1V7ML 4YQXH 5DVLA 4N0FB 2NR6A 4XHQA 5INDB 1Q9OA 2W94A 4M1CC 3FU6A 3FB7B 1RMFH 5DUJA 1MI5A 4WO4A 4A38A 4O51A 4CGUB 5L7XH 2FL5A 2DQUH 1IILE 3FPXA 2WBJB 1UASA 4N0UA 5DUBA 1LJMA 5HYSG 4F24A 3DX4A 3SYCA 2WB1A 2VSDA 3BO8B 5ESQA 4A2HA 1YCSA 3MLZH 4A7QA 3EO9H 3UO1L 3KW8A 4K5OA 2VKWA 5CEYA 3LHAA 3LZPA 4ODXA 2F74A 4PJIE 3AFLA 2HKHL 1U8IB 2VN5A 4HIXH 4UWQB 3MGAA 3KPOA 4DP2X 4KJYB 1E65A 2V9TA 2Q87A 3ASOB 3U9UB 2KKQA 4X8JA 3LCYA 2JCWA 1G7PA 2HRGA 5KSUB 4Z5RA 2BHYA 1YPZE 3HNTH 4UV4H 2NY7L 2WLIB 2EVIA 3TNMA 2WMPB 3HC0A 2WZPD 1AQHA 2AJ3B 2ZXWB 3CZJA 4MLSA 2YWZA 2F1EA 1AGDB 3TT1H 2WD0A 2XFGB 4HCRH 1E9PB 4MJ4A 5L6YH 3FBQA 4JG0H 1VACB 4Y4KA 4LCYB 1EFQA 2CH8A 3SSGA 5J9PA 3S8WA 2Z92B 1SOKA 3ZDYE 2GY7B 4OV6F 3S5YA 4M93B 4N9GA 1LGVA 1OAZL 2Z8SA 4KK5C 3FHEA 4NQXA 1EPFA 5HGDB 3ZL1A 1URZA 3FO0L 3QJFB 4MQSB 2X70B 4N2MA 4K5MA 5LG1A 5GZOD 1Z9OA 1CLOH 2VLJE 3X12A 4BQBA 1VFAB 4AYEC 4C56D 4N6RB 1KENL 2NQCA 1M42A 3BESR 2ZUSA 4DEUA 4N5UA 4O2EB 2JJVA 1IEBB 1ZLEA 3T2PA 4J3VA 2GSMB 5GS2H 4PJGB 4JPIB 5F3HA 2Z3FA 3BZEA 1TENA 3GKZA 3ZTDC 3DDFA 2F61A 2YRZA 4YDLC 1FUNA 2IQAA 4ODSH 2A4CA 4YGAB 3RPBA 1L6XA 1T2QH 3BD4A 3HC2A 3QA3B 1U8LA 4HXBL 5CS7A 2Y7MA 2JWYA 5IVZB 3RWIB 1JV2A 4HGMA 3TWCL 1MWAB 2VDNH 3BLKA 5TGBA 4FXKC 3ZZQA 2OQJB 1VPOL 2QJDA 5IR1B 3A23A 4N4YB 4MDIA 5CUSL 3H56A 2FVNA 3BT2H 5JIMA 4WHTB 4N28A 5GRWA 2DIJA 1EDQA 5E5LA 5ISZA 2D4DA 1UC6A 4PJXF 1BQHA 3STLA 4HIHA 4G9DA 4X0KA 5GIRB 5CHNA 1UCBL 3RHWF 3MI6A 4RWHA 1UXWA 3CFBA 5DJYB 3SE9H 3APDA 3HKZA 1FJ1B 1V7MH 5IQ9B 1YECL 1PF3A 2OYMA 1Q9KB 5GZNC 4QXWA 2H45A 1QHOA 1YC8A 2XTJE 4WU7B 5F8QC 2X2UA 3LN4B 4JO2L 3QPKA 4AYFB 3B3IA 5HHPB 4BH8A 43CAA 5HXMA 3FSVA 2R1WA 2LVCA 5T1JA 1XSOA 3HE6B 1DLHB 1IBYA 2JTYA 3H3BC 5JDJA 2WTOA 3BGFC 3VSTA 4EI5A 1RIVL 3FFCD 2ZNXA 5BQDA 5JYLA 2X89A 3K71A 2BVOB 3BSZL 3CFUA 3TBYA 4ZZFA 3KXFB 2J1XA 2EAEA 3K4DA 2ZCZA 3QHTC 4KQ3H 3QH3B 2WQUA 5M95B 2HKHH 4L4TA 1KY6A 3PL6A 1I1FA 1UD4A 3CSPA 4LPUA 1DTUA 2JKJA 2G60L 1U0QA 2GIMA 4LL4A 4NQDB 5D2NE 3BSGA 2ICCA 1D7FA 4UQDA 4FEIA 4EDXA 1H5BB 3WHXA 4HAKA 1BQRA 1RUAH 2D9QB 1E3XA 4P5SA 1MW3A 3FTSA 4Y16C 4E5XG 3M88A 3ZKND 4ZW6A 3T0WA 1BBJA 4M7LH 3MUGB 5B22A 1MFBL 1G0XA 4HZAA 4P23D 1ES0B 5EEVA 4MA8H 5DJAB 3ZDWA 2BERA 4HHAA 4YSQA 4F37K 1TQUA 1N8OE 1X7SA 3FO0H 4BE6A 3HZMB 5LUMA 3E9UA 5JW4M 1FIGL 4NCC1 1XF1A 5GRJH 3RDTC 3ZOAA 4G71B 4XX1E 4KITB 1KENH 2XOTA 3NZSA 4JAMA 1MJUH 4R26L 2QFRA 3LY6A 2Y25A 2OJZL 4DESA 5C6TL 15C8L 1NFDE 2EJ1A 4GSDL 2WCGA 5EUOA 2FAUA 2YPLA 1WO2A 4MWFB 3WO4B 3PDOA 1HHGA 5E8DL 1NEZB 3K1DA 2YAHA 4GKOA 2UZPA 1HSBA 4L2LA 4OR1A 1S7QB 4HXBH 5MEOA 5KEZA 3CMGA 2HFGL 1TVDA 2A3TA 1W72L 1AQKH 1CDYA 2BNUA 2LTQB 4HUCA 5A2BA 1T80A 3MXVH 4C55A 3QUZA 4PRHB 2Q8BL 4YHLH 2G2NA 2NY1C 2XX0A 2C3VB 3D18A 3VXMA 1CGUA 1ZK5A 1B0GA 2NY2B 4FLQA 3SEPA 4LPWA 1LO4L 4GKNB 3TPUA 2Y1AA 5FYJL 3SOTA 5DHVB 3NJHA 4PW9A 4GEIA 3BMWA 3TCTA 4NKMB 5B38G 3H7BB 4HKJB 1NEZG 2BP8B 4YDKL 2EO1A 5I8OL 1NC4B 1JGEA 4HU2A 1WVZA 3T2OA 5KYUA 1S9YA 3P69A 1TYRA 5AW1B 1XSIA 4AX3A 3N1GC 5AKSA 5I1CH 1YECH 3GJFA 5C92A 5IMMB 3Q1EA 4XNYH 4K4KA 1KXQE 4PRPD 3BWAB 3GXNA 3KBFA 1CFVL 4XNAA 5HYJA 4X9BA 1J8RA 3MV9D 1MH5A 3BGMA 4FA8A 2A9NL 5EFIB 2F54A 1WG3A 4OV5A 2X4NB 2KHAA 3T5WA 4UTAH 1K4CA 3BSZH 5IB1A 5CSZB 3KWUA 3PQYA 5CN2A 5CR8A 5IW6B 5KVGL 2QLVB 5EU6E 2FH6A 4K8RL 5IHUH 2P45B 3IS0X 2G60H 4TSAL 3H6AA 5ITBL 3MOBL 5LGJA 3JBG7 3F01A 3NRFA 2FZ3B 4PY7A 1AIFA 3BIBX 5C0DA 1T0NA 3N04A 1QFPA 2J2ZA 2QEJA 5TDOB 1P5UA 5FO8B 1OAUL 2XQYG 5CD3B 4K3DL 3BPCA 3OZ9L 2IWEA 4RAVB 5C8JA 1I9JL 1OY3B 3IF1A 4BK5C 3RVVD 4DGYH 5LHDA 4M43L 2FR4B 2YC1B 5LCVL 1P6WA 4R5XA 3HFML 4GI8A 1CTNA 3B6SB 1YY9C 2WTRB 2YD8A 5GS3A 2WZAA 2H26B 4G1MB 3ESOA 4QHNB 2CO4A 3EO1A 3FUFA 4AG4L 1D6EA 2P8LB 1FYTE 4BUHA 3UP1A 1FIGH 1SGKA 4JFQA 1U8NA 1T2JA 3GXUB 5T5FL 1M2VA 1H0DB 2AKRA 15C8H 4P48A 2NYYD 4NJ9L 4ONHB 4U0RB 5C6TH 3VXOB 4L9LC 2C3HA 3X1GA 3QR1A 1E6JL 4Z78A 1J5OL 4FTVA 1QLEL 2R29L 3S88L 1OTUD 3C5ZD 3QZNA 2JELL 4K71B 5ESVB 1DN0B 3QEHB 1U91A 2JJUA 4HX1B 2IANB 2PCFA 3HPLA 4ZQKA 3QEGL 3T8VA 4LCCB 2DWXA 3ORJA 1IE4A 4D94A 4TUOB 5I15H 2A0LD 3U6RA 4QRAA 3MBXL 1LQSR 4CBZA 1W72H 1ZT1A 1J12A 1MQ8A 2F5BH 4G5ZH 3RFRA 3MNWA 5EF2A 3DIDA 3VE0A 2FB4L 1Y18A 2B2XH 3IM1A 2KQNA 1VEPA 2QDWA 1F2XK 5LQBH 4R96A 4UM9A 1SNRA 3LRGA 3Q5YA 5FYJH 1J18A 3AG4B 3WS3B 4N2LA 1CF8L 1NH6A 4Y1SA 4E41D 5IY5B 4NFDA 4YDKH 2NZ1A 5I8OH 1H6EA 2LU3A 1NC2B 1CD9B 3H0TB 1X4XA 2UVFA 4NB7A 4AENA 3REVA 5DMYA 1HEJC 2R0KH 5TE7L 4QLWA 4P5RA 1KBBA 2ZOWA 4AQ1A 3PREA 5D7IA 5FYKL 3S3JA 5I16B 2NY6B 2VYRE 4S2SB 1ACXA 1VIWA 4GKSA 3TO4A 1I8LC 1CLYL 2X1PA 5C0CB 1H3UA 3ZPDA 5FYJE 2A9NH 5BRZA 4GG6A 4Z7VA 1TITA 2DD8L 2X9WA 2WB7A 1HQ4B 1RZJL 5FDWA 3RKDD 2P52A 1TQVA 4G11A 1SJEA 4N3TA 3QCUL 4HUXA 1VADB 3EOBB 1FBIH 2XN0A 2FJGA 2GJ6E 5BOZG 2PW1B 4WUUE 3S34L 2VQ4A 4TSAH 1A4JA 3EADA 2HJFA 5ITBH 3VWKC 5KW9L 2XG4A 1W8EA 4J3OG 5F1IB 5HJBA 2AITA 4Q74A 2ZWLT 5FGSA 3EDDA 5IB5B 2NXZC 4F8TA 3QORB 1Y07A 3SDAA 1KTKE 2GEQA 3B9AA 4KK9C 3TU6A 1WZAA 2NY5L 1GTFA 3MC0A 4O58L 2QR0A 5TQ0H 4LCIL 4M43H 4FA6A 4NQVA 3Q7JA 2IIJA 1SEQL 5C97A 1BLIA 2DM4A 3BVNA 1ITCA 1BOYA 4I0PD 4XNMB 5LBGA 1LDPH 3SD2A 2BSTB 5EC1B 2E7LA 1YDPB 3P3YA 3QHFL 2IDUA 3R06A 3MRNA 1YYML 4AG4H 4N22A 3NJNA 4QHPA 4AXWA 1S7UB 1IBGL 1BD2A 2ZXAA 1AACA 1QRND 5FB8B 1MN4A 3PWPA 4MNGA 2B15A 3E0GA 4JLRA 1DL7L 4Y1TA 4TQHA 4NJ9H 3QJSB 1I8UA 1J5OH 1PLBA 3SPJA 1H3VA 3EFDL 3WKYA 2R29H 5FF6B 3S88H 2DJSA 2XKUA 1Z9LA 3WY1A 2JELH 4R2GD 2ESVA 1ORSB 2CZNA 5CJOL 2EDJA 2PYED 3QEGH 2XETA 3RWGA 4GMTH 3TBCA 3FRPB 3MBXH 4F15C 3P3RA 2HLFC 4A6YL 3WYRA 3IFPA 1MCLA 3OAWA 4K9EH 4FJZA 4WNSA 4JVUA 3S36X 1IC0A 2H5UA 2FB4H 2MNJB 2VXVL 3FDWA 4FNQA 4LE8A 5AZEL 1NMCB 4NQEB 1GGCH 4I4WA 2PXYC 5MEPB 1BZ8A 3CVBA 1MLBB 3DLQR 3BVUA 3CD4A 3MUHL 4BXSV 1IGIL 3VFGH 4HUMB 3EYVB 3KPQB 5C0GB 4LARL 3N2JA 1IFHH 4N0UE 1ANUA 5DQJB 4Z7QE 4U6YB 2QPUA 3H4HA 1WWAX 3O9WB 4G8EA 2UYLA 2F7OA 5TE7H 5M7QA 3L4XA 5T3XH 5A16A 4KFZC 5FYKH 5J6HA 5AOJA 4P4KC 1V3LA 4FKKA 3D2UA 5DJDB 4M5YL 4BHUA 2GT9A 2IV9A 3IMWA 3TBTB 1NOAA 1NUGA 1PEZA 4AZ8B 3BPOC 3RY4A 1I8KA 4CVZB 4R3SA 1NIBA 3WV0A 2VISB 1RZJH 3FAXA 5AYUL 1OPGL 1HTYA 2X1OA 4FCAA 4WWKD 1DVXA 7PCYA 3QCUH 3DROA 4N2GA 3VWJA 3U1SL 1HHKA 2WLLA 3GBDA 1JL8A 3BXNA 4N2NA 4OFQA 4WF7A 1G9NH 5FYKE 3TZVD 5T3XE 4P3WA 4LCWD 5IB3B 3A3YB 1QR1B 3QAZC 3S34H 3BH4A 1AZVA 4ZXBD 5KW9H 3UTZB 3TL5A 1R5VA 1IBBA 2HVJA 2GTQA 4Y8DC 4FF9A 4Y4HA 6FABL 1NFIA 2YGOA 1KV3A 5ANHA 2VZOA 2Y7SA 2Q3XA 3K8LA 2EKSA 1J05A 1U2CA 2NY5H 2ZUUA 1JPTL 3BZ5A 4QRFA 2L3BA 2J1KA 3QIWA 4QNPF 1ITBB 2NUPB 5HTSA 4UQIM 2R9HC 1WFJA 4W9GC 4JRWA 1NUNB 1KYUA 3CFNA 1MZZA 3RTQC 3QHFH 4EZJA 1YYMH 3N3EA 1TTUA 1OSPL 3UOAB 2BJML 2ZKYA 3CX2A 4Q9RH 2K4WA 1XGPB 5DUPL 3HLAB 4YH6A 3DJSA 1DL7H 4OKVA 3SO3C 4MJHA 2IG2L 2L04A 2XWBA 4OH2A 5JPNC 3U6XS 3RGHA 3V5DA 5C0AE 2XTLA 3E6FB 1YQ2A 5KWYC 2XFXB 3EH1A 3GS7A 3OJDB 5CJOH 2Z0BA 3FO1B 1IRAY 2D03L 4TV3A 5F7NC 1A1OB 1S7VA 4FA7B 1TXKA 2YPKB 3QUYA 3T09A 2X40A 5EU7E 4XCYA 5J56B 3CGTA 3F7VA 4P2OB 3D0VA 4PW4A 2BOBA 1H19A 4NAJA 4HEPA 5B3JF 2BMKA 2BSDA 2VXVH 2WBXA 4W4OC 5AZEH 3VXPA 3WIHA 3EJZC 4PJAE 3FNKA 2IH9A 3LS4L 2IOIA 4KO9A 4PJDF 5GHWL 3U6XA 4JRXB 5DJCB 1YY8B 4KNUA 4Z7AA 5GGQL 2IAMA 2ARJQ 1IGIH 2H32A 1BIIB 3KEDA 3HIZA 4N90D 4X99A 2GC4C 4XCEA 1KEMH 1DQJA 4P5TB 4LIQL 5TD4A 4DH2A 1AR1C 4HK0B 3I6KB 5AW2B 3VFUA 3DBSA 4KNQA 3B7UX 4M5YH 2MJWA 3SCMB 1S9VB 5IMOA 2FSEA 2V7HA 4X4YA 1JWSB 2DBLL 2BHFA 1RK1A 2LAGB 3KCWA 1F11B 3ARGB 4XO4A 2Y6SC 1AZBA 5AYUH 1DBAH 2A4ZA 3BOVA 1OPGH 1U42A 1WBYB 3GZPA 4PWJA 4YK4B 3UJJL 3L5HA 4LEEA 3CFEA 3VSQA 4HPHA 2KL6A 2ZOTA 4KK8D 4WNQA 1P2CB 3IDJB 5GQBA 3U1SH 3K81A 2OSLA 5KYNA 1JGIA 3O2WL 1AVAA 4HF5L 1WWBX 3D07A 2BP0A 1XH1A 3ULVC 1XR9A 4WI9A 2BOCA 6FABH 1BLNA 2W5PA 1UD8A 2C9QA 3ZL2A 3UCQA 2YGNA 3T9WA 2APWA 1LP9B 5JHDD 2YZ1A 5ESAB 4L1BA 4CUCA 1RUKL 1MDTA 3BN9C 1L5GA 4WGKA 2ZXEB 1DJXA 3L2MA 5D2NB 3NZ8B 4LBAA 4G7YH 1AANA 1JPFB 2GBUA 3RNKB 4QRPD 4D7PA 2YPLE 3GFUA 3T3PE 4P2QB 1MWAL 3C60C 3F58H 4J5VA 2W65A 2VXUL 1T83A 3V4PL 2O6DA 2O5YH 5DUPH 4K0OA 5EEWA 3OKKA 4ZFZA 1BOGA 3E8UL 1OB0A 2WANA 3DV4A 3G08A 5CILH 5CBEA 1CQYA 3HVNA 4QRBA 3L3DB 5DVNA 5D7SH 4OU3A 1THAA 1H3PH 3DDGA 3GJFH 3IDMB 4I85A 4J3SA 1CFNA 4PJ7B 1E3ZA 4MXVF 4PYHA 3JV0A 4I1PA 5EIVA 3AWEA 2YD7A 3VFTB 4OZGF 4WO0A 1A6TB 5AAMA 2NNXA 3MA7A 5E8OA 1TVHA 3OB0K 1T5XB 1HAUA 4U1NA 3PWLA 1NWOA 2ARJB 4L3EB 3QYNA 5INCA 2Y7QB 2DYPB 2QHRH 1XGQA 2XV0A 1BFTA 4ABWA 2GBVA 2W0LA 4R7NB 5GHWH 4P9HL 2JB6A 1IJNA 3MYJA 4L4JA 5GJTL 1ZTXL 4RFOL 1DFBH 5GGQH 4Q9QL 2WBJD 4WU5B 3MVSA 1EZUA 4DGUA 4TUUA 2XN9E 3KVDD 3GBEA 3ULUD 3SKMB 3BP5A 1T6WA 4MRBA 5EEYA 1KCRL 3QIBA 3AREA 3NCEB 4ZYKB 1EA9C 4HK3N 1F6AA 3ZYIA 1KFGA 3B2UC 4NT6B 1MW1A 3HUJE 3PQYE 1ZT7A 4NI3A 2DWEB 3CVIL 4NQUA 4A04A 4QF1B 1LYQA 3NESA 3Q2NA 4NGHL 2AEOA 1N67A 2DBLH 1IL1B 2F7RA 1YQVL 3BISA 3DTUB 1A2YB 1PAMA 2Y07H 3LS5L 3L9EA 4HPYL 4Y5VC 4U1LB 3Q6FB 3RX7A 1A3LL 1EJFA 4UDUB 4U1HB 3UJJH 2J88L 4Z0XA 2HTLD 1KG0B 1MFDL 3WTTA 1CYWA 3ARFC 2IAAC 2XVGA 1QVOA 1Z3GH 3IWVA 4LNRB 4XAKD 1FVEA 4HUWA 2CGZA 2VN4A 5LN8A 5HDBE 1D5XA 4NNYA 3RL1B 4FQIL 2X5PA 3PNRB 4Y9CA 1TQWA 2DOCA 1HOCA 3LSOA 1U4EA 3V4VL 3MBEA 4AEHH 5I1LA 4D9LL 4OD2A 5E9DA 1NANI 4N3UA 4RA3A 4X7SL 1X5YA 5BO1L 3UFIA 5EU6B 3VXUA 5FLVA 1XX9C 4UT9A 2F19L 3ZSTA 1RUKH 3WTWA 5I26A 3MRMA 3DK0A 2O61B 1FLTX 4IQHA 3FT2B 4ONGH 1G0YR 1X7QB 4BCXA 2X4OB 2WXRA 5CBAA 2ZYHA 3PJLA 1HH6A 4PJFB 3V4PH 4X9HA 2WYZA 2CPCA 3E8UH 4P46C 4U33A 4MA3B 5F7HA 3QQ9C 4XWOD 3QWRA 4M9OA 3OG6B 1QSFA 2DYRB 3VA2C 4LGRB 1WH0A 3TVMA 3H42H 5E2VL 4RRPM 1NGWA 1ZS2A 1E4JA 1ZV5A 2VDOB 3GQFA 1P5VB 4XE5B 1TQCC 3OX8A 3EGSA 1EEQA 3QDGA 3PGDA 3CX5J 1NGYA 4K94L 3VXSA 4NUGL 4DO6A 1PLCA 5EIIG 4XO9A 5AOLA 1PJWA 3GYRA 5C08B 3UO8B 4OGYL 4RAHA 2GFBA 2VDMB 1TZ8A 2R7EA 2Q3ZA 4N86A 1TJGL 4WK4B 3IMUA 3PJSB 2ROXA 4JHZA 1S7TB 4QRQB 1AI1H 3B2MA 4P9HH 4L3AA 5GJTH 4MQTB 3TO2B 1ZTXH 4QCIB 2WP3T 4RFOH 5D7IE 3PAYA 2XV3A 4CAGA 4KKCD 3HE6D 4LKCB 1XF3A 3NACL 4MMXA 4YNYA 3VFRB 4CL7A 4JVWA 5J4MA 1CN4A 3I6LD 4EUPB 5JOFB 1G94A 2UWEA 4M5SA 4JDZB 3ARDC 5AVXB 1IQWL 1I8IB 4WFHD 4FOMA 4PGBB 4Z7VE 4JQIA 1KCRH 3DUUA 1OLZA 5DJ8B 5IESL 2BVPA 5IT2H 1DDHB 3OM3B 3O6KL 5B39G 1TU2A 3NDYE 3MRFA 1A22B 3U4KA 3DXAA 5AB0A 4NQDD 4X4MA 4NUPA 1AD0A 4NGHH 3RA7H 4IBQA 4Q6IA 1ZTXE 2X6AA 3BW9B 2J43A 1YQVH 4HPYH 5C0JA 3GT6A 1A3LH 2YQ2A 3P4NB 5DRWA 3LHPL 1I1YB 4QTIL 2J88H 3IRPX 2JXMB 5KBNC 3DX2A 5F6HI 3BZ4A 1S8DA 1AOHA 3NJFA 5LNGA 3ARBC 3JUZA 3GDCA 1JBJA 5JW4N 3UYOD 4PLNC 2FQDA 2Z93B 1TQTA 4FQIH 4L0ZA 2G0KA 4X6DA 2CDGB 1WITA 4HS6B 3E7JA 3QFJB 5EZOL 4RIRB 2CIKA 2DQFA 1BVNP 3MUZ1 3I2CL 4QEGA 3OTTA 5EMYA 4D9LH 3LIZA 4X7SH 1UM4L 5BO1H 3PUCA 1TZGL 3FUEA 3IJ8A 3T0AA 1HJCA 1W0WA 1WDAA 2F19H 3GLAA 4R7DA 1NCCL 2GJ6B 3VXRB 5JIIA 3ARVA 1IAIL 2LHAA 3IAQA 1GSMA 3L3OB 4KV5E 4LEOA 3NRQA 4RMBA 1T2XA 2WQ8A 1CFMA 3VGHA 2BNQA 3GSXB 3QDME 1U9KA 5ABDE 4AYMC 4NO2B 2ZOKA 5BXFB 4H20L 1DSFH 2ESVE 3D48R 2CLZB 2OMUB 2WM0A 1RZKC 5CMAA 1RXLA 3ECUA 3FO2A 4OLZL 4TQIA 1I1AC 1TSRA 1MIML 4NXSA 3L4TA 1KBWA 1FFOA 4GQZA 2NY2D 4U1JA 3MV8B 2YBRB 2VR5A 2OK0L 1RPQA 3B5TA 1MJ8L 5KSVA 3S6CA 4M6AA 4FQXA 3AG3B 1LEIA 3HI1A 5IQNA 2A83B 1CGYA 2ZSVB 3DYOA 4H4NA 2KT6A 4K94H 5TH2B 4LESA 4AGQA 1WHOA 4E9RA 2F7PA 2Z4QB 3BUYA 1U92A 3RWCA 4DZBB 1PJ9A 3B7RL 2D7NA 3PWUB 4DUWA 3UZVA 3CX5K 1LO5A 4OGYH 1FFPA 4YAQA 4OCSL 4KKLC 1TJGH 3GD1C 5I66A 2NCEA 4OZFG 1NIFA 3TP4A 3IRCA 1HN1A 5H2BB 4AT6A 1XGTB 1OCZB 3MCG1 4UOW0 1SLVA 4E0RA 4PGDB 3K2UL 1XSKA 3AXLA 5DMKB 3QPXH 3V5KA 4LLUA 1IQWH 4OZHF 2FIKB 3TTSA 1CTOA 1UFUA 2UX6A 3UPRA 5DUML 4OZ4A 3AJ7A 1Q9OB 2D0FA 2JJSC 1MJ7L 5EC2A 1MI5B 4WO4B 1YSOA 5LNDA 3U4BL 2FL5B 5DUBB 5E6IC 5JMOC 1Q1PA 3M8OL 1C12B 3ZQXA 3SJVB 2YK1L 1MW2A 2MPAH 4X6BA 2GI0A 2P28B 1OAYL 3EBGA 4Z7NB 2XZQH 5CEYB 3F7YA 4P8QA 4BQ6A 3GB7A 1KXVA 2GK0A 4ODXB 1Z3RA 4I9WD 2VRAA 4XPHL 3RWJB 5TFSL 2V2TA 3CHPA 5CCKH 1GOFA 1RJZA 3ZDZB 1NLBL 3UZQA 5DWUH 2VZTA 3BZFB 2H9GA 1OT2A 1IC4L 1G7PB 3EDFA 3I2CH 4Z5RB 4Z7WF 1I7RB 3IJEA 5AW6B 5FKPA 1U8QA 3TNMB 2MQCA 3HC0B 4NIYE 5I0VA 1TZGH 3OLDA 4TNEA 4DF9A 1G5GA 4N2HA 3HMXA 2DQGL 4HJUA 2NX5A 4JPWL 3Q3GA 5BVJA 2IAND 4X8XA 4Y4KB 5J9PB 3ZZLA 3WIFA 1IV8A 3N1PC 4PFEA 4FEMA 2IJ0C 4TTDC 4N9GB 1BZ9A 3WY3A 4AQOA 2EVGA 4NQXB 4PJXA 4PS7A 3IGFA 3ZY7A 3K6IA 1DQVA 3NIGB 2VUOA 3LKSA 1TG8A 4FNPA 4OLZH 3KH3A 3X12B 2FNWA 1MIMH 3H9SA 4F7TA 3J2PA 4W68A 3OKOA 5LJYH 3FH8A 5E2UH 1MFMA 3CU1A 3VSVA 3MRRA 2P1YA 3QI9A 3VNZA 3O41A 1MHEB 1B4RA 1F2QA 5F3HB 2X4SA 3B56A 1QR4A 2RA1A 1VCAA 2VLMD 2AHIA 4OFIA 4RFEB 2DIBA 2IQAB 2BX5A 2GY5A 3MSPA 4NP4H 1NC2D 3O4LE 3D87B 1U8LB 3LDBB 3M17A 4AUJA 5JQHC 1JZ6A 2MNUA 2X05A 1A7PH 4OCSH 4J3OH 5TGBB 3TFKD 4FULA 1MOEA 4PJ8A 1I85A 5CJQL 2NY6D 2VUYA 5CXPA 5DT1H 4WDIB 1JMXA 4WWPA 2OR9H 4JHUA 4MDIB 3N50A 4OZIF 3IRZA 2VMEA 5C0CD 3AS2A 3KWTA 3EF4A 2ENQA 2VXTL 3LTVA 3TIEA 2MNWA 2BCKA 5ISZB 2N7AA 3LD8B 1X4YA 1QFWI 5LXVA 1BQHB 4ZTPL 4HIHB 2ICEA 2G5RA 3BVWA 3GDBA 4G9DB 4X0KB 5CHNB 3VCLA 4DVBA 1MEXL 1OGTA 1T5WA 3MN8A 4PRIA 3CFBB 1BZDA 1EAPA 2FEDC 3CSFA 5DUMH 3X13A 3ZX1A 5C0BA 3JWNC 4MCYA 3KEHA 1MJ7H 1BFOA 2PWFA 4BH8B 43CAB 3MLUH 2R1WB 3FQXA 3TBWB 1Z66A 5EU4A 4PR5A 3EDKA 1ZGLP 3M8OH 2C9RA 4EI5B 2YK1H 4FJYA 3BUPA 1OAYH 2ZKXA 3K71B 3TBYB 3G9VA 3T08A 4QJ4B 4LEXL 1F90L 1I3UA 2YQ3A 4HBCH 5DVOA 4EJ1C 4LLMA 3WTVA 5TFSH 3H9ZA 5HHOA 3HC3L 3Q2LA 5C2BL 4L4TB 3PL6B 1I1FB 1NLBH 2KZWA 1C5DA 4WRLA 5C07E 5SWSB 1TMCB 3G6DL 3IMRA 3ZHNA 4XNQB 4DGIL 2C7UA 3CZSA 4Y4FA 1ZEAH 4PJEE 1KYOJ 3DETD 4EDXB 3WHXB 4ZOCA 2NY4C 3Q8EA 5AVRB 4Y1AB 3LVTA 3U7YL 4TVSa 3RTLA 4U3SA 2F0CA 1HI6A 1ZIBA 5KSAB 1SM3L 1UB6A 2DQGH 2G3NA 4ELME 1ZLVH 3TN0C 1NCOA 4U1GB 5GS0L 2MOQA 4F5CE 4HHAB 4PJHF 5F1SA 4BJLA 4RAUA 4XBPB 3W5NA 5BW7A 2EXWD 3SO5A 4ZG1A 1U58A 2EIJB 3RVUD 5DJ2A 4IRZA 1MSPA 1WIPA 3SDYL 4JAMB 1BP3B 3D34A 3HG4A 3QWOA 4NQED 5L2KE 5ECJE 1L0QA 3B9EA 5EUOB 1FNGA 1IVTA 3KHOA 4MYWB 2CA4A 1XIWC 3O2DL 3NIFB 3PDOB 2QSVA 1HHGB 1HSBB 3IDGA 4IGBA 4X8GA 3UZEA 5MEOB 3MU3A 1BW8A 3TIDA 1NCWH 5JIKA 3O9WD 3OJ2C 3F65A 2YMOA 3QDJA 2BNUB 4Z7IA 5F9OH 1KBVA 3QUZB 1EEUA 2P43B 3L6FA 5CJQH 1DVFA 3N0AA 3D18B 1WEJH 3VXMB 4CU6A 3RGVC 2BP5M 3IEAA 4M1GL 5DHXB 4ZZKA 3TPUB 1DP0A 1C16A 1D9KC 1FFTB 2E7BA 4NUQA 3CIQA 3HLKA 4ZTPH 1QFWM 1BFSA 4RGMB 1JGEB 4HWBL 4L9DA 2GW5A 2L8AA 4LL9A 5EBWB 5KYUB 1S9YB 5I8EA 3D3VE 3KPSA 3MNMA 4POZC 5EDSA 1JZ8A 5A2LH 2Z31A 5AZ2L 4IHOB 3TEUA 1Z5HA 1N59A 2CRIA 5F6HJ 1LHZA 1AFVH 1CTMA 4B0MM 3RJOA 2CKNA 3IJ9A 4WIQA 4E9TA 5HYJB 1MH5B 4U1IA 2F54B 2CBTA 1JHLL 2I32A 1E5YA 4OV5B 1GMIA 5KVMC 6TAAA 1K4CB 4CILA 5IB1B 4LEXH 4FL4C 1F90H 4K15A 4R4BA 1RULL 4GP4B 1RP9A 5I6PA 1SBSL 3PYCA 2ZUQC 3MLWH 2DI7A 1USZA 4GRLA 5IQMA 1T89A 5IREA 4PTTB 1F3RB 5D8JH 4DGIH 4NRZA 5F93C 5LGJB 3OAYK 5IK3B 3RFZA 3O3UN 4PY7B 2R83A 4Y2NA 1AIFB 5IW1A 5C0DB 1T0NB 1P5UB 1G7MA 2VLRB 3D08A 3T1FB 5E1QA 2OW7A 4JFUA 3BPCB 3ZRSA 3U79A 4ZW7A 3IF1B 4QLRA 1ZT4A 4E9SA 1QSFE 3N1FC 4OQTL 4X7TA 5E1HB 4MSWA 3FTWA 3U36A 4BWUA 3I3DA 4YZWA 3L5IA 3SYAA 4OBRA 4WTXA 1D6EB 4W6WB 4P2OD 1K2DA 3M1BB 4KI1A 2HMID 1U41A 3VXSE 4AC4A 4JFQB 5T5NF 3MLVL 1U8NB 1ZVYA 2EYSA 2UZYA 4S11A 4JQIH 1NCDL 2AKRB 4JN1H 4KXZI 2Z6FA 4KI5E 2XZAH 2XWCA 2CO1A 4JRXD 5JQ6L 4FTVB 4G8GA 3O2DH 4IU2A 4JDTH 3SOBL 3CC1A 4BCYA 2JB5H 2V5TA 1H9DA 5CJ8A 1U91B 3VGGA 4ALAL 2DY2A 1AZNA 4ZQKB 3WXVL 2AJSL 5BJTA 1XMWA 4P5TD 4I7ZC 4GAGH 2UWEE 4YDIH 4PJCA 3MNWB 1SXBA 3PDGA 2XTJC 5D1ZB 3SCMD 2EH7H 3EO0A 5ADOH 3HG1A 4UM9B 4NLHA 3S35H 1CDJA 3VRLF 4ETYA 4IEFA 5JHAA 1KB5B 1XGYL 4OLXL 2CHWA 4X7FC 3FU9A 3DXAE 3ARGD 5F7UA 4HWBH 1FZMA 2WNWA 4BH7A 1G6RA 4X9IA 3CN0A 3LIZH 3REVB 3V8OA 4XPFL 4TRPL 3I9AA 4AQ1B 1CG9A 1ZANL 1WZKA 2XVLA 3MACH 1M3IA 3EYUL 2X88A 2HVKA 4NSKA 3VD1A 4GKSB 2CKBA 3RBGA 3TO4B 5I24A 4WI2A 2VW7A 5KYXA 1OP9A 4MS8D 1RJCA 2BFGA 1MY5A 1RK0A 4R0LC 4Q58C 4RFNB 5BRZB 4GG6B 2EDRA 1JHLH 4X6DE 5J5EA 3ZO9A 2DQJH 5T1DL 4M4PA 3QSKB 4JGJA 4DK5A 4L23A 5KJRL 1FZJA 4YXHL 1MKFA 3JTTA 1RULH 1EHLH 4HUXB 2QQLH 1ETA1 4PLJC 1R17A 4F1SA 4E9YA 1TZIA 5E5RB 3GEFA 1UG9A 4P2QD 4LF3A 1A4JB 1I7ZA 3BP7A 2HJFB 4HV8B 4XN2A 2WY3B 2XG4B 4X9YA 3IJHA 1TO5A 3GK8H 2VN6A 1INQB 4JANA 4KJWD 2BNQE 1A4KA 1F00I 2DLIA 5TQ2L 1VRSA 3B2PA 3QK0A 3RU8H 2VDOL 2Y3AA 3SDAB 1R4XA 4P23C 4O02L 5D5ME 1GYUA 2QR0B 4ZW3A 1F02I 1IGFL 4GRMA 5I74B 1RLBA 1HEHC 3ZKQD 1ZGLM 1CI3M 4TVUA 5ETUA 3ZKSD 3BVNB 2D2CC 2EE0A 4JN2B 1TLMA 3B8YA 3OHMB 4IOIA 5L4IA 1V05A 4AQ8A 3FTGA 1QO3A 3R06B 1MHCA 3MRNB 4P2RA 3ELQA 4XMLL 3KS0J 3ZUNC 1QKZL 5CSBA 1UWXK 5B21A 1XCQB 4MDRA 4AXWB 1DSYA 5EUKA 4L3ED 1BD2B 4EBQL 2WVVA 4C83A 3PWPB 4K7PX 4MNGB 4WY7L 2EEAA 4TPRH 1L0YA 2E7DA 5PCYA 3ZZ1A 5B1KA 5JLZA 2OLDA 4WFGE 3WFDL 1CE1H 4FP8L 4K07A 1EZVY 1OAJA 4PB9L 4ENEC 4ALAH 1AS7A 4X7DC 2HX7A 4ZAKA 3WLWC 4OF7A 3VQ2C 3WXVH 4YXLL 4H88L 4F8NA 2AJSH 2MTPA 4QRTA 4FG6D 1ACCA 3MLXH 3IFPB 4WJKB 4PLKD 4C4KO 4I18A 1FPTL 4NQCA 3UG4A 3N40P 1XGUA 1S9KC 1R34A 4AOFA 1WIOA 1BQSA 3H53A 1S78C 5DYOA 3GSVB 1UOLA 4I4WB 4UQ3A 3P54A 1CE6B 5MP6H 4YE4H 4POYA 3SBWA 4OLXH 4JPVH 3SE4A 3CFKB 4B9ZA 1EO8L 4U1KA 1TCRB 2YOCA 1UUNA 4GO9A 2C8NA 1YEJL 3IJYA 1WTGT 4C58B 1KACB 1ROWA 2WKOA 3DRQA 1TNNA 4Y19A 2QADC 2W0FA 4G8EB 2UYLB 1NLDL 3VI4A 5C71A 1WE5A 1ZANH 5J6HB 2NY3B 4MD4A 3HMXH 4WW2C 3D2UB 5FW7A 4KTDH 5I1JH 3T4YA 1T7XA 3F7LA 4Z8FH 4O00A 3BAXA 2YWYA 2B1AL 4Z3JA 3MX0A 1I8KB 5ICUA 1X3DA 1Z9SB 2ZOUA 3IDYC 2ZXDA 4XMKL 1PZ5A 3C6LC 1CCZA 4YGVA 5EU6D 5B1BB 3GJEB 1K8DB 4MGXA 4Z0BL 5DFWH 1HXYA 2Q8AH 1NDMA 2YIHA 2Q6WB 4HC1L 3VWJB 3RI5K 1HHKB 2WLLB 3BXNB 5F96L 3D52A 4JPKL 1Z9PA 3VU2A 2VZ1A 3OKYA 4J8RA 4DKEH 2F5AL 3SIKA 1KN4L 1MWOA 3HZ3A 1R5VB 2HVJB 3VB9A 1IAMA 1AIZA 1F4YL 3CBKB 3SQRA 5JOPE 4PMEA 4Y4HB 1ERNA 1T0PB 4ZJ9A 1NFIB 2HG0A 5AOZA 4H8WH 3UG3A 5D7LE 3VUAA 3WCYA 1GYCA 1J05B 2EKSB 4R90H 2APXA 3RY6C 4B95C 1XCWA 4FHKA 5CKGA 1IGFH 3QIWB 3NTCH 2BXYA 1T21A 1HCZA 1MFUA 2J6EL 3F6LA 4PJDA 4YSAA 1E4XL 2G4GA 4DP8X 2B8OT 1T6BX 4XPTL 4NUJB 5HVHB 3VFMA 1L9MA 1MG3C 2OTUA 5C08D 4F7KA 2VAJA 1H8LA 3APFA 5I8KL 4EBQH 1X7TA 2F9BT 5IBUG 4JHVA 4OKVB 1RHFA 2MHAA 2XWBB 4KHTL 3WFDH 4K3EH 4FP8H 5A6IA 1XH2A 4KKBC 5BZDA 2IEPA 2J5WA 5F3FA 1AGFA 3OAUL 1H8OA 4YO0A 4PB9H 5F7MC 2LGNA 5HHME 3RUGE 1OZTG 4Q52A 1HYRC 1BECA 4H5SA 4Y2DA 4KPHL 3WUWG 4YXLH 4OD3H 5TK2A 3VFNA 4H88H 1S7VB 3VDCA 1CI5A 3QUYB 4AITA 2P5EA 1BVLA 1NFAA 4XCYB 3F7VB 5BS0A 4KX9A 4FQHB 4U3CA 5IWLA 3D0VB 1FPTH 1VKXA 1WIUA 4P2YA 2ENYA 4Z7OE 5IB2A 2BMKB 5B4MD 5CAYB 5F7EL 3VXPB 3CHQA 4PRIE 2AJUL 5IROC 1UA6L 2IMNA 3VYNA 3BZDA 1SYSA 5JUEL 1TFPA 1A3RL 2KDYA 2P5WA 2IAMB 4FI6A 1G7QB 4MJIA 6CGTA 3VTAA 5I0ZA 2H32B 2ZXCA 3U0WL 3WE6B 4EN3A 4IBVA 1BBDL 2N1TE 4XCEB 2NW3A 4BKLA 1DQJB 2APSA 1NLDH 2XWXA 4J4PC 1PG7L 1AZCA 2ADJA 3VFUB 1GXEA 4PD4J 3BPLC 3HI6L 3LQAC 1A3QA 4HEPG 1QAWA 4ABQA 4XP6L 1NICA 1GZPA 2IQ9H 3RKDC 3ZVVA 3QFJD 1A66A 1CBVL 1GR7A 1MHHA 5IMOB 2B1AH 2FSEB 2V7HB 4LL1A 1KF9B 4AIOA 2V9QA 3NJJA 4X4YB 4GSQA 4CVWA 3GSNA 4XMKH 3DA0A 1RK1B 1D5RA 4N2AA 5AENA 4XP9L 1ZVSA 4H0IA 2B9AA 3OZKA 2GJ6D 3VXRD 4Z0BH 1NMBH 4HISA 3ZTCC 2N0MA 2WW8A 2D7OA 2VW4A 3CFEB 3IGLA 5D70L 3MRHA 1KCLA 4K8RC 4JCMA 2HH0L 4NLAA 4HC1H 2FJSA 1ZLWK 3UIYA 3S8FB 4S1QH 1KGIA 5F96H 3WI9A 4U6HA 5GGSA 1ZJAA 3LH2H 2F5AH 1JYVA 2NUTA 2M26A 1KN4H 4ENZA 2BVQA 1O6TA 2N3JA 1JK9A 3T4AC 1U3ZA 2VMDA 3ZT6A 4OZFH 4OZGA 2WIIA 2XXMB 2BP0B 4B96A 3UYPA 1HSAA 2V17L 1M53A 1XR9B 4XE0A 3OWRA 2BOCB 4KMTL 1QFHA 3PGFL 1TQBB 1Y0LA 3MV8D 3HAEG 5I6XC 2K4AA 4XN5A 2I7SA 3PDDA 1J0YA 1L5GB 2E7HA 2HT2C 5C09B 5SX5H 2J6EH 2QVFB 3P9MA 4FMVA 4XN4A 1PCXA 4Y16A 1G7IA 4DUXA 2YO3A 2AI0L 1EHNA 4XPTH 5AQ0A 2OL3A 1UEYA 4WKXA 4PJBA 4JY4A 4YXKL 1A25A 1MLCB 4AEEA 3ILPB 4ZFZB 1BOGB 3S0PA 3NZHH 5CBEB 3DV4B 5CEXB 4IRJD 5CIPA 1EVUA 1XGRB 1KV7A 1X5XA 2WGNB 3MNVA 3HHSA 3QDJE 4KHTH 1ID2A 3ML8A 4AJ0A 4JHWL 4NZRL 1CFNB 3RDTA 3F7KA 4YDVA 4DIXA 3OAUH 2ZKMX 5AEAA 3T2QA 2CIIB 5KJ7E 3P02A 2FBJL 4A2DA 2FQEA