4AQAA

Crystal structure of deafness associated mutant mouse cadherin-23 ec1- 2d124g and protocadherin-15 ec1-2 form i
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
206
structure length
206
Chain Sequence
MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGGVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords CADHERIN-23
publication title Structure of a Force-Conveying Cadherin Bond Essential for Inner-Ear Mechanotransduction
pubmed doi rcsb
source organism Mus musculus
total genus 45
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4aqaA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4aqaA02
1NCIA 1NCGA 4AQEA 2OMTB 2QVFB 2WBXA 2QVIA 3LNIA 3K6IA 4ZMZA 1ZVNA 5DZVA 2WD0A 2YQGA 3LNHA 4ZMWA 4AXWB 4ZMTA 4AQ8A 4AQAB 3Q2WA 2YSTA 2OMZB 3K6DA 1NCHA 4APXB 4NUPA 2A4CA 4ZMQA 3Q2LA 2OMUB 3K5RA 4ZMYA 1WUZA 5CO1A 4QD2E 3UBGA 5KJ4A 4ZMOA 1O6SB 4NQQA 4XXWC 2EE0A 3LNEA 4ZMPA 4ZMVA 3MVSA 5JYMA 5JYLA 3UBFA 3UBHA 2OMXB 1EDHA 2V37A 3QRBA 3PPEA 1OP4A 4OY9A 1SUHA 1Q1PA 3FF8A 4AQEB 4ZMXA 1ZXKA 5CZRA 3Q2VA 4NUMA 4AQAA 1FF5A 2X2UA 4ZI8A 4NUQA 3Q2NA 4ZMNA 3FF7A 2OMYB 2WCPA 4AQ8C 4APXA 2O72A 3K6FA 3LNDA 4AK1A 1NCJA 1L3WA 3LNGA 4ZT1A 4XXWA 2A4EA 4ZMLA 1WYJA 3K5SA 4ZTEA 3LNFA 4AXWA 2WHVA 2OMVB 2OMWB
chains in the Genus database with same CATH superfamily
3VXUA 3FBKA 1XVSA 4KRPB 5ERWB 5KSAD 3NACH 1TOXA 3D39D 3IE4A 2FEEI 2AGJH 3LD8B 1KIRB 4OBSA 4IBVA 4RBPK 4D8OA 3AITA 4A7TA 25C8L 1E42A 5IB5B 4N25A 5HDWA 4AQ1A 4FD0A 5KSBF 1WFNA 3GJFA 3K91A 4LHUD 3GLDA 1NKRA 1KDIA 3O4LE 3CCHB 3QZNA 1ASQA 4RMWA 1RZ8A 1JNHA 5FM5M 1J86A 4WO4A 4OLXL 2YA2A 5LDSA 4PJCA 2DLFL 4UQBA 1BBDL 1TTUA 4A2FA 3BWUF 1Q0XH 1TQWA 1VEMA 3ARGB 4UV4H 4L4TE 3IF1A 4XNUL 2OMYA 4FNLL 3K3QA 1EGJH 3PWLB 4E42B 1LE9B 2VJ8A 1UATA 3WFBH 4OF3A 4NZTH 5MEQB 4X5LA 4TVPD 3FSAA 3FT1A 2YRLA 4KITB 1TJGL 2NX5D 5DR5L 1E9QA 3RAJL 1WUZA 4Z7VF 1LO0L 1Z5HA 2YZ8A 2DH2A 3IMSA 3QEGH 3L3KA 4TLSA 4MJHA 4H44C 2KT6A 4I3RH 4IRJA 2LU7A 2WQVA 2ZT9C 3MCLL 3N42B 2HFFA 3RQ3A 1B4TA 3E7JA 1T5XB 4NFDA 1MH5B 1Q94A 3D48R 1XMWA 1QNZL 3FB5B 3NMEA 5IW1B 1X44A 3FT2B 2OQJB 5DQ9A 5IWLA 3P02A 4NRYB 4N1EA 3ZLQC 5FW8A 3BQUC 5AVUB 2CLRB 3Q8CA 1BGXL 1L9OA 2Q7AA 4N2MA 5K1JA 1NFDE 5DMGC 4BFIB 5IKCA 3WN5C 1NCWH 3NFSL 2EVIA 1JZ2A 4L4JA 3QPQC 1TIUA 2R56L 3K8LA 1MFDL 4A1RA 2YPVA 3BN9C 2RB8A 3RNKB 4WEMB 5CLXA 1RZKH 2VDNL 3WMQA 3HG4A 5I8CA 1R6VA 4L3ED 3DIDA 4Q4IA 5DYOB 1R3LA 2X41A 4QYOB 5F88B 4TUKL 1ML0A 1LP9A 1AGBB 2VDLH 4K23H 3QCUH 1HSAB 1RJLB 2RBLA 4HIQA 3BDYH 3LN4A 4RAVA 5TDPA 5JNYA 3ULVE 1E6JH 1F4XL 1UCTA 4J8QA 4X9FA 3WS3A 3LIZL 3ECQA 3DETC 3GHEL 2D7TL 3H2QA 3LV3B 5M95B 4OB5L 4IRSD 3V6ZB 4KJWC 2V5YA 3HIZA 4BSVB 2NXZD 3CZFB 1GIGL 3IMTA 4PV8B 1A7QL 2LFGA 1A4BA 3L5XL 3QZWA 4FJZA 4PGEB 3B2PA 5AAWA 3DPBA 3MZTA 1AGEB 1W80A 3CXDL 4F15C 3PAUA 2HJLA 2V7NB 2VL4A 4DOHB 3ILDA 1NGPH 2A83A 3OF6D 2CXKA 3TX4A 2G3XA 3RU8H 5GRVL 3BRFA 3AT8A 4W9EC 5D2LA 3IXAB 1TCRB 4GSUA 4FNUA 4MXVE 2NY4C 1KT2B 3STLA 4YSSA 3FCUB 3GXTA 1V7NH 5ADOL 3GEFA 4AI7A 5ECJE 3P9LA 4AJWA 5AB9A 2UX6A 2HX9A 3QARA 4LLMA 3BGMB 4Y4HC 4F7MA 5JUEH 5ALBL 1Q9LB 3FAXA 4H4NA 1SXZA 3WXVH 1DVXA 1TO4A 2ZKXA 5CU9A 1J9RA 4WJ5A 5AUMA 4AV4A 2B1AL 1FYTE 4JDEA 3ZTDC 5AYTA 4Z77B 5BZWB 2BWIA 4X4MA 3WSQL 2PNDA 3OXRB 2KH2B 3KXFB 4Z8FH 5SX4H 4RZKA 5EZOH 3O3AA 4CU8A 2AABH 1DBJL 2MCG1 5E1IA 4WKXA 3MXVL 4QHMB 1PG7W 5HHQA 3E6FB 4QD2E 1AR2A 2HUEA 3F5WB 1VPOL 4R7LA 4GRWB 5CSZB 2Z8RA 3FUFA 2DMCA 1S7QB 3I74A 5C7XL 4XPAL 3CX5J 4L0PB 1J88A 2F74B 2CO7B 1X5ZA 5FIEA 2VERN 2WLJA 3BP5B 1ZHLA 5D4HA 4BQCA 5KVMC 5AALA 4E9WA 5HHXL 1AQKH 1SN2A 2H8PB 1O6VA 4PJBA 3KGSA 3DLQR 5MENA 4ZPVB 2GW5A 4XGZA 3KR3L 4LOUD 3ZZ1A 1RSFA 4WNSA 3MRBB 4PI0A 4G7RB 3WD5L 2ZPKL 1E67A 1K9TA 3VWKA 2DMBA 3HLAA 1OTSC 5ICZA 4NUGL 2YEVB 2AK4D 4MWFA 1WA2X 3VRIA 4BM7A 4R0LA 2XJLA 4MNQD 3RIFK 1EEYA 3WJJC 1IMHC 3SBRA 3DIVA 3KPRE 2XNAB 4U1KB 5IG7A 4QAWA 2WN2A 1FCGA 2E3VA 3KPPA 3P1VA 4YE4L 1AZCA 5CINL 3CSTA 5LBGA 1XF2B 3PWPE 5IVNA 5KBLA 3NTCL 2OMZA 3VQLA 2E8YA 2ZOLA 4EF3A 4HEMA 3EDFA 5MEPA 3SKNA 3QWNA 3G5ZA 4BFBD 3KYMA 1YNTF 1QO3A 1T2JA 2HFGL 5F1KC 5FCUL 4J3OH 5I82A 4HISA 2IPUK 1A8ZA 3VD1A 4BRJA 2F54A 3KD4A 4X8JB 5C0BB 2VR4A 4BBWA 1JPTL 3BT2L 4U7KA 5FYKU 1XSIA 5ES4B 2NYKA 4Y5VA 4LEOA 3IDUA 4KO7A 1OALA 3A3YB 4UTBA 1EQWA 5GGRY 4C59B 1QASA 4HGWB 4KQ3L 5L4FA 1LD9A 3MDJA 4CUCA 2V2WB 2AK1H 3B43A 1ONQA 2BSSA 2ZNXA 3CBJB 3PL6C 3GMRA 3LKQB 2JXMB 1DUZB 1IU1A 1WC7B 3QNYB 3QWOB 2R4RL 5FHAL 2B1HH 2NTFA 5C3LD 1J8HD 3LQMA 1KGXA 1QBMH 2RA1A 4AH2A 1YJDL 2OJZL 5L7XL 4Y2DB 5DK2B 4DN3L 2X1PA 1QW9A 4XP5H 3HPJA 2A9NH 4QLRA 4KC3B 2A77H 3P9WB 1UD5A 3M1BA 5ITFB 4LIQL 4N2LA 5H2BB 1YN7A 1ZVSA 2JB5L 4YFDB 3OHXB 3TT3H 1K5NA 1XFPA 4FQPA 2LLLA 4X7CC 4QHKJ 1IGTB 5A6IA 3WTVA 4NZDA 5IQ7H 1Y0LB 3JV6A 3BO8A 1BAWA 5C0JB 4WTZG 1O75A 2G9HA 3HHRB 1X9RA 1JK8B 1FZKA 2WKGA 1XCQA 2A0LC 2BVQA 3EOYG 3KYKL 3C5ZB 4NQCD 4Y2LA 1YYLL 5EU6B 3RWEB 2NYYC 3IJSA 1TQVA 5G2NA 2MCMA 2J1WA 1E27B 3HC0A 1L5GA 3ALPA 1SJHB 1UT2A 4LSVH 4Y7OC 3S8GB 3D39A 2W9EH 2HKFH 1ULVA 1FPTH 1ZS8B 1NDGB 4B0MB 1KYOK 1Z9OA 1YEIL 2NQ3A 1OY3B 4PGBA 2E74C 5KSVA 5DJXB 4OSUL 4WSJA 4Y4FA 2H26A 4TS6A 1ORSA 5D9SB 5E5UB 1OCWL 4GMTL 4PSPA 5HYJA 4AKPA 5IMKA 1FZJB 2X6VA 1IE5A 1U8IA 4TXVB 1NPUA 2FBRA 4H0HB 3D3VE 3RL1B 2BZDA 2G75A 3ZDYF 4F9LC 3IJYB 1PFCA 3LKNA 1VHPA 4P3DA 2Z31A 1KYUA 1CLZL 1S7XB 1JYWA 1CIDA 1MWAL 2X7LB 1LE5B 4JPQA 4PJDA 3TPUB 3I2CH 7FABH 4XVTH 2VQ1B 5C0EA 3FH8A 3QDGE 2BCKB 2NY2C 1FVDA 4EIBA 3ULUD 3H42L 2VDRL 3DUSB 4JPWL 1N3NA 4IOFD 4DZBB 4Z7UF 2H6PA 2QKIB 3IWVA 4YH6A 2OYLA 4NZJA 4D0BA 1CDUA 2DWSA 5AB0A 5I8OL 4AGQA 4R84A 1FA4A 1YCSA 3TIDA 4FP8L 3UJIH 3F7LA 5J8OA 2DDQL 1HH9B 3DARA 1U8NB 3IN0A 2ZG1A 3TBVA 3UERA 1U8MB 4GI6A 1FC1A 1YC8A 3FO2B 2H9GB 1ODAA 2N0MA 4HUWA 4TVPL 3T4AC 3RPKA 3KPMB 1R3HA 4MHHI 4OT1H 3T2NH 2E7HA 4QIRA 2YGQA 3VA2C 3K6NA 5F0PB 1CIUA 5HJ3A 5FO8B 4X5WB 4Z76A 4ANUA 5J6HB 3K6IA 3O11A 1T4KA 3BUTA 1UD8A 1DLHB 3VJ6B 1A4AA 2B59A 2ZX7A 3S7GA 4S1SH 4NUJA 4CMMA 3G6AA 4FMKA 4Q0XH 5E03A 4HKZA 4JG0H 4CKVX 2JKJA 4NQUA 4LCCA 3AT9A 4DKTA 1H8NA 1U8CA 2WXNA 1A7PH 3GSNH 2WYZA 1CFQB 5EIIB 5AAMC 3R8QA 5E8PB 3ZO0A 2GK0A 5F1OB 2W88A 2EE3A 2W92A 5EDSA 1OLLA 5J89A 1T1YB 1UB5B 4K71B 2VAJA 3CDYA 2R0ZH 2XWTA 2XTJB 4TOYL 3NDYE 5HYSA 3GJEB 5EU3A 4JFQB 3RGVA 3T2LA 2P43B 4NWUL 2GBVA 4PRPE 5EC2A 3LPPA 5KSBB 3MREB 4C4KT 2VDMB 1SDDA 1ZT4A 4NQEB 4FLHA 3MNZA 1QX1A 2XSKA 4EZLA 1ZHKB 2G0LA 1P7QD 2FBJH 3FUNA 1L6XA 5D70L 3HC3H 2X4NB 3CFJB 3CSFA 4ZFZA 3OSKA 5AVYB 4FYQA 1NCUA 2FO4B 3AS2A 3PQYE 4APQD 3VMNA 4XP6L 2VXUL 3SOBH 1JZFA 3QEQA 1E0OB 4MDJB 1M4KA 2XVLA 3IYLW 1ZCRA 2Z7ZA 3GBMH 5HVHB 2EVJA 2ODHA 4G8IB 1Z3GH 2EINB 3OPZH 3IMRA 4Z7VB 3LN5B 1I3UA 1LK2A 1MRCL 3BDXA 2A9ML 1RZPA 3BVTA 5DD0H 2H0JA 4QHPA 4Y2DD 3W9EB 1CGTA 2XWZA 1GOHA 3G5VA 3AJ7A 3R1GH 4JJ5A 4TRPH 5FYKD 3MLZL 1P4UA 1QFWL 5BS0E 1UGNA 3HRZC 3WIHA 2UXVA 4ZFFB 1I75A 2ZONA 4JO1H 1HILB 4BD4A 1K72A 3VD2A 1KEGH 1H8SA 1LMIA 2RQEA 5DVMA 2QQNH 1YMMA 4BUGA 3DJRA 1G7HA 1UVQA 4XPGL 3IGFA 2ITCA 2UV3A 4KK5D 3GT6A 1LP9F 1FFNA 3DURB 5JZ7C 1BF8A 3NJJA 4D3CL 4CKQA 3PHAA 1H6TA 5EU6D 5D2NE 1C08A 1VKXA 3RVTC 3LS5L 3PWVB 4GAAA 2OS7A 4I48B 4YBQD 3K2MC 1E9PA 1RCYA 4KGLA 1YEWA 1D7CA 1E4JA 3BVVA 4IKIA 2CH8A 4FXKB 4LQFH 3Q6FA 5A16B 2AS5M 5KANG 5HVGB 4OGXL 4EAEA 5IM7A 1Z1WA 2A6IA 5DJ8A 4AE0A 1N4XH 2QGDA 3LXUX 4PJAA 5I16B 3A67H 5SX5K 2YZ1A 4D0CB 4WWPA 1OAQL 5HI5D 4KAQH 4KFZC 4HCRL 4N2IA 1WWAX 4KMTL 1UKSA 1Q72L 4I0PC 3JVFC 3AS3A 1G94A 4V1DB 3APDA 1IBDA 1I7ZB 3BC9A 4LEXL 4UI2A 2D7OA 4NNPL 3FFDA 1JZ5A 4DEWA 3U9WA 5KEZA 3C8KA 4FKHA 4LCIH 4ZRGA 3THMH 5CJXC 3Q7JA 5C0RL 1WVZA 3CVHA 3GBNL 1KENH 1KB3A 1OB1A 1T1XB 2CM6A 3QHZL 4JGJA 2ZUQB 4UU9B 3QRGH 4ONGL 5I6LA 3T5WA 1YDPA 4AVHA 3LKPA 5MI0C 4M03A 3O45B 1TR7A 2VM4A 3SKUD 4PLKD 3VE0B 1AAJA 1DSYA 3EOAB 5IR1B 3MFFB 1FO0H 3VGAB 4EBQL 4UNVA 4L4TA 4PJ9B 5HGDA 1IL1A 2FLBT 3FW6A 2KQMA 2VLJB 4GUQA 1YAZA 1F00I 1PD6A 2Y36H 1T20A 5GQBA 3VYPA 1WBYA 3CIAA 4ZMXA 3T6VA 4CNIA 2AI0L 2BOCB 1W72H 2ZUTA 3F6LA 3JXAA 4NUMA 4EN3C 2OZ4A 3QUYA 1FFRA 4PY7B 5DXWA 3NSDA 3SQOL 3TH4T 4PJGF 4S1QH 2V0AA 3HFMH 4P46A 3RB5A 1MY7A 3S3SA 4JS7A 2ZX8A 4ZXBA 1KJ2H 1NUDA 1V3LA 1XH1A 3FSVA 4NQCA 4F37K 5F9OH 3RWHA 4IDJH 1SEBA 2BNQB 2IAMB 3F83A 1GY2A 4DPCX 3EIFA 3UACA 4RMUA 2JCCF 4O9HL 5L2KB 1RLWA 3QFJA 3KPOB 2MH4A 5EBMA 1NFDA 2YEZB 3D25A 3EYVA 1MJ7H 1NM4A 3GEWB 2QL1A 3KCWA 1H19A 3MUZ1 4NM4L 2V9QA 2XKSA 1ZGLB 1BP3B 3ET9F 5FUCC 5IGXH 1I1YB 4YHYB 5CJ8A 2D4DA 1IGFH 4LCYB 4R90L 3MRNA 1W2KT 1HQRA 4HKJA 4XVJL 3VFTB 3N1MC 4Q9QL 4X98A 5L9DH 2AITA 5I28A 2VIRA 5E8NA 4WFHE 4OIIL 3FPYA 3NEEA 4WUKH 3GKZA 2JJUA 4FXGB 4YL9A 3BH8A 4KUZL 4DEUA 3B5HA 4U6YA 1WHPA 4D7BA 5C9JA 2YS4A 4I5BB 4FFVC 4RAUB 4N87A 2Z3FA 4PTUB 3F58L 3N0PB 5CZVH 1BZ8A 1XBDA 2C9PA 2RD0A 3D6GA 2UZPA 1YNTB 4OFKA 1UZGA 3QUZB 5GGUB 2FSEA 1PG7H 3KH4A 3NJNA 5JR1L 5I6XC 3GLEA 2XY1A 5DC9B 3SDAA 4MJIB 2DYSB 1NDMA 4LSQL 3UTTB 2HXAA 2FIRT 1RK0B 5B3NA 3GNMH 2AZAA 3A23A 3EFFA 1QSFE 1NCHA 3SDXA 3ARBB 4MD0B 4D9QD 4KRLB 3QR0A 4OV6F 4PI2A 5D4JA 5KVDH 4AT6A 3FULA 1PY0A 2X89D 5L2JA 3C8HA 5BVPL 5D8JL 3POCA 4Y1AE 3BAEH 3IU3A 3MLVL 3KHQA 3W3BA 1FZMB 2NXYC 5I18H 3PXHA 2DYPA 1F4HA 3Q5TA 3NPSB 2WLKA 4G8GD 4LL4A 4J3TA 4Z7QF 2NY5C 3AGVA 2AXJA 2V33A 5A2IH 4IJTA 3ZTJG 2AEIT 3GZKA 1CF8H 4PEEA 1D5ZA 3KPTA 1FYTA 2VL5A 4ZPTB 2OCJA 4OLVH 4U1GC 3ULUL 3SPGA 3L81A 2B15A 1K2DB 2O5XL 2OSLB 5ANMB 5I1IH 2EH7L 5H37A 3CD4A 1I1AD 1MCPH 1S5HA 3OR6A 2IGTA 2EDDA 2C5DC 2JKNA 1UXMA 3GGWA 3KBPA 3BWAB 3ELAT 2NUPB 2GJZB 3V6BR 4C56E 1DQJA 5FUCE 4Y5YB 3MLTA 4HIEA 5I73C 3MMEB 3OHMB 5HXMA 4O2FB 1DFBH 4TQEL 3QB7C 4UUJA 4LHUG 4WENB 1TZIB 3GSRA 1AKJB 4OUUA 5ISZD 4PJ5B 1OGTB 3SIKA 1KJ3L 4F7TA 4KTYA 1N0LB 1KBVA 4GW1A 3V79C 1RULL 3SCMA 4IIQB 3QJHA 4DFIA 5F9JA 2HLEB 5HHNA 3TA3A 4HLZG 5GRXG 2NR6D 1EBPA 3ZSTA 5BRZE 4X4XB 2XQYK 3DSNB 3Q1SL 2EDXA 4N90D 5KVFH 5GISH 2YD7A 2QPFA 3CFKA 5A1AA 2IEPA 1JE6A 3ZDYB 2LE9A 3V0FA 3I75B 3MJ7A 2J44A 4XI5D 2FX9H 4HBCH 3C5JB 2R2EA 1BMGA 3BJ91 2GQHA 1IFHH 3WXWL 1FCCA 3PWPA 2YPLB 2F7QA 1BVNT 1OV8A 2E59A 1NCAL 4H8WC 4P06A 1S7SA 2X1XR 1HHJA 4H40A 2Q87A 4ZSOE 4PBDA 3FB8B 3HC4L 3BLBA 1E4KA 3MKGA 2R1XA 4J1UB 3DRTB 4LF3A 5K9OB 1BZDA 1NCCL 4HUNB 2P5ED 4LB8A 3UO1H 3ZVVA 4F93B 4H26A 3C60D 4Z95H 2IGFL 2B1OA 2K8QA 1YEKL 4S11A 3QUMH 4Z7UB 2V2TB 2X6AA 5DC2A 4F8PA 3L6FA 1AZNA 1E3XA 4EQ3A 3X13A 3UYPA 3IDGB 4K5MA 3MV7A 4OI7A 5JPMB 3GSVB 4M4RA 4O5LH 3TIEB 2W07B 1C7SA 1F18A 5EEWA 2QELA 5IVXA 2WV3A 3EBGA 3CHQA 3CX2A 2Y7SA 3EFDH 2FJFB 3ZHDA 1OK0A 3NP4A 1AQMA 3TFKC 1G84A 4LGPB 2O6EA 1O6SB 3O2WL 2X4PB 4X7TB 3O2DL 1D9KB 3M45A 4K8RD 4F57L 3FMGL 3MLSL 1UYWL 2EYTB 1M1XB 4OJDH 1B0RA 1M7IA 1QA9B 2X09A 4N8CH 4HUXB 5FLVA 4POYA 4N22A 3U6RA 4JREC 1FORH 1KFAH 3D9AH 2BSTB 1CBVL 5FYKL 3H9HB 5FR3A 3VXUB 2J4WL 2CBOA 1HSBA 1QABA 3VFMA 4N8VG 1NEUA 1HHKA 2FUQA 4GO8A 1LK3L 3DHUA 1F11B 1G5AA 3U79A 3GBEA 4AQ1B 4Z5RA 3GJFB 3C87A 4AL8C 5AW3B 5GGSB 3ZIYA 3WLWC 2E27L 3O2VL 3BPOC 1DN0A 1JNHB 1RJYB 3PJLA 1ZLEA 1A6VH 1G7MB 3MI6A 3L9BA 4PJCB 2YGOA 3IF1B 2OMYB 3MJ9L 4LGRB 4YZFF 5D71L 2JJWA 3OG4B 3PFUA 2ZCHH 5E8OA 4E9LA 3OLDA 5I30H 2EADA 4MJID 3UH8A 2FATH 4H0GA 3BZ5A 4G7VH 4MBOA 1E9QB 2C9QA 1N59B 4FFTA 3KWVA 2JJVA 3UEQA 3L3KB 1PMYA 4IRJB 2DIAA 4V2BA 3K5SA 4IU3A 5CZXC 2J55A 5IHUH 1Q94B 4Q9CA 2XZQH 3FQYA 5JOFA 5K9QG 1JZ3A 3RA7L 3D3VA 1H5BC 1JHLH 4JUTA 2OPCA 1RMFH 2UUDH 1RERA 3MRDA 4JFVA 3CSYB 2I85A 3EGDA 4LVHC 4NRZA 2IDQA 4RFNC 1AANA 3PNWA 2AC0A 2C9XA 4A6YA 2WB1A 5IKCB 1D6VH 1SXCA 1S9XA 2CPUA 3O6KH 4B9ZA 2RTTA 2GTQA 1NPJA 1U9KA 3OM3B 3QDGA 4LOVA 1NEZG 5I8CB 4ZFGL 2DRUA 2HTKC 4I18B 3DX3A 2VXTL 5CLYA 3L1EA 1CTNA 4RNRB 2OJEA 3M17A 1L0XA 1VFBB 2CHDA 3JWNE 1R17A 1LP9B 3DMMC 3IWUA 1RXLA 4X5XB 3X1FA 4RAVB 2PW1A 5TDPB 3WL9A 5JNYB 4LVOC 3WS3B 3C2SA 1W0WA 3LDBB 3B2VH 4PJAF 5IBUB 5JIPA 2CJUH 4U49A 1AQDA 5EIVA 2QTVA 1EAQA 1AYOA 1TVBA 1RJZA 1CVRA 3QZWB 4PJHA 5D1XC 5FUOL 3DPBB 3WS6A 2M83A 3H0TA 3I6SA 4BSWA 1T7XA 2HJLB 3KJ4C 4NHUA 2AXWA 2A83B 1FVEA 5FS5A 2VZOA 1JRHH 4ACTA 4K2UH 4U3SB 5EEUA 2F61A 3EUUA 4DQOH 5B4MC 5CD3A 4WHTA 1UA7A 5IOKA 2G3NA 3BKMH 4GSDH 3STLB 2TSAA 1GGTA 3SBQA 2Z64C 3BRGC 3D2UD 3P9LB 4I9XA 4FI7A 4LLMB 4ACPA 5F89B 4F7MB 5F3BA 1IC4H 2OXGB 4V33A 3TT1L 1H0DA 4YDJA 3GIVA 1BLNA 1KJMB 3LPFA 4WJ5B 1ETJA 3JTSB 1QWNA 1UUNA 5GHWH 2EE6A 3DTDA 3MRLA 5E4EC 1DCEA 2WCPA 4HDIA 3VWJD 2F5BL 4FHBD 5INDB 4P9HH 1ZT1B 3K6FA 2BM3A 1SHWA 1OAKH 4NLHA 2FJGA 4S1DD 5KTEL 2APSA 4OLWH 4UNTA 1OB0A 3GO1H 4U6HA 4MGXA 2VAAA 4JDVA 1OL0A 4U1NB 3PQYA 4HIPA 1E6OL 1S7RB 3PGFH 4NS0A 1CR9H 3PV6A 3FO0H 3VUAA 5KUKA 1E65A 3C8DA 1BFVL 2CZNA 4WGKA 5E6IA 5LKNA 1ZHLB 4FMFA 1ZT7B 2YRBA 3KCPB 1EMTH 3RKDC 1LO5A 2IWEA 3SPJA 3EG9A 4BIKA 3B9EA 5MENB 1NFDF 1Q9KA 1GGIH 4XGZB 1KIQA 4PJGB 1WZMA 2PP9A 3RZCD 3CZGA 4YHMH 3VWKB 4S0HA 3D08A 1NMCB 4DCQA 2J57A 3HLAB 1WFUA 4GAJL 5ICZB 3UGUA 4MWFB 3AY4A 5A2AA 2GHZA 1GGBH 3OAUH 4L1HA 2EDBA 4R0LB 3AROA 5PAZA 3QA3A 2DWTA 3QI9A 2Z7YA 1EEYB 1QRKA 1CXKA 3RTQD 2N59A 2K8MA 4YHLH 5IG7B 2YSSB 3KPPB 4WW1A 4WWKC 3X1BA 4JO4L 4AYFA 3CZLA 3X1NA 4S1RL 4A04A 5ISZA 4DJMA 2OMZB 1OAJA 4Z3GA 1XR8A 2ZOLB 3IGAB 5D1XE 3ULVF 1FDLL 4FG6C 5D2NA 4IHBA 4JMXA 4JPVH 5MEPB 3G5ZB 3SKNB 3WO3B 5E6RB 3KYMB 4PRAA 5BQDA 4KRNA 2BIOA 3GIZH 4HIXL 2L4OA 5BW7A 2NR6A 4WEBH 5ESQA 3CVCA 3KWUA 2NY1B 5DUMH 3ABGA 3EJJX 4PB9L 2CCWA 1J9QA 2F54B 1F4YL 2EDMA 3TBTA 5IFJA 4Y0GA 4Y5VB 4LEOB 3ISRA 3W39A 3UAEA 1E8ZA 1ID2A 4GRMA 2E4TA 2OMWA 3M86A 2W95A 2ZKHH 4RRPG 1KB5A 4BH8A 4O02A 5DDHA 3ZZSA 3F6IA 2BSSB 3MRFA 5DEJA 4U4BA 4NPYA 2BJMH 2CDEA 1NOAA 3GMRB 4MXQC 2X4QB 4HS8H 4MXVF 1JS4A 2DQUL 5FA3A 1TEFA 1AXTH 4DGVH 4M7KL 2NTFB 4XPTH 1X5YA 2CBQA 3TWCH 1KCSL 4BQ8A 2Q0ZX 1CK0L 3H6JA 3NJLA 1OTUC 2Y07L 1XL6A 3WUWA 4R6UA 5D4IA 3HPJB 4EI6A 3BPCA 4RA0C 5ESVA 1I8KA 1FNLA 3PAVA 3RBGA 1YN7B 1ZVSB 2BS9A 1QHQA 1DQDH 3KPQA 1K5NB 4DKFH 4OGYH 2LAAA 2FDBP 5LUMA 2E6JA 1SLVA 1XAUA 1JZ8A 4EQ2A 1EZLA 4GW4A 5I71B 1A1MB 4Z7QB 3QIWA 2G9HB 5TQ2L 1FZKB 4LSUL 1KB5L 2N7AA 4FF9A 4UTAA 2BVQB 4M02A 4OCWL 4U1JA 3GMQA 3HVDA 2FGWH 2J8UF 3AGWA 1E8YA 5CSBA 3ARSA 5I0VA 1GC1L 4KPHL 3IJSB 4JQIA 1YEFH 2A1WH 3HC0B 2DBLH 2OL3L 1WICA 2X4SB 4NFBA 3TV8A 1NGWA 1W16A 4JJOA 4YWGL 1VEPA 5FWRA 3G9AB 1HINH 3QORD 4IRZL 3X12A 2WW8A 2VABA 4P5SA 5KSVB 4XAKE 4UIMA 2H26B 2CLZA 2BXZA 2IIJA 5D7JD 1ORSB 3PWUA 2QADB 4RLDA 5FYJU 3IXTB 1KCRH 1BAGA 3GSUA 3K2UH 7CGTA 4WU5A 5HYJB 5IMKB 1MFBH 2HVBA 1YEGL 1U8IB 3ZDZE 3MRCB 5F7FA 1T0OA 4AMKL 4HD5A 5BV7B 1NGQL 3U7AA 5I9QC 1LDSA 4K8RL 4RESB 2G75B 4KI5C 1IBBA 4R7NA 2D73A 1O7VA 2PR4L 1LHZA 1OQOA 2CLVA 3GF8A 4ODTH 4PS7A 5GSRA 3SZKC 1UH3A 3SPIA 4P3DB 1TG8A 2Q8AH 1KELL 2XETA 3WNIA 3NN8A 5GRYA 1XIWB 1BWWA 3RKPA 4W1TA 2ESVE 1I9JL 2K7PA 3L3GA 1FVDB 4G5ZL 1FNEB 3V5HB 1N3NB 3RFZB 2JQZA 4BWUA 2AJZB 1JI2A 4NI3A 2O4EA 3L4ZA 2H6PB 1DANT 3NABH 5I26A 3WI9A 4FNTA 5IQOA 4D0BB 1PDKA 3MOBL 2I7SA 5HJGA 5HPMA 2E47A 5DGRA 3GLAA 4WNJA 1F58H 2PF6A 5F71A 1FUNA 1U8QA 2KYIA 3TIDB 2J43A 4PPTA 3UBFA 2CR0A 4OCYL 3BYTA 4EE2A 2WUBL 2YD6A 3TBVB 2RMNA 1I3GL 2YRZA 1VGEH 3FKUS 3QJVB 2O5YL 2HWZL 1UUSA 5J13B 1R3HB 3V4VB 2H1LM 2KMWA 4Y5XC 2EUWA 2ZQKA 1QSFA 3CZNA 1MQKL 3BP6A 3CDZA 4ADGA 2YBGA 5HJ3B 3EFOA 4ABVA 5KBKA 4M29A 1S9YA 1E2ZA 25C8H 3O11B 2ZXEB 1T4KB 2G5UA 2H6UA 3AB0B 3KDMB 1P4BL 3B9DA 4K9EL 4QJ5B 1OPOA 2YAOA 2I9LB 1S7UB 2Y25A 3G6AB 4OLXH 1PZDA 4KVCL 2DLFH 4R5XA 1BBDH 2Z35B 4HKZB 4GSXA 4M7ZC 4AQ8C 4Y16A 2WXGA 2O72A 2VSCA 3BGFC 4YHOL 4QRSA 5E2TL 4O58L 3EH3B 1U8CB 3QDAA 4FNLH 3U1SL 1P5UB 5LG1A 4FDWA 3WDIA 1L9TA 1TQBC 3MUUA 2D03L 4PR5A 1U21A 4JRYE 3QIUB 5B38G 1TJGH 1FFTB 3A21A 5DR5H 3MSPA 3NCYP 3RAJH 3QISA 1P4LA 3RIAK 4EIGB 5JMOC 3QUXD 1WUNT 1P53A 4M4PA 5HYSB 5AKTA 3MCLH 4NNYB 3RGVB 4A38A 2NY1D 1QVOA 1HCZA 4IGBC 2XHNA 1QNZH 4JFDB 3BSGA 1SDDB 4CSTA 2F1BA 3PAZA 2YLKA 3LJ3A 2EJ1A 2ZF8A 3SQBA 3D2UA 4H2CA 2D31A 3CC5A 4C56A 5HVWA 4ZFZB 4N2EA 2ITFA 1SEQL 2YD5A 1F3RB 2YAPA 1PW3A 3MUHL 3NFSH 2WBXA 3QUGA 1EIBA 5DQJA 3CSPA 5TDOB 3QEQB 4B53A 3LQAL 3COOA 1MFDH 1FE8L 4NZUL 2TRYA 2VDNH 3MRJB 1T0PB 4BZ1L 2BHFA 1KN2L 3NCFB 1LK2B 2IDFA 5I1JL 1NGZA 1ETA1 3RWFA 2OI9C 1F8TL 4TUKH 2IBGA 3UPAA 4JJ5B 3D4ZA 3HJEA 4H8PA 4EOWL 2ZF9A 1XMEB 2Q3AA 2B3RA 3SO5A 2VDQL 4YBHA 4YXHL 3QDME 2ROXA 4DH2A 5BVJA 4KKCC 1F4XH 3J27A 3SYQA 1FAIH 3LIZH 3BP4A 1E30A 2XN9D 1YMMB 1FH5L 1ZE3C 3UL4A 1ET7A 4A2GA 1EDQA 3I85A 1UVQB 4P5TC 5D96B 2E7LA 2ITCB 4OCRH 3UG4A 2YN5A 1GIGH 2X3BA 4G9FB 3UC0L 1A7QH 1M53A 4ZSOA 3L5XH 4EI5A 5DMYA 1T83C 2BC4A 1P7KA 3MVSA 1C08B 1KBGL 1VKXB 4ONFL 3UTPE 3CXDH 4XBPB 1I31A 1E9PB 3WNMA 2NRDA 5FHBL 2B5IB 3HB3D 5LGJA 2YGVA 3R4DA 4IKNA 4PRHD 1GOGA 5F7KC 3MCKB 3Q6FB 2R29A 1EV2E 1AO7B 1KF9B 3RPIA 1EANA 3EJZC 4HUMB 5IM7B 5DJ8B 1QHPA 2IDSA 4JM2A 4YQXL 3IDYC 2AFNA 1MCCA 4XX1G 4XZ4A 5ADOH 4PJAB 5A2KH 3BVUA 5DGQA 3RGBA 4F27A 3GHBL 4XMKL 1WG3A 1U92B 3WY2A 3O6FB 3FTZA 3P0GB 3G9VA 3BESR 2RJMA 4PJEE 1P6AB 2OAAA 4Q97A 3REVA 2B1AH 5BJTA 3P77A 4FYSA 2P8PA 3FH7A 1XZ0A 3WSQH 3FFDB 1VACA 3LB6D 2H0EA 3B2MA 1MAML 2A4EA 4Z7IA 1JXGA 2XWRA 5T1MB 1J0IA 1DBJH 1A4KA 3MXVH 1MFAL 1W8EA 1OP5H 4WFEE 3L5HA 3TGXA 3C5XA 1CE1L 1DLFL 1VPOH 3CVHB 4N0CD 1G7LB 1Q9WA 3AM8C 4LLVB 5FYJD 5C7XH 4XPAH 3I50L 3LKSB 4AJVA 1ZLSL 5G5DB 1E4WL 2DIEA 1G9NL 2DS4A 3LKPB 2X1WL 5T1KD 5HHXH 2KDGA 1UD2A 1DJYA 4UYQA 3VNYA 3FCTA 2BSBA 4L4TB 5HGDB 1N5YL 1IL1B 1P0SE 3HI1A 2XYBA 3KR3H 1TVHB 2ZPKH 5IB2A 4F8QA 2K4WA 1T20B 1WBYB 1ZY9A 2EZ0C 3FONA 4CNIB 3L3IA 2IPTL 1I8LC 5DFTA 4AJYV 4NKOB 2XPZA 3QUYB 3H2PA 4JY4A 4ZMTA 1WZ1L 1Q90A 2CDGA 5CKAA 1JHTA 3X3GH 5IMOA 1SVBA 4YE4H 3ULUC 5INCA 4ZXBB 5K69A 1KN4H 3RWHB 3NTCH 2VC2B 4DVRL 2V5TA 3TF7C 3FTGA 2PP8A 2R0KL 2ATPA 4M5YL 2HFGH 2ZUSA 3DI3B 2UUDK 3GDCA 1NFDB 5JIMA 1I3VA 3EJQA 3D25B 3EYVB 3GMNA 3A4EA 1GHFH 4MQ7A 3VSQA 2FHBA 2EC8A 2X4OA 3WJMA 4NN6B 2WWNA 2O61A 1JPTH 3CFCL 5EOQL 3ARFC 3MRNB 1FHNA 1HQRB 3P3YA 3PV7A 4HKJB 4W9GC 3KEHA 3VFSA 3CBKB 3QIUD 5D7JA 1G9HA 1EHNA 1R9FA 5E8NB 1CLYL 3F8UB 1CFNB 2ENSA 1SZNA 4YFLF 4KQ3H 5IZ7A 4B41A 1M2VA 2F7PA 4U6YB 3UAFA 1B2WL 3O9WD 3QE5A 4OZFB 4S10A 3FFOA 1EDYA 5LXVA 2R4RH 1SUHA 4NO0A 5FHAH 3F2LA 4NJAL 1L9SA 4DKAA 1MVYA 3WNOA 2OJZH 2FSEB 5L7XH 1BREA 1FG2A 4L4VA 1CD1A 3QIBB 4O4YL 4DN3H 4HG4K 3CHSA 2YKKA 3HTLX 3NJGA 3V4LA 1U3HC 3SDAB 1NDMB 1PJ9A 2JB5H 2EDTA 5CHNA 3SDDA 4GXVL 3BZFB 1TTCA 4ZQTA 1FL6A 1WFOA 3EFFB 3L5JA 4GUCA 4HGKC 4PM1A 1VZGA 5MERA 1SMAA 4XCEA 5F72S 4UM9D 3U2JA 4AT6B 4CVZB 1PZBA 3NSFA 5L2JB 2XPGA 2FAUA 3WV0A 2WZ6A 4YO0A 3KYKH 1BM3H 1ND0A 4WHDA 1YYLH 3HR5B 4MQTB 4EI0A 3G5XA 1BQRA 3B5GA 5ESAA 2HMID 2DYPB 3GSXB 2B4CC 4N0UE 4LP8A 2GI0A 4F5CE 2OV0A 4JPIB 1MXGA 4G9FD 2NZ1A 2WANA 4P2YA 1D5ZB 1FYTB 3GWJA 1YEIH 1ZLDA 2GIXA 4OSUH 1DBML 4AQEA 5F96L 2YRPA 5FGRA 2DQFA 1GTNA 1AY1L 3ZTJH 4JW3A 1OCWH 4GMTH 1CDBA 4CVUA 2WSPA 3N04A 3ARDC 1S5HB 2Q8BL 3OMZA 3OR6B 3I9GL 5ACZA 4PW9A 5EO0A 2Y06L 1AO7D 4TVUA 5E00B 4ZFOA 3GGWB 4PUBH 4RMRA 3KPNA 1CURA 3O6LH 1E8XA 1F41A 2K3HA 35C8L 2F53E 4ADIA 1CLZH 4HIEB 4GY4A 2J71A 2VUKA 2GJ6E 3EJSA 1E9OA 2N01B 3EJYC 4N2DA 3BCFA 1F1GA 2CGRL 3FQUB 2AEPL 2WWMD 4XMXA 2WWKT 5KAQF 3GSRB 2J8HA 4FQ2L 4PGZA 1A6AA 4XHJD 3VNZA 4I85A 1N18A 2B9BA 2VDRH 3H42H 4JPWH 4NAMA 4F7TB 2GPZA 4GW1B 4XC1L 1RL1A 5FDWB 1BYNA 3PHQA 1UB6A 2J20A 3SCMB 1RK7A 3FQ4A 3QJHB 1QSVA 5HHNB 3TA3B 3VSTA 5KVEE 4Y19D 1M7UA 3OKKA 5EG6C 3G3LA 1CJYA 3SBWA 2HVJA 4G82A 1SMDA 3KPRB 3SKOA 3UBXG 5I8OH 3MJ7B 3H8NA 4HLZH 4FP8H 3DTXA 2DDQH 4XN7A 4Z7NE 5SWSE 1MKFA 3M7FB 3PWPB 1I85A 2KUTA 3O4LD 1TZGL 2P1YA 4TVPH 4XN8A 3PJSA 1HHJB 2QV2A 4LBEA 4G6AD 1KTBA 2R1XB 4LF3B 4ZAKC 4UQ3B 1QLRA 4ZW5A 4H26B 2VR9A 1YY8B 2MNUA 4G83A 4FJ6A 4P23D 3O4OC 4AQAA 2O5ZL 5DRNA 1HEZA 2YXFA 2JI1A 1I9RL 1QKZL 1DQQB 2ILLA 5IB1A 4PRNB 2BSCA 1GL4B 2HT3D 2ZKYA 3L6FB 4JFOB 2F7IA 2NY4B 3X13B 3UYPB 4X99A 1HDMA 4WKZA 5E23A 4ZMAT 4ENED 1BZ7B 3DOIA 1JNNL 4Y2OA 3JV0A 3JQOB 5I23A 4ZW3A 3II1A 2VN7A 1H6EA 5LNDA 4OIAA 3EJRA 2C3XA 3T1FA 2PTTA 1FRGH 1WYJA 3UZEC 4BHUI 1ZIBA 4NZ8A 4TOYH 2GVYA 1M7IB 2D0GA 1KGCD 4NWUH 3RB7A 2FECL 4M1DL 3UABA 5D1ZA 2HCZX 2APWA 1JGEA 1NCIA 2DMKA 3ABZA 4KU1A 1NANI 1HSBB 1IM9D 3ZMRA 4IBWA 4QWWD 3VFMB 1GYWA 5D70H 5C8JA 2B2XH 2A6DA 3MRKB 4LLYA 4PMEA 3CHXA 5F1SA 5JIKA 1UENA 5DO2D 2VUYA 5J12C 3SE9L 3VFPA 4Q7DA 4Z5RB 2ENJA 2EDOA 2AJYL 1JZGA 4XP6H 3TO4D 2VXUH 5KVGE 5I66A 2XV2A 4YAQB 3GMMA 3BAIA 3QSKB 3VGGA 3CUPA 4XCFL 3ULVD 1T6WA 1AS8A 2RHEA 4OLZL 3ZE2E 1J5HA 2OYPA 1UA3A 4CSSA 3QG6A 1FNAA 1N8ZA 1MRCH 1N0XL 2PXYA 4KBPA 3QIBD 3O3BB 4JNXA 5JO5A 4TMPA 5E8OB 4J12A 3L4UA 1J5CA 1ZVHA 1QFWH 4JKLA 4BGLA 3GMLB 3AREA 3C09C 3KVQA 1U33A 4JFFE 4WCYL 3OXSA 1XH0A 1L3NA 1T5KA 3GRWA 3X2QB 3QT2A 3F3HA 4IU3B 4FZEL 4ZOBA 3D85A 4XPGH 2BY3A 1YQ2A 1NBZA 2R23A 5JOFB 4J3OC 5C0CE 4FFYA 1QI4A 3D3VB 4ABWA 2HLFC 4XNYL 1WBZA 4D3CH 3E3QE 3MJ6A 4LARL 3MRDB 4MCYA 5GGTL 4NRZB 1XWVA 2IPKA 3S98A 3SY0B 1PD0A 2ZAGA 2I5YL 1DQIA 2GSGA 4NO3A 4XNZB 3L16A 1L6ZA 2E7CA 3DVGA 4MS8C 1MLBA 3UDWC 3NGBB 4AVKA 1S9XB 3N1QC 3N9GL 4F8LA 4CILA 4DVBA 1UHVA 3FHQA 3QDGB 2ESVA 2WTOA 1U8OA 2ZKMX 4NN5C 4OGXH 3JWDC 4H88L 4W9HC 2P5WE 1H3WM 2Q5BA 4FN0A 4CSPA 1ILUA 3TN0C 1NINA 4D0DA 5FYJL 3PL6B 5D4QA 2M2DA 4XVSL 5F7MC 3BEWA 1WEJH 4PCTA 1GTFA 1KB9J 2HTLC 3M17B 4L2LA 1OAQH 2VJXA 1IGJA 5FX3A 4NYLA 4DESA 3BISA 1G43A 1P5VA 2WQXA 3OKDA 4HCRH 4KMTH 4NFCA 3WL9B 2PW1B 3BQUD 1DP0A 4FFYL 3F01A 4PV1C 4YEEA 3OD3A 5DMGD 5DZNA 1W0WB 4IMKC 1N12A 2XG4B 3KYOA 1DVZA 4HEPA 3T0AA 1AQ8A 4LEXH 4NNPH 2D7NA 4ZMLA 1PSKL 1INQB 1DVFA 3TYGL 3QPQD 4Y9CA 3O81A 1JWUA 3BN9D 3V4VL 3K4ZA 4RA3A 4GW5B 5C0RH 3H9HA 3H0TB 5E6SB 3GBNH 2FNBA 2YAQA 2WQWA 4BSWB 1MCIA 4GS7B 2X9YA 1T21B 4NHUB 1RPKA 3Q8BA 3QHZH 3RWDA 3SSGA 3WFDL 1FVEB 4XPBL 4ONGH 1CFBA 3EF4A 1R34A 1A2YA 4R4FH 4EZKA 1OCCB 5AD0A 1K8DA 2GTZA 3DETD 3KLQA 3IU4L 4LOFA 4WHTB 1CICC 1ZDQA 3BI9X 3JBG7 5TDNA 4EBQH 4QLWA 3K6SA 2ZX5A 4KJWD 4F9PA 3V4PB 5K1NA 3RRQA 3QDJD 4DP5X 5EC1A 5E2VL 3WEAA 4QJ4B 4EKJA 1R33A 1OOWA 4MA7L 1H0DB 4YDJB 3GIVB 1BLNB 1BJ1J 3MRMA 2VDOL 1JZ4A 4F8OA 4YSCA 3FSOA 2YUVA 4UM9A 3SE4A 4O00A 1L9RA 3MRLB 3J2PA 4LL9A 4HDIB 4PRPB 2DQIL 5DHMC 3ULAB 5H94B 3L3OA 1AZUA 2D8KA 4U33A 2JNZA 4DGIL 2FJGB 2WXQA 5EBLB 2X2IA 4XP4L 2WN3A 4X0KA 1BHGA 3S96A 4O9HH 1BPLB 1HAWA 4WGVB 4BE6A 4MJ2A 4NQQA 2VAAB 4JDVB 3KPLA 2OTUA 3PQYB 4OCXL 4Y4HD 6PCYA 3WFEL 4P49A 4BUQA 2GUOB 1JXKA 1X5IA 4XXDB 3MNVB 4GBXA 4GRLA 5E6IB 2CBMA 4R90H 4XVJH 4OD3L 1HI6A 3EG9B 4Q9QH 2Z8SA 4K7PL 4XAWL 3PIQA 4OIIH 4P5RA 1R47A 4QTFA 4XOCA 1KIQB 3QJQB 2OZ4H 3FQNB 4QOKD 3SDCC 4KUZH 3NH7L 5HHOD 1ERNA 4HV8A 4DCQB 1G0YR 4NQXA 4AENA 5BS0B 4H0IA 1CE6A 4JN2A 1SF3A 3F58H 3QDMA 2X12A 4IBQA 5E94A 2ZG3A 4XVUC 3L9RA 2SEBA 3HG5A 3BWSA 4WW1B 5JR1H 4TSAL 3T4AB 2BOLA 2Z1PA 4AYFB 1M57B 2ZX6A 3OAZH 4AVIA 4Y1SA 2GT9A 5CJOL 5D2NB 2HX7A 5I1LB 1JHKL 4PRBA 3FYIB 4YK4B 3KEDA 1TFHA 1T89C 5ESQB 2CXGA 1OTSD 4P2OC 2L3BA 5DVLA 3A6CL 5C0FA 5BVPH 5D8JH 2EDLA 1P7BA 3TBTB 5B8CC 5GRVK 1SY6A 2WHVA 1PY9A 5FA4B 3W39B 2HG5B 1EAJA 5MHSE 4GRMB 2K9UA 3MV9E 4GG6A 2OMWB 3C5SA 2X6MA 3PHOA 1G6RL 2VGLM 4YVNA 4BH8B 2DKSA 1T1ZA 4O02B 3ESOA 1P9MC 3QZBA 4NPYB 2CDEB 3STZB 5FA3B 3B9KA 4KRPC 2VXSL 1CT8A 4PJEA 5BO0D 3O3DA 2ERJB 1JP5A 1HL9A 3T71A 1AZBA 4ZBJA 3LD8C 2OR9L 3ULUH 4DK5A 3CG8A 4UOQA 2C9AA 5L8JB 1XCXA 2O5XH 5E56A 3RDTA 3WUWB 4L9LC 5FM5O 5HBBA 3Q8AA 4EI6B 5ESVB 4G7YL 4ELKA 4F92B 2A74C 4Q58C 3VVVA 1R1CA 5GJSL 2AV1B 3KWXA 3KPQB 1A9BA 3DHPA 4YPGA 3T2PA 1AC6A 3ATFA 4AKQA 1MCLA 3ARGC 4FQIL 1F2QA 1PYWA 4JGNA 1SY6L 3BT0A 5BXFA 1OP5K 4GW4B 5E9DA 3PL6D 3BZ4A 5LAPA 3VXSE 4Z6AT 2H1XA 3QIWB 5KYWA 4V2CB 4G8EA 4J3XA 3T4YB 3MNWA 4TQEH 2BRRL 1KPVA 2FT7A 5L8KB 1BF5A 1HOEA 2YD4A 3L4VA 4U1JB 2VSDA 1M3JA 1NGXB 2ZYRA 3LZQA 2Z4QA 1NGWB 2OMVA 4UCFA 4HQQL 1RULH 1T7ZA 2R0WH 4M56A 1RIHL 1FLRL 3CZUB 4YLQT 4BDVA 3ZR5A 5JPNC 2IQ9L 3NAAH 3S9DB 3Q1SH 2F58L 4YLBA 1ZIAA 4LDEB 1F6AA 2XV6B 1EEQA 2VZ3A 4UIMB 3HS8A 5BUGA 4EUPG 5DD5H 3VXME 3WXWH 1A6ZA 4YDLB 4PRIE 1NC4A 3PS6A 3S2CA 3GSUB 4WU5B 1QRNE 2A0LD 5HI3C 1NCAH 3FOMA 3ZKND 4Q9RL 1ZA6B 4HU2A 3FT9A 3HC4H 5SWZD 2Q86A 4R7NB 2KLSA 2J6WA 2UXFA 2CLVB 2HVKB 2IGFH 3GSOA 3UX9B 2JLPA 1COBA 4AGOA 1YEKH 2W1NA 3LIUA 1J5DA 5C08E 4HJGB 4KXAA 1B4JH 3FN3A 4MMYA 2XUWA 3IAGC 3MJ8A 1RH8A 3LNDA 2MIZA 1AHWC 4MZIA 2BSRB 3SGDI 1I7TA 1BZEA 3L3GB 3FQXA 3GQFA 1SHSA 2GFBA 3Q01A 3FJTA 1RHHA 2IADA 4TNWK 4PGDB 3S36X 4U6VL 1T0NA 3MV8E 3CFEB 4P8QA 2A2QT 3FU7B 4MJ5B 4CC1A 2Q3ZA 1PDKB 3O2WH 2NNRA 3ULVL 4KX8A 2X6UA 3O2DH 4ZOEA 5HPMB 5IHBA 1JPEA 4BA8A 4F57H 3FMGH 3BZEA 3MLSH 1UYWH 1U8QB 3LZOA 5ECGA 4F8NA 1ITCA 1U36A 3L4XA 5IJKA 1Y18A 1KPUA 3MQIA 3CVBA 2ZXQA 3LEXA 4L8DA 5CFHA 3R4RA 5FYKH 3S37L 1CBVH 5H4ZA 1N6QL 3K7UA 2J4WH 4GKOA 1C5CL 2NY2D 3ESNA 4GLRI 1QSFB 4HMCA 3X1EA 3BP6B 3CDZB 2WC7A 3HG1E 2KL6A 4HK0A 1GR7A 1LK3H 4IKKA 1I53A 3EFOB 4UDTA 4WNQA 4WJKB 4J23A 1S9YB 2WLLA 3U48A 3HAEA 1YAIA 5J06A 1BDYA 4JG1L 5MI0B 2E27H 3O2VH 4MB5A 2G0KA 4Y1AB 3W0WD 3W1ZA 1BVNP 3LHPL 5BS0D 4EPSA 5I0WA 4NC1C 4XC3L 5CWSA 1JXJA 1SXAA 4Y16B 3V7AE 4N0UA 4HUVA 5E9NA 3H2WA 4QRSB 1A4JA 3OJ2C 3MJ9H 2LV4A 5DUPL 5D71H 4F5CA 3SEPA 1WWCA 4M5ZL 5IEHA 3US9A 3HZMA 1BQSA 4XH2B 2P24A 3QR2A 1RUML 2WVVA 1UFGA 1P4LB 3S3DB 4LMQI 4KDTA 3SJVA 2J7LA 1OCZB 2Y1YA 4ZNEA 3VFUA 4AITA 2KKQA 1QVOB 5F8RC 3TXAA 4TQPA 3II2A 1CYWA 3UBHA 4L8SA 3RA7H 2R0LL 2YR3A 2VERA 3OKMB 3SQBB 4XB7A 3QDJA 3DX9B 5AW7B 2D31B 4C56B 5LCVA 5EUOE 4IOIA 3LKRA 4PCSA 3MPCA 5DFVC 3NEOA 4K3EL 4OVUA 1MCKA 2ZWKA 5DQJB 4YUEL 3AXLB 3I6LD 1K4DB 4NOBA 5B1KA 2GY5A 4PVMA 4CMHB 4OFYD 1JYVA 4ZFGH 2UWEA 2VXTH 1NGZB 1XGQA 3IJ7A 4LU5L 5BRZB 1IIKA 1HKFA 3RWFB 2HJFA 2AAVA 4PG9B 5BQ7B 2BZ7A 3RX8A 2XQBL 1IZJA 4K5PA 1HL4A 3OJMB 2RQ8A 1AR1B 4H0LC 5GS0C 2APFA 4M6OL 5DJZB 5I6XB 1Z9MA 5SWSA 3TTYA 2FRGP 5E1HB 1OAZL 4FLQA 4MA8L 2ADIB 3ZYJA 5DD3L 4A6YH 3FQ1A 4ZSOB 5JHLL 1VJSA 4EI5B 3HHMA 3DROB 2BC4B 3WE1A 7PCYA 1P7KB 5FUOH 1WS7A 4QOKA 4B5ZA 1AZVA 5FXCH 1NJ9B 2DPKA 4EXPX 3CMGA 4AC2A 1WZLA 5K59E 1KCWA 4LAJH 5LGJB 4C58B 1YYML 1IEAB 5FGBA 1EGJA 5D7IF 2ODIA 1ZHNA 4NC1E 3GUTA 3RPIB 3KLHC 1WFTA 1KTRL 1AP2A 1EO8L 1LWJA 1RP8A 5HDLA 1ETZA 1GZHC 2WD0A 1CUOA 4QXWA 3RWJB 4E41E 5L0QC 3NBNA 4MLSA 3RVWC 5JZ7D 1P1ZA 2NMSA 3TT1H 5D5MF 4HVBA 3OHXC 1K4CA 3BIKB 3ZRFC 4X9IA 3RVTD 3REVB 4CVWA 1INDL 1FNGB 3RIFF 2MJWA 3UMNA 2ARJQ 4A2DA 5BJTB 1S9WA 2BWQA 2OX5A 2P8PB 2E0PA 1XZ0B 2F5BH 3G08B 1I1RA 1KEML 3ZYIA 1VACB 3WLBA 2A73A 4FG0A 3C5ZC 3QQ9C 1M9WA 1UJTA 4YSDA 3NJMA 3ETBJ 3QPXL 2WTRA 4JFEE 5KTEH 5LGHL 1A4KB 5AL0A 4AZ8B 4BYHA 4WFHD 1WBXA 5F7EL 3F12A 2Q1EA 5KBPA 4ES8A 1A6UL 2CR6A 2FVNA 3QNZA 1Q9WB 1E6OH 4PU2A 3VRJB 1UASA 3E8UL 1WDAA 2Y1ZA 1T66C 1YA5A 2WP3T 5FKPA 4G9DA 4QRRE 3TH2T 4OR1A 4I0PD 2JE8A 2I27N 5B7FA 3CDCA 2AXGA 3P30L 2GEEA 4XBMA 5E4OA 5D7LD 1G0DA 4GOSA 3FCTB 5AQ0A 5JHDE 1LEKA 1MRDL 2VO8A 4NNXA 2W94A 5JQIB 3CXHJ 3NZSA 3SE3A 4GAJH 3D30A 3FONB 3L3IB 1AGDB 3WFHB 1GGUA 2J73A 2QKSA 2DQMA 4IBZA 1XTMA 1YECL 3ESVF 5J5EA 5INCB 3FN0H 4ODHL 4LDOB 3D0LB 4S1RH 4AGPA 1BG1A 3FO1B 6PAZA 3A47A 5DT1L 1FDLH 5TFSL 1D6EB 2QLYA 5KVDE 3FTGB 4JCLA 5JIQA 2D0HA 2X70B 4R7XA 1KXQE 2ARWA 3GMNB 3MNDA 3FOLA 4KKPA 4PB9H 1MHHA 2X4OB 1PZCA 2PCXA 3WJMB 3PWNA 1WAEA 2WVTA 3CH1A 2CO4A 1EFQA 5EMYA 4EN3D 1O6TA 2PTVA 1E8WA 1UACL 4N2GA 4FA7B 1LTXA 1JDDA 3UAAA 4YDIL 1U4FA 43C9A 3D2TA 1SQMA 1M2VB 4KWUA 3ZJAA 5SWZA 5EUKA 2DQUH 2I26N 1CLCA 4XX5A 4M7KH 4NO0B 4D8PA 3RWIA 4HGMA 4LRIC 1KCKA 1KCSH 1YG9A 1ZLUH 3ES6B 3APNA 5EOTA 1CK0H 1I7RB 1ACXA 2Y07H 1WTLA 3GTTA 4HKXB 4WFGE 4QRQA 5C6PB 1FG2B 1CD1B 1F90L 2CBPA 4H8VA 2IFFL 4Z7WE 3T0EE 1XGUB 2HFTA 4PJEF 1QP1A 3B2UD 1EZUA 5CHNB 3SDDB 4AOFA 3HG0A 4H8UA 4H2AA 5BO1L 1AG0A 8PAZA 1PX4A 2A9DA 2NW2A 4FFVD 3MLXH 3RNQA 3S3JA 1WFIA 5KZCB 3BPOB 4B0MM 5B3SB 2XQYA 2YFOA 1KB5H 4LSUH 4K71C 4YO0B 3SGEI 3VXNA 4YR6A 4XXWC 1ND0B 4OCWH 4JO8A 2FBOJ 3G5XB 2XTJC 1GC1H 4KPHH 3UAJA 3EO0A 2AEOA 2O6PA 4FMVA 2OL3H 4OZHE 3K4DA 3V4PL 5KVFE 4J3UA 5HGAA 1ET5A 4PTTA 4YWGH 4RX4D 3IDJB 1B4RA 2XQ0A 3EYFA 5IROC 1TJIL 1CU4L 1PAMA 1QPKA 4L05A 2ROYA 1MCQA 4GFXA 1THAA 4U1SA 3BWUC 3IJ9A 4Z23A 4OIFA 3LTVA 4Q52A 5TE6L 2BW4A 1QAWA 4I89A 4AQEB 2DQFB 3FS9A 1CI5A 5CXPA 1ZRUA 1H5BB 3N06B 1YEGH 1Z5LA 5ACZB 1JMZA 4LVHB 5EO0B 4AMKH 5C9KA 1NGQH 3MZGB 4K8RH 2NXYD 4JB9L 1F5WA 1F4AA 4LPCA 4RFNB 4ZFOB 3UO8B 4GPVA 2DM7A 3KPNB 2PR4H 5AENA 3CNKA 1RURL 2YHGA 1G9MC 2BOBA 3BSHA 1KELH 1F0LA 3L3DA 1F56A 2NT1A 3GRGA 4XNQA 4MQXC 1MCRA 4PP1C 1E9OB 2PYFA 5HYQB 3KPSD 5JLZA 1IKFH 2ICEA 4UBDC 1VIWA 1WD8A 2GKIA 3HBGA 4G5ZH 1I9JH 1ZJAA 4HWBL 3TA4D 3HNVL 3E6HA 3PHQB 1UB6B 1SXSA 2VN3A 5ICUA 3TJPA 3H55A 5IP4A 1WJ3A 2A3TA 1NCOA 3TS8A 2OCFD 5JXEC 3L5IA 1NAML 5E1GA 2A6KB 2LTQC 1MELA 3CVIL 3MOBH 4X9GA 1NL0L 1U3NA 4LVOB 3FCBA 4PP2A 3WNJA 3TTSA 3TEYA 2HVJB 5CBAB 2OKMA 1TLKA 3P3RA 1ZVYA 3RWCB 3K71A 3DTXB 4OCYH 4FXKC 4YHIA 2WUBH 5KG9A 1I3GH 3QCTL 3BGAA 5D1XB 2O5YH 2HWZH 4RGNE 3PJSB 1KCLA 3HE6C 5DEZA 1B9ZA 4LBEB 3OAZK 3N1FC 1MSPA 1MQKH 1FGNL 3ZL4L 3VTMA 4RDQG 1KLUA 3H85A 4LEBA 4AQAB 5DRNB 3L3JB 5TTRA 1CMOA 1EAOA 1P4BH 4K9EH 1T03L 4XRCA 4JKPH 6CGTA 2ENYA 4X99B 3WTUA 3DXAE 5GGSY 1HDMB 3MUJA 3MV9A 2XN2A 4KVCH 4LSRL 1MCJA 4YHOH 5FEBA 1HE7A 5E2TH 3BUDA 4LHJB 5E5MB 4HXBL 4O58H 2DI7A 3N40P 1FV1A 1NH6A 1MCOL 3U1SH 4N9OB 3VQMA 2D2CC 2FCBA 4UAHA 2PTTB 3ESUF 5AOLA 3SYPA 4ABUA 3HAEG 2W91A 2PP7A 3INUL 4ZDHA 1X4ZA 4PJ8C 3DK0A 1IKNA 5DQDL 4WTXA 1IO4C 2V2XB 4HJ0C 1DQLL 1GH7A 2ITDA 2FQGA 5I15L 3I3EA 1C1EL 3K1DA 1CL7I 5D1ZB 1JGEB 3BAJA 3NCWA 3D8MA 1CC3A 2L7EA 4PJ9C 1M3IA 2A6DB 4LLYB 5E08H 5GZOA 4BH7A 2E9BA 3VFPB 2KPWA 1JN6B 1AIFA 1SEQH 1PD1A 2V7HA 3NIFE 1VGKB 3IETB 4W4OA 2CUHA 3QJUB 3AQZA 1U0QA 1K5WA 4NLAA 5I66B 1NQBA 1X7QB 1MHCA 3CLFH 4DGYL 1JZJA 1FE8H 4NZUH 1YEEH 4K5LA 4AK2A 4OV5B 1MFEL 5KUMA 2ICCA 3QG6B 1KN2H 4CN6A 2YUWA 4FADA 4AGNA 3RY4A 4I3GA 2HN7A 2PXYB 1THCA 3BMWA 3DVFA 5I1JH 2G9KA 2AQQA 1F8TH 3WGUB 3JT0A 4PN6A 4MCMA 4K0OA 1BQHG 2IAMC 4WVRA 4EOWH 2XZAL 2OSXA 3R8BB 4HX1A 2VDQH 1HFUA 4P04A 3AREB 4YXHH 5CD5C 1GZQA 2R1YA 3OXSB 2V4LA 1PNCA 4KI1A 4PJIE 3VXMA 4TYUA 4CC4C 4NKQB 1FH5H 4PRIA 3L5WB 4XCNA 3DVIA 4YHYC 1SN0A 3D85B 5FGSA 4CSZA 5A7BA 4PJ7E 4LVEA 1NBZB 3ZDZB 3UC0H 4FERA 4G42A 3OVUB 3V0WH 4HPYL 1WIPA 4AIOA 2BRQA 1HWGB 2KPNA 1KBGH 4FXGC 4G11A 2IPKB 4ONFH 5CS7A 5LGYA 2GSGB 4Z7NF 5DJDB 2EXWC 1OSEA 4YGVA 4NEHB 5FHBH 5EZIL 2AEQH 1MLBB 5C08A 4NQDE 3UTSD 3GSNA 1ZDSA 4DVBB 4U1LB 3S4SB 2ESVB 1SMOA 3QUZC 5E8DL 2ZD0A 4DZ8A 2C7FA 2QDVA 1XF4A 4YQXH 3QS3A 4D0DB 5CZXD 2EXSA 1EFXD 5EIQA 1TYRA 3GHBH 3BEWB 4HMDA 4XMKH 4DO6A 5ITBL 3DO7A 4XNAA 1OGSA 4POZC 4NYLB 1Z66A 3OKDB 1P5VB 1OGAE 1HHIA 1N64L 1FSKB 4HCGA 4OFDA 2FUTA 3HNSH 5CILL 4MTMA 4BFNA 4P2QE 2J2ZB 5DJ2B 1R5VA 1KGIA 1AQHA 1O9VA 3CDGB 3QUKB 5LBVA 1KCUH 2QEJA 4F37F 1Z2KA 4TQ8A 5I1EL 2H2PC 1MAMH 1CD9B 1HNFA 1JOIA 1I3RB 1JWUB 1QEXA 4IBSA 2EVHA 4OGQC 3HG1A 3NPSC 5KS9E 2VQUA 4K3GA 3P2BA 1DLFH 4WHYG 4ZTPL 3VMOA 5DJ6A 2WLZA 3T3ME 3I50H 3RWDB 4ORGB 1ZLSH 3RHWK 3VG0L 1E4WH 3DMMD 1G9NH 2X05A 3VGFA 3T65A 2X42A 5AD0B 1K8DB 1ITBB 2H3XC 3L1OL 4J4PA 5C09D 2GTZB 3P4OB 4KNQA 3K6SB 5TDNB 3IS1X 2CHNA 2DTSA 1N5YH 3W57A 5GZNA 2DIBA 3V55A 1QLFA 3W11C 32C2A 4WGWB 1TENA 4JRYB 5FECB 5D1XD 3OKLB 2IPTH 4PJXE 3ZE2F 3EXLA 3MRMB 1WZ1H 5A2FA 1ZGLM 5FGCE 5DRWA 3WDHA 3JWOH 3C9NA 4Y5YC 5FLUA 1R24A 5IB3B 2LU5A 2EABA 3S8WA 1F1DA 4ODVL 4DVRH 4UZGA 3O8XA 1EWHA 3IJ8A 5B4MD 5FFGA 2Q20A 1O0VA 1ADQL 4X0KB 3S96B 4RX4A 1MJUL 5GRJL 3QQDA 5EUOA 2YXWA 4URKA 4E5XG 5T1LD 4IIQC 2WXRA 2YC1A 2WIMA 2ALAA 1F1AA 2DEWX 2OTUB 2LGNA 4Z0BL 3OKOA 4ODSL 4KUCF 1I7UB 4GBXB 1J05A 4ELMA 2WTPA 5EOQH 2FEEL 4G8AC 1HI6B 1ZV5A 5D7KD 3PIQB 1CLYH 1RIUL 1YQVL 2I25N 3DI2B 3QAQA 4MNGE 4JO5A 1JF1A 4BFGA 3TOPA 1TTFA 3HHSA 4NQVA 4HV8B 4U1HA 1B2WH 4U1IA 1FFOA 4KVNL 1FNFA 5DD1L 1CE6B 2IALA 2OP4H 3QDMB 4KQ4L 4KJYA 2BP0A 4NJAH 5E94B 2ZWYA 4WDIA 2D2OA 3DRQA 1WAAA 2IBBA 2NUTB 2SEBB 3L9RB 4XOAA 4FG2A 3ATBA 1GYAA 3E9TA 1JCVA 1Z9PA 3FUIA 3RKDD 3Q44A 4BCYA 5CM1A 1EZSA 4Y5XB 4XN9A 2GT9B 3DX2A 4WJG3 4GXVH 3EJTA 3GI9L 3KBFA 4FQHA 3NRPA 1S78C 1N67A 3P11L 3LRSA 2D9CA 3VQ1C 1H3XA 3DWTA 5C0FB 1D9KC 1S7WA 2DQTL 3LNEA 3CHOA 3TJHC 1C16B 1LVEA 2BDNL 3GXMA 3K72A 3BGFB 3HS0C 3IAPA 3NT0A 1QI3A 3IB4A 1IC0A 2ZE0A 1W72A 4QHUB 1YN6A 2NY5L 3C5SB 3S5LG 4E41A 4WWKD 3PCYA 3LVEA 1CDJA 4KX9A 2DM3A 4JK0D 2V17H 1A64A 4X4YA 1T1ZB 4L2YA 1BPVA 4HHAB 5KYYA 1V7ML 2ZOUA 1KJ2A 1CT8B 4PJEB 3O3DB 4OFQA 1BMWA 5CIPH 1HCVA 3VMPA 4ZUUB 4D2NA 2DTML 1C9SA 3OGOE 1P84J 4AQ1C 2ZWSA 1IB5A 1HOCA 2E9WA 3RDTB 4QGYA 1AY1H 4WIQA 3S8FB 3D7PA 1ZA3A 2XBZA 4HJUA 2WIIA 5C97A 2Q8BH 3QJRB 4ELKB 3I9GH 4WO4C 4JFEA 5F6IC 2Y06H 3EYUH 4FTVE 3PNRB 1WFJA 1A9BB 4YPGB 2MQ0A 5B39A 3EBIA 2WYTA 1PYWB 5DCCA 1A3QA 2JJTA 5BXFB 35C8H 1NCJA 4J3OF 1Z9SB 4MXQD 3BZ4B 5C07E 5C0GA 3RGHA 2WNGA 5KYWB 5I8KH 2EDHA 3Q0HA 3MNWB 2UZXA 1KPVB 3WDJA 3N0AA 2CGRH 2AEPH 3NFPB 4XMPL 1OTUD 4FQ2H 4IRJC 1VSCA 1U4EA 2GUYA 6FABL 2YPLE 5JHDA 2Z4QB 2Y5QA 1JSYA 1TEGA 1AS7A 2OMVB 3Q06A 1Q1PA 1IT9L 4CBPA 1NMAL 3ZQWA 4KZEH 5IWLC 4BDVB 3HMXL 3X11A 2DQJL 2ZX9A 1NGYA 2W59A 2HZHA 1JF6A 1T04A 2ZIDA 4QPEA 1ZLVH 4ZZFA 1JERA 2BWDA 3LZFH 4QRUA 4QHLB 3P69A 1A6ZB 3P2TA 3GXNA 1NC4B 4H8WL 4JRXD 5HGGS 4YMPA 5AAPA 1AXSB 3B3BA 3FOMB 4A7GA 2X3AA 4EUPH 1S3KL 4P57A 2L04A 4MCZB 1CFVL 2Q86B 3RVUC 4B7IA 4N85A 3SKJL 1BD2E 3TBYA 2YJLA 3DGDA 3MX0B 4KZDL 2R4SL 5LBSL 1TEYA 3U0TB 2O5ZH 4UTCA 3OMAB 1QKZH 2LW3A 1JGDA 4NQSA 4W68A 1D5BB 5FFLA 4RQQA 4MMYB 5F93C 3ROLB 3W2DL 5E95B 2WKOA 3BHBA 1I7TB 3IDYB 5GS3A 3FQXB 3LDBC 1TFPA 1O7DC 5JHBA 1RHHB 2EVFA 4GFTB 1FYHB 5CR8A 2VDPL 2Y7LA 4ZD3H 1XR9A 5AAWC 4KI5D 2VN4A 4X9BA 3WFCL 4NM8H 1ZJBA 1VCAA 3DC0A 5BMFL 1ZLUK 3MBEA 1Y18B 2IAND 1KPUB 1JGVL 3FFCE 4M1DH 4Z7WA 3T0EA 2NY6B 3LEXB 1NBYA 5DRZB 3WOVA 3WAJA 4KZ0A 2YQ2A 2A38A 1DJZA 3Q9QA 4OY9A 2VYRE 4JZNA 1TETL 3TH3T 5DEFA 2E7MA 4IK6A 5T1DL 2VXVL 4JMNA 5DJCA 3VFOA 4WNQB 3EDKA 3F00A 5E99L 4AL8L 3SE9H 3O0LA 3CZJA 4H5SA 4M3JA 2AJYH 1V55B 4YOKA 5EPMA 5IJDC 3TNNA 1UH4A 5DVOA 1F6LL 1UM6L 3PGDB 1NICA 4XCFH 5HY9B 2R69L 4J6RL 5C0AA 4OLZH 5CWSB 3TBCA 3T08A 3B7SA 4OZHA 1J87A 3UIYA 3FUEA 1GOFA 4N0UB 3TZVA 4HUVB 3VGHA 4G6FB 1N0XH 4K7PY 1A4JB 5EORL 3D69A 1HT6A 1I1CA 1KIPB 4X42A 5DHDA 3BEVB 1SYVB 2XX0A 1VF5C 1YRKA 1FG9C 3AY2A 2P24B 4N26A 4AQOA 4MJJA 1S4IA 2WVVB 3UTPD 4QRPE 4WCYH 2X5PA 3R7QA 3FU5A 3SJVB 1G7IA 4FZEH 3MRHB 5FO7B 4GKZA 1D5MA 4GAYA 5C09A 3FQWB 4L8SB 3CZSA 3ZKMC 4NSKA 3QUMA 5KW9L 4XNYH 1NIAA 5GGTH 3KW8A 5CCJA 3WTXA 2BHUA 2F53B 3VWKC 4LCWE 4IOIB 3LKRB 5D7SL 1NMCC 1UXLA 3T77A 4P48A 5SV4A 3TVMA 3LH9A 2AP2A 3ARFB 3KNBA 3LX9A 3N9GH 1FVCA 3VU2A 3HLKA 4R0LC 4X4ZA 4AXWB 2VR8A 2GABA 2NY3B 2PCYA 3N41B 2DF3A 4H88H 1YNKL 3SN6N 3U6XS 5I0YA 4TVSa 1HCFX 3IDNA 4MD5A 4Z3JA 3S35X 1E4HA 4IGBD 5FYJH 1LO2L 4DETA 2MPAL 1DZ0A 1XGQB 4XVSH 3RX9A 1E3FA 3CLEL 2HJFB 3S5ZA 2VLMD 4PWIA 5LN8A 4Z0XB 4FFYH 3NZHL 4Z7NB 5IMMA 3AU0A 5SWSB 5EU4B 4CDGC 4L1BA 5D2LE 2YARA 1PSKH 2BERA 3NIGE 3OZLA 3SPHA 3TYGH 1XF5B 3QO1A 4K9JA 4R4NC 4Y5VC 2FJHA 1QWHA 4XO8A 4QRBA 4BEIA 2XFGB 4G7QB 3EADA 4N9GA 3WFDH 2GSIA 4ZW6A 3V6OA 4R3SA 3ECUA 4XPBH 4ZTOL 3I9PA 4U3CA 2EDEA 1ZHNB 4GAFB 1SXBA 4KKCD 3RVVC 4ZNCD 3GUTB 1AP2B 3IU4H 5G4OA 4X4ME 4NO5A 4P5TD 1OWWA 3D1MC 2BNRA 1NDTA 3BVNB 2BHZA 2KC0A 4JKWA 5E2VH 4WF7A 5JMRA 1RZQA 5PCYA 4NKMB 1QTYT 3BD4A 1K4CB 2ZNWA 3FNKA 4JJHA 3ZT7A 2ZAIA 2VDOH 4BSJA 4DP7X 5I71C 4F24A 3OG6B 1S9WB 4KMQA 5FOBA 1IE4A 2OW7A 2DQIH 3ZT6A 1KMGA 2A73B 2AERT 1A21A 1G7JA 4FTDA 4ZUVA 1RZ7L 2XBDA 1EJFA 3FZUC 4YDZA 4PJBE 2WTRB 4DGIH 3EJZD 4XP4H 1N7ML 1Y6MR 2E9GA 4PJFE 1WBXB 2ZP0T 4PV9B 1VESA 1USQA 2EAEA 3QNZB 4JCWA 4OCXH 5C0IB 3WFEH 2OMXA 4AMWA 1DL7L 4TNEA 1JDCA 2WZ0A 4G9DB 4B7LA 4OD3H 5DZ9A 5ID1A 1OVZA 1ADWA 4HS6A 4WK4B 1FGVL 4LZKA 2AXGB 4FQXA 4K7PH 4XAWH 4Y4FC 3ZE2B 5HDQL 2VDLB 5J11B 3L4WA 5EUOF 2QADC 1T1WA 1OT4A 1LEKB 4ZMZA 1MNUH 3MR9B 3NH7H 1KXVA 3RTLA 5KN5A 1C12A 4HEME 3CX5K 4J8RA 5HGHA 5BV7C 1J0KA 3IDIA 4UZUA 4AQZA 2BMKA 1WE5A 4FEMA 4JFHE 4JFFB 3OPUA 5FV1L 1UT9A 1JVOA 2NZ9C 2PO6A 2Z31C 4JFPB 1CFTA 4JKKA 5AKVA 1CF1A 1B6UA 4QKTA 4TSAH 4PJ7A 4RZCA 4JM0A 3PP4L 4LSDA 5C0CB 1XIWC 5T5FL 5IOPB 1VFAA 3D4GA 2QQLL 1JHKH 2VLRD 2WBJA 1MXDA 2D3VA 4KKNA 1GPOH 4RFEA 3U4BH 3O4OB 4U0RB 3O41A 3VFWB 2ADFL 2EE0A 3FOLB 1JNLL 1MHHB 2N4IA 4GKSA 1AZRA 4NQDA 2EZ0D 2J1ZA 3A6CH 4K3JL 3EYSL 4NAQA 3L3HA 3L4CA 1UWXH 1X5HA 3H7BB 4ZX3A 4XN4A 2P5WB 4MBRA 4P2RA 5HYFA 1IVLA 5K59F 2CKBL 43C9B 1G6RH 5JOPE 3UTOA 3VXRE 2PUQT 2XKNA 5DJYA 1ANUA 1OGAA 3FUDA 2VXSH 5J13C 4D8PB 5K39A 4OTXL 1U95A 3RWIB 4ISVA 4M3KB 3SE8L 1VA9A 1N5AA 2ED7A 2CRMA 3CFDB 3AMKA 2OR9H 5HDRA 4M5SA 2F53D 4QRQB 5CCGE 1OPGL 2GJ6D 4G7YH 1DO6A 2XFXA 1QSED 3VO0A 5HDBE 5GJSH 1DSWA 5KS9A 2WKLA 1A6TB 1OW0A 3TLRA 3QWRA 3KYNA 1B2YA 4Y4KA 1PBYA 4FQIH 4LCCC 4HSAC 5J12B 1X6LA 3QRFM 1SY6H 2BP8A 3D39E 3BXNA 4LEEA 3RNQB 3BPLB 4XE0A 4DNLA 2VJ0A 2BRRH 3VXNB 1WISA 1CXLA 4YR6B 3BJLA 1NIEA 3ECBA 2Q2LA 1FL3A 3RGVC 4YFLI 3PGCA 3L95A 3CPLA 4R7DA 5HGAB 1U3HD 1F02I 4KZCA 1FLRH 3EYFB 2PWFA 4P2CG 5B39G 3GMOB 4ZK8A 2FR4B 7TAAA 3LEYL 3C09B 4FQQA 2IQ9H 4PJXA 4KXZI 2F58H 2F8VA 2IWKA 3Q5OA 4MYWB 4BKLA 4TVPE 2AJVL 4XOBA 2NX5E 1S5IL 5C0NC 3V5DB 4PJDE 4KROC 4JZJA 5ICXA 2YN3A 1RD6A 5IJBC 4Q9RH 2BSED 1ORQA 5BRPA 1MCFA 2EE2A 1U8KB 4L8CA 1UH2A 1JDAA 3GSQB 1X9UA 2LVCA 4L3FA 3V4UL 3BYYA 2BOBB 3L3DB 5HP5A 4XNQB 4A7GF 5AZEL 2PYFB 4JY5L 4M6NL 4POUB 4NN5B 3DV4A 2CSPA 3LYRA 2ICEB 5EU5A 1A1NA 1OCOB 1TMQA 1HJBC 4G72B 1OKEA 1CGXA 3INOA 1LL1A 5B22A 2E6PA 1LXMA 4G2AA 3E6HB 4GXFA 1F4WL 4U6VH 5I1GH 3L45A 5CP7A 3B37A 3ARDD 3D0VA 1JPSL 1P2CA 1AS6A 1NC2A 2JI3A 1Q9OB 2MQCA 4L3EE 5J1TC 3RIAF 2QR0B 2J6EA 3NA9L 2B5IC 5C2UB 3K71B 3P4MA 2F1AA 1NWPA 3GK8L 2BIPA 4KJQC 3S3CB 2XXCB 4IBUA 4G71B 3QCVL 5E6ZA 5KG9B 3EJYD 3S37H 1N6QH 4YHNA 3NG5A 3CFMA 1C5CH 1PZ5A 1LO4L 2QSQA 3H4FA 4I0KA 3RFRA 2NDGA 1KLUB 1IM3D 2BK8A 2PYED 4Z7WF 1DHKA 4JG1H 2EECA 4KO9A 3A4AA 3WHE0 4BQ6A 4JDZA 3S97C 4XRCB 4F80A 4TQHA 3MRIA 4XPFL 4A7SA 3LHPH 3PABB 2C9VA 2IOOA 2WXIA 4NRXA 3D18A 2VM9A 3MV9B 3T8MA 4XC3H 5L88L 4CGUB 2UZYA 3CMOL 4NCC1 3QXUA 4ZX5A 4RDBA 5KYUA 5DUPH 5CBEB 2J6EL 5ICYA 1FV1B 4YZWA 1QMUA 3VH8A 3V5KA 4DP9X 1Y1DA 5C0CD 2I9TA 3VGEA 3FCGA 1CLOL 2B14A 2AJSL 2AQ3A 2MPVA 4ZAKD 3NCCB 4OF8A 1V8HA 1UOVA 4OZHF 4ZDHB 4NJ9H 1BFTA 1ASOA 5JW4N 3PXJA 4G8FA 2ITDB 5IF0B 3ZO9A 1HX0A 5IMLA 2DMHA 3PDGA 5DC0A 3IMBA 3FRUA 4JQXA 4E0RA 4JANA 2CG9X 3HAEH 4WHCA 1G9EA 1JYXA 4FTVA 1XF1A 4QAMB 2R0LH 5DMJB 3QJFA 1EK3A 4Q89A 4HHGA 4LT7A 1BX2A 2CA4A 1FJ1A 2VW4A 4L23A 2OK0L 3EGXA 3AS0A 1AIFB 1CYGA 4IHOA 2VITA 4JZOA 4RMTA 4E2OA 3K2IA 5JHAA 1E5CA 5EFIA 4KKBC 4YUEH 3BOVA 2DICA 1MI5A 4FI8A 1MHCB 3QUYC 4WU7A 2FNWA 2NSQA 1CD8A 2FX8L 4P46C 3ECVA 4ZXBC 3FRPG 5AVXB 3Q6GL 2HN7B 3U2SA 2JSFA 2BY1A 4LU5H 4RISL 2XPYA 3B3IA 2R83A 3FBQA 1BEYL 1MPAH 4HX1B 2ADGA 1WV7T 2XQBH 5A7EA 5DHVH 1UADC 4G6KH 2IJ0C 1L0YA 1GZQB 2AK4E 3FT3A 2R1YB 3HVNA 4QY8A 3UTQA 2YKLL 3KWWB 3VXMB 1UM5L 3L13A 2DD8L 4PRIB 4BCZA 4MNQE 4NN6C 1UFUA 4P4KA 4BCXA 1OAZH 1QRNB 4MA8H 1CGVA 4MXWL 5BUPA 1OE3A 4ZX4A 5CEZE 3MLYL 4G42B 5DD3H 2Z92A 5GGVY 5JHLH 4C83A 4MAYA 4AIZA 2HJKB 1BD2A 1XSKA 3ZOAA 1BVZA 3QPKA 3F7VA 1BIIA 1EHXA 3WJLA 4BQBA 4P2OB 1FIEA 3F7PC 3CWGA 5C08B 3IFNL 3ZKXB 2KERA 4QCIA 1TPXB 3GSNB 3AM8A 3CV5A 3H9SA 5C1MB 5DS2A 3KLAA 1EO8H 2N0KA 4DZ8B 4I1NB 1XF4B 2ICWA 1EHKB 5H35B 2VDKL 3MV8B 4XBEL 4DEPC 5CJQL 3SDAC 1B88A 1WT5A 2X6CA 4M1CC 4N8UA 2EIZA 3DO7B 2HLFD 2VLRA 3HKFA 1IGIH 2FZ3A 2HFEA 2VLLB 1HHIB 1UQSA 2JKIS 3CFUA 1UXWA 3VI3A 3T6QC 1INDH 2IVFC 2X28A 4HJIA 4N0RA 5L6YL 5DHEA 4L9LB 3HE7A 5F44A 4LSSH 2MKWA 3UYOD 1J8HE 1R5VB 2X9XA 3FFCA 1AHKA 4MS8D 4RETB 1MVUA 1KEMH 2A74B 2XI9A 5MP6L 4NT6A 2J88L 3LMJH 4BGDA 4MHHG 1JV5A 4WI8A 5LGHH 3V0GA 3HG1B 5D1QA 5I6NA 3TN0D 1AGCA 1AD9A 3UC2A 4E36A 5E8EA 3N55A 1G5GA 5DJ6B 1KWKA 3E8UH 2HTLD 1BVLA 4PREB 4X7SL 2ZYIA 4K3DL 4G43A 1U8JA 4WHYH 3T65B 3UFIA 4IOSD 4JQVA 4R26L 3P30H 4GQQA 2G30A 1AMYA 4JFSA 4NQCE 3NIFF 3EJPA 2LLNA 5CSGA 1E28A 1MRDH 3LIZA 1QLFB 5JPNB 1ZTMA 2PKDA 32C2B 2MNJB 4IM8A 2UY6A 1DQKA 2Y7NA 5D6CB 2R2HB 3QFJE 2WAQA 2DQHL 4QRPA 3JV4A 4FLSA 1ZPUA 5J7CC 3WTWA 1OZTG 1YECH 2GTWB 3EBHA 1F3JA 1R24B 5CLTA 2SODB 1WSST 4LXFA 5AW9B 4ODHH 1Q0EA 3FU8A 3QQ3A 5H8DA 3O8XB 3OR7A 5DT1H 3VGDA 4AM0Q 1CICD 4PJIF 2QFPA 3ILQC 1L7IL 3RIKA 2Q7YA 3V0JA 4EZJA 3QQDB 4FCHA 4LCWA 4PG2A 5EUOB 5F1NA 1N9PA 3L4TA 2FEJA 1RK1B 3K0YA 2YC1B 5F8QC 3SCMC 4F7CB 3TA3C 4PJ7F 2GBUA 1PKQE 2ICES 2WM0A 1AHWB 1J05B 1CGSH 3VCLA 1AMXA 2ZOKB 3X1GA 3IRCA 4X6BA 4KO6A 2RR3A 1JJUA 4GMSL 4YDIH 4NDMA 2VLKD 2ADYA 2W0FB 1T7YA 4M1GL 4QNPE 2BSEA 2XXGA 5KVEL 1JF1B 5KJRL 4OZIA 3HHSB 4NQVB 2OR7A 4U1HB 5TQ0H 3ULUE 3IFLL 1DBAL 1FFOB 1DEEA 2ZXAA 3BSZL 1E4KC 2IALB 1IARB 3SDXE 2BP0B 2XWXA 3BUQA 3VB8A 2ISDA 3MRRB 3DRQB 2JK5A 1IFGA 1T2QL 2OXHB 2XT1B 3NACL 1F90H 4LPXA 1IAOA 3VXSD 4CVXA 2FHFA 3T04D 2IFFH 2J5LC 3DHJA 4FOMA 4PW3A 1CDYA 3CU7A 3LH2L 4BFOA 1ED3A 1TU2B 4FQHB 3IVKA 5E6UB 3KLSA 3SDCD 3C6LA 1JPFA 3LRSB 5BO1H 1OHQA 1FO0B 4ZTEA 1TZHA 2KQNA 1ESOA 2NCEA 1WRFA 2C8NA 1S7WB 5KS9F 1LO3L 4XVUD 3IPBA 2RAMA 3L9YA 3K72B 3SQRA 2B4CL 1BXUA 4RMSA 5DU7A 5DZOA 3T3MF 4E41B 4CJ1A 3V4PH 1QFUL 1NM9A 2FE0A 4HXAL 4AW7A 4LKXB 3J8F7