4AQAA

Crystal structure of deafness associated mutant mouse cadherin-23 ec1- 2d124g and protocadherin-15 ec1-2 form i
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
206
structure length
206
Chain Sequence
MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGGVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Force-Conveying Cadherin Bond Essential for Inner-Ear Mechanotransduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords CADHERIN-23
total genus 45
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4aqaA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4aqaA02
3K6DA 2WD0A 3LNFA 3Q2VA 3LNIA 3FF7A 3Q2WA 5KJ4A 3QRBA 2OMXB 2WBXA 4APXB 2QVIA 4ZMPA 4AQAA 3UBFA 4AQ8A 1ZVNA 4ZMWA 1ZXKA 2O72A 5CZRA 4ZMLA 1NCIA 1NCJA 4ZT1A 5DZVA 4AQAB 4ZMZA 2WCPA 4NUMA 2QVFB 2YQGA 3LNGA 3Q2NA 2V37A 1SUHA 4ZMVA 3K5RA 3UBGA 4OY9A 2OMVB 2OMZB 3LNEA 5JYMA 5JYLA 4APXA 3K6FA 4XXWA 4ZMNA 1L3WA 3FF8A 2OMTB 2OMYB 3PPEA 4QD2E 4AXWA 4ZMYA 3MVSA 4ZMQA 4ZTEA 4AQEB 2OMUB 4ZMTA 4ZI8A 3UBHA 1WUZA 1O6SB 1OP4A 2OMWB 4AK1A 2EE0A 2X2UA 1WYJA 4ZMXA 2WHVA 1FF5A 4NQQA 3K6IA 1NCGA 2A4CA 4NUQA 1EDHA 3K5SA 3LNDA 4AQ8C 2YSTA 4AQEA 2A4EA 3LNHA 4XXWC 4NUPA 3Q2LA 5CO1A 1NCHA 4ZMOA 4AXWB 1Q1PA
chains in the Genus database with same CATH superfamily
2ZCZA 1UM5H 1N7MH 2LABA 4WNQB 2BIPA 3O45A 4DZBB 3QRFM 2JXMA 1A1NA 2CIKB 2GBAA 3FU9A 4JM4L 2AQRA 1HEHC 5T1MA 5C0IB 2GK0A 2A6DB 3PYCA 4D9QD 1CN4A 2J8OA 5EUOB 2QDWA 5LWYL 3MV8B 3O11A 2J5LC 1UG9A 2L7QA 3ARGC 1FG2B 4FYQA 4TSCH 2X70B 2XZAL 3Q1SH 2JJSA 1KCRL 4PBXA 5DS8B 1KXHA 4GG8B 1XGYL 2XZCL 4BIKA 5LDUA 4JRFA 3WE1A 1U8JA 3HG1E 3IJHB 2X38A 3O11B 3QJRB 2DQUL 4ZQTA 3KVQA 4MJIA 3OPZL 4NWUH 1F00I 1YPZF 3APCA 3JVGA 4V2CB 5EU6A 3U4EA 5CZKA 4A2FA 1NWOA 4L9LA 3EAKA 4GSRA 1YPZA 1I9JH 4OD3H 5TGBA 5HGAB 3SJVB 3LPWA 2F68X 4DKEL 1U8MA 4QO1B 2DJ4A 2VN7A 1JNNH 4U6VL 2HRGA 4LCCB 4FNTA 2FZ3B 2V5TA 4HIHA 1JYXA 1NIAA 4Z5RA 5FKPA 2PP7A 4LLVB 1HK6A 1LMIA 1M56B 1U3ZA 5HDBE 1FZKB 3SB3A 5BRZA 3QUYD 2MOGA 1OP3H 4EUPA 5GRVL 2B08A 2ATPB 3GSNB 4WI3A 4NERA 5E6YA 1KLUB 2G75A 4IJ3B 1MFDL 2X4OB 3IEAA 3ZKMC 1AE6L 2BCKA 2YAEA 3C87A 2D31B 3QARA 2VQ1A 3VDBA 2IIJA 1J5OH 3L48A 3IKKA 1L0YA 2VMDA 1XGUA 4U1KB 4BE6A 4Q6IC 4K8RD 1WUZA 4GT0A 4Y7MA 4CC0A 3SOBH 1AO7A 2C9UA 3LS4L 1FG2A 4I77H 1MFNA 4S1SH 4FQ1H 2CU9A 2ERJB 2Y7QA 1MAMH 1OPOA 5JQ6H 2PYEB 3TYGH 5HHMB 1F4XL 2GY7B 3KR3H 3NCEB 1EDHA 4HCRA 3QDHA 1PZSA 4GT7A 4EN3C 5HGHB 3N9GL 5GQBA 4PRIA 1UZ6E 4KKRA 1U93B 2ID5A 4NN7B 3ZGHA 2X89A 2VH5H 5F7MC 1D6VH 3PP3K 4OGXL 3KM1A 3BQUA 4DPRA 4WUKH 1QBAA 2ADFL 4FG6D 4I0KA 3KHQA 4Y2OB 3CVIL 1CTOA 1I8LC 2F8OA 3KBEA 1KB5A 2IC2A 5F7LB 2MPAH 3C60B 3NA4A 4JFZH 3AU1A 2XPYA 1I85A 4I5BA 3ILEA 3JV4A 2MNUA 5E6IC 4ZTPH 4JFWA 4LLUA 4HH8A 2Y6TE 3FU3A 3RP1A 3MLVH 4HHGA 4UTBH 4BJLA 1TU2A 3R7RA 1WZ1L 2CGZA 2H4EA 4BA8A 1I1AA 4JPKL 4W70A 3OLEA 2VLJB 2WUBL 3L3KB 4N8PA 3BVXA 4DQOH 3UZEA 3VGDA 3PNRB 1HE8A 5J11C 3AGVA 3A4FA 4K71C 1YMME 2ENJA 2FGWL 4XP5H 4Z7VF 2H1LM 3C6LA 4FQPA 5IFAL 1KTDB 4J4PC 4DPBX 3UTTB 4IGBB 4Y4KD 1DFXA 3PWUB 1UD3A 5AUMB 1JGIA 4TN9A 3QIBB 4XX5A 1OGSA 2Y7LA 3RDTD 2WO3B 1N5YH 4K3JH 1I9EA 2WTRB 5E2WL 5FGSA 3WY3A 3RTQC 2QGDA 4QJ3B 1KUMA 3HFMH 2G60H 2Q7YA 3NYKA 1Y1UA 1EVUA 1UOWA 4LCIL 3K4ZA 4OI8A 3H2PA 1UACL 2VXVL 3JWNC 5DJDA 1EEZB 4POYA 4LHJB 2MJWA 4ZUTB 1SOXA 3UTZB 2I26N 3HNVH 2E7LA 5FECA 2GJ6A 4ELMA 3U4AA 1OSZB 4IRZL 1WS8A 4JDVA 4LOUC 4M48L 4NQCA 2H0FA 4PRBB 1JFQL 4D9RE 4DEUA 3WAJA 3RFRA 4B96A 4R7VA 2WXLA 2EXSA 4BK4A 4WEBH 2IQ9L 3BPOB 1EMTH 1ZLEA 2J43A 4CVUA 1N67A 1Z5LA 1LO3H 2JJTA 2VITB 2WHVA 1G6RH 3MLXH 3QYNA 4ZPVA 1RZIB 2RCSH 1HI6B 2PTTA 2Z35B 2FWSA 3NSJA 4FRWA 5HDBB 1KELH 1T22A 4A2GA 4JFDE 3MZGB 2R2CA 3TFKC 2BVYA 2EDNA 1VEPA 3U4BL 1QNZL 4LAQL 1E9QA 3QCTH 2HKHL 3FQXB 1U36A 3ARYA 3Q43A 4KY1L 2Z6FA 1MJ8L 4P2QA 5HGBB 1B0GB 1UH4A 4TKWA 3VO0A 3OZLA 4M6NL 2F61A 3A67L 2Y0SA 2P49B 4R84A 1CLOH 5I8EA 4H1LH 3DO7B 4K3EH 5D7LE 3QORA 3C6LB 3EFDH 5HVHB 3ATDA 2VDQB 4LSRL 3KPSD 1Z7JA 2PYEA 2WYTA 1KIPB 5FO8B 5KN5B 2L3BA 2R0WH 4GO8A 4A37A 3TYFA 1VKXA 4RX4D 4PRPA 2FLMA 4H0GA 3V4LA 1IGIH 3CFMA 3JBG7 1AG0A 4CAGA 3X12B 4HEME 3QC6X 4MD4A 2YFNA 3FT1A 5IG7B 3F6LA 4TL5A 3WXVH 2EIDA 5KZCB 4TRPH 1QVOA 3G7TA 2A73B 4PJ5B 4WTQA 1MVYA 3DOSA 5B1AB 5IJCC 3T65A 5CUSH 1INDL 1J0KA 1FNAA 5AVXB 2EIBA 3KH3A 2PPFA 5IP4A 2X1OA 1R3KA 4NEHB 2G75B 4RDQF 5HYJA 5IEHB 3P9WB 3DVGA 1I7RB 4POZD 2P5WB 1KTBA 3QFJA 1JZEA 1A1MA 2VZSA 4H13C 4NCDA 1FO0L 2P5EA 4Z7UB 1G1CA 1EO8L 1MUJB 5EOTB 3GJFA 3FQXA 4KC3B 3UTPE 4X6CA 3LV3A 2Z7YA 4ACTA 2AJZB 2XWXA 1PLBA 5E9AA 4ZZFA 2F9BT 4ODUA 5E1HB 3T3PB 2FLRT 4GBXC 2FB4L 3DKHA 2JQZA 4CL7A 1P1VA 4J3OF 2DQIL 2FX9H 4YK4C 5CBAB 5DA4A 3LRKA 3EO1A 4JDTL 4HVBA 3HZ3A 4XO9A 4OUUB 3VXNA 1FNLA 3K8KA 3GMOA 1NDGB 2AZUA 4ZFGH 1IFRA 1I7UB 2PXYC 4YZFE 4OKVA 4P3WA 1G7HB 1I8AA 3PJSB 5D1QB 5C08A 4R2GC 3ZDZF 3O6FD 3DHUA 3AQXA 4R7XA 1F18A 4XC3L 5IQ9A 1BAWA 4NHUA 1QLRB 3LRLA 3RIFK 3W2DH 3WTUA 5B1CA 1YMMD 2OZNA 1TQTA 4YDVA 4ZW7A 4IW4C 4J8RB 5KG9A 1KCSL 4UIKH 1YN6B 1LE9A 2NY2D 1G9NL 5KVEE 3HR6A 3A4DA 3DJTA 2LVCA 2PABA 3C9NB 3S36L 4FN0A 3ZVVA 1IAIH 1PQZB 2P24A 3D39E 4NFCA 2ENSA 1WD9A 1ADQA 4OUOA 3VI4A 5B3NA 5IIEA 4LOFA 1JZ2A 2WBKA 1U92A 1MQKL 3W1ZA 1A7QL 1OOWA 2EVIA 1WTLA 2D3LA 2B4CH 2EE2A 3HA0A 3LH8A 5D4IA 2DH2A 4WW2B 1BYOA 1E7VA 2QADB 1F4YL 2Q7AA 4Z5RB 1KPUA 1RURH 1ZWIA 7FABL 2H9GB 3LIZA 3Q2WA 3QUZA 1J0ZA 3SKJL 5DHYA 4ZD3H 4TQEH 1HHHB 3F12B 5GGTH 1AHKA 1QTSA 2X42A 1MI5A 5J56B 4N5EC 2Y1AA 5DCCA 4B9KC 2RR3A 4U7SA 4YLCA 3TA3A 1KCUL 5EF3A 2WWNA 4OJCA 4XX1G 5C6PB 4M7ZB 4D0BA 5DEZA 1II4E 3S5ZA 1FNGA 1U2HA 3QDME 4W9JC 5TE4L 3UEZA 1HS6A 1XT5A 4AE1A 3VWJC 1DVQA 1EJ8A 3EYUL 1I7ZB 3DX2A 3QGVA 1K6QL 5MENE 1GZQB 4KAQL 1TQCC 3L7EA 1XGPA 3RWGA 4E0RA 3NH7H 4JM2A 2WIIB 4DQAA 1WFOA 2AMUA 4OB5H 1L5GB 4QWWC 1UM6L 3LKPA 5BMFH 2W8CA 4HC1A 1KIPA 1NLDH 4E9LA 5CJ8A 4NNYB 2CLZB 2XN9E 2ZIDA 1HH9B 1B4TA 4KUZH 4PP1D 1S7WB 1ZA3B 1PIFA 5HYSG 3FDWA 4Q52A 3TX4A 4JNXA 2CK0H 4KDVA 3AJ7A 3KL3A 4FQXB 4LDCA 5EA0L 3VJ6B 1J86A 4KK5D 3WFDH 1OQOA 4NN5B 3CH1B 4HS6A 3MA9L 1NM4A 4NWTL 1ZANL 4RAUB 4GW4B 2XWTA 3R1GL 3MLRL 3HHSB 3U48A 3U9UA 3ZKND 2O6FA 3ARGD 5I82A 1NGPL 3LJ3A 4YGAB 2MCAA 2DD8H 1GHFH 4YHML 3EOBB 3KNBB 5EPMA 2J7LA 2NW3B 5IVZB 3UBHA 3ZPDA 2AJYH 3BP7B 2X2YA 5DVMA 1G1YA 3UO1H 4WI6A 2BIOA 4Z0BL 2MKWA 2BK8A 4MDRA 4RISL 5AW2B 1G1OA 4IIQA 4G7VH 5DRWA 2QTEA 4WLCA 2XY2A 4KTEH 4ETYA 5JPNB 1ONQB 4XBMA 1TO5A 3LKQB 4ONHA 4XX1E 2AEWA 1AGEA 2CDEB 3BDYL 3U1QA 3V5HB 3V6BR 2EO7A 4XN8A 3FRUA 3TT1L 1U95A 1Q9LB 2XYBA 1IQDB 1K3ZA 2CCLA 3FQ2A 3DUUA 2R1WB 3RVXC 2D7OA 4FQJH 3QUMH 3TN0D 3APMA 4JFQA 5CAYB 1U8PB 2NNAB 3B2VL 4J4PD 5TDPB 3WY4A 4Y4KC 3GHEH 1YPZB 1FPTH 2C1OB 3VXPA 3UPCA 1FFTB 2LLGA 1DSWA 3WD5H 3WEXB 5I1IH 4EUPG 4PGCA 4PJHE 2C1OA 3HVDA 4PVLA 3VXPB 1KB3A 3RFZB 1IAIL 5FM4A 3DPBA 3HHRB 2KT6A 4KBPA 6PCYA 3FCBA 3GMPB 4GQPH 3MX0A 1MCKA 2DIAA 4QRUA 1JVKA 4XBGB 1KNOB 1O7DC 1Z3GH 2XZZA 3HR5B 3PL6B 4WV1A 2B1HH 4J27A 1CFNA 4ESKA 2YAOA 3VQ1C 1IGFL 3GJEA 2E76C 1PMYA 2BVQB 2JJVA 3CD4A 4AY0A 1E9OB 3DYPA 5F7EH 4HC1H 3VGEA 2I60L 3MRPA 1F4WH 3UZVB 2Q86B 1TU2B 2ARJQ 2NOYA 2YGVA 4M6MH 3HPJA 3BESR 4JPQA 4OY9A 2NY4C 1VFAA 3K72B 4XWGH 1P5UB 4DP2X 2OMTA 1E0OB 4BFIB 3QNXB 2A74C 2FB4H 2ZF8A 2NSQA 3HJEA 2YEVB 3I9IA 2AITA 1ADQH 3UZQB 3VB9A 1YDPB 1L3WA 5KUKA 3T0ED 3QNZA 4K2UL 3IETA 1EO8H 4WO4B 3JTSB 3GIZL 5F1SA 4FZ8H 4TSAL 5E6ID 4JFDA 3O8XB 1MREH 3BQUB 2Y7SA 1DN0A 3MZTA 1KZYA 5J9PB 4I48B 3V6ZA 5LXGH 4G59C 2Y2WA 3NRFA 3SPIA 3KXFB 1ZPUA 1Q0YL 2ZWKA 4OLZL 4KJPC 2X4QB 3RDJA 2QVTA 4HCRL 1FVEA 1SY6L 3ZT5A 4QJ4B 1R4XA 3NPZB 4B9FA 3VXSA 4HT1H 4LARH 4RGMB 2DICA 4UMGA 5GGUB 4BK5A 4R7DB 1SDAB 2NX5A 3PWJB 4PV9A 3SQBB 3HG0A 1KFAL 2DLFH 2W9EH 1P7BA 3HEIB 2ZUTA 2RH0A 5IY5B 5FDYA 1ET5A 4KXAA 5IK3B 4AQ8C 1FAKT 4HOZA 1AXSB 5EBGA 2ALAA 2IQAA 3B9KD 2R7EB 1KTKE 4HJIA 2VZUA 2W92A 4Z7VB 5A16A 5I18H 1D2PA 4B7IA 1CLOL 1B88A 1RIVL 3WUWB 1BX2B 1P5VB 2E86A 3QDAA 4U6HA 2PO6B 3TBYA 2FATH 3QEHA 3QULA 4M8UA 5B1JA 4FFYA 4OLUL 4PREB 3W3BA 2ZXDA 3QUXC 2AJSH 1BZ7B 4X6BB 3WTTA 2DAVA 4QTFA 3L9EA 4PGBB 4AKOA 2R1XA 3GZOA 1C8PA 2IXQA 2BP0A 3ULUH 2VOTA 2WN3A 5I1EH 1BMWA 2VJ0A 1A0QL 5EO9A 3G6JE 2ZG1A 4L3EA 4RMBA 2VKXA 4NKMA 1CXIA 3AU0A 4K9EC 4LNRA 4OVUA 3KLDA 5E8OA 3MV8D 2G0KA 3UXFA 2RCSL 1HDMB 4N0RA 1R9FA 4HXAH 3QJSB 2IQ9H 4GKZA 3WFBL 3N1QC 4J3SA 4R4FH 5I8CA 5E8EA 3KPQB 3TNNB 3EBIA 4F7KA 4EI5C 4NZRL 5EU6B 1KPRB 2GQHA 5CGMA 5CMAB 5CKGA 3IJSB 4HUXA 1M3IA 4TLUA 4LIQL 4ZFQA 3BPCA 4E36A 1MHEA 3EH4B 4MCZA 1A14L 4Y7OC 3ZZSA 2VXVH 2DF3A 3QUZD 4F15C 4GG6F 3BAJA 2EYSA 2HVJB 4YXKL 2YD7A 5BO1H 4U1JB 5EIQA 3SPVB 1H3PH 3TM6A 4KV5E 4HUUB 1SBSL 3Q1EA 4J23A 5KSVA 4Y5XC 2DLHA 3NIGF 2DBLH 3D87B 1M6OB 2VMCA 2N7SA 3OB0K 4OSUH 1WFJA 4KO6A 2WMPA 3CHXA 1KGWA 4ONGH 2VZVA 1I9IH 2QZ5A 1R24B 3D2UA 3SDDB 3EO0B 4LLMA 4XGZA 2FYYB 1NSNL 1ZK5A 1NDTA 4XMKL 4UV4L 4M5YH 4N5UA 5KVDL 5JIIA 4OJFH 1JXDA 5K39A 3LQAL 4GP5B 4N1HB 2WUBH 5F6HI 5LNEA 3DXAB 4NRYB 1GR7A 3FB6B 1PZ5A 4JFYB 4X4MA 1NGYB 4H8PA 1WZ1H 2ZXQA 1R5IB 3Q5YA 3CAFA 3NJMA 3MLVL 4NO5B 4WFGD 1M9WA 5TPWL 3VA6A 2JKWA 3HC0A 3K0WA 1CLZH 1V8HA 2YARA 3WLWD 1CD0A 2A4CA 4JLRA 3RZCC 1OHZA 4LFHD 3SQOH 4FMFA 1MOEA 4AL8H 2XWZA 5E9DE 4QGYA 4AGQA 3B37A 3C8DA 3QZMA 4L23A 1I3RA 3L5XH 2UY6A 1LDPH 4ZMAT 5I8OL 4LF3A 4HAFA 5EBLB 4RA0C 4KQ0A 1DJZA 4WU7B 2GUOA 1A4KA 2R2HA 3C6LC 1ZGLA 3WEMA 5C0EA 2QQNL 3L4TA 2EVJA 1YN7B 4PP1C 1L0PA 2ZKMX 1DUYA 2X3CA 4HMEA 5K9QI 1U8CA 4YFEA 5DMYA 4TTDC 3MODH 1TCMA 2YOCA 3PS6A 2BIMA 1Q0XH 4AQAA 4DF9A 3E2HC 2Q2LA 3V10A 3QP3A 1W72B 1MAML 3V4PA 2JJWA 5DC0A 4BFJA 3MLUL 1KGYE 1NCIA 4S1RL 4F9LC 3U2JA 1AJ7H 2UXVA 1JGEB 3C2AH 3TZVD 2XWEA 1LK2A 2KDGA 3WV0A 5HI5C 4JREB 5KSBA 5C08B 1FI8C 4U1IA 4MJ5B 3KPOB 5IKCB 3VRLE 1XHHA 2SODB 4FQHA 4N0CD 5GS2H 2LLLA 3EYOB 1GIGL 1NC2A 4UQBA 2ZSWB 1LWJA 3N1MC 4HPYL 4XPFH 2XJLA 4YSSA 4M93C 5I71B 1A7OL 4XMPH 2CO6A 1JF1A 3QB7C 2V7NA 3B5TA 4WENB 1OOAA 4MB1A 4IU3A 4A7UA 1EPFA 1AGBA 1J0JA 1L9PA 3MNMA 4N1CA 2BSRA 2I9TA 4QTHB 3INOA 2E27L 4EN3A 4LFHG 1JGVH 2CUIA 5ITFB 5JDJA 1A6UL 2NDFA 2Q7YB 5HJ3A 3UCRA 1I3GH 2PF6A 1CICA 1BD2A 1NKGA 2V9TA 4DKEH 3B1UA 4J4PA 3RJDA 3NJJA 4QD2E 3K8MA 5I6PA 1WZLA 1N26A 3J7HA 1GIGH 5HTSA 1E9PB 2ZP8A 2UUDK 4CNIB 4YLQT 5FM8A 2J88L 1F45A 2HSIA 1H8OA 4XI5D 5E56A 3FQWA 3VFUB 3ME0B 4OLVL 1HILA 3ZIYA 1JK8A 2NQDA 1MRCL 2IWGA 4U1LB 1ZE3H 3KWWB 4HGKC 4EIGB 4JO4H 5J11B 2EIKB 2YD3A 4FNUA 1BIIB 5DHVH 1IL1B 4KKNA 5BRPA 2DLFL 2W9EL 1K4DA 4GW1B 5SX5K 4I9WE 5BNXD 5IBTL 3L7FA 1S3RA 4LZKA 2IAND 3IBOA 4PRHD 4S0TD 4DN3L 3WJLC 4GFXA 1AR1D 3CXHK 4YUEH 4DW2L 5I1JH 1VFUA 3HE6A 4RSVA 3ULVF 5AL8A 3RWFA 1J5IA 1CXLA 1EUUA 2QQNH 4P46A 3WHXB 4C8XA 4PHZA 4M1DH 1R34A 5GXBB 1BF2A 3MCKB 5B7EA 3QUXA 4IOSD 5I8OH 1W2KT 4XNZC 3SIKA 2A99A 4M3KB 4A7QA 5DMJB 1K8IA 4XCYA 3FOLB 4XBEH 2DBJA 2VDNB 3ZKNC 4KMQA 3L5XL 2QBWA 2HYMA 2Y25A 4PJ8D 2GFBA 1N5AA 4GEJA 3UBFA 4ACPA 4AQ8A 5KBDA 4A63A 1AFVH 1FZJB 4K9EL 1HZHH 2O72A 4PR5B 1ZKAA 5C8JA 4UIMB 1QW9A 4ZW5A 4KXCA 2AJ3B 1LHZA 5KVFL 3EYQC 5IG7A 2HMIC 5ALBH 3M1BB 4G1MB 2EUXA 1HOCB 2Q76A 4Z95L 1IZJA 1G0DA 4OZGF 1IC7H 2I60H 1LK3L 5BZZA 1KN2H 4J1UA 1B2WL 1PG7L 1ZS8A 3O3DB 5MP6L 5D2LA 3CXFA 4ODVL 2P47B 3LQMA 1TYEB 4NNPH 3RVXD 4DVRH 1JGLH 2YMTA 3FQWB 3VFUA 3AY2A 1ZE3C 2HP4A 4JO1H 3WGUB 4A04A 1BVZA 1J8HE 1SRDA 3L16A 5C2BL 2Z4QB 1KCVL 4FQLH 3GLZA 2MPVA 4L4VE 4J2XA 1LM8V 1DE4A 1U0QA 4GAGH 4M1CC 1NUNB 4U4IA 1A9BB 1M1XB 1MELA 2XETA 5A2KH 2DBLL 3B2PA 5ADPH 1QHPA 5MI0C 1JK9A 2ZOLB 4RZKA 3C8KA 1E6OL 3VGAC 3JV6B 2Y07H 1FHNA 1IBZA 2PR9A 5D7KD 4WFGE 1Z9NA 5BO1L 2YPKB 2R9HD 3QUXD 4NBXB 5I1LA 3GHEL 4BXSV 4ZUVB 5FYKU 4P2OA 4ZMYA 3QE5A 3U36B 3IKCA 3DV6A 2VW7A 3U1SL 4A2DA 3VFPA 5AW5B 2Z92B 3II1A 1FBIH 3VTMA 3ALXA 1BLNA 4YC2C 5DD0L 3MBEB 5ABZA 2NNXA 1CD1B 2J5LB 4Q58C 4HXAL 2BFVL 1S5IH 4KQ3H 5AOJA 4NQCB 1FF5A 1QFPA 2GSGA 4PBDA 1Z9OA 4NT6B 3CSYB 1S4IA 4UOW0 4G7VL 5HY9A 4EXPX 4JHWH 3Q6GH 4EI5D 5DJYB 4H40A 4NDMA 3QXAB 3HKZA 3BT2H 3SDXB 3OKKA 4L3EE 4XPTH 5I1EL 3V0WH 1OE3A 1QP1A 2IAAC 4ZJ9A 3CZFA 2KL6A 1XZ0B 3JWOC 1I7RA 3PP4L 4FMVA 4N6RB 1E5UI 4N0UA 1E40A 1ND0A 3GS4A 3ARFB 4R5VA 3OR6B 4Y1AA 3QYMA 1VCAA 5ISZE 4B53A 3F7LA 4HH9A 2QQLH 3HRZB 3EGDB 5EU7C 2FEDC 1KSRA 3TS8A 2PP9A 1DANU 1RZJC 1P1ZA 4MD0A 5J6GA 3UO8B 2AGJH 4GUQA 1AO7E 5IJKA 1YECL 4FHKA 2HFEB 3MV8E 2OJZH 4ZFOB 5JPMB 4P9ML 3AB0C 2VSCA 2A6KB 3ULVD 4DP4X 1RZ8B 5J9PA 4XXCC 1HHGB 3P2DA 4HT1L 5EU5A 2B2XH 1K8DB 3PP4H 2NNRA 4PJEF 3EHBD 4HUWA 3BQVA 4FCHA 1EXUB 3LNGA 1COBA 3HC4H 2CJUL 3VSQA 5D55A 4WO4A 4D0DA 4XPTL 2GB2A 3CFJA 4JRYB 1CDIA 3B9KC 3GSRA 3ZE1F 5CZVH 1G9MC 4HD5A 5B8CA 5AVQB 1IZKA 1MREL 3Q5OA 3MJ7B 4JG1H 4Y8DC 4CADB 2AXWA 1KXVC 3PV7A 3FONB 5IJVB 1ZHLA 4E9SA 2C34A 4XN1A 1NLBH 4V1DA 4P9HL 1T1YB 5FB8B 4ANKA 4Y5YC 5DUPL 1DQLL 1GY1A 4NXSA 4WNJA 3U6XS 5L2KD 3H0TB 3P9MB 2ITDB 3ZO9A 3GTNA 4LCCA 3BYTA 2DLIA 1ADWA 5SWSE 1KGJA 2VXQA 3P9LB 2NR6D 4DKDC 4R96A 3B3IB 3QEQD 4OGYH 4QEGA 2DV6A 4V11A 3RJOA 1O6TA 1CFNB 3D3VE 4HEPG 4ZMQA 4JJ5A 3PAVA 3OJDB 4YR6A 3VXRA 5FHAL 1FG9C 3KPOA 1M3JA 1NKRA 5CF3A 5KBPA 3IM1A 3FU0A 1IGMH 4NAMA 5FO9A 2WXHA 4MJ6A 4OR1A 4WWKA 1UASA 3UTQB 5I73C 4E5XG 5J6HA 1ZSHA 3L3IB 1XAUA 5C9JA 2XA3A 3ARBD 4WI5A 3AXLA 1DDHB 35C8H 4X9BA 4NQED 4G6FB 5SWSD 5TK4A 4ANWA 5DJAA 2NRDA 4S1DD 2R15A 1MCWM 3W2DL 5KAQG 1G7IA 4ZSOE 4PYHA 1T3FB 4XC3H 1E43A 3D69B 1NCWL 1OPGL 5AUMA 1YLBB 2VDPH 4E9TA 2C3VA 4FXGB 3APNA 4OLYH 4AYGA 2NLJA 4FQQA 5FHAH 3MMEB 4FI8A 1ITBB 3CGTA 3T8MA 2OZ4L 1KJVB 4LF3B 2I5YH 1RZ7L 3GPSA 5T3ZL 3VFMB 3ZLQC 4V1DB 4HIHB 4LCVA 4OGYL 1FVCB 1P84K 1X9UA 1HZHL 2F54E 2O6DA 2V5YA 3BD3A 3QUML 5DD1H 1PIGA 3AS1A 4JKWA 2YUVA 3TU6A 5I19H 3CHOA 1Z5YD 4APXB 4UU9A 2YA0A 2CM6A 3RA7L 1DVTA 4E41B 1PCSA 1NLBL 3SZKC 1D9KD 5A16B 5D2NB 1JDCA 2NXYC 4W1TA 1FYTB 1OB1A 4M56A 2DIBA 3IN0A 4X5WA 1V10A 3D0VA 4BQ6A 1BQ5A 4Q74A 3UO1L 2V7HA 4N8UA 5DF0A 3BW9A 3V55A 1AGFB 1UWYA 3SCMA 2ICWB 3RI5F 2CRMA 2L7EA 1AKPA 3ZDWA 1THAA 4GG6B 3ZO0A 1TQBB 3SOTA 1CS6A 3GQFA 5FDWA 2P48B 3UBXG 3PGCA 2KKQA 1RUAH 4L1LA 3SDAA 3BCFA 5IT2L 3LZLA 4X4KA 3WHXA 3GRBA 3K4AA 4XNDA 5D7LA 4KX8A 3UDWC 4ZRGA 2AEPH 5C0NC 3HZKA 5I30L 3VSTA 4I48A 5BRQA 1MRCH 2G5BA 2VR3A 4X0KA 3DGGA 3U7WH 5DMKB 1HTYA 1XDTT 2UXTA 4HUKB 3WE6B 2DJMA 1HJCA 1EHNA 3L8QA 3M6DA 1G9NC 2HJKB 1KIQB 3AT8A 4O51B 2E8ZA 1L9NA 3C5JA 5BMFL 4RGNC 2WXOA 4MQSB 3A22A 5KOVC 4HSQA 3QDGD 2CHDA 1N2RB 5ES4B 4G82A 1PKQE 3BZDA 3SBQA 1TVBA 1TJMA 2YSSB 2ITEA 2YMOA 4X9HA 2RA1A 5E00A 2AXJA 2NUPA 4P23A 1IE4A 1MCOH 5DUJA 1Q94B 3ASNB 4LBEA 1KCWA 3QS2A 4KY1H 3BAEL 3VCLB 2ZXAA 2PCXA 2X4SA 1T0PB 2HH0H 3Q2CA 1AXIB 5C07D 1IAOA 3BT2L 1OGAE 5JUEH 2RACA 2X4OA 4OGQC 1OLZA 3PAUA 2XC8A 1EBAA 5BQ7A 3L9BA 4JHWL 3F04A 3LRSA 3Q0HA 4JHBA 3R8QA 2P5EE 4CKVX 1JIBA 3VXMD 4G5ZL 1HT6A 4Q8BA 3GJEB 1BJ1J 2HLFD 4XPFL 4Y2DC 4PJ9D 1F6FB 2R2BB 4EIBA 2ZG2A 5GRVK 2W65A 4QXGL 4ODBD 2XSKA 4L18A 1TEFA 3A4AA 5JW5A 1AZCA 4RZCA 3FFCB 3U1SH 1ZTXE 3MU3A 4AJ0A 2DL2A 1AJ7L 3FHEA 1QLFB 2DYSB 3W37A 4M9OA 2OPCA 4MJ5A 2QGBA 1EZLA 3LPFA 1WITA 2VW4A 4E9WA 1IT9H 1KCLA 4RQQB 5F2FA 3UC0H 2KC0A 2MIZA 3VRIA 2ZZUT 2DYPB 2HJLB 3DX9B 3C60C 4NZTH 4FYTA 2M8XA 3QIWB 4KMTH 4ZNCD 15C8H 3O3BA 1RPUA 1GRWA 4UIKL 1J9SA 2VB5A 1LVEA 3HCVB 4P23D 3W39B 5F93C 4GKZB 2OTWA 3FCTB 3OHXB 4ZAKC 2VIRB 2J56A 2X4QA 5KANI 2AJVL 4FTVD 4OZFH 4L8CB 2JKNA 2FQGA 4AL8L 4NO3B 4Y1AD 5EU3B 3PIQA 3PXLA 2AQTA 3VNYA 4JZOA 1DVFC 1T1YA 2WBWB 1CWVA 1KJ3H 2YPLB 3TBSA 5FB8A 3ILPA 2K45A 2K6YA 1WVZA 2WK2A 2X4UA 4C4KO 4WWNA 5CJOL 2NUTA 2MEJB 2AW2A 1FNEA 2AEIT 4P2RD 2BRRH 2Q20A 4U3SB 5LGKA 3K6FA 3W57A 4C83A 2C9XA 2CLVA 2OQJA 2A4ZA 2CLRA 5IVNA 3GUTA 4XBEL 4Z7VA 3L9RB 4M00A 4WI9A 4I8DA 4D3CH 4N2KA 1T1ZA 3N6YA 1KULA 1XCQA 4YSUA 3SE9L 4DK5A 4TXVB 2P1YA 3RWJB 2DB8A 4S11A 3CV5A 1NEPA 2JJUA 4H0LC 5CJXA 3NPSB 3GB7A 4MZ2A 5CUSL 5K39B 1YJDL 5I1JL 3VFOB 3LB6D 5AAMC 3F7QA 1KEML 3E0GA 2LFGA 1D5ZB 3OG4B 3VG0H 4K5LA 3BVDB 5JPNC 2JELH 2WPGA 4Z3JA 2L4OA 2XXGA 5DQDL 4B6ZA 5IB4B 1F58L 5LXVA 3QXDA 4OZGB 2XX0A 3GMPA 2VM3A 1JS4A 3MBWA 4KKPA 5AW7B 3WNPA 1WICA 4JDZA 4Z3EA 4Y1SA 3VG9C 5E5MB 1JWMA 3FTXA 4J6RH 2YSTA 3F00A 5E6IA 1BFTA 1N4XL 2F54A 5FFLA 3QNFA 1J5OL 4XMLL 1KBPA 3SGEH 1A3RL 3C12A 1SYSB 3V9FA 4Q9QH 3D33A 2XIDA 1ECYA 3ZL4L 2AANA 1AMYA 4ADGA 32C2B 3QXAA 5EF1A 4M6NH 4FFVD 2HRLA 1EEQA 1D5BA 2OMVA 5L9DH 4URTB 1T03L 4UQIM 2CIIA 3NSFA 2DPKA 4GSDH 1N59A 1NCAL 4X5XB 5D7JA 1OM3L 2X4UB 1VIWA 1UWXH 1P9MA 5JUEL 5C0DA 5I0ZA 4NUJB 4G8GA 4X5LA 3WKML 4ZG1A 2NR6C 4KQ4H 3X11A 5I6LA 4ZW8A 1D7BA 4FQHB 6CGTA 4WDIB 4IJ3C 2CPUA 4E68A 1JNNL 4NLAA 1ECZA 4PGDB 5DHMC 4OLUH 3KGTA 2JE8A 1G7IB 3FT3B 4ZO8A 4XC1H 2X6AA 3ZL4H 3BE1L 4Z3TA 1NCBH 1SLVA 2O6PA 4A55A 3EIFA 4XMLH 2MHAB 3MJGX 4NWUL 3ZDXE 1RZPA 1G7PA 3PDOA 4TTGA 4EE2A 2WGNB 1Q0EA 3IGFA 2AEOA 3V6OC 1VGKB 4W68A 2J73A 4C56B 3AREB 2J4WH 1XGQB 5L0QC 3DTXB 2AEPL 2GITA 1SZNA 1Z9PA 4RQQA 3SQRA 4F80A 1CICB 1U4EA 4U0RB 5FA4A 2QQKL 1UGKA 4JN1H 5FGCE 2K4WA 4LDLB 3S8FB 4NQDD 1BZ9A 4YSCA 2G60L 2D03L 2DN7A 4Y9FA 1RUAL 4WU7A 1GW6A 3MACL 1H3XA 5E8PB 2C9AA 1XB6A 3MFGB 5ESQA 3VXOA 2VXUH 3FRPA 5HHPA 3OKYA 4KNTA 5E6ZA 1RPQA 4EDXB 2EC9U 1WQVT 4GRWF 1KDIA 3FZUC 3AT0A 1D5BB 3U79A 3MREA 5CD3A 2BM3A 4X7CC 4GYBA 1G0YR 4PQXA 4BQ9A 1L9MA 3DX1A 1CZ8H 4YWGL 4MNHA 4M5TA 1T0MB 2OW7A 1ZTXH 4XNYH 3H9YA 1U91B 3PPSA 3KW7A 2VMEA 4DK6A 2CKBA 2RBLA 3CHQA 5D6CB 4HWBL 3MLYL 3DVNB 4U33A 4OCYH 2FSEB 3KNBA 5EPMB 5AYQA 3GDBA 2EE6A 4OT1H 3TEXA 2CNYA 4GXUM 1H3WM 1GOFA 2IPUG 4M6ML 2FYYA 5HHMD 4CBPA 4F58L 4G8EA 3T77A 2IANB 4BDVB 3RG1C 5HI3C 2I69A 3F05A 4JFZL 1DBMH 1IM3A 5DZNA 1WFNA 3GMMB 1NKOA 2WTOA 1KIQA 3N0AA 4UQAA 2EO9A 3NGBC 5FF6A 1MLCB 3CFQA 2AVFA 2YLHA 3R8BB 2ODIA 1G4RA 2CRIA 1D6VL 4GB9A 4PLOB 3MUGB 4GH7B 5FAAA 2N0KA 3L3OA 3BVWA 3HMXH 15C8L 1FL5A 3DHJA 1BAGA 4MCZB 5T1KD 3MUHL 2FNWA 4K23L 1KBKA 3VMPA 3ZE0E 4ABUA 1N6QH 3TBTA 3K80A 4UQEA 5EZIL 1QUNA 4B41A 5DFVC 2Y69B 4L5FE 3VXMA 5KJ7E 1XTMA 5E2VL 4KUCD 3MN8A 1E4XH 3JTTA 4FQ1L 4GQ9L 3L54A 1EZVX 1M05B 3EJCA 5D1ZA 5DD5L 3ZN6A 4PGZA 3NCFB 5D1ZD 3PIQB 1TQSA 4X5WB 4QF1A 3ECWA 5E4OA 2OMUA 3RWCA 2VLJD 5E8DL 4BZ2A 3TA3B 1GGIH 1Z5LB 4U6TA 5J3HD 2FEEL 4E41A 5F9JA 4XP4L 3U6RB 4HG4J 5ICXB 3MRBA 3EDJA 5GS0C 3S7GA 1T4KA 1DO6A 1FH2A 1KBGH 4I18C 4XVJL 1DR9A 3SDCB 4DESA 1ZV2A 3TEWA 4Y5YB 3I9GH 4PJAB 4BHUA 4Y4KB 1CQKA 5KYUA 3VE0B 4DP5X 5H4ZA 3DDGA 1U95B 3APFA 4PREA 5A2IH 3QIBD 1OALA 2WWOA 3QDJA 1Z2KA 1U3HC 1QSEE 5D6DA 1FYHB 2K7PA 3DVIA 5ID0A 4GRWB 2O4EA 3BAEH 4FQQB 4IKIA 4S0SD 3HG4A 5MERA 2UWEE 4APQC 2C3VB 4FXGA 4JFFD 5F71A 4ADIA 4CRPA 4D0CA 5C0FA 1E27A 3K71B 1UC6A 3BZEB 1TG8A 4LCWE 5CP7B 3CFEB 2WBJC 4N2LA 1RIVH 2R69A 4FKHA 3DOSB 4K8RC 1ZHKB 4L4VD 5I18L 5E1AA 3OPZH 2A73A 5CN1A 3ZL1A 4MZ3A 3MDJA 2AJUL 2YD5A 1EK3A 4IK6A 2XWTB 2AK4A 1U8CB 2BSDA 3FU7A 1ZS8B 3O3DA 1RIHL 1YQ2A 3ZIMA 4YSOA 3S36X 4U1HB 3IDNA 3CCHB 3RY6A 1CYGA 2AHIA 4PJBB 4EI5B 3B9DA 1E50A 5DXWA 2H6PA 5FYJD 3WN5C 4L3CB 5C0ND 2X3AA 3LH2L 2X1PA 4M5ZH 5C0CE 2WM0A 3JSSA 2A4EA 1J11A 1I85C 4FL4B 4HH9B 5IFHL 1DVFD 3H9SA 3F6IA 2EACA 4LBAA 2CDFA 3TF7C 2ZYRA 1BYNA 3OJ2C 3TV3L 3P02A 1T6WA 2NY7L 4IJTA 4L8BB 5AOZA 1AC6A 3Q6GL 3TNMA 4NQUA 2IANA 5E6RB 5F7UA 2CJ3A 2VISB 2WNKA 4LSVH 1Y6MR 5I8KH 3T2LA 1QFWI 2CR6A 2A6IA 2OYLA 4MA8L 5DMKA 3BKJL 3MXWH 2K78A 3EYFA 3MLTB 1Y7VA 4G8IB 4G8FA 4UCFA 4RBPK 1A7RL 2YD4A 3KPSB 4K3HA 3TT3L 5A3ID 3HE6B 2O30A 1E4HA 4FFYL 4PRIB 1OE2A 5CEXA 1X44A 1J10A 4YC2B 3ARDC 3RURA 4KKCC 5EOCL 1A6PA 4Z7QB 2OCFD 3FO2A 5K9JH 1YYLH 3QQ4A 4PH8A 5C0AA 2Q6WA 2WWKT 6FABL 3K81A 2I85A 2PETA 1PZUB 4JDVB 2N0MA 3CHSA 4KXBA 4QRUB 2VDPL 3LEXB 4R90L 4PJXB 4P5MA 3ZUCA 1SMOA 2BDNH 5FCSH 2DS4A 1S7XB 4GAGL 3ZQ9A 2XWBB 1TMQA 4XNUH 1IRAY 4HUUA 3SY6A 3SYAA 1TYRA 5D7JD 3J07A 4LCUB 3ESUF 3TO4C 3L1GA 4BFKA 4TNGA 5GRUH 2PR4L 5C2BH 2QR0B 4PLKD 3BGAA 2GUYA 4NZFA 5AW1B 1MHEB 4Z7NE 5IHZB 4A2MA 5TDNB 3GGWA 2XFXA 1B2WH 1PG7H 1SEBB 2FJGA 4MA8H 5HVGB 2B9BA 4EUPB 4YPJA 4FI7A 1IBGH 4PGEA 1KACB 5JW5B 1VFAB 3K72A 2E6QA 2ZNWA 3PQYD 4Y19D 7CGTA 3QEQB 1QG3A 2X0UA 3CC5A 1KYFA 4LEOA 4P3CH 5ACZB 3V5HA 5BCAA 2HTLC 2FX9L 3L1OH 4TULH 5ANMB 4BQ8A 2ORBH 5D72H 1AS7A 4FFYH 2BVPA 2QJDA 4DJMA 5D1QD 1X5AA 4MA1B 4JPIA 1T4KB 2BY1A 3TCLB 5C7XL 5AYUH 3UFIA 1JMZA 2ZYSA 1WBXA 4LVHC 1KLFA 1XGRB 5MEOA 1G0XA 2PKDA 3INUL 2YUXA 1DBJH 3VFPB 4D8PB 5HDOA 4KTEL 3RVVD 3WHE0 4LKXB 1K5WA 2WNGA 4WFHD 2BOCB 1N5AB 2D7NA 1HL4A 3DJZA 3ETSA 4W9EC 1UD5A 4AUYA 4ZW3A 5DK2A 5CZVL 5BOJA 2DYPA 2BVOB 2HJLA 5IFJB 1A25A 5IB3B 3QEGH 2RFXA 3T8VA 5TQ0L 4Q2ZB 3VJ6A 1P7QB 1ZAGA 3LH2H 4TM9A 4BWTA 3FTUA 1R6VA 1I4FA 2VABA 5C0JB 5FA3A 3FAXA 1JWMB 1XIWD 4NNYA 1CCZA 1WZKA 3IGAB 4C59B 4KKLD 2EZ0D 1AOHA 3OXSB 4M8QB 3S96A 5FYLD 5KVEL 1RIHH 1TKWA 1IVTA 2JI3A 5HD8C 2NY3D 4Q9CA 3BO8B 2ITDA 3ZJAA 2GUOB 4JMNA 3QIUC 3QDMD 4G6MH 3I9PA 4OZHB 2AABH 4LDOB 1U8LB 3LB6C 3IRCA 3N40P 1PDKA 4X7DC 5EZLA 1Y18B 3SYQA 5E8NA 4YE4H 4YHNB 1D9KB 1XXDC 1YEFL 1ONQA 5L88L 5B39A 3TIEA 4HKXB 3FCUB 1E42A 3K4DA 1FNGB 4KROD 1XCQB 3BP7A 2AV7A 5H37G 4JFXB 2Z8SA 2C8NA 5KSBE 1CU4H 2D31A 4ELME 3DO7A 5DTFA 5E8DH 2FSEA 4XMXA 5C3LD 5ANHA 5EU5B 1Z32X 4PRDB 3FOMA 1JV5A 3FBQA 3RAJL 1S2EA 3HUJE 4GQ9H 4KRPC 3LEYL 4WSKA 1CGXA 4YX2H 5E0FA 1A7OH 1M4KA 1VSCA 1FGNH 4OJAA 4WFED 4XMPL 1EAOA 4OD2A 1JV2B 5DD0H 2XHNA 3DGGB 5BPPA 1FBIL 8CGTA 3NZSA 1HH9A 4Z77B 2JB6A 2ZOTA 3EBGA 3LQAC 1S7SA 4AMXA 4PY8J 3S35H 5F7WC 3SKJH 3NQIA 4EIZC 4I1NB 2PPEA 4HWNA 1IU1A 3B9EA 2W88A 1RURL 3LSOA 2HZHA 4BA0A 2Y23A 2X4PA 5HP5A 2VO5A 4ZO6A 2ESVB 2L04A 4X7SH 4AIZB 2D7PA 2ZX7A 3SDDC 1A7QH 5E2VH 3DOHA 1SLWA 5DJXA 1AGCB 4PJIE 1UKSA 1X9RA 3UTOA 4ELDA 3ZU8A 4CN4A 2UY7A 2CGRH 4QXTB 4K7FB 5AAMA 2JSFA 3FUKA 3QJFA 1BG1A 2GSIB 4B7LA 1EBPA 3F83A 1RJYB 5CLWA 3A6CH 2AFNA 2UY7B 3KLHC 1WPCA 3SN6N 4LSSH 4B5EA 4FTDA 2VDQH 3MFFA 2CXGA 1JZDC 4IBYA 5JNYB 3EO1B 3SZ6A 1AYOA 1RZFL 1TYJA 2QEJA 3LS5H 3BDBA 4FS0A 4MNGE 4ODVH 1H8LA 1SUJA 1DJSA 1CVRA 5CP3H 4DZBA 2OI9B 1LK3H 2F7IA 3PGFH 3SDCA 2Z0BA 1L6PA 4JZJB 4Z95H 3SQOL 2EILB 2OSXA 3LHPL 3QQ3B 3ULSB 1BVKB 4BBWA 3L4WA 5AVYB 4YIQB 1CDYA 5HHOE 5IW3A 3N0PB 5FW6A 1VFBB 1B4JL 4EI6A 1SXNA 3KM2A 2DRUA 4F1ZA 3OMIB 1QWUA 5KJ4A 3VTTA 3ZKQD 2CO6B 2B59B 1T83C 3MRLA 2VWEC 3ARPA 4X99B 1V54B 2VXUL 3C9NA 4WO4C 3GMLB 2WWMD 4Y5VA 4YDJA 1JCKA 1K4CA 1JE6A 3LQAH 3IDXH 3VFTA 2D03H 4KKBD 2MPAL 4GFTB 2YPVH 3F7PC 2V3FA 2X0WA 3S3SA 1E67A 4EDWH 2BMKA 2NUPB 4P23B 4X42A 2EAEA 4TYUA 2AAVA 1TVBB 4KI5D 4ANVA 4EI0A 4NM8L 4AGPA 4GW4A 4OZHF 3PHQB 4ELKA 1RJZB 1KENH 2N7AA 5DRNB 3QZNA 5D1XA 4F92B 4XE5B 1XSKA 5D1XD 4FQXA 4DW2H 1JL8A 2NX5B 3PWJA 4LLDA 4PV9B 3UYOD 4N2OA 4AUJA 4P06A 4DN3H 1KEGH 5DQJB 1T0OA 3WXVL 1CFVL 43C9A 3KL0A 3BN9C 3RL1A 1H3PL 1TQCB 4ZO7A 1HINH 4PLJC 4YXKH 3P9LA 5EFIB 3BUQA 3IMBA 1OAXH 4KXZH 2P5PA 2UX6A 1CO1A 4EJ1C 4HUVA 3RL1B 3WBDA 4PI0A 3EYFB 4KQ4L 3SPJA 1AKJB 2QLVB 3KPLB 4P2QB 4CGUB 3S3PA 1GYUA 3NK3A 1RK7A 4YXLH 3QNZB 3L3JB 1BAFL 3BE1H 2EE9A 4G9FE 2QLYA 2UXFA 2WQWA 4GUCA 7PAZA 2VLRD 3QZPA 1MFDH 3MQIA 2Y24A 1IGCH 4XP1L 4ZTOL 1QWHA 4PTTA 2Q0ZX 2IAMB 2DMKA 2EDFA 1A6UH 5I73B 5IMOA 3LZNA 4FTVA 1NFDA 1GJWA 2LAGB 5JIHA 4JANB 3ARDD 1NCCL 3TCXA 3U4BH 3L3HB 3EGSA 3MRLB 4MNQD 4H2CA 3HOGA 3KGRA 1KELL 1OAJA 2Z8WC 4GSDL 4HIIB 1OM3H 1BPVA 5AW8B 2WVVB 3P4OB 4U6VH 3DECA 4HZLA 2ICWI 5C97A 2XA8H 5ECGA 1KIUB 2IBBA 5KW9L 1QQDA 4ZUSB 4ZUTA 3VXOB 4OIFA 3B9AA 4HPYH 4N0FA 4QRPE 1HILB 4HAGA 3EBAA 1KEMH 4KV5F 5TFSL 1A3RH 3RKDC 3ZTJG 4QDGA 1KEGL 2FZ3A 1RSFA 2B5IC 2Y4SA 3SDYL 3QIUA 2FJGB 1Q9KB 4LLYB 3CPLB 1NFIA 1JZ6A 2VQUA 2J3SA 5E23A 3C09B 3GSWB 4L3FA 3HAEH 4PLKC 4BFBD 3UG3A 4H26B 4JQXC 2XWDA 1WJ3A 2X12A 3IAQA 4MMYA 4PY7B 1T89C 4LP5A 1CE1L 1A7BA 1UWEH 2IQAB 3V4VL 2OMXB 2LU4A 1UOVA 3L3IA 5AENA 1E9QB 1QLFA 2YA1A 5IB2B 1SY6H 3FT3A 5BZDA 3CVHH 1K5NB 4GKSA 4OLZH 4CILA 3QQ9D 1N0LA 2R1WA 1IC4L 9CGTA 1BREA 3MOBL 4N85A 1LNUB 2X40A 2O6CA 1T0NA 1HNFA 4NJAL 3FRUB 4YEEA 1T7ZA 1MNNA 1MW2A 2B20A 3L2MA 5C9KA 3DTUB 1CF8H 2IH1A 3C5ZB 4G71B 3FB5B 4GRLC 5BUGA 5IVOA 4PJGE 1CF8L 4S0HA 2ADIB 1TZHB 3G9AB 4KWUA 3LZQA 4KO7A 1MFCH 4PJ8A 4C56D 1SQMA 1JN6A 4X6DB 2CM5A 1HKLL 3FXIC 1FO0B 1E2ZA 3C8HA 5CJOH 1WA1X 2PCFB 3K6SA 2GBVA 1ZJBA 4TOYH 1Y6NR 4H4NA 4HPOL 2XQYG 3FU6A 2PCPA 4JRXB 3TVMA 4HC1L 1Q9KA 5JDSA 1EQWA 4XNMB 3V4VH 3QPQC 4PJIA 3FTWA 1SJMA 5C6WH 4IBSA 1P7HL 3AG3B 3A6OA 4LCUA 1QNIA 4PIBA 1PX8A 1VDGA 4JPWL 4TVPE 2NY3C 5PCYA 3OG6B 4OGXH 3U25A 2IWKA 3H9HA 3TIEB 5FM5O 4XCNB 1YNKH 3VM5A 1M7IA 4MQ7B 3VXRE 3GRWA 4G42B 4M4RB 4XZUB 2N56A 4XMZA 4YHNA 1FZMA 2F53A 3H9HB 2IJ0C 3I6GA 1N9PA 3LPOA 3US0A 3NIDB 4EBQL 3WIAA 3QA3A 2NYYD 3WD5L 5I1IL 4HIPA 4G5ZH 3G5YA 4RFOH 2E9WA 2O5NA 4FOMA 4F7CA 5IMKA 1OK0A 3FK3A 4IRJC 4QNPE 2G3NA 2OS7A 4NC0B 5CP7A 2FJHA 3AS0A 3HLKA 4NP4L 4N68A 5F9WC 1TQBC 4KUCF 2DMBA 1DZ0A 3T6VA 1VFBA 1P7QA 1HAUA 1JZGA 4XCYB 3TT1H 1K2DA 4O02L 4Y2OA 4FG0A 4L8DB 2YN3A 3GLEA 4N2IA 5HJDA 1N0XL 5SWZD 2ATKA 4X9FA 1YHPA 4MYPA 5F70A 1YEFH 1T7YA 3ARFC 4ECNA 1IGYB 3NFNB 5FW8A 1I1AD 3Q8BA 1OP5H 2AJXL 2B14A 4MX7B 5E8PA 4K3GA 5DS1A 3ULUL 1E5AA 3AS2A 2DD8L 1J0IA 5GIRA 5JIMA 2W07A 3IDNB 5I30H 3ZDYF 3RWCB 2EYSB 1INEH 4TNVF 4I13B 2WKGA 1BIIA 1MFVA 3D39D 3IF1B 5IZ7A 2XTJC 3IPFA 1SXBA 4PRHE 1TPXB 4QRSB 4DGWC 4K7FA 1CFVH 1MQ8A 2QVFB 2Q7NA 3CVHA 5ELIA 1L0XA 3B2MA 3V4PB 2I07A 4PGEB 5TQ0H 3ZE1E 2LFEA 2DQUH 5C9JB 3C5SB 3MRKA 2V37A 4UV7H 1MCWW 4KUZL 3BJLA 1B9KA 2ZICA 1CMOA 3B7UX 3ZTNH 3Q1SL 3VXSE 5FO9B 5CFHA 1S8DA 2DQTH 1D5RA 2IOMA 1H6FA 4PJEA 3FB7B 5GSVA 1KGUA 5TJWK 2IH3B 4LARL 3NH7L 1GCFA 4DEWA 3RA7H 3B2DC 2XI9A 3R18A 3HS0A 4ODXA 1JUFB 2VXQH 2YMXL 3QI9C 4TMPA 5EEZA 2X7LB 4WGKA 5AYUL 4H25B 5G4NA 4FERA 1SDYA 1EHLL 2ALWA 3EH3B 3DUUB 4XVUD 1B4JH 1RQ5A 3G04B 1NOAA 5IROA 5J6SA 2WIIA 5DJ0A 5C0AB 2Q6WB 3MRHB 4L4TE 2GHZA 4PW3A 4JLRB 1DBBH 4LEEA 5FXCH 2AK1H 4JANA 4HXBH 4KVNL 2HA1A 4JE4B 2AJ3A 3MBXL 4L9LB 3IU3A 3FSWA 4PJ7E 3UTPD 1KCUH 3GSQB 1ZA6B 2ZOWA 4NLHA 4BEIA 3CPUA 5HYJB 5IEHA 2UVFA 4G7YL 1FV1B 1O5PA 2NY6D 4YZWA 3QZWA 4F37F 4RWYH 3WLWC 2J25A 2XPGA 4OGZA 1F6LL 1KC5L 1RKRA 3BSZH 7FABH 3S37X 5LHDA 4RIRA 4WRLA 5GJTH 2Z91A 3NIFF 1DQJB 2FR4A 4YFLF 4Z18A 3I6GB 1ROCA 1ZEAH 3K5SA 2CD0A 5I1KL 5DHVA 1RIUL 2B3RA 1DVFB 3CSBA 3FHAA 1OPGH 4RA3A 4GQRA 1NANI 1V3JA 3BPLC 1UA3A 4XO5A 3E1ZA 1ZLWK 3OAYH 1YEHH 4P5KA 4APQB 1GW0A 4JQXA 4PIRF 4JQVA 5D1XE 2IPKB 1BMGA 5D7LD 1J5CA 4YBQC 3VFNA 3LNIA 3IFPB 4OZFB 1ED3A 2GITB 1YDPA 2C3XA 4Z78B 3TJHD 3ZKXC 4F2ME 5DYOA 4G7YH 4YQXL 5I1AA 4WUUA 4PP2A 3DSNA 1IKNC 1DQQA 4GO6B 4ZOEA 4ORZC 4PY8I 2FJSA 4MAYD 2VC2H 4DGVL 1KPRA 4ZNEE 4ZFGL 1GGCL 3W0WA 1NGXA 4AITA 5A2CA 3D85B 5E9DD 3TBWA 3GTTA 3GMLA 4R0LB 3K1DA 3GHBH 1GC1H 3TV3H 1OANA 1R75A 1B4LA 4J3XA 2W07B 5HJ3B 1F6AA 5ICZB 2EQDA 3OHXA 1DQLH 2XN1A 3FSZA 3CU7A 4BUQA 2EJ1A 4POUB 4CMHB 5E5RB 3NFNA 2FDBP 4OZIB 3FTYA 5D7JB 4LSPH 1JRHI 1XEUA 1U8NB 3U0TA 3I75A 4W9ZA 2WANA 4S10A 2B15A 2WMPB 5GGSB 5L2JA 5DK3A 3RKDD 4B97A 4PTUB 4JG5A 2F58L 1RFDL 2ZCHL 4CVZB 5GZNC 5DC9B 5E5LA 4JHUA 2GHWB 5D9SB 1DSFH 4Z76B 2VDOL 4KFMA 5E7FA 5IW1B 2TAAA 1UADC 4QYOA 4V33A 3QIWC 3CQFA 1YMMA 4JUSA 2P8PB 2P44B 3FU5A 4LQFL 4C4UA 1VB9A 5CEZD 1J8KA 4DKAA 2YOAA 2VDPB 1EERB 5F7FA 5FIEA 3HC2A 3P3YA 1IGIL 3TTSA 4CJ1A 2BOCA 1G7PB 3PDOB 2PPCA 3NEOA 3ZDZE 5DSCB 2ICEB 3MRNB 2CG9X 1KBWA 5DJ2A 3IWUA 2NTFB 1FL6B 3QQ4B 1OP3K 5D1XC 3SCMC 3WIFB 3ZDYE 3NN8B 3QRGL 3VFGH 5J4MA 2UXGA 2F58H 4K3EL 3U7YL 3KXFA 1RPKA 3DMMC 4J3OC 4LNRB 5HVWA 3BN9D 2JKTM 1I7TA 4RMRA 4EN3D 2IPUK 1W9XA 2LU5A 2JB6B 3NUKA 5EBLA 2NXZD 1JGUH 2OL3B 2FEJA 3KJ4B 4XP4H 1TTRA 4DP8X 2W0KA 3ESMA 2Y7OA 4E42A 4L05A 2GJ6E 3EYUH 4WW2F 2UY6B 1FZJA 2HKHH 3GFUA 3L4UA 3P30H 2CUHA 1DVZA 2O5ZL 5JDSB 4GOSA 5D72L 2VJXA 1GC1L 1PZBA 1XIWB 5JIQA 3D5OF 5KBKA 4DVBB 2Q3XA 4QUOA 1E4XL 3EFFB 3A6BH 4CC4C 1TVHA 2D4FA 4H2AA 5IHUH 4IKKA 1UTDA 4I0PD 3EJYD 3V0AC 3MV7B 2HAZA 5EZIH 4BWUA 1KWKA 3D4GA 1T2JA 3E80A 3JVGC 4LGRB 1C08B 1T22B 3GEWB 4M48H 2K7QA 4FLRA 1IMHC 5FV1L 4ZX5A 3FJTA 5JPMA 2JJSC 5AOMA 4DO4A 4EKJA 3BH4A 2W9LA 1RJCA 5GRUL 1F4YH 1RV6X 4LPTA 4IBVA 2VUOA 3KEHA 3IK2A 4PWFA 4KROB 2ZCLH 3D4CA 2Z31C 2B4CL 2OMYA 3SEPA 5AD0B 1P1ZB 4QOKE 3HFML 1GL4B 2C9PA 4N2FA 3WS3B 3RUGE 1AD0B 3T0EA 1JZ3A 1HEZB 2L7JA 3OMNB 4FYRA 5I75B 3RE0A 4P2YA 3QG6B 5E7BA 4DP7X 2R2EB 3EYVA 3O4LA 1JI2A 2CHWA 1BVLB 1CFQA 2EIJB 4LP4A 2QFPA 3KEDA 3GSXB 2IPTL 5JHBA 2HTKD 2RTTA 2CDGB 3SDXA 4K5NA 3UGXA 4APXA 2ZXCA 5DJ0B 4PJCE 3T4YA 4WU5B 2IDCA 5MP6H 3VXME 1MN4A 3QQDB 3Q13A 3QIUB 1KN2L 5I2IB 3U0TB 1FVCA 1E5YA 2X4TA 4HJSA 5DQ9A 1XD0A 3AGWA 4LSVL 5DMIH 3T1FA 3NABL 3I6KB 3MBXH 4UM9D 4IRSC 4UZGA 1W8OA 3V5KA 5DUBA 1J05B 4GBXD 1I3UA 2DTSA 3RX7A 4NO3A 4OJEH 3MOBH 3L3KA 1UA6L 1S7TB 3HZVB 3PGDB 3D12B 4N90E 4QF1B 1S7RB 2B77A 2BHYA 5ACZA 4GRLD 3F8UB 5IW6A 3VXTB 4AW7A 3NQKA 3EOBA 3AITA 3BEWB 3CVIH 3V0JA 4NQEB 5TK2A 5DSCA 1N0LB 4GG6E 4IRSA 3HB3B 1AC0A 1RHFA 1R5WA 4B9JA 2A6JB 2AI0L 1MRDL 2OMWA 4JO4L 3ZTNL 3MLSL 2X70A 4ABQA 2FAUA 3ATAA 2G30A 5B3JF 3FQYA 3SYPA 1TF4A 1KFGA 3S88L 3DI3B 2OP4L 3DSFH 5IMLB 2J88H 3QHTC 1IEBB 4PRPE 3N43B 1OAUH 3O4LB 3O41A 4HU2A 1KT2A 1JNJA 5H35B 3MRMA 3OX8B 3QPQD 4QRRB 4KITB 1MW0A 5DD3H 3OQRA 4V1DD 1H15B 4PJXA 2VM4A 2QKSA 3V9EA 1UB5B 2DZEA 2LOEA 1I3GL 5HGHA 1AYRA 5H94B 2JFCA 5GGUA 4FLHA 4UQ2B 3QQXA 1RY7B 4HIJA 4LVOC 2OSLA 4Z23A 3D39A 3EFDL 3W9DA 1WT5A 5INCA 3LRMA 4PR5A 4RIRB 4HOMA 1TUPA 2WLYA 2QQQA 1FYTD 2IV8A 2XQBH 4JRWA 5DD6B 1IGCL 4XP1H 1U2YA 3N44B 3PXJA 2QSTA 3KYNB 1U91A 5F89A 5CIPB 1JNHA 5CWSB 5AZEH 4LGSB 3H9SE 2NY6C 2VDKL 4OD1H 2Y5TA 2ZKHH 2E27H 2BWQA 4PB0H 2GTWA 1BM3L 3BN3B 1MI5E 1DHKA 1FNEB 1Z6JT 4HWZA 4MB4A 5D7IF 1MW3A 4N90D 1W16A 2E5EA 3PE9A 4F7MA 1FN4B 3VU2A 1HINL 2VAAB 1NCDL 2YD0A 4A6YH 1QA9B 2FWOB 1YC7A 3VG0L 4TQHA 1MAJA 4K23H 1WBZB 1QSEA 1ILSA 2NLJB 2ZUQB 4H5SB 4IRZH 1FVDA 1GS7A 4ILDA 3AG1B 4XP9L 3HMXL 5IF0A 4BDVA 1H15A 2NZIA 4WFFE 5IBUG 3JWDC 1HVXA 2MTPA 1JHTA 2K6WA 2MOVA 1RMFH 1TNMA 3P40A 3QDGB 4FI6A 4UM8B 1TZAA 2OTWB 4TSCL 3SE9H 3GXMA 3VXUA 1BEYL 3O41B 2XN9D 3HCVA 4AQ1B 4BK5C 1S9VB 4MMZA 4NQDA 3RB7A 2XTJD 3IXAA 5J13C 3TIDB 3ULVL 3S8WA 1IJNA 5KS9E 3PHQA 2CJSA 3CSGA 1E3ZA 2BRRL 3ARDB 3L4CA 3QZWB 3ZR6A 1HFUA 4BELD 4HCFA 4IRJB 4UB0H 1LILA 2Z31A 1HXMA 1FYTA 4TOYL 5MEND 4AQZA 4D9LL 2E74C 3MV9A 2AXFB 5TPWH 3BEVB 2ESVA 4FJYA 1NUDA 3VSVA 3LNDA 5C0DB 4PJAF 1HSBA 3F12A 1ZT4B 3VFVA 4CVZA 4UANA 3NZHL 3MRGB 2OMZA 4DQOL 3GWJA 2YD8A 4W9CC 3NZHH 5BRZB 3MSPA 5AVTB 3DIFB 2GKIA 4KJQD 4QRBA 4UTBL 5CJQH 1HIML 3QDMA 2XG4A 4RGNE 2H47C 3HNTH 3AC0A 3CDGA 3CMGA 3NGBB 5FEBA 2GY5A 3HIZA 2FQDA 3FB7A 4DAGL 1WRFA 1JK9B 4OSUL 5HSFA 3AABA 2HRHA 2X87A 1A9BA 1M1XA 3B4NA 4HJ0C 5CXPA 2X1QA 1XR8A 4HS8L 1VGKA 1RVFH 3UC0L 3QIWD 4MTMA 2XBTA 2V2TB 2W59A 5KVDH 1CE1H 1UWEL 1H3VA 1KTDA 1NTDA 2KZBA 2MHAA 4C55A 1R46A 3CFBA 4WUKL 1ACXA 3NDZE 3MRDA 3KLKA 1JPFA 2YSSA 5DGQA 3NIFE 5AG9A 1N2RA 1TTBA 2VH5L 3NK4A 4P5MB 2YBRA 3W0WD 1X7QA 3SYCA 3C5ZD 1DJIA 4I2XA 5EZOH 4YDLC 3S35L 5ID1A 1SUHA 2R2HB 5TFSH 1ZGLB 2F5AH 3M1BA 4G1MA 4KRPB 4PJCA 3S5YA 3F7YB 3W81A 2DIEA 3IMTA 4W6XB 1QWNA 1FGNL 4QHKI 1GZHA 3KS0J 2CO1A 2IALB 3LEYH 3LXAA 3NIGB 1IKFH 4KI5F 1U3YA 3IGAA 3SOBL 4Z3HA 1NBYB 2EEBA 4XPGH 4XN7A 3GJFK 3DX8B 3FRPG 2AJZA 4WTXA 1UOLA 3WY1A 1UZ6F 2BP8A 3PV6B 1XZ0A 2W0LA 1MVUB 1SXSA 5F0MB 4AI7A 1ACZA 2YC1B 2VDKH 4OD1L 1T04A 2HJFB 1IBDA 1PY0A 3PY9A 4K7PL 4NPJA 5L9DL 1RK0B 2BSBA 3EXLA 3CFDB 1AKJA 2V7HB 3PWPB 2VR9A 2QT6A 4JVPA 1SOSA 1A2YA 2E9GA 2CKBB 3MRCA 3V4UL 3M17B 4PS7A 4G2AA 1T1WB 3EFOA 3N3EA 1BAFH 1HL8A 1RZKC 4E9YA 4N20A 5SWSA 1M71B 1UEYA 4AQEB 5JHAA 3HPJB 4UBDD 4G8AC 3HN3A 3U7WL 3UOAB 3IU4L 2M1KA 1MFEH 2A6KA 4RNRA 4JFFA 5DZAA 4MJHA 4TVPH 1IEAB 1X9QA 3TYFB 3GZQA 2YBRB 2KS0A 2ZWZA 4GW5B 3QZOA 4DTGH 1TTCA 4LPXA 1HJBC 1F56A 1KJVA 3VRIB 5JA9A 1FL6A 1TJIL 2BMKB 4ONFH 1VZIA 1NDMB 1GSKA 4WGWB 4O9HL 2WP3T 2XRAL 5DMGD 2VR8A 1TZIB 2DQGH 3T1WA 3RFZA 2AI0H 2P8MA 3ZZLA 2E6JA 4CDHA 3MNDA 2L8AA 1KFAH 2G0LA 5D8JH 4LSPL 2DOCA 4DIXA 4TUOA 3FUIA 5FYLE 3QRBA 2MCMA 4LXFA 3QUMA 1FL3A 2BNQD 2ADJB 2C7UB 3OXRA 5CEYA 5FOBB 4MCMA 4OQ1A 4IRSD 1J5DA 1GGBL 3PXHA 1UA6H 2EEDA 5T3ZE 1MWOA 1U8NA 3SCMD 3ZKSD 4AMWA 3FQ1A 1SLXA 1Z0MA 3FSOA 3CLEL 4FC3E 2EVHA 5F1IA 3SHSA 3NBNA 4OUUA 3WL9A 2I5YL 4YPGA 5T3ZH 2OZ4H 3VMNA 1NEUA 2DMCA 3EYOA 1X5FA 3S3DB 5BV7B 3UJIH 4FZEL 5DURD 3WGVB 2ILLA 3FSVA 3FTGB 3HAEA 1ES0A 5CEXB 4IIQB 5IEKB 5LGJB 2QPDB 4GG8A 2NY4D 3CK0L 3LN4B 1IGFH 2C3GA 4I4WA 4Y2LA 2R0KL 3HG3A 3G6JA 3OR7B 1FJ1A 3RNQB 5C6TH 1CICD 3I84A 1K2DB 3L3JA 4XWGL 4UINH 1ZOXA 1ACYH 4MMZB 4NQDB 4DCQB 5MHSE 2IH9A 1KGCE 3SE4A 3A6CL 5HBBA 2G5BB 4X0KB 3VD7A 4YVUA 4XXWA 3T4AC 8FABB 3QFDB 4R90H 1UOKA 2XACC 3VWKC 3HS0C 3H85A 5IB4A 1QRNE 4K73A 4PUBL 1J1OH 2VSDA 2EP6A 4N2HA 3TFBA 1LP9B 4A39A 3EG9B 4CU6A 2W60A 1EWHA 4Q97A 4JY6B 1UT9A 2R27A 3ZRFC 3B2VH 4PV8A 5ID1B 3P54A 1HCFX 4LHUD 4TLTA 2WXJA 2IADA 1TPXC 1NFAA 3N85L 4ELKB 3NRQA 3BVNB 5DUPH 1P4BH 3MV11 5IHUL 1H6EA 3LKNB 5I0WA 5DEFA 4JJHA 2AK1L 4KVNH 2JKRM 1RD6A 4PGJA 4P0DA 4JKNA 4P2OD 2JV6A 1PZ5B 2NY7H 5GRJL 3HBGA 1XVSA 4FAAB 4DEPC 3MV01 1O6VA 1I1YA 2OR9H 2HH0L 5IFHH 3VD2A 3C09C 3GO1L 2JCCA 2OCJA 4JFSA 4NUPA 3RPIA 1C5BL 2BY3A 2QADC 4U0QB 1WP6A 1O75A 3KPLA 3ROLA 2BPBA 4UAOC 4H8WC 2V9QA 1GS6X 1XGZA 4U4BA 3II2A 2ADIA 3HZKB 1M6UA 3MA9H 4BCYA 1QSFD 3GSUB 4F93B 3H1ZA 4PJFF 4FTVE 4XN4A 4Q14A 2CK0L 2J8UB 3IT8D 4QJ5B 1T3FA 3BRFA 2CKNA 4IEFA 4MA7H 4BRVA 1A4AA 2AGJL 1BQRA 1FFQA 5FA3B 4ZX3A 1UURA 3WSQL 4LL9A 1G7MB 4OM0L 1LEKB 4PRBA 4FXLA 4AJYV 4FKKA 1C7TA 4IRJA 2RFXB 3FU7B 3O3AA 3MRFB 4GKOA 3R1GH 4YFLI 2YRZA 4YZFF 5IT2H 5D1ZB 4AW4A 4HUXB 1O5DT 3WFDL 3BP6A 3IJYA 4DK3A 4HLZH 4KO5A 1JPGA 4PRAA 5A1AA 4AC4A 3TZVC 3Q2NA 1E9PA 4YNYB 2MRYA 3QEGL 4HSCX 4G80B 1S7RA 4WWKD 2X6MA 5LNGA 1UM6H 2JXMB 2X1XR 5K1VA 4HHAA 4LRIA 5I9QC 5EO0B 3SBPA 3VXRD 3FQRA 4Q6YA 1BDYA 2Q3AA 2DQCL 4MYWB 3S4SG 4X4ME 3Q6FA 1QA9A 1JI1A 5IUCA 2IXQB 1HC1A 1UD2A 4JZJA 2ADGB 3GO1H 5D1ZI 4KJQC 3QR2A 5I19L 1RUPL 5E6UB 4JFFB 1AZUA 1U8HB 3L1OL 3OKLB 3GMQB 4GUPA 2I25N 3QWOB 4LL4A 4P3CL 1VERA 1NFDB 5C07E 4Z7UF 5IQMA 4J3OG 4YOKA 4D0DB 5EEXA 3BCDA 4PBVC 3MI6A 3QO0A 5F3BA 2D9QB 1U8JB 2VTFA 3IJHA 2R2EA 2YN5A 4JDZB 5I5MA 4G8GE 3MRFA 3KDMA 3AFLA 2ZOUA 3OWEA 3BH8A 5I0VA 1S9VA 2V8MA 1R3LB 2YGNA 2HB0A 3BP4B 4JO1L 2BHUA 3OC5A 1YEHL 4F57L 2VDLB 5B3JE 2EECA 1GGTA 1KIRB 3NIFB 4L1BA 4UQ2A 5ENWA 1S9WB 3SO5A 1RULL 2MOQA 4R96B 2JH2A 1XEDA 5HGDB 4Z8FL 1YN7A 1DJHA 2QMKA 4F24A 2VERA 3P4NB 4OFYA 1ZEAL 4D9QE 4URKA 2E46A 1Z0NA 4YS4A 5EOCH 4MCNA 5E2UL 3CZFB 5GJTL 3BUIA 4W81A 5D4QA 1KCSH 1CI5A 4JFEB 1A5FL 2CO2A 4NBYB 4WGVB 3ETBJ 5JXED 3N50A 1SVZA 4LAJH 4JFHD 1G43A 1MFCL 3I3BA 4U3SA 2IAMC 3H3KA 2UZYA 1RHHB 1T5XA 1ZTXL 4XNYL 4A7GA 3ZHNA 3WEOA 4MJID 4J28A 1FO0H 3P4LA 5EUKA 3VI4F 3J2PA 4NS0A 4PM1A 2BVUA 3FT2B 4N0YL 4PJBF 4QRPD 1KTRL 2FL5A 2VLRA 3CLEH 1NOFA 3AADB 2VSKB 5HHXL 5C0GA 4Q6IB 5FUOH 4AEHH 2AXGB 5F7BA 4LEBA 3U36A 1P84J 1NZRA 3POCA 3GKZA 3E3QE 2WQSA 1MIEL 4Z7OF 5KBNC 1ZGLM 2H3KA 1F3JA 5KS9B 3MTRA 3P0GB 3MMEA 5DQ9B 4GMSL 3GXNA 1NUGA 4JN1L 5I2IA 1CYXA 2MFNA 3H54A 3MGAA 3ZQXA 4JE0A 5F1KC 1OF0A 4CJ0A 4CBZA 2A83A 2OJZL 2P24B 4U3CA 5JHDB 2XVGA 1Z66A 4YJZL 3TPKA 2QSQA 3UTSE 1TJHH 2BOBB 5C0JA 4OLVH 4OCLC 4FF9A 5AOIA 1SYSA 1CQYA 1G9HA 1MCJA 3KYAA 3SDYH 4XCFH 1CDUA 2QR0A 2WSDA 3QFJD 4FQXD 4GXFA 4ONFL 4U1JA 3PP3H 3RDTC 5PAZA 2Z7ZA 2EDEA 4H26A 1G84A 1R3HB 3G5XB 5T3XH 5EIVA 4GKNB 2NDGA 3BKMH 1BP3B 1PAMA 3ISYA 4PJFB 4MJ6B 4LSQH 5D2LB 5LN4A 4M03A 3ARGB 5CD5C 3SD2A 4WAFA 3PWLB 1WC7B 1ES0B 2QL1A 1N68A 1BV8A 4MD5B 1W72A 4AV4A 3AG2B 1KBBA 5EUOA 5AD0A 2R2BA 1RZJH 2H5UA 1MCBA 2XN2A 2LW3A 3S3CB 3UABA 4GRLB 1OE1A 2JIXB 2H3NA 3SGDI 3VI4E 5F7KC 3C2SA 3QFJE 1O0VA 1HX0A 4NKMB 3PREA 5KTEH 4F9PC 1LO3L 3NFPA 3WTWA 3ASWA 1TTAA 3FS9A 4KI5E 4LQ1A 3ROLB 3BAKA 3BPLB 1GGIL 3SE8H 1I3RB 3I02B 3X13A 3IDGB 1J1XH 2I9LB 1J9CT 4QRQB 1H9DA 3GC3A 2KHAA 3TTYA 4LU5L 4C57C 4PMEA 2XTLA 3GSRB 3LZPA 1YA5A 5FK9A 4D2NA 2BWDA 3IDGA 4NSKB 3ILDA 2V0AA 2NY3B 1T6BX 2GTQA 4PJ8C 4Y4HB 5A3IC 3VH8A 2OL3A 2F5AL 1NGQH 4QRRE 2F19H 2PWDA 2JKLA 4K07A 4KKCD 4B9CA 1IM9D 1R0AL 3F7RA 3L5IA 6PAZA 5IFAH 4M7KH 5C09A 4QXUL 1AO7D 4LRNH 4N0UE 2P43B 4PJ9A 1UACH 2XNAA 5J1TC 5JOFB 1AANA 3TLRA 3RGBA 5BS0E 4D3CL 2C9RA 1A6AA 2YQGA 2YPVL 3KWUA 4MSWB 1NEZA 4P5TB 2YEQA 1I8IB 4A66A 1QFUL 4B9YA 3DNKA 1ZLSH 2EYRB 3EHBC 2EVGA 3DVNA 4AZ8B 2ZYIA 5CGTA 3VRLF 4XNXH 4ALAL 4DOHE 1DJGA 2OV0A 4I0PA 3RWIB 2JLPA 1GPOL 2E6PA 1OCOB 3E6HA 4CVXB 4FD0A 3JTSA 4K9EH 3VI3B 5A43C 3B8YA 2OXHA 3TO4B 3NESA 3MNWA 2KYIA 1NAKH 3JT2A 2GJJA 2I9LA 2R9HC 3M86A 4AV0A 5GS1A 3DURA 4Y16D 5CMAA 3AROA 4FXTA 4D8PA 1XO8A 1CZ8L 2AJVH 1ZHNA 2KLRA 3JYBA 4NCC1 2ZUXA 4YWGH 4KKZA 3BQUD 3G5WA 1A6VL 5I8CB 4PJCB 2EH7H 2VAJA 5D1QC 5FKPB 3MNZA 4M1DL 2YEZB 1KB9K 1IGJA 4RDBA 5ICZA 2XTJB 4DWHA 2V6HA 4PJ7A 3RWHA 1IC4H 1E8YA 3KXFD 3HC3H 5TH2B 3B9KA 1XB8A 3HN8A 1Z5HA 2ADJA 4G6AC 3DMMB 1JNLH 1RSYA 3HG2A 1SBSH 3RIAF 4Y1AE 3PL6A 5C0BB 1B4RA 3T1FB 4E9XA 5CU9A 1S9YB 2QGCA 3IJYB 2DIJA 1QO3A 1FGVH 1QTYT 1BEYH 2ZOKB 3CVHB 3HN5A 4JKKA 1A14H 3LPGA 3CFCH 3U9UB 3GGWB 1RMFL 3QJFB 4GIPD 3AQDA 3QULB 5EN3A 5JIKA 1A8ZA 3EDDA 3OKOA 4FGMA 4BSVB 1BZQK 2KZKA 2WAQA 3N9GH 4JPVH 2VDMH 5FYJL 3LZRA 4ENZA 3CXHJ 3P69A 2VC2B 1J5HA 4Z76A 1NCBL 2XG4B 1Q1PA 4MMXC 3CIAA 5HD8D 3PHAA 3WTXA 4JQVC 4X4XB 1XFPA 2VZ1A 1HEZA 4WWOA 1IM3B 4S1SL 1ZGLP 1XX9C 4Q7DA 4PJAA 5EOCJ 3RNKB 2H6OA 1MJJB 5JHMA 1UQSA 1JYVA 1A0QH 1AVAA 3CZJA 1L7IL 2QVIA 3T71A 2VRQA 5GHWH 4M7ZC 1EA9C 3GMRB 4AGOA 4NQVA 1USQA 4YK4B 1CB4A 4JG9A 1YEKH 3K3QA 2BWIA 4L3AA 4X8JA 2X1WL 3MJ7A 3BPOC 3D52A 3KDMB 4WNSA 4I85A 2CMRL 2X4NA 5BVJA 5T33L 1UYWL 1ZRUA 3BVTA 2RAMA 4JN2A 4KOBA 4ZMZA 4IIQC 5IB1B 2HT4C 4OD3L 3KH4A 1IAOB 2OBGA 5DVOA 5DZPA 1U2CA 3W0WB 2VDOB 2HVKB 2JKSA 3I74A 2KQMA 1QSFE 4Y4FA 4GG6A 3GYRA 1WWCA 2NX5D 3V0VA 1V3KA 5HYFA 3S3JA 5HYQA 3IBEA 4IDJL 1A4CA 5JA8B 3UADA 3BUBA 1KCRH 5ICYB 3KCPB 1BXAA 5DVNA 3QUZB 1ID2A 2APBA 2C4FT 2GJ6D 4MASA 3TH3T 4MQ7A 5DQDH 3IFOA 4Z3FA 3C75A 2I32A 3N42B 5HYSB 4PJFE 3CG8A 2QPUA 2H6PB 3GI9L 1OAUL 1WFUA 2E7HA 1MAKA 5J6GB 1T6VN 3UJJL 1E30A 1UUSA 3FQTA 3I2CH 4Y2NA 1Q0YH 2XKUA 3WN5A 3OKOB 4BSVA 5JQIB 5KBLA 4AT6B 4N9OB 2DY2A 4UYQA 4KPHH 4PS3A 5LN8A 1UD4A 1P6FA 3MRKB 1U6AL 4TQ8A 2K6ZA 2JKXA 1GZQA 3UAEA 2VLKB 1YEDA 2OL3H 3E6FA 2IAMD 1U8QA 3IDXL 4N28A 4EPSA 1GH7A 1RZQA 1QTPA 2AZAA 3UZEC 2LTQB 4UT9A 3D48R 5DK2B 1ADQL 3FTVA 1WBYB 4QY8A 1TZHA 1QEWA 3TJPA 1HDMA 3LQZA 4ZQKB 4CSSA 3QO0B 2ORBL 4UZUA 1SN0A 3CDZB 3QR0A 4AGLA 2VIRA 2IFFL 2ZXWB 3CFKB 4XRCB 3W9DB 1RZ7H 1G7LB 2F7OA 3EJTA 3MLWH 1BLNB 4NO2A 3BAIA 2Y2TA 5H4YA 1IC1A 3NABH 4EVNB 1F4WL 3BSZA 2UYLA 4PLNC 1RJLA 2VR7A 1ETZB 4OLYL 3REVA 2DKUA 2BNRA 2R0LH 2EYTA 2O1AA 1NCWH 2A9CA 4GXVH 4OZIA 4LO9A 4XHJD 4JAMA 4OLXL 3ES6B 4JO5A 1NSNH 4F8PA 3U0PA 2DI9A 4F2MB 1F1GA 3D4ZA 3GJFB 2B1HL 5JZ7C 1I9IL 35C8L 4BV1A 1ZVSA 1UVQA 2OW6A 2OTUB 3MJ9H 3P3UA 2VZTA 1EJOL 1AS8A 2VMFA 2YRPA 5IK3A 1RL1A 1S9KC 5DFTA 5IHZA 4G80A 4XOAA 2J1KA 4JZNB 4EN2A 1AQKL 1QZ1A 4IRSB 1XR9B 3DV4B 5IHBA 2Z4QA 1V3MA 2H32A 2RD0A 2ZCLL 1Q9WA 3EJZD 2XXMB 5EO1A 1A3ZA 5FYJE 1TIUA 3REWB 1J9RA 3TONA 2DDQL 4BCXA 2HG5B 4BKTC 2SEBB 3HZYA 5C08D 3RUGF 1ZLUK 1M7UA 1VCBC 1C7SA 4Q6IA 4WJKB 3GMNA 3QEUB 3V6ZB 4PJDE 4WI4A 4GI9A 5FUZH 4QXGH 5EO9B 1RP9A 4R4FL 1SOKA 2ISDA 1CI3M 1MCDA 2OX5A 2PW1B 4GO9A 3HG1A 3W11C 3FUNA 4JL2A 3AS3A 5J1SC 4PTTB 2NZ9C 4WW2C 3NMEA 2ATKB 4NENA 1UATA 2O5ZH 1MCSA 4RFNB 2ZXEB 3KWTA 5D6DC 1LO5A 3L95B 3ABKB 3K6SB 4XMWA 1ZHLB 2ZE0A 3G6JF 2MQCA 3N41B 5IQ7H 2P5WA 1WZMA 1C8QA 3KYNA 4TQIA 1T5WB 2GBUA 4R4BB 3O3EA 3AT9A 1CK0H 1EEYA 2FATL 4NWTH 4KZDH 3H7LA 5L88H 3DETD 4P9MH 2EEAA 2ZKXA 1I8IA 3L3DB 1QHOA 2N7BA 2C3HA 2IDUA 5EZJB 3T04D 2F7PA 1A6AB 1TETL 3KBPA 3QRGH 4GSXA 3VFGL 4ZI8A 3RVUC 3PGCB 1JXJA 5B3SB 1YZZA 5CZXD 5DQJA 2OYPA 3A24A 1HHHA 2DQMA 2QSVA 5DFWH 1PS3A 3VD5A 4ZMXA 4MJ4A 3NRPA 5JR1H 2M26A 1K4DB 1VENA 4KY2A 5FFOA 4G42A 4ODWB 2ZX8A 3ARGA 4LVEA 4YSDA 1M7IB 1KV7A 3CSPA 4OB5L 3UMNA 4ZUVA 3HLAB 4PRHB 1XH3A 2EDYA 1IKNA 1MH5B 1NC4B 1T1ZB 2FVNA 2YAFA 4OCXH 1TVDA 3D0AA 3D8MA 4QPEA 4M8RA 5HDBF 2CHNA 3JV6A 4MJIE 1TZOA 2WTRA 2K70A 2VE6B 2CSPA 3KCWA 3FUMA 4BFNA 1T89A 5SWZB 3OKLA 4AEIL 3QIBA 1NC2D 3SE3C 5CR1A 2V17L 4G72B 1QSFB 2GTZA 2JQMA 3DDFA 3GIZH 3C60D 4XVJH 3L2LA 5D5MB 1BWMA 4PJ7F 4ISVB 4YDVB 3NJVA 4YSRA 1QR4A 3O9WD 2OULB 5CGBA 3RVWD 3QBTB 1JZ7A 4FHBD 1M7XA 4H8UA 1LE5B 1YMHA 3OMZA 3QVAA 4HZLB 4MAUL 3VW3L 3CSYA 3GM8A 5HPMA 2FHCA 5CILL 1MCRA 3ATEA 4HIIA 2AC0A 1KTCA 2UYLB 4G9FA 1HSBB 2TSBA 4TPRL 3WJJC 4O2FA 1P4IL 3X17A 1GYWA 1HXYB 4QHKJ 4FNLH 3IGLA 2NW3A 2WCGA 4A6YB 3HR5A 1MQKH 1ILUA 4NO0B 4DGVH 4E9VA 5I6NA 1ETA1 4YQXH 4MS8C 5J6HB 1JGEA 4RH4A 3C6SB 1CURA 2CBPA 3BZ5A 4WWKB 2CA3A 1ZLWH 1FLTX 4C54A 1SYVB 1T04B 3M1OA 5EBMA 1KCVH 2ZT9C 2PR4H 4IGBD 2WKLA 4Y5XB 3CN2A 5SV4A 1BD2E 2W9DL 4NC2B 1B90A 4LSDA 4N2NA 2VDRB 3T8XB 5CLXA 2GK0B 4DVRL 1UWGH 1F2XK 3ZX1A 3QWRA 4F33B 4AZ8A 1F3RB 1LP9E 3GEFA 4R9HA 4P99A 3ZSSA 2VLMD 1T1XB 1BF5A 1SY6A 2CE6A 3G5YB 5E2JA 3OAWA 1IC7L 1IQDA 4LCYB 1JGDA 4Z77A 1CGVA 3WFHA 2B7DT 1CDBA 3W56A 5B39G 1ZIBA 5GRXG 1ZT7B 4AXWA 3CXDL 4H0IA 1KIUA 3QJVB 3OL2A 4NQDE 4A7VA 2XTJE 2WVVA 3MGTA