4AQAA

Crystal structure of deafness associated mutant mouse cadherin-23 ec1- 2d124g and protocadherin-15 ec1-2 form i
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
206
structure length
206
Chain Sequence
MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGGVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CADHERIN-23
publication title Structure of a Force-Conveying Cadherin Bond Essential for Inner-Ear Mechanotransduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 45
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4aqaA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4aqaA02
2EE0A 2WCPA 3Q2VA 1O6SB 3LNFA 4AQEA 3LNGA 1EDHA 5JYMA 5JYLA 4AQAA 3LNDA 4XXWC 4APXB 2QVFB 2A4EA 1WUZA 3K6FA 4ZI8A 1Q1PA 1OP4A 3LNIA 2O72A 4AXWA 4ZMWA 4AK1A 3K5RA 2OMZB 2A4CA 1ZVNA 4ZMLA 2OMUB 5CO1A 1ZXKA 4XXWA 1FF5A 2YSTA 1NCIA 5DZVA 4ZMPA 4NUQA 1L3WA 4AQ8A 2WHVA 2X2UA 4OY9A 3Q2WA 3PPEA 4NUPA 3Q2LA 4ZMQA 1SUHA 4APXA 3K5SA 4NUMA 1NCJA 4NQQA 3K6DA 4ZMNA 4ZMOA 1NCGA 4AQEB 4ZMXA 4QD2E 4ZT1A 2V37A 2OMVB 4ZMVA 5CZRA 3QRBA 3FF7A 2OMXB 4ZMYA 3UBFA 2QVIA 3LNEA 3Q2NA 3LNHA 2WBXA 2YQGA 4ZTEA 1NCHA 3K6IA 3UBGA 3MVSA 4AXWB 2OMTB 3UBHA 4ZMTA 5KJ4A 2OMWB 4ZMZA 2OMYB 2WD0A 4AQ8C 1WYJA 4AQAB 3FF8A
chains in the Genus database with same CATH superfamily
2VJ8A 1ACZA 4UNVA 1P7BA 1JWUA 4PJBF 3LAFA 5DHVA 2EE0A 3KLSA 4F24A 2CHZA 4HEMA 5JLZB 2FZ3B 3Q6GL 3WFDH 5D4HA 1JNNL 2QV4A 2XA3A 3TIEB 1I8MB 4I0CC 3KNBA 1DUYA 1D2PA 3ZDZE 5DRWB 2UZYB 4Q74A 4MJID 3C6SB 1QRNE 3TVMB 2BK8A 4JN1L 2IALB 1GGCL 2IDSA 3ATDA 3IRPX 1T20B 5E0QA 1S7RB 5MENB 3ARGB 4EMZA 4K23H 4XAKD 1GMEA 4K94H 5I24A 4AEHL 5DS1A 3C8KA 3I6LD 3CZSA 1YEDA 4DEUA 1BQLL 3VQLA 1ACYH 4LLUB 1NDTA 4NKMA 1KIRB 2YD2A 2ZCLH 3DIDA 1S4IA 3V95A 1DQQA 3WE6B 1MCRA 2B3IA 4PVMA 1GC1L 4JZOA 1RULL 4XXWA 3ZKMD 4M6MH 4TTDC 2FEEL 3BPOC 5F93C 3T0BA 4X4YA 3KCPA 1OGTA 4DP9X 4FA7B 3U83A 1FG9C 3SZ6A 3BWUC 1LO5A 1X4YA 1MY7A 1H5BB 4BK5A 2SODB 3MV01 4IGBC 5E6IC 1QBBA 3F6LA 3RZCC 2XKNA 2Z35A 2BVPB 1G9NH 2KDYA 4ZTPL 5FCSH 3QNXA 3ULVC 2VDNH 4OFPA 4OI9A 4P5RA 1CBJA 5J6GA 3GHPA 1ZT4A 1BOGB 5A7EA 4XWGL 5A6IA 3ZPDA 3FUNA 3P30H 2JVUA 1MUJA 2ICWB 3SGKA 4ORGA 3DWTA 4KXAA 4FFWD 1HHKB 3LX9A 1JRHL 3GEWB 4EVNA 3KPRD 3LQAH 1MFBH 3CXHJ 3DX8A 1ESOA 4KK5D 4DPBX 2CK2A 5T3XH 3PJNA 5SWZD 1MLBB 4F2MA 3HI1A 1QG3A 4UQAA 2D4FA 3STLB 3OMAB 4MMYA 4QRRD 3FCTB 1AJ7L 5EF0A 1ZHBA 3B3IB 4CMMB 3QWOA 4GUQA 3B2VH 3IN2A 4ZMYA 2Z7UA 3SB3A 3Q2NA 1MAJA 1MREL 1JN6A 4L1DA 2Y7OA 5DCCA 1U8CA 1HL9A 5DGRA 1IBFA 2CDEB 2HTKD 1UXWA 3IFNL 1XZWA 5DFAA 2X05A 3SY0B 3TOPA 2PWDA 4X5WB 2RTTA 4NN5C 3RJQB 2VZ1A 1OB1A 2A6IA 4NEHB 3T6XA 4XP4H 2QSVA 1OAKL 2XICA 1IAIM 3BDBA 4LVNB 1GOGA 3B5GA 3HHMA 5LGHL 5DLMH 3II3A 1TZIA 2F19H 2HRGA 3DUUB 3SDAD 4P99A 1DYZA 3BAYA 1RJCA 4HUVB 3N1PC 1FJ1B 4ORZC 3IJEB 3TEZA 5DRNA 5EZLA 3HPLB 4I3SH 1IEAB 4G6JH 5BXFA 3EOBB 1K8IB 3REVB 2LR4A 3J07A 5EOTB 3GXMA 3QQXA 4GFTB 2HTLD 1MLCB 4XOBA 3FQNA 1RZIA 5TDPB 4ZDHA 3MA7B 4YVNA 4F8QA 4KV5E 4BD4A 1A2YB 4TPRH 2H7WA 3DGGB 4XHJD 3PS6A 4YHML 3CHQA 3FU0A 2VLJE 1QBMH 3GMRB 3VXSA 3KXFA 2JJWA 5I5IA 2Z8RA 2DIAA 2YQ3A 3ZOAA 3H42H 1H3XA 1A14H 5FHBL 1KCSL 4EOWL 3WY3A 4HH8A 3SBQA 4YHNA 3CFBB 3QIBA 2NY1C 5HHNB 4JFFB 4QTHA 1WIPA 2R4RH 2VKWA 4JPWH 3GJFH 3V0AC 4AJ0A 1GH7A 1TCRB 1B6UA 3NIGB 3CZGA 2JCWA 2WP3T 1IEBA 4TVPL 5ENWA 1MFVA 4U1SB 3EYOB 1LE9B 1R5IA 2OP4L 4U4IA 5HHVL 1GYVA 4KROB 5D93B 5CEXA 1NWPA 4LMQE 2Z7YA 3GF8A 3GI9H 1NFIB 4P9ML 2ZYSA 3LZLA 4KX7A 1J12A 4PRAB 3MLZH 5DJ8A 1QLEB 1CGUA 1X5MA 2VXQH 1UACL 1GKEA 1YEIL 1F5WA 1JWMA 3TM6A 1BYNA 2UXGA 2DLFH 3GXFA 4ANVA 1U8OB 2ICES 4YBQC 4JR9L 3QDMB 4YPGB 1BECA 1LTXA 2HJLB 4LB8A 2EUZA 3JV6B 3HAEG 3NCJH 3G5YB 1WE5A 1HILA 4G1MB 5D72L 5IQMA 3OZ9H 5FC9A 4XMWA 1CICB 1KBWA 1CTMA 4HF5H 4G9FE 1B9ZA 1E4WH 2IWFA 4L37A 2YAFA 4NKOA 5LHDA 1YN7B 2R8SH 4ZMNA 1E30A 2CJUL 3S5LG 1XIWD 5ALCH 2R9HC 3GMMB 3OB0K 4FNRA 4WW2A 1T3FA 5BW7A 2V37A 2W60B 3I2CL 3IDNA 2ILLA 3NJLA 4FEIA 2IJ0C 4JQIL 3VWKB 3H4HA 4TLKA 4ZYKA 3GXTA 4M8VA 3P4OB 4Z7QE 4WY7L 1R6VA 2NX5B 4TOYL 5K39B 5BQ7A 5KBNC 2LFGA 1GC1C 3MR9B 4GY4A 4F3FA 3R0MA 2F54D 4KZDH 1BZ7B 3A4DA 3IMTA 3OSKA 1QTPA 2AXGA 1F97A 4IBTA 3CIQA 3M1BB 1R3HB 1YEKH 4AUJA 2HLAA 1T83A 2HUEA 3UGUA 4UINL 1AMYA 2BSCA 2MSPA 2VSDA 3B2XA 4EI6A 2QLVB 2DYSB 3X2QB 3QIWD 2NNRA 3K6NA 4FEMA 3JTSB 3VDAA 1JYNA 5DJAB 4DTGL 2GIMA 1FVCB 4YSRA 3TU6A 3MNMA 5A2IH 4X6CE 2AEIT 43CAB 3LS5H 3MACL 1IX2A 3OX8B 4X4MA 1MRCH 3SE9L 5AOZA 3UADA 5T1LA 3HZVB 4J3TA 5I8EB 1AKJD 2FT7A 3F5WA 4TSCL 3H9HB 1D5MA 1OGAD 3JYBA 3OWRA 2XUWA 4Q6IA 4X9YA 4EJ1C 3FT1A 3QUZD 3TEWA 3BUDA 5IR1B 3RFZC 1CJYA 4XXCA 3BKMH 4B0MB 5EULV 2H2PD 1J9QA 3JV5A 3O6LH 2Q76B 4KZ0A 2VDQB 3KD4A 1OP4A 4PFEA 5D6CA 1S2EA 4PJAA 5C07E 1ZHNB 5T5FH 5A40E 3NPSB 3L2MA 3LB6C 4P59H 4PRPE 3STBA 3CWGA 4PM1A 4TUUA 2CXGA 2L7QA 4OT1L 4RBPH 4ES8A 4R8WL 1AS8A 5GGUB 3B9KA 1LK3H 5J1SC 2ZAGA 4AITA 4XC1H 4WWPA 4NRZA 1W6LA 4KXZI 3QUYD 4GS7C 5IW3A 3PGFL 4G7QB 2HVBA 4LSTL 1JZ5A 3EG9A 2OBGA 3BPOB 1JGVH 4NERA 4P07A 4QDGA 25C8L 2TSBA 4GAJL 3WJJC 2E74C 3WN5A 2YRZA 3QP3A 4IGBB 3B8SA 5AZ2H 5E6IB 1EZVY 4Z18A 5AOIA 3RZCB 3C08H 3TV3L 1XF4B 5HI5C 4LRNL 3VSQA 2OR8A 4H1LH 4GINA 3QB7C 2WN2A 1YSOA 2X9YA 4PGCA 1XGUA 1UWGH 1KN2L 3IJHB 4MJ5B 5A2CA 4X4XA 1T1YB 1EO5A 2V17L 1P4BL 3S8GB 4AQEB 3V4VA 2BO0A 1FO0L 4DPRA 1AQDA 1R47A 3QO1B 5D1XE 1ML0A 5GZOD 2FGWL 5FKPB 5BVPL 4K8RL 5D5MB 4ZX6A 5H8DA 4PN6A 2MIZA 1WO2A 4NT6A 3M8OH 2FLMA 3MRMB 2NY2D 4UMSA 3KHQA 3D85D 4WI3A 2EEAA 3W2DH 5JTWA 4QXUL 4LKCA 4LLDA 3R8QA 1ZPLA 5EPMA 4ZD3L 5BRZD 5KVFE 1DBBH 1KENH 2AHIA 4LGRB 5G4NA 4LVEA 3IKCA 2QVTA 1L4IA 4YSPA 1E5ZA 4E9QA 1KGIA 2EE9A 3UYOD 1G1KA 4X6FA 3HB3D 4XTRD 2R0LL 3QRFM 4N26A 5TPWH 5JIIA 4AWJC 3DX6B 3GSVA 3ASNB 2OL3L 5DEGB 5CBAA 4Z8FH 4HJJL 1JCVA 3B8YA 3WKQA 3T65B 2XN9A 1ONQB 3BLBA 5CEYA 3IGLA 1IO4C 1HSAA 3OZLA 4K7PH 3WEXA 4TNFA 1X7QA 4Q9RL 3VYPA 4QHNB 4KTGA 4CVZB 1X5ZA 2AK4B 3NFNB 1JNLL 3IGUA 2IG2H 1J9CT 2GJPA 3BP4B 4RMRA 4Y4HA 4YXHH 4FYSA 4JKWA 1E9QA 3VI4F 1J5DA 3GRWH 1LYQA 5DD1H 5AW8B 2YPLB 3RVVC 4O5LH 4RMBA 5JHAA 2Q86B 4GAYA 4O2FB 4ZG1A 5IQNA 3K80A 3O3UN 5JMOC 1Q0EA 2FAUA 3CHRA 1GMIA 2YA2A 4P23D 5F1IA 3H9SB 3N50A 3PL6C 2OYPA 3U7AA 3QDME 4H26A 4EI5D 2NY1B 1EFXB 4UT6A 4PG2C 4QUOA 1RURL 5I74C 1CF1A 3EJUA 4A7GA 3DSFH 1YVLA 3UC0L 4AYMC 1ACXA 1E4HA 2G2RA 5IW1A 4KAQH 1AGEB 4RWHA 4ONHA 4NJAH 5I1EL 2F58H 2DLHA 1ZWIB 2WBKA 4HCFA 5C08E 2F53B 3MRKA 5IJDC 2BIQA 2P44B 5GSRA 3SJVA 3TX4A 4G6AC 1OTSD 4UZUA 3L3JA 3FB8B 2J55A 2YD6A 2YGVA 4B9FA 1QLFB 4PJ9A 5EZJA 1ASQA 4ODVH 1H0DB 2WBJD 3BUBA 3CXHK 1VHPA 1LO3L 5JHLH 3ESPA 1FL3A 4G80A 3FYIB 3WIAA 1CDJA 5IF0A 1MCHA 4RZCB 3BH9B 4YZFE 1JP5A 2IAND 5HY9A 3O0RH 3BKJL 4WFHE 1QRNA 3H2QA 5HYSA 1J11A 2WWNA 1GGYA 2E7MA 3BFQG 5E4IA 2P43B 5FW8A 2FBJL 4Q9CA 1BQHB 1P6AB 3QI9D 4MWFA 5ADPL 1ROWA 1Q38A 1ULVA 2AAVA 2VCOA 2OJ1A 1AAJA 3MRHA 2ED9A 5E94B 3HAEA 4JFDB 5EU4B 1Q72L 4GRWB 2BNQB 1FBIH 4NBXB 3IS1X 4F33A 5ICXA 4WJG3 1UM6H 4WKXA 4NZTH 3UYRH 5KYXA 4W9LC 1CLZH 3MBED 4IRJA 2X4UA 4ENZA 4G7VL 1H19A 4KKCC 3ZE0E 3ZR5A 3S5LA 2D31B 4KK9D 5F0JB 4DQOH 4EZKA 2X1XR 2QKIA 4XH2B 3DTXA 4PJ8B 3OHXC 2WO3B 1NDMB 1G9ML 4PWEA 1Z6JT 3KL0A 4L8CB 1IRAY 1B4RA 4Y16C 1LL1A 4BZ1H 4F92B 4UTBA 1AO7D 3U2SA 4XNYL 4FFYH 1KXHA 35C8H 3VU1A 3PWJB 4L5FE 2MEJB 1AQKL 2F2HA 3R8BB 4W4OA 4B50A 3VD4A 4HXBL 4JLRA 4KHTH 4K8RC 4PW9A 4HS6A 4P48A 3RFZB 5SWQB 3RJDA 2AI0L 2VM9A 4XOCA 5E2TL 4DF9A 3BLKA 2ZG2A 3RVXC 2F1BA 2MH4A 1MVUB 4YN3A 4JO4L 3DIFA 3TIDB 5SX4I 3QK0A 3T3ME 4Y8AA 1JNHA 2QADC 2DWDA 1T21B 4OQTH 3BKCH 3GZQA 4PG9B 4UM9B 3MROA 5FYJH 3IMSA 4GQPH 4JVUA 2D8KA 5FO8B 1NWOA 5LN8A 2ROYA 2IPKA 5IEKA 1SXBA 2VJXA 3R06A 5SWSB 3CLEH 5BRQA 4ZFQA 1A3RH 4GS7B 2Y23A 4D3CL 4FNLL 3L3HB 2RFXB 1N7ML 4BH7A 5I1IH 3SE6A 4BV1A 5DEZA 4JFYA 5I8OL 4NRYB 4QHUB 5EB9A 4EDXB 3K4AA 4GRMB 4MNHB 2GIYA 5LWYH 3GDCA 1IARB 1OWWA 5D5ME 3UAJD 5C3TA 2Z91A 3EJRA 1L3NA 2CUAA 5E8PB 4C55A 4BSVB 5HBBA 5H4ZA 2BSRA 5DTFB 4M9PA 2NQ3A 2EDWA 4C83A 4P49A 3ULUL 1KELH 4FJ6A 3AS3A 4YLQT 3FQRB 2BNUB 2DDQL 4HX1B 4PRHB 4YDVA 5DLLA 5D7IA 3FFCA 2JJSC 2FO4B 1UD2A 3FOLB 2AQSA 4NWTH 1BIIA 3LN9A 2HT4D 4HJGB 5L88L 2VLJA 1IGYA 2A9NL 3NG5A 4JO1H 1Q0YL 2VLME 1P5UC 2XWJB 2ZE0A 4PRDA 2FYYB 5JHDB 2APTA 4WTWA 2R1WB 1CK0H 4MA1C 3PP3K 3VU2A 2FQGA 3QAQA 4ZMTA 3QJHB 5F1NA 4C8XA 1RK0A 3QRLA 3VXSD 3NA4A 2X6VA 2EIZB 3EBIA 5B1KA 4YOKA 1IIKA 3IVKA 3HZ3A 1YAZA 3WNPA 3F8UB 3BYYA 1R33A 1JGLL 2CHNA 1NQBA 2XZAH 3F7RA 4KJPC 4PCSA 4AH2A 5D7LE 1DVQA 1F3DH 1B2WL 3JT0A 4Y5VC 2QGEA 4BFEA 3QIBD 4L4VB 3WEOA 2E7DA 4OF6A 2KKQA 1U8IA 2V7NB 4LSPL 1BM7A 3PQYE 4IRZL 4Q0XL 4NO3A 1Y1UA 4Z7WF 4Y9EA 4CSTA 1DSWA 2ZUXA 4Y2LA 3ETTA 4LCWE 1NGWA 5GS1A 2VNCA 1TYEB 3H9SE 4CU6A 1T6VN 3F7VA 1HSBB 2IO5A 4ERSL 1INEH 3FRPB 4ECNA 4C47A 1F4AA 1ERNA 4J1UB 2Q6WA 4G9FA 2WIMA 5ACZA 1S7XB 4XC3H 1MFEL 1G1OA 1T04B 2XWTA 2JNZA 3CFMA 3FSOA 1EXUB 2CIKA 4OLXH 3BQUC 3DRTB 3HOGA 4NC2B 2QFPA 4W9DC 1G9HA 5IHUH 1QFPA 4XCCL 3LV3A 1C08B 3EJCA 4AC4A 5TTRA 2EDEA 1BF2A 2ZNWA 1KGUA 3PL6B 4N9GB 4LPTA 2H8PA 4GSUA 1Z9OA 3IMVA 4K9EL 4X5PA 4AW4A 2VZTA 4L48A 4N87A 1D6EB 1FPTL 4MS8C 1XGQB 1EWHA 3QZOA 4KNQA 5LG6A 4D2NA 5JLZA 2G5RA 1G9MC 2A74A 2XWRA 4MD0B 4FFVC 5AVUB 5I74B 5LQBH 1Z9LA 3CSFA 1ZVSB 4FDWA 3ZT6A 4A1RA 1FWXA 4JGUA 1IL1B 1KTKE 2DQEL 4M5ZH 3O11A 1NLDH 4NCC2 2C1OB 5DRWA 3H3PL 2UZYA 1ZJBA 2MCPL 2CGYA 4ILDA 2IALA 1B2YA 4KUCD 4ELDA 1QSVA 4HZ1A 3IPBA 4WKZB 3WDHA 1X9UA 2WSPA 1T20A 4YDIL 5L9DL 5M94B 2Y72A 4AYEC 3ISRA 3TBCA 5MENA 3ECVA 4Y5YA 1U3NA 2QTEA 1G7QB 5FWRA 5IG7B 4A6YH 3IDXL 2PCXA 5ID0B 2Z7ZA 4W68A 4LLUA 1KIRA 2VDOL 3L4XA 2Y36H 3GS4A 1PGRB 3WE6A 2CBTA 2VRAA 5TQ0L 3QRGH 2XBDA 4HBCH 1BQRA 4GXVL 2FJFB 5C07A 4FQHA 4QGTA 5FECA 5HDQH 4YPJA 2IXQB 4KZCA 4PRPA 1QBLL 4XPHH 1HKLH 1EK3A 2G0LA 1NFDB 1H3PL 2QBWA 4HKBA 3BGMB 1WICA 2X6AA 2EYTA 2VLLB 2ATKA 3UBXI 3N41F 3WFEL 1EQWA 1FH5H 4I9WD 4BE6A 5I16A 4ZUTA 3QEUB 3V6OC 3VD1A 2DQFB 1HHKA 4LPWA 3GMOB 4IBZA 1GR7A 2H32H 3ARSA 1B4LA 3OHXB 4P3DB 1MLBA 4NQCB 3ULUC 3B9KD 4WI7A 4AV4A 3STLA 1SM3L 1JUFB 3FCTA 3IS0X 3O6KH 3BJLA 1IBDA 4Y16B 5FV2A 2ARJQ 3NIFF 4JPIA 4CMMA 2J25A 2GBAA 3ZR6A 5JIHA 1FGVH 2KS0A 3LXUX 2EXYC 1CXHA 3S2CA 1CGTA 1FO0B 1U3HC 3QPXH 5IQ7H 4XVTL 4LKXB 4Z77B 3DTUB 2X12A 1C1EL 2A83A 4GSRA 1HWGB 3SY0A 2CDEA 5FK9B 3RNQB 1IAMA 5CIPA 2ZCKH 4HIHB 4X5WA 4Q52A 3HE6C 5CZKA 2F7OA 3N44B 1UJTA 4AQ1C 3DNKA 5D1XA 2BSEA 3RUGB 4HW6A 4WO4D 1OM3L 1PEWA 4TUOA 1L0XA 2MRYA 1OP5K 2EDRA 4JKPL 4D7PA 4DKTA 3ECUA 3SDXB 3RY4A 4GSDL 4BA8A 1FJ1A 3Q1SH 4A2EA 1IEAA 4WU7B 4L0YA 1JZEA 3EOBA 1K8IA 4ZX5A 3HZYB 2IDTA 3REVA 1RZ8B 1JAEA 5EOTA 5I6MA 4OY9A 2OL3B 1MLCA 5FA4A 1T5XB 3KS0J 1NCDH 5HGGS 4NCDA 1A6WL 3UJIH 2DQDH 2EC9T 2WVVA 3GMRA 3KYKL 2XG5B 4N5EC 2IPTL 4X9GA 3E6FB 1JGEA 3U30C 4WEMB 4R7NA 1CFMA 5ACMA 4U6XA 2QSTA 4U6HB 5LNGA 3NOIA 4MCZB 2WTRB 4LCIH 4M93B 1WITA 4XBEL 3WKPA 5AUMA 2P24A 5MP6L 3D0AA 4JFOA 2HPTA 4KVPA 2WZ5A 1MPAL 5T3ZH 2DMKA 1K9TA 5HHNA 4BDVA 1LK2B 3HFMH 3VYNA 3CDFA 1RHHA 2EKSB 5L4FA 2XN9D 1RXLA 2AKRB 3EYOA 1LE9A 2JKWA 2HJFB 2FE0A 5GS2H 1AOHA 1ZMYA 5DJCB 3K4DA 5IVNA 4Z0BL 4XCNA 4LCUA 1NFIA 4L4VE 4FLHA 2VDRH 1P5UB 3GEFA 3DUHA 5C0CB 1YNLH 5AYUH 2N3JA 1PD6A 3KPQB 3IDJA 4G9DB 4TNGA 3RVUC 2Q8AH 1SVZA 2V9UA 3EH5B 1RUAH 5K9OA 3ZHFA 3W56A 4MA1B 3RVWD 1U8OA 3QFGA 3PXHA 3QDMA 4HJUA 4MAYD 2HJLA 4NRXB 1CQYA 1RUKL 2PP7A 4FQXC 5IBLC 3RWEA 3TBSA 4P2CG 2DQIH 3CUPB 4MB1A 1OHQA 2FJHB 5ALBL 4HU2A 2NUTB 4CC1A 4JG9A 5F7LB 3S3CB 1E9PB 1N67A 4UTAH 2WQ8A 4XO5A 2OMWA 4Y5VB 5DYFA 5L2JA 5AVQB 3T0ED 3UAFA 2N01B 2JB6A 2E27H 3DX7B 3GMMA 4ZS6C 4YAQA 5C08A 3QDJE 5BQDA 4WJ5B 3RPIA 1RJYB 2APBA 2HT3C 3W37A 1NL0L 4Z7OB 1NEZB 1KNOB 2A4EA 4NIYE 3VWKA 3P4OA 4XPFH 5K39A 4J6IA 1RJZA 2V7HB 5KUMA 5LXVA 1F58H 1I9JH 3F7PC 4O2CA 1MAMH 2AJZA 3SJVD 3U7WL 2AJXL 1QNIA 3M1BA 1GGIH 5DK3A 4MAZA 3SYPA 4PS8A 3CHPA 2X7LB 4L2YA 1KIPA 2VDML 5KYUB 4JKMA 3BQUB 1T80A 4PJ9D 4JFWA 4UIKH 1OVZA 4HMEA 1KULA 3JTSA 4Q6KA 2GKIA 3TYGH 4U3HA 3UH8A 1RLWA 1P4LB 2F1EA 5DJAA 3JTTB 3HC3H 1RFDL 1U3ZA 4GMSH 4JDEA 1CTOA 3TO4C 4LLVB 3I50H 3DV6B 4J3OF 3DOHA 3HZVA 2PCPA 2P7TB 5EIIG 1TQCC 3QWQB 1BLIA 1FUNA 4GG8B 3QNYA 4KO6A 4ACPA 3LCYA 2J12B 3QJUB 2GVYA 1OT4A 1FL6B 2HAZA 4FAAB 5IR1A 2EIJB 4MB4A 3DJ9A 4J4PC 3VTMA 3VXOA 5IIEB 3IWUA 5IJCC 5JNYA 2Q76A 3H7BB 1VEMA 5GQBA 1SY6H 2KZKA 3S5ZA 4UOQA 2J56A 2CMRL 2FB4H 1PVHA 2MOQA 1ZHNA 2OMNA 1ZLUH 1A21A 1WBZA 4XE5B 1HCFX 1KXTB 4CVXA 4JCWA 2OYMA 1KACB 1S7QB 4RFOH 4U7KA 5EF2A 1UYWL 3GUTB 1QRKA 4JM2C 3Q9QA 4XO4A 2OAAA 3GSQA 2GJZB 3WTYA 4GNKB 4NFDA 1EFQA 3Q01A 2ADFH 2WXOA 3U7YL 3GBDA 3WIHA 4TUJA 5EO1B 3ABKB 3A0OA 5F9DC 2WIIA 5ID1A 4YBLB 3SDYL 1TETL 3V5DB 2OTWB 4IGBA 3C8DA 3PUUA 2DL2A 5IFHL 2VSMB 3LKOB 1FCGA 1K6QL 4FXGC 1XF4A 4PHXA 1HDMB 1BPLB 5DO8A 5FYKE 2CO7B 3WFBL 3HG0A 3MUHL 5IMKB 2X4PB 3CJJA 3IJHA 1JGDB 4DUVA 4H0HB 1T1YA 4MNGE 3SSGA 2W59A 1BFOA 1QZNA 3VG0H 4AQEA 4XP6H 1E4KA 5CJ5A 2AQPA 2ESVE 3QDAA 3I3DA 3WU1A 3FCUB 2G3MA 3RUGE 5FAAA 5FKPA 4X7SH 5D5MA 2XJKA 2BY0A 3FKUS 5F7EL 2EIDA 5DK0A 3SDXE 2LLNA 3MRMA 4HKXA 1U3HB 4IK6A 1GZHC 2EABA 1QSZA 4DWHA 3CXDL 3WTXA 1HZHH 4LNRB 2EQDA 1MNUL 4G8GD 5TDNB 5IFAL 5EHFA 3FRPG 3LRLA 4PREA 1MCOL 3TCXA 1IQWL 2WQXA 4H0LC 1E7VA 3OMZA 3HE6B 1GHFL 1KPUB 4H25B 3KZ8A 3Q8AA 1MELA 4AQ1B 4NFBA 2X4SB 4Y1AE 3EADA 2CDFB 4FQIH 2UZIH 2Y3AA 3JWNC 4P2OA 1TF4A 5D7SH 3JUZA 1EJ6A 5E2JA 2ARJB 1FIGH 3FFCD 1DVTA 1I7TB 1NMAH 1D2OA 1YPZE 2K8MA 4MXWH 4FZEH 1KY6A 5K9JH 2VLJD 3MRJA 3NIDE 2R83A 2IFFL 4NUPA 4UNUA 4QHNA 4WJKB 5ICYB 2JJVA 1BBDL 1HOEA 1OO2A 3NFNA 4MMXA 1FDLH 4ZFGL 1TMQA 4AL8L 1MFDH 3BP4A 2W5PA 5FF6A 1I1RA 4GQQA 2ZUSA 5D7LA 1UOLA 5IB3A 2YPLA 5B3JE 2CLVA 5DD0L 3U30B 15C8H 2Q86A 1FLRH 4JS7A 1N59A 2Q7YB 4BZ2A 3PQYA 4QYOB 3QDGD 4Z78A 2XDHA 3SE8H 4DAGL 5I71C 2Z4QB 1TO5A 1IM9A 4KQ3L 4LPYA 5IP4A 2AK1L 4LCWA 5FHAH 2XQYG 4PGDB 4AGPA 3H9SA 4JRXE 4LLMB 1QFUH 4RGOL 3VQMA 2FIRT 1WPCA 4YQXL 2WBXA 4YEFA 4RIRB 1QAWA 3LZRA 4R5VA 3H2PA 3VRIA 1T0NB 3BSZH 1CFNB 4HPOL 3C87A 4FMVA 1NCBH 2O6CA 3QPQD 1B0IA 2OZNA 1AGEA 5LBVA 5GRUL 2BERA 1UTDA 1ID5I 2EH8H 4WRLA 2Z92B 1ZWIA 1WBXB 2TRYA 3D09A 4ZS7H 2NNAA 3QUMA 1P4IL 2QDVA 4AK2A 3QHFH 4XNUL 1KWGA 4R90H 1TVBA 4Z7OE 3DMMD 1XCQA 4JB9L 4UAHA 4FQXB 2QPUA 3MX0A 3RIAK 5AAMA 1DFXA 4GAAA 1H0DA 4MRBA 4MSWB 1O6SB 2BS9A 4G8EB 2G3NA 2PYEE 2YLHA 3BH9A 3FTXA 2BLFA 1GJWA 4IEFB 2B1HH 1NGXB 3ILEA 2ZF8A 5JPNC 1AIZA 4LSVH 1PKQB 3ES6B 3QULB 1PKOA 5JR1L 2IAAC 2OR9H 3DX9B 2VDOB 3ZTNL 4HUXA 4PJCE 5E94A 4JFDA 3HC2A 4XE0A 5EU4A 1D5BB 3FONB 1V3LA 2MOGA 3FU7B 4FL4C 1OCCB 3AREC 3RFRA 3AXLB 3RYMA 5EOCJ 2IH9A 2XTJC 1G6RH 1HNGA 3ZL1A 3J27A 3RE0A 1CGSH 4Q4EA 2YC1B 4AYFB 5MEND 4L4TB 2D31A 4ZOAA 3R1GL 4RMWA 2BP0A 2UXTA 3TEYA 1K72A 4MKTA 4PJ8A 1EO7A 2FEDD 1C5DA 4UMGA 5EORH 1SYSA 3I9GL 3HMWL 4NAJA 3HMXL 2D3JA 3EAKA 3QG7L 2YMTA 4KNUA 3RHWK 5I76A 4UNTA 1JBJA 1IC4H 1NGYA 5CAYB 2VLRE 1MXGA 3ARFC 4JE0A 1GZPB 2FR4B 2WANA 4HHGA 4H44C 3TO4B 3S98A 2R29A 1CYWA 2VMCA 1TQCB 4DHLA 3DSNB 1P7HL 4GOSA 5D1QE 1X44A 4GEJA 2AJVH 2H9GB 2Q0ZX 1WZLA 4KUCF 3WTWA 3IFOB 1PF3A 4V1DB 5SWQA 4FMKA 1HXYB 1RMFL 1NCAH 2F61A 1XQ4A 2W0FB 1U42A 3AQYA 3GKWL 1S7WA 1M05B 3FUJA 3KWTA 2ZSVB 3CMOL 2ZOKB 4LOUD 3HG2A 2YO3A 2FX8H 4F57H 3PCYA 4XB3A 4HCIA 3M88A 3V6FB 4HJIA 5AW4B 1OARL 4UM9A 4F7CB 4EEEA 4Y4KC 2H0FA 4JM2B 3L9RA 1P2CA 3II2A 5TFSL 1A4BA 5EIIA 3WJLA 5JZ7C 3ZE1B 1NAML 3MKKA 1VCAA 1YQVL 1VGKB 2GCYA 3L3HA 1YY9C 4W9JC 2Z34A 3SGEI 4I0PA 3WG7B 2FYVA 3H0TB 2CO2A 3RILA 1KEGL 5B4MD 4NRYA 3CBKB 4UI2A 4QHUA 2GJ6B 4GRMA 4L8DB 4MNHA 3FN0H 3ZTJH 1XGTA 2R7EB 5D2LE 2TAAA 1KCBA 4FXGB 4D7BA 3TV8A 2D03H 4LHUB 4K3DL 5CJOH 5DZAA 4PJAF 2X4OB 3A5VA 4AL8C 2RQEA 4G8IB 5IVOA 2Y7QB 2BNUA 2XV3A 4HX1A 1U58B 4LLAA 4PW3A 4J2XA 2O6PA 3IMWA 5IB2B 4LBAA 1IGIL 1FGNH 4RSYA 2BS71 4PP1C 1DBJL 1W8NA 3MOQA 3LN4B 3HI6L 3MCKA 3QZPA 5E2UH 4TTGA 4N0FA 4OFIA 4CSSA 1ET7A 1GRWA 1IC5L 4R96A 2WQAA 4NX0A 4NJ9L 2IGFL 1BAFL 2XWJA 1U6AH 2FYYA 4WNQA 3HR6A 2AJUL 2NLJA 5I82A 3WSQH 3DV4B 3FQUB 4HIEB 4UQ2B 2DD8L 4PSRA 2EDLA 3GXNA 1NEZG 4NZJA 2OJEB 3RVTD 3QJHA 4U1MA 5C0AB 3L5XL 4F93B 1KCUL 1RZKL 2ZCHL 4DUXA 2HA1A 1GPOH 1SQ2N 1FF5A 3O2WH 4HUMB 2E9GA 1KGYE 2RD0A 4I18A 2UX6A 1R3KB 1A6VL 3H53A 1JV5A 3A22A 3NACH 4PJFB 1TZ8A 4Z0XB 1IC7L 2DYPB 1I8AA 1CF8L 4NP9A 3ZYJA 1ZXQA 2YA0A 4LAQL 1UA6L 2OZ4L 5FFOA 4L4VA 4JFFD 4E9VA 1UH4A 1A1MA 4IBUA 1ZANL 1DVYA 2R2HB 3KGTA 4A66A 1JZ8A 3U0TB 4K07A 4AENB 1EGJL 4KROD 3ROOB 1DVFA 1AR1B 3D3VE 4GMTH 4D0CB 1MJ8L 1CFQB 2QPFA 4ZUWB 3FRPA 2XRAH 1RZQA 4GW4B 1S7XA 1KTBA 3AQDA 3RX9A 3QDMD 3FZUC 4JQIA 1EXUA 1RUQL 2CHWA 3AC0A 3DOIA 5D7HA 5BVJA 3P9WB 1CLYL 1HE7A 1N6VA 3CZJA 3EBHA 3NH7H 4UUJA 1CICD 2DJ4A 2DWXA 4ANKA 5I71B 1UD4A 3KYMB 3GSNH 2XU9A 5CEZH 3LNEA 2Z9TA 2G4GA 3MRBB 1L6ZA 4L1TA 4YHPA 3N42B 3SYAA 2AZAA 1BFSA 3W5NA 2I5YH 1ILUA 1WIUA 2VDMB 4NQDE 5E7BA 4JBSA 1D6EA 1MZZA 1QSEB 3P73B 5I1CH 3GJEB 2Z7WA 1WLHA 4MCYB 2UWEB 1EZUA 2J72A 3VWKD 3B7YA 2NX5D 1IL1A 2APXA 3L1OL 2MQCA 1WYJA 4PY8I 5KSVA 2AF2A 2AEQL 4GKSA 5LVEA 4R3SB 1IGMH 3VW3H 2DQUL 4DIXA 2XQYA 3RX5A 1CQKA 2OW7A 1SFHA 3MYJB 1P7KA 1KCKA 1G7QA 4KI5C 3FPYA 1FNHA 3MLTA 3ULSB 1QD0A 4OD1L 3B1UA 1F4WH 1JPTH 1WGVA 1L9MA 4WHDA 5DHXB 1QPXA 2CHXA 5D96B 2GBVA 1TEFA 1Q0XL 5JHMA 1U8KB 5I1HH 5ES4B 1CBVH 3B9EA 2AW2A 2XQBL 4ZO7A 5EC1B 5H37H 4AE0A 1T1XB 2O72A 2XT1B 2BOBB 3T2NL 4HOMA 4XRCB 4RMSA 4YMPA 1R34A 2IXQA 5I0WA 4M62L 3ZKQD 1SOKA 3FUEA 3UPRA 1B4JH 3GS0A 3NJFA 4FL4B 5IHHA 2XQ0A 3AREB 3BGMA 3S7GA 4LU5H 2K6WA 2XTJB 4MFHA 1QNZH 1VJSA 4XNDA 3AY4C 3FOMA 3A4FA 1KYUA 4X4ZA 2PWFA 2N7AA 1F8TH 3GMOA 1O9WA 4XVUD 4Z7NE 2XOTA 2MNJB 3X3FH 3TEXA 1QEXA 4ONGL 1Z5LB 1E5AA 1W9XA 4P3DA 1UASA 2ARWA 1FZJB 1P69B 3S88H 3ARRA 2EIBA 1Y6NR 4Y16A 1MRFH 1EEZB 3ARFB 3MOBL 4TTDD 1IBGL 1EAPB 1J0IA 2X4TA 4PV9B 3LEXB 3VJ6B 1IFHL 3K72A 3NK3A 4IGBD 1YCSA 4U2YA 5E6ID 4YH6A 5FK9A 2YRLA 3IDUA 4M1GH 4MNGA 1MIEL 2XN0A 2X2JA 3ULVD 1YN6A 2H6PB 4P4KA 4YDKL 2ESVA 3ZQXA 2B5IB 1E4XL 3KJ6L 1AMXA 1F02I 3RUGA 1LO2L 4K2UL 1NSNH 3SDCB 2DQJH 2CKNA 2XLLA 1RZKC 2L0DA 1CXFA 3MRPB 5TE4H 3SDXA 5FFGA 3T2PA 1C16B 3TONA 3D39B 4TLSA 4WU7A 4JFEB 3V52L 5HHXL 3JBG7 4ODSH 4WK0B 1RZ8A 4DGVL 4U1LB 1FYTB 2IF7A 4AKPA 1JNJA 4F8LA 2C9RA 4PR5A 2R0WL 2G60L 1SBBA 4I1NB 1FG2B 1EHNA 4NM8L 3SKOB 1OAZL 1JF1A 4KXCA 4Y1AA 4P9HL 4TNVK 2QQQA 4XBMA 4IRSC 4DP5X 2X9WA 4QYAA 1HJCA 1ADQA 1OW0A 4G3YH 5F70A 3QWNA 1L6XA 4MCZA 1YPZA 5LBGA 3CQPA 2N7SA 4OM0L 4G6KL 4E41B 4LEOA 5IROC 2D7TH 3ESVF 4K5LA 4YHLH 4NDMA 5AYQA 1LK2A 1LO4H 5DMYA 1QI3A 1S9XB 3AU1B 1A7RH 4DGYH 1FN4B 4H5SA 2DEYX 4L3CB 4IKIA 2HMIC 2ZUUA 4Z9KB 5E99H 2L7UA 3HNVH 4YVUA 4PVLA 1F2QA 1XGYL 5DJCA 1GW0A 4TNWK 4TSAL 1N0XH 3RU8L 4ZMWA 1MWAH 2YKLL 1P5UA 2AK4D 3I74A 5JDJA 1J5OH 3PY9A 3DGDA 1QR4A 1BF5A 5IVXE 3QFJE 5AD0B 2VTFA 4DZ8B 4JRXA 4NRXA 2YPLD 2R4SL 4ELMF 1U2HA 1UT2A 3FT0A 4TV3A 2BX5A 4Y19B 2I9LB 3MLXL 5CJQL 5A6LA 5MEOB 2FX9L 3FCBA 2FJHA 2BP8B 3CVHA 2YAMA 2NUTA 4FQ1H 4H8WL 3R18A 1IM9D 3OAZH 1F4XH 2MHAB 3D08A 4OLWL 1LEKB 4HCRL 3H9SD 1ZLVH 1ZHLB 4B6ZA 2NY1D 5CNHA 1EFXD 5D7IF 1MJ7L 3FQYA 2ZX7A 1PAMA 1OK0A 1T22A 3DX7A 4JFUA 2H6OA 1XH1A 1MY5A 3GKZA 3VFGL 1V8HA 4OCWL 3F62A 1IT9L 4POZD 1NEZA 1KNOA 4OD2B 4BRJA 3TL5A 4MXVE 1YNKH 3ELAT 4U6VL 1VESA 2HN7B 5DJZB 1E40A 1MFUA 2F53D 4PRIE 1DLFL 4UILL 4LMQI 3SQBA 5GJTH 3UZVB 5JW4M 2PYEA 1RD6A 4DP8X 1T7VA 1NBVH 2XZCH 1Q9KA 1OSZB 2X1QA 1XF3B 1JRHH 3O6ML 1YEFH 2W92A 3MAWA 1SN5A 2FK9A 3PHQB 1AZVA 4X6BB 1NEUA 3U6XS 4NO0A 3EJJX 1XBRA 3U6XA 1E65A 1DQLH 1R3LB 2WV3A 1AJ7H 1R75A 1P4LA 4QCIA 3VE0B 2R27A 1GGBH 4PJCA 1VZHA 2RACA 4XZUB 2PP8A 4XCFH 2R9HD 4WTXA 4ODWB 1EHLL 1TZOA 2E6JA 4KVCH 1G7IB 3UPCA 2QR0A 1V3KA 4LEXL 4MA7L 3D18B 1RZGA 2P7TA 4WIQA 4GG8A 1NC2B 3MV7B 1WFJA 4YXLL 5DD5H 1SLUA 4YSTA 5B38G 2ADJA 1FNFA 4JFDD 1UOKA 1DBMH 3DXAB 5AKTA 2BNQD 2GC7C 3MBXH 5C0FB 5KTEH 4CAGA 5IIEA 3WO3B 1CDUA 3BWSA 4MYPA 3MCG1 2P8MA 2WCPA 5EUKB 4X7CC 2YQ2A 1O7SA 3DRQA 5CHNA 4I89A 3BOVA 3AT8A 1MEXL 4JY4A 2VLRA 1LP9F 5JUEL 3UABA 1M2VB 5DVLA 4P06A 3HJ0A 2Z64C 4Y2OB 1UADC 5IQOA 1EHKB 1S7QA 5FGRA 3V4LA 2R69L 4Z7QF 3GUTA 2UZXB 4PJ8D 4JDVB 4YDNA 1TTCA 4DP2X 1DEEB 4EIBA 4PCTA 2GT9B 4YZWA 1HZKA 3PGCA 3OKEB 5D1QA 1DQIA 1LEGB 1MCJA 2FIKB 2H1LM 2YSSB 1ZTXH 3IETB 4Y9GA 1DQVA 5EO1A 2NCMA 4XGZB 4YGAB 1PZUB 1AQMA 2ITCB 1IAOA 4F20A 2OTWA 4NHCL 3IEAA 1JPFB 1NAMB 1GA2A 1GS8A 1W80A 3LKOA 2YSTA 1KYOJ 3OZKA 3AG4B 1HDMA 2C9SA 4EOWH 3GIVA 4U1HB 2X6BA 2CO7A 4PS4L 2EDNA 2OMZA 2DBJA 3COOA 1U3YA 3AZUA 4UV7L 4P9HC 5IMKA 4CDGC 1N10A 2COVD 4J3OH 1FV1A 2VERA 3OWEA 1PD0A 4LFHG 2EVGA 2AMGA 3LB6D 1RZJH 2APVA 2A6DA 2X2UA 3C5SB 4JZJC 1EO8H 4PIRF 4UM9D 2X2IA 4JNXA 4PH8A 1YNTB 4KDTA 5SWSD 3W9DA 3GGWB 3TZVA 3JWNG 4N6QA 5TF1L 1U9KA 3HRZC 3RWFB 1DVZA 1LXMA 2C8NA 4RNRB 2HH0L 3CFJB 3VFTA 4F9LA 1KN4L 4ZMAT 5AB0A 2ICWI 3X1FA 1HHHB 5AZEH 3KPNB 5D7KE 1T2XA 2O6DA 2IIJA 3MRLA 4U1IB 2P5PA 5HI5D 5HPOA 4A6YB 1HHGA 3MRGA 4H25A 5DHVH 4E9TA 2OR7A 4F5CA 4OBSA 2C7UB 4UU9A 2CJUH 1DL7H 4PRHD 1J1XH 1NTDA 1KGWA 1CZ8H 4K7PX 4ONFH 2ARJA 5FDWB 2X0UA 4TL4A 2AVGA 1KY7A 4H8WC 3QORC 1ES0B 2XY2A 4E41E 5IEHB 3LQZA 4WY7H 1SDDB 4B3EA 2JTDA 4QHMA 2Y1YA 4EZMA 4NWUL 5E5UB 1CXLA 4RAUA 1KLUB 5LB1A 5JHDD 1MOEA 3MODH 3MNDA 4TVPD 3NZUA 3S34H 1BXAA 4OZ4B 3V9EA 3V4UH 2BP3A 1SJEB 4OCRH 1AQHA 1T4WA 4IRSB 4P46C 4HG4J 4BINA 3LVEA 1UOVA 1M3IA 2Q7YA 3ARXA 3KE0A 4OVVA 5DMJB 2I69A 3TNNB 2B77A 2WUCH 1ZS2A 2X6MA 4LLQA 1J5IA 3LNDA 3OKNB 4ABWA 1A0QL 1F3RB 5FKAA 3D3VA 1NGQH 1UGKA 4L3EB 4LLYB 2PW1B 4L4VD 3SE4C 4LLMA 2WXNA 1N8ZA 4GT7A 4TRPH 5B39B 1MFCH 4Y19E 2VH5L 2CM6A 3CN2A 4J8RA 1QFWI 3SE9H 4RIRA 5BZDB 3MJ9H 5INDB 2VXSL 2VC2H 4B27A 1E7UA 5BRPA 1T0NA 1Q94B 1ZK5A 4XVJH 5K9KB 4TQEH 4NS0A 1EBAA 3EGDA 4HULB 2Z92A 1RIHH 3C9NB 1UH3A 3CFQA 4XNAA 3FT2A 5DEJA 4AYSA 3GM8A 4NNYB 1I8KB 1OZUA 3B5TA 3RVVD 4FQXA 1D5IL 1DBAL 4DN4L 1JOIA 2F1AA 3K7UA 4WFGD 2YFOA 3L3KB 1U91A 3A23A 2EEDA 1I7RB 1QKZL 3MLRH 5CINH 3QXUA 3F7LA 3NIGF 1PZCA 3PL6D 4EN3C 3G04A 2P80D 4RMTA 4G6FB 3VSTA 4JG1H 3SCMC 3KDMB 3CZNA 3WE1A 1NH6A 5BMFH 4AGQA 5F6HI 3OC8A 4GAJH 5DMGC 4OIIH 3FH7A 1JL8A 5B7EA 4MA3A 5M95B 1F13A 3FO1B 3DX9A 1HAWA 1RIVL 4M3HA 1BBJB 1Y7VA 1HL4A 1D5BA 3EH1A 1CFVH 3FONA 4LRNH 4PB9L 5F9WC 4U2ZA 4ZO8A 1FHGA 1MHHB 3AXLA 3FQWA 4X7DC 4G6AD 4PI2A 4N4YB 3JVGC 4AYFA 4E9LA 2XX0A 3B56A 5A16A 2ALWA 3N1GC 4PV8B 5FW7A 1CURA 1BF8A 3BAXA 3VWJA 5F7YC 5I1LB 4K23L 1QSFE 3NK4A 4K94L 3ETBJ 4MXQC 1RZ7H 2W07B 3HKFA 5KJ4A 1MCQA 2NUPB 1ZLWH 1ACYL 1TQTA 2BOLA 2ZCLL 5FIEA 1GZPA 2FR4A 1MCCA 5DC2A 5F2FA 4AG4H 3TO4A 1X6LA 2VE6A 4M6ML 5GS3A 5K33A 5I0XA 3QARA 5ANHA 3WV0A 4HQQH 4O2EA 4AJYV 1DJYA 3PWLB 4K7FA 1HXMA 1HEJC 3IFOA 1Q9LA 2CUHA 3WD5H 1XO8A 1BDYA 2RHEA 3O4LB 1HXYA 2ZF9A 4J4PA 4YZFF 1M05A 2VDNL 3MJ7B 4XWOC 5E51A 5IK3A 3DYPA 3EBAA 4N0CC 4KKCD 3P30L 5IJBC 3V6FA 2QPEB 2AV7B 2EINB 2X0WA 1QQDB 4ZI8A 4JM2A 4NQCD 3LQAL 3OKOB 1MFBL 3HNTH 5T3XL 1GGUA 3MOAL 1HCYA 4Y16D 5JOPD 1VGKA 5B38A 3J7HA 5BZWA 5HJ3A 1KXQA 4FTVB 3H0TA 3D2UB 1XGZA 3MC0A 5KBDA 4FERA 1UT9A 3B2VL 3SE3C 3GZPA 2DEWX 1N26A 2VDKL 4PJBE 4L8DA 5CILH 1W91A 4K8RD 5L8KB 2FWLB 4GLRI 2X4OA 4JL2A 4TQPA 4ETQA 2J8UB 4CADB 3RVXD 2Y07H 4I2XB 3ZDXB 1G7MB 2DS4A 4G8IA 5KS9B 3CU7A 4XP4L 1U58A 3RB5A 4IMLB 2E7HA 3OGCA 5DLML 3DLQR 4XPTH 1KJVA 4JZJB 3UTSB 5IB2A 2DMBA 2F19L 3NJKA 2CBQA 5KAQG 3FPXA 1KTDA 3QUHA 3LN4A 2JKNA 4WSGA 3BVXA 4N85A 5C6PB 1QLRA 2A9AA 1II4E 1AXTH 2F08A 4Q9BA 4FJZA 5EZPA 5F6IC 4DGUA 4I3SL 3IE4A 4G6JL 4R97B 4ZMOA 5DK2B 2FJSA 3HRZB 5BCAA 3BWUF 3KWWB 3O3DB 4UQ2A 4NN7C 5ECGA 5IJVB 4KKLD 4X0KA 4PYHA 2Y7NA 2MQ0A 2OJEA 5KN5A 5C0AA 4NZRH 5H94B 1UWXH 4TPRL 1F1AA 1G4MA 3ULVF 1WISA 1QBML 2JCCB 5CZRA 4Z3GA 4EIZC 4EDWH 4CNIB 3GXIA 2X9XA 1FORH 3K3QA 3WENA 4ZOCA 1P1ZB 3CC5A 3LKNA 4JAMB 3T2QA 2P5WB 3BD4A 2LU3A 1A14L 1CXKA 3K0YA 2HPOA 2WW8A 1JZ7A 3CSPA 3LEVH 5J3HC 4OZFH 1T4KB 1I3RA 1HX0A 4C56E 2X28A 3Q3GB 4DGWC 3QORB 3QSKB 2CLZB 5LKNA 2M83A 5D5MF 3MI6A 2CUMA 3KLAB 3OHMB 1IMHC 1A6TB 4D0CA 2GAZA 5DVNA 1H3TA 2E9BA 4JQVC 3SKMA 5C0CD 5FCUH 3GI9L 1E8WA 5DI8B 5IV2B 3MLZL 1CG9B 3P4MA 2VXQL 1XZ0B 2ZOOA 4RQQB 1ZIAA 2DB8A 2VLKE 5FYKU 4P04A 3K8KA 3L5WB 2DLFL 2DWSA 4HS3B 4P46B 3HHRB 1A25A 1KGCE 1RKRA 2AEWA 2GI7A 3NJJA 4XBGB 4L8SC 4DOHB 3S37H 4AVJA 3NCJL 4HHAB 4OM1H 3SODB 4KJPD 1MFAH 3KYMA 3Q6FB 1I3GH 1CDBA 4O02A 1ORQB 4HF5L 4JG0L 1E4WL 2OSWA 5KYWB 3EO9H 3RL1B 2R8SL 4NKIH 4A38A 1AY1H 3EO1B 1G4RA 5ALCL 5HGBA 3PGDB 3QBTB 4GAFB 4K94C 4TNEA 2WLJA 2UWEA 4JW3A 3TBYB 2Z31A 4KRLB 1UQSB 4HV8B 3RWGB 1KYOK 2AI0H 2HKFH 5E2TH 4P2RB 5CZXC 1AGFA 1ZHKA 5FGCE 1ZTMA 1QHQA 3V4VH 4R3SA 4KZDL 4OLYH 3HBGA 3ZZSA 5HPMB 1BXXA 3UDWC 4BFNA 4GSXA 1BMWA 2DMCA 2NY6C 4N68A 3BQUD 1YEKL 1FZKA 5EA0H 2NQDA 1KSRA 1RQ5A 2ZX8A 1DZBA 4HKJB 4B3VA 2XZZA 3HR5B 2VABB 3O3AB 4QRUB 4Z5RB 1CFBA 1ID2A 2Q3ZA 2E6PA 4EN3B 1CS6A 2GJRA 3F04A 1U8KA 3SCMB 3BDYH 4W9GC 3DX0A 5EC1A 4KKRA 1MCEA 3D30A 1WD9A 4X8XA 4MS8D 5B7MA 3MGTB 2CHDA 2VSKB 1DQKA 2IWKA 1S7VA 1NANI 3LQAC 3LS5L 4FFVD 1ZOXA 1MRCL 5DR5H 1GL4B 1MHEA 3EDEA 4NZFA 1M7DB 3ZDYB 3ZDWA 1UOWA 4HKZB 4UOW0 5F9WB 2H41A 4ZMVA 1DSFL 4LE8A 1QA9B 3BKML 3SY6A 3R7RA 4PJ5E 4WI9A 2YD8A 1U8PB 3O6LL 2DIEA 3GBML 2B15A 1FVDA 4MX7B 3HS9A 1T0PB 1NPUA 5EU6E 3MN8A 4C4BA 5T5FL 3ZVVA 2BC4B 4P59L 4TVUA 2E5EA 3KM2A 1S6NA 3WLWC 1WRFA 2BCKB 3OXSA 3OAUH 3D69A 1W72A 3T1FA 5IMLB 1LK3L 3BUYB 2FEEI 4XC1L 3ARFA 2VN7A 2ZWSA 1OP9A 4EXKA 2DM7A 2VWEC 3MV9E 3FW6A 1EAPA 5DJ2A 1P0SE 3U9UB 4OVUA 2LLGA 4OJAA 5BUPA 1JGVL 5KANG 5F3BA 1FVEA 2XETA 4TF4A 4YLCA 2FNWA 4GRWF 4HG4K 2VMDA 4WI0B 5AZ2L 3ARYA 5DC0A 3RJOA 5AFAA 5I1DA 1SUJA 3C08L 5DMIH 5EBMB 1OCRB 1ZA6B 4UT6H 1HQ4B 5EBLB 1Z9NA 4WHYG 1KTCA 2YZ8A 1MVFA 1UEMA 3TNMB 1M71A 1UKSA 3SDCA 1JRHI 3LN5B 4LSPH 4PHZA 2NNXA 3PP4H 3MRPA 1UWGL 1YEJH 1PZ3A 1AD0A 2J8UE 1KIUA 4H8VA 1FZMB 2Y5TA 1MF2H 3ZDXE 5ABZA 2RCSH 4AMKH 3AACA 3MLVH 3NN8B 1FYTA 4DP4X 3BWZA 3EGSB 3F7YB 2HRLA 2EXYD 4KRPC 5HI4C 1FG2A 1U3HD 3G5XB 3M8OL 3E0GA 1A4JA 1BREA 1DBBL 7PAZA 1KENL 4HWZB 2ATPB 1JD7A 2E7CA 5C6WH 4J5VA 4WEBH 3HE6D 3FAXA 1CD1B 1G5GA 2OQJA 3FHEA 4E41A 1A9EA 2NYZA 3T0DA 2PPFA 4ODXB 2Y69B 1OAQH 3B6SA 4WCYH 5TPWL 3AU1A 4Z3IA 1I1YB 3TJHC 5KSBB 3HAEH 5IFJA 5KVDE 3A67H 4OCSH 4PJIB 4Z8FL 3ZT5A 3I6GA 1ZGLM 3L5IA 4GP5B 4JCMA 5CLZA 5GRVK 1V3JA 2CBPA 2NOYA 3M17B 4K7PL 5F6IB 2EUWA 1RPUA 1OALA 2JI2A 2X41A 3ARVA 4ZXBC 5AD0A 1YA5A 4NN7B 4P5MA 4DZ8A 4ZFFA 1QEWB 3AG1B 4NPYB 4F7PB 4A2HA 2OMXB 4YXHL 3OAYK 3KWUA 5AENA 1XB6A 3R4RA 4WU5A 4Y19A 2I9LA 3D0VB 3GRWL 3MMEB 2EDQA 3S0PA 5MEOA 3AWEA 4O5LL 4M7JH 4UTBH 2CRMA 5DHEA 5L4MA 4OV6F 4BUHA 3GBNH 5C8JB 1WP6A 1ANUA 4QLRA 5IUSA 1LEKA 3A4EA 1BYOA 3LYRA 3QFDA 1G0DA 2PW2B 1KBVA 2DQHH 6CGTA 3BT0A 4E5XB 3ZL4H 2ZWKA 4ZW5A 1AC6A 3RRQA 2WYIA 4LP5A 4XB7A 5IW6B 2BRRH 3ZJAA 2PXYC 1QUNA 3HE7C 2DWYA 3DSFL 4XNXL 4M61B 2HN7A 2APSA 3Q5YA 4M9OA 2EO7A 4KAQL 3RVUD 3BAKA 4NQXA 4A7SA 4NJAL 1X5LA 2F58L 2CR0A 4FQQB 2MPAH 4ZO9A 4FQXD 4PPTA 1QZ1A 5IBLD 2C9AA 1TVHB 5BO1H 4GUCA 3NJXA 4Z7AA 1YMHB 4Y9FA 1VGEH 3D52A 3BH8B 3D87B 2NYYC 4KJQD 4ODVL 4OZGB 3F6JA 3VNYA 4Y2NA 1R3LA 1A4KB 1DANT 3I02B 4K3EH 4X80L 3ZXAC 1ECZA 2QGDA 4RVBA 4KI1A 3LZFL 3MTRA 4FKEA 2IDQA 2OSLB 4XZUA 2HLFC 3RWDB 1NCCH 4ODWA 4ZS6D 1I8LC 4BBWA 4WDIB 1KZQA 3O0RL 4U49A 4GI6A 2P3YA 2HT3D 5I0DA 4RMQA 4NZUH 1NC2A 3EGXB 4N24A 1VACB 3HMXA 2WLIB 2FH8A 3BPCB 3QC6X 3P77B 3PDOB 3CK0H 1G5AA 2YGQA 5MEQA 4LCYA 2WNKA 2DIBA 1CLOH 1ZRUA 3QPKA 5EU3A 5EUKA 3CFTA 3QEHA 5H4YA 1UM6L 4NZTL 1F00I 3UYRL 5HDBE 1CLZL 5TK2A 3KEDA 2NY6B 1M2VA 5F1OB 3VI4E 1C8PA 4Y2OA 3NJNA 2RBLA 3H3KA 2V3DA 5E2VL 3WNKA 4JDVA 1E8ZA 4ATWA 2A77H 2HUHA 2VDNB 1CR9H 1DEEA 2GT9A 1JMXA 1VA9A 5E5MB 1LEGA 3O9WA 2FIKA 2X87A 3U1SH 4BZ1L 1H8LA 3IETA 4TLUA 3TO4D 3O45B 1TEGA 3LKQA 3UEQA 3C09C 4XGZA 2PO6A 2IPTH 1XB3A 4FFYL 5CFAA 35C8L 4WV1A 3U25A 1NAKH 5EEUA 4HPHA 2E8ZA 1JPFA 1NAMA 2VL5B 1XHHA 2FLRT 3D8MA 3ECBB 3X17A 5EDXA 3C6LC 4V1DD 1NCWH 3T4AA 4KHTL 8FABA 3RY5A 2K3HA 1F4HA 4LDCA 3ASOB 4CL7A 4HH9B 4J4PD 2GTZB 3RWCB 1S9WB 4LBEB 3CC1A 1JPST 3OTTA 1PQZA 2EDYA 3C5SA 4QMEA 2PCFB 2BMKB 2DRUA 4OQTL 4XPGH 3BKCL 4N0YL 1AIFB 4JM2D 4QHKI 1G87A 3TT3H 2J6EA 1YNTA 4E42A 3QG6B 2Z93B 4PJBA 43C9B 1CL7H 1V10A 5JW4Q 1S7SB 4MA8H 4HK3N 3CLEL 4OUOA 1A3RL 1VKXA 3ZRCC 5DJDB 3BD3A 1OCOB 2EDBA 3GSWA 5I1IL 5BJTB 2GJ6D 4Y9CA 1HHHA 3WNJA 3KPNA 4NZDA 5I26A 1NFDF 2EH7H 4ZAKC 2PPCA 1BJMA 1R3JB 1MCWW 3FHQA 3NYKA 5GS0H 5LWYL 1CXEA 4LHUD 4AUYA 4Z7UB 3O41A 2ZXEB 32C2B 1J18A 1EEYB 1JG9A 4TKWA 1KELL 3MPCA 2BXZA 1QFWM 1FFQA 4NBZB 3OKDB 5JOEA 2E76C 1N64H 5CLYA 2JI1A 1ES0A 2DQ6A 4UDUB 4NWTL 1E27A 3I85A 1CT8B 1J05B 4ZZKA 3M6DA 3S96B 1HTYA 5J56B 4JO1L 1KLUA 1CIUA 3GT6A 4M7KH 3UZEC 4CU8A 4AKQA 5KSAB 3BP6B 2AJXH 3C5ZA 3DO4A 4PJIE 3GJFB 3S3BB 4PRBA 3OM3B 4KRPB 3ZT7A 3IFPB 4JRYB 4OZ4A 1EGJA 5C0AD 4IRSA 1CK0L 4ONOA 3N44F 2EZ0D 4LFHD 4ODBD 1IM3B 3H2WA 3PNWB 2N59A 4C56A 1SUHA 3RUGF 1CE6B 3OKNA 2ENPA 3ZZ1A 3EDKA 2DYPD 2XZAL 2ENYA 3KH3A 3TC9A 5E03A 4YSOA 4Y88A 1NZRA 4RDQG 1K5NA 2CCLA 3SDXF 1CWVA 3VXNB 1CDGA 4Q89A 4C4KT 3T8XA 4XAKE 1J86A 1NUNB 1J87A 3TPUB 1GTNA 2I7SA 1OSYA 5DO2C 3OF6D 4POUB 2VLKA 1AR1D 1Q94A 4DETA 5K9KA 1DDHA 4JJHA 5D8JL 3C9NA 3V0IA 2CLRB 1INEL 4ZXBB 5B3NA 1J5CA 3MRQB 4LQ1A 2OMTB 2X3BA 3QVAA 4G6ML 3UFIA 1A8ZA 3QIUC 5C9KA 1UYWH 3NIDF 3L3KA 4OLXL 1S5IH 1I7RA 2X70B 1PCSA 1YLBB 2XFXB 4HK0A 2BSBA 4N5UA 3VO0A 3AADB 5IHUL 3WAKA 3U4EA 4A37A 3P3TA 3ATBA 1S8DA 5CIPH 4YK4B 3T09A 5CN3A 4KQ4L 1L9RA 1QSED 2Y7SA 3VGBA 3SHSA 3WLBB 3QQ9C 3GD1C 3KPPB 5SWZE 1XAUA 3GLDA 2PXYB 2A4ZA 3L81A 4ZQKA 3HE7B 2IBZX 3FT4A 4QRRE 5LQBL 2ZG1A 1NGPH 4YFLI 3KYOB 4GRLC 4M5ZL 4QT5B 1MHHA 1NLDL 1XDTT 1HHJA 4DO4A 1I85C 3DVNB 4U4BA 1SHWA 5KVFH 1MJUH 5IHZB 5ETUA 5IT2H 5AALA 4PUBH 4N2OA 5FUCE 2JQZA 1EPFA 2H26A 3EUUA 4HIQA 1FNGA 3DX1A 1FFOB 5JPMA 2UZPA 4A6YL 4FHKA 2W07A 3EJSA 4AEIH 4F8PA 1UZ8B 2NUPA 4B0MM 4Z95H 2C3HA 3OPUA 1JWSA 2Y36L 3RWJA 4UCFA 2EDDA 5I66B 1YYMH 1QMUA 4Z7OF 3E8UH 4A39A 3QRGL 5I28A 4HBCL 5DZJA 3OJDB 4PJ5A 1FNSH 1MNUH 1SNRA 4F7MA 1T5WA 1UEYA 4OFDA 4Z6AT 1OTUC 5EU6A 1OEZW 3OAZK 5HDQL 1PIGA 2X89A 1GHFH 1BXUA 4OLVH 4OBRA 1OLLA 4XPHL 3ARED 1HKLL 3K71B 3CZLA 3IK2A 2WQSA 2XTJD 3VGGA 2CBMA 3GI8H 4MJ2A 2EYSA 3MLSH 4ZUSB 4LIQH 1FH5L 1OAUL 2AV7A 3MV9A 4XI5C 5FB8A 2Z1KA 3CGTA 3LEYH 1QQDA 1BJ1H 1G94A 1U8LB 4LVOC 4BRVA 4PJCF 3OKOA 4DESA 4H1LB 4Q2ZA 3WDJA 1KGJA 1NDGB 4YDJA 5IMOB 1XF5A 3WMQA 5F21B 3ARFD 3U79A 4AL8H 3O6KL 4K3JH 4B5ZA 3GHBH 3GMNA 3MFFA 1FGVL 3C09B 1WWBX 5CSGA 5DD6B 5AVSB 5CSBA 5DD0H 1X5HA 5IQ7L 3QPXL 2E3VA 4YDLC 1JYVA 2AEOA 3C6LB 2AK1H 1RVFH 3QEGH 2ZCKL 1G7JB 1MCNA 4XMLH 2J8UA 4CADA 4XCEA 3UP1A 1CD0A 1XR9B 3FFDB 5E6RB 3ZTEA 3SDCD 4I3RL 1EVUA 2D7OA 3EYVB 1DLHB 3WNMA 3VXRB 3LZQA 4D9RD 1SDYA 5BO0D 4FLSA 2EKJA 3BISA 3D39D 2C3VB 4D94A 2LE9A 4JFED 2NR6C 3B5HA 3Q1SL 5D7KD 5B7FA 2YPKB 4A2MA 1U8HB 1VF5C 3FT3A 1BQUA 5C2BL 1YYLL 5JZ7D 1DCEA 3S3DB 4KITB 1R24B 1YY9D 1FYTD 1P4IH 2O5YH 4WWOA 4OFYD 3KWWA 3O3DA 4PLOB 4E5XG 1NCDL 4NNXB 5JYLA 4ANXA 2J2ZA 2M8XA 2XWEA 4V11A 2W88A 4ZTOH 1A4CA 3UJIL 2D0FA 2DQDL 1GSKA 2JCCA 2VXUH 3DI3B 4ZAKB 4LGPB 3LIZL 4FN0A 3KVDD 2F54E 4MB5A 3HLKA 3DBXB 4E41D 2FATH 1J1OH 3MBWA 4LCIL 2AFNA 3HC4H 1BD2B 3HZKB 4P5TA 3E8VA 4RX4D 3DTDA 2JE8A 3FTWA 5LCVL 5T3ZL 1X5GA 1T4KA 3FS9A 3ML8A 1SEQH 3HFML 3WFCH 1Q90A 4P57B 2W0KA 3KLAA 1E2WA 1HINH 1A6TA 1F2XK 1AHWC 1MH5A 5K93A 3OLIA 4L18A 4ZFOL 2BOCB 2VDRL 3GSRB 3WXVH 4AJWA 1CG9A 1YNLL 4GQ9H 1CGWA 4JFTA 4L5FH 2Q8AL 1BZEA 4RQQA 2A2QT 1JE6A 4AOFA 1RUAL 1J9TA 2A9BA 3ARBC 5DSCA 2JWYA 4Y19D 3WS6C 1OGAE 1J5HA 2DQIL 2FGZA 3WIHH 1I7ZB 3I9GH 4UF7C 1X5FA 3KCWA 4HIJB 5CP3A 5KYWA 1NA8A 3BKYL 3K4ZA 3SE4A 4C59B 2NSXA 4UTAL 2WLLB 4HFWA 3NZSA 5FO9B 5E9NA 3EO1A 5E2WH 2F7QA 2B9AA 2E27L 1L0QA 4JQXC 4PRNB 3DPDA 4L9DA 2UY7B 3OR6B 4P5KA 4XPFL 1O7DE 2O1AA 5FO7A 1TQUA 1NBYB 4YL4A 4BH8B 1TYJA 3D0LB 3GM0A 4X8GA 2B3RA 5AOLA 5HVWA 1F58L 4QRQA 5HYJB 5I0YA 1JTPA 1MAML 1AXSB 3QQ3A 4N2AA 1RP8A 3FZUD 1GGIL 1BXVA 3IAGC 5C0RL 1AACA 2LLLA 1F3JB 3QIUB 2DKMA 2Y4SA 3LPFA 3S3JA 2VAAB 4HKJA 1HEZB 3ECQA 2IAMC 2ZSWB 1VFUA 3ILPB 4UIKL 4XO8A 2GUOB 4NHUB 1YQVH 1HWHB 2DZEA 3CFCH 2IWGA 4EN3A 3GB7B 1JXJA 2WYTA 5DC9B 1HI6B 5GZNA 3SCMA 1JDCA 2FEJA 1FIEA 3BMWA 3HC3L 5AW0B 4PY8J 5KVEL 1OCZB 2P4AB 5C0IA 2NY5H 4P2QB 3FAWA 3MGTA 4GMSL 5F7UA 5I75B 5GGQH 3I50L 1HHIB 1AXIB 1NC2D 2DOCA 3MV7D 3KLQA 4DFHA 3G7TA 5A3ID 4YXKH 3S8FB 3TA3A 2VDLH 2WUBH 1M7DA 1KXVC 4F8TA 1A3LH 3DXAD 4HKZA 3RGVC 3MUJA 2F8OA 3I75A 5C9JB 1JGIA 2GG1A 3SBWC 1WTGT 2CIIA 4EE2A 4YNYA 1QA9A 4N8VG 2BFVH 2BWDA 1U8PA 4O51B 3CZUB 3OB8A 4EF3A 4NKDB 1YDPB 5I1KH 1SY6L 3T3PE 1Z3RA 2FB4L 4BCZA 1PZBA 4KI5D 2BC4A 2G3ZA 1B9KA 2ITDA 1IC5H 4UQEA 1ZT7B 4RFOL 1NKGA 1UUSA 3ILDA 5T5NG 8PAZA 4GKNB 3BUYA 3RBGA 2AJUH 2HVKB 1A7PL 5DZVA 4B7LA 3RDTA 3TLRA 2BS8A 2VKXA 4BA0A 2XZQH 1C8QA 2ADFL 2O30A 2GK2A 1B0GB 1I1CA 2B0SH 1UT1A 4GT0A 4S1QH 1XF2B 1KCUH 2ZCHH 1GKOA 4G43B 2AXFB 4N20A 4RA3A 1PZ5B 3GMPA 1UH2A 4KXDA 1OLZA 4UYQA 5EBMA 3RWIB 2XG4B 4OJEH 4KDWA 5J0BA 3K5SA 3TFBA 2DV6A 3BVNB 4WFFD 2V3FA 2EO9A 2I7OA 1KPVB 1E67A 5AL8A 1EERB 2WLMA 3WMSA 2XN1A 3L4WA 3LN5A 4PAZA 1JV2A 5DUPH 3VTAA 3ZE2E 2Y24A 2FNBA 4RGNC 4LVOB 3UO8B 3QUMH 3VG0L 3ENEA 4N2DA 4XP6L 5B8CA 1RH8A 2Y7LA 3KW7A 2Z1PA 4YHZH 3BHBA 3HG1B 4IKKA 3L16A 2GY7B 4X7SL 1KF9B 1UWYA 3LTVA 4BFGA 1PZSA 4U05A 2P5EB 2BW4A 4MQSB 3VFVB 2XXMB 1CLYH 1HZHL 3W9EA 4YDLB 2ATPA 5KVGE 5CCKH 3DYMA 2SEBB 1CD1A 1J0HA 3MRCA 2ZXDA 3APMA 1XD0A 4Y7OC 3TN0B 1ETZB 2XWCA 3TH4T 3M07A 2BHYA 1I1YA 5KSBA 4JM2F 2V2WB 2UZIL 4PJIA 5D7SL 3GSOB 3ZE1F 5IWLC 1OD9A 1MG2C 4MXWL 1T6WA 1PDKB 4FZEL 5C0JB 3DA0A 3M17A 3L3IB 1R46A 5K9JL 4M1CC 2H45A 1V7NH 2PP9A 5DRXA 3CHOA 3ASWA 4XCYB 4QIRA 3DHPA 4ALAH 1TTGA 4C54A 2DW5A 9CGTA 2A1WH 1QEWA 1S9YA 1WBYA 1FDLL 1F1DA 4NPYA 2A9MH 4F7PA 5HHPA 2OMXA 1MFDL 1RHFA 1UJ3B 4O58L 3H4FA 4IRSD 2CAKA 4PP2B 3HBZA 4KBPA 1MAKA 1L7IH 3V5HB 1HEHC 2A6KB 15C8L 4PJEB 4Q58C 2AERT 5C8JA 3MCLH 3SE8L 5IROD 4L3ED 2C3WA 2QEJA 3QJXA 2R29H 5FHAL 5EFIB 4ZFZA 4LPUA 5F7DB 4OJYA 2PW2A 1KG0A 1QFUL 2NW3A 4P4RB 2OTUB 2HMID 2XNAB 4E5XA 4Y89A 2VITB 3DUSB 1A6AA 2WWOA 3B34A 5IW6A 5EN2A 1N4XL 1TMCB 3BZFB 3ZY7A 1D3CA 1MCIA 2XWBB 1OTTC 1PMYA 1AHWB 3ATAA 1A4AA 1K4CA 3BSZL 5H35B 1NCBL 2DWEB 1LWRA 2D0GA 4WENB 4OFKA 1KIQB 2Z0BA 1AO7E 3CD4A 2EH8L 1QABA 1EBPA 3MLPA 4ZS7L 2CJ3A 2XXGA 3ARBB 3QHFL 4UQBA 2KBGA 2EDJA 4R90L 3V0WH 4HSCX 3A6BH 4Z76A 3UYPA 1AGCA 1TVHA 2VN4A 2WXRA 5EOQH 3TYFA 5AAWA 3Q8FA 3GINA 5E9DB 5HYJE 4UZGA 5EV7A 4ZBJA 3GZOA 5SWZA 3I02A 5F7WC 1J8KA 4G6FD 2V4LA 4AEEA 2OSLA 1FNLA 3L48A 2IDFA 3WTVA 2GQHA 3AB0B 3UTZB 4L0PB 1M7UA 3IDIA 4AM0Q 1UWXK 1WZMA 3W5MA 3EYQC 2ZXWB 1O9VA 4NAMA 5ANME 1NGZA 4LSVL 3EGXA 4H1LG 1HWWA 3QZWB 1B0WA 1VACA 2JXMB 2VDPH 1NIFA 2WLIA 3BPCA 3HNSH 3NFSH 3NSJA 2OR9L 5CKAA 3BWAA 4PWHA 1SJHA 1WD8A 4OF0A 3SZKC 3BZ4B 2YUZA 3FUDA 3E3QE 1JF5A 4XPAH 3DPBB 4K2UH 1TTAA 2CXKA 5DWUH 3KPTA 1M2OA 1NBZB 3LH2H 3CH1B 1G6RL 1CGSL 1I3VA 1WCBB 4LF3A 3ZX1A 2AEPH 3G9VA 4U7MA 1M57B 1XVSA 5KYNA 1RJLB 1U92B 3VXQB 2R15A 1V54B 4NQSB 4R7DB 5DZLA 3PJSA 1UCBH 3N42F 2XA8L 2IAMB 1UD5A 3V6ZB 2G30A 4I88A 5EORL 5GXBB 3JV4B 5D71H 1LQSR 4IHOB 1I4FB 2YEVB 2Y6TE 4AZUA 1IC4L 3MLYH 3EJPA 1WS7A 1MVYA 1OAZH 2UWEF 1OSEA 4HUNB 4NSKB 3WO4C 4P9HH 3CSYB 1F90H 2P42B 1PY9A 2H32B 5F89B 3ECBA 5JXAH 1T2JA 2HKHH 2D73A 3MUZ1 2YBRA 1JJUA 3RGVB 2GSIA 1DUZB 4N86A 3VDBA 4ABVA 3O4LD 5IMMB 1N6UA 2AJVL 3I9PA 4HH9A 4UZSA 5DJYB 2B7DT 2LAGB 3ESMA 4LHQB 3RWCA 4JHWH 3WIIL 1S9WA 1V27A 1NCAL 1WFUA 4PGBB 5FYJE 1A8JH 1G7LA 4KJYB 2YZ1A 3IF1B 3VXSE 3T1WA 1S78C 4ATTA 1XH3A 3ROLB 5E8OA 2FX8L 4F57L 1RV6X 3FQ2A 4O00A 5EBWB 3VXTB 5DJ0A 4JFHE 4QXWA 4TSAH 3RU8H 4UQ3A 4NN6C 5F9JA 43C9A 3U0WH 4XP5H 1H3WM 5D4JA 5T1KB 3UXFA 4UT7H 3VI3B 4JHZA 2D7PA 3MZTA 3D2UD 1YO4A 4FTVD 1IC1A 2DLTA 5DJDA 4U1NB 4N8VA 4KKPA 2VZ3A 2J20A 4HC1H 5BJTA 3X13A 1IGJB 2NY7H 3CZKA 1PPIA 1R3JA 5IREA 4NUMA 3FN0L 4WHTA 4K5NA 3FQXB 4Z7UA 2P1YA 4KXBA 4XNQA 4Q56A 3SKUD 1D6VH 2W9EH 1RIUH 3U6RA 4JY6B 3UGEA 4BIKA 4F91B 3K2KA 3IJ8A 3MRRB 5CJOL 5CF3A 1UA7A 5BS0B 5IJKC 3AUVA 1U95A 1KC5H 1I9IH 2VN3A 2VQTA 4ZSOE 2FTAA 2VOTA 2JIXB 4M5YH 2DBLH 1XIWA 2ZPKH 3VFGH 1BZDA 2K9UA 4OKVB 4WAFA 2XV2A 4OGXH 4RGNB 3FMGH 1KJ2H 1ITBB 1X7TA 2ICWJ 5EZOH 5L0QC 5E2UL 3UAEA 1TZHB 1U0QA 1WAAE 2AQRA 4X83A 1FA4A 4OUUA 3QUKB 4YIQB 5FS5A 5KSAA 4L9LA 1U6AL 1VFBB 1I75A 3EFOB 3WSQL 5FGBA 4KH2A 4G71B 3UTOA 1QI4A 3DX3A 1J8SA 2H47C 1U4FA 4AEFA 1IM3A 4BE5A 1Y18B 5ADOL 5DFTA 1GPOL 3QQ4B 3O2WL 2VDRB 4HYTB 2ZYHA 5JIKA 1I7UB 2P5WD 3QQDB 1IBZA 2Y5EA 2VXQA 3NACL 4TXVB 2DEXX 2GK0B 1A7NH 4F8NA 5AVRB 3TPUA 7TAAA 4MA7H 4GUPB 4NQUA 3E1F1 3QORD 3L4ZA 1OP5H 3VCLB 1CYGA 2I24N 2PPAA 1OSPH 1AKJA 2EDKA 2YWZA 1LE5A 1DANU 5JOFB 1OGAA 5DRZB 4GMTL 4GXUN 1AHMA 2EP6A 3NCYS 4IJTA 4XX5A 5D6DA 3FTUA 3MO1A 3FC8A 1MEXH 4LARH 3MRQA 3NFPB 5HHOB 4ZUVA 4PLJC 3WXWH 1M56B 5C86A 3QXDB 3B37A 3B2UC 1BAWA 4WW1A 4Y2DB 5AG8A 2X70A 2N0MA 2C1PA 5FYKH 1ZSDA 1CFTB 4HUWB 3VFNB 3GSNL 4I9WE 5CEZL 1ED3B 3OXRB 3QUYA 4L29A 1SOSA 2A73B 3FQ1A 1PSKH 3BW9B 1TJHH 4JVPA 3D2TA 2NT1A 3N06B 2I5YL 4B53A 1X5JA 4PTUB 3WLBA 4M7LT 4NHCH 5DQ9A 3KPPA 3PHSA 2JELH 4G5AA 2CWRA 2X40A 2YMXH 3HE7A 4NKQB 4RAVB 3V0HA 3IN0A 5T33H 2A38A 3QH3A 2DKUA 3KYOA 4P2RD 4DT2A 5HI3C 4KJWD 3VH8B 3AM8C 2F15A 1BQ5A 3QNZB 4BCYA 1FSKC 3DVNA 4Y5XC 3X1EA 2E75C 1KCRL 3GTTA 1CI5A 1IGML 2V5MA 3VW3L 5ICZB 1KFAH 1CGXA 2XYCA 3O3EB 4BCXA 3P40A 1PLGH 5KAQF 3ZSSA 3DKHA 1BG1A 3SDDC 5I0ZA 5F6HJ 3BRFA 2ZD0A 1IKFH 3A47A 3L7EB 1F4WL 1JPTL 3DARA 2VMEA 1CE1H 3ABMB 3ARDC 3IKKA 3QXAB 3V10A 4EN3D 1EHXA 4OV5B 2Y6SD 4WWKA 4HMCA 4FHBD 3SCMD 1WF5A 2I60H 1TTRA 2HH0H 1ADQH 3EOAA 1KOAA 4HWEL 3D6GA 4IS6B 3AGVA 1CBVL 4LO9A 5DMGD 3UBGA 3HBPA 2OYLA 4HGWA 2IGTA 4BFIA 5LGYA 2RALA 4IBYA 1YMMB 4N2BA 1TENA 4GIAA 1G9EA 1AFVH 1HIML 3TESA 3CFDB 4HETA 4JFSA 1B4JL 4OZHB 3DOSB 3WKYA 4MCMA 4TYUA 4QXTA 1DQDL 4LU5L 4Y4FB 4ZUSA 4MASA 1QNZL 3P0GB 1PJ9A 3OKKB 3EOYG 5JW3H 4TUKH 2OI9C 3INUH 5AW7B 1F8TL 1U8LA 3N91A 3QZMA 5DYOB 3C5JB 3X3FL 4AM0B 2J8HA 1AE6H 2JSFA 3MGOB 4H1LA 4PW4A 4U7SA 1I82A 4F9PA 3F64A 3S88L 3SPVB 2CKBH 2QVFB 5LBSA 3CVHH 2XN9E 4D0DA 4TMPA 5EC2A 2NYKA 3WO4B 4ZW6A 2IDUA 5I8CA 3LKPA 3EFFA 4J3VA 4M4PA 5I8KH 2OCFD 4TVSa 2X6CA 3ZZQA 3LRSB 4IOIA 3MRFB 3VI3E 3MV8B 5TDOA 2G75A 4Y7MA 1MQ8A 1PJWA 4LRIA 4M1GL 1G7JA 2HVJB 1X5XA 4U6YB 4XWOD 2LQRA 4WEUD 1EH9A 4IOFC 4KI5F 4CVWA 3N04A 4N2IA 4N0CD 2DH2A 1IFRA 4N2FA 5GRYA 3VXRA 1NSNL 5GISH 1IGTB 2KH2B 2WQVA 3G9AB 4I5BB 5TE4L 1HQRB 2R23B 1A6PA 1U8HA 1JFQL 4LLWB 3OLGA 4PJDB 4ODSL 5EUOB 2LGNA 3T0EE 1C5BH 2WOYA 4L1HA 1IJNA 1ZE3H 2EYRA 4RGNE 5DEFB 2X4NA 1HK6A 4LSRH 4D9LL 3RTQB 4R7VA 3WTSA 1DTUA 4W70A 4AMXA 1YRKA 2Y5QA 1ICTA 3VTTA 3TJEH 1JZ6A 3IJ7A 4PBVC 3FB7B 2R2EA 4G3YL 4FFWC 1ZAGA 3WUWG 1NCGA 1JFHA 3F83A 3SOBH 1ZV9A 1R19A 1TKWB 3UZQB 5ERWB 4CBPA 2D7TL 3H6AA 3OR7B 4YHLL 1PFOA 1KB5A 4KZEH 1JK9A 1ITCA 1LO4L 5GGSB 5CSZB 3F65A 3PUCA 1YNTF 1A7RL 4DGYL 3WKMH 3RB7A 1GIGH 1ZS8B 3H1ZA 3OLDA 4GXFA 4YC2C 1RIVH 1JHTA 4OCYL 2F74A 3D07A 4B9GA 5CD5D 3QI9A 2OW6A 3HNVL 5E99L 3OJ2C 7FABH 5L0QB 2H3XC 3O6FC 4PB9H 1VFAB 4DO6A 2B20A 1N0XL 1HH6B 5BUAA 3UZEA 2AQ3A 1MWAL 2MCMA 1J5OL 1H3GA 1WT5A 3SO3C 3QZWG 3EJYC 2FWSA 4HSAC 2OTPA 4R5XA 3MBEA 4FADA 5ESVB 2C9QA 2PLTA 5DHYB 4FXKC 1IV8A 4AQAB 2E46A 4NXSA 1JF6A 1JXKA 1L7TH 3TBVA 5AEAA 3PAVA 3L5HA 3OBAA 5KANI 1B0RB 3EDFA 3SPHA 4FQ1L 3VNZA 1F4XL 3P3YA 4RISL 3FL7A 4AQOA 5J1AB 3G6DH 4JZNB 1HAUA 2WLLA 3EJZC 3KL5A 1NFAA 5HD8C 5J3HD 2KDGA 3CZFB 1AO7A 2VISB 5EO0A 1AYRA 3OLEA 4PRNA 4U1KA 1MHCA 4LESA 2KLTA 2UY7A 3OR6A 4QKXB 5JHLA 3G6AB 4S0HA 2J21A 2GHZA 3HS0B 1NBYA 3C6EA 4JHBA 4BH8A 2JMRA 1YNKL 3FFOA 5MERB 1TSHA 3T04D 4AGMA 5HYJA 1TFPA 2AXWA 3O8XC 1AXSA 2YPVA 3TTYA 5GJTL 1VFMA 3OKLB 2OMUB 3AUWB 5SV3A 4UDTA 1I9EA 3SGDH 3ZU8A 1GXEA 3NSXA 2VR4A 1NBVL 1JERA 1F3JA 2XZCL 3QIUA 4JFXB 4R0LA 3V4PA 3V7MA 2FECL 1YEFL 2I9TA 3WI9A 2XXCB 5BNXD 4MAUH 5ANMA 2GUOA 5FM8A 2YEZA 3MOAH 3VFUA 3KPLA 3KYNB 2OKMA 1DQLL 2EADA 5FM5M 3QYNA 4K9JA 3EDDA 1SEBA 2VN6A 1GGBL 2AMUA 4P2QA 4MNQB 3KGUA 4XCFL 4YHIB 2NPLX 2VDKH 1PIFA 2L8AA 1TXKA 4KVCL 5D4IA 4UM8A 1HHIA 2HFFA 1MJJB 5KJ7E 1K2DB 5J12C 4DJMA 3JWDL 4JFQB 4PJHB 5DD5L 2ZOWA 3SKJH 5IB4B 3UAJA 1INQB 1CB4A 4G11A 1U36A 5CZXD 1PX8A 3M86A 4EUPG 2AP2A 1DBML 3A6CH 1Z66A 5C6TH 1FCCA 5JDSB 3MBXL 5KTEL 1FSKB 4Y5XB 2XBZA 4O51A 5J5EA 1A1OB 5EF3A 5DJXB 3SGJC 4NI3A 1YMME 2R2BA 4G8GE 2NY6D 3ABZA 5F7FA 5L4IA 3DYOA 3VXPB 3ARWA 3F01A 3SDDB 3WNNA 3M1OA 3RPKA 4ELME 5J6SA 4JM0A 4OZHE 1ZT7A 4I3GA 4X0NA 5HGHA 1F4YH 3KPSB 2BY1A 1T1ZB 5CWSB 1IKNA 1UD6A 1NM9A 2WNGA 1ZTXL 5D7IE 1A6ZB 3FFCE 4QHLB 1QR1A 2E86A 2Y06H 2ITFA 3DC0A 1OAJA 3VB8A 1CI3M 2AXFA 2QGCA 5T3XD 1TR7A 5DA4A 4B9YA 2CO1A 1LD9B 2FO8A 2XN2A 4RFEB 3IB4A 1GAFH 1MIMH 3LZPA 4KKZA 3QIWC 4WF7A 5C0NC 1PG7H 3MV8E 3WMPA 5KYYB 2OI9B 3QDGE 3DJRA 2FQFA 1RZJL 1OK8A 2FBRA 2P26A 3BPNC 4PWIA 1EO8L 3WLWD 1RCYA 4IOSD 1C7SA 1G7PA 3LHAA 4CKVX 4CC4A 3PHOB 4GO6B 3P9MA 2LTQC 2X09A 1S9VA 3K6FA 1FFRA 4QEGA 1AC0A 1Q4NX 1MQKH 3MTXA 3L3OC 3KS0H 4ZRGA 3FSAA 4JO3H 4I77H 5IB1B 1WZKA 2H5UA 2ICEA 3VFVA 1DVUA 2OSYA 2LW3A 4ZSOA 4CGTA 5AZEL 1USZA 1ORSB 5EUOE 4OLEA