1Z9PA

X-ray structure of a cu-zn superoxide dismutase from haemophilus ducreyi
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
155
structure length
155
Chain Sequence
EKIVVPVQQLDPQNGNKDVGTVEITESAYGLVFTPKLHDLAHGLHGFHIHEKPSCEPKEKDGKLVAGLGAGGHWDPKQTQKHGYPWSDDAHMGDLPALFVMHDGSATTPVLAPRLKKLAEVKGHSLMIHAGGDNHSDHPAPLGGGGPRMACGVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural basis of heme binding in the Cu,Zn superoxide dismutase from Haemophilus ducreyi.
pubmed doi rcsb
source organism Haemophilus ducreyi
total genus 38
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1z9pA00
4MCNA 4OH2A 2GBVA 1UXMA 3PU7A 1OEZW 1OAJA 1JK9A 1DSWA 1PTZA 1TO4A 3ECVA 1SDAB 1Z9NA 4OJAA 1SPDA 1E9QA 2VR6A 4N3TA 1E9OB 2E46A 1SXBA 3LTVA 3QQDB 2ZKXA 3GZPA 1BA9A 2WWNA 3GTVA 1N18A 1YAIA 3ECUA 3GZQA 4A7SA 2Z7ZA 1B4TA 1SXCA 2AQNA 1SXSA 1SDYA 1L3NA 2ZOWA 1IBDA 2XJLA 3KM1A 2Z7WA 2C9UA 2WKOF 1SRDA 2APSA 2V0AA 3SODB 5KBKA 1B4LA 1EJ8A 2Q2LA 1OALA 3F7LA 5CU9A 4N3UA 3S0PA 2AQRA 3H2QA 1S4IA 2GBUA 1HL4A 2Z7UA 3KH4A 5KBMA 3KBFA 2AQPA 1MFMA 2AQQA 4L05A 1KMGA 1PZSA 1IBHA 4BCYA 2AQTA 2E47A 1YSOA 3F7KA 1Z9PA 2WYTA 2WZ6A 1N19A 1F1GA 2XJKA 2C9SA 3L9EA 1YAZA 3ECWA 3CE1A 3CQPA 3KM2A 1PU0A 1QUPA 3GTTA 1JK9B 2K4WA 1OZTG 2AF2A 2ZKWA 3K91A 1E9QB 1E9OA 1HL5A 1ESOA 3QQDA 1BZOA 1P1VA 1XTMA 2WZ5A 1RK7A 3MNDA 2Z7YA 2WZ0A 2JLPA 2ZKYA 1IBBA 1CBJA 1F18A 1F1AA 2LU5A 1EQWA 2NNXA 1SXZA 2AEOA 2WYZA 1IB5A 1F1DA 1E9PB 1DO5A 4FF9A 4A7QA 4U4IA 4A7GA 1TO5A 3HW7A 3RE0A 1SXNA 1XTLA 2WWOA 2VR7A 4A7UA 1OZUA 3GQFA 3HFFA 3T5WA 4B3EA 1XSOA 3GZOA 3KH3A 4BCZA 1IBFA 1SOSA 1SXAA 2GBTA 3HOGA 1Q0EA 1U3NA 2C9VA 2WKOA 5KBLA 4A7GF 1JCVA 4BD4A 2SODB 3KBEA 4MCMA 2R27A 2JCWA 3H2PA 1CB4A 3CQQA 1UXLA 3MKGA 4A7TA 1COBA 1FUNA 1AZVA 4A7VA 2VR8A 3L9YA 2AQSA 1E9PA
chains in the Genus database with same CATH superfamily
2ADFH 2ORBL 4RGND 3MJ7A 4WHYH 3PWJB 1BZ8A 4PLKD 1T2QH 2HN7B 2XC8A 4M1CC 2WUCL 3QWRD 1QLFB 2GJJA 5C0AE 3BKJH 1OAJA 4KXBA 2GJRA 4QOKE 4W9LC 5BV7L 2R23B 3GSQA 5CJXA 5BOJA 3GNMH 3SE4A 3MCG1 2MNUA 3K0YA 2UY7B 4ABVA 2VLJB 1R17A 4QYOB 5I1LB 4AQ1C 1VKXA 2WSPA 4ILDA 5T3XD 4GSQA 1JFQH 5DCCA 4KK9D 4Y9EA 4WUKL 1I8IA 2KQNA 1I9JH 3HN8A 3PQYE 3OJDA 2R4SH 3U0TA 4KY1H 4P46A 4D94A 5CMAA 5HJDA 1BFOB 5IBUB 3I6LE 2GSGA 2YIHA 4ONHA 4C56A 2V7HA 3KLLA 1T1WA 2DWEA 4HIIB 2HSIA 4R5TA 3ZYZA 3UP6A 3TBYB 3KJ4C 4L48A 1ZPLA 4XBGB 4BE6A 2CKBH 3DVGA 5KWYC 2F54D 1M7XA 2EIZA 1FVEA 3DURA 3QDJD 3LNFA 2WXJA 4M61A 1Q1JL 4Z7IA 3IFPB 2G3NA 4L05A 3OWEA 4DGVL 5ICZA 3FBKA 3O11B 2X4OA 4BGDA 4N2GA 4YHIA 3L4CA 5B7MA 1L0XA 1LDPL 1A6VL 2E7CA 3VXSE 4YXLL 3B2XA 3S3BB 3KBHE 3F58L 3OKYA 1NC2D 4HOXA 1TTBA 3CZNA 1NGPH 2AXGA 2DQUL 4LZKA 1NCCL 5IFHH 3EH3B 2JXMA 3NSYA 2RQ8A 4HFWB 2BOBA 2ESVA 3ZQ9A 3MNDA 4KK5C 5FA3B 3UBGA 4HULB 4PP2B 4WEMB 4R7XA 4R7NB 3V4VB 4WENB 4IMLB 2O5ZH 5DFWH 4DEPC 4F2FA 4DP9X 2OA9A 3IMUA 5IB1A 4NKMB 1A1NB 1Q9OB 1JK8B 2H7WA 3GSWB 1INEL 4QRPB 3U2SB 4I1PA 2IH8A 1ZGLM 4MDIB 4FFTA 4MCZA 4POZC 3BVTA 1BREA 2VDRB 1UM6H 3KYNA 3QJXA 4UAHA 3VFRB 4PRPD 4RBPK 4L37B 4DAGH 4H4NA 4XPGH 4A63A 1LNUA 5ILTL 3VFVA 1UOWA 4E9SA 4YFLF 2VLME 4YDLB 1R24B 2G2PA 3STLB 1Y0LA 4FFZH 3VWJC 3SHSA 2CMRH 4IGBB 5ERWB 4GO6B 3W39B 4RVBA 1FIEA 5ICYB 1E4XL 1JF1B 1O5DT 4JM2C 2K3HA 3HKZA 2A74C 3BUQA 2DAVA 2OTUB 2W60A 2YPKB 3QO1B 4LSRL 3T1WA 1T21B 1S5HA 4BHUA 1CC3A 1XF5A 3NMEA 2ZUQC 3QT2A 2I07B 4KMTL 2NYZA 1QSED 2GYSA 2W9EH 2XXFA 3NFPB 4PLOB 3OB0H 4OGAC 5DRXB 3KS0J 4BFRA 3QFDB 5ANMA 3KPRD 2DMHA 3P11H 4MBRA 3DVIA 5I30H 2F1AA 4Q14A 1OCWH 2EE6A 3PWNA 5IEHB 4ACTA 5C0RL 4UDUB 3DJSA 2B4CH 3NIGB 2FE0A 2HG5A 4OB5H 4BA0A 1KIUA 1MCDA 4HIHB 3GKWL 5L8LB 1CXFA 5GGVY 2GW5A 1NTDA 2VW6A 3E38A 3QGVA 3CFIC 1J8HB 4WI5A 1UWGH 3MRFA 4YXKH 5BZDA 1N6VA 2PPFA 3QIWA 1T1ZA 1EHKB 1K8IA 3H2QA 5F9JA 3K0WA 4G6ML 1VB9A 1RY7B 3MROB 5DC0A 4N9GA 5IMOB 2AQPA 4EZKA 3L9RA 2WBJB 1N59A 1G7LB 2HWZL 3MRCB 3WFEH 3ZO0A 3PXLA 4K15A 5FFOA 2DQ6A 3ZKND 2Z92B 2DQFA 4E42A 4MAYA 1KGWA 3BPCB 1QWHA 2VQ1A 3UABA 5BQ7A 4JHUA 2CRYA 2VWEC 3KLAB 1J0YA 1KBKA 5D1QA 3WNIA 4B9FA 4OGXH 4DO5A 4F92B 3G5XB 2EEFA 3QH3A 3GSQB 3MOAH 2HFEB 1BAWA 1TMQA 3EBAA 1SGKA 2BX5A 5DK2A 1LMIA 2XXCB 2EINB 4ZXBC 4FGMA 4Z9KB 3UTPE 1KLGA 4RA0C 4Z7UA 1EMTH 4MX7A 1TJHH 1OSEA 2QT6A 3SDAC 4ZTOL 1GJWA 4JRYD 1WC7A 5CLWA 1I8IB 3OZ9L 4UMSA 2HLEB 3QXDB 4WV1C 3U0TB 4P46B 2PPAA 3AG4B 4ANKA 5CMAB 3E3QC 3FTWA 4BZ1H 3HI6L 3JVGA 3U1SH 3DHPA 4KVNL 1I7RA 4C56B 2V7HB 5B3JF 5TQ0L 1FVDB 3ARFD 3AY2A 3O6FA 1X4YA 1EVUA 3B9KA 5TPWL 2FLBT 3DVGB 3C2AL 2EIZB 3GDCA 4PJCA 5A2JH 4W9EC 5IVOA 3Q2CA 1WRFA 3DURB 2HFFA 4M61B 4BH7B 3OVUB 1VDGA 3QXUA 3SOTA 7PAZA 2ZOUA 4LIQH 3FJTA 3WIIH 4IOSA 4X4ZA 1XBRA 3ABZA 5LNDA 1KN2H 1TYRA 4JFDE 4KPHL 3UAAA 2JI3A 3ULUF 4Y5YB 5K9KA 3NDYE 1IZJA 2HLFC 5TDOB 2AXGB 1PTZA 3TYGL 2ICWI 3FH8A 1AOHA 4WEBH 3THML 3F05A 4NWUL 3BI9X 2JXMB 2ATKA 3ILEA 4FG2A 5KYUA 2ESVB 1AXTL 4N2BA 5I82A 3SPIA 2RD0A 4UQBA 1OAYH 4N20A 5D9SA 1MVYA 1C12B 3F5WA 3LQAC 3AU0A 4N4YB 3DX4A 3GDBA 3T8XA 4QGTA 4OIIH 4K73A 1NBVL 1FYTD 3AXIA 4EZJA 2G4EA 2B77A 2DYRB 4Y2OB 4Y4FC 1QLEL 4M9OA 3TT3H 4EN3D 4Z1PA 2HAZA 1ZLVH 4DVRH 3DPBA 3KYOA 4OKDA 4X8JA 3KYNB 5D71L 4YDNA 2C9PA 4PS8A 3QFJB 4NBYB 4TVPD 5T1DH 4N6QA 4BEIA 2X6CA 4YZFE 3TTYA 1LNUB 3OAYK 3VFVB 3BPLB 5CBEA 3TLRA 2JIXD 5F97E 1S9KC 1LHZA 2NTSP 2EH8L 1Y0LB 3RZCB 1A6WH 5EBGA 4Z95L 3LZRA 5F44A 4UAOB 1OSPH 1W0WA 4FFVD 2MNWA 5K9OA 5EORH 3DIFB 4Y1AE 43C9A 1YEKH 4GMSH 3BCFA 4UM8B 5AW1B 4ZMYA 2W60B 2YJQA 3MUGB 4GBXC 3U4EB 5KBPA 1S5HB 4XVSL 1XF5B 2ZKHL 4RIRA 2VMCA 3GEFA 4JFZH 2XOTA 1TZAA 3NCFB 4ZFZB 3DDGA 1I7ZB 1RUAL 4M5ZL 3EYQC 3DUSA 2AJXL 4J3OH 4OLXH 2DEWX 4F15B 4HBQA 4RZCB 4LAQL 5ANMB 1QZ1A 3ILQC 4RMSA 3PWNB 4F7EB 3GXTA 5IF0B 4FKEA 4ENEC 2OMYA 4C4KO 4FMKA 1FFQA 3TO4B 2Z31A 2EKSA 4QRSB 4TTGA 3H85A 1F86A 5IGXL 2NY2B 1KJVA 4XXDA 2VXQH 2QQKH 1OZUA 5DXWA 2I32A 3MRFB 2ZWYA 2VMDA 3QIWB 1HNGA 1Q0YH 2OR9H 4PGBA 3VGBA 2HT3C 3ZDXF 2OAAA 1JZFA 2NR6C 1CTOA 3B7TA 2VDOL 3QR0A 4HFUH 3TEZA 1O5PA 1KIPA 4YGAB 1N59B 4JVWA 4JPVL 4FXKA 4FHBD 4PJ8D 2IWFA 4WJG3 2V9TA 4WNJA 4MAYB 5HD8C 2H41A 4LF3B 4BBWA 5BQ7B 5H4YA 2W88A 1Z0NA 5L2JA 3AXLB 1J0KA 4YN3A 4L8BB 5FFLA 5D1QB 2CD0A 4QPEA 4AJVA 3WEBA 1E9QA 3NCJH 4Z23A 4APQC 4MZ2A 3VXMA 3CZFB 1DBKH 4HKZB 3OJMB 1KLGB 4Z7UB 2DDQL 2OYLA 3C5JA 3K2IA 1UGKA 4M1DL 2YOCA 4F91B 4A2FA 4ZUSB 1WC7B 4Y2NA 4BINA 4AUUA 2YXVA 2VSCA 1PAZA 3MCLH 1IBGH 2AJUH 1CGWA 2EDNA 2IQAA 2PYED 1BBDH 3GWJA 1WAEA 3FMGH 2XG5A 2JKSA 3ZX1A 3IDMA 4Y4HB 3H3BC 4ZW7A 3REWB 1GJUA 1Q4NX 5KYWB 1S7XA 4Z7VE 1IAII 1JUFB 4GRWH 4I2XB 4NUJA 3K71A 2JKIS 3GSXA 4W9DC 1LL1A 3ZTJG 2Y69B 3E3QE 3WS3A 2B5IB 5EZIH 3D0AA 4LSQH 2NY3C 3D5OF 3MC0A 1NDGB 3T4YA 3IBOA 5DO2D 1PZ3A 4PRNB 3MV8E 2GFBA 4X6CB 5ALCH 1ZE3H 3QYCA 2VDLB 3HPLB 4HJJL 4LASH 1JPGB 2UZYA 3NESA 4U6XA 4NJAL 4OFYA 1U41A 1JIBA 2IH9A 1G9NC 3H0TA 3WJJA 3SGKC 1BXAA 1OKEA 3JBG7 4A2HA 1GTFA 1CI3M 3JWDC 3QQ9D 4KUCF 2ATKB 2NXYB 4QCIA 5E2WH 1Q9WA 5F7EL 5KYUB 2CUAA 2JCCA 4FYQA 3IJEB 2W59A 2XKSA 5D9SB 2F58H 5DR5H 3UAJD 1MVFA 3F5WB 1PYWA 2QKIC 4MZIA 2NUTA 3CVDA 4GIAA 2DB8A 4UM9A 3T8XB 1TEFA 2EYSA 1SOKA 1ACYH 4XNAA 6PCYA 2VUYA 1JNNL 4QXWA 2Y7LA 4DP5X 4TNFA 1SXNA 3PWPD 4C55A 5CN1A 4X4ME 1SEBA 1VCBC 3KYOB 4X8JB 1IM9D 3VXRD 4D0CB 4KZEH 2WPGA 4KX9A 4JFYA 3I50H 3CBRA 3TJEH 4WFGE 4ZO7A 2AEQL 1E8ZA 4CMMA 5DD6A 1F6AA 3ARGC 1R6VA 4BKLB 2J44A 4E41E 1UCBH 2O6FA 1O7DC 3RWGB 1NEZA 4TLKA 4AOFA 2XACC 3UCQA 3CXDH 3LVTA 3OPUA 3R0MA 3ARDB 3C6LC 4LCIL 1DVUA 3ABKB 3O4OB 1C16A 1J9QA 3HZMB 2AI0H 1QBAA 4GKZA 43C9B 4YS4A 1N5YL 4JZNB 2IQ9L 2ZYHA 1RJLA 3VGGA 1KIRA 5DD3L 5EH1A 2RH0A 1AZNA 2HVJA 2TSBA 1L3WA 3WG7B 4XTRD 2D3LA 4QTHB 1UJTA 2OYMA 5JDSA 3DUSB 3B34A 3QC5X 3RZWA 4FZEH 1CN4A 1FNHA 3RBGA 4ELMB 4NC1C 2OMYB 3QIBD 1EEYB 3VXUD 3HEIB 1RZGA 2HTKD 2Z31B 2EKSB 3BKCH 4FQXC 4MDJB 4WCYH 1MCPL 1YVLA 2G3ZA 5SV3A 3SDYH 2FZ3B 3PXJA 1DBML 4O02L 4KJPC 4FMFA 3UGXA 1FFNB 1LO3H 1RAMA 4OD1H 3VFTA 4MBOA 3WY3A 5JHAA 5DGRA 2P5EA 2YOAA 3UAEA 5KUKA 3RDTA 5I74C 2QQLL 3A22A 3CDZB 3K6OA 4WHCA 3F8UB 4IGBC 3RP1A 1G7PA 3ZRCC 1XL4A 3BZFA 3F2LA 1LYQA 5KS9B 3TEUA 1HHGB 1AQDA 1S3RA 2A0LC 3NFSL 3FAXA 4M3HA 2WXKA 1MW3A 3FB6B 2XWZA 2D03L 1A21A 1XIWD 3ULUL 1IMHC 1E5UI 3V6OE 4AY0A 1E9QB 1CLYH 3VXMB 2Y2YA 4XBPB 4P9HL 4BCXA 1G4RA 2JLLA 1NC4D 2ZQKA 1NOLA 2JJTA 4MQ7A 3A6BH 3W57A 4LQFH 1MAJA 3B2MA 1FDLL 4S0SD 1ZK9A 3BIAX 5E5RB 2DIEA 4A04A 1ASPA 1XV8A 4JANA 2EH7L 1S7WA 1U36A 3CVHL 1YNTA 2VSDA 2XWDA 3PL6B 4Q9CA 4JFTA 2NNFA 4Q9RH 3IDMB 1S6NA 1Q90A 5C0DA 4FXGA 2ZUTA 5CEZL 1S7XB 3QRBA 5A2FA 3CVHA 3GSXB 4LSUL 3QK0A 4JZJB 4LVNC 3QCUL 1KZYA 2FO4A 1QRNA 2EE0A 35C8H 4N6RB 3FHEA 1A9EB 5HHOD 3T4YB 2RQEA 4GJTB 2CQVA 3LKRA 3V0HA 2X1XR 1BWWA 3JYCA 2HA1A 5I19L 2HVBA 3VRLE 4NZRL 5EUKA 5GGVL 2WKLA 3TWCL 4G83A 4LLMA 2EO1A 1ZK5A 5CJXC 12E8H 1UZGA 3H0TB 3HZYB 3SE4C 3NJGA 2ADFL 4FA8A 4YFDB 3CX5K 1T2QL 4YPGA 3L48A 2WWMC 3RLSA 1TQBB 5IW1A 2P8LA 3BKJL 3KG5A 2J72A 4H88H 1JHTB 5BUGA 4QCIB 1EWHA 2J12B 2JCCB 1NMBH 2QQNH 3GNML 3CN4A 5B1BB 4NO2A 4P46C 4J3OF 5GRZA 1EH9A 4PJ7F 2Y7OA 4KUZH 4TSCH 4UM9B 2IV9A 5D5ME 1JFQL 3VFMB 3OSKA 4JG0H 3ISYA 5E8PA 1I9JL 3F84A 2R4SL 2X6AA 4KY1L 4DFHA 2ZYSA 2D8KA 2X3BA 1LK2A 1CFTA 3Q1EA 4IJ3B 5DUMH 4R4ND 3QCTH 2UX7A 4JFYB 3TASA 6FABH 3QO0A 1ZHLA 1AXIB 2R2BB 4PJEA 2QGBA 2WQSA 1HYSC 1LTXA 5DQJB 3QS3A 4CMMB 1F6AB 3QI9D 2CKBL 4G9FE 4E2OA 4OCRH 2KC0A 2WZPA 1S9WB 1X7QA 5ESAA 1NEZB 2VE6A 5DJ6A 4JY5H 4EIBA 3OLDA 5EIVA 3VB9A 2CKBA 2I60H 1WBZA 4CU6A 2BIIA 3LOWA 3NEXA 1RJLB 4IYKA 1O7DE 2VMFA 3GINA 4JGMA 3C9NA 4UNUA 1EUUA 4W93A 1E2WA 2JV6A 2HVJB 3A24A 4J4PA 2DYPB 5HDBE 4JFFD 1NGPL 3S3JA 2A73A 3I3DA 1D7CA 4KXZH 4U3HA 5IFHL 3D1MC 5ECGA 5CKGA 3KXFD 2V3EA 2X10A 1T2XA 2XWBB 4XMVA 5C07A 1JMZA 1PY4A 1M1SA 2EDDA 2WO3B 2X53A 1RZGB 3L1OH 4FTVD 5E99H 2O5ZL 1EO5A 5KTEH 1CK0H 1C5CH 1PZCA 1TTGA 3IBEA 4RFEB 4QT5B 1WBXA 2QADB 2YD2A 3HHRB 4HALA 3HE7A 2VAJA 1NFDF 1JD7A 4PN6A 4GRWF 1E2ZA 4DP8X 1BIHA 3BPLC 4Q6IA 4NO5A 1UM6L 3HPJB 2JCWA 2P5EB 4XNUH 1RL1A 4OV6F 4ZAKB 4DAGL 4P23D 5EC1A 1PNCA 4ABWA 1G7PB 2O61A 2WQXA 2V7NB 4UUJA 4XPGL 3BZFB 5DMIH 3N40P 3DI3B 1AQDB 3CSGA 3R4DA 2W9LA 2D4DA 3U7YH 3VH8G 3LNDA 1FH2A 3IS0X 4Y9FA 3RNKA 2IDFA 5DF0A 2X1PA 4FFZL 1CLZH 2OSLA 3MGOB 1N12A 2CMRL 1EEZA 1Y1UA 2KZKA 4HOMA 2OI9C 1TFHA 4F15C 2ZX6A 3T2NH 2QZQA 4K2UH 1OWRM 4Z7NF 4JUSA 1MRDH 1X6NA 3C12A 2WXGA 2CDGA 3OMAB 4JFPB 2ZG3A 3H53A 3TO4C 1BSIA 3WIAA 2W9EL 3ALPA 4KFZC 1XAUA 4JANB 3WSQH 3HG5A 4YLCA 1UYWH 4UIKH 1YNTB 3H9ZA 2ZSWA 3P11L 5GS1A 4ZW8A 4DP7X 5I30L 5INCA 1OCWL 3ZKQD 3QIWC 4FXGB 4OB5L 2B4CL 4NQDD 4HS8H 3NIGE 4XPFH 3G5YA 5ALBH 2XYBA 4GP8B 1A6ZA 1UWGL 3G04A 4YXKL 1J8HE 1QRNB 3WO3B 4CILA 1NCNA 2DICA 3APCA 1JPFA 4RMBA 1T1XA 5TJWK 4MAYC 3C8KA 1PY0A 4XO3A 5F6IB 2L4OA 4IBSA 5DC2A 4D9QD 1HSAA 1XGYH 1SFDA 1MCNA 2WZ6A 5EUKB 1NZRA 5D1QC 2VN7A 3FB7A 4DHLA 3QDMD 5LHDA 3WFEL 4OD2A 4G1EA 4Z3HA 1NKRA 3R8BB 3TC9A 4XVUC 4YC2B 4RBPH 4OD3H 2BVYA 4OGXL 5C9JB 2GY7B 3AABA 2Q8BH 3MOAL 4Y2DA 4CC1A 3EGXA 3O9WD 1IBBA 1TCMA 4E36A 1KDIA 3DX6A 3JVGC 4JCMA 1EMTL 2FK9A 1TJHL 4WI2A 3HZKA 3GS7A 2Y23A 3KPPA 1GZQA 5IW6B 4YVNA 5AG8A 5DK0B 1G5AA 5E8PB 3I6GA 3O6FC 3CVCA 3B9KC 3UMTA 3O8XA 1LK2B 1CFTB 2A6JA 4BZ1L 5JUEH 5DMYA 3GZOA 4JN1H 3FFCD 3U1SL 3HLAA 4C56E 2F7IA 4PJEB 4B97A 2V5YA 2O5NA 3QXTA 4NBXB 1S2EA 4FKKA 1SMOA 2EIEA 2KMWA 4JKLA 1X7QB 3RVTC 3ZTDC 5JORB 3MOQA 4FX5A 5IHUH 2EDWA 3WHE1 1QACA 4LCWD 1V27A 5LDSA 2OMWA 3P73A 4LIQL 4AMWA 3WIIL 4PJGB 3OKEA 4ZNCD 1CICD 1TVBB 4AE1A 3MSPA 2FO8A 4QRRD 1KN2L 5DURD 1EV2E 1HDMA 1MCBA 1ZA3A 4LSPH 2A73B 1PCXA 2OULB 3IMRA 4WEBL 2AK1H 1BZQK 2OW6A 2WXNA 3V4PA 3ZJAA 1I8UA 4PSRA 4FAAB 1OAYL 3DX9A 3F7YB 2VZTA 5D7IF 4EN2A 2FQGA 2IH3B 1T03H 2OCCB 3L54A 4LBAA 4OIIL 4WI0B 3UTTD 3HG1A 1WBXB 2EIBA 3VA6A 4AQZA 3LKNB 3D2UA 3HE7B 3TT3L 4JHVA 4BFEA 4DVRL 1AS8A 3T2LA 3V55A 1MFEH 4Q6IB 5GGTA 4NO5B 4QHKJ 2TRHA 1A4KA 2QLVB 2WLHA 3HUJA 1F13A 3VXOA 4D7BA 1UWFA 5HP5A 5T1DL 5C0CB 5EC1B 4QOKD 4YE4H 3FFOA 3F7KA 4LP4A 3MRKA 2YAHA 5FM5M 2V17H 3RNKB 3X1EA 2Y1YA 1TQCB 1A6WL 2JNZA 2OSLB 1AKJB 3DC0A 3PWLA 3VD7A 1G7HA 3NIDE 3T3PE 1OSPL 1T2JA 4HKBB 2WIIA 3RNQA 5EORL 4E5XG 1YEKL 4GMSL 3CTTA 2GT9A 1UADC 1RUKH 5JW4R 4XH2A 3BUPA 1GHFH 3I6LD 2ED7A 2VISA 4S1SH 2ZKYA 4F37F 4AKOA 1LE9B 1CBJA 2XCMC 4JFZL 3UTSD 5I28A 1H8OA 1S7RB 2FQDA 2W80C 2Z31C 1RP8A 5C09A 1SXZA 4LESA 3D0LA 4OLXL 2X89D 3MREA 1F1DA 4JX0A 1DSYA 3EJCA 3RWFA 5KN5A 2Q7YA 1L9QA 3MBED 5ANME 5INCB 1KUMA 5CWSA 3L5XH 3KNBB 2O6EA 4BKTC 2CO3A 4LOVA 5DJZB 5KOVC 3GSVA 4IKKA 4XO9A 3ARVA 5B3SB 1ZAGA 5FO9B 5GGRY 3CC5A 2VXQL 1A6ZB 3MO1B 3KVDD 2QQKL 4FNLH 2JQMA 2Q76B 4E9RA 2E27H 4FXKC 4KKBD 4AMXA 3BISA 1VA9A 1Q0YL 2OR9L 1T1XB 1GW6A 3L6FB 3C8KB 1WJ3A 4IDJH 5I8EA 1AYRA 1NGYA 2VXQA 4HFUL 5B1CA 3R1GH 3QPQC 1ACZA 3QS2A 3AAZB 3FB7B 3PXHA 4L3AA 2BOCA 4FXLA 1ZV5A 1T5WA 1C7SA 1TO4A 4G1EB 3SKJH 3F7QA 3ZE1B 4K71B 4YEEA 2MCMA 5E70A 4FLSA 3W3BA 1DQJA 4B27A 1II4E 4CAGA 2ZKXA 3VE0B 1OLLA 3WO4B 1KLUA 3LN4A 4M8QA 2M2DA 5G55A 4Q9BA 2HX9A 4EUPA 4DPCX 1OP3H 3UBXA 3NCJL 4Y2DB 2CBMA 2ZYIA 3OAYH 4IEFA 3HJEA 1DBKL 2X40A 1MUJA 2W07B 1MZZA 3P02A 4Z7UE 1O6VA 2YMOA 5EN2A 3HZKB 1W2KT 2W0FB 1WAAA 1U8LA 4YOKA 3H7BA 3MCLL 1IBGL 2AJUL 2YPLE 1BBDL 3O8XB 2XBZA 1QG3A 2NNCA 3FMGL 4TQPA 4WU7A 2VLMD 3HLAB 5DEFA 2X05A 4GAGH 4APXA 1H8LA 1REIA 1R3IH 3NCXA 1MCJA 3ZZ1A 4PJCE 5EZIL 4FZ8H 1PBYA 1NFDA 2DW5A 4LSQL 2NX5A 5F6HJ 3WJJC 3DBXB 3DOIA 2VZOA 3P73B 4Y16D 1DANU 4NAMA 3HE6D 4B9CA 4DGYH 4KJQD 2O6DA 5ALCL 1ZT4B 4P4KA 4LASL 1Z5HA 4YSPA 4AQEB 1KFAH 4BFJA 2GITA 4PMEA 3WTSA 1J5CA 1ZA3B 5T3ZD 3VMNA 9PCYA 3KPOB 1KYAA 5F1OB 3V4PB 3BAEH 2LU5A 5LCVH 4N22A 5E2WL 2NNXA 5IBUG 4YX2H 3DX9B 2YO3A 3FT2A 3S35X 3SY0B 2Z0UA 5DR5L 2F58L 5FGSA 5C7XH 5FOJA 1R5VA 4RLDA 3TPUB 4IJ3C 4PLNC 4FYTA 3A3YB 1ACYL 2QVKA 3S88H 4EO5A 5EIIG 1LMKA 3RAJH 1UOKA 2F53A 3ASWA 1UT9A 1VADA 4KZEL 5ITFA 2EEDA 3CHXA 2GJPA 4CBZA 3I50L 3CU7A 3HUJB 4J1UB 4XMWA 3VXOB 4UOZA 3EH2A 3TJEL 1ZV9A 2F5BH 3C09B 4ELDA 5A2BA 5I5RA 2O72A 2KPWA 3QORD 1UCBL 5D7KE 2ZP0T 5AZUA 1VLXA 1R3KA 3CXDL 3DOSA 4NQXA 3TH3T 2YEZA 4M1CD 2CHDA 3PWLB 2XYCA 3FC8A 1S7VA 1MVUA 1TR7A 2GAZB 5EF1A 2VLRB 2E46A 2J2ZB 2WIIB 4JQVC 5EBLB 3RA7H 3RNQB 2AI0L 3X11B 2KQMA 5IVZA 3BSHA 3MBXH 1G1OA 1LD9B 4XH2B 2K7PA 3VFOA 2DIAA 3E80A 3K2UH 4DOHE 4UI2A 1USZA 4HT1H 4IHOA 1N70A 3MRHB 2O93L 1EZVY 5C09B 3V10A 4N26A 4KGJA 2BVTA 1JZ6A 3MJGX 2Q7YB 5HDWA 4FZEL 1MFNA 5IM7B 4TOYH 1PD1A 2XKNB 5FIEA 3LPFA 2CNZA 4EDWH 5C2UB 3H3PH 5L4JA 5EBWB 5FOBB 3ML9A 2GSIA 3BKCL 2VDQB 4WCYL 1RV6X 3GSVB 3RB5A 3WHE0 4JM0A 3SDYL 5IFJA 4LGRB 1U3HB 2BERA 3CC5B 3FBQA 3OV6A 3RDTC 1GY2A 3ZDYB 5FM4A 1ZIAA 4UQDA 4Z77A 4L1HA 4YDKH 4TNVK 3SBRA 1LO3L 2LLLA 4JFDD 1ETB1 1U8CA 1YDPA 3WD5H 4AH2A 3OWRA 3VVVA 2X6UA 5E7FA 2XTSA 1DJSA 1FNAA 4MB3A 4HKXB 4OD1L 4MSWA 1CZ8H 2XIIA 2EEAA 3F04A 2ZF8A 1RZ8A 4JPKH 2KDYA 5AOKA 2EC9T 3S8FB 2BOCB 4EZLA 3QIUB 1CJYA 2UX6A 2XFGB 1HI6A 1OTSC 3KGSA 1CLOH 4HX1B 2JJTC 4JHWH 1NCWH 1DQJB 3IJYB 1KLUB 2IAMA 3LAFA 3UGUA 4EUPB 2E74C 4JUTA 4ODTH 2ZWSA 3UBXB 3A4AA 3DYPA 4IEFB 4KK5D 4P9HC 3FH7A 1CLYL 5FO7B 1QI5A 3VCLB 2FSDA 1FNGA 1MUJB 1HCZA 3TT1H 2WGNB 3UPAA 3A6BL 3JXAA 5EN2B 3AT9A 4LQFL 2AXFA 1G7MB 4FXGC 3U6RA 1U8LB 3BZDA 4H8WH 3AXHA 3H7BB 4B9KC 4D3CH 4EQ2A 1D6VH 3MYJA 5IB4A 1WFUA 1RK1A 1YZZA 2P5WA 2YC1A 3HFFA 1LP9B 4POZD 5I1DB 2CLZB 2EXYC 4WU7B 2D3VA 4Q9RL 4QHLA 3FRUA 4AYGA 3VM7A 5I6PA 1RUMH 4APXB 2CUIA 3GJFK 2CJUH 1IGYB 2CUMA 3FRPG 5HDOA 3LXUX 4Y1AD 3WNOA 4TVPH 3BD3A 3S4SA 35C8L 4LLQA 5F7DB 2BVQB 2X4TB 1OIOA 4WNQA 1ONQA 3DRQB 5EBMB 3VWJD 3KYKH 5JHMA 4JZOA 2H1XA 4M4RA 1QSFE 4LCYB 5I1AA 3H42H 4JM2D 1GC1H 3RVWC 3D3VE 4P4KB 1R9FA 3IETA 3WEMA 3FQWB 2D2CC 1EJFA 12E8L 1MFAH 2E86A 1KCBA 5HHMB 5AUMA 4D8PA 2VZSA 2RTTA 3GO1H 3DI2B 4MCYB 3N06B 4OGAD 2W81C 4ODSH 4H88L 3BC9A 3HLKA 1NMBL 2IALA 4DN3H 2QQNL 3R18A 4Z7NB 4D0DA 4P5KA 3BVNA 4KUZL 1UURA 4TSCL 3QUYB 4YSQA 2IPTH 3OAUH 2Q2LA 4H8VA 5HYJB 2WBKA 1O9ZA 4BQCA 4JG0L 3ZOAA 1BX2A 4FMVA 1JZ8A 1JG9A 2ATPB 2GEQA 1DFBH 3D08A 5J8OA 2H6UA 5ITFB 5DUML 1EHNA 3QCTL 6FABL 2EIJB 1LLAA 2DQEH 1MWAA 1CIDA 2ZAHA 1KCKA 2EO9A 3GMPB 2J1YA 4L1DA 4PV8A 4A55A 1N9PA 3HI1A 3MV9B 3UOAB 4OCRL 4WWPA 3UERA 3DV4A 4I48A 4CA4A 2X3AA 1RP9A 4JY5L 2YEZB 4IRJA 1HHIB 1MAMH 4J4PC 2JB6B 1A02N 3NIFF 2QZ5A 2NY5C 3BRFA 2I60L 4O2CA 5CM1A 1LO5B 3ALWA 4HZLA 4MJIB 5DJCB 2P43B 3T0WA 5TGBB 4GAFB 4TPRH 4ZXBD 3CWGA 3VFOB 1JFHA 3SDAD 3MRMB 4LEOA 4R96B 4Q74A 1W0VA 4HV8A 5H2BA 4O00A 5AAWA 1TVHA 1AGFA 2BHZA 3VXQA 5CILH 3BGMB 4AYBA 1H3WM 5EU6A 1Z0MA 4AI7A 5AAMA 1HHHA 2VR7A 3HE7C 2LVEA 3Q8AA 4MWFA 3L1OL 3QEHA 4C4KT 5E99L 2X9WA 4YBHA 5KTEL 1CK0L 1C5CL 3BUYB 1YMMB 4LCCA 4Q6IC 5BS0B 2BM3A 1KTKE 3MV8D 4KH2A 4I0PB 2OMUA 2CO7B 2X2JA 1A2YB 2E0PA 1E42A 1YDPB 4WTQA 1FGNH 2OMXB 3NZUA 3WY1A 4BDVA 1GAFH 1HXMA 2FECL 4EKXA 3SGDI 5IHBA 1FZOB 3CFDA 4F5CA 3SE8H 4XNUL 5B3JE 1TQCC 1RZ8B 5LAXB 5KVFH 1JZJA 2VLKA 1KOAA 5DMIL 1HI6B 4LHUD 1YY8B 2HLFD 3U7YL 3ZR6A 4X42A 2YEVB 4F24A 4ELKA 1BG1A 1MH5A 3ARBB 1CLZL 4PYHA 4XOAA 3LKQA 2N56A 5BW7A 1MJ7H 5CCHE 3U2JA 1T89A 1NCGA 4DCQA 4NHUA 5FO8A 1T7VA 3LZPA 2CLVB 2Y6TE 3PREA 4K2UL 3T2NL 2CCLA 4KO6A 1HWGB 1MRDL 4X0KA 4BRVA 2ZX5A 3L95A 3L4XA 2AXFB 3ULUE 3ABGA 1A6TA 1KYFA 1PZBA 1BVNP 1FH5H 4A37A 4L1BA 3JV6A 4Y4FD 4Z3IA 2Z8WC 5J6SA 1ZS8A 3MYJB 4P9MH 3WSQL 1UYWL 4UIKL 1T7WA 4B5ZA 1DJIA 4ZJ9A 1UD2A 5I73B 2H1LM 4XPTH 4HS8L 4R2GC 4XPFL 3T2OA 2QVTA 1U30A 5ALBL 3BWUF 2BIMA 2J3SA 5FKPB 3FU3A 3QUKB 1NIAA 5BO0D 4GSRA 2FHCA 3S4SB 5I1CH 5F3BB 2J6EH 3TESA 2VTFA 4LLQB 5CEZE 2CR0A 5JZ7C 4WNQB 1CGSH 3A21A 4PWJA 4JZOB 3MKKA 3VU1A 4J8RB 1XGYL 5K93A 1V3JA 5AVZB 3WO4C 2E59A 2DPKA 3H9SA 3IETB 3L2NA 4GBXD 2J73A 4Y2DC 2FX8H 2JKWA 5IV2A 3KPSA 4FC3E 1IVTA 3G6AB 2PYFA 2DWXA 3EYQD 3ZMRA 5CJOH 4YSUA 3SKMB 5GGRA 2YSTA 4OD3L 8CGTA 2Q8BL 3T0AA 3ILQD 3WAJA 1R3HA 3OM3B 4HCIA 5EU7C 5I16A 3WUWG 4ENED 3FTVA 4KRNA 1KG0A 2R0WH 4GXUM 4PJXF 3O8XC 3DX0A 2AMGA 2LAGB 3GMMA 1IEHA 4F7KA 1QW9A 3D87B 1I3RA 2NY0B 1JD9A 3QNYA 3JTSB 1TJMA 1BX2B 1XZWA 1MOEA 3NAAH 4GT0A 2OSWA 2H3NB 3P3TA 2HT3D 1NDTA 4PV1C 5JUEL 2C1PA 4JN1L 3SO3B 2NR6D 1RZJC 1CB4A 1XGZA 3BT0A 1ES0B 4HJ1A 3VXTA 1OV8A 1CD8A 4X9HA 1MWAB 1NQBA 5KJ4A 4AM0A 2W8CA 4JEGB 2NY4C 1YA5A 1VFAA 5AZEH 1NCDH 3VTTA 2ZAGA 3HI1B 3MLSH 4FI8A 1FNEA 3DV4B 3LDBB 2H0JA 5EZLA 5DFVC 5HD8D 1FI8C 4LNVA 4S2SA 3D07A 4H1LB 2UV3A 5SX4I 5HHPA 5IHUL 2I9LA 2K8QA 3ZDXE 2QPEB 4NCC1 2XU9A 4F33A 5J3HC 5EEUA 1GGBH 4APQD 3RILA 3QEQA 1ICTA 3ARSA 2IBBA 3PWVA 3ULVF 2Y9RT 5BOZG 4KI5C 4E9WA 4UZGA 4Q8BA 1J12A 4LEOB 4BSVA 1C5DB 4LSPL 3AGVA 1TEYA 1OD7A 4HV8B 5H2BB 3BPOB 3RU8H 1I7TA 3RBSA 1TVHB 1AGFB 2AK1L 2IBZX 2NT1A 4L8CA 1EAPA 3U1PA 2K9UA 4NM4H 1HHHB 3V7AG 5C1MB 5C07E 2ZOKA 4ALAH 4Z0XB 1NJ9A 5LGJB 4E68A 1CXEA 2P48B 4H2AA 2BHUA 5EOTA 2IPKB 4Z7OF 1T03L 3BN9C 1IC4H 1XGUB 4DK3A 4E9QA 2VC2B 3Q5TA 4WGVB 3HIZA 4QRTB 1E8WA 3NCYS 3WXVH 3WL9A 2OMUB 2EAEA 1L9PA 4ZFOL 3G6JB 5BNXD 2FJHA 1GY1A 1RIUH 2NY3D 4GB9A 4BDVB 5HYEA 1HXMB 4ZS6C 1MFEL 3GSOB 1V10A 2P3YA 3CFDB 1PG7X 5DVNA 4KK6C 4RGMB 4X9IA 1A64A 1KYOK 3FONA 4YE4L 3K8MA 4P99A 4JRXB 1B6UA 3WNJA 4H2CA 4HIJB 4EI0A 1HK6A 1Z5YD 1EDHA 3RPIA 3SPHA 2V17L 1F2QA 5J0BA 4ELKB 2IMMA 1MH5B 3N44B 4DKFH 5HGBB 3D4YA 3ZDWA 4N0CC 4NHUB 4LOEA 3BH8A 5I2IA 2VIRA 1AD9A 1RUKL 4X0KB 1GHFL 3L95B 1BQUA 2VMEA 4S1SL 3AT0A 1IRAY 4TM9A 4GNKB 3GMLA 3CBJB 1H8NA 3HW7A 1JV2A 1P7KB 4J3OC 1UXWA 3JV6B 3VSTA 3QXAB 4I1NB 5EU5A 5CO1A 4HXAH 1DDHA 3O6LH 4QIRA 4G9FD 4AIXA 2BNUA 5I6XC 2C9VA 4FFYA 4BXVA 3ZL4H 3L5XL 3AREB 4MS8C 2QTEA 3CN2A 2WY3B 2FHBA 1EGJH 3ARGD 4U31A 1TZIB 2C34A 4KTEH 4WZ9A 2CDFB 2VYRE 1HQRB 4FNLL 4L3CA 1E9PA 2OMTB 3AMLA 2E27L 5HI5C 4JJOA 5D7LA 3V0JA 3C6LD 4N2HA 3NVQA 5AVXB 1GZHA 1OSZA 3MLPA 4IDJL 3RURA 5JYMA 2BSBA 4JRFA 3ECVA 3R1GL 5EZOH 2JELH 3RIAK 5IV2B 2A6IA 1CPUA 4DETA 3KPSB 1IC7H 1U42A 3SKJL 2PYFB 2PUQT 2BNRE 1M1XA 3BAIA 3ESNA 3GB7A 4BZ2H 4DIXA 1FE8H 3K80A 4NRXA 5C71A 3EDKA 4AVIA 1IM3B 5EU4A 3ELAT 2VLLB 1HHJA 1R3HB 2OV0A 3HCVB 4MJ4A 5A40E 5I16B 5K69A 1EVTC 4ETQA 5KVDH 2EIDA 2X6BA 5HGDA 1YCSA 3WE6A 4FQXD 4WWNA 4JPIA 4YO0A 5F88B 3GMMB 4HWEH 3BX7C 3BUTA 3L13A 4MB1A 1I3RB 5A1AA 3WXWH 4KJPD 1RPQA 5EU7E 1NANI 1ASOA 1Z9SA 2LFGA 4POUB 4UT6A 1BVZA 4XCFH 5D2LF 2C1PB 1MI5A 1PLCA 1J5IA 3BAYA 3CN3A 4GAGL 2VXSH 4M6OH 5DJDB 4AM0B 4PGEA 2QPSA 5EIQA 3TN0B 3WFBH 4IGBD 1U8PB 4X7TA 1R3IL 1VFAB 4OUOA 4JY4B 1K72A 2BJMH 1BJ1H 1CFQA 5EZLB 4Z3JA 4P4KC 2WXHA 2A0LD 4FZ8L 4LL4A 5C08A 1A8JH 1NCIA 1NBZB 1Q0XH 2ADJA 2WK2A 3LKPB 3NZHH 4UT7H 3B2UC 5FUOH 4CSTA 3KMDA 1ZE3C 2H9GB 1CYXA 1FFPA 4U1IA 4DGYL 4EVNB 4RQQB 4ZMPA 4JFQB 5GRVK 1BBJA 2ZOTA 3PWVB 3PE9A 1KFAL 2XKUA 4I9WE 4LIQE 3EFDH 4K5NA 4BSVB 1FV1B 1I7TB 5KBNC 3T0EA 3V0IA 2ICEB 4L8CB 5AOMA 4F8OA 3UIZA 3BAEL 5LCVL 5JTWA 2WIMA 1AO7B 4NZFA 3WTXA 2CK0H 4YX2L 1J8HD 2QDVA 2ZOKB 5C7XL 1NJ9B 3G08B 3UIYA 3L3KB 5GS3A 3ZIMA 2G5BB 3KH3A 1PZUB 5KSAA 4N86A 4JQIH 4ZO9A 3L16A 4N1HB 3VD0A 1V7NH 3WL9B 3S88L 3HG1E 4NQEA 1D6EB 4GUCA 2A77H 3RAJL 5JLZA 4G8GA 1NCOA 2N7AA 3QC6X 1LEIA 3ES6A 2JB5H 4CVWA 5IREA 4LOFA 5J06A 1X44A 2F5BL 4IW4C 2PCPB 3V79C 1WIOA 3FONB 3QDGB 4TXVB 3VUAA 3D85A 4HPYH 2ETWA 3LRLA 4NNYA 4BK5A 1K4CA 1XXFC 2YQBA 3C8HA 4JFWA 3EBIA 2WWMD 2NW3A 2O6PA 1ZHBA 4G7QB 1QFUH 3RA7L 3HG4A 3KLHC 4YIQA 3OHXA 1FZJA 2VN5A 4W4NA 1NLDH 4IBWA 3MBXL 3BH8B 3LRSB 2VIRB 4P46D 4XXWA 3MBWA 1ZDQA 2XJLA 5H35A 1DN2A 3NOIA 3K2UL 3D52A 4G7SB 5BRZB 1OW0A 4C56D 5IK3A 3ET9F 3SGEH 4HT1L 4DN4H 3LD8C 5EU5B 1P1ZB 3OD3A 5C09E 4AVJA 3G7TA 3KEHA 3HN3A 2WB1A 1WCBA 1YEGH 3D33A 2VL4A 2WLYA 1XBDA 4TOYL 3S9DB 4HMCA 1TKWA 3WV0A 1OPOA 5K1VA 3W9DA 1TLMA 1E30A 3H3PL 2KZ1B 4PJXA 5IVXF 1G43A 4EDWL 2YKLH 1HYSD 3W37A 4O9HH 4PJ7E 4HEPG 2H8PA 1JTPA 5K9QI 2BNQB 4MDRA 5GJSH 4YDKL 5DHMC 3GJEA 1T0NA 3WD5L 5DD0H 1EBPA 4EKJA 1T20A 4UB0H 3P9MA 1WCQA 4AW4A 4B41A 1CZ8L 3KM2A 4UV4H 2B3RA 3N1FC 3G9VA 4G8EB 4JPKL 1ACXA 4FI7A 2IAMC 2XA8H 5JOFA 1QI4A 2F19H 3GHBH 3ROLB 2ESVD 1VEOA 4X8CA 2MKWA 3AW5A 3MJ6A 1CLOL 1V3MA 1M1XB 3GB7B 2XTJB 4JHWL 4AIZB 1NCWL 4NRXB 5TD4A 1VZHA 2X4NA 2ZP9A 5LAPA 1QYGH 3Q3GB 3FO1A 4ODTL 4OGYH 4H40A 3NK3A 3C6EA 4NLAA 3ME0A 5HGDB 3RWDA 1U8NA 3FPXA 4LCUA 4LEBA 3SPVA 3TT1L 3DV6A 3OJ2C 3WE6B 8FABA 1IL1A 2J56A 3HMXH 2F1BA 5BRQA 3LSOB 4RWYH 1ZCRA 2GI0A 4H8WL 4HCRA 1DN0A 3WJMB 3EFFA 4D3CL 4BIKA 3I2CH 1D6VL 2AJZB 4R9HA 4LNRA 2AKRB 1XAKA 3QPXH 4Z5RA 5DA0B 1RUML 4K94H 3QZPA 2HCZX 4LDOB 2CJUL 3RVUC 1AFVH 5EWIH 4GKOA 4RH4A 4OH2A 2GBAA 4TVPL 4MHHI 2JH2A 4PI2A 5IOKA 2ID5A 4I3SH 4Q7DA 5J9PA 1NFDE 1QSZA 4PG2A 2B0SH 2NX5E 4GRWE 5FCUH 5F7AA 2ADJB 3KYKL 4XO4A 1GGTA 3KCWA 5HPOA 3H42L 1KZQA 1MCEA 1KTJA 3K1KC 4CW1A 4S0HA 1GC1L 1N18A 3MX0B 3U36A 2XWJA 3KPMA 1OQXA 4CC0A 1XB8A 4QO1A 5T5NG 1BBJB 2ROYA 5DZOA 1S7QB 3B4NA 5CGMA 4QKTA 1MFAL 4AWJC 4WHTB 3EADA 4BE5A 3ZDZB 3GO1L 1KGIA 4XO5A 2YS4A 3TO4D 1E5CA 1Y1DA 2OX5A 1FAIH 3L17A 4I18A 4ODSL 4ZTEA 1BPLB 2X4RB 5E23A 1OE3A 3Q5OA 1OT2A 4DN3L 4PRBB 1IEAA 3A4DA 4NO3A 4PSPA 3QIWD 4FQCH 2EDLA 4Z7NE 3EYSH 2BO0A 2IPTL 3OAUL 4OVVA 1MN4A 4NQEB 1U93A 5JLZB 2COVD 3KLDA 2F53E 4UWQB 2ZWKA 1LEIB 3VI3F 3ES6B 4FQPA 3RQ3A 1DFBL 3GHPA 3PYCA 2IDUA 3VG9B 4MAYD 2OPCA 4AX3A 3IB4A 1XF3A 4AT6A 4IRJC 1WVZA 2DQEL 3QQNA 1CGVA 3PHOB 5C6TH 1HOCA 1OHQA 2W1NA 5D1QD 4QXTA 3PLYA 1OB0A 3GTTA 3NRFA 4CDHA 4NNYB 3N04A 1AGDA 3ISRA 4AQAB 2D31A 4XVUD 2K8MA 1MAML 2QKSA 4DGIH 1SOQA 4XNXH 1ZHBB 3GJFH 1S9VB 4O2FA 5C0NC 2VL5A 1FZJB 4U6TA 2JTYA 4HPOH 4LSVH 3WHXB 5AAWC 5CEYA 3NCYP 3GS0A 4TPRL 5H35B 3FTGA 1OTTC 5AAMC 3VD3A 3RTLA 1AQKH 4TVUA 5EUOF 4ZMWA 5B39A 3FT3B 2GHWB 1DVFA 2J5LC 2HKFH 4LCCC 3O6FD 5E4EB 2WP3O 3B9KD 5CILL 3RB7A 4UILH 4JDZB 2X0VA 5DD5H 4YHKH 3KR3H 2O26U 4OW6A 3UO1H 2EKJA 4HLEA 3ENEA 4MJHA 3EIFA 4PJXB 1Y7VA 5G4NA 3AT8A 5D72H 1CFSA 3P77B 2XWRA 3NSDA 4V2CB 4IOSD 4TUOA 4W9IC 1A4JA 3M1CA 4IRSB 4MMZA 2V2WA 3RVTD 3BP5B 4MJ2A 4AC4A 1T0NB 2D0FA 5J1TC 1FQ9C 1FGNL 5D2LA 2WLLA 2MHAB 1GAFL 3P9MB 1PF3A 3IRZA 4PJIF 1HZKA 2XQ0A 2P26A 1GS7A 1DSWA 1J5DA 1MCRA 3SE8L 5CP7A 1XVSA 1I8MA 1D9KB 3NZ8B 4GXUN 4XO8A 5BW7C 5KVFL 2Q5BA 2PW1A 5EMYA 1FL6A 2MPVA 2UYLA 1T89C 1RLWA 3HRPA 3EJQA 4X83A 2Y24A 2KI6A 4NX0A 4BHUI 5CBAA 2H0FA 3OKDA 5SWZB 5G2NA 4IQHA 1E4XI 3PFQA 4ZMLA 2E56A 3F6JA 1SN2A 3WN5A 4DKEH 1MJ7L 3VGAB 3IJSB 3FO1B 1JN6A 5T3ZH 2BP8B 4TULH 5H37G 4AZ8A 1XGPA 2WXPA 3E6FB 4RDBA 2XV3A 3GUTA 2D7QA 3ME0B 4OV5B 3SPVB 1U8NB 4LCUB 2V0AA 3NEOA 2OZ4A 1BECA 1PX8A 4L3EA 5DZPA 8FABB 3H2WA 4OSUH 1SHXA 1FH5L 3DVNB 4QUOA 3BWZA 4NQCA 4KKCC 3HNSH 1ORSB 1U6AH 5DHXB 3L3GA 2GC4C 2VAAB 4P9ML 5D7KD 5IJKA 1TTCA 2P5WE 4A2EA 5FV1L 5L4MA 1U92B 2F5AH 4Z5RB 1S7UB 5HYSB 4XPTL 4UZSA 4Z7OB 3KL0A 5D7IE 2WTRA 1KPRB 3I75B 3W0WA 4KKZA 4PBXA 3BPNB 3TA3A 3KD4A 2ALWA 1OF0A 3JV0A 5H94A 3DUHA 5I1CL 4NN6C 3RX5A 3T8MA 2J6EL 1CGSL 3CZEA 3K6NA 2WMPB 3ZN6A 4NC0B 1ZSHA 1JYVA 2PR9A 2M83A 3KPMB 1ZHKB 2J6EA 2VB5A 3FQTA 5FPIA 1MY7A 1JAEA 2IAAC 4JG1H 3J8F7 1A22B 2FX8L 3DGDA 1ADQH 3EO1B 1FAKT 1AZZC 1CFMA 2Z31D 1MHPH 4W68A 3L3OB 4PJDB 5CJOL 1XSIA 5DZNA 4DZBB 5JR1H 1AZBA 1KJ2H 3QZWG 2W94A 4QXUH 3WGVB 3TZVA 4NO3B 1ZD6A 2R0WL 1DVQA 1M42A 2SODB 3OG6B 2NZ9C 4YHOH 5KSVB 3E0GA 1DQKA 1JJUA 1JGLH 2X2UA 2FIKB 2VN6A 3IFNH 5CR1A 2R29H 1UXLA 3JTTA 3SQBA 3U0PB 3NAAL 2HUEA 2KLRA 4B9GA 5IHHA 1A47A 2I27N 2R56H 4RAUA 3BSZH 4AXWA 4FJZA 3DTDA 3D4ZA 1EK3A 1G6RH 5DHDA 2M8XA 1VERA 1HE7A 3QPQD 5IVXA 1HOCB 2VUKA 1XF2B 2IGFH 5AZEL 4MD4A 2BWDA 1B0GB 1B0WA 1NCDL 3MLSL 5DGQA 4WNSA 3VXMD 5CLYA 4Z7QF 5AOJA 4JKPH 1NSNH 1V7MH 2P80A 3FUHA 1FORH 3L7EB 3NH7H 4NZ8A 1BD2A 1ROCA 3V52H 5JPNA 4UF7C 1L0QA 3MLYH 3DK0A 4G6KH 1F2XK 4DK6A 3LKOA 5HI4C 5DJ0B 1KYUA 4GKSA 4G72B 2ZG2A 1GGBL 4RAVA 1MDTA 2ICEC 2YD8A 5ESQB 3C6SA 1P84K 4BM7A 1YC7A 3OXSA 2FBOJ 5DHVH 4AMKH 4FNRA 4L0PB 1UB5A 3IT8D 4WRLA 3RU8L 1RZIA 4Q9QH 4EI5B 5I0WA 4NM4L 5EU6E 4FP8H 3VVWA 4BQBA 4HKJB 1D7FA 3LV3A 1X9QA 5F96H 1I1RA 3SEPA 4ALAL 2B14A 1UVQA 4AK2A 4MJJA 3FN0H 3SOBH 5ISZA 5FUCC 4MNQE 3O3UN 1IC4L 1CFSB 5CHNA 5E9DB 3KWWA 2MQCA 3WXVL 5AAPA 1I1AB 1XGTA 3R0NA 1U2HA 5EOCH 4MMZB 5JDJA 1IAKB 1SHMA 1RIUL 2P45B 4OFYD 2H4EA 4BUGA 2WLLB 5KG9A 5FKAB 1PU0A 4WWID 4XGZA 4F5CE 4GKNB 4Z0BH 3CHQA 4R6UA 4N5UA 4OCLC 1DEEA 1FL6B 4MA1B 1QI3A 2IIJA 4KKLC 3KHOA 3N0PB 2VLKE 3ZSTA 3GI8H 4UOQA 3DMMA 3EKCA 5CBAB 5GXBB 1A7RH 1IGFH 2W9DH 3GPEA 1XX9C 3OKDB 5DJAB 2J25A 4UM9D 3OQRA 1W8EA 3NTCH 3WN5B 4L18A 2ENPA 2VJ8A 3Q6FA 3CPLA 4DKFL 4H7VA 4ZYKA 4AZ8B 3HR6A 2Y1VA 5HVWA 1L9NA 1Z7JA 4FNUA 1H5BA 1MFCH 4OZHA 5IMLA 3HZVA 5CGYC 1TU2B 3VD2A 4GQZA 3SJVA 4QWWC 2HRLA 5I23A 1ZDSA 1SDDA 4NQCB 4ANWA 4N0FB 4HXAL 1Y18A 4QI3A 3L3GB 2VO8A 3O6LL 1OTUC 2PWGA 4UT9A 1AJ7H 3CVBA 3F6IA 4DK5A 2Q8AH 3CX5J 3OG4B 4QGYA 3ZL4L 3N1QC 4GW4A 4LLYB 1GZHC 1EGJL 4KRPB 2LGNA 5HDQH 3BZ4B 3TA3B 5LLIC 1N6UA 3V6ZA 2ZUYA 4KTEL 3DO7A 4U1MA 2LOEA 2NUPA 5E00A 4CN4A 3DROA 3W9EA 1J05B 2EACA 4IIQB 1EGJA 4PREB 3E9UA 3CN0A 2XTJC 4AYFB 3BE1H 1YAIA 5FM8A 5EZOL 2PPDA 1BW8A 3VRIB 3T1FB 2G5UA 3H9SE 2JELL 1MHCA 4IK6A 1MLCA 1SZNA 1VGEH 1LXMA 1YEDA 3GC3A 1IC7L 3BO8A 3TV3H 1I1YA 3TNMB 4BZ2L 1CDCA 1KB5B 1FE8L 5GRUL 2V33A 3VFGH 3UZVB 1AE6H 1B4LA 5IB3A 3MA7A 4U3SA 1XR8A 4NOFA 3TZVB 2WHVA 5KVDL 1JZIA 4OJYA 5BVJA 3LQZB 4FADA 3EOTH 4L0YA 3FO2B 4BUHA 4HWEL 4NPYA 1IGMH 4KXDA 1UJ3B 1N0LA 2P5ED 3O3BA 5EUOA 1UC6A 2W5PA 4NIYE 3RDTD 3Q6GH 4P5RA 3WXWL 5JHDA 3EJPA 5HYFA 3X14B 1U21A 3JT2A 3NJXA 1VZGA 4XCFL 4AXWB 3E2HC 4UCFA 5I1IH 4XPHH 2OMNA 2BS71 5IVXB 1IJ9A 2VXSL 4M6OL 4U1NB 4PRIA 3LPOA 3WFBL 1NGXA 2KS0A 5BOPA 4M5SA 1L9SA 1UWXK 2BJML 4WUUB 1NUFA 1OTSD 2BVOA 3DRTB 1IQDA 3EJZC 4G7YH 1C08A 4LFHG 3TBVB 1WWAX 4FHKA 4G3YH 5JPNB 5F7BA 3GMQB 1Q0XL 2BVPA 2WZ0A 3LKOB 3NZHL 3Q13A 2BSRB 4XZUA 1MRFH 2OXHA 4NIKB 2BSSA 2MSPA 4PJIA 4UT7L 5FUOL 4XVTH 1HL8A 5EZJA 4N2IA 4RAVB 2GKIA 3LPPA 3T0EC 5D93B 3T3MF 4JNXA 3C6SB 2W95A 3QEQE 4BWTA 4BFNA 2K7QA 4W9HC 5AB0A 2DKSA 3LX9A 4MNGB 3EFDL 3BMVA 3OXSB 3LQAH 5KSAC 5DRNB 4WU5A 2JI2A 4OLYH 4XB8A 5D1ZI 1J9SA 4YHPA 2G60H 5C6WH 5C6PB 5ETUB 1G1CA 3M45A 3CMOH 2CK0L 1HILA 3LV3B 2EXYD 3C2SA 3T2PA 1PZ5A 1QRND 5E6RB 1UVQB 1PKQA 3Q43A 3C5ZB 4HXBH 1RXLA 2ARJB 5ISZB 1AHWB 4JQIL 1AG0A 4XNZC 2HX8A 2L0DA 3A47A 2ZJSH 1FVCA 1V7NL 1XGTB 3UTZB 4HD5A 4K3JH 4OJCA 1U8JB 32C2A 2A77L 3NSJA 4G80A 4XR8C 5J12C 5LGHH 3SE9H 4WFFE 1GMEA 2LU4A 4JQIA 4MYWB 4BK5C 1MIEH 2JB5L 5FUCE 3VI4E 4OFKA 4MLSA 4XGZB 5HGAB 3HAEB 3NEEA 7CGTA 4GINA 1YC8A 3RVWD 3V9EA 1OGAA 1TJGH 2GUOB 5DZAA 3V0VB 2OP4H 1W72B 25C8H 4HPYL 5EDSA 3OHXC 1LDSA 1EBAA 4XXWC 3FQ4A 5FWRA 3BN3B 1KJ3H 3RWJA 3H55A 4MD5B 4KTGA 3ULSA 5DFAA 1OW0C 1INQB 2BY2A 3CPLB 5CP3H 4HIPA 3O41B 1QFUL 4JY6B 3QBTB 1NLDL 2RMNA 4OZHB 1A4AA 4U1HA 4WJ5A 5IMLB 4G8IA 1F90H 4CN1A 3EOBA 1D5ZA 3V95A 4IBLT 4RGNE 2EVJA 1XQ4A 2EIMB 3Q8CA 4M3JA 1WFNA 3BYTA 4DN4L 1I31A 2BCKB 3WU1A 1YEGL 4XNQB 2WZPD 2VH5H 1RSYA 3O0LA 1AR2A 2PP9A 1DBBH 1U8HA 5F7LB 3QR2A 4LK4A 1TZ8A 4BV1A 2AJVH 2DM4A 3OLEA 2YKLL 2R1XB 3ZE0B 2CJTA 4GG8B 3U7WH 4O9HL 3GXUB 1UATA 2V2XA 3V6ZB 3EOYG 5KVMC 4Z7WB 5GJSL 4UNIA 1D9KC 5FW8A 3LZNA 1YN7B 3A23A 3W9EB 1PS3A 2ED6A 1HWWA 5DD0L 4L4VA 5D7LE 4UB0L 2DV6A 4J4PD 3CFKA 4UV4L 5HXMA 4M56A 4ZMQA 2P4AB 1NDMB 2X09A 3MCKA 2XA8L 4GQ9H 1OB1B 1MHCB 2BCMA 2F19L 1F18A 1MLCB 3GHBL 3GIVA 5C07D 2A99A 2F54E 2HT4C 3BO8B 3UH8A 4GG6B 1Z6JT 2FWOA 2R39A 3ULVC 1QBLH 3FCUB 1RZQA 4EE2A 1KXQA 1QYGL 3NIFE 3KCPA 5IB3B 3N2JA 4OGYL 2O5YH 3MA7B 4U3SB 1XR8B 2NPLX 2D7NA 1O6SB 2PWFA 3EOAA 3HE7D 3KL3A 5FK9B 1YN6A 1DVTA 5BVJB 3D6GA 1NGZA 2CCVA 3FOMB 3FPYA 3QUXA 5K9QG 4MXVF 3G5WA 3N41B 2ZSVA 3LYRA 3R7RA 1Q1PA 3HMXL 3O3BB 4H8WC 3S5ZA 2AEPH 2XN9A 4RWYL 5IOPA 3N1PC 5JHDB 1UA6H 1G1KA 3O6MH 3I2CL 4CSSA 4GP4B 2DLFH 3HMXA 5LNEA 1OAZH 1MI5E 1XZ0A 3NG5A 3S3CB 4EBQH 3QPXL 2WWKT 3NYKA 4PG2C 1IILE 4K94L 3SGJA 4DW2H 4L1LA 4D2NA 3RJDA 1NGXB 1JK9A 1WDAA 5D7HA 1WUNT 1AFVL 3NRPA 5F9WB 5EWIL 2RACA 4PJ6A 2B39A 3L4VA 1IQDB 4BGLA 4HJIA 2EE9A 3QXWA 1BIIA 3IF1B 3ZYOA 2G9HA 1EIBA 3MA9H 3N55A 4I3SL 5ID1A 3BQUA 2B0SL 5FCUL 3KGUA 2X4QA 5C08E 1G9NH 2BVPB 3CIAA 4XZUB 2DQCH 1B4TA 4PJIB 1GC1C 3U82B 5C3IA 4X5RA 3MV7A 1OXYA 1MJ8H 4MAUH 2IADA 5IW3A 1FG2A 2ZUSA 4I18C 3JWDH 4AW7A 3NCBB 5KYXB 5EO1A 3M17B 4KNSA 4QY8B 3ZK0A 1MFVA 2FAUA 5LXVA 3S34H 4WU5B 4ZNEA 3COOA 1U91B 1FAIL 3N0AA 4F7MA 3T0EE 4UV7H 5D1XA 1KPUA 3QJFA 4AYSA 2FH6A 2VERA 3S3SA 2X70A 2WYIA 1KXHA 1RZFH 1QQDB 1F3DH 1PZ5B 4OCYH 1PKQB 2DRUA 3FZUC 3DHMA 2BIPA 3PWUB 4FQCL 3QJQB 3EYSL 3KPLB 2YGPA 1FO0A 4HEME 4HH9A 4R2GD 1HEZA 3WNPA 4A2MA 3D39A 1QTSA 2H6OA 3ZTNH 3FT1A 3KHQA 4MHHG 1HEJC 2GG1A 1H19A 1YSOA 4KROC 4YK4C 1JNLH 2J1WA 1E6JH 3ARWA 4G80B 2PXYB 1GCFA 4JHZA 2A9MH 2JI1A 4H1LG 4LLUA 4G8GE 5JZ7D 2L7JA 4TSBH 3BVWA 1T22A 4MMXA 4QHKI 3BAXA 2V3DA 4KK8C 2ZKWA 4ZT1A 4L8DB 5C6TL 1OGAB 3I74A 5C97A 1UD4A 2FHFA 2CK2A 1TQTA 3VWKA 2AK4A 4KBPA 2WXFA 4HDIB 1WEJH 1CCZA 1IE4A 2VMJA 4ODXA 4Y2DD 4G7RB 2CR6A 4R8WH 2ZUWA 3RWJB 2CXGA 4N9OB 4BFGA 4DGIL 3CFBA 4XNXL 4NGHH 4A2GA 2A6KA 3V4VH 3G5ZB 3DGCR 2JKTM 1DVFC 2QPFA 5FC9A 1JI1A 2EEXA 3GSRB 2R7EB 4HPOL 4LSVL 3OMNB 4LKCB 3ASNB 1E28A 3EOBB 3BSGA 3O8XD 4A7UA 4ZUTB 3FUDA 1DLHA 2Q0ZX 3DOHA 4Y5VA 4CU7A 1AQKL 4NUPA 1CG9A 2HKFL 1I53A 4R0LA 3ZQXA 2VDRH 2DEXX 4UILL 3E8VA 4I1RA 4YHKL 1ZVNA 5DD5L 3KR3L 4MMZC 3UO1L 4A7TA 4OCXH 4ZK8A 3UYPA 5FLVA 1A0QH 3EDDA 1JGIA 4PJXE 2MCAA 3FB5B 5F93C 4RNRA 5D72L 2NY4D 3CZGA 4FS0A 4OQTH 4XN9A 4KU1A 4HLZG 5D4JA 4X6FA 1ZY9A 4P5SA 5E6SB 3FSOA 3GRGA 5DFVD 4BFOA 4MA1C 1JZEA 5K5YA 2HP4A 4L4VB 2YPVH 4I9WD 2P7TB 4DT2A 5B8CA 1MQKH 4Y9CA 5F1KC 3IAGC 4WFHE 1W6WA 2NNRA 5J3HD 4N0RA 2G3MA 3AQZA 3WN5C 5E2VH 1E3ZA 1Q94A 2EVIA 1AD0B 3MRGA 3GIVB 4KI5D 1IV8A 1AIFA 1WIPA 1TZHA 3ABMB 2FWOB 4IBYA 5ABDE 4DKEL 4F8PA 5IEKA 2E8YA 1EERB 2X4PA 2FEEL 5T1LA 5I75B 4XMPH 3HG1D 5T3ZL 4TULL 3ILPA 5LO7A 3D2UD 1DUYA 4DVBB 1NGZB 3QUXB 1RHHA 4DJMA 5IJKC 2X6MA 3ULVE 3BN9D 1VRSA 3QE5A 4OSUL 3RIAF 5EU3B 1EA9C 2XN9B 4U1JA 5FYJU 4N8PA 4LL9A 1CT8A 5CGBA 1MNNA 3HNSL 1U6AL 4KJWC 4KRPC 2WQRA 5I76A 1VPOH 3TA3C 4IKLA 5EEXA 2FT6A 4ZS6D 4Y4KB 1XZ0B 4MMYA 2F5AL 2XXMB 4I7ZC 4KK6D 3CE1A 4L8SA 2AGJH 3PJNA 4ZFQA 3D69B 4MA3A 1JK9B 2LW3A 4XMUA 1I4FA 5CINH 5DJYA 3EDFA 1BXVA 4HS6A 5AVQB 5I1HH 2G9HB 2H47C 1K85A 5F6HI 4EJ1C 3N1MC 2Z6FA 4TN9A 1OT4A 2YXFA 2WCPA 3QUMA 4WW1A 2GJ6A 2A9AA 3GGWA 4N90E 4X5PA 5JPMB 3MV7B 5C09D 3RTQB 2NLJA 3F83A 4N0CD 4TVPE 5ACLA 1FG2B 4JG1L 5AKTA 1HWHB 1NGWA 3TZVC 3X2QB 1ADQL 4QNPF 5BJTA 1RIHH 4J3OD 3DNKA 1MHPL 3ROOA 3SKNA 5JR1L 3ZE2B 1KPUB 5F0JB 4DGUA 3GLEA 2E9JA 5IVNA 2HB0A 2X2HA 1BLNA 3DSNB 4FQLH 4FTDA 4H0LC 5CSZA 1KJ2L 2XZZA 3AG3B 5DZJA 4QXUL 1U2YA 2V9UA 3GXDA 5KJ7E 2CPCA 4MS8D 4FFWC 1FO0B 1HEZB 4E9VA 1X5IA 4YDIH 4YHOL 1MRCH 2AQSA 4YSCA 3HVDA 1PGRB 1JGLL 2OYKA 2B15A 3IFNL 4I8DA 4PJAF 4Q0XH 2R29L 3SQRA 1I1FA 15C8H 5HI5D 2FJGA 1B90A 2R56L 4P2QB 3BSZL 4D8OA 4MMXB 5DI8A 2A6DB 1TPXB 2CGYA 4Q52A 1YQ2A 1G6RL 3TBTB 1M3IA 4AGOA 3F7PC 3MVSA 1CD1A 2G0LA 2OTWA 1VGKA 3V9FA 5A7EA 5JPNC 4MNHA 3VWKB 2IGFL 2AK4B 2BZCA 3BSZA 1JERA 3KYMA 5CSGA 4ODXB 3STBA 3MMEB 3V9CA 5D93C 2YD6A 3KPTA 4JKPL 3EJUA 1NSNL 1V7ML 1C8PA 3V52L 1FORL 3NH7L 4ZMAT 2ZOWA 2BSDA 1UWYA 3FCBA 3MLYL 4G6KL 4HZ1A 1IZKA 2DLHA 5HDLA 2VT0A 3S97C 1AQHA 1WZKA 2A6KB 2ZX8A 4K3HA 2FGZA 1QSVA 4Z3TA 4K7FB 1BZ7A 3NP3A 3WEXB 4E9TA 4PBDA 4L9LB 5CU9A 2XY2A 1DLHB 1F97A 3RDJA 5M94B 1A7BA 4X4XA 4AMKL 5I0XA 4HSCX 1CG9B 3NABH 4NT6A 4XXCA 1ZPUA 4J2QA 4Q9QL 4JO4H 4JREB 1VESA 3IXTA 3I9IA 4KZ0A 4FP8L 3T77A 4PJFF 1PZSA 5F96L 5DHVA 3EYVA 2NX5D 2Z9TA 3FN0L 3SOBL 5JW5A 1F4HA 4P5MA 2WN2A 1KTDA 5KSUA 5EOCL 2C9XA 4P4KD 2NZIA 3QXVA 4RFOH 2PYEE 1T0MB 1I82A 1H8SA 4JM4H 4LSSH 4OCWH 4U0RB 5B8CB 1HIMH 1PLAA 3DMMC 3QCVH 3L4YA 2JK5B 3P4NA 3GBDA 4UTBH 5D2LE 3B2UD 1UH2A 5LBSH 4QLWA 2ZCKH 1PZ2A 1R1CA 4Z0BL 1DQTA 3QA3B 1CE6A 3MFGB 1Q94B 1PSKH 3MRGB 2NZ1A 5C0EB 1SF5A 3GI8L 1H5BC 4OAWB 4OF3A 1KGJA 2W9DL 1A7RL 1JVKA 1IGFL 4IIZA 4X50A 5ENWA 3OC5A 4CGUB 5KVFE 1RERA 3FTYA 3NTCL 1KTCA 2LTQC 3VRJA 3DX8B 4WQOA 4YLBA 1WFIA 2F53D 3GXIA 4X4YA 1MFCL 1HXYA 4WGWB 3WLBB 1TIUA 2FUQA 4L3EE 2NW2A 4JKWA 4U1JB 2WLZA 1CT8B 2IANA 4NQCE 1COBA 4RMRA 2L3BA 3S2AA 3F01A 3KPNA 2I26N 3EO0A 4EEEA 3B7YA 3F7VA 3DPDA 1AJ7L 3PDOA 1J10A 4GUQA 4MMYB 2Q8AL 1HE8A 1KBGH 3MLZH 3MRPA 2OJEA 4L8SB 2E6QA 2V5SA 3L1FA 3QEGH 3MR9A 4TNWK 1A4BA 4C83A 1WITA 1NAKH 4I0KA 4P2OA 5HDQL 3IXAB 3W0WE 1U95B 5B7EA 2NSMA 4O51B 4HS6B 4PCYA 2WWNA 5KVEH 4JJ5A 2YAMA 4X6EA 2PO6B 5B1KA 5GGSY 3VFWA 4P2RB 2NLJB 3BE1L 1CF8H 3AS0A 3KLHD 5EHFA 5F7UA 1IBDA 2G75A 2WSKA 4HETA 1WQVT 5IKCB 1QR1A 3M7OA 4PQXA 4OUUA 2OR7A 1VGEL 4HUKB 3S37H 3TV3L 3SODB 5BJTB 4W81A 4C54A 3P3UA 3RWHB 2JVUA 3DJTA 1BVLB 4IBTA 2APVA 3GD1C 3MODH 4YBQC 3VFGL 3ARPA 1AE6L 1UGNA 2GTWA 1NAMB 3ZHLA 5IJBC 1V05A 1E0OB 3EOTL 1ZVSA 1MIMH 4JPSA 1AGBA 1OAXH 5GS0H 1IGML 4MB4A 5DWUH 4WGKA 2ZAIA 1P4LA 3Q6GL 2ZICA 3Q8EA 3AVEA 1I1FB 2NY1B 1TOXA 1H6EA 3QUGA 2FJGB 4IU3A 4NRYB 5DI8B 4Z78B 1OM9A 3SBWA 1JWSB 2VDLH 3VXUE 5I1IL 4XPHL 1MNUH 4XZ4A 3O4LB 5F0LB 5G4OA 5LDUA 2OTWB 2AFNA 4PRHB 2IAMD 1FHNA 3B56A 2B3IA 5FA4A 5E56A 4P57A 5MI0B 4QR7A 4NNXA 1X5KA 2W0PA 4G7YL 1EQWA 1A1MA 2MQGA 4G3YL 1TCRA 1BD2E 1OSYA 1BFSA 3OR6A 1HJBC 1MRFL 3RIKA 1F5WA 4H5SB 4XVTL 2W91A 4I87A 5T1KA 4TS6A 3H7LA 4X7FC 3L7FA 2P5WD 5E4IA 3GPSA 2VXTH 1H3VA 4X9YA 5G5DA 3MFFA 4JFEA 1ZGLB 3FN3A 4F9LA 3LQAL 1M71A 1UT1A 4OLYL 4GQQA 4NT6B 1LWJA 5F89B 5I8KH 2YAFA 2G60L 3MLWH 2WP3T 5KVGH 2AC0A 1R3JA 3CMOL 4EZMA 3U25A 4HXBL 5ESVB 5I1KH 3IE4A 3IS1X 4MQXC 4P5MB 3SCMB 3SE3A 3RVUD 1J88A 1KTDB 2ZJSL 1PLBA 3CLEH 3HBPA 3EG9B 2VXUH 1JPSH 3D7PA 4K3JL 4Y4FA 1NPJA 1EHLH 4LGPB 2I7SA 3SE9L 5HHVH 1SPDA 5LGHL 3SDXB 5JOPE 3EZ8A 1KBBA 2WLIB 1MIEL 3P4NB 4Z3GA 4HLJA 2VDPB 2FJUB 4OFQA 3GLDA 1CE6B 1TJGL 2CIIA 1EUTA 5MEPA 2H0EA 2OP4L 3EDEA 1OM3H 25C8L 2ADIB 2WLMA 3FO9A 2QPDB 4U6YA 5MEOA 2BIHA 1P4IH 1K2DB 5D7JA 2UZPA 1BQSA 1KJ3L 2O30A 5BUAA 4PGJA 1T7YA 3CSYB 1CVSC 4FQ1H 5E2JA 3TGXA 2FSEA 3VH8B 1X5HA 2KUTA 2LFEA 1UWXH 5I1JH 3M1BA 3EH4B 1HXYB 1DHKA 2ADGA 1ZSDA 4FULA 1OD9A 1QNZH 2JJUA 2CBQA 3GZKA 1QPPA 1F90L 2GJZB 4AYMC 3BW9A 5E5UB 3SJVE 3T4AA 3X1GA 2NW2B 1XXDC 4M7ZB 4PU2A 3TVMA 2NYKA 4H0IA 3KPNB 3FQRB 4M03A 5GRVL 5I5IA 3PABA 5AD0B 2WLNA 3MUUA 2VH5L 8PAZA 5LB1A 3D25A 3PGDA 3MRPB 1DBBL 5EZPA 2B1HH 2OJEB 3ECWA 4IRJD 2AJVL 4OI7A 1AXSB 3MR9B 5KAQG 1N5AA 4MFHA 2K4WA 3U7WL 4ZFGH 2Y7QB 5GSVA 2MOGA 3SYPA 5EOCJ 2WBXA 1HCVA 2F7OA 4U2ZA 4MASA 1JWMA 4K7PH 4LP8A 2ZPKH 1WFJA 4EPSA 4PJAA 3R8QA 3MRIA 3NJMA 3DTXA 3DX2A 4TUJA 1K4DA 5FB8B 1ZTXE 3FSVA 3VI3E 3SB3A 5C08D 1S9YA 1QR4A 5C0ND 3O0RH 4E9YA 1HKLH 2G75B 4GQ9L 4A7QA 5EU6D 4LLVA 3HMWH 1PNDA 1OTTD 2VNCA 4A7GA 3OGOE 2WNKA 3LEXB 5FHAH 5DTFA 1G0YR 3QUXC 4HW6A 3IJHA 2ZXGA 1ZLSH 3S2CA 1U8IA 1QBLL 2QHLA 1M3JA 3CFCH 2O5YL 1CXHA 1RZKC 5HJBA 3QQ4B 1KBVA 1VHPA 5FF6A 1AGBB 4V1DA 2QQQA 1BZ9B 4JFFE 1DR9A 4OZFB 1MPAH 1RUQH 2XETA 2AEPL 1P4LB 4ZUUA 5EUOE 4LPCA 3SGJC 4IJTA 1NWPA 5KVDE 1UA6L 4WI8A 3VYPA 3CDGA 3O6ML 4FNSA 2VLKD 4P3DB 4IU3B 5E8OB 5IB5B 2DLFL 3T04D 1TDQA 3VFSB 4PJFA 1OAZL 3LHAA 4ORGA 4EBQL 4K94C 3BQUC 4FTVE 4PRAA 3WGUB 3X3GH 4KZDH 1A65A 3WDJA 2IWEA 4KMQA 3ATDA 4PRIE 3QWOA 4OIBA 4NAQA 4L0ZA 4DW2L 3RFZA 2N0KA 5FA4B 1BOGA 2F8IA 1PQZA 5E2UH 3QDJB 3MA9L 1A1MB 1IEBA 2VW7A 3EUDA 3UPCA 3J07A 4M00A 1G9NL 3PWJA 4P59H 2DQCL 2HN7A 2DLIA 1QLFA 5LVEA 3Q2WA 1MJ8L 4MAUL 4P2CG 3JWDL 5D1XC 3UG4A 1OCOB 2R23A 4LPWA 1DJXA 2BSCA 3DHUA 2UY7A 2VLJA 3ECQA 3MFFB 4QYOA 4JFEB 5I1LA 1NMCB 3K6IA 1DVXA 2YUVA 1M71B 3NK4A 3S34L 4KKCD 1KYOJ 1HL4A 4UV7L 4AENA 2XLLA 4NHCH 1R3JB 3JV4B 2XY1A 1HEHC 1RZFL 4OCYL 5FAAA 4X9GA 4NZDA 3SQOH 2G2NA 3QJZA 4M93C 4MMXC 1B2YA 2R2CA 3CSTA 3ZTNL 5CZRA 3R06B 4HIIA 4UINH 3U48A 4YDZA 3TBYA 3C87A 1JNLL 4YH6A 1E6JL 3H9SD 4XBGA 4HHWA 3VWKC 2A9ML 1FCCA 5E1HB 1FSKB 2H32B 4TSBL 5EIIA 3KPSD 4PW4A 1UFUA 3QW9A 4PRPB 3IFPA 4WHYG 2F7QA 4XP1H 5AALA 1OLZA 3O11A 4B9YA 3T0XA 1OGAE 2CIIB 1I8KA 1WEJL 3FO9B 1RPKA 4U6YB 2OMBA 3GBMH 3L2LA 4R8WL 3GEWB 5D7JB 5LBGA 1PX4A 2AVGA 2ICWB 4N2DA 2FSEB 4Y5VC 4NGHL 2QV2A 4FERA 1CLVA 3V4VL 4D9QE 3QYNA 1GXEA 2XV0A 1UKSA 2HVKA 4LPUA 5F3HA 3GFUA 3M1BB 1TJXA 3APDA 4NXKA 5B1JA 1ZSDB 2N1KA 4I3RH 4JREC 4R0LC 2VR5A 4E5XB 5FA3A 3BW9B 4KXZI 4PP2A 3T4AB 3WENA 3Q05A 1VFBB 1A3QA 2NZ9D 4IMLA 1QSEB 2YJLA 3CCHA 5HI3C 1HINH 1A1NA 3KPRB 4NKMA 1Q9OA 1JK8A 2YQ3A 2VDRL 1L9RA 1U58A 5HJ3A 2QSCH 3GM8A 4QRPA 3VNYA 3SPGA 3D25B 4OCXL 2FEDC 1A0QL 1MJJB 1UZ8A 1N5AB 3OKOB 5B8CC 5CN2A 4URKA 4OQTL 4X6CF 4L37A 4Y7MA 3QEQD 2FECI 3MRIB 5CEXB 4TUJB 1K4DB 3HG0A 2YPVL 4L4VE 3KWTA 1MQKL 1V55B 5HI4D 1E4HA 1IGTB 2YD3A 3LB6C 3M7FB 1R24A 4PW3A 2ZCLH 3QJHA 1LK3H 2A9CA 4CN6A 2Y22A 5ERWA 5E2VL 5FR3A 3W39A 5INDB 3ZLQC 5ICYA 2C3GA 4LLVB 4ANXA 4W9FC 4GLRH 2YPKA 4RRPG 5CF3A 4Z7QE 2UZXA 2YAPA 1EAJA 1KTLA 2VRAA 1U8IB 2E8ZA 4U1LB 1S4IA 4ERSH 4XMPL 5DRXA 4TQEH 4WFFD 4PIBA 5TDNB 2KYIA 5FF6B 3RL1A 4V1DB 3SKOA 1WBYA 3SBQA 3POCA 2CA3A 4L8SC 4HIHA 4PJHA 3WIFA 2XJKA 2C9SA 1A7OH 5IQ9B 1VFUA 3OF6A 3CDGB 3VXNB 4DKAA 1VPOL 5CD5C 1QUPA 3CIQA 4DPBX 4ORGB 1E9OA 2AABH 3ARFB 3TH4T 2AGJL 4YEFA 4KJYA 3QWOB 2HLAA 1X5GA 3MROA 4HS3B 1BOGB 3KLKA 4KKLD 4QAMB 1PQZB 2CLRB 5CINL 2BFGA 5ADPH 2WBJA 3U30B 4XMKH 1G7LA 4WDIB 3MRCA 4PJBB 5I1HL 3FRPA 1BG9A 3IGKA 1IEBB 2Z92A 3BPCA 5HVHB 3W5MA 2X4SB 2AQ2A 2VDNB 3BGFB 3WOVA 3KLAA 3PPEA 3G5XA 2J21A 5CGYD 1A7QH 2HFEA 4B3EA 4R97B 4ELMF 3TONA 1B9KA 4QWWD 3IJ8A 4XAWH 1RIHL 3ARQA 2WV3A 4ZNEE 2R15A 3KBEA 4XP4H 1OTUD 5D1XE 4HJGB 4LVHB 3C75A 4AENB 1F58H 1M7DB 4FQLL 3QXDA 3LXBA 3QISA 1E5BA 4HBCH 2ZNWA 2XVKA 5D7LD 2OM5A 3GRWH 1JXDA 2Y72A 1FYTB 2DLTA 3D39E 4TL5A 4YDIL 5GGSA 4M8UA 3UTSE 1MRCL 5J6GB 1FVDA 3UCRA 2NSQA 4Q0XL 2F74A 2BP3A 15C8L 2I25N 5KS9F 5EIIB 3VO0A 5C2BH 5MI0C 2OK0H 4RCAA 1KTBA 2R0KH 4LT7A 3GZQA 3VSUA 2DWYA 4AJWA 4BH7A 4GSDH 2XTJD 3W81A 4M29A 3QR1A 3BP7B 4XN8A 5AW8B 2XIBA 2NY5H 4CVZB 3TJHC 1I8KB 1CDUA 2CALA 4XCNB 4Y5YA 4WHDA 5IESH 5TDOA 2MCPH 1ZT1B 5I6KA 3N6YA 1WWCA 4MS6A 2IDQA 5F3HB 2HVKB 4XXCC 3CSBA 4X6DA 4LDCA 2V4LA 2APFA 3DDFA 3WTWA 2GTQA 4PTTA 5I18H 3KH4A 5D2NB 1MI5D 1JOIA 1C12A 1T7ZA 5B38B 1S9XA 4OZGB 4PTUB 4XE0A 3CCHB 1IBHA 3NABL 3UG5A 3WI9A 4JO4L 5HJ3B 4JGUA 1U58B 3QHFH 1F3DJ 1AR1C 1SOXA 2ZOLB 1MKFA 4IKNA 3V0GA 2EVHA 4Y2OA 3WFDH 2X5PA 3HAEG 1VZIA 4XOBA 2ZCHH 4LHQB 1O6TA 1UZ8B 1OARH 3CZKA 3P4LA 4XWOC 2VZ1A 1PVHA 4NQTA 1MCFA 4PIRF 4ODUB 3OB8A 1NEUA 3FUEA 3QFJA 5FDWA 1MW0A 5LGYA 3EJZD 3WYRA 4DF9A 5HJGA 4RFOL 5CZVH 2YWYA 4JM4L 1VF5C 4LSSL 4OCWL 1HIML 4UTBL 3QCVL 1J8KA 5LBSL 2H3KA 3Q44A 5L2KA 1JZGA 2YD1A 2ZCKL 3RZCA 3ZXAC 3QJHB 3T0ED 2XVLA 3J7HA 1M6UA 3BJLA 1QVOA 2JCCF 2WJ7A 3FOLA 3M46A 4IU2B 3DIFA 4X8GA 1PSKL 1YJDH 2PP7A 4WWOA 3U7AA 3VNZA 4UTBA 4AJYV 4UM8A 5LBSA 2FNWA 3I84A 4ORZC 3MUGA 4FD0A 3U4EA 2UZXB 1URZA 4GW1A 1KTLB 5KSAD 1A4CA 1A8ZA 4AGLA 3DETC 1A6PA 1ET8A 4ZFZA 1I7ZA 2C8NA 4NQED 4XVJH 2AV7A 3IDGB 4RZCA 4G8GD 3PV7A 3L9BA 5F3FA 3T3ME 5A2LH 3GI9H 3QPKA 1SUJA 3RL1B 3RIFK 3WFCH 4I4WA 2VR8A 4F7EA 3SDCB 3SKOB 1WBYB 1LO2H 3HNTH 5AVTB 5IF0A 5T3ZE 1OP5K 3TO4A 4QRSA 3WIFB 4PJHB 3CXHK 1C5BH 4ESKA 4MCNA 1YEEH 4JG9A 3W11C 2Q2EB 4P2OC 3D85D 1PMYA 2FNBA 4DPAX 5JIMA 5BRPA 5D96B 2KDGA 1E9OB 1KBGL 3MLZL 1P7HL 3EO9H