1Z9PA

X-ray structure of a cu-zn superoxide dismutase from haemophilus ducreyi
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
155
structure length
155
Chain Sequence
EKIVVPVQQLDPQNGNKDVGTVEITESAYGLVFTPKLHDLAHGLHGFHIHEKPSCEPKEKDGKLVAGLGAGGHWDPKQTQKHGYPWSDDAHMGDLPALFVMHDGSATTPVLAPRLKKLAEVKGHSLMIHAGGDNHSDHPAPLGGGGPRMACGVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of heme binding in the Cu,Zn superoxide dismutase from Haemophilus ducreyi.
pubmed doi rcsb
source organism Haemophilus ducreyi
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 38
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1z9pA00
2XJLA 2APSA 1IBHA 1EJ8A 1SXCA 1OEZW 3S0PA 1IBBA 3GZQA 1YAIA 1FUNA 4BCZA 1HL5A 3KH3A 1OAJA 2JLPA 2LU5A 3QQDA 2C9SA 2NNXA 3F7KA 3QQDB 1BA9A 2VR7A 1COBA 3CE1A 3ECWA 3MKGA 1JK9B 2VR8A 2E47A 2Q2LA 1SXNA 2C9UA 3ECVA 1E9QA 4A7TA 1F1DA 1XSOA 2GBTA 2JCWA 3GTVA 4FF9A 1L3NA 1E9OA 3GQFA 3GTTA 3HFFA 2AQSA 2Z7ZA 1PU0A 2AEOA 3HOGA 1AZVA 1XTLA 4L05A 1YSOA 2WZ6A 1N18A 2WYZA 1SDYA 2E46A 5KBMA 2ZKYA 2ZKXA 1CBJA 1PZSA 4B3EA 4U4IA 3K91A 4OJAA 2R27A 4A7QA 2K4WA 2AF2A 1YAZA 2XJKA 1CB4A 1DO5A 1U3NA 2Z7UA 4BD4A 1IBFA 1BZOA 2ZOWA 4BCYA 4OH2A 2Z7WA 3GZPA 1SPDA 3H2PA 1JCVA 3RE0A 3SODB 1SOSA 2VR6A 4A7VA 1MFMA 1IB5A 2WKOA 1TO5A 2AQPA 4A7GA 2ZKWA 3ECUA 1F1GA 3F7LA 3MNDA 1IBDA 1UXMA 2AQTA 3L9EA 1F18A 1ESOA 1SXZA 1OZTG 2GBUA 3LTVA 1KMGA 1E9OB 5KBLA 1QUPA 1SRDA 3GZOA 1Z9NA 2C9VA 2WWNA 2WZ5A 1E9QB 1N19A 1OZUA 2AQNA 2WZ0A 4N3TA 1PTZA 2Z7YA 1E9PA 1SXBA 1SXSA 5CU9A 1P1VA 3CQQA 4N3UA 1B4TA 3KH4A 3T5WA 4MCMA 1E9PB 4A7SA 2SODB 2AQRA 1F1AA 1SXAA 1HL4A 1OALA 4A7GF 2AQQA 3KM1A 1DSWA 1Q0EA 1UXLA 2GBVA 4MCNA 3H2QA 3HW7A 3PU7A 3KM2A 4A7UA 1SDAB 1TO4A 3KBEA 2WKOF 3KBFA 1RK7A 1S4IA 1EQWA 2WYTA 1JK9A 2WWOA 5KBKA 2V0AA 1B4LA 1Z9PA 3CQPA 1XTMA 3L9YA
chains in the Genus database with same CATH superfamily
3U48A 2XN9A 1LO5B 5IESH 1E5BA 5D72H 3DA0A 1GOHA 4UQ2B 1MJ7H 5KW9L 1XF5A 2A77H 2PPFA 5I1JH 1RHFA 3JYBA 3O2DL 5JDSA 3U0WL 3N91A 4BCZA 3WJMB 3FYIB 4UNTA 3VE0B 1I8IB 2DQFB 1BQKA 3SCMA 3SGDH 4NO3A 3V0VA 3V0VB 2CKBL 3IMVA 3GXMA 3IU3A 2DQUL 3EOBA 4MHHG 2DQ6A 5EEZA 3L95B 4LIQH 4GB9A 2BMKA 5LQBH 4LFHG 1MWAL 2PO6B 3I75A 1WAPA 3CLFH 5BPPA 3QG6A 4JCMA 3ULUC 1HL9A 4IM8A 3UBXG 2Z7ZA 1ZT4A 1AJ7L 5I30H 5AOMA 2WLKA 1RZ7H 3LVEA 3MZGB 2YD2A 5D7JC 2V5MA 1XR9A 2FAUA 1U8CA 3JWDL 4ZFZA 2MRYA 1I8MB 2IOOA 4BKTC 1HJBC 4QIRA 4I88A 1YEEH 1QLEL 1MUJA 1Z0MA 4JZOB 4JFFB 2VQ4A 2K6WA 5CJQH 4DGYL 5GS2H 5EFIB 5T3ZD 4NUQA 5DYOB 2JKTM 3ULUH 4L8CA 4DW2L 3QGVA 5GSVA 4YHIA 4LMQI 1NCAH 4QNPF 1E65A 3GKZA 4KK6D 1HQRB 1WTLA 3SBQA 2OYLA 4XX1G 2WSPA 4R4ND 5DHEA 5A6LA 3V6BR 3W5MA 4JLRA 2WD0A 2HLFC 5IHUH 2PTTA 3JT0A 3WFDH 4IGBA 4ZTPH 3HG3A 4LOUD 4U1NB 3UACA 4ZD3L 2DM2A 4XCYB 3T3ME 1BVLA 1VADB 3GIZL 4R8WH 5KBDA 5LHDA 4XMWA 3DUSB 1D5RA 3BZEA 1NC4B 1D5BB 4NKMB 4AQEB 3TONA 3PAYA 1MVFA 4DP1X 3VFGL 3U6XA 1NPJA 1ZD6A 4OF3A 4C55A 4YFEA 1M6UA 1XMWA 2A74A 3FZUC 1BBDH 4JDZB 2YO3A 5SV4A 3RUGF 1UWXH 3CZFB 1SHSA 1U21A 4M6ML 3CCHB 2IANB 4R4BB 1DVSA 4JS7A 3BSZL 3DV6A 3P2BA 3QJQB 4DVBB 5AVYB 2F7PA 2BZDA 2E7LC 4X7TB 3N2JA 3U0TA 3PAVA 3CNKA 4JUTA 1ZHKA 1HHHB 3GPSA 4XI5C 5H8DA 5FYJL 4QDGA 3TH2T 1XSKA 2DWYA 1VJSA 3KS0J 3O0RL 2AANA 4UT6L 5AW3B 3SDAB 3VB8A 2PR9A 5D2NC 4EN2A 4EI5B 4UU9A 3T65A 4ZMNA 3NCEB 3O9WB 1MIEH 4MX7A 3N85H 4N6RA 1FAIL 4NC1C 3QHTC 2GAZA 4WWID 3QEHA 3ARFB 2NRDA 4P23D 2LU3A 2V9QA 3ULVH 3GBMH 4HWZB 4ZUWA 3MUGA 3PG2A 4MB4A 5DC0A 3LV3B 4KDTA 2C3HA 1ZLEA 2NW3A 4X8XA 2VXTL 3QQ3B 3AB0B 2C9UA 2P9RA 5I0YA 1XXDC 2QLVB 4DKDC 1S7XA 3GTVA 4NQEB 2FIKB 4Y5YB 1NBCA 1NIAA 3HMWL 2D3JA 4ZRGA 4F15C 2CDFB 2CXKA 1P5UB 1S5HB 5B3SB 4HXBL 2GSGB 4JPKH 3EDDA 3KPLB 1NMAL 1SYSA 3QNYB 2O6FA 1DEEA 4L3FA 4UCFA 4A2MA 4YLBA 2X9YA 2HTKD 5FUCC 3NN8B 2X4QA 2BSRA 2YD0A 3S97C 4OLXL 4DGIH 5IGXL 4OJAA 2VZTA 3RL2B 5LWYH 1PZDA 4MA7L 1UD3A 4XPHH 1VGEL 2OULB 5D5MF 3DETD 5CBAA 2DQIL 2WLIA 2HTLD 2YA1A 1T0NA 4PJDA 4QHLA 4IOIB 1XGTB 2CRMA 3KPNA 5E2JA 3QE5A 4BWUA 1SBSL 4GT7A 4Z18A 3ALXA 5JOPE 1NMCC 2FRGP 4TUUA 4X6CE 3DMMD 1CBVH 3LEVH 2W65A 2X1QA 2G2PA 4PG9B 2XBZA 4W9FC 1BAGA 1XCTB 3TBWB 2GSMB 2MHAB 3BO8A 1F3DH 1SOKA 1AGBA 5D70L 5D1XD 3BE1H 3QAQA 2BY1A 1JERA 2QZ5A 5EUOB 3KW8A 4X6DB 2QVIA 3HZVA 3QVAA 4HWBH 4HFUL 2ERJC 4EI6A 3G5ZA 5IM7A 2Y6SC 4WWKB 4LLVA 2ZPKH 3UH8A 2SODB 3DYOA 1IZJA 5M7QA 3HBGA 1GZQA 3IJ8A 3K74B 2A73A 4FYTA 4ZFGH 4BDVB 5H94A 4EF3A 4HUWB 1EBPA 1PSKL 4GG8A 3KYNB 3LYRA 2WQXA 3IM1A 1L9QA 3O6FD 2ADFH 1UM4H 4I4WB 4M93B 5DD1L 4BZ2A 1W9XA 3Q5OA 4XVOA 3CUPB 5E08L 3D1MC 1U4FA 3V5DB 1Z66A 4I4WA 1K2DB 2WQVA 4F33B 2WXPA 4PRIB 4BFKA 3UXFA 1V7MH 1KCWA 5AENA 4JK0D 1VPOL 3BPLB 2IAMC 2EUVA 1C9SA 1AOHA 2M8XA 3CZJA 4E5XG 3M8OH 3F7YA 2CA3A 1J12A 1JPEA 2JXMA 5D1ZB 4QI3A 4IRZL 4OZHA 1LO3L 3IJYA 4P5SA 3BUYB 4NZUH 3K6FA 1LDSA 4NENB 1VFBB 1T20B 1EBAA 1UWYA 1HOEA 4I1NB 4AQZA 1F3JA 4R9HA 5GHWL 1ZV9A 5AW6B 1N4XH 1WHOA 5IVXB 5CSZA 4A7TA 4L8BB 1A6VH 1CLCA 1MAKA 2Q2EB 5BO0D 4LAJH 1YY9C 2I85A 2YRBA 4NQDA 4L37A 4WI4A 5E95B 3ZBMA 4PGDA 1JPGA 3EBIA 5IB2A 5IMKA 3ARDD 1SHXA 3GKWL 3B9KD 1WC7A 5B38G 2RJMA 4QRRB 2A6DB 2EJ1A 3KPRE 5C3IA 4JKKA 2H0JA 5F8QC 4FRWA 2FT8A 4AYMC 3QDHA 1K8IA 2J6EH 4YE0A 3T4AA 2MIZA 1HHKA 1T7ZA 2J8UB 1EEZA 3K91A 5CBAB 3SD5A 2AHIA 4Z7UB 4QYAA 2X6AA 1LGVA 4KTEH 4G8GD 4DP6X 3FH7A 1OP3H 1OY3B 2BSRB 3TJHD 3O6FC 4Z0XB 4G43A 5D7LB 3FJTA 1BW8A 4J7RA 3FOMA 43CAA 1BXAA 2WKOA 2I5YH 1UWEL 5EO0B 3KPLA 4JM2C 3QUHA 4XOBA 3WNMA 2VXSL 2XZAH 3CLEL 5DTFA 4N2EA 2LU4A 5H35B 3BP4A 5KG9A 1ZE3C 5KYWB 3HE7B 4HYTB 4Q9RH 2RALA 3ZT6A 3F04A 4OQTH 1HHKB 3ILQD 1KGXA 2KZWA 4C4BA 4J8RA 3CGTA 4LSUH 1IC4L 1AR1D 2XTSA 1WC7B 1E9PB 4DTGL 4D0BB 3V5KB 4I48B 3GWJA 4OIIH 3MV01 2OCCB 3IMBA 5C0CD 2FO1A 5CKAA 3WXVL 1Z6JT 1UM6H 4MB3A 5JORA 2K45A 2X3BA 1B9KA 1X9RA 1LILA 1P2CA 2H6OA 2EYRA 2K7PA 4FI6A 4L37B 1KEML 1KTLB 4UOW1 1BFSA 1OQOA 3ZZLA 1CN4A 3WHXA 1QFHA 4NFBA 4QJ3B 1JNNH 1BZ9B 4FFZL 4RMUA 4PGBA 3VGFA 4HJJH 1P6WA 4UOJA 3VH8A 3EFOA 3G6AA 4PGZA 4NENA 3QCUH 2JTDA 4IRJB 4PUBH 1RZKH 4DVRH 2DQTH 2YARA 5KEZA 1BG9A 2H3NA 5HYSB 1VKXB 2DRUA 1YDPB 3WAJA 3FTXA 3UTQA 1XX9C 1I8LA 1G7IB 1CG9A 1LE5A 2MMXA 4U3SB 5AOKA 4JHAH 4M5YL 2MPAL 3WJJC 4KXDA 1P7QA 2E7MA 1OB0A 1RUQL 4TS6A 1FGNH 1KXQA 5CZXC 1H3UA 1K8DA 2CUAA 2DLFL 5GRWA 4BSVA 4L0YA 4JL2A 3L1OL 3N06B 3HHRB 5TH2B 4IGBD 2JI1A 1OCWL 1ZT1B 4LF3B 2W0FB 1H5BA 4HHGA 3VGBA 2CBPA 2QQKH 1A7NL 3E6FB 1UYWL 3TT1H 1U3ZA 3FUIA 1XV8A 3IAGC 5DD5H 1BEYL 4BCXA 5KSVA 3CPLA 4H8PA 4G6MH 5INCA 1W16A 5KWYC 3UL4A 5D5MA 3HG1D 4ADIA 4OD2B 5I1LA 4AIZA 3P0YL 2A4CA 5CILH 1RZJH 5JXAH 1HQRA 5DMKB 3FXIC 3MLSH 4N24A 3T4YA 5I8OH 1SVCP 1T04B 3LJ3A 4C56B 3WO4C 1F58H 1TQBB 1HH6A 3RWEA 4OUOA 4WFGE 4FNTA 1BVKA 4DK3A 4WFHD 3BFWA 3SCMD 2W65B 4LPUA 4U7SA 5I1IL 5ISZD 4HKBA 1I8MA 2D31B 4A6YA 3HG1B 3S36L 3JTBA 4TL5A 3U30C 1DBKL 2ZF8A 5DZVA 5E8EB 5LXGH 1AFVH 5E99H 4KJPD 1ZT4B 3IDMB 5F3FA 1QQDA 4DZ8B 4JO2H 3FW6A 3TV3H 2X4OA 2N1TE 1XF3A 3NTCL 3VB9A 2Y7LA 4H8UA 1TPXC 1T7VA 2ICWJ 3VWJC 3PNWB 4PBDA 4JREB 4EN3B 3GDCA 4R7LA 3NN8A 1F4AA 4A37A 3IU3B 2FB4H 2BDNL 3P9MB 2ZOTA 5HYJA 3WJMA 4LAQL 2OSLB 1IBYA 2VO8A 5EU4B 4D0CB 1OV8A 3SPIA 4MNQE 5FGCB 1NKOA 3W39A 2Q8BL 1FL6B 5BW7C 1IEAA 4PB9L 1ASQA 4W6XB 4Z7WF 1LK2B 1ZWIA 1PZ3A 1B3JA 2EEBA 2QSVA 3WGVB 3D69B 4OQTL 3V0WH 2DM3A 1J8HD 4R97B 3RA7H 4WO4C 43C9B 1NPNA 2VDRH 4IBSA 4QO1B 2VDOL 4TQEH 4AV5A 4FFWD 4L9LB 3BGAA 2Z4QA 4WHCA 1UZ8B 2ZX9A 1K5WA 1RZKC 4MX7B 3OJVC 3P9LB 3OKOA 5HJ3A 3QEGH 4ZMOA 2IFGA 4BRJA 5DD0H 1IGYA 3GMPA 1G7QB 2OMYB 4HZ1A 5E5MB 4XGZA 1EUTA 3WYRA 1CGVA 3GXPA 3N0PB 2XXFA 4HF5L 3ZTJG 3VW3L 1RZKL 1USQA 3GTNA 3VFPB 4RFOH 3VGDA 2Q76B 2Y6TE 1JTOA 2ZAGA 4G6AD 2R23B 3PABA 5GRXG 4RMTA 1QSVA 4CMHB 3GQFA 5HGGS 1E4WL 1JUFB 2Y5EA 5E8DH 4Z7NE 1MKFA 2R2HA 2AERT 1JPFB 3DXAE 3O45B 1DJWA 3SDCB 2CJUH 4IDJH 1N18A 2G5RA 1JJUA 4P2OC 4RGOH 1WFIA 1J9QA 2DIAA 2XHNA 5DHMC 3OLEA 5GPRA 3UPCA 3WAKA 4F27A 2DW5A 5FGBA 5MERB 3EJPA 3QZWA 5T5NG 4ECNA 2F19L 1LO2H 4FKKA 4TQPA 2G4EA 2XC8A 1QFWH 1QNIA 1S8DA 2WUCL 2OMUA 4BBWA 3MCKA 5A7EA 1UYWH 3MAWA 4NN7C 3TT1L 1YC8A 3LIZL 3C6SB 3PQYB 3POCA 1GVIA 3EHBB 1U0QA 2HRGA 4P23A 1B2WL 3I74A 3HUJF 3MA9H 3MDJA 2DQHL 3NJJA 4PRBA 1QPXA 5AZUA 2Y24A 3U1PA 1XO8A 3LMJL 2BSSB 3ZKXB 5IHUL 1KPUA 4FHKA 4MJ6B 3VG0L 2LVCA 5A2CA 2Q86B 4XAKD 1X9LA 3UYOD 5I1EH 1FPTL 1ZVSB 4XNZC 3IKKA 5I0WA 2NR6D 4ZUVA 2OL3A 4R8WL 4J2XA 2AJUH 3I50L 2TAAA 4Z7WB 4RX4D 3W56A 2AMUA 5GGRA 1PZCA 3U46A 1KXVC 4PJXB 1BQHG 1FDLH 1WAAA 5I17A 3L13A 4P5TD 4B96A 3MLRL 5E2TH 4ZFZB 5F71A 5BRZA 1TJIL 1RCYA 1Q0YL 3LS5L 4UQEA 2A6IB 5GGSB 4OLXH 1GS7A 2DLTA 4I9WE 1RIHL 1JWMB 1MAJA 1WFMA 1D6EB 2MH4A 3CXHK 3L2LA 4AXWA 4JVWA 3QG6B 2A9MH 5EU5B 3C5ZB 3HE6A 3SDXB 5IQMA 1EPFA 2CJ3A 2BVQA 2ZUQC 1ZVSA 3AREB 2Z31B 3PUCA 1KTKE 4U1LA 3WFHA 4MJ6A 3A6OA 5B1CA 2EYTA 3DMMA 4WEEA 4MQXD 2CQVA 3INUL 4L4TA 2BRQA 3G5YB 4LAQH 3MXVH 3TVMB 4M1GH 2UY6B 3CQPA 3C2AH 1NCNA 1ZPUA 4KI1A 3C60A 1QFUL 2GK0B 4HIQA 4AJYV 3EKCA 3ZDZF 1J1XL 4RIRA 4MA3B 1FVEA 1Q0XH 4NX0A 5EB9A 5JQIB 2W9LA 3E7JA 1FUNA 3O3EA 4PRAA 2K3TA 3Q1SL 2KKQA 1UOWA 3GHBL 3QQDA 5FGRA 5C9JA 3FU3A 3FT4A 5JR1L 4GP5B 2E47A 4NQCB 3QFJE 1VLXA 2HN7A 2V2WA 5LNEA 2GUOA 1XEUA 1JUFA 2GVYA 1BDYA 4UM9B 2DQJH 4WEMB 4YHKH 2VB5A 4Z3GA 1UZ6E 3U2IA 5I1GH 4F91B 2IC2A 3BZ4A 3CSYB 4YSCA 5ANMB 5IQ7L 3VFPA 3VDCA 4AYDC 4F1ZA 4IJ3C 4YFLI 3P11H 4DO5A 1AY1H 1NTDA 1LWJA 2IBBA 5KSBE 1Y6MR 2VXVL 3P3YA 1A4KB 1ZHLB 4LQFL 5G5DB 3V8OA 1JZJA 5E5MA 3KLLA 4FYRA 4L0ZA 1T22B 5F7HA 2NY5L 5FV2A 1FZKB 2WQWA 3PS6A 4RFOL 5J1TC 2K4WA 1HC1A 4DGUA 2QHRH 2E7HA 4ETQB 1PLGL 4F7TB 3VUAA 2P8PB 2H1PH 2R4RL 4F8TA 2V8MA 4DUVA 3O6MH 2NT0A 4DWHA 3CVHA 4G6JH 3ZE1F 2X4TB 2ZSWB 4YAQA 1J8KA 1GTFA 1P4IH 4X4ME 2WC7A 3QXAA 1EWHA 3F7VA 3WFZA 4QOKB 2PXYB 3QJHA 3GJFA 2NY1D 2E8YA 2V5TA 5HTSA 3HS0A 2L7EA 2UY7B 4DERA 2FCBA 1FNEB 3SDXF 3GIVA 4OGQC 3UO1L 2YUXA 3D2UB 1AG6A 2ICEB 5CIPA 2QQLH 4CBPA 3QORB 1M6OB 2PTUA 3N40P 3G04A 4D0CA 2VZ3A 1KSRA 5ERWA 5J11C 4N8CL 1OT1A 4GUPA 5ADPH 1MXGA 1RUPL 4KY1H 1T66D 4NN5C 4PGCB 2DB8A 1UB6A 1XAKA 4LDCA 3ULSA 3IGUA 3RDTB 5CHNA 1K4DB 5D6CA 2Z93B 3UFIA 4GG6F 1FVCB 3SDYL 1N7ML 3IDXL 1HDMA 4A38A 2EVJA 3DGCR 4N2NA 1A1MB 4HMEA 2P49B 5DLMH 1NLBL 1MI5E 3BQUC 5F0MB 5IROA 2CIIB 3VGGA 4I9WD 3BHBB 3I02A 3Q8AA 4UBDD 4UANA 5E8EA 5EBWA 4U33A 3BAJA 3ZZSA 2MQCA 4L2LA 1CDJA 4M8VA 1WCBB 2ZUXA 3HG1A 2BY3A 4JGJA 2FL5A 5C0ND 1KPVA 4F58L 4GMSL 2EDHA 3IU4L 2ITFA 4M93C 4Y1AE 4GAFB 5LUMA 2VDLH 2DKSA 5BVPL 5EORH 2WBWB 1HH6B 1WZKA 4XNZB 5GRJL 1FH2A 5ESVA 1MQKH 1KLUA 2AAVA 4JY6A 1DE4A 1GGYA 5IB3A 2DH3A 3WUWG 2CALA 3ZKNC 1J1OH 2BJML 1FYHB 4IGBC 5I26A 3UTZB 2ZUQB 4QJ5B 1GGCL 5E0QA 1NGZB 3WXWL 3Q6FA 3AM8C 3GJEA 3S3PA 4FG2A 1BFOA 4XAWL 5KSVB 4AGMA 2B2XH 4OCYL 4BH8B 3S2CA 1JVLA 1QSEE 2XUWA 2YD9A 3E6FA 4CU6A 3WTTA 1QMUA 5BV7C 1I1FB 2XG4A 1IM3D 2Z9TA 3VRLE 4OLWL 1M3IA 4DPRA 1UB5A 3WNOA 3O2WL 4TPRH 1IAKB 1TCRB 4MDIB 1JGLL 4WHTA 2P47B 1YMME 3LH8A 3LKOA 4PJGB 4AG4H 3B5HA 3MN8A 5KVEE 2YPLA 2ZWLT 3TIEA 4A6YH 2J8OA 1JMZA 3D39B 3F8UB 2Y5QA 2JVUA 4FQIH 5FKAA 1ZT7B 1LJMA 4L4VD 4K8RD 4OD1H 4FFZA 4M1CD 1DBAL 2J57A 4L3EB 4P06A 3IS0X 3OR6A 3I9GL 1O6SA 4M5YH 4L1DA 4FD0A 3B9VA 4Y9EA 1I9IH 3VH8B 3VFGH 3DHMA 1OSEA 4A7GA 3U4BL 2I9TB 2XN1A 1VFMA 3UBGA 4S1DD 1PS3A 2HG0A 3BH9A 5D2NA 4UM8B 3ZDZB 1UXMA 4I77L 2ZZUT 3DXAA 5CIPH 5C09D 1J88A 3FQ4A 2XDHA 3V4VA 5K39A 5JW5A 4I1PA 3TNMA 5D96B 4AV4A 1MVUB 3X3FH 4F7MB 5A3ID 1E2VA 5C0BE 2DJUA 3QUZC 1CDUA 5DUML 5K5YA 4A66A 4Q8BA 2G2RB 5EZLA 2NY7H 3TF4A 1BYPA 1P1VA 1XF4B 2OS7A 3R4DA 4NCC2 3CFJB 4WHTB 4XVJL 3CD4A 2F74A 5LVEA 4P2RA 4HAFA 1WA1X 5LJYH 2RA1A 4J4PC 5HHME 5HI5C 5HVFB 1WGOA 1P84K 1MCJA 2V5SA 2XIDA 4M7LT 5J3HC 5H35A 2Y72A 5EO9B 4GQ9L 4NKIL 5ISZA 1QP1A 4KMTL 1PYWB 5C0IB 1ZY9A 3HFMH 4Q6YA 4KJQC 4DN3L 4PV9B 1FFPA 5HDQH 2P45B 3I85A 2IDCA 3WMPA 3Q9QA 1KBGH 3WKPA 5EC1A 4EQ2A 3OLIA 5ADPL 4RAHA 5DJCA 5EOCJ 1CQYA 3UTSD 1N5AA 3TBBA 1RUAH 3RWDA 3TX4A 4E42B 1G6RH 1CR9L 3MRGB 3RHWK 4BFGA 3NRFA 4JM2D 3PIQA 3VXUD 2WVSA 3U7AA 2IG2L 4HUVB 3PHOA 4TQ8A 3NFNB 4FNSA 3P73B 1UZGA 2I60H 3ZQXA 1AHWA 1S7TB 5MEPA 5J6GA 1JD9A 1IC1A 1PZ5B 5E2VH 1MHHA 2QGDA 2ZOOA 4P2QA 3GM0A 1NOAA 5SV3A 4X9IA 5IMKB 1HESA 2AXFA 1LO0H 1ETZA 3IU4H 4NUGL 4WGKA 4ZW3A 4Z8FH 3LS4H 2X0WA 3U9PH 3QEQD 2E6QA 2J55A 4GKZA 3RJOA 1QI4A 3KL5A 1E3ZA 2XWZA 2Y5TA 2BIIA 4J3OH 1IC5L 1NUNB 2BINA 4KWUA 1KIUB 3WN5A 1DJGA 2VIRA 3CSTA 4L0PB 3UBFA 1I9JL 4DZBB 2WNKA 4PG2C 2FHCA 1R3HB 1NFDB 2IPUG 5HYJE 1BF8A 4UIKL 4XR8C 1UB6B 5AL8A 3FFCA 2IH1A 2A2QT 3QO1B 1OGTB 1HH9A 2W5PA 4Y0GA 3F7YB 3EJYD 1M6OA 3EFDH 1RQ5A 4YBQD 1FZMB 1UWXK 4BA0A 4F2ME 5EH1A 2J1YA 1U3NA 3ZE0E 5I1KH 3BUPA 1ZS8B 2R29H 3REWB 4Z5RA 5DC9B 3SQBA 2DBLL 4MAYC 3BDYH 2C3VB 2FUTA 5CJOL 3F7VB 4OZGA 1R5WA 1N10A 2YMTA 1IAOB 2NY0D 3W9DA 1BZDA 3VW3H 3FFDA 1WBZA 4FQCH 1TKWB 4JHWL 2Z8RA 1T66C 4BH7B 5FYLH 2ED7A 2YUVA 3CJJA 1DDHA 2LTQB 1PX3A 4NAQA 5D1XE 3C9NA 1SRDA 4HIEB 2YLKA 2SEBA 1SHMA 3K1DA 1YYMH 1UCBH 1JGIA 2G3MA 3QUXC 5IIEB 1JPSH 4OFYD 1XHHA 3EJYC 2H2SD 5AAMA 5IM7B 1MFDL 4B9FA 2AI0L 1AO7E 2EXSA 3H7LA 3HUJA 4LEXL 1I9RH 1K72A 3FQUB 1U8HA 3DARA 1IRAY 3HPLB 1XT5A 3CSYA 1FGVL 5DD3L 3OXSB 4WU5A 3QWOA 4LDOB 3BO8B 5BCAA 3MV7A 3MLWL 5EUOE 5J7CC 3N3EA 1HQ4B 4CRPA 1CF8H 1TQSA 3KWVA 3ZY7A 1P9MA 4TNWF 5EZIL 1QNZH 4YQXL 2YPVL 3GI9H 4Y19A 1I7ZB 5ADOL 3MGAA 3TGXA 1XH1A 2GTZB 1EIBA 2JTYA 5CR8A 2YLHA 1XAUA 2MQGA 1TVBA 4C4KO 4EUPH 5F3BB 6FABL 4LVNC 1GZHC 2OJ1A 2VXQA 1NBVH 4PJDB 4XAWH 4PI0A 4ZI8A 4ZXBC 3MRPB 4KK9C 3DJSA 5AVTB 2H6UA 4ZW6A 3INOA 3S37H 3L9BA 3GSRA 2R0LL 3FT0A 5DD0L 1GJIA 1KB9K 5IBUB 5E1AA 5DJ6A 4C83B 4IS6A 3BZFB 3LXUX 1C5DA 1DEEB 4XWOC 1G87A 2WAQA 1ORSA 2FEJA 3JYCA 3GXDA 3IJSA 3F12B 2DLGA 3FT3B 2ZUVA 1VRSA 2Z31A 4K3GA 5F6IC 3RTQC 1JXFA 3LN4B 3GTTA 5D7SH 1BM3H 1YNKL 4AQ8A 4G9FD 4HG4K 4ORGB 2WXLA 5D2LA 1JWMA 2YJQA 4PQXA 1F3DJ 4MKMA 2CAKA 1ZTXH 3L4TA 4E9RA 2MNUA 1L5GA 4LHUG 2UWEF 2H9GB 3EOTH 4TTDC 2VJ8A 1AD9B 4KQ4H 2K78A 1EZVY 3MJ8A 1XIWB 2E76C 4XO8A 1TVHA 2ZUTA 3SE3C 5A6MA 5BJTB 4JPWL 4KHXH 1MFUA 4PBVC 4IHBA 4P2OB 1MIML 2CKNA 1U8LA 1FORL 1BECA 1X4YA 4G6KH 4LVHB 5A3IC 1NDMB 3HC0B 4ZUVB 2A83B 1CLOH 1GHFH 3PP4H 4YK4C 2Q86A 3CXDH 2OTWB 1TG8A 4XNXH 4H2AA 2VR4A 2J72A 5J57B 3MBEA 1INDH 4X0KA 1KTCA 4JFXB 5AW8B 4N8VB 5EC2B 1F18A 4LVEA 4W9GC 4AIXA 4ZD3H 3QA3A 1EAQA 3I9AA 3S5LA 2UZYB 5CD3B 1TNMA 1FJ1A 3HNSH 3L4CA 3V5HB 3SKJH 1MCSA 5I1JL 3OKLB 3QG7H 1U8KB 2VLRD 4YDMA 5MERA 5FF6A 5JXED 4AV0A 1WZLA 1X5FA 1U2CA 4U1IB 5CN3A 4WSGA 3QCUL 5TJWK 2IFFL 2E9JA 1OT2A 3MV9D 1AP2A 1IQDB 3GSVA 4JZJC 4WTZA 5IFAL 4MD4B 5GGQL 2O5YL 4PRPD 4R7DA 5HHMD 5KVFL 4JZNA 4MVBD 3HW7A 1D5XA 4OJFL 4WVRA 4M5TA 3HHSB 3HG2A 1AJ7H 1V54B 3KL3A 3PY9A 4NM8L 4R7NB 4YXHL 2ED6A 5KYYA 1U8OB 4NPYB 4QHUA 4YDJA 3VI4F 1FO0B 2CU9A 4XTRC 3DKHA 1IQWH 3S34L 4G9FB 3U9PL 1U2YA 3W11D 5B38A 2XWBB 1IGJA 2APSA 1RULH 2WY3B 5DYOA 3DTUB 4GW4A 1ZTMA 5D1ZI 2PCFB 2FJHA 3NSYA 2Z4TA 3SKUD 3D18B 4JY4B 5C3TA 1EVTC 1NBZB 1JZGA 3GRWA 5IK3A 2A4EA 5J0BA 5DK3A 4QRPB 3JXAA 1T83A 5LKNA 2BOCA 4DP8X 3P77B 3ABMB 3HCVA 1G0XA 5DEGA 3GSNH 3IDNA 2DYPB 3VD9A 2NR6C 1EXHA 1F1DA 5INDA 4GKNA 1E5ZA 2OMWA 3EFDL 3FO2A 1EHLH 1UJ3B 1E9OA 1F11B 5FECA 2DWTA 1IBGL 4U6VL 3T6VA 3QUXA 2X0VA 4Z9KB 3WFCL 4ZS7L 1T5XA 4JKWA 2JMRA 4L29A 3ZT7A 4G1EA 5ICUA 2OSLA 3QWRA 4GRWE 1JYWA 3U4EA 1I8IA 2DQFA 2WLZA 1MCOH 5E8NB 5KVMC 3C6LA 3LHPL 5F7BA 1P7KB 4V11A 1FNHA 3PNWA 3EJTA 3GSNB 1RZPA 1U3HB 1YEGH 3WFBL 5LGJA 2O61A 2EH8H 5DO2D 1DBJH 3NFSL 3SSGA 1MEXH 4DUWA 1AGFA 3CFTA 3R06B 5I6OA 3P54A 4PN6A 3MRNA 3JTTA 5F7YC 3DYMA 1WIOA 1HE8A 4ZO6A 4DEPC 1CCZA 1KV7A 1YUHA 1HT6A 2H7WA 2OPCA 4OSUL 2MJWA 1BVNT 4N2AA 5E8PB 1CT8B 2NXZC 3KPPA 2VAAA 3MBWB 4JM2A 4O02B 2XTJB 5DD6A 2FUQA 3NA9H 3VXUE 4EVNB 1E6OH 2E86A 3MMEB 4C56A 5EZIH 3KAAA 5GGRY 3PP4L 3FUFA 4QLWA 4OVVA 2AZUA 4JN1L 4BSWA 4YX2H 3ZGIA 4RETB 2XV3A 5I6LA 4HKXB 2XQYG 4I2XE 3UZEA 3ROOB 5CAYB 5DJ0A 1CTMA 4FNPA 4ZX3A 1OW0A 3F62A 5F3HA 3S4SA 5IJKA 4XPBH 5C70A 4OB5H 3MV9E 3KNBA 4NN6C 2K9UA 3D87B 1LEGA 4JPKL 4PMEA 1DL7L 1F41A 1LD9A 4ELME 3MUZ1 1F4YL 4QCIA 5C09A 1ZAGA 1MCNA 2B1OA 2R15A 3CHOA 4XXCC 5CEXB 4JG9A 2YRPA 1IBHA 1TTRA 1T0OA 5T1DH 4WI8A 1LE5B 4JO2L 3HTLX 3ATDA 4F1SA 3WDHA 5C0CB 3S0PA 1AZCA 1IBBA 1MWAA 1LE9A 3FKUS 4XP6H 3WY4A 2C1PB 3NTCH 3TESA 2YQ2A 1E6JH 1T1WB 5AZ2L 2AGJL 2Z64C 3APFA 2JKRM 3GSOA 4LCIL 3WO3B 3HKFA 5EN3A 3VRJA 3BGMB 4LPYA 1OGAD 3ARPA 4ANVA 5GS1B 4MJ5B 5IFHH 4OFPA 3B43A 4HZLA 1OL0A 2FGWH 2YSTA 4XN4A 3TTYA 2J88L 3AY4A 3BXNB 1DYZA 3O4OC 5BVJA 4JM2B 1RURL 5JOEA 2X1OA 1A3RH 4KVCH 3L4VA 3E2HB 1TEYA 3R0NA 2M83A 2ZCHL 1G5AA 1GPOH 3M45A 4KMTH 3DX2A 1TFPA 3V0GA 1BD2E 1JGLH 1NCJA 3A22A 4D0BA 4J12A 3WMQA 4KXZH 2J3SA 3HMXH 3ILPA 5SWSE 5SWZE 3B6SB 4KVNH 3NABL 4M61B 1CBJA 4IIQB 4GXVH 4WZ9A 1X5AA 5DFWH 3N6YA 1NFDF 4Y2OA 4YK4B 1TZ8A 1UM5H 3DX9B 3GUFA 2A9CA 3BPNB 1A0QL 1JN6A 1P7KA 2FJFA 3QH3B 4HJEA 3B7UX 1LMIA 1CJYA 4JM4H 1OM3L 3B9KB 2AS5M 4N8UA 4NN7B 5E9NA 5EEYA 4PW9A 2FWUA 4G1EB 3KYKH 2YAHA 4YHOH 2I32A 3HI1A 5LNGA 4UOZA 7TAAA 3O11A 3N9GL 1HU8A 1UGNA 4PJCF 1F11A 3D51A 4J3SA 1NLDL 1JPST 3HC2A 3PQYE 3IF1B 2K3HA 5E0FA 1VA9A 3BUDA 2OCJA 5F1NA 2YC1B 3NCJH 2D7MA 3RRQA 1AE6L 3KE0A 4MNQD 3RX9A 5I5RA 3TEWA 1HX0A 5F89A 4M6AA 5TQ2H 1U8IA 4PHXA 3RIKA 4F8LA 1PNCA 4ES8A 5IK3B 1IGIH 1BBJA 2Q6WA 1MCCA 4KZDL 3RFZC 1CQKA 1XZWA 3ZE1B 3ZLQC 3UJJL 2P5WE 3QJXA 2F8VA 1QRNA 3PWPE 3E9TA 4I0KA 4N0UE 1ED3B 4LQ1A 2XBTA 3D4GA 5AZEH 5FDWA 3QIUB 2AK4E 2AV7A 2YGOA 5ITBH 5IVXA 1OOAA 4DCQA 4ZOCA 4OM1L 4XP4L 3N44F 1T20A 1TPXB 3P3TA 4NBXB 4ONGL 3KCPB 1OAKL 4OV5A 2XXMB 2FWOA 4OLZH 4F2MA 3CX5J 4Z3EA 4DO4A 3FO0L 3LPFA 3ZHFA 3UJTL 4YSTA 3F6JA 2EDTA 4JZJB 4OFYA 2X2JA 4OJYA 4N1EA 1K2DA 3PDGA 3BUIA 2YPKA 2XZCH 4MCYA 4QRUB 4W9EC 4NOBA 3B8YA 4L5FH 1A7PH 1GYCA 5AB9A 2V7NA 3QQ4A 3K6NA 4BHUA 1RZ8B 4PVMA 4UZUA 1AR1C 2WGXA 3FSAA 1A6UH 2EO1A 1BMWA 4TV3A 1CICC 4PJ5D 1OTUC 3MV7D 1NAMB 1OP4A 1A9VA 5KSAC 1JGUH 2WMPA 3RIFF 3JVGC 4XP5L 4BDVA 3FN0H 4Y19D 2J5LB 2VLRA 1OW0C 4KJWC 3KJ6L 2G9KA 2DMHA 2R9HC 4M48H 5KYUA 2N59A 3G5ZB 1NGXA 1NEPA 1OAYL 5KJ7E 4TTDD 3WGUB 3UAJA 4PMFA 5EUOA 4BZ1L 1HE7A 1E4KA 1NSNH 2ZCKL 3OD3A 3V6ZB 5JW4R 4PG9A 2X10A 4XN7A 2PW2A 5DJZB 3TYFA 5A16B 4KRMB 5FKPB 3VNZA 3D8MA 3V6OC 1N0LA 1G7PA 2N7SA 2A0LD 2Y4SA 2GB2A 5DI8A 3TA4D 5CFAA 3ARYA 4LCYA 4PR5A 3UTPD 3BKCL 3ABZA 4CN6A 1BLNA 2OJZL 1TTAA 4RZCA 4JHWH 2WHVA 1CI3M 2YMOA 3LPGA 4MNGA 3L48A 1N5YH 4WUKL 2X7LA 3ZHDA 4YHZL 4FQXA 4DKEL 5JHLL 3EO0B 4KOCA 1PJWA 4KPHH 2A77L 4OAWB 1G4MA 4EE2A 2AQNA 3NP4A 3OKYA 4J6RL 2OK0H 4ODSL 3ZU8A 4CVWA 3AG4B 3CLWA 4AW4A 4CMHC 1W72A 2CRYA 1C8PA 2FD6L 4QRPD 2DLIA 4HOXA 3E8VA 4QOKE 5I18H 2OZNA 3DSFH 1JP5A 5C8JA 4UTBL 3QK0A 3KLHC 4XPTH 1T4WA 4O5LH 1PZ2A 1S5HA 1C5CH 1P5UA 1FHNA 3IVKA 2ZUSA 1R4XA 3QQNA 4QRSA 5DZAA 1NM9A 5TGBB 3KHQA 3K72B 4G9DA 1S7XB 1NMCB 2QLYA 3J7HA 3ULAB 1JF1B 2YK1L 1INEH 3T09A 4MD0B 4IU3A 4W9ZA 2IGLA 4P4KC 3WY1A 1AYOA 1ZDSA 3QDGE 5I0ZA 1RJLB 4ODHL 3TN0B 4X4YA 2VXUL 4OLYL 3MODH 3L7FB 2HFGL 4XMVA 1G1KA 1YAIA 2VL4A 1BJ1J 3CMGA 1PDKA 1UOLA 3EO1A 2HFTA 2KPWA 1DZBA 4JPIB 1HHHA 1ZHKB 3TFBA 4GI6A 2ZKHL 4ORZC 1B4RA 5EU6D 4LNRB 5KYXA 3GMNA 3MV9A 2OMXA 4ANUA 2QGEA 4Q4IA 3K8KA 4PRPA 5HHQA 3GRWH 2FR4A 3FO0H 3MNZB 4H7VA 5DUPH 3KS0H 1A6ZB 2GCYA 2YD7A 3HFFA 3W38A 2CCLA 3AB0C 2VDMH 3OAZH 4NKOA 5DRNB 5DEJA 2YD8A 1WEJH 1BQRA 5IB4A 3SE4A 5IHWA 1U8PA 4LLWB 3KLQA 4BFBD 1CFTB 2DQCH 1JFQH 5FGBC 3RUGB 3WELA 3BPLC 5F7UA 1V3LA 4QRSB 1KELL 3REWA 5H4ZA 1GGBL 3OAWA 1RXLA 4TSCL 4HJIA 5CKGA 4NQUA 3A6BH 3IJHB 2IQAB 3TT3H 3RU8L 2EUWA 2R51A 3O6KH 3WUWA 5C71A 1P4UA 2Z7UA 2DEYX 1AS7A 3AT9A 3O3AB 3QNZB 5BMFH 2NY2C 1QEWB 5I8KL 4AWJC 4U1NA 3NCJL 3HZMB 1AIFB 4RAUB 1WSST 4N8VG 1J1OL 3L08A 3IE4A 1SBSH 3DECA 4HIXL 1UOVA 1JGVH 2D7OA 3WEAA 4FQXB 3SDDC 2GTQA 3WY3A 4P5MA 3BVTA 5GSVB 1OZTG 4NP4H 4Y4KB 1IGFH 2CD0A 1P53A 5K9JH 4N2BA 1MUJB 5ITBL 3NZSA 4UILL 1CD0A 4U1KB 1MPAL 3BKYH 3VXQA 2PW2B 1B4TA 1PZ5A 5B8CC 3II2A 4NNYB 2WNGA 2DLHA 3ZDZE 5GGTL 3QUMH 3M86A 1ZGLM 2AV1A 1IKNC 3ZO9A 2YEQA 5EF0A 3MLVL 5C0BB 2ITCB 4LKCA 4PJHA 1BMGA 3AABA 4MFHA 3L95A 3QPXH 1U36A 3AY2A 1KJ2H 4ZFOA 4DEWA 1OF0A 1TU2A 2XVLA 4Y7MA 2TRYA 4APQA 4AEIL 2CMRL 1C8QA 1PX8A 1A6UL 2DEWX 3X3GH 1ZHNB 4F9LA 1KCVH 2VRQA 4XBPA 4OBSA 4C56D 2V7NB 3QQ4B 1DQTA 2MTPA 3Q13A 3X3FL 1T6BX 2W92A 3DOIA 4UYPA 1A2YA 2F15A 2YPKB 4MCYB 1ZV5A 3R18A 4QRUA 1SLXA 4GH7B 5JHBA 2NUTB 5DEZA 2RFXB 3MYJA 3KPRB 2G2RA 1E8WA 4JQXA 1JZ4A 3KZ8A 5DK2A 3QJTB 1VFOA 4WKXA 4XRCA 3AU1B 1KCRL 2J8UE 1FL5B 1LO4L 1QLFA 3QUZB 5T3XL 4LOUC 5JW5B 3MXWH 4J3OC 2JIXA 2X40A 5ESAB 3BEVA 4Y1AA 1AMXA 1KTRL 3ZYOA 5EG6C 4L1HA 3LNIA 2NTFB 3QDMD 5HGBB 4P9HH 1AS8A 1KB5L 2G2NA 1OAXL 1MFCL 1MCHA 3FTVA 1Q0YH 4K2UH 2DL2A 4KHTL 3RZCB 2XTJC 2PP8A 4IU2A 4XPGL 3FT2B 3H55A 2H1LM 4G6FD 2MCAA 4R4NC 2DF3A 2XACC 1JWSB 3A23A 4XE5B 4JRXE 4FZ8H 4ZMYA 1FRGH 3QYCA 2ZOWA 2YPLB 2Z7WA 3V0FA 3IGFA 4ODSH 1U92A 4QLRA 2DY2A 2F68X 5FWQA 2X4RB 3VU2A 3UJIL 3T2OA 1EXGA 1BMZA 4PLJC 1F1GA 4HS6A 4OIAA 5IWLA 3O2DA 1OCRB 3H9HA 2VXSH 3CLEH 4H1LG 2V9TA 1DVFA 2CKBB 3RY5A 1BOGB 1U95B 5DO8A 4FTVA 3QFDB 5E4EC 5M95B 1NAMH 3AACA 5IEKA 2A7BA 1U58B 2Z7YA 1NCAL 4AT6A 2PCPB 1BYOA 4ODVL 2YPVH 4LSSL 4U1HA 1TF4A 2VE6B 3TO4C 2R1XA 2PYFB 4R6UA 1QW9A 1E3FA 4GXVL 4LEOA 4HAKA 3QUKA 4QNPE 3B7SA 1N7MH 3AAZA 3HE7D 3W3BA 5I1GL 5B39A 3GO1H 5DR5H 4U3HA 4E0RB 2D03H 2B9BA 3U7WL 2Q10A 1AXTH 2Z8WC 4UILH 4JE0A 2JKJA 1G6RA 1U8JA 5FUZH 4X8GA 1X4XA 2O26U 4G8FA 3Q8FA 2ZCZA 3UO8B 1VACB 4AGNA 4H20H 3S8GB 3ZTDC 5KS9B 4JFHE 2O5XH 1X9UA 2ISDA 3WS6C 2NDGA 1W6LA 1HXMA 1Q9WA 2H0EA 4RCAA 1NJ9A 2Z93A 4HUXB 1BGXL 2BNRB 4LVOB 4PGCA 4NUJA 4QRRD 2NY6C 3EJCA 3VXRD 2WPGA 2QVFB 4EKJA 2C1PA 4NHCH 2Q2LA 3SDDA 2UUDK 5ISZE 5SWSD 5SWZD 3G04B 4ZNCD 3MACH 1MHEA 2EDQA 3CDFA 3D2UA 5FO2A 3A6BL 4PJFA 4X6EA 5EPMB 4UNIA 2FO8A 2ZE0A 2I69A 1WWBX 4NQSB 4ZX5A 4FQXD 1ZK5A 1EMTH 4URTB 1LP9F 2F58L 3EJSA 4P3DA 2H32A 2Q3ZA 3G6JA 4E5XB 5DJDB 3MOBL 4EJ1C 1OP5H 1INQA 1NANI 3P0YH 4UWQB 2WWKT 4PH8A 2ZKXA 3VYNA 2XPYA 3IPFA 5C0NC 3POHA 6PAZA 3OR7B 4LL9A 3N1GC 4GUQA 4JNXA 4ZS6C 3S4SB 3DUUB 1OGSA 2JKIS 5FCUH 5HSFA 4HJ0D 3KXFD 3ZTNH 3W5NA 3JWNC 3N41F 4ZO7A 2YA2A 4PJBB 2W9EH 2CHWA 4MD5A 1F2XK 5I6MA 3OWRA 1RMFH 1T3FA 3K6SB 5IR1B 2ILLA 3GDBA 4L5FL 3L3IA 3US1A 5JOFB 3VA6A 1DANU 1UOKA 1DEDA 3VI3F 4M4RA 1E5YA 4IKKA 3MBWA 1HOCA 3VM7A 1RU9H 2DTML 5DJYA 3ZDXB 5GGSY 2EDYA 2GUOB 2DWSA 4NQXB 1DQDL 4FZ8L 2WQRA 4NQCA 4RISL 4O2FA 1NINA 3MREA 4JY5H 1TETH 2VRAA 3UG3A 5HYSG 1BHGA 3HB3C 3MRNB 3PP3H 4OZIE 1FVEB 2X28A 3BUQA 4P2OD 1X5XA 4UB0H 3SE4C 3CK0H 4Y16C 4Z7OB 2GABA 1ZA6B 3IXAA 3D08A 5BV7L 3ESUF 3PF2A 3X1NA 3F64A 5IMMA 3NJXA 4B6ZA 1QRKA 4OCSL 5IQNA 4PRHE 3FN3A 3WL9A 3DYPA 2LAGB 3MBXL 4ADGA 4YNYB 4P99A 3QUXB 4GO6B 2QSTA 5IMOA 2W60A 4WY7L 6TAAA 1UT1A 4HUXA 3D0AA 3VDBA 3UDWA 4I8DA 4NZ8A 5FM4A 5B3NA 3HNSL 1AQ8A 4RBPK 1FAKT 2HX8A 3BP6A 3FSVA 3PE9A 5I0XA 2J73A 3DX0A 1KY6A 1AC0A 1QSFB 1MCWM 2G5BB 2Y07H 2D0HA 4QRPA 4WTZG 4Y19E 3NCCB 5L2KD 1L9SA 1GGUA 1XQ4A 3BC9A 4G9FE 3NZHH 2PCFA 4AUJA 2X9ZA 1YUKB 3KGSA 3RL1A 2WLLB 1BYNA 1T1XB 1KJVB 1I4FB 2XWBA 3UADA 3WN5C 4DEPB 1QUNA 2NY1B 2DQIH 2FSDA 1PW3A 5HP5A 5DC4B 5HJGA 1I9JH 3UCQA 4K3DL 3C8DA 3U1SH 2ZOLB 1NL0L 1S7VB 3KJ6H 3L81A 3QDME 5EF1A 4WTWA 3QUMB 4JPVL 4U1HB 3CN0A 3CVHL 5CP7A 4U1MB 2VMEA 1D5XB 4UZSA 4I87A 4PCKA 3FK3A 1N64L 4RGNB 4IHOA 3U0PA 3E0GA 3LQMA 1BQSA 3L54A 1JE6A 4U7KA 2B59A 2AEPL 5JIMA 1T6WA 1SVZA 1NGYB 2G60L 3WIIH 1N0XH 3PWJB 1IJ9A 3NSJA 3WIHH 5F7LB 4HOZA 5D2NE 4LCUA 2WXNA 2F53A 1N2RA 4G8AC 3C2SA 5AW5B 3PCYA 2VUKA 1SUHA 5I24A 4JFDA 3ULVD 2W95A 4UV7H 5EA0H 4QHMA 4PRDB 1IGCL 1CR9H 2J44A 4P5TC 1UD4A 4R96A 3WNPA 4R5VA 4KFZC 3NJHA 3W82A 5DVKA 5FCUL 2Y1AA 1A7OH 1QZNA 3T0EE 2KZBA 1UM4L 3EBGA 4JO1H 1BWMA 3OMAB 4LVHC 3WNNA 4XP9L 4AM0A 3CHPA 1QO3B 2F53E 4Y5XB 5BO1H 4YO0B 1U8LB 2BIQA 4FFWC 2EDDA 1NC4D 3VYOA 1EJOH 3PWPA 4TRPL 3SEPA 2CR6A 1VDGA 1QBML 1XSJA 2VJXA 2XFGB 3KM1A 5DMIL 4BGLA 3FF8A 2XTJE 1FGVH 5DD3H 2ALWA 1IM9D 2PF6A 1BZ8A 4MA8H 4W9HC 4NRXB 5E5LA 3UABA 2B8OT 4RISH 1A65A 1Q9OB 3LPWA 3FCSA 4GRLB 4QXUH 4MRBA 1L5GB 3ROLB 3S98A 3TJPA 3VG9C 1E4XH 1CLZH 2E7LA 2LQRA 4U0QB 2EECA 3K0WA 2KL6A 2FX8L 4M6NH 5BS0E 3EYFA 4G72B 4AQAB 2OA9A 2B14A 1BXVA 2EE2A 2NY4C 1FFOA 4GQRA 2FT6A 3IXTB 4O9HL 4WGVB 5CZXD 2QADB 4TTGA 3IGKA 3X1FA 1OEZW 2XA8L 3B1TA 4MJJA 3GSQA 3VFSB 3QFJD 2Q7YA 1FI8C 1K5NB 2BVEA 3IETA 2VWEC 3FONA 4HK0B 3H1ZA 3SJVD 2EIJB 3R8QA 2XVGA 1R1CA 5CU5A 1QYGL 4WWPA 5AKRA 4JJ5A 1CYWA 2HH0H 3ISWA 6PCYA 1MFEL 4YHML 2X4OB 2HFFA 4ALAH 3CC5B 1DVFD 1EJ6A 3N41B 5FWRA 2HVKB 4F57L 4HDIA 4O4YH 4NPKA 4FTVD 2JV6A 5IJVA 3GXUB 1GYVA 2WN3A 3B37A 2X6BA 5DHVA 7PAZA 2ATKB 4HKZB 2CO1A 4ANWA 4PJCE 4Y4HD 3CIQA 3CDCA 1WG3A 1PCSA 4PWKA 3PGDA 4PWHA 4WI5A 1TNNA 1YAZA 1L4IA 3H3PH 5LQBL 2QDVA 2EQDA 3C5SA 1MFAL 3AVEA 4ZZKA 1BEYH 4HLZH 4JO4L 2J4WH 2CPUA 1BIIA 3ME0A 2JCCF 3NZ8B 4A2EA 3NFPB 1TETL 3HN3A 4G7YH 4OD3L 1JNHB 2OMZA 3HI6L 5D5MB 1A25A 4PREA 3BX7C 4Z7QF 1FZJA 3ML9A 4D8PA 1GC1L 1KYUA 4HIEA 2ROYA 1QEWA 4XOCA 4QHNB 5EULV 5EIIA 5LBSL 4PEEA 4BH7A 4F7CB 4AENA 3JZ7A 1ZGLP 1KJ3H 1AGDB 2G60H 2BNUA 4P48A 4Y1AD 3VFOB 3IJHA 4N86A 3II3A 2IWFA 1N8ZA 5LGHL 3BI9X 3T3PE 1R5WB 4AL8H 1LQBC 1OGAB 4HJJL 4ZQKB 5HHNB 4QY8A 4QY8B 3QARA 3GHEH 1X5KA 5IKCA 3HMXL 3VXRA 4OCWH 4ONGH 1CL7H 4PRNA 1OE2A 3UTQB 3ARWA 3BT2L 1OSZB 5CGYD 1UXLA 2L04A 3WE6A 2O5YH 2VLJE 5KVFH 3DV4B 1NC2D 3ILEA 3FFCB 3PLYA 2B0SH 1HEJC 1IGMH 2N01B 2OKMA 4FZEL 1XH3A 2OMZB 3FBKA 5KYXB 3EFOB 4OI9A 3VSUA 5JMOC 3NFPA 2ENJA 2NYYC 4J23A 5ALCL 5EMYA 1FP5A 3V7MA 5E4EB 2FEDD 1Y18B 2WIIA 1WFNA 1P2CB 4MYPA 4LU5H 2L8AA 3F7PC 3WMSA 3G6JF 4S1QH 3MJWA 1ETZB 2IDFA 5FDYA 3TN0A 2IWGA 3NSCA 1JXJA 2AK4B 4QYOB 3LH2H 1UH2A 2ATKA 1ZLSH 4M7LL 1X7SA 5BQDA 5AYUL 3Q2LA 3B34A 2WSDA 2VQ1B 2ZUUA 3BPOB 3O4LE 5B7MA 4NDMA 4NZJA 2CA4A 4M5ZL 4PJ8B 4PJGE 5MI0B 2CK0H 3C09B 3L3DA 4YXKH 1FQ9C 3EZ8A 1SHWA 3MCLL 3V7AE 3B2VH 4NNPH 1WLHA 3DHUA 1J5DA 5KVEH 1CO1A 3BP4B 3ARGB 3Q6GL 4Z7AA 5JPNA 3WIHL 2BHFA 3GO1L 4H26B 4LOVA 2OZ4A 1CDHA 4JJ5B 3X11A 5MEND 4Y1TA 4JG1L 2WYIA 5GSRB 5HHOA 2VW7A 2X4NB 4YR6A 2X6MA 1FFPB 4G59C 4KKAD 5KBMA 4H1LB 2E75C 3BPCA 3WEXA 3LRHA 4JKMA 4EN3C 2LU7A 3W81A 5DEFB 1HZHH 3C6LC 1I3GH 1SOXA 4OCNC 3U83A 2R0WL 3ABKB 3VNYA 4FAAB 3B9KC 2C4FT 3JUYA 5DRZA 1ZGLA 4G7RB 4YHZH 4UTBA 3SY6A 1BZOA 3ZUNC 3T4AB 4HSAC 1BBDL 1G1OA 4Z77A 4KQ0A 1CXIA 4PV1C 2J1WA 4PJIB 1ROCA 5IVXF 4LCWB 1I53A 4V2BA 3KYOB 5SWSA 5SWZA 2NYYD 3DROB 3BAEH 4F7MA 4PIBA 2K9FB 1EDQA 1E42A 1IBDA 4KTYA 3GUTB 3GM8A 3LEXA 3V4VB 4LL1A 5HHMB 3R19A 1KB5A 3L17A 1HHJB 4XP1H 2RR3A 1KJ2B 5C0AB 1QUPA 2K6YA 3QI9A 5BVPH 4JM0A 4L8BA 2WWNA 1BQHB 1CE6A 2CDEB 1XF1A 4L8SA 4Y2DD 2I9TA 2X1WL 1MCPH 5BZXA 5ITFB 3W0WE 3NQIA 4X4MA 2A4ZA 4BZ2L 2HYMA 4MB5A 1AACA 5C0FA 4XHQA 4TQEL 3ZTJH 1TZIA 4JX0A 2WXMA 5T5FL 1G43A 5E4OA 3VXSB 1NDGB 5E6ZA 2RH0A 1HI6A 4MCNA 1JF5A 4OB5L 2XQYA 3PJNA 1OIOA 1ZA3B 3FOLA 3WV0A 4MMZC 5GGVH 3D07A 4HFWA 4Y89A 2DQMA 5DVMA 4HFUH 3WKMH 4BQBA 3P2TA 2OJEB 3SGKA 3VSQA 4AM0Q 1UGKA 2N7BA 3P0GB 4K8RL 2LLGA 4LCUB 4OZFA 3UCRA 5F7NC 1H15A 1SXCA 1RU9L 2DTMH 1VZGA 2FQDA 3TBTB 1DTUA 4K07A 3RVVD 4Y5XC 3HR5A 2APBA 5DURD 4RGNC 1I7RB 4HEMA 1H8LA 1GZQB 5DQDL 3ZR5A 1U30A 5EU3A 5CZVL 4A67A 4WI0B 4LARL 1HINL 4GW1B 2HFEA 4JY6B 4HIJB 5C08E 4Y8DC 4ZNEA 5I1HH 5ESQB 3T0EC 2X70A 5AUMB 2CLRA 1DJZA 3RLSA 1DQJA 1R34A 1YMMD 4OKVA 4L23A 2OYMA 4DNLA 3HAEB 3DO7B 1QUNB 5FDWB 4HWUA 3PJSB 3BIKA 3RNQA 1E40A 1CIUA 4MAUH 4QRBA 2CR0A 5KVGL 5E2UH 2HLFD 4B5EA 4DGYH 3BWUC 3LRKA 4HH9A 1KXVA 4M5SA 4XNQB 3ZE0B 3ZKSD 1BZ7B 2BCKB 3V0EA 4KK6C 4PS3A 3ZR6A 4ZTEA 3DBXB 3T1FA 2JB6B 1PEWA 4ZXBB 5E00B 3BHBA 3I02B 1F4WL 5EBWB 2ZYRA 1CXEA 5GS0D 5HYIA 2QADC 4S1DC 4QHLB 1IC4H 1FC2D 4PJ7B 3LZRA 2OQJA 4U4IA 4Y2DB 1N4XL 3R7RA 2EDBA 1MY7A 1UXSB 1VHPA 3BPOC 4PJEA 4UTAH 3TA3D 3D0VB 3MLPA 2V37A 3EDKA 1PKQE 1SMOA 4GY4A 5DJAA 4NSKB 2XKSA 3NIGF 1A4BA 5KS9F 3K5SA 1NCDH 2OTUA 4IRSC 3DX3A 4MXQC 3OZ9H 5ERWB 4L9DA 3WL9B 1X5HA 2ESVE 4FFYL 1KNOB 3ZZQA 4KDVA 1AO7B 1TSHA 3KYKL 4YHOL 4YHLL 3CFBB 3D2TA 2HUEA 2PPAA 1Y6KR 2P52A 5I8EB 2WP3O 1TJHH 1KMGA 2WLMA 3STLB 4RFNB 4TOYL 3DX9A 2FJGA 2VDQB 5FOBB 3FB5A 3NSXA 2G75B 3QFJA 4K3EL 1J0HA 1IAMA 2ZSWA 4JHBA 1NMBH 4YAQB 3ULUE 3T8XA 4OGXH 1MAMH 4JQXC 1IE4A 4E9SA 5D9SA 3QPXL 3EHBD 2KLSA 5ALCH 2JI3A 1QHOA 3HRPA 5JHDA 1UVQA 1WPCA 4BYHA 2OP4H 4UQ3B 2EO7A 3MV7E 1KTDA 3FQ2A 1IU1A 4JFEE 4L1TA 1E0OB 2FNWA 4LHUB 3O9WA 1J0JA 2ZNXA 3HC4L 2G0LA 4Z95L 5BS0D 4X4KA 4JFEA 5CLTA 4XBMA 4NO5A 4YL4A 2ZG3A 5F9JA 4RWYH 5L4IA 3SKNA 3UP1A 4D9LL 1A4KA 5G5DA 3KEDA 1TR7A 4ZMQA 1HWGB 3P30H 5GS1A 2OW6A 3ECQA 3U7YL 5EDSA 5ANMA 1L0QA 1Z9PA 2ARJQ 2OX5A 4A2DA 2O5NA 3MRMB 1QEXA 2HP4A 4DVBA 4HISA 4Y4HA 1TJGH 2Y25A 2HN7B 2V2WB 5C1MB 4HJUA 3VFRB 3VD4A 2C26A 1A21A 3GC3A 1ADQH 2VDMB 4AQ1C 2GTWB 4JFDE 1INQB 1B0RA 3D5OF 3GSUA 1PD6A 4E9TA 5I75C 2C9QA 1XCWA 4Z6AT 1HZHL 3BVNB 3EYSH 3ETBF 2F5BH 2PXYC 3VH8G 4M8RA 3HHMA 3DURA 1QHPA 4A68A 4GIOA 1KXTA 4M02A 5FYKE 2PNDA 2VH5H 1JWUB 2P5EB 3DMMB 5IBTL 4GO8A 3VXPA 4NM4L 4Y2NA 4JPVH 2O6PA 4M7KH 4BSWB 4X2UA 1D5MB 5TFSL 3V0AC 5TE4H 1IX2A 1LL1A 2C3GA 2NYZA 4OKDA 2F9BT 3NZUA 2R2CA 3NBNA 1X5JA 2VN3A 4P9MH 4NQEE 2WO4A 1LDPL 1WBXA 5IVOA 2W8CA 2CBQA 4M1DH 5D7JD 1OAQL 1F8TH 2P5WA 4OIFA 5F9OL 2CO4A 2OMVA 4PJIF 2F54A 4MMZA 2R0ZL 1MCPL 1A7QL 5J6SA 2WQUA 4HWBL 1RV6X 1QPKA 5D4IA 5G4NA 2I9LA 1EFXD 2VW6A 3TEYA 1HIMH 2EZ0C 3LKNA 1QYGH 3BDBA 5C7XL 3T6QC 5GGRB 4M62L 2NQDA 4GSRA 5IB1B 3JTTB 3ARGD 3AWEA 3DGGB 2IDTA 1QBLL 1OT4A 2GBUA 3B2UC 3G5VB 3BZDA 3NCYS 1HYRC 4NRZA 4KK8D 5TK2A 1LEKA 1DQLL 5ICYB 1FSKB 2YPLE 1V7NL 3AJ7A 1S78D 4S0TD 1I1CA 3NACL 3T08A 3G9VA 2PYFA 5JMRA 5GGUB 4OZGE 1AAJA 4OQTA 2VO5A 4N25A 4BKSC 2JCCA 5TF1L 4YSOA 4NJAL 3QNXA 4G2AA 1J5OL 1E90A 1U9KA 2ADIB 1AR2A 5JDSB 1GY2A 1Q9KA 3GYRA 2IFFH 1QBMH 3REVA 5G4OA 1KEGH 1KGJA 1SY6L 1S9WA 3JV6A 4A2FA 4PWJA 3QZWB 5FECB 3IWVA 4RQQB 4B5ZA 4QAWA 1DSFH 1HEZA 2YGPA 3FCTA 3MRKB 4CW1A 3ARGC 4JAMA 2P24B 4G1MB 5HHOD 5F0PB 4P4KA 3CHSA 1OLLA 2FB4L 2RIKA 2H6PB 3VMNA 1GKOA 3QSKB 4H25B 1MCFA 4IMLA 3FU9A 5J6HB 1RSYA 4KNTA 3U36B 1M57B 2EXTA 2BIMA 2R69L 3MODL 5EUKA 2YAOA 4JE4B 2QPSA 4HJGA 1N68A 3OF6A 5KSBA 35C8L 5B1JA 4LSRL 4WI3A 5T3XD 4J1UB 3CBRA 3B1UA 1EAOA 4GRWB 4NPYA 4QHUB 4YDJB 3KLKA 1E27B 3U79A 1CICA 3SBPA 3BKML 5HJ3B 2DPKA 1BXUA 1QZ1A 1YZZA 4CKQA 2J6EL 2XWTA 2BSEA 4N1CA 3HZKB 4UQIM 2Z4QB 1O7VA 4OIBA 2CLVB 4WU7A 1UQSA 2HSIA 2FIRT 2YUZA 1MJ8H 4WNQA 3TO4B 5B4MC 1R5VB 2BNRE 3OSVA 4P4KB 2LTQC 3QRLA 4A2LA 4XH2B 4KGJA 3EZJB 3JWOH 1WEJL 3W0WA 4J4PA 1E5CA 2NUPA 1Y0LB 2CIKA 3GLEA 1B88A 3OAYK 4RQQA 4PLNC 3VM5A 2F0CA 4L4VB 4N0UA 4YZFE 1JZ7A 1BAFL 2BOLA 3MOAH 5BUGA 3TN0D 2GIMA 4GXUM 4Z1PA 3KMDA 1KGUA 1EH9A 5EU4A 3QA3B 1KBWA 5GS3A 2ROXA 1ETJA 1QBAA 4IRZH 1S5IH 4JFXA 1NMBL 2HG5B 4K0OA 5L0QC 3E1F1 1X5IA 4X6DF 4S0HA 3D3VB 2OTWA 3ELAT 2H8PB 3RVUC 3TEZA 3MLUH 4YDKH 1D5IL 2YAMA 3MGOA 4KXZI 4LKCB 4ZFQA 1KGCD 4APXA 5IY5B 1S9VA 3G5VA 1UXWB 4JVUA 1MWOA 4HIIA 1XCQA 4ODTH 5GRVK 2Z1PA 3QR1A 1KN2H 1NFIB 5C2BL 4PP2A 3BKJL 5GS0L 3SPCA 5I76B 3DBSA 4W70A 2H3KA 1TVHB 5TE7H 4PHZA 3ESPA 1KGYE 3OPZH 2D31A 3BISA 4WENB 1U42A 4U6TA 5F9WB 2KZ1B 5JZ7D 1VAHA 2IPKA 4YPJA 1I8KB 3KPSB 4XPFL 5ABDE 4OZHE 1CFBA 1I1AC 1M53A 3BT2H 3KHOA 4ZMZA 3BRDA 1SJHB 5JPMB 4DP9X 1MNUH 3ELQA 4GS7C 3U6RB 3OX8A 4IEFA 4TL4A 5C0DA 3RBSA 3GBNL 4U3CA 4JRYA 4FQHA 2NNAB 5E94A 4AIEA 4ZZFA 3IFPB 5IHZB 2W1NA 1UCBL 4Q74A 2XXCB 1LP9A 3B5TA 1CU4H 4LEBA 1DJHA 1DLFL 2OMBA 3PL6A 4P46B 1ZIBA 1C5DB 5FFLA 3MLRH 4HBQA 5TDPA 1X4ZA 1LO0L 3U82B 5TF1H 4IS6B 3B2XA 4HJTA 4IK6A 1EA9C 1OSPL 1OCWH 3H9SD 4PJ9B 3U4AA 3UYPA 3VCLA 3Q2CA 4ZSOA 3A6CL 3L1EA 4QWWC 5IV2B 2X6UA 1ZLSL 2BRRH 3ASOB 2OSWA 4YDIL 1B0RB 4DPAX 1AKJB 4PRHB 4X9FA 5CSBA 3S4SG 3F3HA 2AXGA 5DRNA 1U2HA 2WUCH 5LCVH 1I7ZA 2WUBL 3DC0A 3INUH 1OD9A 4MAZA 3O0LA 3QHFH 3MRIA 4AX3A 2XY1A 3GK8H 1L3NA 5ID1B 2H3NB 3OSKA 3OXSA 4WU5B 3BSHA 2VSDA 3VFUA 1KLGB 3L6FA 4FP8H 1YY8B 3FQUA 5F6HI 3CVIL 3L8QA 3QIWB 4OFVA 1R0AH 3BSZA 4GMTH 4FFZH 3CFCH 1YQ2A 2H26B 3B9DA 4HPHA 3M1BA 3VJ6A 3RIAF 3UTTD 5EDXA 4CSSA 2L7QA 1PZSA 5CLYA 1IIKA 3OJMB 3TO2A 2A5UA 3JV0A 4MNGE 4FG4A 3FMGH 1J5IA 1VCAA 1GA2A 4JFED 8PAZA 5DJ2B 3ESMA 3S5YA 1WBZB 4NO2A 5DMGC 1JI2A 4S1SL 1I1YB 4X99A 3ZQ9A 5LBSA 3QQ9C 2OFQA 2VABB 5L2JB 5JYMA 3ARRA 3TS8A 1GGIH 3ZTCC 1XFPA 4C47A 2EXWC 2FJGB 2O5ZH 4DK5A 4Z3IA 4HUUB 5AG9A 1BOYA 1S7WB 3UC2A 1K6QH 1IFHH 2HKHH 3SO3C 3ALPA 5EORL 1ETA1 1ID5I 4KRPC 1QVOA 1P6FA 5HHPB 3T2NH 1FV1B 4H88H 4OI8A 3MXVL 43CAB 2IH1B 1B9ZA 4JKPH 3X13A 4JHZA 2VDRL 1CLVA 1AQDA 2CK2A 2L4OA 1DBBH 3EG9B 2ZOUA 1YEHL 5T5FH 4X7DC 4DK6A 4BKLB 5EBMA 1DQQB 3UPAA 1JYVA 2Z34A 1K8IB 2FO4A 3VVWA 3PAUA 2HT3C 1YQVH 5IG7B 3N1FC 2A6DA 2ZCHH 2HRLA 3O3BA 2RD0A 4LP8A 5DUBB 3OPZL 4XMKH 4OF0A 1QTSA 1DBML 1J05B 2WYHA 4B9GA 3ARED 1U41A 3AQYA 4KY1L 4X80L 3H3BC 3S3SA 2NY0C 4I3SH 4KNUA 1DJIA 1TJHL 4YBHA 1W0WA 1N9PA 1NBYB 4X5WB 2ED9A 5CSZB 4XX1E 1WS8A 1Z0NA 2CRIA 4UF7C 1DQJB 3QHZL 3IGAB 5CUSL 3MRGA 3PFUA 5ESQA 4AI7A 1M2VA 2ITDB 5D1XC 1R3KA 4RRPG 4UV4L 3AS3A 3C5ZC 2X4SA 3VXMD 3IFLL 2OSYA 4P5TB 4TLKA 5I15L 1MRDH 4ZXBD 5FYKD 1S7SA 2XWJB 4HG4J 5LG1A 1A5FL 4LRIA 1PYWA 2HT2D 5FM5O 2EC9T 3ARBC 4HX1B 1RULL 1WZ1H 1LO2L 3O6ML 1WWWX 2DKMA 5HI3C 1SBBA 2NQCA 4KRPD 2JFCA 3A4DA 3D3VD 2LOEA 1OSYA 4FXTA 2E46A 5EU7E 1WA0X 2QMJA 3ZMRA 4CBZA 5LDSA 3RVXC 2NXYB 1H3PH 1HI6B 1F13A 2BVTA 3HB3B 4GINA 1VF5C 1DCEA 3VXSA 3GMOB 4NFDA 2XJKA 5FW8A 1OWRM 3ZKXC 3FPYA 3I6LE 4UQCA 5IQLA 1EGJH 3ULVL 3C8KA 1L6PA 3ULVE 4EDXB 3DXAB 1WBYB 1M9WA 1GIGL 5AW9B 2VXTH 1D7BA 1CLYL 1RUKH 3EYVA 3ORJA 4GAAA 5H37H 4YHYC 3NT0A 5I2IA 3GBML 3OL2A 2XV2A 4N0FA 1MHCA 4P4KD 5J1AA 4JJHA 1OAZL 4LLYB 4GOSA 2AC0A 2V17L 4MJIA 4W6YB 3JV5A 1KB5B 2IGFH 3O6LH 3VX0A 5C0EA 4ALAC 1EEUA 4P2RE 3GUTA 5KBLA 3HNTL 4WKZA 1WISA 5DS8A 3UGUA 1IAII 5CD5C 1RZQA 4JFSA 1PD0A 2DDQL 3G6DH 3FMGL 4AC4A 5BRPA 2XRAL 3TZVD 2B0SL 3OF6D 4N90D 1R24A 1XB6A 5DD1H 1F02I 5LWYL 5AD0A 4Y9FA 1CFQA 5E08H 1CGSL 3QDGB 1HL4A 5JQHC 1HYSD 3RFRA 5I74C 3APDA 2F54D 2X12A 3ATAA 1WWAX 1JGUL 3GPEA 3QUZD 3T3PB 2XPGB 1BFOB 2JSFA 1EFXA 1FYTA 1KB3A 5BUAA 4LCWD 4R7XA 3NJKA 5JIDA 1E4XI 4TNVF 5E6RB 1EAPA 4V33A 1VEOA 1JN6B 2Y7NA 3GSNL 3FUHA 1A8ZA 2IQ9L 3K6OA 2VR3A 4MSWA 1AHKA 2B9AA 3MRLB 2VM4A 3MCLH 5JPMA 2DM7A 4I18C 4ERSH 4IIQC 4K5PA 1G0YR 3H56A 1ADQL 4CDHA 1MW2A 4LBEB 3MNVB 2FWLB 5D70H 2YXVA 3Q43A 4M1CC 1RMFL 4DN4L 2CR3A 3QEHB 2EEXA 2FL5B 4QTFA 2UVEA 4GSQA 1KBGL 1B0GB 3E2HC 2BP3A 2HJFA 1UA7A 4KJWD 4OD1L 4JBSA 4JFFE 2EH8L 3MRHB 1G9NL 2H45A 2ODIA 3LRLA 1UXWA 4KTEL 5J89A 4ZFOL 2NY3B 1ZLVH 4G42A 5IEHA 1U6AL 3MGOB 2OL3H 1IKNA 3V52L 5D6CB 3U2SB 1K4CB 3GLAA 4HCFA 3BGMA 4XCFL 3BW9A 3FAXA 2MFNA 1KCBA 5T1LD 5L6YH 1SN0A 5I71C 3PWLA 4X7TA 2WINB 2VCOA 2AI0H 1SEQH 2XWDA 4Y4FC 4UDTA 1HSAB 3NIFE 5EIQA 3K1KC 3RY6A 3ENEA 4AJVA 3DRQA 4NJ9H 1XSIA 2AJVL 4JRYD 4QXTA 2CIKB 2PN5A 2YRZA 2NZ9D 2BWIA 3TN0C 2NSQA 4D3CH 4KI5E 5DO2C 5EA0L 4AENB 3HRZB 2R56L 5CWSA 4YIQB 5GZNC 3OAUH 3PV6A 1BVLB 1VADA 2IANE 2P8PA 1L9OA 4RRPM 4Q14A 5IQ9B 4RLDA 2XWTB 5DS2A 5F3HB 3MUUA 1M71A 1Q72H 3RJDA 1FZKA 2IIJA 5C2UB 3RDTC 3S3JA 3W0WD 2DV6A 3GHPA 4TNFA 4YHPA 2N56A 4UYQA 4P5RA 3CH1A 4LQFH 2K70A 5GRYA 4ZS6D 2KQMA 5AB2A 4QTIL 5HDLA 1CFNB 1DUZA 4U6XA 1CFMA 2DOCA 4F20A 1O7DE 3U36A 3BT0A 4FADA 2D7QA 5DMIH 1P9MC 3ZDWA 3NK4A 4M29A 3K8LA 1SDAB 5CCKL 1RI8A 1AZRA 5EOQH 2FJUB 3W1ZA 5I16B 5BOZG 2NX5E 4ONHB 1ZTXL 4WFHE 2VISA 4HDIB 4KAQL 3IMWA 3CC1A 5EEXA 3JWNE 4Q9RL 2FBOJ 4XI5D 3UTTA 1AGFB 2WW8A 3HZ3A 4GRMB 1NM4A 1Q94B 3ARUA 5HGHA 4OM0L 3GJFK 1KCVL 1U3HA 1YEKL 4KTDH 3OAZK 1EFQA 1JZ8A 3EGSB 1FLRL 5CEZD 3GMQA 4JRLA 3DHJA 4FA8A 3GLZA 1Z9SB 4CN4A 2OR7A 3CZLA 2BP5M 1DLHB 2K8QA 3LY6A 1GHFL 1K5NA 1TEGA 1XZ0A 1ZXQA 3CHRA 3F84A 1AD0B 1WFOA 2IMNA 3ECVA 5GRZA 5HGHB 3HN8A 4HP5A 3FQTB 3GI8H 3X17A 4Y4KD 2ZX8A 2IQ9H 1UA6H 5DHDA 3NIDF 2BVYA 4OJCA 1EGJL 2AEOA 4R5XA 1XGQA 4NC0B 4WFED 5F2FA 3GMRA 3JBG7 5GGVL 3AS2A 5I16A 2CM6A 1FL3B 1I3RB 4X6CB 1SYVB 2QVMA 3SE3A 1NBZA 4MMZB 3C5JA 1JXGA 3KPMB 1L7TL 5CN1A 2ZD0A 4G8GB 1QSEB 4F7PB 2AQ2A 1Q4NX 3LD8B 4NZFA 1IGJB 1BX2B 4M56A 3BD3A 1EO8H 2E6JA 4Y5XA 3CH1B 4X6DE 1TTCA 4N9GB 1MFMA 3OV6A 2EXYC 4I18B 4JUSA 2H47C 1KTBA 4ZUUA 4F3FA 1JWUA 1AZUA 2P5EA 1MI5A 5LCVL 1KCSH 4PRBB 3FN9A 3EW3B 5CEZH 2EDFA 3D39E 4XNUL 3VFTA 1MRCL 2ZQKA 4PJHF 1SN2A 4NKDB 4H5SA 5BRQA 3P4OB 1PKQB 4JFHD 4FQ2H 3CV5A 5TTRA 4AGOA 5C3LD 1A1NB 2E5EA 2EADA 3EH5B 4MJHA 5CN2A 3ULUD 4X9GA 4U1IA 4ELMA 4IKNA 4OM1H 4PY8J 4BQ9A 4KI5F 1LHZA 3VXTB 3B8SA 1TQBC 3IT8D 1JSYA 4LPTA 1YJDL 3MJGX 1L0YA 4WJ5A 2NDFA 1E5UI 1JPFA 1LVEA 2EYSA 3Q06A 3APNA 4H5SB 2WKGA 1T21A 2BCMA 2V2TB 2EXYD 2O1AA 3WFEH 4CILA 1BXXA 3N0AA 3H2QA 3QIBB 3QYMA 5J12B 2I07B 4C4UA 3PABB 3GBEA 2Q0ZX 4I5BA 1IBGH 3DDGA 2Q8AL 2OX5B 4X4ZA 3AGVA 2OK0L 4FXGA 2ZOLA 4KO7A 2I26N 1NMAH 1K4CA 2EILB 5K59F 4DP5X 1BSIA 4WDIA 2EIDA 2F61A 4NI6A 2Y7OA 2A83A 1NDTA 1IEBB 4I13B 3ARQA 4W6WB 2NX5D 1LTXA 1W15A 2YD6A 4HF5H 2ICWI 2IH9A 4JFEB 1BF2A 3SIKA 3A6CH 5E9DB 3CZGA 1KTDB 3VXSD 3ULVF 1M7UA 3V6OA 2ADGB 1T5WA 1B0GA 1UVQB 3IS1X 3MJ8B 4HD9A 4X6CA 3GNML 3VWKD 3TBVB 2KC0A 2WO3B 4Y4KC 5AYUH 4K3HA 1RJYB 1RLWA 2WGNB 3RX7A 32C2A 4H0HB 3TM6A 3QUYC 4MS8C 5JDJA 3MV11 4LFHD 4JO8A 3RPIB 3DJZA 5J13C 4N0RA 1RVFL 2BWQA 3OB0H 1SJMA 3FQWB 3STLA 5IMOB 1R3LA 4M1DL 3SYPA 3W39B 4JO3H 2WVTA 2BVPB 2OAAA 1OCZB 1ZKAA 4HW6A 1J8HA 4QMEA 1AO7A 3HUJE 3IJSB 3WKNA 4F5CE 5C86A 2GHZA 1A66A 2FLBT 4K3JL 4DN3H 3TZVA 3V0WL 1T1YB 1EXUB 4MCZA 4KJPC 4F2EA 2BWDA 4JO5A 3M46A 1O9ZA 4JFVA 3D0VA 1E2WA 1DVTA 3KGRA 3UYRL 1RP8A 1Q94A 1UHVA 3ISYA 2EEFA 4P4RB 3SPHA 4DKEH 5JHLH 3ZRCC 1OE1A 2BOBA 4AH2A 4KPHL 1WYJA 1ND0B 3UTSB 4ETYA 2H3XC 3HRZC 2YGVA 3F00A 3K2KA 1KN4L 1BCIA 4O2FB 4R90H 4FKEA 1KFAL 4A6YB 4KKRA 3O8XB 4OZIB 4QXGH 2CO6B 1ES0A 5C0EB 1CTOA 1VPOH 2J43A 2VWEE 4TUOA 2IAND 3AXLA 3MO1B 3WTSA 1MEXL 1FNGB 3CBJB 4NZTL 1CDIA 3RWEB 3L3IB 4ZO9A 5KSAA 1WITA 2X70B 5AUMA 3MTXA 3T4YB 5D1QA 1BJ8A 2D73A 5HGAA 1SLWA 3P4MA 4ESKA 2ZX6A 1ZDQA 1KENL 4ENED 4F24A 4JREC 3ZGHA 3NGBB 2AZAA 1SXAA 4U6YB 3S37X 2JJTC 3EHBC 4YVUA 2NZ1A 4NZRL 4HMDA 3KM2A 4M7JH 1GZPA 5IROC 4KVCL 3MPCA 8FABB 5TH2A 3KBFA 2F58H 1QSFE 3OTTA 1CXHA 4IYKA 4OZGB 3SN6N 4QTHA 2H32B 5B22A 3ARBB 3SQBB 3PHQA 3A24A 5T1LA 2JJUA 3ZHKA 1ITBB 1ZS8A 3L9YA 4BK8A 4G7QB 4PJFB 4HX1A 5EPMA 2EO9A 1FZMA 1ML0A 1R5IA 1OOWA 3FBQA 2HB0A 4BXSV 3U0WH 1S7SB 2XWJA 3GIZH 1MH5A 1DQLH 4UT6A 2WM0A 5E70A 5HYSA 1MJ7L 2KYIA 4P5TA 3AQZA 1CGXA 5C0FB 3RGVD 2E9GA 3KEHA 5D7IF 4HWEH 4BXVA 2ZF9A 1FSKC 5JIKA 5AG8A 2I5YL 3D85B 2ZSVA 3DVGA 2V3DA 3IGAA 1CDGA 4RGMB 1XBRA 4PJDE 4BUQA 2IVFC 4NP9A 4P59H 3MLYH 3QI9B 2B5IB 3WHXB 2FX9H 5MEOA 3SZ6A 5BQ7A 3Q2WA 4FNQA 3MLWH 3HPJA 3FCUB 4JFOA 3FUMA 5JHDE 4N26A 4GI9A 3EDFA 3GI9L 3JWDC 4QGTA 4OCRH 5I30L 1QR1A 3NIGB 4LGPB 2ATAA 1I7TA 2QKSA 1WFTA 2Z92B 3CN1A 3OKEB 3MLZH 4J3TA 2G9HA 4JHUA 4JG0H 5BZWA 3RX5A 4YDLC 1FZOB 4PIRF 5DRZB 1ZGLB 4M6OL 5DJ8B 3HC3H 3CDZB 3KD4A 4FNUA 4QKXB 4OY9A 5K9JL 2HT3D 5LO7A 4J6IA 4LP4A 3UAJC 2VE6A 1JCVA 3VXNA 5DJCB 5TQ0H 3WEXB 1ZSDB 2XZQH 3WFDL 5C07E 1QVOB 4OLVH 1DVFC 2DL9A 3KPOA 1YYCA 2P8MB 4OJEH 4Z0XA 1M1XB 1U95A 2AQTA 1EHXA 1X5ZA 3LH9A 4XNMA 4L4VE 4PVBA 1SXZA 2W0LA 4LVNB 2L7UA 3CFNA 4WF7A 1FE8H 2ZIDA 5D7JB 2YPVA 1T1ZA 2AP2A 3DIVA 3QULA 2G9HB 2HPTA 5EWIH 5BXFB 3FO9A 3D30A 4Z23A 4NM8H 2JQAA 1QA9B 3L5IA 5BS0B 4UNUA 1J10A 2BSCA 2EC8A 2YOAA 3AGWA 3NMEA 4WV1B 4WWOA 4PJ5E 3HS8A 2JB5L 2HA1A 1G5GA 1EJOL 3GS0A 5H4YA 5K39B 3WSQH 3ILQC 4KH9A 5EOTA 2MCG1 3M1BB 4QRQA 3VJ6B 1TTBA 3CPUA 4DIXA 5AB0A 3CFDA 3K2UL 1JBJA 5DCCA 2F5AL 3KPTA 1BIHA 1F3JB 1R33A 2PYEB 3GRBA 3BFOA 3BWAA 1FG2A 5FB8A 2ICWA 4NLAA 3OR6B 1A3RL 1JDDA 3H85A 4TUJA 3H0TA 4OZHB 5F1IA 4NAJA 1WH0A 3BIAX 4FL4C 3AITA 3FUDA 4W4OC 4UT7H 5L0QB 1PPIA 4Z7NB 2GITB 5C09E 4AQ1A 1ZLDA 1KPRB 2J20A 2YEZB 2FLRT 1TZGH 2W59A 4PRHA 3RZCD 4IRJD 3VSTA 4JFZH 3V5DA 1Z32X 4CVZB 5LXGL 4F8NA 3LNEA 4KUCD 3ZVVA 4XBPB 4XO5A 2EDNA 5IREA 1MI5D 3DWTA 2BNUB 3UMNA 3EAKA 3FU6A 2KZKA 3QJSB 4YLCA 4FQIL 2WTRA 3NGBC 4OJFH 2BXZA 2HMIC 2YKLL 3GMLA 1KFGA 3A47A 4QRPE 4XCFH 1KY7A 2FEDC 2E7CA 4B0MM 5GZOA 4KO6A 1G7HA 1X6LA 3ZE2F 1SN5A 3IE9A 4B9ZA 1KCLA 3AREC 4V1DB 2XN9D 1FFRA 3T2PA 1ECZA 2Y1ZA 5DHVH 2HRHA 4KRPB 5E6UB 3FH8A 3ARFC 3I6GA 3VMPA 4GQQA 5JYLA 1UH4A 4CVUA 1AE6H 2O72A 3TBSA 4NZTH 1Z3RA 2R59A 2XVKA 5T1MB 4J3VA 1D2OA 4PJXE 4XWGH 2QPFA 2PW1B 5DHVB 5FR3A 1J05A 2NT1A 1OGAE 1CBVL 2J56A 3O3BB 4XO3A 1W72L 3LMJH 2E7BA 5HDBF 2OMTA 4ZAKA 4DQAA 1XH0A 1A14H 2GPZA 3BVWA 3ESNA 1A1OA 3OHXC 4PWFA 4XN8A 3T6ZA 1T0NB 1FAIH 2VSKB 4O9HH 1IM3A 2QT6A 1FBIL 2W80C 3OHMB 4M6OH 1PIFA 4BKLA 3K2MC 3ZIMA 1ZJAA 1UACH 3RDTA 4XO9A 1YQVL 2D8KA 4ZT1A 2VW4A 3HFML 3TCXA 3PPSA 1T1YA 2IOIA 1QI3A 2QKIA 4JG5A 2JJSA 4AL8C 3BGFB 3OG6B 4PWIA 3EH3B 3L16A 2EKJA 4LE8A 4AMKH 4L4VA 3WFBH 1D6VL 4JRWA 3KLSA 2KERA 3FQWA 4Z3FA 4NQEA 1NEUA 4GAGL 3T8VA 2NUPB 1KULA 3RFZB 4QOKA 3RBGA 4J6RH 4PV8A 4ZFFB 5IB4B 1AO7D 3BMVA 2Q3AA 3MUGB 3UPRB 1L9PA 3BQUB 4IBWA 2V0AA 4FOMA 5DQJB 1U8QA 5M94B 3DIDA 4NQCE 1A6ZA 2GCYB 1IGTA 2R9HD 4NUGH 4LLMA 4RESB 4PRPB 2FR4B 3Q0HA 3QJUB 4JQVA