1Z9PA

X-ray structure of a cu-zn superoxide dismutase from haemophilus ducreyi
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
155
structure length
155
Chain Sequence
EKIVVPVQQLDPQNGNKDVGTVEITESAYGLVFTPKLHDLAHGLHGFHIHEKPSCEPKEKDGKLVAGLGAGGHWDPKQTQKHGYPWSDDAHMGDLPALFVMHDGSATTPVLAPRLKKLAEVKGHSLMIHAGGDNHSDHPAPLGGGGPRMACGVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of heme binding in the Cu,Zn superoxide dismutase from Haemophilus ducreyi.
pubmed doi rcsb
source organism Haemophilus ducreyi
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 38
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1z9pA00
1E9OA 2VR8A 1PZSA 1SRDA 4BCZA 1JK9A 1XSOA 4U4IA 2LU5A 1OZUA 1E9QA 1CBJA 4A7QA 2Z7WA 3F7KA 3L9YA 4MCNA 1YAZA 1DO5A 1F1DA 2ZKXA 2JCWA 2WWNA 3SODB 1COBA 3HW7A 3CE1A 1PU0A 1XTMA 1N18A 2APSA 1YAIA 1IBHA 3H2QA 1E9PA 1OAJA 1Z9PA 1FUNA 5CU9A 1L3NA 3MKGA 3KH4A 3GTVA 1BZOA 3HOGA 2Q2LA 4A7GF 1Q0EA 2JLPA 1Z9NA 2ZOWA 2AQRA 3RE0A 2WYZA 5KBMA 2C9VA 1OZTG 3LTVA 3HFFA 2R27A 2WZ0A 1UXMA 1E9QB 1IBDA 1OEZW 4BCYA 2C9UA 1ESOA 1XTLA 1IB5A 5KBLA 2AQPA 1PTZA 3MNDA 1E9PB 4N3UA 4B3EA 1TO5A 3ECUA 1N19A 1CB4A 1F1AA 3T5WA 4L05A 1SXBA 1IBBA 1RK7A 2AQSA 2V0AA 3KM2A 4N3TA 1B4LA 1JCVA 2SODB 3KBFA 2Z7ZA 3ECVA 3F7LA 2E47A 3ECWA 1SDAB 4FF9A 1SOSA 2AF2A 3PU7A 2AEOA 3KH3A 1B4TA 2VR6A 3K91A 2ZKYA 1SPDA 1YSOA 2ZKWA 4A7GA 1UXLA 4OJAA 2XJLA 4BD4A 1F1GA 1SXNA 1EQWA 2K4WA 1S4IA 2WKOA 1AZVA 2C9SA 1SXCA 1EJ8A 1P1VA 2GBVA 2NNXA 3GTTA 4A7VA 2WWOA 1BA9A 3QQDA 1E9OB 1QUPA 2AQQA 2WKOF 1HL4A 4OH2A 2GBTA 2WZ6A 1SXAA 3GZQA 2WYTA 1HL5A 3GZPA 1SXSA 4A7SA 1SXZA 2Z7YA 1JK9B 3CQQA 3L9EA 4A7TA 3KM1A 3GQFA 3GZOA 1SDYA 2Z7UA 3CQPA 4A7UA 4MCMA 1IBFA 2WZ5A 3QQDB 1DSWA 1KMGA 3S0PA 1U3NA 2AQTA 2AQNA 3KBEA 1F18A 1OALA 2XJKA 2GBUA 5KBKA 1MFMA 2VR7A 3H2PA 2E46A 1TO4A
chains in the Genus database with same CATH superfamily
1DVFB 3CHRA 4KUCD 3E2HC 3W82A 2WJ7A 2Y7MA 4GKSA 3F5WA 5GRXG 4OD2A 1QTPA 3JYBA 1EHKB 2CMRL 3O0LA 1O7SA 1FBIL 2DQIH 1EO8H 2MQ3A 2J6EH 4PJXF 1A1MB 1PYWB 1RJZA 5J5EA 1A4JB 1I4FA 4L1HA 2OI9B 3O2VH 5TPWL 3F65A 3C09B 2Q76A 3CFJA 1BBDH 4HGMA 4HUVB 5JIQA 3BAKA 3MKGA 3G5VA 1T1XB 2FGWL 5TQ0L 1RIUL 2VRAA 3P73A 2Y6SD 4NO5A 4HBCH 2OA9A 4N8CL 4ZW5A 4OZFA 3V5DA 1G43A 1U3JA 1P84J 2FBJH 1QG3A 3L4WA 1JN6A 3HR6A 1W0YT 5JLZA 3FB8B 2ADFL 3PF2A 5T1DL 2HFTA 4H5SA 5IHLB 1RZKL 5INCA 2IWGA 3Q9PA 5KYWA 3TF7C 3WN5C 1JUFA 4IBYA 3DTXB 5HVHC 1KGIA 1ILUA 3OLGA 2RALA 1YDPA 1N70A 1YNTF 4YFLI 4LNRA 5JMRA 2WQAA 4PRHE 2ZG3A 4I18B 4DEWA 2GK0B 2X2HA 3X1NA 5F1IA 4IIQC 2ZCZA 5GRUH 1TMQA 4R0LC 3KR3L 2Y5TB 2BVOA 1A14L 1O9ZA 1EAPB 4TV3A 4EVNA 4UIKL 1JZHA 1YC8A 1D9KA 1QSFE 4W9CC 1A6AB 2I60L 3PWVB 1PZDA 3C9NA 4HQQL 4YN3A 4AM0B 4NRZA 4OJFL 3J07A 1ZCRA 1S7QA 3FCGA 2EZ0D 1R3IH 1YNKL 1A6WH 2Y3AA 4HALA 4E9XA 4ZNCD 4Y1SA 3GIVB 4HQQH 4UNIA 3B5GA 1E2WA 4KXZI 3N40F 3DV4B 1SOQA 2F15A 1W8EA 4HUMB 3EADA 1T2JA 3BUPA 5ABDE 5D7LA 1LP9B 3H7LA 1XMWA 4JLRB 2EDBA 3BEWB 4AYBA 5FCUH 3VDBA 4JM2F 5FS5A 3OZLA 4P2RB 4ZXBD 1CE6A 2I32A 2P48B 3JWNG 2AK4E 1HHJA 2K9UA 3PDDA 5I74C 1IQWL 1MKFA 2IDSA 1M05B 4P4RA 1TZIA 4C56B 2GTZB 3X14A 3O3UN 3BD3A 2NTFB 3I9GH 5EWIH 3HMXA 1I7RB 2F5BL 2XG5B 1CFSA 1KY7A 4UF7C 2YFOA 3EJPA 3HNVH 3QR1A 3U1SH 2QTEA 3HS0A 1UD6A 1MFCL 2X7LA 1YEGL 4E42A 3BMWA 3VFRB 5IEHB 1ZA6A 2X1OA 1RZKC 2AC0A 1WT5A 4KI5D 4WFGE 4NKIL 2RIKA 2BNQA 1C1EH 3QE5A 4HLJA 4KI5F 3WJMB 2BMKB 1LQBC 2PABA 2PW2B 1KY6A 1A7RH 3KPLB 1IBGH 1WICA 2XYCA 3F7KA 3OLIA 1YEJL 5EZOH 3OMNB 4WQOA 2H2SD 3I9GL 3MGOB 2Y6SC 1AP2A 5H37A 3SDAC 4RGNB 2YQBA 4C4KT 2VZ3A 1OTUC 5H4ZA 2HFGL 3F2LA 1UT2A 3PHOA 4LCWD 5E8EB 5E4IA 5F71A 1X6NA 1FVEB 4TXVB 2BCKA 4BK5A 4WV1B 5K9JL 1K9TA 1NMBH 1ZT1A 1NANH 2WINA 2OMZB 5F9WB 1AXTL 1YN7A 5A2AA 1VZGA 4NIYE 1LO4L 5I9QB 3I02A 4QI3A 1JWUB 3GSNH 4DESA 4J1UB 3T3PB 2EUVA 1UYWL 2AEIT 4WCYH 3CVHL 3D52A 2R2BB 4NQDB 3UDWA 3BQUC 2I26N 1PEZA 1T2QL 5FGSA 3UG4A 3MLUL 5IOPA 3X11A 2J1YA 2KPWA 5F6HJ 3ROOA 2CHNA 2JTDA 1P0SE 4OKDA 3QXAA 4N8UA 3OL2A 3FSOA 3UBXB 5K9QG 2Q7YB 3CHSA 3JWOH 1KJ3H 3L1OH 3KL5A 3VXUD 3WIIL 4GFXA 3KH3A 4W4OA 3S96B 5ITBL 1KBBA 3VM7A 1NGXA 3UYPB 3N91A 1A1OB 1BG9A 5DS2A 5AVVB 1MRCH 2BDNL 3QJVB 1GGUA 1I31A 1NAKH 3FU7A 5D71H 4LHUD 1QEXA 2XBDA 1U8NB 2DLIA 2NZ1A 2G0KA 2VSCA 1XVSA 4FLSA 5F9DC 2J4WL 2P44B 5IJKC 4XP9L 2BHFA 3GBNH 2UYLB 4N87A 4HULB 4ZUWB 5JXEC 2ARJB 3WELA 2QGCA 2H45A 4DEUA 1KGUA 4P2QD 3WXWL 4HJEA 3NCJL 4ENEC 1LD9B 3ENEA 2HVJB 3POHA 2XY1A 3IMRA 3KPQA 2FTAA 1PZ5B 4GRWB 3QH3B 3Q1SL 3QNXB 5HHVL 4LPXA 4TNVF 2VH5L 2WMPB 1DQJA 3BFOA 4K3HA 3ZKMD 3CFEB 1MCIA 3TV3H 3EUUA 1K4CA 4P4KB 1R33A 1E28B 1QSVA 5CGMA 1XGYL 2FEDD 2P5EA 4BWTA 1QFHA 3PHSA 4FFYH 1KTLA 4KOBA 3O4OC 1U9KA 4OF8A 5LWYH 1M6UA 1W6WA 1G9EA 2NYYD 4U1MA 3QDHA 1UYWH 2ZX9A 1G6RA 1FYTE 2KZBA 4AEFA 5I6XB 2CLVA 2CJUH 3PREA 3AREA 2VL5A 2BSBA 2X2UA 4HC1H 4UV7H 4X4ME 4U1LA 3TA3B 4UM9A 1ITCA 4PUBH 5DUMH 1EUTA 4D94A 1N6QH 3BVDB 3PGDA 4R7DA 2R4RH 3TTSA 1KB3A 2GJJA 2ED9A 4L3CA 3ZVVA 2ALAA 3NFSH 1ACYH 4NUGL 1J86A 5IB4B 1MJ7H 3QA3A 3QXAB 4GAYB 2AZAA 5CILH 4XNMB 5GGRB 2XA8H 4DCQB 1FZOB 3E6FA 4TLUA 1G7LA 2OYPA 2WD0A 1RERA 3NFPA 3RQ3A 5AVTB 5C0BA 5GRJH 3QP3A 1TTAA 2EEFA 1BZEA 1ZHKB 4CILA 1FL6A 2X6BA 5TH2A 2RCSH 3GMNA 1NIFA 5BQDA 4E9SA 5I2IA 2DS4A 1PIGA 3ZZ1A 4D0BA 4PCYA 1U2HA 3S3CB 4ZD3H 4I85A 4X0NA 1UZ8B 1PFCA 2ZXGA 1EO7A 2Z7ZA 2HJKB 3CSYA 4L29A 5AOZA 3TH3T 3WUWG 1YNTA 1QSED 5DQDH 4BKLA 3O6FD 3O3EA 3JWDL 1GKOA 3MBWA 1XGZA 2OW6A 1G7JB 3EYUH 4AENA 3GJEB 3QQXA 2HH0H 4A04A 4XXDA 4P05A 1NGWB 1W91A 1TNMA 2P7TB 1CK0L 2DI8A 3LB6D 2VAAA 5DEGB 5EBWB 3FNKA 2BRQA 2N56A 2IQ9L 3LKOB 3VX0A 1W8OA 1YEKL 2C7FA 2QL1A 2YPVL 2CR0A 3CFEA 5EO0B 4FNLH 2JK5B 4EN3A 1GAFH 1ZSHA 4XZUB 2WLLB 1M7XA 5LGJB 4ABQA 5JPNA 4KTEL 5JO5A 5DYOA 2YUXA 1DDTA 1HHHA 2YKLL 3NCBB 3RHWK 4LBEB 3KPSD 4PY8I 3RVXD 1ACCA 1SN2A 4ELDA 4H8WH 3LQZB 1K6QL 1AMYA 4Y19B 4MJID 2YN3A 3X1GA 1S9YA 5I74B 4YXLH 2JTYA 2AJXL 5IJVA 1CWVA 3PL6C 3T9WA 2VLJE 3UMTA 4C4KO 3N6YA 2OMZA 2PWHA 1HXYB 1RULL 2APVA 5FHBH 2ZNWA 3WDJA 4AI7A 4PRIB 3AAZB 3CFCL 1E9OA 3TN0D 2WCGA 3MN8A 4H8WL 1T5XB 4Z77B 2BFGA 3A23A 2XACC 5IQNA 3H8NA 5JHDB 4POZD 4MKTA 1E9QA 3PNWA 1RJYB 5J1AA 5IJBC 4ZMTA 6FABH 1MNNA 1U41A 4W9JC 4AYFA 4Z0BL 4NNPH 1M7DA 2VDNB 2BWIA 4JGUA 3V0GA 1AQ8A 3CLEH 4RWHA 1SFHA 4FYQA 2DEYX 3GMQA 5EFIA 9CGTA 3O2WL 4RISH 1PVHA 1JDCA 5EOCH 2P8PA 2O5XL 3WJJC 4K0OA 1MFCH 1P5UC 2G60L 5DK0B 1Z32X 4B50A 1C9SA 4IIQB 2AXFA 1PQZB 4PJBF 4PCTA 2P80D 3HI6L 4XI5D 1PKOA 2WN3A 3L48A 3CV5A 1KYDA 4LEBA 4Z7NF 3VXSB 1XXFC 4C56D 3LHAA 4X99B 2Z4QA 3CN3A 1NAMB 1RZIA 4L37B 3CN4A 5JMOC 2H0EA 5TE6L 4PW3A 2JB5L 1A4JA 2VR9A 3OKDB 4ZNEE 3ASOB 3QUZC 1MCPL 3C12A 5D1XA 2GFBA 1QNIA 1JNLH 5E7BA 4KAQL 5EF3A 2NY2D 2VGLM 4LP8A 4AYDC 3SDCA 4FMKA 1OP5K 1QQDB 4P2AA 3NRQA 4AGNA 3ECWA 2C1OB 1AZCA 1WZMA 3QZBA 2FWOA 3U7AA 2WMPA 1G1YA 1YYML 2ZXWB 4OZ4A 4WF7A 2NY1B 2EVJA 1A3QA 3IMBA 3CPLA 5B8CB 2ZYSA 4LRNL 3AT8A 1I9IL 5IHWA 1WG3A 1MXGA 5AVXB 1MFVA 3VYNA 3UYRL 5FHBL 1KIRA 3DX9B 4K3EH 1RH8A 2DI9A 3Q0HA 2XN0A 4HZAA 2DQDH 3O9WA 4JCLA 4KU1A 5I66B 1DVFC 1VFUA 3OMAB 3VGAB 4UWQB 1ICTA 3TXAA 5IEKA 3D85A 3LZPA 4CJ0A 4UOZA 4ZFFB 1KLUA 3TV8A 4HA1A 3IBEA 3IFNL 3ARFD 5A2IH 4L1DA 3FCTB 3HUJF 2JB6B 4G1EA 4JM0A 4NCDA 4WHTB 4DP7X 5LWYL 3MLTB 1J12A 3A4FA 3DTDA 4ANUA 2VQ4A 1QVOA 1G84A 4TNWK 4NQED 1IGIH 2BVQA 3O41A 3SGDH 2QQLL 2PTVA 2Q8BL 5IMOB 2O6DA 2P5WD 1BEYH 3RVUD 1PLAA 3CVDA 4IJ3C 2VH5H 4ZPTB 5HDBF 5DC9B 3OSVA 1D5RA 4MFHA 3H2PA 3AY4C 4PWHA 4UBDD 4XPBL 4FQHB 3AWEA 2WY3B 4YO0A 2IH9A 3EFFB 2ZP0T 5EG6C 1EPFA 4QAWA 2I9LB 1GHFL 4UZGA 5HI3D 2GPZA 2DMGA 1S7RB 3G5ZB 1E8XA 4BJLA 5J3HC 1LEIA 4OUUA 5I71B 4N1EA 1NCNA 3EKCA 2V2TB 1G5AA 3TIDA 2OMYA 1E5YA 3BPLC 5DJCB 2BVEA 4XB7A 1XCWA 5CEXA 4KZEH 2BSEA 2Y0SA 3P9LB 2W9EH 3U25A 4PG9A 2UWEB 5H4YA 4WHDA 4ADIA 3KAAA 1I8MB 4JRXE 3B5TA 3U2SA 1RV6X 4QHMA 2DDQH 3IDIB 3ME0B 1L6PA 2N01B 1A7OH 4MBOA 1XEUA 5CJ8A 3TWCH 1WTGT 4WEUD 4BCYA 5IREA 4BFFA 2WK2A 3ARFB 3WJLA 3GIZH 5ALCH 2E6JA 2XTJC 4PWKA 1EBAA 2ENPA 4F8QA 1MI5A 3SDXA 1E5ZA 3O2DL 1MJ8H 1C5CL 1AS8A 1F4XL 1UB6B 3GIZL 4XMLH 2WNKA 2ZJSH 1KCRH 3WTWA 3IJEB 4Q58C 5H37G 3HI5L 4TTGA 3CZKA 1DQMH 1TQVA 5C86A 5DHVA 3QULB 1T0NA 2COQA 4UTCA 4M4RB 1E5AA 1I9EA 1ZHNB 1X3DA 1DQDH 1KC5L 4XNYL 3IGFA 3UJIL 1RMFL 4U2ZA 2VDPH 4HIQA 2D9CA 3D0LA 3O3DA 4JN1L 2E7HA 3BEVB 3FB7A 4KO5A 3ZE1E 1FNEB 4YHIB 2X1PA 4JPVH 2EH8H 3S3DB 5BS0B 5CFHA 1E4HA 1NCDH 4M7LT 5CKGA 5H35B 4D9QD 2DH2A 3CK0L 4MMZC 3TO4D 3PJSB 2E7CA 3DBXB 1VF5C 3WFCL 4TUKH 1J0JA 1RJLA 1FVDB 5E23A 3QCUL 3BKCH 1EFXA 1IM3D 4H1LH 3FTXA 4M6AA 5FUZL 4PSRA 1L6ZA 3V6ZA 1TZGH 2Y7QB 2ZOOA 3QQ4A 3HTLX 2FBRA 4L3AA 3KG5A 1A6TB 4AH2B 2OMBA 3MHZA 4JRYE 2WV3A 3IDJB 1I7ZB 1L9MA 1LK2A 1G1OA 3MUY1 4X6FA 3RB5A 5D1ZA 2ICEC 3WHE1 2CE6A 3SQOH 4YDIL 2HMIC 3MRKA 4P46A 4M02A 3GNML 1P6FA 2F19H 4PJ8B 3KLKA 4MQ7A 2WWNA 1RUML 3PWNA 5KVFH 2YAOA 1A3LH 3L4UA 2AJXH 2G4EA 5J7CC 1RK0A 5LO7A 1FZJB 2KERA 1DO6A 3D39A 1EZLA 5JHLA 1TQTA 4A2HA 4AKQA 4UAOB 3HRZB 4PWJA 5JZ7C 1KLGB 5LDUA 1YYMH 1IZJA 5AW3B 4DEPC 3OLDA 2EJ1A 5DR5H 5IBUB 3AZUA 4J4PD 4QUOA 4APQC 2FX8H 3ZTJH 1SBBA 2UX7A 4BQ8A 5F9JB 3B5HA 4M1DH 3WLWD 4PS3A 3L3JB 4U3XA 4IDJL 1RP9A 3EHBB 4N0CD 1OV8A 1RZFL 3BEVA 4R83A 2HFEA 3NEOA 3UDWC 4ZOAA 1G6VK 5JIKA 4FP8L 2VXUH 3RX5A 2WLNA 3PY9A 4X6DB 1IC4H 2HSIA 4XNDA 2X4NA 3ULUD 3C60C 1KPVA 3MLZH 4Z7OE 1KN4L 3NACH 1CTMA 1MW2A 4HFUL 2IC2A 2XFGB 2Z6FA 3NABL 4HUXB 1GC1L 3K91A 5KYUA 4KKLC 1INDL 5BZXA 1XX9C 2WB7A 2D7MA 2W80C 3MDJA 3D9AH 4Q52A 1KEGH 4HUWB 2BS8A 4QCIB 3TPUB 4QY8B 1S7SA 1BQKA 3UPAA 1EJ8A 2I07B 3DECA 3TT3H 4XMVA 4DPAX 2CHXA 4IHOA 1IM9B 1U8JA 1DVTA 2MKWA 4O2CB 2GFBB 2MJWA 5C0IA 3ZYZA 1H3TA 1NPJA 2ED6A 3DX6B 4O02H 3KPPA 1NDGA 3TBYA 3GZPA 2WP3O 3DDFA 1BVLB 3NJMA 5E94A 4EKJA 3ULUE 2EIBA 3RNKB 2KYIA 3B2UD 4X6EA 1EDQA 3GQFA 5I6MA 4ENED 4FQXB 2YQ2A 4WTWA 5ICUA 2DQCH 5JHDE 5J6HA 1IC7L 4KKRA 3DV6B 3KS0H 5I1IL 1CLYH 1AR1B 4LPYA 3GJFK 3G08A 5CLTA 2EXSA 4AQEB 4IS6B 4L8DA 3G6DL 3B1TA 4Z6AT 2VR7A 2GY7B 2YN5A 5KTEH 2OMXB 1S8DB 2A9AA 3N42F 1IE4A 2VWEC 2FWLB 4JUTA 5ISZE 2J88H 4OV5A 1I8UA 2VLJB 4FFZA 1CUOA 1M2VB 2WVTA 5ANMA 3VRJA 4LLMB 3H9YA 1UXWB 2UUDK 2ZKXA 1JIBA 3EFOB 3EHBC 4PBVC 4ZOBA 3MLXL 3T0DA 1IILE 4WHTA 3WXVH 3PLYA 3ESNA 5J1SC 1EAOA 3TZVB 4Z3FA 5CZXC 4TPRH 1WJ3A 4JRXB 3V4VB 1KGCE 1WAEA 4PY7A 4QKTA 1FPTL 2J8UA 2E9WA 4YNYB 2HPOA 2ROYA 2Q10A 1T5XA 4H88L 3SO3C 4BSWB 1JXJA 1KCVH 2OL3L 3O45B 1OPGH 2A9CA 1IBDA 4QRRB 3FTZA 5BZWA 4F5CE 2O61B 4LLWA 4DP2X 3D4YA 3QQ3B 3OVUB 2OJ1A 2NT0A 1G4MA 4LMQE 3RHWF 3VXOA 1U8KB 4HEME 1MQKH 4O9HL 2WSKA 5EULV 1U8QA 3KNBB 4J3XA 3WENA 5T33L 1E4XL 2KI6A 4NX0A 3VGBA 1MIEL 2ZYHA 3VXNB 2LVCA 3QR0A 4GXVL 4W4OC 2DQUL 4Z7UA 5F70A 4FFYA 4AW7A 3W0WD 2MEJB 4BWUA 4QT5A 4QRSB 5TD4A 2D9QB 3K2IA 3HCVB 3OJ2C 1OGAA 4KQ3L 3BPNB 4L5FH 5GGTL 1ZLUH 1RZ8B 3HBGA 2G2NA 1I82A 3CVHB 1ORQA 2CCVA 3X3FH 2VMJA 1MF2L 2X89D 3ZTCC 4PRPA 3IDNA 1ZPUA 2BVTA 3D0AA 5FM4A 2P8LA 3CC5B 3TFKC 3UP1A 5CHNA 5LDSA 4Z7NE 2VLLA 5IMLB 4GUOA 3H7BB 1ZIAA 4GW4A 5CIPB 1LE5B 1Z3RA 4EQ2A 4UQ9A 3ARBD 4MJ5B 3ZQXA 1BDYA 1F4WL 2HTLC 3UYOD 2NR6D 3W9EB 2X4SB 1KPUB 3RL1B 2KDYA 4PV9A 4S10A 3ZTNL 5SV4A 3LHPH 3TN0B 4EI0A 1XGYH 4NRYA 4IGBA 5C6WH 4Y5VA 2KKQA 4W9EC 3T65B 3MO1B 1EANA 1LWHA 1UKTA 3OAWA 3TZVC 4LAJH 3U6XS 2YD4A 5D7IE 4CDGC 2QLYA 3S98A 3BPOC 3QXUA 3S0PA 3TO4A 1MIEH 1IFHL 1NKGA 3ZL4H 4NN5B 2V9UA 1GZHC 3ARVA 2QQKL 4HH9B 3MUZ1 4X5WB 3QWRA 2B9BA 1S9VA 1B6DA 1GCFA 2NX5D 3P4NA 1ED3A 3EYOB 1UWXH 4KX9A 4LHUB 3W38A 4NHUB 2OTUB 3MLSL 4LXFA 4KNQA 4F7TA 1J1OL 3ELAT 4X7FC 3BXNB 4EO5A 5KBNC 4PW4A 3QQ3A 4BSVA 1OM9A 1D7DA 2DWYA 2FO4A 5C08D 3HZ3A 3GJFB 3GMRA 1F6LL 3VXSE 1CU4L 1TSRA 4LU5H 3U0PB 3ULVD 2VN7A 1Z3GL 4RGNE 2CO6B 3ZDYB 1CICC 3Q05A 1FORH 4KROD 3OPZL 4NKQB 4D0BB 3AMKA 1PIFA 4YLBA 3LKQB 1I1YB 1QEWA 4M5ZL 1BZ9A 3D8MA 2HJKA 2PO6D 5CF3A 1WC7A 5C09D 2CKBL 4IMLB 4P99A 1KFAH 2J57A 4BFGA 3INUH 5K39B 2QDVA 5DS1A 3MACH 2XXCB 4D8OA 3ZBMA 4KK8C 3QG7L 2C3XA 2XZZA 1NINA 3KBHE 2QSVA 4PJIF 4F92B 3SGJA 3V4UH 2OCJA 5KSUA 2Z4TA 4HLZH 5DEGA 1AAJA 3L1FA 3QRFM 3NJKA 5C0NC 2G9HA 4LOEA 2GC4C 3BJLA 3OC5A 2Q86A 5L4MA 4XZUA 5DA0B 2WQXA 4AEHH 1L3WA 2HTKD 3RWEB 4FTVE 3JSSA 1JD9A 4JKNA 1SY6H 2YD8A 4FTVB 1A8ZA 1N0LA 1QZNA 2B1AH 3RA7H 2WBXA 1IKFL 4RGND 4WWKD 3SO5A 3WL9B 3CH1A 1OCRB 3F01A 2J7LA 1N6UA 4PV9B 4S1SL 4O02L 3ZGIA 1O75A 4LRNH 1QBBA 2C7UB 5ID1A 3BWZA 3CVBA 3GM8A 5GGVH 3TBSA 3MRPB 4H26B 4X8JB 2NMSA 2ADFH 2A4ZA 3AITA 3O8XD 4RVBA 5EORH 3TU6A 4OVVA 3NSJA 1SN0A 3QFJB 2A74B 3QHFH 5LNDA 2G5UA 1Y6MR 5GGQL 2ISDA 3VRJB 3MR9A 4F7EB 1S5IH 2DQFB 4EBQH 4HJGA 4YFLF 5ENWB 3NIDF 3OGCA 2A99A 4BK8A 3S88L 4YQXL 4ONFL 5B38B 4IRJA 2W94A 4PJCB 4L3CB 2QLVB 1FYTA 3BIKB 1HIML 5SWQB 1JZ3A 5GHWH 5K1JA 2X28A 2R7EA 3VB8A 3MCYA 1L6XA 2IVFC 5PCYA 4GSQA 5L2JB 3Q2WA 2EICA 3LEYH 3QFDB 3QNFA 1FN4A 1DFBH 5FCUL 4ODTL 3S34H 4KQ0A 4OSUH 1UWGH 3VXOB 4RISL 3QQ4B 1KJ2H 3MROB 3JTTA 1ZTXL 1OXYA 1YAZA 4WFFD 1ADWA 1TFHA 3BDYH 1CCZA 5H94A 4G8FA 1HHKA 1F90H 1C7SA 5BO1H 1NCAL 4PR5A 4F15C 4HIPA 4FQLH 3VXPA 1MIML 1INEH 3F58H 4TOYL 2GJRA 2ZOWA 1FH2A 3MPCA 4YSQA 3TEZA 5K9QI 1PLCA 2HG5A 1IGYA 3CFNA 3F7VB 1A7OL 3C5XA 5IROD 3L6FB 3Q01A 3I50H 1WAAA 1E90A 4QYOA 3S5LA 5MP6L 1QO3B 4DGVH 2UZIL 1W72A 2IH1B 3H9HB 4YSCA 4WJ5B 4POUB 3SOTA 5DDHB 3ZDWA 2R1YB 1MFEL 1RK7A 3HS0C 3J2PA 2FL5A 4XC1L 1UATA 2B16A 4GIPD 2J73A 3L3DB 2M26A 3VB9A 1DUZB 1KPUA 3O6KH 4DGIH 2EP6A 4PY7B 5D1XD 3LDBC 4X9IA 2F53E 1R5VB 1NAML 1XH3B 2HX9A 3G9VA 4XO5A 4YXHH 2DWEB 1GS8A 2YC1B 1BLNA 1XB6A 5C0EA 2UY6B 1NSNH 2VM4A 4MVBC 2ZAGA 4ZAKB 1HCYA 1MAKA 1BWWA 2CRYA 4GXFA 4I13B 1IGTB 3RWDB 3OJDA 1QA9B 1CF8H 3QORB 4MWFB 2W81C 5E6IC 3QHZL 2FNBA 4CC4A 2R69A 1U8MB 2LT9A 3LZOA 5GJTH 4QF1A 2PP7A 2Q7YA 4WKXA 1V7NL 4GSDH 1I7UB 2M8XA 3LH9A 4EMZA 3DHUA 1KJMA 3N1PC 4TQEL 2XWJB 3NH7L 3BZ5A 2APTA 5CEYA 2EXYC 2XG4A 1F6AB 4KXCA 3EJJX 1EGJA 4GKSB 1S7VB 4JFQB 1KCSH 2FUQA 2D8KA 3V79C 3O4LE 4OI8A 1P7QB 5CO1A 5KN5B 3D39D 2UXTA 3VVWA 4I4WA 5D72H 4ZMXA 1RPQA 1HSAA 4PJFF 4EN3C 1HFUA 1ROCA 3FTWA 3O6LH 4GRWH 5E1AA 1KB5L 1UB5B 3G5VB 4UYQA 3ZPDA 5C0IB 3FMGL 2AHIA 1NFDF 3UTSA 1MJ7L 2YRBA 3ARDB 1U6AH 1QPPA 3LNIA 4QLWA 3GLZA 3CJJA 3ME0A 5KYYA 4UNUA 2R1WB 3KBPA 1HOCA 3CFUA 5FO2A 1DTUA 1PX3A 2BY1A 4KK9D 4BUHA 4LEOB 3QJFB 5DO2D 1W9XA 5EZIL 4JRYD 4LE8A 1JYVA 2BIHA 2AERT 2ZE0A 2VXVH 1FJ1A 5AAMC 4CW1A 5J8OA 3MRGB 3ZKXB 2CJUL 3F3HA 1OLLA 4XOAA 3G08B 5K59E 1XH1A 3UC0H 1KJVA 1YN6A 2D7NA 1G7IB 2GK0A 4YPGA 1MREH 3MJ9L 4HU2A 1JG9A 4PGBB 4RRPA 1D6EB 4XN4A 1GZQB 4HOWA 4PJ7B 5LQBL 1A8JH 1OP4A 4Z7UE 5EOQL 4H25B 2VQ1B 3HZVB 3S5ZA 5GJSH 5DJ6B 4F27A 5IV2B 4P23A 4MBRA 4J3TA 4PWGA 4KUCF 3V8OA 4XWOD 4OCRL 3BSZH 1QFPA 1W15A 4R0LB 3LH2H 4ZX3A 4F37K 2X3AA 5JR1H 1TJMA 4NO0A 4KX7A 2Z3FA 1OOWA 4OZGF 4OTXH 5EIIG 3DBXA 4R90H 3GT6A 2P24A 1JZIA 3O6FC 2VQTA 1ROWA 4EN3D 4DPCX 3V4PL 4XAWH 2XBZA 3UIYA 2VN3A 4ETQB 2W0KA 3NDZE 3X12B 5IVXB 5IW6B 1GYCA 1NAKL 4UQEA 4HK3J 3RVWD 3ZYJA 5DVOA 1FNHA 3QZWB 4IYKA 5FAAA 3S3PA 5BV7L 5G5DA 1A14H 2ZWNA 3T6XA 1EFXD 1EH9A 1OE2A 2NNXA 4XGZA 3VVVA 2CBPA 3BZFA 4XAKE 5HHME 5GSRB 3JTSA 3IPBA 1OB1B 4ICWA 4JHUA 5C09B 5T5NF 4YSRA 3SOBH 3L5IA 4PHZA 4W68A 3PHAA 3VI4B 4KH2A 2DBLH 4ADJA 1T03H 4NT6A 1ZGLP 1MCOL 3MRKB 2Q87A 2C1OA 1R3LA 5B1AB 4B9KC 2XWRA 1JGIA 4DZBB 4HMCA 4HUVA 3HIZA 4WI5A 2RJMA 3FC8A 2H3KA 2ADGA 2Y24A 4YL9A 1UHVA 1ZTXH 1ZS2A 1WFMA 3P4MB 2XA3A 1SZNA 4OZFB 3V5DB 1DBML 2IAND 1KMGA 3AB0B 3D69B 5JR1L 4OCSH 2FQEA 3FPYA 2XWTB 1AS7A 1I8LA 4R8WH 4G43B 5FUZH 3TT1H 3VXMD 4LSQL 1CK0H 4ES8A 4NKMA 5I6KA 3IE9A 1PZSA 4K8RD 4J3VA 3PIQA 1E2ZA 1GZQA 5EU7E 2BIIA 2FB4L 3QIUD 1SJEA 4U1GC 1G9MC 2E59A 3TEUA 4FADA 5F3BB 3NEEA 2WXIA 3RBGA 3T0EB 5BOZG 5FDWA 2XXMB 4PWFA 1WAPA 1NM9A 1KWKA 1EVUA 2APSA 5HP5A 5F3FA 3QUHA 1AZRA 1RK1B 3HE7C 5IM7B 3O9WD 4IRSC 4JG1H 1TJIL 3AS2A 4E5XB 3NT0A 4OCSL 3QJTB 1BW8A 4P23D 5KUKA 1MRDH 2OJEB 1UD4A 4JFFE 4WI0A 5MEND 4JAMA 2IALA 2IGFH 5ESAB 1KIQA 5BO0D 3B2XA 3FB7B 1BF5A 4JRWA 5AZEL 3O6ML 1M9WA 4N8VB 2DQMA 3NABH 4IM8A 2KH2B 1F3DJ 4JFXB 4Y5YC 5C8JA 3S4SA 1ET5A 4JHWL 4N2GA 5GZNA 1TYRA 4I3RL 3ULSB 5B1CA 5HGHA 3WYRA 5CEZE 1MXDA 2XWBB 2CCLA 4HXAH 3R18A 1Z66A 4PREA 4ZOEA 1MELA 2Z34A 5FR3A 4G6KH 3F7YB 3LN5B 1J0YA 2FH8A 1BQLL 5IW1A 1OSPH 4CGTA 3LXBA 4QJ3B 4B41A 4DZ8A 4F8LA 1CGWA 1UXLA 4ZMOA 2WBJD 4U7KA 4FMVA 3LSOA 4G82A 4QHMB 1R3LB 5J11B 4N2AA 4AIXA 4C4UA 4MDJA 2OXGB 1NWPA 2NNFA 3MRJA 4NQCD 2ARWA 2DB8A 3VFGL 4DERA 3RPKA 2MMXA 3EGDB 2DY2A 1LMKA 3TCLB 2JCCF 3QUZD 5HPMB 1C7TA 1ZAGA 1F3DH 2KHAA 5KJ7E 3H9HA 4PJAF 1Q0XH 3CX5J 4EN2A 2OL3A 1CI3M 3SE4A 5LKNA 4Y19E 1U8HB 5ECJE 6PCYA 1J8SA 1UQSA 2R2HB 4CADB 1J9SA 4FS0A 5DHVB 3I3EA 4EEEA 1I1AB 4AY0A 4RRPG 3MTXA 4F1SA 1WZKA 5E9DB 3TYFA 2AJZB 3G5WA 4OF7A 4JO5A 3L81A 2A6IA 4KRMB 4WW1B 5E1IA 5AW2B 1UJ3C 4TNGA 1X7QB 5F9OL 3FUNA 3UABA 4WUUA 3HEIB 2XZAL 2IPUG 3IFNH 1BVNT 2XQ0A 4N68A 3FFCA 4FZ8L 3CDYA 1HAWA 4YLQT 5FYJD 4OZIE 4JDVB 1MCBA 4X80H 3TCTA 2CO3A 3Q5OA 4FG6D 4RBPH 4OM0L 1BFOA 3M6DA 1F6AA 2DL9A 4G5ZH 3TO2B 5DURD 1AC6A 1U6AL 1SLVA 5IG7B 4AV4A 4QTHA 1S7VA 4JFQA 3K8LA 1KGWA 1HHIB 4UTBA 1DJSA 5FYLE 5L2JA 1ACZA 1G5GA 5ADPH 3L2MA 4V1DB 3ABLB 3WFHA 3O6LL 1EJ6A 5DRXA 2HZHA 1T04A 3QXTA 5CCKH 4WCYL 1ZA3A 1EAJA 2ZYIA 3B1UA 5T1LA 4J6RL 4M7JL 4KROC 4ZMWA 1K3IA 3WIHA 1O6TA 1R5IA 3QARA 4NGHH 4LRIC 4K55A 2PCXA 2EKSB 3IAGC 2G3NA 3ARDA 4OZFG 1OTUD 5DJ2B 4OT1L 5JW4Q 4G42A 3SCMC 3MLWH 4G7QB 2EEXA 4ZSOB 4PRPB 2ZWLT 4N2HA 1N67A 2NXYB 5ADPL 2OTWA 4TSCH 2BP8B 2JIXA 3KM2A 2JSFA 5DFWH 3V8CA 3IFPA 4UMSA 5EU6A 2SODB 5D6CB 5ERWB 1ZVHA 4FKKA 4GRLC 1OE1A 2D7QA 2G3XA 3QH3A 3QNXA 2X9XA 4ACPA 1I8IB 1FG2B 1CYGA 1XSIA 4Y8DC 3RIFF 2B39A 3EYQD 5F7NC 3PABA 1SLWA 3VTMA 2DM4A 3HG1D 4P57B 5D96C 3ROLA 4P4KA 4BZ2L 2N4IA 3CLWA 3DIFA 1EZVY 5T33H 1YY8B 2PKDA 5FV2A 2F5AL 3X3GL 1S3KL 1AZVA 4PCKA 4ZQTA 1C08B 5J9PB 5HHMB 3FTUA 1SXCA 5BV7C 5K59F 5I73C 3SGKC 2WQUA 5B7FA 3QO0A 4KVPA 1H19A 2VMCA 2ZXDA 5JXEA 3CFIC 2CLRB 5T1MB 1EK3A 3GZQA 3JBG7 1E6JL 1GYWA 1TQCB 1XIWA 3TBBA 3N55A 4HS8L 2YC1A 4M5YL 4KO6A 3FU8A 1D5BB 3I6KA 5FGRA 5IVNA 3ATBA 2UZPA 4FE9A 3IDMA 4RAUB 3TZVA 3E9TA 1CLZL 2XBTA 2BVUA 5HDLA 4KK9C 3ZZSA 3ZL1A 1A1OA 5E08H 3SDYL 1JERA 2R2CA 1Q1JH 4HX1A 3IJSB 3VXME 1XGRB 2PPDA 4M9PA 3CZFA 5L2KB 3RWFA 4Z3IA 3V4PH 32C2A 4JO3L 4YWGH 3SKMA 4N3UA 4HMDA 4DVRH 2IWKA 5L2KE 4P2OA 4YEFA 2EVFA 3I74A 3KPRB 2Y7OA 3HMXH 3QJSB 5EH1A 3T0EE 4B6ZA 2R59A 2J6WA 3OAUL 2DI7A 1XXDC 1CVSC 3M88A 4ZO8A 4OF5A 5AD0B 1KT2B 12E8H 2HAZA 1EVTC 5CEZH 4V2BA 3FQ2A 2Q9OA 4JX0A 2B59A 3IK2A 4NWTH 5KSAB 3QZNA 4Y4FC 1DYZA 1VENA 2PYFA 4M43H 5FUCE 3FTGB 3T8VA 3EH4B 5BV7H 2CO7A 3IJYB 3C60B 3T08A 4I1NB 4WUKH 3JWDH 3MRCB 3RWEA 1NGWA 2CO4A 1WFIA 2PW2A 5CWSA 5DFVC 1NIAA 5DSCA 4J6IA 3IU3A 4QXVA 4HJIA 4JPQA 4LP5A 1HI6A 1MLBA 1UCBH 4G9FB 2YJQA 3ZKNC 1S7WA 5A43C 5EBMA 3NYKA 2EXWC 5AVYB 5T1KA 3QRLA 1BOYA 1M2VA 1HYSC 1R9FA 3IMVA 3H7BA 1XF1A 5CIPA 5L2KD 3WLWC 4IBZA 2Y25A 1TF4A 2XY2A 5I30L 4QRBA 4Y4FA 2W0PA 1E7UA 3BKCL 1MJUL 5DVPA 4Y5XA 1DJGA 3NIGF 3TEXA 1HN1A 3NPZB 1TNNA 3GYRA 2EDEA 3TBVA 4Y5VB 2FO8A 3KGRA 4YSOA 3BP5A 4B7IA 3EJCA 4UDTB 4GSXA 4ZTPH 5C09E 2CUHA 3ERXA 1G7LB 3REWA 1X5IA 4G7VH 3MBEB 1MJJB 3RA7L 3LIZH 5BRZD 3F83A 3P0VH 5HDOA 1DUYA 4P2QA 4JK0D 4HPOL 2O5ZL 4MVBD 4U6HB 1DQDL 1KC5H 4XNYH 5DUBA 2MCMA 2DTMH 1CFQA 5MHSE 4CNIB 5DFAA 3WU1A 1HCVA 3IJHA 2I27N 1DL7L 4JDVA 3WTUA 4KI5E 4CVWA 1XF2B 2YUWA 5IFJA 1JV5B 1LDSA 1FAIL 5I1EH 3KMDA 3OKKB 4PP2A 3KLAB 3C6EA 4OGYH 4OD2B 4AOFA 3KM1A 3GMPB 5ACZB 2FYVA 2W91A 4HT1H 1NBZA 2FSDA 1C8PA 3UFIA 3MRLA 3BGMA 2B14A 4JPIA 3C09C 4UBDC 3OSKA 2OI9C 1JHLL 1TYEB 4JFEE 2DQ6A 4UOW0 4MA7H 5DK2B 1CVRA 2R0KL 1MFMA 2VDLL 3ZKXC 4L8SA 3GEWB 5FYLL 1WAAF 4F58L 2ZWKA 1TO4A 3HUJB 3EDFA 1UT1A 2I25N 4N2KA 5FGBA 1BVOA 1BJ8A 2BZ7A 5SWZA 1JN6B 1OAZL 4XOEA 1BXVA 4QGTA 4ZSOA 1YNLL 4PJ5A 4K7PH 1J0KA 3FCUB 1AGDA 4JFFB 4AUJA 4E9YA 1BGXL 2OTWB 3W9DA 4HXBH 4TUJA 5EC2A 5JNYA 3U4EB 3DGGB 1LO3H 4FNLL 3VG9C 4J39A 2ZCLL 3CSGA 2LU7A 1YEHL 4N9GB 1MI5E 3SDXE 2VUYA 4YAQB 4IBWA 2ZG2A 4F93B 1G6RB 2C4XA 4UQDA 4RNRB 3LTVA 3N0AA 2DMKA 3KD4A 3RDTC 1EEYB 1NC4B 4LLVA 4OV5B 2DN7A 2EABA 2P9RA 4HVBA 5G55A 3HHSB 1WWBX 1EGJH 3C9NB 4JZJC 4PLJD 5FOBB 4N2FA 1SLXA 4W93A 4KK5D 2OSXA 1ED3B 2WNWA 2YZ8A 1MCLA 3EYOA 3QZLA 4QNPE 2EECA 2IDCA 1F02I 1B0RA 2KDGA 1KB5A 4O5LH 1MVYA 3P3YA 4QOKE 5G4MA 2X2JA 1PBYA 2MQCA 1U93A 2PN5A 4G8EB 2WWKT 4DP5X 3U4BL 5LAXA 4BDVA 3WGVB 4CJ1A 5ESAA 3N43B 3CLFL 2MHAA 4JMXA 2W0FB 4H20H 2H2PC 3LZFL 1NICA 2WSPA 3ESPA 1ZIBA 1TDQA 1VHPA 2VLRA 5K9JH 2O61A 2XI9A 3BWAB 4MZIA 2IV9A 3LZNA 4U31A 3CMOL 1NMAL 4B95C 3OKNA 1QOKA 3RKPA 3M17B 5ALCL 1D5IL 5HYJE 1K5NA 1RHHB 4NOFA 4ORGB 4K23H 4G1MA 1QUPA 3G04B 3HS0B 3KYOB 2N1KA 3DUHA 3P0YL 3D51A 4IOSD 1D5ZB 3ULVE 1ZA6B 2AXGB 1DEEA 3FF8A 4WIQA 3ZE0E 3LD8B 2ZOLB 4MQXD 2BNQB 3HNSH 4O2EB 4IRZA 3S34L 2YA1A 5K1NA 2X4QA 1I3GL 1NLDH 1EJFA 3TIDB 3ZE0F 3MV9D 1NC4D 3VRIA 2A9MH 4AXWA 3P9LA 4KJQD 3CDGB 5SWZD 4WUKL 1O9WA 1SM3L 3RWJA 3FH5A 2YBRA 3SD5A 5KVFE 4PHXA 1ET7A 1QLFB 2D0HA 1JZGA 5HGAB 4UIMA 3RGVC 2V8LA 1P4LB 3BWUF 2DM3A 3RWIB 2XWDA 5DCCA 2EE6A 4OFYD 4RAHA 4U7SA 2WLKA 1BQRA 1Y0LB 3DRQB 3FSVA 4OCYH 1WEJH 5BUAA 4YZFE 2V3DA 1JZ5A 5IMMB 1RL1A 1KJ2A 4OCMC 1JPEA 1UD8A 5D2LA 3TYFB 4AQ8C 5ICYB 7PAZA 1MCQA 2CXKA 1JGEA 3DTUB 4G7SB 3JZYA 1QMUA 1KEMH 2EDQA 4GQ9L 3UGEA 1R24B 5HHNA 1R4XA 4DGYH 5T5FH 4PIRF 4NJ9L 5IB1B 2HTLD 4DWHA 5B3JF 1EAPA 3L9RA 5GIRA 1WWWX 3JWNE 5A16A 2VR3A 2N7AA 3MV9E 3PV6A 1OAKH 3P3RA 2ALWA 3C08L 1T89C 4P49A 3ZW3A 5D1ZD 3OC8A 1HKLL 1BAWA 3BLBA 1DVSA 3M86A 4P23C 1XCTA 4HKBA 1M7UA 5FUOL 4HHAB 5BS0A 1GJUA 1I53A 3QVAA 2J1KA 3WIIH 2JKNA 2ZZUT 3EJTA 5KBLA 4KMLB 5E56A 2O5YH 4TS6A 4X5PA 1J48A 3CIAA 3F5WB 4PW9A 1CB4A 4GW1A 5JW3H 4XGZB 2JXMA 3UH8A 2AQSA 3KWXA 2L8AA 3EDEA 5CU5A 5A6MA 3UL4A 1OP3H 1CDUA 5D9SA 2X88A 2Y7QA 1WHOA 1T89A 1ZJBA 2BZDA 4RFNC 3P02A 4OAWA 4IBTA 4OQTH 4IIZA 1JGLH 4JY4A 2EDDA 4LEXL 4N1CA 4ODWB 1LO4H 3N42B 4AT6B 5I5IA 5M94B 3TBYB 5GGVY 4D8PB 3VWJA 2VDRL 4BRJA 4D3CL 2YIHA 4BZ2H 1BBDL 4G70B 2C3WA 5SX4I 2H2SC 1Z9OA 1I9JL 4DKEL 1J5DA 3OTTA 5C0FB 4TVPL 2CRIA 5HSFA 4NKOB 3IDUA 5EU4B 4UAHA 2IV8A 4Q2ZB 4WW2B 2XN9D 2Q8AH 5I1KH 4BA0A 5ITFA 1UM4L 3C6LB 2ZICA 3O81A 5EOTB 4P5SA 3FONA 2QPFA 2Q8AL 2OQJA 4PJ5B 1JTPA 4MQ7B 5D70L 3VGFA 1QNZH 3F6IA 3RWIA 4ONFH 4MA8L 1M3JA 3L3OA 5T5NG 3AMLA 1SXSA 2ZP9A 3WFBH 3K8MA 2R0WL 3DUUB 1T0NB 3MBXH 3QORC 4JO4H 4WWID 2PPEA 1A3RH 5E6IB 4OFIA 1B0WA 1HNFA 3GUFA 4FLRA 3G9AB 3SPHA 2ZSVB 1XCQB 2YA0A 5E99L 1AIFB 4HWEH 1HYSD 2IH3B 3NIDE 1DJIA 5LBVA 3L2NA 1Q90A 5DLLA 4NJAL 1L7TL 3CCHB 5KOVC 5G2NA 4HZLB 4OLUH 5F7WC 4LESA 2E75C 3FU9A 4ZI8A 1IGJB 3DHPA 2V2XA 3FU3A 4U3SA 4POZC 4JN2B 3NSXA 3WMPA 3AXIA 1ZV2A 3CVCA 1T6BX 2OSLA 3TN0C 4MNQB 4A2MA 1KSRA 2O5YL 3HG3A 3TESA 4XPAH 1KJMB 5HHXH 3QHTC 2A9DA 5CZXD 3T77B 4MTMA 3FO9B 1UA7A 4L8BB 1U42A 4M6OH 3BKYL 3V5KB 2WQWA 3AVEA 3FO0H 1MNUH 5T3XL 2YGVA 4DP0X 2JVUA 2CIIB 1DANT 4FN0A 3WS3B 4F37F 1R3IL 4KVNH 2QSTA 3KJ4C 2DQTL 4J3OC 2KZ1B 4R96B 4RMUA 5E8OB 5DJDA 4DAGH 1QPXA 5IB3B 2AAAA 3J27A 4U6XB 1HXKA 1SMDA 4A39A 1WIUA 4K07A 2OMWA 4KUZH 3DVGA 4YSSA 1PD0A 2NY3D 3TJEL 2YPVH 5F0PB 3FULA 4URTB 3AB0C 1J11A 1PS3A 1IV8A 4DKFH 4O58H 1SDDA 4Y4KD 4KZCA 5MENB 3QJFA 2GTWB 1KTCA 1VPOL 4L05A 4WK0B 2C9QA 1FJ1B 4UV4L 1MFDH 4Z3EA 1CFMA 1YYCA 4KMTL 2OQJB 3MLVL 2AQ1A 4J23A 4OCLC 2YD9A 1FLRL 5F7FA 3BHBB 1OOAA 2Z35B 3MOBH 4XBMA 2Q0ZX 1YC7A 3LY6A 3FL7A 2VJ8A 2G75A 3DURA 4G3YH 2P5WA 2PPAA 2X4UB 4XMPH 2IH1A 5KS9F 1SVZA 3SHSA 3MRRB 4WTZG 2R1YA 4LDOB 4RGOH 4TSAL 1DLHA 5L9DH 2NNAA 2YHGA 3KVPA 3BAIA 4G8GE 1LYQA 4Y9EA 1IGJA 1B0RB 3MAWA 5DD1L 3H4HA 5JDSB 1MG3C 2PTTA 4UDTA 1BVKB 2R29L 2IMNA 3MNWA 3QC6X 3HG1E 4OZHF 3PQYB 1ES0B 3T1FA 4X7SL 1UOKA 5I1EL 1WSST 1AO7B 1I8KB 3MLUH 1U95A 5CZVH 4XCYA 1WP6A 1AXSA 3W2DL 4OFDA 4F7PA 1FL5B 5IB2A 4K7FA 3TT3L 5IWLA 5D72L 3VMNA 1RLBA 5FWRA 2YAMA 3Q2VA 4NERA 3BESR 4QF1B 3OXRA 2WZ5A 1BM7A 1EHLL 1KXHA 1KEGL 4JRYB 1XF5A 3V0AC 1I7UA 2XICA 1JWMA 2CO6A 4N26A 1TJIH 3DPBA 3PWPA 5GRVK 3IGKA 4UANA 2ZT9C 5IFJB 4WNQA 4HV8A 2N3JA 1IRAY 4FNUA 3AXLB 3U36A 4PP2B 1HH6B 4OY9A 4A2DA 3W39A 4JM4L 1LP9F 2WVVB 2V7HB 4KNTA 4L37A 1URZA 3BGAA 3SODB 2HVKB 1C16B 2FT7A 3AUVA 4CRPA 5I15H 4Y5YB 3BQUB 3V7AG 4UQCA 3PWPE 1QI4A 2G5BA 3ET9F 1KACB 3T3PE 1T3FA 3KLDA 4L8SB 1E67A 2FLMA 3V6FB 3NSYA 2WAQA 3DOHA 4CMHB 3NP3A 4JVWA 1KXTB 4ZMNA 2BY2A 1J5IA 5J13B 1CICB 1RFDH 1OPOA 1FNAA 5C08E 7FABL 1JV2A 5AZUA 1OHQA 5EN2B 2ZUYA 3KPOA 1AFVL 2OL3H 1TTFA 3MCG1 4XTRC 1A9EA 1UXSB 5EWIL 3CPLB 4RWYH 2BJMH 1USZA 1JGUH 2AQPA 3MTRA 1KULA 3UTQB 1J8KA 4NN7B 1CMOA 5LGJA 4U1GB 4UB0H 3TEYA 3L4ZA 3ZRFC 5GSVA 3RGHA 1HOEA 3B56A 4KV5E 1VADB 1T66C 1UCTA 4MD4B 1DJYA 4HP5A 5D4QA 1SUHA 5HYJA 4JQIH 2MOGA 4ALAC 4QRPA 3QR2A 5TE4L 1EEYA 3DVFA 3IMTA 4LLVB 5T1MA 3APDA 3VA2C 1KCWA 3MZTA 4BFJA 1M57B 2WXNA 2A3TA 4QHLA 5DU7A 2NY0D 1JNNL 1CGSH 4X2UA 1NCHA 2WOBA 2PETA 3DOIA 1ZHLA 5F1NA 1HH9B 3TL5A 2RACA 3QIWA 1ZHBA 3BW9B 3I9PA 4IRJB 5I23A 3PQYD 3ILDA 5EZPA 4YHZH 4HKZB 5IOPB 3QSKB 4U1SB 3KZ8A 5EIIB 3HZKB 4W4NA 2WLMA 2Z31A 2P5PA 1LEGB 5C7ZA 3CFQA 4XPHH 1ZE3C 2VABB 1Q1JL 2R7EB 2DJSA 1NGZA 5LAXB 4BDVB 5CJBA 1LO0H 3PL6A 4KXAA 4Q6KA 4XXCA 4HJ0C 2VR5A 5FGBC 3DO7B 1HL4A 2FDBP 1TPXC 3IDXH 4IRSB 2NUTA 3HG1B 3CX5K 1TZ8A 2CHZA 2Y7SA 3P2TA 1BQHA 1D3CA 1NA8A 5IFAL 4X50A 3MA9H 1XAUA 4TUKL 2VDKL 1UEMA 3P4OA 4WSKA 3WD5L 4F8TA 2V2WB 4P5TD 2G5RA 3GMQB 1EUUA 3FTSA 3TC9A 1CBVH 1PZ3A 1OM3H 4WVRA 5CD3A 2AK4B 3SQBB 1YEIH 1UOVA 1XL6A 3B2VL 3BVVA 3HKZA 1NCDL 2DIEA 3DRTB 3K6FA 2XN9A 3NZUA 2R4SH 1YECH 2XKSA 1KLFB 4QTIH 1I1YA 2NZ9C 1E7VA 2IBZY 2VAAB 5DD5H 2CLZA 1RFDL 2HKHL 4XXWA 4CA4A 5JIPA 1N9PA 4CBZA 2VLKD 1MCFA 1OL0A 1BFSA 4FNPA 2HCZX 3A6OA 3MRCA 3QHFL 3P0GB 2GKIA 1U92B 4G42B 3HUJE 3UAAA 4ZTEA 2GJ6D 5EN2A 1IAOA 3BH9B 5IIEB 1DQJB 1P9MC 3GBEA 4NNXA 1VFBA 3B2VH 5JW3L 1MZYA 1RPKA 4GQPH 4QTFA 5CGYC 1J0ZA 3W56A 4WU5B 3HBQA 2FB4H 4NRYB 4KDTC 3CBRA 4XB3A 4CBPA 3CSFA 1X5AA 3VM5A 2AABH 2RGSA 3FN0L 4LSQH 1T22A 3D3VB 1QUNB 4WNJA 5I1CL 1AHWA 1RZGB 4IDJH 1T7VA 1BWMA 2ICWB 4UILL 2CLVB 4RA0C 5L4IA 3NCYS 5CLXA 5GISH 3S2CA 2DM2A 1N7MH 5BRQA 4HCRA 1QRNB 5F1NB 4NP4L 2NNAB 5DD6A 2ZUWA 1P1ZB 2KUTA 4NC1C 2VLKE 4ZUVB 2PWFA 4NHUA 3QJQB 2X6AA 1H9DA 3HZKA 3IB4A 1FL3B 2F7RA 1MHCA 1B3JA 1X7TA 1FE8H 3UCQA 4ODSL 1A3LL 3U83A 4OCYL 2O5NA 2UXGA 2IQ9H 2V6HA 4FF9A 3IDMB 3MREB 3GTNA 4PJ9B 5D55A 4K7FB 2IQAA 4JY6A 2G2RA 3VFMB 2P5EE 3CDZB 2A74C 1NL0L 1RCYA 2Q2EB 2VXQA 2KC0A 1DVFD 3LNGA 2HH0L 5LBGA 3RVVC 1T2XA 4TLSA 3BE1L 1LO3L 1FP5A 3B3BA 3KNBA 3MV11 3D0VA 1R0AH 4FHJA 1UD2A 3ESMA 4K7PL 1HVXA 2E3VA 2Y36L 4K8RL 4YSEA 4UOQA 4Y4HD 2FRGP 4F2EA 1X5FA 2PNDA 4OH2A 4UQIM 4IU2A 1MFDL 1F13A 2IDQA 3EFDL 3LD8C 5JOFA 1FO0A 4XRCA 3H42H 1CXIA 1G7PB 1CFTA 2DJMA 3FT4A 5EDSA 1DZ0A 4Y5YA 4XPBH 3TTYA 4FHKA 1HDMA 3ARBA 3H2WA 1PD1A 4KNSA 3S36X 1NBYB 4KOCA 3EW3B 2MTAA 2R8SH 2QVFB 2FHCA 3D05A 1YUHA 2X2YA 3QI9A 2X4UA 1CXHA 5IR1B 1KGJA 2Y7NA 5C0BE 5LGKA 5F6IB 1LE5A 2VSKB 1J1XH 1N4XL 4B60A 1XGUB 2LU3A 4ZO9A 2G9KA 1U8HA 5JQIB 4HGKC 1UWYA 3T0WA 2CHWA 3WNOA 3HS9A 3AG1B 5EEUA 3B7UX 4OLZH 1NFIA 3QDJE 5JDSA 3U4BH 2XKNB 1NQBA 4BEIA 2ZCHL 4GOSA 1G7HA 2W1NA 4HWUA 3MNWB 5I0VA 3MV7D 3MRNB 2JMRA 2IH3A 1KTDA 4ERSH 5AAWA 2EE3A 3LXCA 4GMTH 5L0QB 2BSDA 1TU2B 3MBED 4PRNB 1TZHB 4X6DA 3RJOA 1GSMA 3TO4C 4J27A 2W92A 1REIA 4L5FL 3DROB 5T3XD 1U2YA 3RIFK 1D7CA 1VGEH 4PJ6A 2AEPL 5LAPA 2W38A 4HX1B 3NRPA 4PS4H 4AM0Q 3QIWB 5CN1A 3GI8L 2C9VA 2R2EB 5MEQA 1I75A 5B38G 3IGAB 5IP4A 3LKNA 4J3OH 3NA9L 3MYJB 1JOIA 4MJIA 4OZGA 2HRPL 2JI2A 2QHRH 1LNUB 3L3OC 5CSBA 3GHEL 3R4RA 4X9FA 1AGEA 1ACXA 3BPOB 3EYVA 3CFDB 1XZWA 5EEWA 3N9GL 3E3QC 3G5YA 3D7PA 2EIDA 2YQGA 3T0AA 1OAYH 3PGFH 2FX9H 1D9KD 4U1JA 3AQYA 4G6FD 1B4JL 3N1FC 1XF4B 3K4ZA 4N3TA 1ZDQA 4XP9H 3RWHB 2J5WA 2AITA 4TQEH 1P53A 1G6RL 2P80A 2JLLA 1HHJB 1ZJAA 4H88H 5TE6H 1ETB1 5I1AA 1LLAA 2VRKA 3OHMB 2XQYK 1JHKL 4LPWA 4C56A 3FRPG 1VKXA 2W07B 5IB5A 1PZUB 4XMKH 4TRPL 3LAFA 1T7YA 2DJ4A 1WVZA 1SBSL 2WNGA 5EO1B 3VGAC 4X6EB 4QWWC 4GI9A 4HAFA 2C4FU 3WKMH 1NSNL 5DJXB 1SF5A 2C9SA 3IYLW 3MLXH 4H5SB 3TFBA 2Q8BH 3BLKA 3DTXA 2RQEA 3HG4A 2R1XA 1H8OA 3U7YL 2J25A 4Z0BH 3QT2A 3GDCA 4I18C 2K70A 3ETBF 4RMRA 2FGZA 3WTVA 4LCWA 2VZVA 1F3JA 1L0YA 2C3GA 4JO3H 3KPMA 1CYWA 1TCMA 3MGOA 2VXTL 3FT3B 3QZMA 4HJ1A 4D0CA 2G75B 3MACL 2Y5TA 4XAKD 4M7KL 3K2UH 1ADQA 3GSNL 1T1YB 5L7XL 5GS0H 5F3BA 3B43A 4LT7A 1EMTH 3QS3A 3SDYH 3SOBL 3WG7B 4RQQB 1CDCA 4A68A 2EE0A 3DSNA 3STBA 1NGPH 3BUQA 3QIBD 3RGVA 1AJ7H 5IJKA 1SBSH 3MRQA 2WQVA 4E5XA 4ZDHA 4HUNB 4MCYB 1Z5HA 4E0RB 1DDHA 1KBPA 1ZRUA 4WWKB 5C6TH 1E6JH 3S4SG 3SN6N 3VFUB 3HZYB 2VXTH 4JREC 3L9BA 3MUUA 3U46A 4N8VA 4F7PB 4X9GA 3CN1A 4JDZB 3VXTA 3K6SA 1J05B 3LS5L 1OP3K 3CZJA 2YPVA 2MPAL 3RL2A 5CGBA 3SBQA 4NUJA 5HTSA 1GYVA 5H2BB 3UROR 2NT1A 3JWDC 1F11B 4FI8A 4M3JA 3UCRA 5HHQB 1S9XA 5I17A 1V10A 3ZL4L 1JZEA 4Y2DA 3KPTA 4I1PA 1IAKA 2HKHH 1VERA 1YEDA 5EIVA 2GCYA 2JLPA 1KYUA 1IL1B 2H1PL 2DD8H 2ZWYA 4L48A 3MLZL 2ZKHL 5KSVA 1JVKA 3OKNB 1BYPA 3BSHA 4ANWA 4UZUA 2TAAA 4XB8A 5FM5O 2J8UF 1E9PB 4BQBA 4RAVB 3UMNA 2OFQA 4HJSA 1NLBL 4OCNC 4KJQC 1EDYA 2VOTA 4KKQA 4WW2A 1RMFH 4YFEA 5D7JA 3CPUA 4QRQB 4LDEB 4LEXH 4NN7C 5IUCA 4OF6A 2DQEL 3MODL 4Y4FD 2MPAH 3NCMA 1J1PH 3TVMB 1D5XA 3R1GL 4G9FD 3C2SA 1Y6NR 2PYED 4P9HC 4JHVA 2CR6A 4IQHA 4YPGB 1BP3B 4XMTA 4U2YA 1S7TB 1JFQL 5EEYA 1NMCC 1RPUA 1D6EA 5E6IA 2A6JA 3QDGA 4ZFZB 1YDPB 2YBRB 2YRLA 3L13A 4U0QB 1BXAA 4A55A 2L7QA 5E8DH 3FT2B 3VI4E 5JW4M 3IWVA 4XO4A 1YEEL 3GTTA 3ARED 1XL4A 2CUIA 5FOBA 4N2MA 4KRPD 3SCMB 3GM0A 5DJ8A 5EPMA 3U9UA 1L9QA 2E4FA 3K6OA 2VDOH 4AC2A 1A7NH 4N6RB 4IU3B 4X6CB 5CJ5A 4IBVA 4XBGB 4MAUH 5E2UH 2XTSA 4NO0B 4XNZC 4L3ED 2AEWA 4HGWB 4S0SD 3BI9X 3U30B 4P46C 3TBTA 4WEEA 2A2QT 2X4OA 5I8EB 1EXUB 2SEBA 2BY0A 1S7UA 3DIVA 3NSDA 2OTPA 3K6SB 2B4CH 4NDMB 2A0LD 3TPKA 1T21A 3SPJA 5KSBB 4NUPA 3RL2B 1HNGA 3SBRA 5AOLA 4C59B 2AMUA 3TVMD 3QUKB 4HBCL 3QZWA 4PJCF 3M17A 5E8PA 3ECBA 1XCTB 4Y2DB 2PXYD 4I3SL 4PTUA 4JKWA 5GGUB 4F9PC 4NFBA 4B0MM 1JYWA 1FG9C 3BISA 5GSRA 4LB8A 2WWMC 4L4VE 1NCCH 3IF1A 4ODSH 5JTWA 2YZ1A 3N1GC 3EXLA 1DEEB 3PYCA 1NUGA 2YMOA 1QHPA 2CUAA 1RVFL 4MS8D 4WO4A 5EZJB 3RIKA 2E6PA 4JPIB 1KG0A 3BSZA 2GT9A 4FXGC 3BVWA 1ZWIB 1JPFB 1Z9PA 5D1QB 4TMPA 1Z2KA 1KF9B 3GLAA 4JFHE 3GO1H 3GTVA 4NP4H 2IO5A 2J6EA 5E7FA 2C3VB 5T3XH 2IAMD 4QRTB 3QI9C 4ZOCA 3UG3A 2EIMB 1YUHB 3QI9B 2WWKO 4I0PC 1QQDA 4F9PA 1A7NL 1MVUB 1JZ7A 1NL0H 2BHZA 2WW8A 5GRJL 4UIMB 4DQOH 1XDTT 4NKOA 1SMOA 1T5WB 2BIMA 5DJXA 3QJHB 2RA1A 4JPWL 5E8NA 5KVGE 2YPLA 5GZNC 4AGPA 3QB7C 5EUOA 1YG9A 3A4AA 4UDUA 2BSED 4TL4A 3BZ4A 3IAPA 4OB5H 1F1AA 2CGYA 1BG1A 4PJIB 5FFOA 1VFOA 3OM3B 4KTGA 2OBGA 4L3EE 4YPJA 2E5EA 2MTPA 4JFTA 4QRUA 3VXRA 4G6ML 1EAQA 5DQ9A 1S7XA 4PRNA 1U33A 4JANA 3BDYL 1AG6A 3ILPA 4LEEA 3FFCD 4WU7B 5FM8A 3DROA 4CVXB 4LSPL 4ODVH 3EYQC 4NKIH 3RVUC 2DQFA 1CD1A 4GEIA 4J6RH 2Y1YA 2F53B 4PTTB 2KL6A 2PCFA 3ARDD 3MX0B 5DZOA 2UWEF 5I8KL 1F1GA 3C5JB 4QJ4B 1O5DT 1CO1A 3BUTA 3HNVL 4JRXD 3KJ4B 1JVOA 4JDEB 5D2NE 4A2GA 1P9MA 2B20A 4JJOA 3EO0B 4OZIA 2BNUA 5GS2H 2XXFA 1LL1A 2N1TE 1IQWH 4F33B 3UTTE 4FFZH 5LXGH 2P24B 5KVDH 5JYLA 1U58A 1XHHA 3QO1B 4JQVA 2YGQA 3MNVB 1WBXB 1BJ1J 5FW6A 1DEDA 1SYVA 3K72B 2F8IA 3BD4A 4UM8B 5TE7L 4AZUA 2DWXA 3ULVL 1MAMH 2PCYA 2AJYL 5LBSL 3PQYE 4KKAC 4O2FB 4U49A 3QFJE 3VSTA 2BVPB 3QG6B 1Q9WA 6FABL 5JOPD 4R97B 3U1SL 2IPTL 1UJ3A 5EO9B 1J9TA 3VFWA 2XTJB 2OMYB 1MFEH 5EBWA 2NQDA 5CAYB 3OAZH 3VWKA 3D34A 3Q7JA 5EB9A 1TETL 5HYQB 1BQLH 1NTDA 3U4AA 4RMQA 2WIIA 3E6HB 4N0UA 5HPOA 1E8WA 5L88L 3WE6A 4MB1A 1QLEH 3PUUA 4G83A 1JHLH 3VWJD 4HHWA 5BUPA 3UG5A 3EOTH 3D3VE 4HDIB 1OCWL 3HR5B 4JCMA 4GAGH 4QWWD 4WI3A 1S78D 1YPZE 3NK4A 2DLFL 1TJHH 2XN1A 4L4TD 1QR1B 3T1WA 1P69B 2J1WA 4FC3E 5IR1A 1S9YB 2DQGH 2HT3C 3KPRE 3OQRA 2QKIB 1XGUA 3DXAD 4Q4IA 1UH3A 4YR6B 4BXSV 3A6CL 1KEML 4M61B 1LO2H 3QEHB 5GZND 4G80B 3ARGB 5LGHH 1A2YA 2NQ3A 2C7UA 5ELIA 1N5YL 5I8OL 1P7BA 2IANA 3LH2L 4FQIH 3VRLF 5IHUL 3P4NB 5ICZA 3MBEA 3CFBB 4I48A 1NGQL 4WLCA 2HTKC 1ZTMA 4FDWA 4ZUTA 2V9RA 4JDZA 4RZKA 4UZSA 3P9MB 2OCCB 1IEHA 1GOFA 3DK0A 2DICA 1BZDA 3O3BA 1A4BA 5INDB 1SN5A 2K9FB 1Y1DA 1T1ZB 4LQFH 3ZUCA 4MA1B 4GKNB 2W9DL 2E47A 1G6RH 3VE0A 3NFPB 1NC2A 2H1PH 4PY8J 2O93L 5F7LB 4P5MA 4MLSA 2XV2A 2A1WH 3T6WA 4ZUSA 3VXMA 3EBGA 1FGNH 3HPJA 4X8XA 5I1JL 1KZQA 3KLAA 4X9HA 5IHZA 1WF5A 1E6OH 1ZPLA 1WWAX 3GI9L 2K8QA 3CZFB 5L2KA 5BZDB 2CDFB 4WDIB 3VD3A 1GA2A 5MI0B 3SGKA 5F88B 4NBYB 4PRHD 4F7MB 3BVNA 1MH5A 4UAOC 4OD3H 4YXKH 2CLZB 3GI8H 2W9DH 1DVQA 1KGXA 1N5AA 4GO6B 5BRZE 3O2DH 1QBLL 1NMAH 1V7ML 3EBAA 3GPEA 5F3HA 1IJ9A 3HC4H 3HAEG 3FFOA 5J57B 3MXWH 3CVHA 3DETC 1QSFD 3GSQB 2WNXA 1ZLSH 4M9OA 2MIZA 1IAOB 5JIIA 4OI7A 3UBFA 3CQPA 1AS6A 4HG4K 4FLOA 3L7FB 4P57A 2Z1PA 4D9LL 3K80A 2FX8L 5KYNA 5C0AB 3U7WL 4DK6A 3JV0A 1CICA 1A6VL 3IU3B 3GXPA 1IGMH 4YHZL 1U3ZA 4MS8C 1CFVL 2EACA 3Q3GA 4HEMA 4A37A 1KPRA 4N2OA 3M1BA 1PX4A 2MOVA 3HBZA 4LSTL 5CCJA 2BSRA 2IJ0C 1K4DA 1H5BA 3LQAL 3INUL 4PH8A 5CIPH 1Q72L 2QPDB 1P4IL 3NOIA 3Q44A 5E9DA 4AJYV 5IJVB 2I7OA 1CXEA 1NCUA 3NFNB 4Z7OF 5E4OA 3U30C 5BXFB 3G6JF 4MD4A 2LOEA 4ODXA 5L0QC 2OCFD 4ZQKA 3CZEA 4FA8A 4KJPC 5E4EC 4L4TA 2EDXA 2HLAB 5C2UB 1VEOA 3LV3A 3LEVL 1X9RA 1DP0A 3OXRB 3B2MA 3QUYD 4H0IA 4BFKA 1S9VB 2YOCA 2XPYA 5GZOA 5I0XA 1J1OH 3VE0B 1IZKA 2BP3A 2OTUA 2VC2B 1AANA 3QEGH 4LP4A 3WLBA 4E9RA 5EIIA 1RXLA 2DQTH 3KS0J 2IG2L 3KYAA 1IFGA 4MJ6A 1IB5A 4PJEB 3SDAB 3TO2A 1KNOA 3BVXA 5EU6D 2NX5E 3FO0L 3PL6B 3N9GH 3FU7B 4NZFA 2VXVL 5D7LB 5AYUL 5TF0A 2YMTA 4NYLA 1GY1A 2VLKB 1X7SA 3MMEB 4UT9A 1MWAL 1QR4A 3QO1A 3MJ6A 3IPEA 2XUWA 4RMTA 4P4KD 4FQCL 2VC2H 3V55A 3WSQH 4I1RA 1T1XA 2YLHA 3UC2A 1T3FB 3W1ZA 1ZLEA 1I1CA 3KPPB 4LCCA 2YXVA 4Y16D 3KYMA 2HJFA 2X2IA 3Q8FA 1JFQH 2FATH 4MHHI 4ZW8A 3S8FB 3MV8D 3BYTA 3ZHFA 4DAGL 1ZDSA 3GK8H 2X7LB 2WKOA 1G9NC 2YKKA 2BRRH 4MMXC 3TONA 3E7JA 1E28A 1IC7H 3UJJL 3ZT5A 4Y4KC 3VU2A 2DRUA 4I18A 4E9QA 1PG7X 2NY5L 1HL9A 4G6MH 1FG2A 1F00I 4PJIA 5F96H 5HHXL 2OR7A 2OMXA 4X7CC 4AVIA 3FQTA 1IT9H 1B6UA 3PABB 4HIJA 3V4PB 4J8RB 2VMFA 4TUOA 4LCCC 3L9EA 1GR7A 4XCCL 1L0QA 3Q48A 4PJDB 4GKZA 1NPUA 5ANMB 5T1LD 3ESVF 2C26A 4OCXH 2CPCA 1EDHA 1HIMH 1L5GA 1ZHLB 3RWGA 1DCEA 1X4XA 4YX2L 5HY9B 2Z1KA 3SDAD 5JYMA 4GAJH 5DEFA 3BW9A 4ZQKB 3MV7B 4NN5C 2EAEA 1OE3A 4G80A 2Z31B 2NSMA 3K2MC 1JXFA 1QSZA 2FBOJ 3QUGA 4YBHA 2XZCL 1L9SA 3U9PL 5LG6A 3D08A 3AQXA 3IFOB 4HXBL 2AK1H 2HFEB 3FO2B 1GC1H 1J8HD 4XR8C 3AW5A 4JQVC 4JGNA 1XR8B 1DO5A 4UT6L 2JI3A 5IQMA 1WFUA 4FNRA 3VA6A 4QRFA 4KRPB 4W9GC 5AW1B 3CZUB 1KTKE 4WO0A 2V2WA 3CFCH 4K15A 4AYSA 1UUSA 4ZFOA 1FUNA 3KCWA 1P6AB 4KV5F 2AK4A 2CH8A 1G9NH 2F7IA 4GT7A 2VLRE 2KZKA 1J0IA 3GBML 1S9KC 2JXMB 3PL6D 5GGUA 3SB3A 3AC0A 5KYUB 2X9WA 3C6SA 4K8RC 3B3IA 3QPXL 4WHYH 4Z7UB 5AOKA 1E4XI 3VWKC 1MHEA 2AXHA 3QEQB 4LFHG 2E9GA 5KANI 5D7SH 1V5JA 1ESOA 5FO8A 1G9HA 3BZFB 3UPRA 1S5HA 2NOYA 1CGUA 1BLIA 3KPLA 4LGPB 1TTGA 3WCYA 2K7QA 2HT4D 4AQAA 3IAQA 1N5AB 5B39B 5B39G 4M00A 3V9CA 3V2AR 3V0HA 1PY0A 2VLLB 2PP8A 2EVHA 1BVLA 5E94B 5AUMA 3RILA 2IBGA 4LDCA 2F68X 4JKMA 1GS6X 4B9JA 4QAMB 3IETB 1NMBL 3BAWA 1ID2A 5SX5K 3D50A 4LLQB 2ZKWA 3S3SA 4WI7A 2PMZA 1BF8A 2AEQH 1G9MH 1USQA 4P2OD 4LNRB 2G3ZA 4BUQA 1SF3A 3ULUL 1AG0A 1TTBA 2W95A 3HZVA 2VDQB 4YDJA 3QIUC 1IBZA 2V37A 5EC1A 4GSUA 3PWJA 4MXQD 3VGDA 1J88A 1WBZA 3MRIB 2BVOB 4OTXL 3GI9H 3BYYA 3D5OF 4M4RA 1MCCA 4WWKA 4NPJA 4JQXA 3DK2A 5KYXA 3NAAH 4OZHE 4DFHA 4FQ2L 2GY5A 1G7MA 5I15L 4JO2H 4U1SA 1GVIA 3QCUH 5E6ZA 1ODAA 4QRRD 1GY2A 3L9RB 3GDBA 4KVCH 1D5MB 1DN0B 2GW5A 2H32B 4B27A 1KTRL 4GY4A 4Z7WB 2BNUB 3LRSA 1NDMB 2ZKHH 3IXAB 3CMOH 5LCVA 3WEXA 4QCIA 2AQTA 3TPUA 5DHVH 1RJLB 1MFUA 1K5NB 3AGVA 1JF6A 1YEDB 2IOMA 4L0PB 1U8LA 3KPNA 2F61A 4H1LB 4NQUA 1R3HA 5I73B 3S8GB 1AMXA 3RUGB 1IL1A 4N85A 4S0TD 5DWUH 1WCBA 1MOEA 5T1LB 1O7DE 1HYRC 1NOAA 3QJRB 4AYMC 4O02A 1UVQA 2CM6A 3EBHA 1GYAA 1NBVH 1H6UA 1X5HA 4GW1B 4M7JH 4HU8A 5EZIH 1I3UA 2F18A 2XG5A 1T20A 3VQMA 1BCIA 3HN5A 4PP1C 5MHSD 1JZ4A 4ELME 3CXFA 3WIAA 3DETD 3CG8A 3HZMA 1VKXB 1TEYA 2PCPB 3II1A 3EDDA 3MXVH 3OAZK 2UZYB 1IGCL 1NUFA 4QRRE 3LSOB 4PJ7F 5BVPL 1B0GB 3QYNA 3MUGB 1AJ7L 4FQCH 1SY6L 4ONGL 4NI3A 4FYRA 1YUKB 2JH2A 2V17H 2WN2A 3D09A 2P5WB 4RSYA 3MRGA 2W5PA 4J7RA 5FYJH 5DRZB 4OW6A 5ICYA 3T0EC 4XAWL 3V0WL 1A02N 4N9GA 3V4UL 4NQEB 2YR3A 2QDWA 3P2DA 4BUGA 1NEZG 3TIEA 3RZCC 2ZPKH 3VFPB 2FEEL 2P45B 3GRWA 2FBJL 1Q8MA 3RJQB 4AJVA 1QRKA 3RFZC 1BECA 4XVJL 4CSPA 2DQHH 2VISA 3K3QA 4LASL 3BSZL 4PJBB 5HDBB 3T4YB 2CK0H 4N8VG 1THCA 1SXNA 1IQDA 1YEFL 4MJ2A 1UWFA 3II3A 4L23A 3LN9A 3HE6B 4ZYKA 5BRPA 2V2XB 4UU9A 2J6EL 1V55B 3I6GB 4Z76B 4X9BA 1MVFA 1P7HL 1NBCA 1WV7T 4PJ9D 5ANME 3HPLB 2MHAB 4MCZB 4CVUA 1CD8A 1F58L 1U8LB 4OD1H 3B9VA 4KVNL 4Y4HC 5E2TL 3RUGF 1BYOA 1WCBB 1DL7H 4PVMA 2ICEA 5AOJA 3V5KA 2XZCH 4PGDA 4JHZA 2E27L 1JGDB 3U9PH 5AAPA 5TDOB 3PAZA 3QYCA 2B2XL 2JJSC 4FABH 5E6YA 1QASA 2NUPB 1T6VN 4NBZB 2VIRA 4LCYB 1DANU 1AXTH 4G8FB 3RVVD 4EKXA 1E5UI 1RJZB 4K5MA 2KLSA 1UURA 1OCOB 3N3EA 5ESQA 3FN0H 5HVHB 2ITFA 2Q76B 3CFJB 5BVPH 3X17A 1IM9A 2ZX6A 2M1KA 4MMXA 3CU7A 3FFDB 2E9IA 5E8DL 4GRLD 4FQLL 1FO0B 4LL9A 4PG9B 3UAEA 3QK0A 3SGEH 1BQHG 4U6VH 1B2WL 2R1XB 4K5NA 1T4KA 5CBAB 1E4KA 2GUOA 2VDOB 3BP4B 3UPRB 3N5AA 5HYSA 5DO8A 2WXQA 1JI2A 3B34A 1MCHA 3MUGA 4AEIH 2KPNA 1HHHB 4DZBA 3L9YA 4KFMA 3SJVA 1UOLA 1WGOA 5C08A 1A47A 3AABA 3VG0H 3L3OB 5B39A 4ZFQA 2R69L 4JHAL 2BOLA 2GITA 4GI6A 5DZAA 1QO3A 1I3RA 2BP5M 2Z9TA 4Q6IB 2JIXD 5TF1L 1C8QA 2I5YH 4XP6H 4RQQA 3OHXC 3P3SA 4PJEE 1J5HA 4QDGA 1BQ5A 4IKNA 1IEAB 4OZ4B 25C8H 1B2YA 2NY4B 4PRPE 2AQRA 3ARGC 4J3OF 1EGJL 4XHJD 1FFNA 1A4KA 3MRQB 3SJVE 5L6YL 4UNVA 1YZZA 2LLGA 5IMMA 1DDHB 3L1EA 2JWYA 1FPTH 1G7HB 4YDJB 4B96A 3NFNA 4E41D 1K2DB 5F7BA 3BWSA 4XCNB 3VXRD 3BT2H 1MG2C 3JV6A 2D0GA 2YD6A 4P5TB 3LQAC 4RFOH 1IJNA 5AYUH 5TQ2L 1WRFA 4U7MA 1PLGL 3OF6A 1NAMH 3TFKD 2CJSA 5HGGS 3VH8B 3KL0A 3ECVA 2YSSA 4LSTH 2LFGA 5EORL 4Q0XL 5EZLA 5IOKA 2XWJA 3C5SA 3L3IB 2ITCB 2N0MA 3Q8EA 3CXHJ 5D7IA 4K3DH 3QAZB 4OJFH 3ARFC 1BOGA 3QAZC 2HFFA 2HRGA 4W9FC 4YHKL 5GPRA 3DHJA 2HP4A 5IF0B 5KUMA 3O0RH 4K3JH 4XCFH 3FSZA 2Z4QB 4WFEE 1HEJC 1NEZB 3COOA 2IIJA 3F84A 3OKEB 1NBZB 3S48A 4A66A 5SWSA 4U1JB 3VDCA 5I1LB 3I6SA 2F9BT 3FJTA 3KVQA 3GMOB 1U91B 2VITA 2AQQA 2MPVA 1Q0YH 1I1FB 2DWDA 1MFAL 2DQDL 4FYTA 4BRVA 5IROA 3QQ9D 3E1F1 3VNZA 3P54A 2I9LA 5D96B 3BD5A 5D4IA 3SKOB 5T1JA 4TNWF 1MIMH 3OMIB 3P2BA 3CVIH 4PMEA 3UTSB 5KAQG 3GJEA 4LLAA 4OM1L 5H94B 3FN3A 1FNGB 4GFTB 3GSRB 4NJ9H 2R0LH 3CHOA 5C0ND 3GB7B 4DVRL 2VXSH 3BSGA 4N24A 4L4VA 3L7EA 1AGDB 4JFFA 3MJ8A 5EU4A 5J89A 1L9RA 4XVUC 4LSRL 1NIBA 1UA6H 5BVJA 4GPVA 5A6IA 2BS9A 5JOEA 5K5YA 1R46A 4JHBA 3QIBC 1VSCA 2UZXA 5GZOC 4XWOC 2GBUA 2MCG1 4LCWB 1SQMA 4Z7QF 1A0QH 4E41E 3CDCA 5IEKB 4PGBA 4TUOB 2V7NB 3MV8B 4J8QA 2GI7A 2WLIB 5DMIL 1QYGL 4OFQA 2YK1L 2DIJA 1RUAH 2VTFA 1PD6A 1MW0A 3IJ9A 4H2AA 2NLJA 2WIMA 3TGXA 2IANB 1UASA 5DMIH 1OWRM 4M8VA 5CSZB 4P9HL 3IWUA 1GC1C 2HLEB 1MREL 3LKPA 5J0BA 4PJHA 3FT0A 4N4YB 3NTCL 1Q9KA 4R7NB 5D7LD 1FH5L 1OF0A 4W9HC 5F1KC 4G6FB 1SUJA 2UY6A 2WYZA 4DGUA 2WZ0A 1XSJA 1UXMA 2IADA 3QFDA 1E9QB 4XODA 1IC1A 2WB1A 3TEWA 5KW9H 2M2DA 2ZJSL 4ZUSB 2VLRB 1MUJA 5DUBB 1FSKC 4LQFL 3MNDA 2EVIA 4NUQA 2I9TB 3LHPL 5HI5D 4HG4J 4Z5RB 1AVAA 3X13A 1NZRA 1CXFA 3QQNA 1FZMA 4Z7VB 4XN7A 4ZSOE 5HYEA 2EUXA 1W16A 4M3HA 5AOMA 5DTFB 5JA9A 3I2CL 5GS1B 3RURA 1OIOA 3WKQA 4YDLC 3D18A 1HQ4B 2NDGA 1FDLL 3VXSA 4F57L 2ARJA 1N5YH 4DN4H 4L8CB 1YY9C 1PMYA 4KPHL 3V6FA 1JNHB 2OW7A 4JY5L 3RKDC 3DJRA 3UZQB 3T8XA 3E1ZA 1AI1H 5AW7B 5D7EA 4DETA 1PZ5A 4CGUB 4IGBD 1AGCA 1EQWA 4OD1L 1VZHA 4AJWA 4TSBL 1XBRA 2ZF9A 3ZE1B 1ZLVH 5DK2A 1IVTA 1DE4A 3UTOA 3BP7B 5KSAC 1I1RA 5E9DD 4XNUH 1M42A 1O5PA 3UGXA 2YGPA 1WEJL 1GGTA 4JKLA 3N40P 4FQJH 1AE6L 5B22A 2V9TA 3IETA 1QTYT 4LVOB 3BH9A 1BZQK 1QACA 4MNHB 2LHAA 1E30A 2PXYB 5HYJB 1A9VA 3RIAF 1KXQA 1SXZA 3UTZA 5JDJA 3CK0H 3VD4A 3OLEA 4M29A 1C08A 5J9PA 4HWBH 5IKCB 4JKPH 1MWAA 3NJIA 4JO1L 1TOXA 3ES6B 1O6SA 3HN8A 4HD5A 3D3VA 5A7BA 3BUBA 1H3XA 3MLSH 5IQ9A 1F2XK 4BK5C 2WUBH 4ZFFA 1CL7H 3T3MB 4AG4L 4JDTH 1DJHA 1BQSA 4F7KA 1DHKA 3LV3B 3TNNB 2F8OA 4KGJA 1ZTXE 4NZUH 2RTTA 3REVB 3CXDL 3WNMA 4BM7A 1TZGL 1GCYA 1SVBA 1FDLH 3DMMA 1ND0B 3UZEA 4TN9A 1WA0X 3ZXAC 5HYSG 2IH8A 2WGXA 4G6KL 4JLRA 4QRRA 1HILA 3LPFA 4FQJL 2EZ0C 2EIZA 4APQD 4LLWB 4MB5A 5CFAA 2B5IC 1P4IH 2EDNA 4RMSA 4MDRA 3GHBL 4I3RH 3B7YA 4GBXB 1XGRA 4H40A 4MXWL 2A77H 2AVFA 1IKNC 5I2IB 4PRID 1LWRA 5T3ZL 1X5XA 4JG9A 3RWFB 3I9AA 2UY7A 1X5YA 3VW3H 1LDPL 3CAFA 3AROA 4NZTH 3T2NL 3DUSB 3C6LC 4DQOL 5AWNL 2IDFA 1QW9A 1PZBA 1TKWA 2WXMA 2RH0A 3FOMB 5E99H 3SYCA 4FABL 2IGFL 4X9YA 4HJJL 3VD1A 2R0WH 3HCVA 3AUWB 3MBXL 2PYEB 1NLBH 5AVQB 2BWQA 2V33A 1QSFB 1W6LA 2A6DA 2V4LA 2D31B 3RY5A 5T3ZH 3MRJB 4LOUC 3TBWB 3HR5A 5KG9B 3BP7A 2D7OA 4MX7B 3TCLA 1KYAA 3RTLA 2R8SL 3OR6B 3QIUB 5I1KL 5EEVA 4Q6IC 4AIEA 4KKBC 3M1CA 2VC2L 3FB8A 2KLRA 4UT6A 3VQ2C 3B9AA 4ZZKA 2ZCLH 3MV9A 1Q9OA 3DV6A 4HCRH 2MCAA 1LE9A 4G6AC 1QSEE 2UZXB 1QP1A 5JPMC 1VDGA 1K2DA 2FJFA 3HLAB 1CIUA 1QSEB 2VZUA 4PJXB 1M1XB 1ZT4B 3FUEA 5AAWC 4P9ML 4NM4H 4Q8BA 3ZE0B 2CM5A 3IM1A 1H5BB 4X6BB 5IY5B