4S10A

Gelsolin nanobody shielding mutant plasma gelsolin from furin proteolysis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGRTFSSFVMGWFRQAPGKEREFVASISRSGSVTRYADSAKGRFTISKDNAKNTVSLQMDNLNPDDTAVYYCAADLHRPYGPGSQRTDDYDTWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/immune system
molecule keywords GELSOLIN NANOBODY
publication title An ER-directed gelsolin nanobody targets the first step in amyloid formation in a gelsolin amyloidosis mouse model.
pubmed doi rcsb
source organism Lama glama
total genus 25
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s10A00
5D2LF 3SDAA 3HCVA 1KULA 2R1YB 2B4CC 1K5NA 1CFSB 3O3UN 5GGSA 1AIFB 4LPCA 3O3DB 3LEYL 1OTTD 1DQDH 1RUKL 2FL5A 1RZGB 3KJ4B 2R2EB 3GI8L 1MCLA 1NUFA 1AQDB 1B0RA 1DJSA 1KLUB 3JV4B 5EU6A 4MQTB 2BNUB 1YNLH 4G6FD 1FGNL 1PD6A 2ADFL 1T20A 5D7KE 5D8JL 2J12B 3FQNB 2Q3ZA 5GGSY 1PBYA 1OGTB 4X5WA 4DVRL 4TSCH 4L4VB 4EDXB 3WSQL 4HH8A 5EZOL 3U7YH 3S5LA 1FL6B 3V8CA 2YA2A 1YUHA 4KAQH 1EHNA 1ZOXA 2GK2A 5ESVB 3QJFB 4YBQC 3DURB 3RRQA 3CFJA 1J8HD 2FD6L 2JJSA 4X6CA 3TBVA 3VE0A 3OF6A 3VXUA 1LO3H 1BJMA 4S1DD 1MQ8A 2BXYA 3QCUL 5D7LE 5K59E 2CRIA 1XF3A 3O4LD 3T2NH 2NTFA 5KSAA 5GS2D 1MJ8H 1NAKL 3NCFB 2AS5M 1T03L 3PGDB 3IB4A 2XTLA 2XTJD 5C0JB 2HG5A 3C2AL 3DBXA 1CDYA 4OF6A 4LLQB 4JQIH 5SX4I 1LEGA 2DDQL 3MLWH 3V5KA 3P9LB 4YFDB 4JGJA 1A7NH 5D96C 4JO2H 5DD0L 1Q9LB 1BGXL 4ZG1A 2DI8A 4OBRA 2HLFD 3P30H 1EMTL 2EIDA 4DKEH 4XPGL 1A4JB 2EDBA 2CO7B 5T1MA 1NFKA 1W72H 5F3HA 4ALAH 4KJQC 2KPNA 5HPOA 1GGCL 3GBMH 4TQEH 4OV6F 2DQTH 2VLMD 1OAKL 1XIWA 5IW1A 2GIYA 5DF0A 3KPNB 3B5TA 3QG7L 1N2RA 1FGVH 12E8H 1DN0A 4JFEE 2V6HA 3IDIA 4ZFOB 3THML 1BJ1H 1Z9SA 2PO6A 5HPMB 1Y18B 4LSTH 3WFCL 1TVBA 1AQKH 4RIRA 4WWKD 4Y1AD 1A9EB 1UXSA 4I0PC 4XPHL 3TO2B 4KUZL 3VU2A 1DSFL 1EO5A 3RVWC 3ECBA 4MS8D 3K8MA 5K9JH 3N9GH 4ONFL 1PLGL 3IU4H 4U7MA 3OKNB 1QACA 5BV7C 5DC0A 5JDSA 5IBLC 1J8HA 1REIA 25C8H 2YPKA 4OSUH 4NJAL 5CBAB 1RZ7H 4G43A 2Q1EA 1OP5K 1Z0MA 2Q8AL 4KZDH 1HINL 2XZAL 5J13C 2X4NB 2ORBL 2Y7QA 3MLXH 4FQ2H 3KPPB 4P4KD 5H8DA 1NGXB 4A6YB 3WKML 1SBSH 3IT8D 3EJZD 5D7KD 3T77A 4QHUA 1RIVH 4AH2A 4TUKH 5EFIA 1JTTA 3AB0C 5DT1L 4YUEH 3T4AA 3CFCL 1ZLSL 5FDYA 4Z7UA 3AGVA 5JR1L 4XVJL 5DJCA 2XRAL 1IQDB 1LVEA 2B4CL 3G04A 4PLNC 1HSAB 2MCPH 1NFDE 1JRHI 1TNNA 4TTGA 4GBXB 3U4EA 3JWNC 1LDPH 3TO4B 2IH3B 3DSNA 3MFFA 2J6EA 2FSEA 3QXDA 3DROB 4F7TB 5HGGS 1P6AB 4HJGA 3MGOB 4LDEB 2VLRD 2D7OA 3R06B 1FLTX 1S9YA 4Y4KA 1MUJB 4XPBH 5EH1A 1SJEA 3FO0H 4GG6B 4KV5E 2FCBA 3ARWA 2R0KH 3F58L 3BGFB 1U8KA 2ED8A 4J1UB 4YDIH 4ODTH 3PWLB 4IM8A 5A2LH 5EIIB 4YHNB 3RWIA 4OQTL 2QQLL 4JZOA 1OAYH 1IAOA 4LCWB 2AW2A 2OP4H 2W38A 2AVGA 2ADJA 4JKKA 1AY1L 2Y1VA 4ODBD 2AAVA 3ZLQC 5H2BB 3MBEB 5C0GA 5ADOL 1EK3A 5EC1A 2AJSL 4OCXH 4UQ3B 5L8LB 2XA3A 4D0CB 5C92A 5I8EB 5C08E 4X7EC 3MRFB 4XP5H 3K2MC 3LKRB 4R6UA 5LAXA 5I2IA 2C7UA 3TNMA 1NCBH 1T22B 3WFBH 4Q9CA 1YMME 4RFOH 3BKJL 4P4KA 4D0DB 2F5AL 2DI7A 4BSVB 4BZ2H 4JFED 2RGSA 1FE8H 1CN4A 3BH9B 3O9WC 3EDEA 5HHXH 2XY2A 5HD8D 2F58L 3I02B 3QULB 3UBXI 1I4FA 3MCKA 3LMJH 1FN4B 2XNAB 3JWOH 3K1DA 4ZTOL 2GJ6E 4G80B 3TT1L 1F2XK 2ATPA 4JVPA 2HFTA 5CSZA 3BIKA 1XGUA 4I0CC 5C8JB 3HUJA 4U3HA 4OLZL 1U8IA 4HCRA 3G5ZB 2VLRA 1QLEH 2WIMA 4MNQB 4OZFH 5DQDH 1URLA 1U9KA 1QRNE 2L0DA 3VI3E 1E4XH 2I9TB 4CNIB 4FQXA 1MCOH 3TVMC 3HLAB 3U46A 2FJGA 1BVZA 4TNWK 5ESAB 1KEGH 5FYKU 3EYQC 4LU5H 4ZUTB 4PJ5B 5CGYC 2PN5A 3IAQA 1BOGA 1EJOL 1KELH 4QTIH 3TBYB 5J6GB 1CR9L 2P24A 4D94A 1QKZH 3QUXA 3TH3T 5CZVL 1Q9WA 4GRWF 1T1ZA 4Z95L 4XH2B 2HFEA 3IAGC 3QXTA 2BC4A 4U6YB 1FJ1A 3GB7B 2R4SH 3MR9B 5F89B 1ND0B 3D5OF 3ARFB 4RRPA 4L8DA 3CUPB 4XBEH 5JOFB 4P48A 4N1EA 5HDBF 4HFWA 4W68A 2ZUYA 4ZFGL 1OWRM 4LCCC 3QUMA 3FHAA 2B1HH 1CD8A 4JFFB 1L7TH 4NRXB 5KTEH 3ZHDA 3C60D 4KGLA 4MNGB 1YYLH 2BFVL 4TSBH 2R29H 4KI5F 1S5IL 5HVHC 2JB5L 2O61B 4Q2ZA 1NBVH 5GRVK 2ARJB 1HILA 4A2MA 1CQKA 1JGDA 4JN2B 4JO1H 4LAQH 1NLBH 3EO1B 4FS0A 3MLYL 5E6ZA 1NCDL 5I74B 3QH3A 2A6JB 1S7WB 2DQEL 5DR5H 5C08D 1YEGL 2JJUA 2YC1A 1JWSB 2EYRB 2BY1A 3A6BH 3C6SA 1YPZF 2BY0A 5EBGA 1F4AA 1YMMD 3H3KA 3JV5A 3E2HB 5LBSH 3FT2B 4WI4A 2H2SC 5ISZA 3F62A 1I7UA 1JPFA 1T66D 1ZT1B 3DV4B 4P9HH 3QFDB 2J5LC 3QUYC 4JRWA 4M1DL 3OKDA 1KEML 3VXPA 1JI2A 5SWSB 1M6OA 4FZ8L 1NFDA 4FFWD 3H7LA 2GJ6D 5LGKA 1T1WA 2DBLL 4O58H 1A1OB 4XGZB 1Q72L 2VDPH 3L9RB 3TN0A 4IIQC 3UJJH 4BH8A 2OBGA 4NQCB 5KG9A 1OW0C 2HJKA 3DUHA 3IFLH 2BMKA 2FX8H 4M61A 3RWEA 1NGWA 3HG1E 3LV3B 3WIFB 4F3FB 3GHBH 5EUOE 3W81A 1QRND 4WHTA 2IADA 1D5XA 1TQCC 5IF0A 3VXTB 3HZMB 1FO0L 4F33A 1V3JA 4MX7A 2I5YL 2UWEB 1HNGA 3SKOB 3C60A 4JM4L 3VDBA 4L9LA 4MQXD 5IMOB 3P4MA 3IFOB 1ZGLB 1CLCA 2XT1B 5GSVB 2HMID 4HIJA 5E7BA 4NQEA 1JN6A 5MENB 3HNSH 4WWID 3QT2A 3T2OA 4ELKA 4X9HA 2EDWA 5BRZE 5ANMB 5I1LB 5DGQA 3IS1X 4Z7NE 1B4RA 1P69B 4ZDHB 1FZKA 1K9TA 2AEQH 4TPRH 4GSDH 3T0EC 1RVFL 2GITB 1KPVA 1OAZH 1V5JA 5CS7A 1DBAL 5FCUH 2EC9U 1BJ8A 4RA3A 2EXWD 4ODVL 4NO5A 2HTLD 4OGYH 1V7MH 3FAWA 1B0GA 4PG2A 2P44B 3GBNH 3KYMB 3BIAX 3MYZA 3P4NA 3D48R 3QFJB 2Z31B 1KIPA 1XZ0B 5AAMA 1OAUL 3EYOB 3U79A 4G6AC 4ZO8A 3WLBA 1HCFX 5J4MA 5I18H 5KSBE 1AGEB 3CFDA 5GRWA 1EO8L 4HXBL 4XMKL 3ZTJG 4OT1H 4X6DA 5DRXA 5DD3H 3DECA 1Q94A 2CUIA 2JK5B 4CVXA 1QRNA 1SQ2N 2J88L 3C5ZC 1MREL 4FQCL 4ZOCA 5JORB 5A16B 3OKLA 3V0WH 5E8NA 1ERNA 3SKMB 3GSRB 1C5DA 4J23A 2A6IB 4JJ5A 4M4RA 3SO3B 2BNQB 1BBJB 3HS0B 3VXSA 2VDLH 1TTUA 5HHNA 4R4FL 5IKCA 1AI1L 2DLTA 3O3EB 1X5HA 1VGKA 3OKMB 3EOBA 4F2MA 4QRRA 2X6MA 1I85A 3MV7B 4M7KL 1B4JL 1CS6A 1FFNB 4Y5YA 4O2CB 4YO0A 5FIEA 3DYOA 1JZ7A 3VCLB 4XAWH 3CSYA 3PV6A 3TBTA 3LPWA 3TIDB 3WUWB 2XWBB 4YR6A 3DX9B 3V6BR 4HAGA 3MOAL 5CJ5A 5F7YC 3PGCA 2CIKA 2I07A 5CWSA 4JZNA 4ZS7L 4NQDA 4NGHH 1LO5B 3GUTB 5J06A 5T1DH 3CH1A 1Z5LA 5CBEA 1WFUA 3T2PA 4APQC 1FH5L 1SY6H 1NSNL 3P4LA 4FFZH 4WJ5B 5C71A 3ROOA 4NQXB 3GI9L 2LU4A 4NKQB 1J0IA 4H1LG 5BRZD 3W5MA 3RGVA 5TPWL 5DQJA 4M7JH 4I48B 1WIOA 1WWWX 4J6RL 4M9PA 3QBTB 4YHYB 3VXQB 1R3KB 5DI8B 5GS1A 1R3LA 5CINL 1JNJA 2X4QA 5E7FA 4PV9B 1A1MA 4LVHC 3BHBA 1TJHH 4OCNC 1QLRA 3E0GA 1ZMYA 2YSSB 3MNZA 3MV8E 3TH4T 5HYJB 1BBDL 3NGBB 3WL9A 5TDOA 5KS9E 3NZHL 1WCQA 4LKXB 2CDEB 2H41A 3JXAA 4K71C 4XT1C 2NY6C 5EO0B 4P2OB 1HQRB 4WCYL 2J8UF 3VWJD 1W72A 3HI5L 3BZFB 4DGVH 5GJTL 5MEPA 4NNPH 1MIEL 3PWPB 3REVB 2ZCHH 4ELMF 1PFCA 4U4BA 3ZDXF 1JE6A 2ZPKH 3IYLW 1ZAGA 2Y4SA 4OIBA 5IGXH 3QEUA 3ULUC 1WBZA 1EHLL 1QBML 3WXVH 3F7PC 4U6XB 3QRFM 5ETUB 2NW2B 2NXZB 4LASL 2B2XH 5IB3B 2H1PL 1QFWH 3SJVB 1I1RA 5DS8A 4WV1A 3V52L 4JQVA 3BDYL 3IDGB 1S7XA 3RTQC 4JRYE 3NOIA 3QI9A 4PTTB 4LSUH 3BEVA 1DDHA 5GGTH 2F8XC 2VXTH 5JA8B 5KZCD 1G9NH 2E3VA 4N0UA 4FABH 1UXWB 5FO7B 1JWMB 3UO1L 2X4OA 4H88H 4KK5D 2D7MA 4NKDB 5DHYB 1J1OL 5T1LB 3ZE2F 1YN6B 4OZGA 2FYYA 3KJ4C 1WUNT 3SOBL 1UZ6F 1YEFH 3TZVA 5IBUB 3GJEA 4JM2B 3S36H 1OGAE 5E9DE 4CJ0A 4FTVB 3CVIH 1F3RB 2B39A 4XC1H 1JPGB 1YJDC 3CFKB 3IXAB 3L5WB 1NLDH 1C12A 1MF2H 5KAQG 3EYFA 4GQPH 3WIIH 2IANB 2MOVA 3BW9B 4Y16B 5A2IH 3BFOA 3RY6C 5AZEL 4QY8B 1KPRB 5FCSH 1RMFL 1T2QL 4OZIB 5ADPH 3BO8B 1LHZA 5IJKA 4YHKL 3SGJA 1EEZB 2HT2D 4P5MB 3L7FB 2WBJA 3KVQA 1B2WL 5CJXA 1Q0XL 1P7KA 1R6VA 1N6QL 3ABZA 2MPAL 4HLZG 4JY6A 4QHKI 4WI6A 1LEKA 1EGJL 1F13A 1XCQB 4F7CA 1UM4H 4HKJB 1ROWA 4OLUH 4HT1L 2WUCH 4HEME 2J4WH 4UOW1 4XNZB 3H6JA 3O2WH 3QIUB 3NFSL 3OKKA 1U8OB 2KQNA 1QZ1A 1UG9A 3QUZB 2Y72A 4QRQA 5MERB 1EAPA 5D2LE 2Z4QA 4G8GE 3MV01 4G9FE 1G7QB 2GAZB 5TDPA 3W39B 1MFAH 2I60L 3CU1A 1TQBC 1CDUA 1N5YL 3CAFA 5TE7L 3D6GA 3NZ8B 3QNYB 5EULV 1YECH 4UTBH 2EDOA 1B6DA 1ZHNB 3NCJL 5SX4H 3VRLF 1HDMA 4GRWH 1IE5A 1F6AB 5CHNB 3QWQB 3U1SL 1BD2E 4HGWB 4LBEA 3R0MA 3ZE1F 1JGVL 1IM3B 1QYGH 1IGIL 1S7VA 2KQMA 4BFIA 3AU1B 3TT3L 4PJFE 5DVLA 2OZ4H 1RD6A 4K07A 4X5XA 4ESKA 2APFA 1DLHB 4TSAL 3K2UH 2VXUH 4CDGC 1TZGL 4YHIB 3CLFL 4HHAB 3RBSA 2P49B 3S9DB 3ZKSD 3T8XB 4JRYD 3RA7H 1TCRB 1YNKL 4YHZL 2X4RA 2GSGB 1SBBA 3N85L 4G8EB 4JRXB 3DUUA 4OZFA 3C87A 1MHHB 3DETD 3GHEH 43CAA 3CVHB 3UJTL 5AYQA 3VFRB 3BZ4B 4PS4H 1N59A 3ULUL 4MJID 5D93C 3KLSA 5K9QI 4X6FB 3KXFB 5TE4H 3HMXH 3C5JB 1OGAD 4MGXA 4N0YH 5E9DD 3RJQB 3EFDH 3V7AE 3X11A 3T1FA 1IGJB 2IPKB 1GH7A 1NBZB 5C86A 5DMIH 1HSBB 1FG9C 3VXRE 4XWOC 5I76A 2XZQL 4C57C 4IOIA 4KJYA 4RAUA 5J6HA 2DOCA 3NA9H 2D0FA 3REWA 1PSKL 4Q7DA 3NFNB 3QYCA 4P57A 5F21B 3TO4C 2DIAA 2ZUTA 4RWYL 4Q9BA 1UC6A 2OS7A 5E5MA 1KCSL 5BVPL 4YZFF 1IEBB 1MCWW 4ZAKB 4IMKA 2GHWB 5SWZB 4L8SA 1TZHB 5EWIL 3L3GA 2G60H 1I8IA 4XCCL 1IL1B 3E8UH 4F8TA 1JRHH 3VFOA 3UYOD 5FV1L 5CEYA 2QL1A 1WIUA 4UIMB 5CJQL 3G5XB 4PY7B 2XKUA 3ZHKA 4PJDA 1B88A 3LRSA 3R0NA 4YDLC 5HGAB 4JDZA 4U0RB 5FXCH 1MQKL 5T3XH 2O26U 4CN1A 3ARXA 1XGRB 3I6GB 2VQ1B 4G8GD 4QF1A 4TUJA 2DMCA 4KHTL 4Y4HB 4G9FD 5F6HJ 3RUGB 5ID1B 3MOBL 1IGCL 2EEBA 4OB5L 5EUKB 1MY7A 2M2DA 4IRSD 1VACB 5F7FA 3DTXA 4XNMA 3MNWA 1I1FB 3RAJH 2OJEA 3U2SA 3VXOB 4MD0A 5TGBA 3MACH 2R15A 3TBSB 1U8MB 2R56H 1S9VA 4LSDA 1MRDH 4MJIA 4JB9L 3HE6A 4NHCH 5F7HA 5DURB 1YN7A 5IROC 4H25A 3BKCL 4I3SL 1T0NB 5KANG 3O3AB 1PQZA 5ENWB 5T5FH 3HC3H 3D69A 1OTUD 3TBWB 2FBJH 1SJVA 5C0IB 4KY1H 5DTFA 5CEZL 1II4E 1PZ5B 2M1KA 3TV3H 4MJ2A 1MHPH 3QQNA 5HBBA 3B9KC 1ORSB 2EIZA 1Q9OB 2G9HB 1XT5A 2OR7A 2VISB 3LDBC 2BCKA 3HZVB 5FYJH 4X6BA 4XXCA 4KWUA 3FFCD 2OTWB 3MMEB 4XNYL 3RDTA 2FJFA 5DJYA 1J0ZA 3GSXA 1T89C 2R0LL 3GMNB 4R7DB 4PJGF 5SX5H 4LHUA 2DQGL 2CLVB 4ZUWB 3V6OA 4WW2C 4MA7L 1I3GL 4LIQE 2R0WH 2JCCF 4R7NB 3STBA 1GGIL 1AC0A 2O93L 1INDH 3TCLA 1S5HA 4ODSH 3MA9L 3K8LA 3QJHA 1S78C 3LRHA 1XEDA 5KJRH 4YDJA 4BYHA 3VXRD 2ZUXA 2CMRL 4FN0A 4JFDB 4CU6A 1QLFB 2XZZA 4LARH 5C0AB 5KVGH 1DQMH 4IRSA 4JPIA 1NGPL 2EH7L 4MNHB 4AK1A 4YXLL 4X4XA 2RFXB 1C5CH 4LQFL 3LQAH 4TTDC 3UTTA 3IDXH 5C6TH 4PLOB 4E0RB 1NMBL 3KPLA 3QQ3B 4TVPE 1DCLA 2APXA 2NY0D 3IFNL 3QDMA 4H5SA 3MRDA 4HZAA 5IVXB 1OARH 4GMTH 1I1AB 3GIZL 5K9OA 1I8KA 1S3KL 4YXKH 3VMNA 3BEWA 1NCAL 4DGIL 4JO3L 5D9SB 2ZP0T 1KPUB 3WUWG 3QG6A 3CXHK 5FHBL 4FQLH 4HQQH 5A1AA 4M48H 4DKAA 5I19H 2AI0H 4C83B 2ESVA 4JPKH 2VXVL 2A0LD 4ORGA 1T83A 4I18A 2Q76A 4R26H 4P49A 1W2KT 1CDHA 3QCTH 4F58L 5I74C 3FFCA 1MLBA 4UOJA 5EZJB 3UXFA 4X8JB 2A77H 4QYOB 3FT3A 2HN7B 4K7FA 5D2NB 3MZTA 4DN3L 1UWXH 4P9MH 4CJ1A 2WLZA 1H15B 2AJ3B 2YZ8A 1LO0H 3DRTB 1VB9A 4P3DB 5CMAA 5JMRA 5TDNA 2CKNA 4X7CC 3E2HC 1B0WA 5BS0E 1G7LA 3LKOA 1ZA3A 3VXRA 4FQ1L 2PETA 5D7JD 1HQ4B 4LRIA 1TJIH 5IBTL 3L3JA 4IRJA 4JLRA 3MLUL 3O6KL 1INQB 2YPLB 1BF2A 2KUTA 3B2UD 4H8WH 4GRWE 3WUZA 2DQHL 4DZ8B 4EN3A 4Q6IC 5L2KA 3VFUA 4UV4L 3P73B 4PGJA 1OQXA 1OM3L 5I1JL 1HXMA 1CDCA 1DVFC 4R8WH 3HCVB 3NIFF 4M1CC 2AQ2A 4ZFZA 3FJTA 5GGSB 5HDBE 4O9HL 5HDQL 1Z9MA 4HK3N 1MH5A 3NVQA 1RIHH 5KOVC 4K9EH 5KVEH 1O5DT 2VWEE 5EU6B 3H9YA 3RGHA 1SY6A 5IMKA 1MHEA 2OR9L 3QEGH 1BWWA 1MPAL 4GW4A 5GISH 5E5UB 1T20B 3T0VA 1TVHA 2W0PA 1PG7X 1UA6L 4X5WB 1BZ7A 4P3WA 5DYOA 3Q2CA 3DMMA 3SDYL 3QIWD 3S5LB 1ACYL 4PY8I 4W4OC 5C09B 4ACPA 3MLZH 4MSWA 2DMKA 3TFKD 1RAMA 4OIAA 5CIPH 4TVPD 5E08L 1EUTA 3TBVB 4HIHA 3VE0B 5IHZB 3VXUB 5E2JA 5DJ0A 3NCEB 4PBVC 1JUFB 4R2GB 1SYVA 3RVUC 4KKAD 3FB8A 2FATL 1XF3B 2NTFB 5DD5H 5KSAB 4PJCA 4FHBD 2CKBH 5IBUG 4KPHL 5DWUH 2HG5B 2ZNWA 5D7JA 3DBXB 5EU5A 3RVTC 3MGTB 4ENEC 1LEGB 2Z31C 3V5KB 2OI9B 4LSSH 4PLJD 1Z0NA 3V8OA 4JANA 4FQIL 1HEZA 5TFSL 1DBJH 4ONHA 1TZIA 2NXYB 3AS2A 2BSRA 1FV1A 1QQDA 1C16A 5JHLL 1P1ZB 5ITFB 3DHMA 3BRDA 4U6TA 4YXHL 4NZJA 4JR9H 4U7KA 5A3IC 5T1MB 1CD1B 1G0XA 5C0RL 2C3HA 1KN2L 4HC1H 1N64L 3MFGB 4O2FB 1JHLH 4PRPA 1CU4H 1OB1A 1KCRL 3FOMA 5ACZA 2A83A 2A74A 1WZ1H 4ZUSA 2Z8SA 4TOYH 1DBMH 1XIWB 1K3ZA 5IW1B 4ZOBA 4CUCA 3G5YA 4G6FB 4LGRB 5GGTA 1A6UL 1IAIL 2ERJB 1P4BH 4R0LA 1JPTL 5JHDE 1F4XH 1DN0B 3I85A 5HYSA 1V8HA 2AJVL 4POYA 4UTAH 3BD5A 3RI5K 1NCCL 3P0GB 1TVBB 2Q7NA 3GMRA 3H3PL 3WCYA 4MZ2A 5L6YL 2F54D 1UXSB 5GRJH 1LK3H 2V17H 2JE8A 1ORQA 3QIWA 4H20L 3ECBB 3NACH 4PB9H 3GK8L 4N1HB 2WUBH 3PL6C 4X7SL 5CILL 1J8HB 1MI5E 2YPKB 3GSVA 4FFVD 4ZPTB 4OM1H 4HLJA 4G43B 3GEWB 4UB0L 3PWVA 5FHAL 2R4RL 3BDXA 3ILPA 3FQWA 1OWWA 2I27N 3BGMA 4LLYA 3O4LB 2Y7QB 4P2YA 1U6AH 2XTJB 1FSKB 3WNKA 3V9FA 5FYJE 4LEXL 3U6RA 2FJHA 4QHUB 4AH2B 2BSTA 3PGFL 5GGVH 1CDGA 3T4AB 3LS4L 3I9GH 4D3CL 5DJCB 1TPXB 3G04B 5GS0C 4Z78A 2HJFA 3U4EB 5D6DA 2YD2A 5F1KC 4PREA 5EB9A 3ZHLA 2E9JA 3MFFB 2FSEB 5DJZA 1IFHL 5IEHA 4HWEH 5HI4C 1S9YB 4Y4KB 4YHOL 1SJEB 5J3HC 1NAML 2YPVL 1NMCB 1HKLH 1G9ML 5DEGA 1J8KA 5K9KA 1ZT7A 4R3SA 3O11A 4YDKH 1BM3L 4JZOB 2IH1A 4P2OC 5TQ2H 3VG9B 1N7MH 4WTZA 1IAOB 4S1QL 5HGDB 4JY4A 2Z8VC 3ULVH 4OQ1A 1I7TB 4WWKB 1KJ2L 3C6LC 4Y1AB 2F54A 2ZSVA 5JQ6L 4ZUUA 3LPGA 1MJ7L 3RHWK 4R97B 2OZ4A 1JGLL 4WEUD 5C0BA 2YBRA 2FH6A 5EC1B 1G0YR 4QRSA 2HKHH 1FG2A 2X44D 5DUML 3I6KA 5T3XD 2EDLA 4D9LH 3N0PB 5LAXB 4JY5L 2C7UB 3TNMB 2RR3A 1I9JH 2WM0A 2IQ9L 4RMSA 5MHSE 4P4KB 5DD1L 5E6ID 1E4KC 4PJXA 4UV7L 3F7VA 5JHDD 3X3FH 1HCVA 3KPSD 1EH9A 1MY5A 1U8HA 5TF1H 4B50A 2CUHA 1VHPA 5EZLA 1U91B 1R0AH 2KZWA 4XPAH 1I4FB 3DARA 4JKPL 2N56A 3BT2H 3MV9D 5D1ZC 2H32H 35C8H 1N4XH 4K2UL 2ATPB 1FZJA 3UYRH 5CSZB 1YPZA 2EDEA 3BIKB 1XGUB 3HUJB 5DVOA 1A0QH 3WS6A 4JM2C 1U8IB 2C3XA 3F7QA 1GPOL 2VLRB 4K23H 32C2A 5HYEA 2BXZA 3SE4C 4LMQI 4UDUB 4K7PH 2CR6A 2D4FA 4Y16C 2Q87A 4FQXB 3OSKA 3Q6GH 4FNLH 1CBVL 1GC1H 5IOPB 3U46B 2FJGB 4MAUL 1ZHBA 5FYJD 5KVFH 3E1F1 1UENA 4OCLC 1P2CA 2YZ1A 5KSUA 3U7WH 4ELME 3BP6B 4PD4J 3ZDXE 3OAYH 4NUGH 4JO4L 1BOGB 4A6YH 4N5UA 3CMOH 3JWDH 4MJ6A 4JJHA 4P5KA 3HE7D 2P24B 2EH8L 2V2WA 5DJ2B 4G8IA 1DFBL 4LSRH 2VL4A 1T1ZB 5D7IF 2JELL 2HFEB 4JG1H 3LEXA 1I7RA 1FQ9C 3QDJA 3BP5B 4QT5A 1WK0A 2JB6A 3QUZC 4L8DB 5MEOB 3DYMA 3AS3A 1K8IA 2IGFL 5FYKE 5CJBA 2YHGA 4NCC1 4B7LA 4HFWB 4NFCA 2FZ3A 4KQ4L 4G7VH 1MJUL 3QUMB 4R96B 4XCEA 5J7CC 2VB5A 2W9DH 1QP1A 5GS0L 3KPSA 5INCB 1X5JA 2OK0L 3IXTA 2O5ZL 3ZE2E 4EXPX 4M43H 2X1OA 1UZ6E 1YY9C 4Q2ZB 5DK2A 3MV9A 4MJ5A 1DQQA 4D9RE 2WQRA 5BQ7B 1HILB 5LQBH 2DKMA 2W60A 4YNYA 3AXLA 1YEEL 3QH3B 4OLYL 4UIKH 5DRWB 4JQXC 2NR6C 3BSZH 1UWEH 3EJYC 2YC1B 3M8OH 4K8RC 3KJ6H 2R23A 1ZEAL 3GKWL 2OYPA 4OJFL 4LPVA 4MCZA 1EEUA 3P0VH 5MHSD 3L1OL 3LN4A 2F19L 1JPFB 4MXWL 4U31A 5EORL 1C5BH 3FT4A 4EI5D 2DQJH 1OAQL 3OKDB 4LLVA 2AQ1A 1SEQL 3QQ4A 1G7MB 1OTSD 1M6OB 3UBXA 1NFDB 2PTTA 3MLSL 1T0MA 1C8PA 4P2RE 2XOTA 3HE7A 3ARRA 4QXUL 5FGRA 4PJ9A 3HMWH 4BH8B 3VD3A 1UKQA 3QA3A 4RA0C 5KG9B 2HJKB 2BMKB 3V4UL 5FO9A 4M61B 3WN5A 4AL8L 1NGWB 3CK0L 5E0QA 3HI6L 4M8QA 2CDFA 4L1DA 2E9BA 3FQTA 4WHTB 2IADB 1CICA 4V1DE 1YEKL 3DO7A 5CGMA 3SGKC 4Q97A 5I75B 4MX7B 4RFEB 4U49A 2XA8L 5ITBH 4YGVB 3WXWH 3VRLE 3RVXD 4GKZB 1IT9L 3D39E 3C60B 3LEYH 4WHCA 1RUKH 3P4MB 4U7SA 5F7NC 5FO8A 1INEL 3GI8H 4OTXL 3P9WB 4RAVA 4HIJB 5D70L 3SCMA 3ZE1E 4ZAKC 2Z91A 4OD3L 1JN6B 2HWZH 4PUBL 1CZ8L 2C26A 2VKWA 3OX8A 4AEIH 2F74A 2YUWA 2ADFH 2IPTH 4XHJC 5IR1A 5F9JA 5D8JH 3ZYJA 5IFAL 1MNUL 2W65A 3NPZB 1FZKB 3KHOA 5DMKB 2AKRB 4NN5B 3V5DA 2P45B 3HRZB 4JHZA 1OCWH 4U0RC 4UT7L 4RNRA 4XP9L 3P0YL 1JZ2A 4WVRA 4Y4HC 4HAFA 2MMXA 4YEEA 3MRNA 4JFOA 3DJ9A 4HZLA 2FD6H 3BISA 5DRZA 3V4PL 3MRKB 1ZVSA 2LU7A 3QCUH 3P4NB 1IKFL 3GO1L 1KIPB 1KJMA 1PDKA 3SE9L 2P42B 3H9SE 4KK9C 1NAKH 2GJ6B 4D9RD 4NKOA 3ARGD 1T03H 2IJ0C 3NABH 4X4MA 2BRRL 1AGFB 3C2AH 5IP4A 4M1GL 2J2ZA 5GRVL 2DDQH 4KRNA 3S5LG 3U0PA 3LSOA 5CLWA 2DL2A 1MFEH 2H3NA 1Q94B 2HT4C 1QRNB 2ADIB 5JNYB 3BMVA 5HI3D 3TJHD 4KQ3L 4F57L 3HFML 3OKLB 4PPTA 4ZNEA 3QISA 5E8NB 2J8UA 4MDIA 3KLDA 1HYRC 1EMTH 1JWUA 3HAEB 4XBPA 2P8LA 3HHRB 3MBXL 2GSIA 1KENL 1XR8B 3BZDA 2P7TA 3F65A 3V6ZA 5IKCB 5E99L 4DGYH 3JSSA 4PJIA 4P2RD 1VGKB 4QRRB 4F2MB 2X41A 1XAUA 2HKFH 4NJ9H 1QFUL 3QG7H 3WHXA 2FB4L 4YX2L 1IC5L 1BFTA 3WD5H 4YO0B 1MFNA 1UWGH 3O2VH 3THMH 4DUWA 1QVOA 3OPZH 1HIMH 1D9KA 2GK0A 3PV6B 3TBTB 3ZKMD 4IDLA 4YR6B 4EBQL 4XPHH 3ARBD 4KUZH 4V1DD 1DSFH 3PGCB 2CIKB 4ONFH 1PLGH 5FA3A 1QA9A 1JGUL 5CWSB 4JZNB 4NQDB 4DCQA 9CGTA 4KDVA 2DYPD 5DVKA 1F11A 4OKVA 3BH8A 3CH1B 1Z5LB 2GTZA 5A43C 3D39D 3ILQD 5CBEB 4NJAH 1IAIM 1CFVH 2H2PD 3H9HA 1U36A 5CIPA 4GMSL 1UZ8B 2Q8AH 1HINH 5J1AA 2ORBH 3ROOB 3AAZB 3ARGA 4W70A 2QKIB 4MMZC 3O8XD 4LLWA 1U92A 4XPTL 1PKOA 3TA3D 1ZHKA 3BPOB 2CKBA 3PIQA 3T3PF 2FEDC 2WAHA 4LLUA 4NQTA 4PJAE 5DT1H 4BQBA 3CFCH 3EFFA 1ZLSH 3RX7A 4ZFFA 5JR1H 3S3SA 4XVJH 3VWKA 3OB0H 2B4CH 5GS1B 4EIGB 1P4LB 5J11C 3WJLA 4M6MH 4S2SA 1R3LB 3I2CH 5EDXA 4U33A 4M7LL 1A1MB 1AO7E 2DKUA 3DX6A 1DQJA 1QLRB 1X44A 1ZTXL 4LF3A 1T6VN 4PP1D 3L3HA 3MNZB 4ZSOE 2Y23A 1RUML 4LDLB 5BO1L 5TDOB 5DLMH 3OMZA 4UT6L 2HH0H 2VXSL 4KI1A 4KKBC 4J4PA 2JCCE 1S8DB 3F58H 4HC1A 3H9SD 4YE4H 1W72B 3BPNB 4ODUB 5D2NC 1VFMA 1ZANL 5MEPB 4X99A 3D0LA 1FHGA 1PX4A 2PXYC 4HG4K 3MXVL 1QSEE 3TESA 3UTSE 4EOWL 3OZ9L 1RFDL 4XMPL 4LCIL 3KWWA 1IGTA 2C4FT 4KK6D 4PJHF 2OXHA 1WBZB 1JHKL 1FNLA 3ARBA 5KN5B 4XX1G 4WI9A 4J3WA 2BVPA 3CLEH 2HFGH 5E2TL 3WFHA 1IARB 5DS8B 2AJSH 1ZT4A 2WANA 4CADA 1S7XB 1I9EA 4M00A 5DD6A 3NAAH 1RU9L 1Y6MR 4QEGA 3QI9B 3SDAC 3BEVB 1DDHB 1WF5A 1XGTA 1UCBL 4N0UB 5D5MF 4RX4D 5M95B 1UJ3A 3BKJH 5D1XD 1MRFL 1ZWIA 2AEWA 2MQCA 3O8XA 2R1YA 1KT2A 2FYYB 1YZZA 4WFFE 3K4ZA 3S8WA 3O3DA 1U3ZA 2E6JA 5ALBH 1Q9KA 5AZ2L 2DLFH 3MNVA 3BKML 3U4BH 5D7SH 4HKXA 1AQDA 1ZS8A 4ZTOH 1JBJA 3TT1H 1F3JA 1C12B 4XCFL 1LMKA 4UOW0 2O5XL 1L9MA 4Y7MA 1JI1A 3N1FC 4ODWB 3QRGL 4EEEA 3RZCA 3H9SA 3VWJB 4NNXA 2WBJB 3L3IA 2JJSC 4KJPD 4N8VA 4CKVX 5GGVY 5KSBB 3QJFA 1TETH 3DURA 3EYUL 2CIIA 4JY6B 1E0OB 3F8UB 3BKYL 5CD5C 3MRRB 3RPIA 4MDJB 1E4WL 3FB5A 3U82B 2V2TA 4XVUD 1EJOH 3WJJA 4F7PB 3LD8B 4QRQB 4JAMB 2OI9C 1JL8A 5C0JA 1EAPB 5KSVA 5CZVH 5JTWA 2ZCLL 3NIGF 4LLQA 1L0QA 1AGDA 3OKOB 4ZTPL 2NXYC 1T80A 5EBMA 2BVQB 1PG7L 2ARJQ 5BJTA 3W2DL 5IJVA 5KZCB 1Q9LA 5D1XA 2EDHA 4XNUH 5DO2C 1HDMB 4OD2A 2NQCA 4LNVA 1VFOA 1QSED 3UTSD 2EE6A 3UDWA 2BFVH 4LBEB 3RZCB 1S5IH 1S7VB 1EERB 1XIWC 4BFIB 4DOHE 3ZO0A 4X5XB 1MCRA 1UM6L 2YN5A 4U05A 5L9DL 4WI8A 3E6FB 1DQLL 2CSPA 2PO6C 1NCDH 2H32A 2BHYA 4RRPG 4MLSA 1LO4L 4WUKH 2D7QA 2V9RA 1XR9B 2ZCKL 3BPLB 3FN3A 4KMTH 2IFFL 2X4RB 3ZKXC 3DUUB 5F1OB 2XACC 43CAB 4S1DC 1CFNA 2NZ9D 1N59B 2VDKL 5EO1A 4M1DH 1CE6A 4L5FL 2BZDA 4FZ8H 3KPOA 2OMNA 3EDDA 3X11B 5J1SC 5IG7A 5T5NG 2DBLH 4ONOA 5I76B 3KPPA 4IOIB 3QCVL 1NGXA 4A6YA 1RZKC 4RAUB 3C5SA 3HA0A 5J6HB 1TPXC 3REWB 4K7PY 5F44A 4NO3A 3QO1A 4PJGA 4KVNL 1WFNA 4P57B 5HI5D 1OT2A 3GMMA 2EDQA 3QR2A 2JCCA 5JIIA 1HSAA 2X7LA 4X5LA 1TITA 4Y2DD 5HHME 5E5MB 4GBXA 3MCG1 1FO0H 2X9YA 3S88L 3B6SA 3V95A 3TYFA 2XQYK 1VADA 4PV8B 4Y4KC 4BELD 3UTSA 4F7TA 3GSOA 5DZNA 3BD3A 1I8IB 4PJ7F 1BLNB 5CEYB 2FO1A 5H37H 4KTDH 2D0HA 3RL2A 1A6TA 2LVCA 3BOVA 4RZCB 1L0YA 4PJDB 2IF7A 4PGDA 4KDTC 2VDOL 2HRPL 5L0QB 4M7ZC 2DICA 3VFMB 1KLFA 4QF1B 4TUJB 3KPQA 1JK8B 1ITBB 1MEXH 3PQYD 2XY1A 3DTXB 4JRYB 1RVFH 4GLRI 2OJEB 4YFLI 3OR6A 1I3UA 4MD0B 5TGBB 3BWAA 4DQOL 3TP4A 2MQ3A 4P5TD 3MBEA 3EDKA 4OM0L 2VUYA 2AXHA 1GGUA 4MJIB 3SQOL 2VQTA 5I8EA 2IAMA 1GHFH 1OGAB 2VAAA 4P4KC 3LKRA 5KVDL 2NY4D 3L5HA 3D69B 5CJOL 3MO1A 4D0DA 1RI8A 4FQJL 1DLFL 3NTCL 2I9LB 5DTFB 2YR3A 2X42A 3NCYP 5GJSL 2ZOLA 2D3VA 4QKXB 5DDHB 1A5FH 4XMKH 2EIZB 1A6PA 2EDKA 1EIBA 2BOCA 3SBWA 3VXME 4Z5RB 5AWNL 4M6OL 4GS7B 5EZIL 2J88H 1CIDA 1MREH 4X6BB 2XNAA 1JTOA 5HJ3A 3QNXB 4XCYA 2E7CA 2FJFB 5DJYB 3ARPA 3RPKA 2G2RA 1J1PL 1OOAA 4M6NL 3OXRB 1MCKA 1LP9F 1NUGA 4HH9B 4J2XA 4HUXA 1WZLA 4MXQC 4FQXC 2CDGA 4MB5A 1F8TL 1A7RL 1S5HB 4ONGL 4QOKE 2I9TA 3CVHH 5F70A 3MLRL 2BSSA 4XHQA 3O45A 4ZXBD 4M7KH 5D2LB 1B4JH 4G8GB 1CLOL 2EDNA 4IRSB 1GSMA 3PQYA 1CF8L 4JPIB 5C0ND 4RQQA 4IHOB 4NO0A 4PJ5A 4X4XB 1WT5A 3BAEL 3HB3C 4HK0A 3QUXC 3MOAH 5HHMD 2NY1D 4L4TE 3SE3A 3ARQA 3BGAA 4PGZA 4UNUA 4E5XA 1NBYA 3WS3A 2X4PA 2V7NA 3KPLB 3VGHA 4ZO6A 2FHFA 4XH2A 4X9BA 4H5SB 1PKQE 5EIQA 3MRDB 4R4ND 1A7OL 4OUUA 3ARFA 1EXUA 1RZKL 1RZJC 2D7NA 1I8KB 5F8RC 1H3VA 1MWAB 3BEWB 4WY7H 4S1SH 4J8RA 4LLMB 1UH2A 3QG6B 2QQKL 5HD8C 3BVNA 4JFFA 4NRXA 4L3CA 4WO4D 1FORL 4J6RH 3D25A 4ORGB 4MNGA 1MCJA 4NZTL 3VFMA 3BQUA 3IETA 4GAJL 5CINH 4YHPB 4PRBA 5ILTL 3FFCB 1MLBB 2GY5A 2ARJA 4BK5A 4JN2A 3FT3B 3EO1A 1WEJL 2UUDH 2RCSL 4GT7A 2R9HD 4DAGL 1S7WA 3NZHH 1J0HA 3DX8A 1MFDL 5CMAB 3OGOE 2H6PB 5TDNB 4WCYH 4FMKA 1GAFL 2QADD 5DVNA 1BZ9B 1FYTA 1A6ZA 1G7LB 1ZA3B 1K6QL 3VXRB 2VR4A 3L3JB 4JLRB 1R5VA 1RV6X 2UZIL 4PGBB 4OLWH 3MRCA 2VMFA 3QFDA 4EN3B 5K59F 2A9NH 3EJJX 4TNVK 3VXMD 1D5ZB 2APWA 3TN0C 1QBMH 1HXMB 5TQ0L 4LASH 4XGZA 3TYGH 3L9RA 4YBQD 4GAGH 4QXGL 1A9BA 5J12B 1G9EA 3V52H 5GZOC 3BDYH 1MH5B 2NY0B 3KYOA 5SX5K 2F9BT 2GCYA 1AHWA 3WIFA 1T2JA 3DUSA 4QOKD 2YD6A 5E94A 3GIVA 4NKMB 4QHMB 3T65A 4GW4B 3VGAC 4FP8L 4L9LC 3QWRD 1J1OH 4ZO9A 1K4CA 4WW2F 5T33L 5DUPL 1CLZL 3SOBH 2ED9A 4WO4A 4S1RH 1WCBB 1TVHB 5INDA 1YNTB 2VAJA 5IMOA 4B7IA 1UYWH 1BZ7B 4HCRL 4J3UA 4P59L 3H42L 1DEEA 5DYOB 4PG9A 3OJDB 2EKSA 5FUZL 5MENA 1IZKA 4L4TD 4MSWB 5E4IA 2P5WE 4UINH 5KW9H 4KKNA 2VLLA 5ANMA 5L8KB 1JZ3A 3HC0B 1RMFH 2IBGA 3INUL 4HIHB 1ZGLP 3HC4L 1T2QH 1RUPH 4KJQD 5DJ0B 3SDXE 5EN2A 1SYVB 1PGRB 2GITA 4YHKH 5A40E 4YFLF 3QDHA 5C0CD 2BOBB 4C58B 1T66C 1B2WH 4PG2C 5D7JB 1VERA 5EU5B 1IEAA 1S7QA 1N6QH 1E6OL 1EGJH 3T08A 2YD7A 4TULL 4FFWC 2DQCL 2ZJSH 4JANB 3R1GL 1HEZB 4P2CG 1QEWA 1Y0LA 3QFJA 4I0PD 1UGNA 4JPVL 3RVWD 5FAAA 3NFSH 1C16B 2PR4L 4BK4A 5DQ9A 3N1GC 3BE1L 5IBLD 4HXAH 4OZHF 4CMHC 7CGTA 4OLVL 1RULL 1RZJL 1FZOA 1SVCP 1NANI 1UWXK 5MEQA 4Z7WE 3FOMB 5ACZB 2A83B 1S7UA 2JK5A 4KK8C 2A74B 4ZUSB 1AJ7L 3NCJH 5A16A 5ACMA 3G5YB 5F6HI 5IHUL 4E42A 3QWRA 4R0LB 2Z35A 5F7EL 1KIQA 5HYSB 1F58H 4ODHH 2APTA 1W8OA 4JPWH 3LS5L 1JGVH 1IGIH 3AFLA 4MLIA 1FBIH 5DHVB 4KH2A 1AH1A 4YPGA 2QSCL 4L3EE 1I85C 1ORQB 3IDYB 3O3EA 3QIWB 4Y5YC 3OKMA 4AENB 5CP7B 5FK9A 1TZGH 4L4TA 3CLFH 3QEQA 4W4NA 2UZYB 2Q86A 1RUQL 4U2ZA 4P2QE 1JCKA 4O2CA 3GSVB 2RQ8A 3KG5A 3U48A 3VCLA 1U95A 3TIDA 3PWVB 2A9ML 2XWBA 2DQFA 3FQWB 3IJSA 3BGMB 3ILPB 4LLYB 5C0CA 2EYSA 3UTPD 1MIMH 3N85H 1BQLH 4AEHL 2FJHB 2AK4E 3GUTA 1BIHA 4XMLH 2BVUA 4GXVL 2Q6WA 3SPVA 3G6AA 3KPRE 5I1IL 1KCUH 3WNLA 1DN2A 4Z78B 4I0PA 3DSFH 4XP1L 1G1YA 3RGVC 2FECI 4HUWA 1IAMA 5HTSA 1YQ2A 5H94A 1FL5A 5GS1C 4CVWA 1VFBA 2DQDL 3NIDF 4OZFG 1QSZA 1X4YA 4G6KL 5GHWL 1R3KA 3ZKQD 3BYTA 2NY3C 1I9RL 2K1MA 2BDNL 4OFYD 1I8LA 5ESQA 1ZT7B 2CRYA 4LSQL 4HG4J 1JIBA 3MX0A 3O11B 5IV2A 2GEEA 5HYJA 2YMXL 2IH1B 3O0RH 1VGEL 3LIZH 3PF2A 4JY4B 4M03A 2CDEA 1QO3A 4GRWB 1SM3L 4XCCH 5D7IA 3VI3F 1A7BA 5DA0B 4C56D 3GJFH 2W0LA 4RDQG 4V2CB 4U1MA 4DW2H 2F54B 2ZSVB 1E28B 4OFDA 5CJQH 4I3RL 3BRGC 3O6FA 4ERSL 1MQKH 1YMHA 2PYEE 4KHTH 4AQOA 1IMHC 1FG2B 1CT8A 1B9ZA 3I6KB 4IRZL 2CO6B 2FHCA 2K7PA 4HIEA 3TVMD 2VRAA 1PJ9A 3DXAA 2NW2A 4JQVC 4WV1C 3S36X 3F7VB 1J0KA 3MA7A 3QI9C 3LCYA 4W6WB 4JB9H 5KVMC 4JGMA 1R3IL 3EYQD 1KB5L 4WUUA 3T3PE 4D8PB 3LHPL 4I3SH 3TPKA 4PTTA 4L3ED 4AEFA 1UXWA 5FO7A 1JWMA 1CLYH 3T0XA 1YPZB 4Z7OE 3TZVC 4RSVA 5DHYA 1F4YL 1ITCA 4NN7C 4P2QD 3QB7C 5IFHL 3EHBC 2NLJA 1CTOA 1FDLH 3L3DB 4UQ2A 4FZEL 3BP7A 5FYKL 3T0EE 3KYNB 1JPGA 3CC5B 4RGNC 4XNYH 4OFYA 4LFHD 1YC7A 1K2DB 1YEJL 2VQUA 1ZHBB 1XF2B 1DQDL 3Q6FB 4HFUL 4RWHA 3EOYG 3SEPA 5DRNB 4QY8A 1N8ZA 2DQGH 5IJKC 2YRPA 5HHPA 1FO0A 1P2CB 5MP6L 4JDTL 3SGJC 3KPRD 5KSUB 5DGRA 4C56A 3L6FA 2WBJC 3KYAA 1YNLL 4I13B 4ZS6D 2BY3A 4FFYL 4MJ6B 4RGOL 3L7FA 4P5KB 4PJHE 2VN4A 5DK3A 2FH8A 3MJ6A 2V2WB 3MXWH 3S97C 4G8IB 4F37F 3BZEA 3V0VA 5HSFA 1WISA 2B20A 3LEXB 4BFEA 1NGPH 2EH7H 1UKSA 3SKUD 3QDJB 1FFQA 4HKJA 4QT5B 4WU7B 4YXLH 3LD8C 3S96A 2JB6B 4KAQL 3EIFA 4LHUG 4LQFH 1U8NA 1K8IB 2QHRH 5F9OL 4OFVA 4HF5L 5E6IB 1ZV5A 5D5ME 2BVYA 4XCEB 5MERA 2H2SD 1LO3L 1UEYA 5JHDB 1D3CA 3KPSB 1DZBA 1G7QA 3IXTB 3QUYD 5EUOF 3W39A 1DUYA 1AFVL 4M7LT 3MV9B 3FMGH 4MJ5B 1DQQB 3GIZH 1S3KH 3WO4C 3HNVL 5DZLA 1NCAH 3MLWL 4JO3H 4PJEF 2AEPH 2PYED 3U7AA 3AXLB 3RZCC 2N7BA 1X5KA 2VL5A 4MA8L 1F6AA 4P2QA 3KPMB 3S34L 4WFGE 4JO2L 5AUMB 4P3CH 2VXVH 3EOAB 1AD9B 1QUNA 2ENSA 4HS3A 4MAYA 3N50A 1XGYL 5FFLA 4F58H 1I9IL 1WAAE 3P30L 2ZOKA 4X0KA 2ZG2A 4MCZB 3JWOC 2CJUH 1CXFA 3DOSA 4YC2B 2G5BA 1OP9A 2IQAA 4YHLL 2JF1A 1GOFA 4HHAA 4ALAL 3LN4B 4DN3H 3GBML 3FB7B 3FT4B 1JNLL 4TQEL 4ODXA 3DX7A 4QCIA 1U8JA 1KTDA 4LLVB 1IGFH 3Q5TA 5BW7A 1TCRA 1UACL 3UBXB 2PTTB 4LEOA 3RWFA 2WQ8A 1FGVL 3HE7B 3EW3B 4JRXA 2OL3L 3TIEA 3QA3B 1PX3A 3O6KH 4LSTL 3VFRA 1BPVA 5IQ9A 3MODH 4BJLA 5FO9B 3S35L 3WN5B 1G7PA 5BOZG 2DQHH 3KXFA 3T0ED 4Z7VE 4J3TA 4M8QB 4UNTA 5K9JL 2CDFB 2KZ1B 4OD1H 1IKNA 1OPGL 3IU4L 1OM3H 3FQTB 1CICB 5I1JH 2F53E 2IPKA 1DBBH 1T4KB 2WLYA 1CGTA 1HSBA 4BFGA 4QO1A 4U1SB 2AJZA 4OSUL 4J12A 4O9HH 1RZ7L 5HDQH 1FNGA 3SKJH 5CCKH 3VJ6B 5JLZA 4EVNB 4MA1C 4KZDL 3QUYA 4EQ2A 3B2VH 2VLKE 2UVFA 3MLXL 1YEIH 3NFNA 1W0WA 1QNZH 2ICEA 5DJ8A 4N1CA 4RAVB 3SCMB 2HJLA 4XVSL 5AG8A 3ET9F 1EVTC 4R90L 3OAYK 4IMKC 4G6AD 4L8SC 2QV2A 3T2QA 2XG5A 3OX8B 4AJ0A 2F74B 3HI1A 2R2CA 2PYEA 4I1NB 4I4WB 5F9JB 1DBKL 4RISH 2IG2L 2MCPL 2W65B 2NCMA 1OP3H 1JF1A 1LDPL 3V5DB 2VZSA 2VJXA 3ULUE 3SDYH 3C5ZD 3G5XA 4RNRB 4PY7A 3SE8H 3FO9B 4S10A 1G7JA 1MFCL 3MRNB 1XGRA 2ZUQB 4HZLB 4JFOB 4XPBL 2DJ4A 5E2WL 1L4IA 2R0KL 2E9IA 2X09A 5EUKA 4B41A 1ZVSB 4J3XA 2WK2A 5FYLL 4YDIL 2FIKB 3RY4A 4ODTL 4HBCL 2XZCL 5B39A 4JFYA 1KJMB 1TXKA 3H7BB 2BX5A 1OAYL 6FABH 1FC1A 5B3JF 1CD9B 2XN9D 3HE6C 3TBSA 3RVVD 4WFGD 1VSCA 1MCHA 3U0PB 3LSOB 4GLRH 4P9HC 5E70A 1GVIA 1MVFA 1D5IH 3FO2A 5I9QC 4FQIH 1H3TA 4PB0L 5GGRA 4ETYA 1W8NA 3QXAA 2WSKA 4FQQA 4Q6YA 1T7ZA 4JFPA 2OQJA 1E27A 4GOSA 5C70A 3WKNA 2J8UB 4MDIB 2G5RA 4HPOH 1FAKT 1WSST 3TBWA 5C0IA 1W0YT 4XP5L 4XBPB 3BI9X 1V3LA 1TIUA 4LVOB 4DUVA 1ONQA 3PE9A 3WFBL 1N64H 4APQD 4ELMB 1CDJA 1Q9OA 3P2TA 1BWMA 1KCRH 4RFOL 2P7TB 3RDTC 2NY2C 4NOBA 1SEBB 4PJ7E 2FEEL 3HZVA 5CZKA 1FNSH 4PJHA 5GGRY 1OSPH 1FE8L 1XF4B 3V6OC 1A6UH 5HHXL 5KS9F 3WHXB 2DI9A 4R7DA 1QBBA 1JYXA 3PJSB 1XH3B 2CLVA 2AJVH 1QVOB 3O6ML 2LFGA 2GK0B 5DVMA 4R7NA 4OCYL 3H3PH 3O81A 2F53D 4H20H 1GJIA 5FA3B 5JQHC 1FAIH 1KFAH 4DCQB 3B9AA 3GK8H 5D5MA 5HHOD 4ISVA 4IRSC 5BZDB 5J9PA 1QLEL 3ALPA 3BH8B 5CILH 1H3WM 5DQDL 5C0AA 3NH7L 2NY6D 5CEZE 1MCOL 4UB0H 4MNHA 5CIPB 4DVBB 5BXFA 4YK4B 5J1AB 2RFXA 4WHDA 4LLDA 4U2YA 5HYSG 1F42A 3LQZA 2B7DT 1TTGA 3ARGB 1KEGL 1CE1L 2NX5D 2XN9A 3V4VL 4LEXH 2BVEA 5EU7C 2Z93A 1ZHKB 2CLZA 3PGFH 4RAHA 3Q1SL 4LLUB 1KELL 4ZFFB 3Q0HA 4LVNB 1QKZL 4S2SB 3ULUD 4GRLC 5FUCC 1EGJA 3PHQB 1I1AA 5TF0A 3MJ7B 4CN6A 3OG6B 4NN6B 1DQJB 3GMPA 4LF3B 4NQVA 5D9SA 1TTFA 1KPUA 2R4SL 1AE6H 1NC2A 1T83C 4U6VH 1IFHH 4I18C 3RTQD 1LP9E 1CQYA 4MHHI 4NFBA 4XBEL 4YHOH 1NJ9A 3OL2A 1NAMH 2YPVH 5DJXB 2B1HL 1G9MH 4P2RB 5KBNC 1U8QB 5HGBA 1MJJA 1Y6KR 2DLIA 4X99B 3D0LB 4X8JA 4NZDA 2HN7A 4NQSA 2E27H 5GPRA 5GZNC 5J1TC 3FRUA 4S1QH 1H15A 2AJ3A 1NBVL 2XI9A 4QTHA 1XF1A 1KUMA 1ETZA 4QRPE 3KWWB 1IGTB 3O2DL 1Q0YH 3FO1A 4LAQL 1NLBL 4LRIC 3ARBB 1GRWA 4IRJC 1M7XA 2BVPB 5DR5L 5HHOA 3FZUC 4EN3C 1GZPA 1AGBB 2ZUUA 2NY5H 1ZT4B 1EJ6A 3D39B 5F7DA 1INQA 2YPLA 5DUMH 5DD6B 4HEPG 4CADB 3A6BL 4DZ8A 3NCCB 5IM7A 3ES6B 1XGTB 3HAEH 2YS4A 4WTZG 1ZWIB 3O8XB 2NY0C 3TNNA 2NX5A 1KT2B 1XMWA 2JJVA 4KUCD 5DEZA 3UC0H 3VFSA 3CDFA 4HJJL 5I71C 1Q9KB 3MZGB 4O58L 3MNVB 4JKPH 1X7QA 2VDPL 4HKXB 1ZS8B 2JTDA 1P6FA 1F3JB 4K2UH 3IFLL 5DSCA 5GSRA 4U1GC 2FX8L 4HWZA 4LCWE 2VLJA 4WNQB 3K4AA 2A0LC 4BQ8A 3IU3A 4I77L 1ZLWH 3DMMC 1KB9J 2VDNH 4PJFF 5CEZD 4K55A 3V7MA 4GH7B 5C0EA 3H9SB 3SDCA 5I6XB 4NNXB 4TRPH 3L3IB 5C09A 1DANT 4N8VB 1NDGA 4MAUH 1ULVA 5FGSA 1J5OH 3SGEI 4NM4H 1P9MA 1S7SA 2IEPA 2CIIB 2HVJA 1TNMA 2V5TA 5IHZA 3RPIB 4UMGA 1HH9A 1JUFA 3FB5B 4JO4H 5I0ZA 2V2TB 5L7XL 5D7JC 3OB0K 4JG0L 5GRZA 3GJFA 1MCPL 5I73B 3WMSA 1DFBH 4C59B 1AKJD 3B2UC 4TPRL 5KSVB 4GSDL 3MGTA 5JIKA 2JELH 4OKDA 1HHJA 1OAZL 4KGJA 1AGDB 1BVLA 5EBMB 3STZB 5LWYL 1G0DA 5BJTB 4E41D 5IJVB 4MD4A 2WINA 2IGFH 3U0TA 4OGYL 5D1XB 5CAYB 1AD0A 1P1ZA 4LHJB 1KTLB 4KQ4H 2B5IC 5ITFA 4OD2B 3GBNL 1MVUB 1CXIA 1U3HC 4MNQE 2OK0H 1CD1A 1JNNH 4O2FA 2WBWB 1AGCA 4CW1B 2BJML 2ITCA 4QRPD 4W6YB 5I18L 5F1NA 5IT2L 4OCMC 1G9NC 1FP5A 4XWOD 3CFIC 4LHQB 3JTSA 4AMKL 2P5ED 2H32B 1NANH 3L5JA 4OLYH 2Y36L 3UPAA 1EUUA 2PYFB 3NN8A 1LDSA 4G6MH 3IDYC 3QIWC 3B9VA 1Z6JT 3V0WL 3TO4D 1IZJA 3IJYA 1NL0H 2ICWI 4YFEA 5D71L 4QHLB 4OJFH 4KTYA 3TFKC 5I1DA 1XF5A 1QR4A 5E1AB 1JPSL 3L1OH 4P46C 4M93B 1RZIA 2F19H 4MXWH 1CFNB 5HHVL 5EORH 1JMXA 5EO1B 1OAQH 1CWVA 4ZPTA 1T5XA 1CE6B 1NC4D 1OAXH 2VZ3A 4X9GA 3KPOB 3O4LA 5IG7B 2XFXA 3PABB 4QXUH 4LCWD 5DFTA 4ZSOB 3QPQC 4NOFA 1AKJA 4YBHA 4J7RA 3C5SB 4LNRA 3V4UH 5SWQA 4NO3B 3QO1B 4PJGB 5C2BL 2LTQB 4OZHE 3CK0H 5D6DC 3GMMB 4E41A 2JCCB 2X7LB 4NGHL 4BSWA 1YEKH 4KMQA 4G42A 3B6SB 3GSNL 3TYFB 4KJWC 1VADB 3UBXG 1IT9H 3UTSB 3GSOB 4UT9L 4UUJB 3VRIA 2V7HB 8FABA 1INEH 3MLVL 4OTXH 4QRPA 2DM2A 5D7LD 3ESUF 3RL2B 4X6CF 1A6TB 3CX5K 5E24E 4OD3H 1ZHLA 3MRBA 3QP3A 4PUBH 2NW3B 2ZKHH 4PGDB 4M7JL 2P5EA 3CPLB 3PWJA 3KPQB 5SWSE 3B9KD 1MNUH 3CDYA 5IFAH 5HGDA 2O5YH 5HXMA 2D03L 5IWLA 3UZVB 2ZUWA 1I7TA 1EHXA 4WWKA 4Y1AA 2XKNA 3OR6B 1WWBX 4NQCE 3GM0A 3HR5A 4XP9H 2DJUA 3EO9H 3P0YH 1J88A 3BWAB 4FFVC 4LDOB 5E8DL 4PRHE 5FV2A 5C2UB 3EAKA 2XG4A 3ARTA 1J86A 4KI5C 4Y5VA 2IAMB 1NC4A 2VAAB 4DGVL 3QHTC 5C9JB 5CP3H 1S78D 2B8OT 2Y5EA 3MO1B 2IC2A 5I1GL 2GI7A 4K7PX 4O4YH 5IW6B 1CGUA 2ZOLB 5IGXL 4Q0XH 3HR6A 1NEUA 4NBXB 3WXVL 5BCAA 1CGWA 4HJ0D 1YDPA 1U91A 3NIDE 2BOCB 3DV6A 4Y2DB 4TTDD 4KQ3H 5HJ3B 4F57H 3HFMH 4QRTA 3WS6C 1G6RL 4XCYB 4HKBA 2G2RB 4JREC 4PP2A 3ARDD 1KF9B 5GGTL 4HUXB 3MBXH 4O5LL 5LCVL 1SMOA 1G9NL 1J11A 2CDGB 2GJJA 5JIHA 4FABL 1KENH 5D7LA 4UDUA 5E99H 4H88L 1MHCA 2BSSB 4XXDA 4WEBH 3O45B 4PLKD 5IOPA 2ARWA 5HY9A 1KJVA 4OF5A 2FB4H 1IC5H 4MD5A 1BIIB 3S36L 5IMLB 2G75A 3EDJA 4XC1L 2B0SH 3PQYB 3ZYZA 1CYGA 1DUZA 4RQQB 1X6NA 3BP6A 2X70B 4NO0B 2I25N 3W9EA 2P1YA 4EBQH 1MF2L 3CXDH 5BV7L 5I1KL 4HK0B 1KC5L 3GKZA 4Z7UF 1JGUH 1UT9A 3LQMA 2D9QB 5DJ2A 4E5XB 1NBYB 3WS3B 5ADPL 3UTZA 2X4PB 3FQRB 2V7NB 4POUB 2RBLA 4OCWH 5JXED 3K3QA 4POZD 3BP5A 4OUUB 1FCGA 1EXUB 2Q8BL 1OSZB 5MEOA 1VKXB 1YYML 2NY4B 2BNQE 2X5PA 4J8RB 4XPTH 3MGAA 4R96A 4K3DL 3BVNB 5KOMC 4L3CB 4JFEA 5INCA 3KPTA 3D25B 2XWTA 3B8YA 2RAMA 1GXEA 2X4TB 3BQUB 3IETB 3RWCA 1L9NA 3VMOA 3KLHC 3MV7E 4LGPB 4PRBB 1DVFD 5BQ7A 4M1CD 2F8VA 4PRHD 1RUMH 1RY7B 4EKXA 2R39A 3V5HA 3ARDA 4P99A 4UT6H 2VXSH 5DRWA 1YECL 1ES0A 3DX8B 3HZYA 1BAFH 4YC2C 4PRNA 1FYTB 1A6ZB 2V9TA 2YK1H 4DK6A 2GQHA 2EEAA 1ZANH 5C07E 4ZXBB 5JOEA 5JDJA 4LSPL 4OIIL 1I7ZA 1R5VB 3FQXB 4X80H 3MXVH 3RX5A 1RFDH 3MRCB 5F7KC 2DQUL 4OGXH 4Z0BL 4XCNB 4YAQA 3HE7C 3U0WL 4DKFL 1G7MA 1Y6NR 4PJ9C 1JHKH 4LCUB 2WZPD 5HHMB 2NY1B 4M4PA 5IB4A 1NUNB 1K4DB 2EXYC 3WN5C 2CLRA 1J9CT 3RA7L 1A9BB 1K85A 5JXEA 3KYOB 1CICC 1T04A 1I1YA 5FUOH 4I8DA 2GCYB 4U1JA 3RVUD 1AHWB 3DUSB 4L8BA 5E03A 3GHEL 5AD0A 5E94B 2APBA 3GIVB 3T65B 3VW3H 4RFEA 5F9DC 4YIQA 2NYYC 4O51A 5TE4L 3HMXL 1CGVA 4JN1H 1K4CB 4YGVA 5EG6C 3RVTD 5I1EH 3FQUB 4PJEE 4WO4B 3SCMC 4GKZA 4L29A 2FWOB 5INDB 4HUVA 3TF7C 1M4KA 4Q6IA 5AZ2H 1HHGA 2VH5L 5DMIL 3TH2T 1FZMB 3BKMH 3K1KC 1DEEB 3D3VE 1A7PH 1IQWH 1FNAA 3QNZB 4PG9B 1DQTA 2ZUSA 3BESR 3PWPE 2EKSB 3VGGA 1DVFA 4XCFH 1N3NA 2Y07L 4QHKJ 2GW5A 2VLLB 1X6LA 3CZFB 5C08A 3EUUA 5DMKA 2AKRA 4FXLA 3QRGH 5EN2B 4IJ3B 2YRZA 3VI4E 2QADB 3HRZA 2YD8A 1VFUA 2ZUQC 3SJVE 1YMMA 4CRPA 2BNQD 4BUGA 4XTRD 1NAMA 4JKMA 1JRHL 1IEAB 1LK2A 1S7QB 4K3JL 2IMMA 3P9MA 2ICES 5DJ6A 1NKRA 3MRKA 3VGEA 1MWAH 4N90E 1QEWB 1Y0LB 3VXMB 1FRGH 5IW3A 4Y88A 2GJ6A 4EZMA 4FA8A 4IOSD 1FIGH 2ZNXA 5DQ9B 1JJUA 3RWGA 1AGFA 3PL6D 5FM4A 2ZCLH 3RAJL 5F6IB 3WNPA 1WWAX 1FZOB 2MFNA 2ZWLT 3AUVA 4KHXH 4ZTPH 3AS0A 2UUDK 5MEQB 4H8WC 4N8VG 5EA0L 1OY3B 4DKDC 1S7UB 3W2DH 2ADIA 4QOKB 5T5NF 5JNYA 4PYGA 1A2YA 5T1KD 2R56L 3RVXC 1MRDL 5C07D 3LRGA 3T4YB 4QWWC 4HUUA 2WP3O 4LVOC 1N0XL 4NHCL 4E42B 1ADQH 1F90L 2Z35B 3HAEA 5BMFH 2FGWL 1KIQB 4NWUH 4G8FA 4W81A 1A3RL 4NDMA 3HC3L 3ZE0F 5HDLA 5GS0D 4K9EC 1H3GA 1XR8A 2FBJL 4TUOB 4YPGB 5D96B 4WDIA 2R0ZH 4KY1L 5E56A 1DQLH 3TV3L 2MWCA 1IILE 5FK9B 4L4TB 3QEQB 4WTXA 5DFVC 2Q86B 1D9KC 1QPPA 1LO4H 2GTWA 1SVZA 5IK3B 3WFEL 1U95B 5TJWK 3HG1D 2AXFA 5J3HD 1B90A 2DQFB 3IJSB 2YA1A 3QDGE 1MOEA 3RIFF 2VSCA 4PJBE 2EYSB 1XGQB 4NT6A 5C0CB 3G6JF 1HHKB 3Q5YA 3QZWB 4L4JA 5C0FA 3Q3GB 1JZ5A 2R0WL 4MWFA 1X5YA 4JFHE 2AXGA 2OXGA 3ARUA 5B3JE 3T09A 3D1MC 3BPCA 2VDKH 4ODSL 4YK4C 5AAWA 4NC1C 2Q6WB 3SPVB 3G6AB 2A73A 5KJRL 3WYRA 3DO3A 3IRPX 4AM0A 3ARGC 4L5FH 3C6LD 2LABA 1IC4H 3D3VD 1UZ8A 5F9WB 4I0PB 1DL7H 2XKSA 4LARL 4HUWB 1WIPA 4JZJA 3AAZA 1VEOA 1DQML 2QKIA 3QCVH 4H0GA 3W0WE 1KBGL 1F3DH 4EJ1C 5KVGL 4PJ8C 4KFZC 1NCUA 4HUNB 4DN4H 2W9LA 3VWKC 5H94B 1FL5B 1V7NH 5HVGB 4YQXL 1VFBB 2X9WA 1C5CL 5HI3C 5FGCB 1KN4L 2R2HA 5C6TL 4NN6C 2EC9T 1P4LA 3NMEA 3RQ3A 1HHHB 4XAKE 3KAAA 5T1KA 2WV3A 4KROB 5ESQB 3S88H 5C07A 1UJTA 3B5GA 5IV2B 2EDDA 1H5BA 4J4PC 1QHPA 2Y6SC 1V3KA 5EPMA 1MFBL 3OAUH 3AB0B 3T0BA 1QO3B 5D7IB 4EDWL 4N90D 4BZYA 2ATKA 2IBBA 4U1MB 1BMGA 5D1ZD 4Z8FL 5J0BA 3VXNB 1S8DA 4LPXA 3SO5A 1CTNA 2OX5A 3E6HB 5T1LD 5JIPA 4ODUA 3ZKNC 2VDOH 3WNMA 2HRPH 4FQLL 4XP6L 3O6FB 4M48L 4WI3A 2AI0L 1YMHB 3PWUA 2DQIH 3ZKMC 4R26L 3LEVL 3S37H 1J12A 3JUZA 2GYSA 1CT8B 3ARBC 3HG1A 3CZJA 5EUOA 4CMMB 4Y16D 3S7GA 4HIEB 5KN5A 1A8JH 1JNHA 3OGCA 3DXAB 4X6DF 2QQNH 3ILQC 2F15A 4LIQH 3AS1A 4OM0H 4FRWA 4DEPB 3MA7B 1AXSB 3UROR 4GG8A 1F00I 4WUUB 1W0VB 1UJ3C 4NCC2 1CGYA 3O8XC 3D3VA 3PUCA 3IDJA 1TJIL 5SWZE 3DVIA 2VZVA 1X4ZA 1YQVH 2PW1A 5CJOH 4FQJH 3MRIB 1DLFH 4H8WL 1FLRL 1KGCE 5GJSH 5BRZA 1A1NB 5DHVH 2DS4A 2D4DA 2NLJB 5IIEA 2VOTA 4UQ2B 3BP7B 3QUZD 5AWNH 3QDGD 4M6OH 4PP1C 1H3UA 2OSLB 4TVPH 3RUGE 3QO0B 1X5FA 4F15B 1CG9B 5LGHH 1RIHL 2GT9B 4M6NH 4K9EL 5KVEL 1N8ZB 4HIXH 5HHPB 1FO0B 4ODWA 3L5IA 5I6XC 2YD5A 4C56B 3L6FB 3QEGL 1YY9D 1F8TH 1A7RH 3MUHL 4I3GA 4GQ9L 5GISL 2D31B 5JW4M 1QHOA 3VWJA 4NZUL 4K3EL 1A3LL 3MROA 2LVEA 3W0WD 3R8QA 3BZEB 1OD9A 1JF5A 3V0VB 5KSBA 1UM5L 1D5MA 4ZYKA 1TDQA 1CF8H 2NR6D 3MRRA 3WJJC 3ULVC 3S96B 1NH6A 3EJYD 4MDJA 5E95B 5I73C 4KRMB 1U8NB 4XAKD 1G7HA 3SGEH 3L95B 4F7PA 3M17A 3QSKB 4Y2OA 3ZYOA 2CK0H 5K9QG 4JAMA 3MV8D 5AYUH 4J3VA 3OKOA 3A6CL 3TPUA 4ZMAT 1DUYB 2I24N 2CKBL 2BVQA 2AV7A 1A7OH 5D1XC 3RHWF 4X7TA 2D7TL 1RZKH 3BN9C 3IDNB 5DWUL 3GJFK 4N0FB 1QFHA 3OJMB 1RJZA 2CRMA 5AEAA 4LSSL 5CP3A 3UDWC 2QQKH 5FOJA 4Q74A 2VL5B 1VEMA 4P2QB 2YUZA 1FORH 2J8HA 1DR9A 4HS3B 4MAYB 4RMWA 1LNUA 4JFDE 4GAJH 4NSKA 3QDGA 3JVGA 2ZOKB 4X0KB 1BQHA 3E6FA 2G5BB 2AGJL 4OFPA 4HC1L 4LCCB 1KIRB 2IQAB 1WEJH 1JHLL 3KDMB 1T7VA 4ODXB 4NM8L 3DX7B 4QCIB 1U8JB 1KTDB 1WZ1L 3KPRB 4TOYL 3ZT6A 1DBML 1FVEA 1XR9A 1GAFH 4LEOB 4ZAKD 5SWZD 3G5VA 3RWFB 2C3GA 4M93C 1P4BL 1F4XL 4BA8A 1GC1C 1KCVH 3GRWH 3W0WA 3TIEB 2BNRE 1NKOA 5IVXE 5IQ9B 2V5MA 1G7PB 1LK3L 4JQXA 3FN0H 1M71A 1WICA 1UH3A 4XWGL 2ADGA 5F96L 3I50L 2H9GB 3LH2L 4OZGF 3G9AB 1BZQK 2M8XA 5DMYA 1JGEB 3JWDC 2F5BH 5TQ0H 2AJZB 3QHFL 2LTQC 4QXGH 3MV8A 1FNGB 5JLZB 2QTEA 4WFEE 1EO7A 5KS9A 2J5LB 1NCWL 3QUYB 2YA0A 1W0WB 4GBXC 5J8OA 1U6AL 2ICEB 5DJ8B 2HJLB 4PY8J 1GGBH 4NPYA 3VFWA 4KK9D 5EBLA 5D2NE 5HYQB 2QBWA 4HUKB 1F4HA 1FPTL 3HI1B 4NC0B 4IIQB 3LKQB 3WDJA 4GXUM 2PYEB 3I9GL 5T33H 1CLZH 2XYCA 4PV8A 3JUYA 5EBWA 1WITA 3GMOA 5IMMA 1MCFA 1YJDL 3IDMA 1JF1B 3BGFC 2WBKA 3CFBA 1BLNA 3H42H 1SJHA 1MCQA 5EU3B 4RZCA 3JV0A 3GSQA 3P40A 4HWEL 1CFQA 1OVZA 4F9LA 4M5ZH 1NGQL 1G7JB 3ROLA 5JUEH 3RIAF 4X6EB 3BP4B 5I8OH 4KXZI 4P4RA 3INUH 1BFOA 1JK8A 3LN9A 2H26B 4JRYA 1HKLL 2HYMA 2EDJA 5B39B 2UV3A 7FABH 4JFYB 2IBZY 3JBG7 3MBEC 1AR1C 1N7ML 2HLAA 4KTEH 1RK0B 2VERN 3ULVL 4PGEB 2IAMC 3PHSA 2DIJA 1BD2D 3BUYB 2DQCH 2NNAA 3CSGA 3FO2B 3T0EB 5EU6E 3R1GH 1IGMH 5GGRB 1OGAA 4JVUA 5E9DA 1G7IA 5IB5B 3QXAB 2DJSA 4FQQB 4JFPB 2OQJB 1E27B 2PR4H 4HWBH 2HKHL 5JOPE 2I9LA 3AY4A 4PJAF 1KJ3H 1D7FA 2YXFA 3MTRA 1RZJH 3SBWC 5DDHA 1ONQB 4G7YH 4C4KO 1I9JL 1NFIA 4WFHE 4Z5RA 2FO4A 2DTML 1AJ7H 3W5NA 4WGVB 4Z76A 4PJHB 4X6CE 3H3BC 3QNXA 3MSPA 3KNBA 3VXUE 2VC2L 2AJXH 2BNRD 2HFFA 4U3CA 3OXRA 3PXHA 2FEDD 4U6HA 4HH9A 4I2XE 3LS5H 4H26B 1QOKA 1N4XL 2BSED 5FA4B 3ZDYF 1UH4A 4G6JL 4ZFOL 3UYRL 3D0VA 1F97A 1ZE3C 2Y9RT 1JPST 4QXTA 5CUSL 5D5MB 4ISVB 5J9PB 4OI8A 5D2LA 4G8GA 1RSFA 4WFED 4G9FA 4K7PL 4KKBD 1WT5C 4YGAB 4M9OA 3Q6GL 4FNLL 4F9PA 4IHOA 1GC1L 2A9MH 5BXFB 3SE3C 2QEJA 2HT3C 5DEFA 5KVFL 4LLDB 3NCYS 4XC3L 3LQZB 4MMXC 1K3IA 4QGTA 1EZVY 4KKCC 2XN9B 3FFDA 5EOQL 2PXYD 3BUTA 2MHAA 2ILLA 5A2FA 2A1WL 2Z93B 2CLZB 1FFOA 3ARFC 4A6YL 3EYVA 3VA2C 3K4DA 1BD2A 2NY4C 3CMOL 3JWDL 4OCRH 4PJFA 3S3PA 2AERT 4M62H 1OP3K 5JW5B 2VITA 3FOLA 4XP1H 5GGQL 4U1LA 4X7DC 1CXLA 4YJZL 5IESL 1MWAA 3GMPB 1H3PL 4HIIB 4L1HA 4NQVB 4S11A 3DI2B 4LLMA 3P11L 4EUPH 1NC2B 5C3TA 5JPMA 3BQUC 2DQDH 3VDCA 4APQB 2X2YA 4DK3A 2DD8H 3SDAD 1NJ9B 1WZMA 4G6KH 4KVCH 4G7VL 1IC7H 3H0TA 1I9RH 4YHPA 2W9DL 2BDNH 5I1HH 1J8HE 1MAJA 5HGBB 1MJJB 4NQSB 1VGEH 3FRUB 5EU4B 3ZDZE 3ZTNL 4QTHB 2MSPA 3WLWD 1ETZB 1ADQA 2AEIT 2H6PA 4GW1A 1WBXA 2YUXA 3FO1B 1WVZA 2FNBA 4U1KB 1BZ9A 5LQBL 4I3RH 2F53B 4M5YL 4LVHB 3OXSA 1KACB 4YWGL 2C5DC 5HVWA 4ERSH 5HHOB 5JOPD 5EC2A 4Z7UE 5CLTA 1YEHH 1GZPB 3BSZL 4PGBA 4O00A 4K71B 5F7DB 2NY6B 4IRZH 2W9EH 4ZUVA 5IM7B 3RU8H 2IMNA 1MAMH 2NY1C 4WFHD 4MQ7A 1D5ZA 5C6PB 2PKDA 4HMEA 5JMOC 1C5BL 2E7LA 3TNNB 3OF6D 4PBWD 2OJZL 2NX5B 4L8CB 3B9EA 4NZRH 1AHWC 2JJTA 2YD1A 2ZUVA 4UNVA 2UYLA 5E8OA 3VFSB 4Q9RH 1X7QB 5B3NA 2FLRT 3HMWL 3HN3A 2GJZB 2R69H 4Z18A 4WO4C 5DSCB 5GSRB 4NKMA 4QHMA 2OLDA 3UPCA 4HWZB 2VLJB 2Z0BA 3V2AR 3IJHB 3IU3B 3V6FA 5IFHH 5I1AA 1WCBA 4PYHA 3QXWA 5B8CA 1YNTA 5FF6A 3RWJA 3C09B 5FYKH 1LE9A 4O02H 2CR3A 3DRQB 2VZTA 1C7SA 5C0EB 5ITBL 3SDCB 2E7MA 3OJDA 3WXWL 3MUY1 3CH8A 5ID0A 4N8CL 5DO2D 1YEJH 1NDGB 2R9HC 5E2UL 4HFUH 1M7IA 1S7SB 3E3QC 3L5XH 3GDBA 4IJ3C 2HVJB 3ZT7A 3HC0A 4Z0XA 3QPXL 5MP6H 2QADC 4JDTH 4AYFA 5CSGA 4X8XA 1XIWD 2HWZL 1HH9B 4BKLB 4AEIL 1RJLA 4IDJH 1EA9C 4FFYH 4RGOH 4EIZC 2IPTL 4N68A 2BOBA 3TJEL 2X40A 3GJFB 1A7QH 4Z77A 2PO6D 2WWMC 2N1KA 3R4DA 1U2CA 1HHJB 4NFDA 1NPUA 1BVLB 1OCWL 2B1AH 3SHSA 4E9LA 4P23D 4MD4B 1CL7L 4PJ7B 3HUJE 2WINB 1MLCB 2EDXA 3QUKA 5F9OH 3U0TB 4HF5H 1AD0B 5F6IC 5C3LD 4PRDB 2AJYH 4MVBC 2VLRE 1NGZB 1I1CA 4XPFL 1QBLL 1YC8A 4I2XA 1KXVC 1AGCB 1AFVH 3UX9B 2ITCB 5H37G 3NABL 4NRZA 2COQA 4GAYA 5F1NB 1HYSC 3MRLB 5BS0D 3IF1A 1WFTA 1I3RA 3HNVH 3JTSB 3SO3C 4ETQA 3PG2A 1RJYA 2J1KA 2N4IA 4LSVH 1MFEL 4MA8H 3S34H 3NN8B 4NKIL 3KYKL 1TQBB 1P7HL 1XGYH 3IJYB 3RZWA 5DHVA 1JYNA 4JCMA 5LJYH 3WEXA 1I9IH 1IGYB 5I1DB 1XF5B 3D87B 5F7LB 4AENA 5CP7A 5I8CA 4YHLH 2W91A 1RZIB 4Y4KD 2C1OB 5FM5O 1JNLH 2YN3A 5E00A 4DGYL 1EEYB 1F6FB 1T5XB 2EC8A 1C1EH 1UACH 5T3ZL 2J8OA 2HKFL 4NJ9L 2XFXB 3ALWA 3WD5L 4CGTA 5FKAB 1UWGL 3O2VL 2OL3H 3UEZA 3OPZL 1LILA 1AKJB 1HIML 4H1LB 4HX1A 4QLRA 5ELIA 4LNRB 5SWQB 3S35H 5F9WC 4G3YL 5FYJU 4PBXA 2FR4A 1LP9B 4LFHG 1ZLWK 4JFZL 1T3FB 4P23A 1TENA 1OPGH 1M7DA 4E41B 3M45A 4BSWB 5I1CH 2NTSP 4G42B 2Q7YB 1KOAA 3LN5B 5JZ7C 1CFVL 1JYWA 4XNXL 4LVEA 3U9PH 3ORJA 3ISWA 4YHYC 4PRAA 3G9VA 5D93B 5C0DB 1M05A 3VRIB 8FABB 2C1PA 4KROC 1I8LC 1HN1A 1L7IL 4QRPB 4XVSH 4R90H 3ZE0E 5ISZE 1ZHLB 3MRBB 5BS0A 1QR1A 3NGBC 2FRGP 4OI7A 2VABB 2P5EB 1UADC 1WBYB 3MRQA 3PWJB 1DBKH 4PJCF 5D6CB 3X12A 1LD9B 2IG2H 4M6ML 3I2CL 4LQ1A 3RWDA 1T1XA 1OQOA 2ZG1A 3MCLH 4BM7A 3O6FC 2XKNB 1E28A 4FG6D 4FXGA 3HR5B 4NUJA 4XNQA 2ICCA 3VD4A 5DLML 4K94C 2X4UA 3NCBB 5HHQB 2HH0L 2EDTA 3G6JE 4F37K 1MFCH 1MCWM 3DVNB 2JIXD 5JO5B 5E2WH 3J8F7 4QXWA 4MXQD 4YE4L 4FQXD 3VG0H 2AABL 4Y5VB 5FYLH 1NC4B 4HBCH 2XZCH 4EXKA 2NXZC 1PYWA 2LU3A 4Z7QF 4KZEH 3MUGB 4DEPC 5F71A 2EE2A 4KDTA 1O7VA 4YDLB 1OF2A 3MRHB 5FGBA 3RKDC 3NFPB 4NWTL 4L3AA 3GRWA 2DTSA 4NQEE 4PRIE 4OGAC 1NMAH 2XQBL 4PB0H 1YDPB 4D8PA 3RNQB 3C8DA 3HB3D 3QUXD 3DV6B 3SY0A 3T0WA 3CLEL 2ICWA 2HFGL 4QRTB 3EOTL 4JFXA 3OTTA 5EO9B 4HKBB 3PHOB 5EOCH 4XI5C 15C8H 3MJ9H 3NAAL 1JZ8A 5B39G 1CK0H 4PP2B 1D5BA 2YXMA 5DMJB 1MI5D 1T0PB 2PCPA 3L3DA 1P4IH 2Y06L 3F12A 5D7LB 4F15C 3KYNA 1MHCB 3KS0J 3CC5A 4XXDB 1K2DA 5HY9B 1XF2A 1KJVB 3NCMA 3Q6FA 4MD5B 5ALBL 3EYSL 5DRNA 1XGPB 2DLFL 3U4BL 2G75B 3B9KB 5D7SL 3O6MH 1T6WA 2WWKO 1DUZB 4WHYH 1U42A 4UZGA 3AM8A 3LDBB 4OCYH 2QLVB 3W9EB 2XIDA 4Q9QH 5GGUA 1RIUL 3GBLA 4CN4A 3OKEB 3SDDD 3UTZB 4X6DE 2JIXA 2VXQL 2DLEA 3NH7H 4WW2B 4XNZC 3QIUC 1UVQA 4KC3B 1MCIA 4FQHA 2BRQA 4WU7A 5BVJA 4DUXA 1QD0A 5J89A 1MCNA 5ISZD 1TETL 4NRYA 2QQQA 1CE1H 5E6IA 3V4VH 3VXSE 3RL1A 5JHDA 1SYSA 1J1XH 1X4XA 4JFEB 3Q1SH 2ZZUT 5I30H 2XWTB 3WV0A 4QRRE 4QNPE 4HS6B 4PTUA 3RWCB 1WC7A 3TN0D 1KYOK 1QG3A 4ZD3L 1KSRA 3CGTA 1JFQL 2VDQL 3PP4L 4MAYC 2BK8A 4K3HA 5GZOD 3V5HB 3ARDB 1A6WL 3KPMA 4HWBA 1OT1A 1MI5A 5AUMA 1ES0B 3HZYB 2KKQA 1AD9A 3EOAA 4PRNB 4XNUL 4NQDE 5ACLA 2BVOA 3U83A 5DHXB 4NP4H 2V2XA 1HXYA 1X5IA 3U9UB 3EO0A 1SJXA 5M7QA 1FNEA 4D0BA 1I7ZB 1CGSH 5BW7C 3LY6A 3FB7A 2MKWA 3SDXF 3D18A 4Q58C 4ZS6C 4NQED 5F97E 2GUOB 4PRID 4OZHB 1U8LA 3A67H 4PJXF 4YAQB 4K94L 3WFDL 1LO2H 3O2DH 1Q1JH 5IB4B 4WUKL 4NHUB 4N0CC 2CLRB 3SDDA 3M1BA 1TJGH 1IKNC 1LQSR 3MYJA 4F7MA 4KMTL 1T04B 1I1YB 3FB6A 2BHUA 3B4NA 3PXJA 4HS8L 4I9WE 4U1JB 2ITDB 1S7RA 4LCYB 5B22A 2CGRL 5HGHB 2OMBA 4L8BB 4YDVA 5AD0B 2R8SL 5I17A 1T4KA 3F7YB 5DMGC 3PP3H 4U1SA 5HYIA 4YIQB 4O51B 3RY5A 2EE3A 4OGZA 3VJ6A 4L29B 2DN7A 4EVNA 5L88L 4Z7WF 4HUVB 4HJJH 3QIBD 3LKSA 4Q6IB 4F80A 1HHGB 5JPNA 1ZLVH 2P8PB 2E8YA 1DVFB 3K8KA 1N3NB 1FGNH 3G6JA 4PRHB 4I77H 5ICXA 3K80A 4I4WA 4U1IA 3L7EB 1JZ6A 3G6DL 5C08B 4G9DA 1UQSA 4EUPA 4DVRH 2IWGA 1NDMA 4KK8D 4NC2B 4NIKB 3WSQH 5EZOH 1CFTA 3D9AL 3W82A 5FYKD 1BX2B 3DVGB 4OFKA 4NNYB 1YMMB 3VFGL 3PWNA 5F7MC 3FO9A 3VXSD 1NAMB 3BYYA 5E5RB 3FKUS 1LK2B 4WENB 3P9MB 4N9OB 4KTDL