1BLNB

Anti-p-glycoprotein fab mrk-16
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
218
Chain Sequence
EVILVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATISSGGGNTYYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYYCARYYRYEAWFASWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MONOCLONAL ANTIBODY MRK-16 (LIGHT CHAIN))
publication title Mode of binding of anti-P-glycoprotein antibody MRK-16 to its antigen. A crystallographic and molecular modeling study.
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 218
sequence length 218
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1blnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1blnB01
1UT9A 3FRPA 4JB9L 4Y4KC 3KJ4C 4UTBL 2G2RA 2BSRB 1YEHH 3TIDB 4A2MA 2HA1A 3JV0A 4LGRB 4URTB 1C5DB 3FO1B 3GKZA 5JW5B 1X5FA 4ZG1A 1UM5H 3CH1A 4MCYA 3D18A 4RQQB 4F3FA 2FX9L 2X44D 4S2SB 3FB6A 3GSRB 3MFFB 4JRYE 3SDXF 5HVWA 5IFHL 2X4QB 1AH1A 4KWUA 1PDKA 3VXUE 1JHKL 1LVEA 2WZPD 3QUXD 4KXZH 25C8L 5GGRB 4U1HB 2XZCH 1RUKH 4HGWB 3VGAB 2PW2B 1YC8A 2Q8BH 6FABH 1KSRA 5BVJA 2XOTA 4PTUB 3ARDB 4NPYA 1UH3A 4PJAB 4Y4KD 5DRXA 5E00B 4KK8C 5DMJB 3QO0B 4Z0XA 4EI5C 4LLYB 4P9HL 2BNQE 3QQNA 4RWYL 1YEJL 2YD7A 1NAKH 4JFEA 4YXKH 1I8KB 3TBYA 3P2TA 1NFDB 2PUQT 4H25A 4PJ9A 3WFBH 1KN2H 4P23A 1QO3B 3RNKA 3CC5A 3QUML 1CN4A 1CIUA 2IANE 3JV6B 2G2RB 1S5IL 2Z4QB 1CFVL 2JTDA 1ZHLB 2X9WA 2F8VA 3GMQA 5CJ5A 3QHTC 3SGKA 4I77L 3O3EA 4XWGL 1RULH 4LPCA 1I7RB 4OZFB 3QDGD 3SDCC 3U9PL 3LY6A 3HKFA 4NC2B 3HZYB 3MLYH 1A47A 2H26A 5GZOD 5ESVB 3RHWK 1WJ3A 3TEUA 2CLRA 3FB6B 1CLYL 2VAAB 4ZYKA 1WZ1L 4UINH 1IC4L 3Q5YA 4ONGL 4K2UL 4XHJC 4KK8D 2NW2B 2A6JB 4EI5D 3V4PH 5DJ6A 35C8L 5D93B 1OAYH 5D7LB 1GCFA 5AZEL 1F00I 5C3TA 2RBLA 1T6VN 3OKKB 4X8XA 3VXMB 3BZEB 3DXAE 2Z8SA 4PJGA 4GBXA 3G9VA 2RFXA 4K9EC 5L8JB 4GW5A 3CLEL 3G5YA 2IGFL 3HI5H 4KGLA 1K4CB 1X5ZA 3M17B 1IEBB 1BVZA 3FCTB 4RAHA 3BESR 3DPBA 3SDCD 5BMFH 3CC5B 1FH5H 1A9EB 3EW3B 4H1LA 4NQVB 3EO1A 4PJEE 4GXUM 5ID1B 1ZK9A 1ZTXL 4X80L 3O3EB 4WFFD 2XA8H 1E4JA 3QUXB 3WSQL 4XHJD 2I9TB 4JFDE 4BQ8A 5I30H 3BYYA 3N85H 4YDJA 1Q0XH 3W11C 5I17A 4FTVA 4Y4KB 2ZUVA 3KJ4B 2XI9A 3BHBA 3O3AA 1RZJL 3PQYD 5HDQH 2X70A 4KK6C 3OKDA 5MEPB 2DD8H 4I9WD 4JRXA 5IK3A 4LSSL 4P2CG 5JR1L 3WNOA 4MJ5B 4N8PA 2ADFL 1MCJA 2NY5L 2CDGA 2BC4A 2X7LB 4B41A 1QFUL 4NWUH 4NRYA 5B3JE 1X3DA 4JZNA 4OQTH 5IBTL 5F9WC 1R3LA 2WBKA 2BVOA 5TQ0L 5FUOL 4KQ4L 1V8HA 3TFKD 3QDGB 1FL3A 4JDTH 1KTDB 5HDBF 5FOJA 1MCQA 4QTIL 2FB4L 5E9DB 5C92A 4AEIH 1KCLA 1F45A 3RGVA 5LGHL 1H0DA 3EHBC 1RSFA 4BQBA 1CDJA 2X1XR 4G9FD 3W11D 2JE8A 2HKFH 4F8TA 1JV5A 5CUSL 4EI5B 2W0PA 5GRWA 2VZOA 4OLXL 2BVYA 1QFWH 1CT8B 2XZQL 1F3JA 1XGTB 3IF1B 3KXFE 4RAVA 2Z8WC 4GO6B 4MA3B 3U46B 2N7BA 2IFFL 4N0UB 1IKFL 1XGUA 5GGUB 1Q72L 4QY8A 2DLHA 4HEPG 1RUQH 2IPTH 3BHBB 2BNRA 2CO6B 3V7AE 5TDOB 3HC0A 4LGPB 5IV2A 5HHME 3VGGA 1M7XA 4NC1E 1MUJA 4WW2A 3KPRA 3QXVA 4X7TA 1FSKC 1G7LA 1VFAA 4XPFH 3S8WA 4RMVA 5IW6B 3HG1A 3O0RH 3P0GB 3R06A 4M4RA 1C5CL 2VXQH 3SDCB 1IGMH 3SE4C 1LP9E 2BC4B 1X6LA 4JPWH 3VXOB 3B2UC 3EHBD 5HHXL 1D5MA 2EE2A 3PP3K 3ROOB 3MV01 1GGUA 3NPSC 1DCLA 2ADGA 1UKTA 3MMEA 2MPAL 5IB1B 1QSFD 4NZUH 4M03A 1CICC 4R90H 5KS9A 2FEEL 3BP6A 1NQBA 1CK0L 3FHAA 1FVCB 3BZ4A 4HT1L 2ZUQC 4HH9A 4PJAF 5EOTB 5F7EL 3O6MH 3PGDB 4WEUD 4XMLL 3SDAA 1H0DB 1TIUA 5L2JB 4PGCB 5ISZA 3VI3E 2WIIA 3PQYB 4OCWH 1NFDF 4PPTA 3CMOH 2DRUA 1JK8A 5EO1A 4MAUL 5GJSH 2V7NA 5C0EA 5D7IE 3S97C 5IWLC 2EKSA 4XPGH 4NHUA 3WFZA 3WFCH 2H45A 1T66D 2XRAL 3PV7A 3ZL4H 3BH9A 5ADOH 4QY8B 1MHPH 5JW3L 4RFOL 2NZ9C 3B2UD 2D3VA 5IV2B 1JFQL 4LHUG 1Y18A 4XRCA 3IKKA 4PS4L 1U8JA 3SDDC 1FRGH 1IBGH 5D2LE 4P2OC 1UEYA 1CICD 1KFAH 4G3YH 3V8OA 3HG1B 4G8GE 5EDXA 3L5HA 1NMBL 4HS3A 4BZ1L 3HC4L 4XNYL 2GK0B 4G9FB 4R26H 4HUUA 1RZFH 3MLXH 3ZKXC 2Z0BA 3F58L 3PWJB 2WINB 3T0AA 3UCRA 3OAZK 3ARZA 4OT1H 2D0HA 3IXTA 3A6CH 4RRPA 3AC0A 4POYA 5KS9B 1LMKA 4IIQA 3BEVA 4HWBH 3NFPB 3WS3A 3WNMA 1TTFA 4ONFL 3FTGA 3QFJE 3DUUA 1JGEA 1AR2A 5IJKC 1P7KA 3R1GH 3ARSA 5ISZB 4GAJL 5EUOB 2IAND 2WIIB 4D0DA 1IGYB 5EIQA 1MVUA 1C7TA 5CD5C 2NY6D 3PL6C 2NZ9D 5F9WB 5KW9H 4O9HH 3SDDD 4HG4J 1G9ML 1INQB 3HR5A 1G1YA 1ES0A 3P4NA 4HJGA 1HKLL 3RDTD 5HYQA 1MHEB 4JFYB 3U0WL 3LH2H 2O26U 5JHLH 1NEUA 5DT1H 1MPAL 3G5VB 3NCYS 3PDGA 4M48L 4MHHI 3QDJA 1PKQA 4L3CB 3VFTB 5D1XD 1BQHA 2VITA 3MGOA 4MJ4A 3RL2B 2V2TB 4U1IA 3CVIH 1NC2A 1T0NA 4LPWA 3TGXA 3V5KB 5JPMB 5KANG 5DEFB 4DKAA 5L2KE 2OS7A 3TIEA 3BWUC 5DMKB 5E8PA 5CD5D 4OIAA 3PL6D 1FSKB 4P2OA 3WS3B 3I50L 4OI9A 2BOBB 2HYMA 3MXVL 1H3VA 3AY4A 4PB9H 4RGNC 4U49A 3BO8B 1ZSDA 2ZCLH 4QLRA 3NPSB 4Y2DD 4QOKD 1CLZH 5TDNA 3JWOL 5E0QA 5E1AA 1CICB 2EYSA 4Z5RB 5GS2D 5DK2B 3LHPL 1DFBH 4JFDD 2ZUQB 3RPIB 1VADA 1I7UA 4TVPH 1VDGA 3QHFH 2ICWJ 1KENL 2VDNL 4U1LA 3MUZ1 4HMCA 3BJ91 4GQ9L 2P5WA 4KTDH 1C16A 3QQ3B 3OJ2C 4RAUB 3RY4A 3QQ9C 3SBWC 1PKQB 3PXJA 4M00A 3MV7A 1QPXA 3MRNA 1BWMA 4XGZB 3MJ9L 5HPOA 2IANB 3CVHA 5FYKE 1BIIB 2CGRH 1AP2B 1T20A 1OSZA 2A6IB 3MR9A 1FPTH 4J7RA 1YECH 3SDDB 2A9ML 2OTUA 3D39B 3JTSB 4P2OB 1KLGB 4ERSH 3LKPB 5C6PB 2X41A 5KVFL 5J57B 4JJ5B 3OF6A 3ZKXB 5FF6A 2WSKA 1X5LA 5D1ZC 1I3VA 1IM9B 2ATPB 5DQ9A 2EEAA 2OX5A 2PN5A 3AXLA 4XAWH 5GSVB 3D69A 3LDBC 5CJQL 3KXFD 2BY2A 4KTEH 1J05B 5HPMA 3OGCA 4UIMB 1QLFB 5CWSB 1E4XL 2AABH 5DD0H 5J6HB 2ED9A 3SQBA 4OFIA 1YJDH 5T5FH 1FZJA 1QSEE 1C16B 5TH2B 4LDEB 3FQWB 2M26A 3PL6B 5FHAH 2PTVA 2Y5TB 5FYJE 5D72H 3HI1B 5HYIA 1TJIH 4PJCE 4JGMA 3WS6C 2CRMA 3UPRB 5FO9A 4L5FH 1X5GA 4ODHL 1EEZA 3CVHB 1KPUA 1TMCB 1NLDL 4QOKB 1KCUL 1U8HB 1ETZB 3HTLX 3LIZL 4WEMB 4DKFL 4RMSA 4JFDB 4ISVA 3BT2L 4LSPH 3IS0X 3SBWA 4ESKA 1KXQE 3IDXL 3MO1A 2Y07L 2I60H 2OTWB 1JNHB 5EU6D 3ZYJA 4KKAC 1Z9SA 5HDOA 4UU9A 3T65A 1PD6A 5EUOF 5C0RL 4NNXA 2XT1B 3IFPA 4ODSH 3VRJB 5B39G 4WTZA 2R23A 2Y36L 2Y9RT 3QUYC 4LCWE 4J3UA 2WBWB 4CMMA 1NBZA 4QEGA 4RGNB 1P7QA 3L95A 1WT5A 1FO0A 1HH6B 4N5ED 1WZLA 3PP4H 3UJIL 1K8IB 5FB8A 4M7KH 5FGSA 1RJYA 2VZSA 1CR9L 1ZXQA 4Z7VE 1MVFA 4G8GD 2ZKHH 2X89A 5FO9B 4QHNA 4KJPD 3DX9B 5AEAA 4NO0D 5CEZE 1UWGH 1CG9A 4HKBB 1GH7A 1RK0B 2ICWI 4DFIA 1PY9A 3CDYA 5CJOH 4EKXA 2VYRE 2P7TB 1G7PA 3VXNB 4ZFFA 4JN2A 3IETB 2H6PB 3MRCA 4YK4C 4DGIL 4HWNA 5D71L 2H41A 5E99H 3E1F1 3QUYD 1I9IH 1F2QA 1FIEA 1TENA 4HZLA 4KDWA 4H88L 1XGPB 5EZOH 4ZD3L 3RJQB 4H0HB 3FO9A 5GISL 3Q5TA 2D7TL 1H9VA 1T0MA 2CKBA 4N0CC 1NC4D 1MLBB 4TN9A 12E8L 5IMKA 5H37H 3GIZL 2ED8A 3RVWC 1MREH 3BH8B 5C0BE 5E2WL 3P0YL 3P0VH 1R3JA 4CMMB 4EZMA 1T21A 1HXMA 4C54A 3L95B 5IMMB 1FO0B 2AQ2A 5D1ZB 3MNWB 1JIBA 1NMAH 1RY7B 4HQQL 1T04A 2Y7QB 1RFDL 1J1PH 3GRWA 3O11B 4NQCE 3LDBB 5E03A 3B9AA 4JM4H 4M3JA 5EU6B 1OP5H 5CJXC 3I6LD 3IB4A 3VXTB 4DZ8B 2YMXH 4DGVL 4NKIH 1WC7B 1WAAA 4Y4FA 3D48R 5GRYA 5L2KD 5BXFB 5HHVH 1BBDL 2Y25A 1G7PB 2DQFB 4O5LL 1J1OH 1DL7H 4GKNA 4JN2B 1JGVH 1Q9KB 3GK8L 3VG0H 1ZEAL 4N0CD 4Y1AB 3TLRA 3H7BB 3RVWD 4LOUC 1RMFL 1XH3B 4F7PB 1EX0A 5EWIH 4HIHA 5K9QG 5F6HJ 3W39A 1N6UA 4PIRF 3RWIA 3KPQA 4NO5A 1JNJA 4HWEL 3JV4A 5H94B 3QIBC 3LRSB 3CXDL 3C2AL 4NO0B 1WTGT 1OD7A 3A67L 1R3JB 4WI7A 1ZHBB 1K8DB 1T21B 2W60A 2J4WL 2QEJA 5C07D 1LDSA 4N8VA 5KN5B 5DA4A 3VA2C 2JB5L 4DW2H 3MV8A 2HLFC 4K23L 3EDEA 1D6EA 1IAKA 2X6MA 4NO2B 3IGAB 3ARWA 5HYEA 2H1PL 4JDZA 3T0BA 2HP4A 4HF5H 4P57B 3TBTB 1MAJA 4MDJA 3HR6A 2O5ZL 3QUYB 5FYKD 5DYOA 3IDGA 3QEUB 3MFGB 3FO2B 4YR6B 4K94L 4ZSOA 4Z7OE 2DQIH 4LOUD 5FDWB 4OFDA 1NCDH 4LNVA 4W70A 3V8CA 4YBQC 5C2UB 3RTQC 5ACLA 5JW4M 2LABA 1NC4B 4B7IA 1E4KA 3GUTB 2P48B 2V2XB 4LVEA 4OF5A 3V6OE 3BD5A 3QIBD 1MWAA 1AGCA 3BSZH 4FZ8L 2G60H 3T2NH 4MJIE 3RVVC 3EDJA 3DTXB 4R6UA 1K4DA 4M1DH 3L7EB 2IH3A 3O8XD 2FIKA 3DRQB 4WU7A 2X40A 3WIHA 2BRQA 3U4EB 1SMOA 4K3JL 5EIIA 2C1PA 3FQUB 3RWIB 5LCVL 5I1JL 3BRDA 2V9QA 3JV4B 1HSAA 3DX7B 3H42L 4Z7WE 2JCCA 4XP1L 4YK4B 1XF3B 2MSPA 4N8CH 5I8OH 1Z0MA 1UM6L 4B0MM 4UMGA 4ODBD 1E6JH 4GXVL 3L6FA 2RCSH 4YGVA 5DUBB 1A0QH 3C08H 5L2KB 2NTSP 1VFOA 4X9IA 5TE7H 3MV8B 4XNUL 3UBXG 1QLEH 1LEGB 5FYJD 1KJ3L 4IBLT 4YBQD 3RTQD 3RVUC 1OCWH 4L8SC 3MRMA 4PG2C 5HDLA 1WEJL 4PG9A 3G6DL 4YIQA 5I1KH 3UROR 1KCSH 3L5XL 3RVVD 5IOPA 2DM7A 4FOMA 4ZTOH 5ETUB 2PR4L 2ESVD 2UYLA 1RJZB 1KXTB 1OAKH 5I76A 3V7AG 4EUPH 1A6WL 2NR6C 2VB5A 4X4YA 5FCUH 3TZVA 4OFYA 5DK3A 1CFQB 3UTQA 5EZLA 4XWOC 3EO9L 5C07B 1U8QB 5EBLB 4JO4L 3F7QA 4FFYL 3KYKL 3CU7A 1WCBA 4L9LA 2FIKB 4X9BA 4HWZB 5JOPD 5IQ9A 4R7DA 1YPZA 3QJFB 3VFOA 1ED3A 1OWWA 4NZRH 4DK6A 1YY8B 2DQDH 2ZUWA 1G0XA 4LU5H 4PGBB 2NX5D 2IMMA 2JCCB 4M3KB 4XNQA 1GGTA 5A16B 3T3PE 5MENE 3RVUD 4LCWD 3EAKA 3FRUA 4UILL 3ILPB 4H26B 3STLB 5HHOB 2VDPH 3EYVB 4DVBB 1JTPA 1P5VA 3RWCB 4YGVB 4TUJB 3DOSA 1BZ7A 2PYEA 3U0PB 2R0KL 2Y5EA 5GZNC 3OKOB 3GBML 2EIEA 2O5YL 3E6FB 3QIBB 5EU5B 5IVZB 5F6HI 3RWJB 2WK2A 3UX9B 4XAKE 1MJJB 2NR6D 4K3DH 4POUB 4K7FA 5CEZD 3QDME 2YUWA 3HZKB 1T1ZB 4YHYC 1ACYH 2X4NA 4MA8H 3HAEB 1DBAH 4XWOD 1RZ7H 2SEBB 4WUKL 4DAGH 3OJDA 1H3PH 5A2FA 5KSUA 2C26A 5I1CH 1BFVL 2JJUA 4PRNB 3VXSA 1U3HA 3KPNA 4Z6AT 2X4UA 1K5NA 3B2VL 4ZTPL 1ZT1A 3UTQB 1B0RB 3LN4A 3RZCC 3BEWA 1BEYL 2OL3A 1MCRA 1WBYB 1ZVSB 2AXGB 5DUPH 5LVEA 2ARJQ 5IQ9B 1MFAL 1RK1B 4R7DB 5E2UH 4YWGH 5JUEH 4OCMC 3RTQB 1ED3B 3RKDC 4U1GC 4XNXL 5CEYB 5GZND 3B9KC 4EVNA 1RIVL 2AV1B 4HLJA 3AUVA 2JF1A 2VDLL 1L9NA 3H9YA 4LAJH 5EORL 5C0BD 5KSBE 4FP8L 1JWSB 2C5DC 5IT2H 5F1NA 2ESVB 1ZLVK 1P6AB 2FJHA 5FV2A 1A7QL 1V3KA 5GHWH 5HGBB 1AHWA 1DUZA 4FMFA 4AYFA 3GDBA 4R4BA 1BGXH 1YEFH 2XA3A 3ARGC 4JN1H 4QXTB 4K7FB 4MWFB 4DVRH 3VWJC 2GCYA 4POZC 3RZCD 2ZSWA 5H37G 4JPKH 1CCZA 1AXSB 4MXWL 5DA0B 4DZBA 4FQXA 2C3WA 5TJWK 1MFCH 4MNHB 3QIWC 2ADJA 5I1IH 4GFTB 4FQ2H 2FECL 3VFMB 1R6VA 2NX5B 3PXHA 2B39A 3RKDD 4L8SB 1VKXA 4HC1A 2EDWA 1OAQH 4MDIA 5CLWA 2Q6WB 3B8SA 3QEHA 5SV3A 3G6JA 3VMPA 3SKJL 5HJ3B 4KJQD 1ZLUK 3IRPX 1MEXL 2CLZA 2NY7L 4I4WA 2Z8RA 4R96A 3ZTJH 4IOFC 5IKCB 1RUPH 2AVGA 4WW1A 5CZXC 3V6OC 5DRWA 4LF3B 5IB5A 1B2WH 4EVNB 2NW3B 1MIEL 3KPSA 4ZOAA 3O45B 3QNYA 3EOYG 3ARGD 2DLFH 4XP6H 2UV3A 2R0WL 1HH9A 3KLSA 4LEOA 4MMZC 3HNVL 1FAIH 2XTJC 4WY7L 4HS6A 4U7KA 4DQOL 1GRWA 3EDFA 2GEEA 5C0AA 1MSPA 3B9KA 4JHAL 5KZCB 2RJMA 4PREA 3FO0L 2BNUA 3IKCB 5CD3A 4N1EA 4OD2B 4PP2B 2A83A 4X4ZA 2ZSWB 1UCBL 1ZANL 5IVXB 4YAQA 4M6NH 3C6LC 1XZ0A 2DDQH 2VL5A 4RIRB 2ITDA 1I3RB 1T7WA 4L4TA 2ADJB 1S9XA 1SYVA 1DQMH 4IOFD 4WVRA 5DD5L 5C0BB 1S9WB 3V5HB 1IAOA 2EKJA 4TSCL 2ZPKH 4TSBL 4YHYB 2MHAB 2G5RA 3DVNB 1I4FA 1Q9WA 1U41A 3LKQA 3P11H 4R96B 1FV1A 3IFNL 4JEGB 2XTJD 3B3IB 3HZVB 3LSOA 4WW1B 3ZE0E 4BKLA 3OAYK 4HS8H 4LEXH 3SOBH 3AU1B 3KS0H 4R8WL 5JW4R 3RZCB 1MCEA 2APBA 4O51A 5BS0E 3VFSB 4EDXB 2QLVB 4S1SL 4L8BA 1BAFL 1LDPL 3UO1L 5ESAB 2JCCF 1OARH 1QQDA 5AZ2H 5F7HA 3C6LD 1KBGH 3C60D 4JR9L 3ULUL 4U1GB 3MLUL 3L3OA 4OGAC 2LU7A 3B9KB 2ZOKA 3GJEB 4F2MA 3UC0H 3ZYOA 4JHWL 2Q86B 1II4E 1WFTA 3K2UH 4KUCF 1U8LA 1YMMA 4UT9H 5EULV 2WUCH 5BQ7B 3VGDA 5D7KD 2F58L 4EI6B 2H2SC 4X6FB 1J8HE 1CXLA 4JLRA 2DQGL 1JPGA 4GLRI 3GSXB 3K8LA 4OD1L 1KIQA 4HUXA 3F7YB 3FQRA 3HE6A 1DBJH 1B0GB 4KROD 4XP9H 1S7VB 3ARGB 2V5TA 5EO0A 1SMAA 4XCEB 1XGQA 2EDLA 4JG0H 4PRDB 3S5LG 3IYLW 4WI6A 2L0DA 3VWJB 2E6QA 2A9NH 5EFIA 3PHOB 4N1HB 1JYXA 1I4FB 5ICYA 4NQDA 1M05B 1IVLA 1FV1B 2BJML 3QIWB 3MROB 3BFOA 4HFUH 3QA3B 1U42A 1UWEL 4OGAD 1NJ9A 2NNAA 4M93C 4EIGB 5C0DA 1AIFA 1WBZA 1J9CT 4EUPG 4O51B 2J8UA 5JW4Q 3RY5A 1PG7W 2OXGA 2NY4C 5T1LA 4JQVC 1IL1B 3LS4H 2H2SD 2ZG3A 5MI0C 4JPVL 1BVKB 4JY6B 1HHHB 2VISB 3QRGL 1ADQH 4OFPA 3E8UL 5F1IA 4EBQL 1UG9A 1A02N 1QVOA 3QI9C 4UTBH 4LHUA 3MLTA 3OZ9H 4S1QH 5CKGA 4KVNL 1Y6NR 5LAXB 4OF8A 3BKML 3EZ8A 4OV6F 2XTJB 2BRRH 4CNIB 3V52L 3OAZH 3T04D 3K0WA 4RX4A 1U8PA 1YYLL 3OTTA 1ONQB 1P69B 4JFOB 1ULVA 1F02I 4NNPL 2DM3A 2FX9H 4FA8A 2ITCB 4O2CA 3AGVA 4KAQL 1F4YH 1JP5A 5ID0A 1TCRB 2P5ED 1ZLWK 43CAA 5IFHH 1MRFL 5KVGH 3C6LB 3GRWL 4NO3B 1OAXH 2YPVL 1VGEL 3A6BL 1JHKH 3CFDB 2HFGL 1HYRC 1UXWA 4C56E 2I5YL 1HK6A 5KSAA 25C8H 4GAGL 4IM8A 1YQVH 3DYOA 4WNQA 4WHDA 4ZO7A 3X3FL 4I8DA 1JF1A 4KKBC 4PJDA 3QI9D 2J8UB 3WDJA 2DIAA 4P9HH 3NZHL 4RWYH 1YEJH 1YUHA 1C12B 2HRPL 3DETC 4OUOA 5IQ7L 5IBUG 4ZNCD 1OPGL 3P4OA 2CJUH 1A1NA 3VGEA 3LEVL 3DBXB 5DR5L 3GSNH 1KT2B 2A1WL 5HD8C 4AH2B 3QUMH 5JQ6L 1DEEA 2Z35A 2NXZD 4HUKB 1S5IH 3LV3B 3MLTB 4MA7L 1CFVH 1SYSB 2X5PA 3IJYA 1UXSA 3MNVA 4G6ML 4I77H 2C7UB 3QHZL 4FQPA 4JQVA 4XWGH 3O2WH 4KFZC 2ENSA 4O00A 3LKRA 4CVXA 5IESL 5F7DB 3B6SA 4NIKB 4G5ZL 1CL7I 5IVXF 3T2OA 4U1JB 2BVQA 4HX1B 5J4MA 1JUFA 3ET9F 2VLKE 5F7MC 4AJ0A 1CLYH 2XWBA 3GBNL 4YHML 1FORL 1WZ1H 2F5BL 2I07B 3RPKA 1MH5A 2JIXD 1IC4H 3RIAF 4ONGH 3CZFB 4QGYA 5ILTL 3P4LA 2E8YA 3O6LL 3DNKA 2R0ZL 4K2UH 3P4MA 4KKBD 3VFVB 5D1QA 3FFDA 3DETD 35C8H 1BX2B 1SVZA 2FHFA 4F33B 1I7TA 3FB5B 5AZEH 5HD8D 3OKMA 5IBLC 4X5LA 1UQSB 1BQSA 5J9PA 4LARL 5IHUH 4JFQB 4GG6A 3GMPB 1S9YB 1UWXK 1QFOA 3CLEH 1KV3A 4M9PA 2IGFH 4LVHC 3P4OB 4JFHD 4Q0XL 1NGZB 32C2B 4MNQB 5JA8B 3KWWB 1RHHB 5BRZA 3S37X 4M93B 2P5EB 4QRPD 5BOZG 1F6AB 5FO8A 2G5BA 2MTPA 5JORA 3TPUA 3BVNA 5BZWA 1UXSB 2LTQC 3MNVB 4F58L 3SCMC 2NY4B 3BPOC 1KJ2L 2F74A 1ZTXH 1AXIB 4N90E 4MQ7B 3W0WD 1DVFA 1N3NA 3O4LE 5MI0B 4U3CA 4P5TC 4XVJL 4PRPE 4AZ8A 1L7IL 1EAPA 3IVKB 3V0AC 2W9DH 1S7RA 3KG5A 3QI9B 3VRLE 2QKIA 2V2WA 2GTWA 1RZJH 2FEDC 5IBLD 5DI8A 3IS1X 2DQCL 3EIFA 1SEBA 4Z7UB 2R56L 4LSSH 3FFDB 5JR1H 3CX2A 3H7LA 1HXYA 4XZUB 1OP9A 1DQJA 4WUUD 4JFZH 1QFUH 4NQSB 5BS0D 5F70A 5E2JA 1P2CB 5IBTH 1HYSC 3EUUA 1EFQA 2VNCA 1DQQA 3HPJA 4KQ4H 5FUOH 4YHZL 5JHDD 5IG7B 1I8MA 3F7RA 4OQTA 2B1AL 1KPVB 4XX1E 4YXHH 1JZ5A 1OWRM 1HSBB 1WZMA 1LEKB 2BY1A 2FB4H 4V1DA 1IAII 5EUKA 4KZDL 2OI9C 4P5TD 1DJSA 4PP1C 4Y19D 1NUNB 3BP4A 2DQEL 2DTMH 3BVNB 4ALAL 3VH8B 3Q1SL 5CUSH 3ZDYF 2FEDD 5JZ7C 4OLXH 2HVKB 4FN0A 2XZQH 1NGWB 3ETBF 2IFFH 2VUYA 5IJVA 1IKFH 4HH8A 5IIEA 4UOJA 5C0NC 1Q72H 1EAPB 1UKQA 1S7RB 1W0WA 3DO7A 2HVJB 5D7JC 4XPAL 3GMOB 4D0CB 4PBVC 4N9GA 3WFHA 3WXWL 3GIVB 1WICA 3CD4A 5J3HC 4OZHA 3TNNA 4A6YB 3VE0A 4MD5B 3WLBB 1HYSD 3RWHB 2EYRB 1C5CH 1FC2D 1E28A 4PD4J 4YEEA 1UADC 2J3SA 4QRPB 2XG4A 3GMLA 1KELH 5FAAA 2F54D 1S8DB 4PP1D 1IEAB 3DRTB 3W0WB 2PYFB 3QCUL 2OBGA 2HTLC 2ZP0T 1MCNA 3HLAA 4PJFB 1AGDB 1CK0H 5B38B 1R5WA 4HT1H 5B39A 4Q2ZA 1QSFA 2C3VB 2FYYA 2GY5A 5F7EH 3ZKND 2J8UF 4XMLH 4F7CA 4MQXD 1U95A 5IHZB 1FVEB 3ARFA 4ZUUA 3ZKMC 4GUPA 2RAMA 4QTHB 5CGTA 5T3ZE 1A3RH 3L3KA 1CDYA 4YZFF 2QQKL 4JPIB 4M43L 4MAUH 5D7JD 4ZFOA 5D5MB 1INEH 3CU1A 4LVHB 5J3HD 4PR5A 3P9MA 3KPMB 4ZPTA 4WUUB 5F7WC 2XRAH 1ZT4A 4JY5H 1EHLL 4MNGE 4HKZA 3X13B 3GZKA 5JW3H 3GI9L 4QHMB 4RFOH 3VFNA 1JFQH 2UZIL 2LTQB 5JHDB 4UV7L 3SCMB 4PS4H 3BPOB 4X6DE 4JRYA 5EPMB 3QB7C 3CFCL 4KV5F 5JO5A 4KK9C 2AI0L 4P5TB 3VXUA 5D70L 4Y19B 1MHHB 2R39A 3HC4H 4WEBL 4BFGA 4BZ1H 2H8PB 1I1AD 4P5MB 1MCBA 3H9HB 1S7UB 1QA9A 3X11B 1J7VR 5D9SA 2RHEA 2D7MA 5C09A 1BFSA 5C9JB 2BNQA 4HC1L 4J4PD 4ONFH 1R0AL 5CSZA 3S35X 1N64H 1U95B 2CXGA 4GAJH 4IS6A 2X4SA 5DD3H 4ZUUB 2LVEA 3UTTE 4FQIL 2VDQL 1BIHA 4P59L 1CS6A 5IROC 3DHMA 4LBEA 3D87B 5C0IB 1ZGLA 1FBIL 5EO9A 4M8QA 4NBXB 1G9MH 2IALA 3DECA 4U7MA 4CRPA 3T1FA 1T1WB 1HKLH 1IC7L 2F54B 4KK9D 2OI9B 3LB6C 3SDYL 5ACZA 2HJKA 4OF7A 1L0YA 1MQKL 1YZZA 4Y2OA 3MOBL 2P8LB 3GSVB 3RDTA 2BSTB 1MPAH 4OKDA 1AO7D 3PHQB 5DF0A 1OF2A 3FFCA 3U0TA 3EYQC 3MUY1 1CGUA 4AG4H 1RJLB 3DV4A 4Z7UF 2P42B 5DEZA 3UDWC 2AJ3A 1CXIA 2JB6A 3G08A 5D1XA 3CFKA 5HYSB 5CMAB 5FKPB 5D7JB 1B6UA 4NKMB 4U6VL 1W72H 5AYQA 5M94B 1NUGA 5C09B 2PW1B 3PIQA 3DXAA 2C4FU 1BVLA 4OZGB 3I50H 3AS3A 1DSFL 5MEOA 1I1FB 4HKXB 5IW1B 3WEXB 2CSPA 4JGUA 1G0YR 4M61B 4WHYH 5CSZB 3MLWL 2B4CL 2X4SB 1KNOB 3LB6D 5F3HB 1PX3A 1KB9K 5EC1B 3LKSB 1T22B 4PY8J 5T5NG 4N90D 4EN3C 4Y2DA 3LHPH 1S5HA 4PJEA 3ALPA 1S7WB 5ANME 1ZGLB 5E8EB 1P4LA 3ECBB 2FJGB 1KENH 2VDNH 4OZIE 5D7SL 4GQ9H 1MCFA 3PWNA 3K80A 3O3DA 5GS0L 1U3JA 3RIFK 1FVDB 3DV6A 2WAHA 5E8DL 2FGWL 5B4MC 2FZ3B 1R3HA 4XMPL 5IEKB 4QHLA 5J56B 2G9HA 3JVGA 3PWPB 3QNXB 4H8WL 2CXKA 4XB7A 3WJJC 2HT3C 3MJ9H 3GJFB 3PWUB 4FQLL 4Y5YC 2AJ3B 3IDYC 1LE5A 1X5JA 1X4XA 2DS4A 3ZHLA 3OB8A 2BY3A 3VRIA 1DUYB 5HGDA 5FK9B 1H15B 3Q48A 4IOSD 5J89A 1AC0A 1LO2L 8CGTA 5C6TL 3NGBC 3S6CA 1BHGA 5C08D 1UZ6E 1PZ5B 3Q6FA 1OD9A 3WE6B 5KVFH 5E4IA 4PJFF 4BZ2L 4J6RH 3MRJB 1AO7B 5FUCC 4Z76A 1DZBA 3UBXA 1AJ7L 5MHSE 1AD9A 4HHAB 4YNYA 2MCG1 4UT6L 3IXAA 1JNNL 4F57L 2IAMC 3IAGC 5L8LB 5C0FA 1P4LB 1EVUA 1E4XH 5D5MF 2HT3D 3KXFA 3QIUA 4LRIC 3TNMA 3EGSB 3T8XA 1C08B 3L3JA 1G7MA 3PJSB 5D6DC 5FGRA 4I2XE 4E42A 4TPRL 4NUJB 5T3XD 4Y5XC 4Z18A 4QCIB 3IU3A 1KLUA 3HC3H 5IEHA 2OP4H 5ELIA 4WCYL 4ODHH 1NMCC 4X4XB 1DTUA 4AIZA 4JQXA 4XCCL 1NLDH 1W8OA 1KCUH 3TO4C 3VRIB 1LP9A 2EXYC 3TP4A 1D9KC 1AQDB 4NCDA 1WIPA 4HIXH 3GNML 3BT2H 4FQ1L 2CQVA 2Q7YB 5FA3B 1IEHA 3SKOA 3NFNB 4LFHG 1HWHB 1XF4A 4RDQG 2EDQA 5FECB 2IAMD 3OHXB 3NVQA 3IDXH 1Z2KA 1M7DB 2Y07H 3DJ9A 3S37L 4GW4A 4HCRL 5C0RH 5FHBL 1REIA 3ZHKA 1CDUA 4W6XB 2DQJL 4I48B 2A6DA 4ZQKA 4U1KA 2BMKB 5D7IA 2Y36H 2A6KA 1CE6B 3U1SL 1R5IA 1UYWL 4PJHE 1BFOA 1P4BL 4APQC 4J2XA 3UJIH 2R8SL 3BGMB 3TO4D 4UB0L 2EXYD 5EBGA 5GGVH 4LP4A 4MD0A 1WWWX 2GJZB 4EN3B 1XCTA 1CR9H 1KLUB 5C08B 2YD2A 4X6BA 4PY8I 3SY0A 5E8OA 4MJ6B 3BKJL 4I0CC 3S36H 4X8JA 2VZVA 3RWFB 1OSPL 4ZO8A 4Z95L 4G8GA 3SJVD 1MOEA 5D6DA 5EN2A 1ZLVH 2E7BA 1V05A 4W6YB 1V5JA 4Y88A 1J1XL 1Q1JL 4KI1A 5GS1C 2IPUG 1NBQA 2Y6SC 2KKQA 5CGMA 4PGEB 2D9CA 3VFPA 4GMTL 3IJHB 3QO1A 5D71H 1HEZA 4Y5YB 1MCPH 3IDYB 3B9EA 1NDGB 3QFJA 1FNSH 5HGHA 1BD2D 4M7LT 5MEQA 4OZGF 3LN9A 1CXHA 1ERNA 2F15A 2IQ9L 3BP5B 5KOVC 3UTTD 2VXVL 4KRNA 3F8UB 4H88H 4PJXB 5EU3B 4NN5C 2P8PB 1OTUD 5GISH 4NYLB 4XC1L 1FAKT 1ZA3A 3IDIA 3MBEC 3V6ZB 4U1KB 3NGBB 4JM2C 5E2WH 3NFSL 3U4AA 4KMQA 5F3BB 4EDWL 3P9WB 4CVZB 2GSGB 1X6NA 5DHXB 2PTTA 1DE4A 3DLQR 3C87A 5DJCB 2R1XB 4HQQH 3I84A 5JA9A 4XH2B 4TNVF 3K1DA 1RFDH 1N0LA 2IAMB 2E5EA 1JYNA 5DQJB 5DHVB 2NY1D 5J06A 3T0EC 2Y6SD 1KIRB 3SN6N 4H1LH 1FZMA 4P4KD 1YYML 4J3TA 5E2TH 4WFGE 2JK5B 5DJXB 3MRHB 4DGVH 4APQA 2YN5A 1SBSH 4BA8A 4Y5XB 1EV2E 3VU2A 2PO6C 2HTKC 2APTA 4O5LH 2X4RA 4JANA 3CMGA 3GK8H 3VFPB 3MBED 1ZEAH 3SE8L 4WI3A 1HEZB 1T2XA 2GITA 1NMCB 2FLBT 1MFBL 4NM4L 1FNEB 4GRLA 2H32A 3SE3C 4ORGA 3TO4B 4HMEA 3KPPA 4ETQA 1D9KB 4OLYH 2VAJA 2DLIA 5L7XL 4U3HA 4U4BA 4K9EL 3MOAL 2DMCA 5JLZA 3C2AH 1N6QH 1QRND 1IC1A 3GMRA 3U36B 5DZLA 5FGCB 5DJZA 3A67H 3SJVB 2AJZA 2D9QB 2DWDA 1F6FB 2J4WH 1FFNB 3T77B 2AK4E 2JB5H 4K23H 2PF6A 1UJ3C 3RY6C 3TBSB 2H1PH 2HTKD 5E7FA 3ARQA 4JM2A 2O5ZH 1BD2B 3OAYH 4XXCA 1A6ZB 4AQOA 3OR7B 3RWEA 1EFXD 1IM3B 4K94H 4J8RB 3D3VA 1A4KB 4APQB 2JJSC 1GHFH 1T89A 2XFXA 4DTGL 2DICA 3TO2B 1IAMA 1NBYB 4Y5VC 3EYFA 4FZ8H 3UTZA 4WWID 1W0YT 4I0PC 1LGVA 3T0EA 4YHLH 2GITB 4J3OC 3S35L 5GGTL 4KDTA 1YEEH 1ZKAA 5AYUH 1ROWA 4ORGB 2DIBA 2YA1A 3KPPB 4K3JH 3RBSA 3ZE1E 1MELA 3O8XA 1KIPA 5LCVH 5I1JH 3RNQA 4O4YL 2PO6A 3CUPA 4LPVA 3H42H 4OLZL 5GS1B 3DWTA 4LHJB 1TNMA 1A21A 2R69L 1A14L 1RZ8A 1UM6H 2F19H 1AGEA 5MP6L 2AJZB 1Y6KR 4GW1A 2NCMA 4GXVH 1A6AA 3HZMA 2JKXA 5ESQB 1FQ9C 1IGTB 1HOCB 4XX1G 2R4SL 3G04A 1H3GA 5AD0B 1QSEA 1FZOA 4NN5B 4XNUH 5F7FA 3S4SB 1L6ZA 5B21A 2OJEA 1KJ3H 3MBEB 1M6OB 3QYCA 2CIIA 1WEJH 1HHIA 4JM2B 3G6DH 3S5LA 2J6EL 1OP3K 4PJCA 4I0PD 3L5XH 4X6CE 5HVGB 4CBPA 1H5BC 2QSCL 4FXKB 3RWEB 4ZFOL 1QBLL 5C1MB 4Z77B 5KVEL 3MA7A 1Z9MA 4EXKA 1OAUL 5E24E 1F8TL 3TJHD 2BSED 3NCEB 1SJEA 1QRNB 1MLCA 1GSMA 4PRBB 1BBJA 1A6WH 2XFXB 4FXGB 4EUPA 3TYGL 3UTZB 3KLHC 3FOMA 4FQQA 3T0EB 3EO9H 3P73A 4N0FB 1T1YB 1MNUL 4TUOB 4FFYH 4NRZA 3MLZL 1E4WL 2YKLL 4MCZA 3RI5F 2FJFA 5D2NE 1KIPB 1VEPA 2JJSA 4QXUL 5F88B 1KJVB 2PO6B 3CUPB 1LO4H 4PLNC 3IT8D 4PJ8D 5TGBA 3ZDZE 5SWQB 1D5IH 1MCSA 5MERA 4KUZL 1KPRA 4PJXF 5FM5M 3O3BB 1BECA 1AI1L 1G6RL 3S96B 3QISA 4GW1B 4UAOC 3STZB 4LCWA 4E9LA 2NMSA 3SGJA 2NXYC 1JYWA 3NA4A 3OXSB 2M2DA 5C0CA 1ZLWH 1RUML 2BSSA 2O5YH 3C8KB 3GBMH 2CDEB 2VRAA 4PRID 2AK1L 2UWEE 4OTXL 2EIZB 3D0LA 1INDL 2CIIB 4OFKA 3KAAA 1PYWB 3S5LB 4WU5B 4UNVA 3OPZL 3KLHD 4PJ7B 1QLRA 3MX0A 4L1DA 3UTPE 3I6GA 5J1AB 3CFEB 3DROA 2WIMA 1BFVH 1A7BA 2YSSA 1UJ3B 4NT6A 1D5BA 4OUUA 1RV6X 3T3MF 3MLVL 1CTNA 3HE7C 3T0XA 4LLDA 3MRFA 3T1WA 4QHUB 4ZTPH 2VQUA 4FQQB 3BUYA 5DXWA 1YEGL 1F4XL 1FNHA 1H5BA 4XPHL 4NRZB 5JNYA 2OCFD 4ZNEE 3V2AR 1R3KA 4YEFA 1MFAH 1N4XH 3CK0L 2NXYD 3UXFA 4XNXH 2OK0L 2QQLL 1H8OA 1DLFH 4RFNC 4YXLL 4Y5VB 1KPRB 2VDLH 2XWJB 4I0PB 5EORH 3V6FA 3PWVB 4WWKA 1J88A 1KUMA 4FP8H 3IRZA 2VLJE 4GSDL 3L5WB 1F11B 4Y0GA 5FYLE 2YPLD 1JN6A 1A7QH 5JXAL 4X7SL 4X7FC 2D4FA 3ZT7A 3KYNB 3IJSA 4J3VA 3JV5A 4NQCA 2EDEA 4Y4HD 2BXZA 3GSOA 3CCHA 1MRCL 3S34L 3PWLB 3RFZC 4NQEE 2ZOLB 5ENWB 4MXWH 5ABDE 3VXRE 5DJ8B 3H9SB 3NIGF 2E9IA 3GSUA 4FFZL 2R0LL 1EEQA 1CZ8L 4LLVB 1U93A 5F7YC 4MB4A 1H5BB 4MGXA 3VXQB 3TWCL 3SKJH 2X1QA 1JYVA 5K9KB 1MEXH 5IBUB 1R3KB 3AMKA 2CIKA 4J3SA 4PRIB 4KHXH 4TYUA 1HHKB 3FONB 1T1XA 2FEEI 2DM2A 2R4RL 3BISA 3DIFA 2ICEB 2GQHA 1MIEH 2J2ZA 5DS8A 2FX7L 3O41A 2CDFB 3TN0C 4NCC2 4YHNB 1ZHNB 4K8RC 4QRSA 4ELKB 2R0WH 4LLWA 3HNVH 4TSAL 3MRIA 2VDKL 2BVUA 3TCLB 4WY7H 1NDMA 5HHNB 3C5JB 3CXHJ 3OMZA 4DQOH 3PGFL 2CPCA 5JDSB 5K9OB 3RL1B 1A64A 4IRZL 1ZLSH 5J6GA 3TH3T 3FO0H 3V5DA 3S7GA 4ZXBA 2PCPA 3MJ8A 2X4TA 5ICXA 1HI6A 1SHMA 3BAEL 4G8FA 4UAOB 1CU4L 3WFEL 2FWOB 2GY7B 3BKCH 1UCBH 1M71A 1ZANH 3MZGB 5K59F 2NXYB 3MC0A 4JM2F 3M45A 1HHJB 4MB3A 3VMOA 4RNRA 3VFWB 2DM4A 4OLEA 1LWRA 1QBAA 4XCNB 4HDIB 5DD5H 3STBA 3WXVH 4AK1A 5AWNL 1J5OH 3B5GA 2R2HB 2YPLB 4TSCH 4TSBH 4PTTA 2GFBA 4QNPE 4ELMB 1IGJB 4MJIA 4K8RD 5ECJE 2A73A 1LILA 4U1NA 2EDYA 1QHPA 2DKSA 3IFNH 2HG5B 1N7ML 2VLME 3HE7B 4OKVB 4O02L 3I02B 3DVGA 4R8WH 5DS8B 4Z7WA 2YK1L 4QRSB 4BELD 4LLWB 1JZ8A 4S1SH 4OLWL 1LDPH 3UO1H 3K46A 2AERT 2CK0L 2MQCA 3P3YA 2ZSVB 1RIHL 4JR9H 1NCAL 3ULUH 5M7QA 3GMMB 3HN3A 2OQJA 4WENB 1WVZA 4RFNB 2XKUA 3C60A 3V5DB 2PCPB 4JHWH 5SV4A 3D1MC 3EYUL 5E6IA 3BIBX 3QCVL 2YS4A 4NDMB 3VW3L 4GMSL 5GRVL 1FCGA 2F58H 5C8JB 4D9LL 3MA9L 4U6XA 3P40A 4OAWB 3HI6L 4XBEL 4HIIA 2DQGH 2VIRB 2HH0L 1AKJD 3U30C 4LDLB 4PJ7F 4BQ9A 2CUIA 4N0YL 2R1WA 1QFPA 3X12A 4KRMB 4F9PA 3EO0A 4HFWB 3SDXE 1IQWL 3QJHA 4XBPA 3G6AA 3ES6A 2RR3A 4W4OA 3W9EA 4I3GA 3ZDXF 1HQ4A 2BJMH 4P9HC 4TRPL 5C0GA 2A2QT 5JMRA 1GOFA 2YA2A 1H8SA 4UZGA 1UWEH 1QBMH 5DRNA 1U58B 1KB5A 3QZWG 4JZJC 5E7BA 1AXTL 5MENA 1EEUA 4OBSA 2X4OB 2ZCHL 3WIFA 3BXNB 1TZIA 2WUBL 1I9RL 4U33A 4ZFZB 4LSTL 4YHIA 5C0JB 4JPVH 1NUFA 3MRGB 3ZKSD 1ORSA 4E41E 1CDIA 5EA0L 3HUJB 1FHGA 1TVBA 4NRXA 5GSRA 4PJBB 4EBQH 5CEXB 5DVOA 4L8DA 4OGXL 4WI5A 5IHBA 1FGNH 5BO1L 3TN0B 1LO5B 1IKNC 4KVNH 5I16B 3ALWA 1LK3H 1HHGA 3SKUD 3CZJA 3BKMH 4ODXB 2DMBA 3QDMA 1PJ9A 2ICES 2XIDA 2G75B 4BSVB 8FABA 3V52H 2A74A 1A3LL 1ORQA 5IVNA 2NY0D 5F7UA 1DQDL 5FGBA 2R1WB 3MRDA 1JNLL 5T1KD 4H5SA 1FYTE 1H3XA 4NNPH 4LQFL 4KAQH 2QBWA 4ODUA 1RZKC 1DANU 2VLLB 1VGKA 3Q3GA 3UTSB 1MRFH 1IRAY 3LOWA 4XP4L 2ZZUT 2QV2A 3GRWH 4G80A 1FYHB 2YPVH 1VGEH 3A6BH 1CXEA 1CXFA 1CFNA 2HFGH 3O2VL 4G8EA 1N0XL 3SGDH 2YD1A 1T03L 3BPLC 1Z3GH 1LE9A 4MMXC 1U92A 5IB3B 1ZHKB 1AGFB 3D2UA 2P45B 4XXDB 1NAMB 3NPZB 5FYLD 3RKPA 5KSBA 1OW0C 5DSCA 5GGSA 4K7PX 3NZHH 1TZIB 5IQ7H 1TLKA 3KYMA 3GO1L 3NACH 2VZ3A 4RMTA 1WLHA 1OPGH 2ORBL 4WV1C 3QULA 4IDJH 4G9DB 3UYRL 3LEVH 5DR5H 4WDIB 2A1WH 2AV7B 5C7XL 3RHWF 3MJ7A 3SKMB 4X5WA 2GK2A 3JWDH 4GRWB 4KK5D 3ULVH 5JQ6H 1CE1H 1JRHI 4C83A 2DLGA 4MXQC 3CFBB 5INDB 3BDYH 3QUMA 3QXDB 3BP7A 4G6MH 1PAMA 1RZJC 2FCBA 3QHZH 3L7FB 3RAJH 4KRLB 1K3ZA 1QFWM 1ORQB 2K7PA 3VFRB 5IESH 3EFDL 3EOTL 3FAXA 4Q6YA 1UFUA 3SQOL 1OOAA 4WI8A 3CFIC 1ZVYA 2DAVA 4I3RL 5I2IA 1TNNA 4ENEC 2N56A 1PQZB 3EOBA 4EEEA 2BCKB 2CLVA 4YHMH 1FORH 2EDHA 4ZUWB 1Q0YL 1SEQH 3HMWL 3BQUC 5ILTH 3TBVA 1CQKA 3O6LH 4MAYC 4ZOEA 1DBBL 1V3MA 3U30B 4NZJA 4G7VL 4CW1B 3IDNB 4ELMF 1DBKH 1OTSC 4ZUSA 1UB5A 1BWWA 4PJ5D 3E6HB 4IMKA 4D0BA 5FYKL 3DUSA 4U6YB 1J0JA 3G5ZB 4L3EE 2BFVL 1JF5A 3EJZC 4LARH 5GRXG 3QXTA 1T5WA 4HXAL 1AE6L 3J7HA 4MXQD 1YEKL 4OCRL 1PEZA 4JVWA 3FB7B 3GEWB 1WFNA 5ITBH 3TBWA 2YRZA 3S3SA 5T1KB 4Q0XH 3EJYC 1MWAH 4CVWA 1BZ9A 4OD3L 4P2QE 1F58L 4O58L 1JCKA 4R2GC 3TYFA 5HI5C 3GSNB 4JZJB 2FD6H 3WIHH 1FCCA 1BJMA 3QUMB 4ENED 2HMID 4F58H 1KJ2H 2X42A 4X6EA 5ICZB 1J11A 3BQUD 3QNZA 3U82B 2IH1B 3E3QE 1OB1B 4YDIL 1I85C 2DQUL 1OTSD 5I2IB 4JGJA 1CFSB 4JFFA 5CHNA 1NGQL 1RURL 4Y16C 3N50A 2DQCH 1S9VB 1P7HL 3EJZD 4G42B 4WHTB 1C5BH 2R56H 4HIJA 4NUGL 4OZ4B 2VLMD 5CP7B 5FYJL 4PGJA 2UY7A 3HB3D 4JZOB 3EJYD 4Q9RH 2LU3A 4AEEA 3KR3H 4Z78A 2EH8H 5DZOA 5HI5D 4EOWH 4WJ5B 4MAYA 4PJAE 1PLGL 4PV9A 1EXUA 4PJIB 1XR9B 2W59A 4IRSD 4YHZH 2B1AH 2AS5M 3NCMA 2GSIA 4KHTL 1ITCA 1OY3B 3TT3L 1QUNA 3OKNB 3BPLB 4AT6B 1NFDE 4KZDH 4OB5L 3TM6A 2H3NB 3PF2A 2VQ1A 3L3HB 3WMSA 1T7XA 3RA7L 4ALAH 3HUJF 3Q1SH 5C70A 4PJBF 4WTWA 1ZGLM 5AAWA 3QNZB 3MCKA 2A0LC 5TF1L 3CSBA 3ZE1F 4WV1B 1I8LA 1J8HA 2BP3A 4IOIB 1MI5D 4PJ5B 4IRJA 4NHCL 5ERWA 2IQAA 1KOAA 3ZO0A 5KVDL 1QEWA 4JFFB 4L4VB 4JCMA 3WXWH 4K7PY 2Z93B 2YUXA 3AREC 1N59B 1U8KB 2IEPA 5I1AA 3QWQB 1O7SA 4CN1A 1M7IB 1ZE3C 5CS7A 3MUHL 1G7IA 5DD1L 4UDUB 4M6OL 4XC3L 3MRRA 3L3DB 1D5XB 15C8L 5D7LE 5CEZL 1D6VL 1IGCL 3NCJL 4IEFB 4MSWB 1AGBA 3VXME 1N26A 3BQUB 3SPVA 2FR4A 4MAYB 3ZSSA 1U8IB 1EXUB 1CD1A 3H2WA 4BH7B 4NJ9L 2R2EA 2PXYC 4UUJA 5IHLB 5EU4A 2X1WL 4E41D 1GZPA 2A0LD 1GXEA 1B6DA 1X7QB 1G9MC 1UVQA 4LCUB 1BJ1J 3WUWG 5CINL 2MJWA 4DOHB 1NEZB 2QQKH 4F9LC 4HUNB 1BOGA 3VD9A 2ZCKH 4GRWF 4MZ2A 2EO9A 4LKCA 4N0RA 1LD9A 3ARED 3C09C 5IB2B 3NA9L 2AJXL 1S78C 2XPGA 2RIKA 4JQIL 4NSKA 2OR8A 5BZDB 3DGCR 5I66A 1EHLH 4R2GB 4J1UA 4YJZL 1UCTA 1GVIA 4D8PB 2JJTC 3GI9H 2AAVA 2HLAB 3QEQD 4JFPA 3D25B 3IDJA 4WHCA 4UV7H 1XR8A 3ARVA 3B43A 3FL7A 3IU4L 1PBYA 3BIKA 3LMJH 3CFCH 1XF5A 1OGTA 4YHPB 2AI0H 2GHWB 2PXYD 5DRZB 5M95B 2XNAB 5D70H 4BJLA 2F53D 1FGVH 3QUZC 4C56A 1VEMA 3QH3B 5C9KA 3F5WA 4YPGB 3IFOB 5GGQL 3C9NB 4Y16B 4U7SA 3NTCH 1OGAB 3WNLA 2PKDA 1LEIA 1CD1B 2W0FB 1MI5B 5HXMA 1DLHB 4HC1H 3F12A 3C5SB 1GZPB 3QDGE 3C6SB 1S78D 5FM4A 3EDKA 1LHZA 5E9DE 1K6QL 4LCCA 3H0TA 5AUMB 1XCQB 5I1EL 2PETA 2APWA 4ETYA 4FQIH 1A1MB 1BOGB 2VDQH 2Y72A 3GB7B 2QQQA 4Q9BA 4MYWB 1BLNA 1FBIH 1GPOL 3I9GL 5JIKA 1EIBA 4OCSL 2XYCA 4E5XB 4N0UE 3SDYH 4GRMB 1MQKH 3RUGB 3QUZD 5FO7A 1Q9LB 1F90L 2VLKA 1P84K 1A1OA 5JPNA 3E3QC 1EMTL 1GGBL 1P4IL 4XBGB 2FL5A 4HUWB 3WN5C 1F2XK 4DEPC 3EOAA 1HWGB 1MHCA 4IHOA 1T5XA 4KH2A 4U6HA 5DDHB 4X5XA 2RB8A 4L3ED 3RVXC 1OQXA 3D85D 4U6VH 5IMOB 3AREB 4OCYL 5CBAA 1SVCP 3T4YB 1G7QA 1EGJL 4R3SA 4CAGA 4KMTL 4PJIF 4RCAA 3MLWH 3MUGB 2DYPD 3RWDA 3UYOD 4X83A 5FOBB 3QEQB 4OM0H 1YNTB 1OHQA 4PLOB 2E9JA 4LVNC 4M9OA 5F1KC 3LEXB 2KZWA 4KGJA 4LPYA 1ZA6A 2PXYB 4P3DB 2F53B 2N4IA 5IMLA 1XIWA 7CGTA 1B4JL 3O4LA 2XWTA 2GJ6A 5D7SH 2AQ1A 4G6JL 4PRPA 5K33A 3DX8A 4LQ1A 5GS0H 5L6YL 5FO7B 3J8F7 5E8DH 2FGWH 1NKRA 2VDRH 4YUEL 4XMPH 2IF7A 4JJHA 5JPNB 4H8WH 3C09B 4C59B 1NCTA 2WBJA 2LU4A 5ITFA 5SWZD 5E6YA 4FFWC 5DC4B 5KG9A 2ATKA 3HG1E 4FQLH 4U6HB 4GKSA 1NGYB 1AQKL 3MJ9A 3QWRD 4KKLD 4DCQA 3AAZA 2DJUA 1LK2A 3QG6A 5B22A 5T33L 3ARDD 2EYTB 1U8NA 4K7PL 1F3RB 4UI2A 1W72B 1LO2H 3LKNB 4YO0A 5KS9E 4HJ0C 1JPSH 5C6TH 1G7QB 3QUZB 1XMWA 3MV9A 4KC3B 4X7DC 5HGGS 4BZ2H 3VJ6A 1D5ZA 5ISZE 2K3TA 2F9BT 5LXGL 1GIGL 1AJ7H 3M8OL 3ZSTA 2YOCA 4UT6H 1JNNH 3NIDF 1IAIM 4PJ9C 2LQRA 1KB5L 4JO3L 4P23C 4OZFH 2EH7L 4FFWD 4L3EB 1IILE 4JCLA 1JZ3A 4ODTL 1JGUL 1ND0B 4R7NA 4XT1C 3SGKC 3ZZ1A 5B8CA 5C71A 2EDFA 5T1MA 1T2QL 5I1LB 4XCFL 1A6TA 1V3JA 2AKRB 4HJ0D 2XN9A 2AXFA 1JWUB 1QSVA 4RDQF 2VLRA 5D7LD 1Q9OB 4ZS6D 1VACA 4XCCH 5JIIA 4LLMA 1LK2B 1QR1A 2BHUA 3U2SA 3VXMD 2XZCL 4ZUVB 1KN4L 4KMLB 3I3EA 4FQ1H 3MRKA 4CJ0A 4JFED 1JHTA 4YPJA 4QT5B 2Y23A 4JDVA 1U0QA 3W81A 3WN5B 4DEPB 3OAUH 3REVA 4I5BB 4PJ9D 2P24B 4RMQA 5IF0A 3S37H 5SWSA 3VJ6B 4P23D 3JTTA 3OG6B 2MCPH 1KN2L 2X9XA 3ESUF 3FQNA 4GBXC 4HCRH 4GKZA 5FHBH 2IPKA 5SWZB 2DQJH 2BZDA 3HS0A 5I8CA 4E0RA 1CFTB 1XT5A 3QR2A 5DJ0A 4J3WA 3TF7C 1RULL 3WLWC 1DDHA 5HHQA 2GAZA 2X2YA 4MNGA 3U1SH 1UYWH 4LVNB 2KQMA 1EAJA 1P4BH 4R7NB 2R8SH 1I9EA 4UB0H 1I3GL 2WW8A 5KSVA 1A6PA 2BOCA 3RUGF 2NLJB 4X6DA 4UINL 3X14A 4HK3J 3WYRA 1PKQE 3ROLB 1A6UL 4LKXB 4C55A 1UA6H 5ALCL 3I75A 1TVHA 4Z95H 1Z5LA 3V4PL 5HVFB 3OJMB 2IBBA 4GBXD 2YXFA 1J1XH 3CH1B 1Q1JH 4MCYB 3D18B 3D39E 5DMGC 4GMTH 5FFLA 1CGXA 4F3FB 5E9DD 2HFFA 5FEBA 4HG4K 2IQ9H 2VXVH 3SGEH 5DZNA 2BVTA 1FIGH 4XMKL 4PV8A 5DD6A 4HBCH 2OLDA 1ZWIA 1X44A 3RGVC 4C57C 4TTGA 5DJ0B 2DL2A 4EDWH 1T0PB 5BVJB 4RMUA 4Q7DA 4NPYB 4LLQA 4FTVD 1SJHA 1KG0A 1KTLA 1HZHH 5DRXB 4Z0XB 3SO5A 3DURA 4K94C 4LSRL 4JFEB 5F71A 1JZ7A 4J3XA 3TBYB 4JRXD 1CGVA 4U05A 5HY9A 4MLIA 4A6YL 4RFEA 4H25B 3TV3L 4PJ9B 3MLPA 1F5WA 4P23B 2XY1A 3RNKB 1TVHB 2EDOA 3MRBA 3LZFL 4P4KA 5DJ2A 2J7LA 4QOKE 5BVPL 2R2BA 3GMQB 4YHOL 5L8KB 4G43A 4WW2C 4YDVA 2EIBA 3RRQA 3MLSL 5DGQA 1DN0A 4UT7H 2H26B 4L8CA 1MFBH 2CLRB 1R5VA 3RGVD 3V9FA 4ZYKB 3O2DL 3FOLA 4PRAA 3N1PC 2Z92A 4XCYA 5DJ6B 4K9EH 4PV8B 3MOAH 1TVDA 4PFEA 3RJDA 3SDAC 5ANMA 1EO5A 5CIPA 1V7NL 3R4DA 4WFEE 1QP1A 4Q9QL 4OZIA 1TJHH 4RISL 4RGNE 1OAZL 4PJGB 4GBXB 1WK0A 2RFXB 2OSLA 4OI8A 2L4OA 4WI9A 4MX7A 1CQYA 1R24A 4GW5B 5E5MA 1RUQL 1A6VL 2W65A 3G5YB 4LLUA 1FJ1A 2AEPL 3KPRD 5HY9B 5JXEA 4QRUA 3N06B 4KTYA 2QL1A 4F7MA 3HG1D 3K4AA 2VE6A 5HGAA 3O0RL 4H1LB 1T3FA 1N8ZA 4YLQT 3EO1B 6CGTA 3G9AB 3T09A 1EFXA 1G9NL 2V9TA 4YDVB 4KK6D 3CDGA 3RX8A 4W81A 1P5UA 3FQXA 2YZ8A 2JLLA 4YDJB 1BQLL 5I17B 3S35H 3SDAD 5GGTH 2HJLA 4FTVB 4W6WB 3O3AB 5ISZD 3N9GH 3C5ZA 2X70B 3OKDB 1U2CA 4JRXB 3GMNA 4O4YH 5INCA 5IK3B 4AM0A 4IIQC 4XCYB 5L9DL 1GGIL 3FN3A 4R97C 2YR3A 1A14H 2EDJA 1FDLH 2BVPA 5MP6H 1N5YL 2CDGB 2Y4SA 4M8VA 4BFIA 4XPGL 4ZAKC 4I1NB 4NRYB 2R4SH 2JJWA 3ZL4L 1SJVA 4G7YL 4JZNB 1OL0A 1IQDA 1R3LB 2BVOB 5CCKH 1JWMA 4I2XA 5CBEA 1FL3B 5D6CA 1KCKA 4KJWC 4C58B 2J6EH 2V5MA 4JY4A 3RGVB 3FQTA 5ID0B 1S7SA 4NZDA 2QSCH 1TQBC 5EZIH 5EU6E 2XV6B 1QBLH 1N8ZB 1JV5B 2V17L 3GKWL 1OAUH 1F8TH 4OZFG 3BD3A 2RQ8A 1WZKA 1F3JB 4RAVB 3QZWA 3TYGH 1XGUB 3A6CL 4M5YH 4NKDA 5H2BA 1MNUH 2VERN 2C3GA 2Z91A 4HWBL 4Y1AE 2BNRB 3MLZH 2YKLH 4X7CC 3HC0B 2EC8A 1J12A 1XGRA 2AP2A 4QXUH 1W0VA 1MUJB 4WW2B 3KPRB 2FX8H 3GMNB 4X7TB 1FC1A 5INCB 1G7LB 1VFAB 1I75A 2EDKA 3R06B 4KUZH 1AI1H 1G6RH 2FO4A 4LNRA 4MJ2A 2J5LC 4PJ8A 4O2FA 4O9HL 1P6FA 3AY4C 5DJYA 5IFAH 1D5MB 2ADGB 3MMEB 1F4HA 4QRQA 1HQRA 2GUOA 2NQCA 3PUCA 1RUMH 1FFPA 3BP6B 4PJHA 1PSKL 2I9LA 3BZ4B 2AK1H 4HH9B 4OTXH 3QDJD 1YMHA 3AS1A 1INDH 3OG4B 1JE6A 5I8EA 4QKXB 4IJ3C 3SDAB 2QADC 2EDTA 3Q2CA 1YNLL 5EOQL 3OPZH 4OF0A 4ZAKA 4DN3L 4AL8L 3BKYL 4K3HA 1JK8B 5EO1B 5C0EB 2V7NB 5GXBB 3F7VA 5I1HL 2EKSB 4U6TA 3D39D 4NHUB 4P2OD 4WO4C 3REWA 5I18L 3BH9B 3S88H 1YEGH 3NIFF 1F4XH 1KYOJ 4XPHH 3QAZC 3CGTA 1MCIA 5E6ZA 1WSST 1Y18B 4XRCB 3CK0H 1QG3A 1U8JB 2NZIA 1IM9D 2OK0H 4BSWA 5EBMA 4HGKC 1KXVC 1CLZL 5HHPA 4HS3B 4DN4L 2QR0A 3GI8L 4OV5A 4GSDH 4HUUB 2QADD 3CSPA 4EXPX 2FBJH 3I6LE 3LKOA 4ZOCA 5DLML 2P5WD 4JHBA 1ZS8A 3T0DA 1U8MA 2YC1A 3RWGA 4P46A 3GSQA 3IXTB 3NCFB 5JXAH 2EZ0C 1BPVA 4IIQB 3BEVB 1FNGA 2P44B 3KPLA 3MV8E 3FTGB 3MGTA 4BH8A 1P9MA 3DUUB 3QPXL 1JGEB 4R97B 4PJGF 2V6HA 4FZEL 1P7KB 3MV7D 2D7NA 1RIUL 1JMZA 3ARBA 3DSNA 4D0DB 3O4OC 3CX5J 4Y4HA 4ZAKB 5DTFA 1MRCH 3S34H 1MVUB 5JDJA 1HILA 2IWGA 3K2MC 2GYSA 5GS2H 5EBWA 3U6RA 2FSEA 3IDMA 1N6VA 2R0LH 3HR5B 1ES0B 3P4NB 4HJGB 3REWB 2E7LA 1YECL 4DFHA 1SQ2N 5HYQB 1VFUA 2K7QA 1QHOA 2VXUL 4PRHA 4X98A 1TQBB 1UZ8A 3TESA 3TWCH 4HLZG 3LEYL 3OR6A 5C07E 2CRZA 3O9WA 1TZHA 2HWZL 3QDJB 4TQEL 1O7VA 3KYOA 2EZ0D 5EBMB 4Z7NF 2R4RH 1FFOA 3ULUC 4WO4A 3MODH 1E27A 3MYJA 1BQHB 2VITB 3MGOB 4CU8A 3T4AA 2JCCE 4LLAA 4WFED 4U1IB 5CLTA 5H35A 5HHOE 1NC2B 2VDKH 4KTEL 1T0NB 4RGND 4DKEL 2AABL 5DD0L 4J23A 3TIEB 3WNNA 2E6JA 5E8PB 2AK4A 4IRZH 1CF8H 2D31A 4W4NA 3L1OL 1YN7A 1F3DH 3P9LA 2J5LB 3UMTA 5F8RC 3BAEH 1CL7L 1CU4H 5D72L 2A77L 1WT5C 1ZSDB 2ARWA 4CU6A 5TDNB 5E1AB 2EYSB 5TE4H 5IB4A 3BPNC 3EJJX 2IFGA 1VADB 1I7UB 5FKAA 3QQ9D 3KYAA 1NCWH 5AWNH 4CJ1A 4IJ3B 4P3WA 2QADB 4U1LB 2B0SL 4YFLI 3JXAA 2P5WB 3O6FA 3B83A 1UZ8B 43C9A 4GG8A 3HCVA 3MRQA 4M1GL 5T3XL 1N7MH 4P4RA 1XF2A 1T7VA 2VABA 4O02H 3MV7B 2XKSA 3MRNB 2FLRT 1YN6A 4WO4B 5C86A 2VSCA 1RU9L 2DBLL 3MYJB 4WW2F 1H3UA 4OIIL 4GAYA 3U4BL 5I0ZA 3QAZB 1T20B 1GAFL 4XB8A 4UOW0 1OSZB 5F1OB 2ESVE 3WHXA 1P7QD 1SM3H 4NCC1 3MR9B 5D1ZD 1S7XA 1RIHH 2OTUB 1NCAH 2WWKO 5DHYA 2QHRH 3WDIA 4M4PA 1KEGL 3DMMA 1QYGL 2CD0A 2ICCA 4M7KL 5KS9F 2X89D 3EYUH 5FF6B 2UVFA 3QCVH 4GMSH 3GHEL 1MAML 5T3ZL 4D9LH 4X6CA 3MA9H 5JOPE 3HI6H 3WHE0 5DQ9B 2KQNA 5SX4I 2ZUTA 3AXLB 1UWGL 1NLBL 4QF1A 3D69B 4N0YH 1ZVHA 4CADA 3O81A 5HPMB 2NX5E 3OGCB 1RZIA 4KZEL 3KLAA 4ZMAT 4JFXA 2J88L 5F96L 1IQWH 4Y1AD 3O4OB 1FZJB 5IP4A 1MFNA 3KGRA 2NY2C 4LASL 3HCVB 4Y4FC 3N1FC 5E99L 1Z0NA 1A3QA 3OL2A 4JAMA 2VABB 4LGSB 5D2NA 4TUKL 2EECA 4YQXL 3WUWA 3I3BA 4OIBA 1FZKA 1EEZB 1KPUB 1AXTH 4ODVL 4OLUL 3JWDC 3ULVC 1IAIL 2ZCHH 3FT2A 4OBRA 1MREL 5CSGA 4ZDHA 4KKAD 3MZTA 3P0VL 3NH7L 3F6LA 1I9RH 4ISVB 2KH2B 5DEGA 4LSTH 5C3LD 2A38A 5HYJA 1J18A 3EFFA 4KI5C 5EA0H 2X10A 1NMAL 4OGXH 2UWEA 1VFMA 3MO1B 3NABL 5BO1H 1W8NA 4KU1A 5LBSL 2IPUK 4GJTB 4UNTA 2YZ1A 2ARJA 5F44A 4UU9B 1MCKA 5IVXE 3T65B 2NY2D 1A3LH 4NNXB 4UDTA 3IFPB 2YA0A 1DQDH 2WQ8A 1OM3H 4JVPA 2YMXL 3P77A 1RD6A 1JNLH 2EDBA 2R23B 4OGZA 2FHCA 2L7UA 4LQFH 1NBZB 3RGHA 1P7QB 1JGVL 1NFIA 3ULVD 4BSJA 3I6KA 1CVSC 5FB8B 4ZNEA 1RJYB 3TVMA 3O2VH 2R2CA 1N0XH 4X9FA 1E4KC 3BPNB 1JBJA 5EOCH 5EWIL 5GIRA 4ZOBA 1A4JA 4QHNB 2ADIA 4KI5D 4CGTA 3GJFK 3U9UA 1CG9B 4QYOA 2VLJA 3HRZA 5BV7C 4AENA 4RGOL 3GO1H 2ORBH 3Q0HA 3MV8D 2VN4A 3UYRH 5HYJB 3WJLA 4ZFFB 5C7XH 3QXAA 3MRCB 5F7KC 2H32H 3QWOA 1U91A 1WQVT 2HJFA 4MVBC 5LG1A 4HZLB 2MKLC 4HUMB 1S7TA 3FO9B 5HI4C 1UB6A 5DC9B 4UV4H 4NQEA 2Q76A 3EFDH 3EOTH 1T80A 1FN4A 3S3JA 1T0MB 2CKBB 4Y8DC 3P77B 4S0TD 3VXRA 1MCCA 4P0DA 4I3RH 5IMKB 5DC0A 3DVFA 4V2BA 5DK0A 3VFGL 4ONHA 1HXMB 1Q0YH 3VWKA 5ADPL 1I1YA 1I8IA 3LQZA 2DWEA 2G60L 1DBBH 3T2NL 2B1HL 4NQXA 1T04B 3K74B 4G6KL 4G7VH 3UJTL 4OSUL 2VDMH 3PABA 3C8HA 3TZVC 1T7YA 2CRIA 5FYKH 3TA3A 3IDUA 4QRRA 3ZE2F 4MD4A 2BFVH 3U9UB 5HHOD 1KACB 4HXAH 4L9LC 4F7EA 1AE6H 2NY2B 1YEKH 4OCRH 4Y4FB 5DGRA 5BJTA 1E6JL 3MCLL 1IGIL 5HI4D 4KUCD 4OD3H 4GKNB 1WBXA 1F58H 4O58H 1X5IA 2E7MA 4KXZI 4UBDC 5GRJL 3GSWA 5F21B 3ZDYE 4JKPL 3UZVB 4BK4A 3K4ZA 3VI4E 2GI7A 4HIHB 3W39B 2L7JA 3KPQB 2EO1A 4NO5B 1KCSL 2XTJE 2P43B 4LCYA 5EZJA 1KJ2A 2HLFD 4MXVF 2V5RA 4YDIH 2WP3O 2DQUH 2WANA 5EIVA 1BFTA 3H9ZA 4OFYD 2W60B 2ZG2A 4N8VB 4BM7A 1FL6A 1I8IB 3NZ8A 3Q6GH 2J1KA 5E8NA 1D6EB 1IAKB 2BXYA 4NUGH 1FL5A 5TFSH 1U3HC 2O61A 2AEQL 3B5TA 4NQDE 4X99A 5FYJH 5I1DA 4JDZB 1N2RA 4MDJB 1WGOA 4HPYL 4NZRL 5DYOB 5KANI 4FQHA 2CKNA 3IDGB 3VCLA 2DQHH 3X17A 4LU5L 4UBDD 5D7KE 4ZSOB 1S7QA 1K9TA 2MOVA 1PLGH 2J8UE 2PYED 3SGEI 3ABZA 3AVEA 5BW7A 3MBXL 4KHTH 3FT3A 4IRSA 2HN7A 1MWAB 1AGCB 4OB5H 4YZFE 3A6OA 3U79A 1CI5A 5GRZA 1K4DB 3RA7H 2IH3B 3ULUF 4WU7B 3MXWL 2Z31A 4I3SL 5LWYL 5BV7B 1O5DT 5EIIB 4P2YA 2C1PB 5JOFA 3LQAC 2KDGA 3R8QA 3FB8A 1AHWC 1VSCA 5TF1H 1HSAB 5E56A 4YDKL 1EERB 3TC9A 3VXSD 1U3HD 4NHCH 5A2KH 5KVDH 3OKLA 1NBVH 3L6FB 5IUSA 2BDNH 3NZ8B 4KV5E 4FQXC 3U83A 5DD1H 3MRMB 1HCVA 4M6OH 4XC3H 4PG9B 1BZQK 5I8KL 4YIQB 5JUEL 15C8H 2XKNA 2Z8VC 3OX8A 5CEZH 1D6VH 1T83A 2B5IC 5IOPB 5FA4A 3V7MA 1YY9C 1QPPA 1L7TH 2UYLB 3CLFL 4NJ9H 1K2DA 5F9AC 5I76B 3LAFA 2YRPA 1MFDH 4X4YB 3TZVB 5KZCD 4MNQE 3KNBA 3FT4A 5EZLB 3BE1L 2F5AL 1WCBB 4L9LB 2P5EE 1YEFL 3L3IA 3CSYA 4PY7A 4HULB 4JO2H 5TDPA 1YPZB 2DKUA 3VFOB 3PV6A 1Y0LA 4FQXD 1RZGA 1U8OA 3PNWA 5DMIL 3K1KC 4XNQB 3M1BA 3FRUB 5I1IL 1FYTA 1EEYA 3L9RA 1CTOA 3WFDH 2C4FT 1U6AL 1BZ7B 4JE4B 2PYEB 4ZPVA 5L88L 2NTFA 3IU4H 1YY9D 4DUVA 1TZGL 3VGFA 3QBTB 5LQBL 4Z7UE 2AJUH 1QFWI 1F6LL 2P46B 2I26N 1YDPA 2H9GA 4P2RA 4KY1L 4N68A 1RUPL 3PDOA 4LP5A 2VN7A 5GGQH 2MMXA 2X4NB 2D03L 4HD9A 5CGYC 3OJDB 5KSUB 2VO5A 4HPOL 5DVLA 5FUZH 4UTAL 4TOYL 3VXSB 1U3HB 1SJXA 4NQTA 3KPNB 4CUCA 4G8IA 2X4UB 1K5NB 1WAAF 3B9KD 1G7JA 4YHKH 5CP3H 3K7UA 1K6QH 1ZT1B 1FP5A 5BRZE 3LN4B 3MREA 3BEWB 2OL3B 5GRUH 5I1EH 3FZUC 4JG1L 3D0VA 3VGHA 2C9AA 5F8QC 1SBBA 1VFBA 5K93A 1CGSL 3I9GH 3ULVF 4OCSH 4L4TD 4BFBD 1U8OB 4H8WC 1N5AA 1HNGA 4HW6A 1A7OH 3CDCA 1GGYA 5F1NB 1F90H 1DQML 3L9RB 1FG2A 2FJHB 4KI5F 1JMXA 3VWJD 2CR6A 5LJYH 1F4WH 4POZD 2MQ3A 1EMTH 3BPCA 1WV7T 1G7HA 1GGBH 1P4IH 5CGYD 1AHWB 1DUZB 2VTFA 3ARTA 3QFDA 4JFHE 2YXMA 3HE6C 4R4BB 3QIWD 3ILQC 1YEDA 3ARXA 4QRPE 5DJDA 2GCYB 2EICA 2P8MA 4B53A 3DI2B 2PNDA 3SKNA 4OCYH 2YBRA 2DJSA 3D85A 3FZUD 5ALBL 3W0WE 4LSQL 4DZBB 4FQXB 3LD8C 5DURD 3VD3A 4PJFE 1EGJH 4JO1H 5IM7A 5CZXD 1VKXB 1JPFA 4HK0A 4Z0BL 4X9GA 1KLFA 5JTWA 4MDIB 4MS8C 1KBGL 3RIFF 4P2QA 3QEHB 3UPCA 5CKAA 3G6JB 5LGJA 3EYOA 2DYPA 2B5IB 4K8RL 1YMMD 2JELL 1UC6A 2CLZB 4I4WB 5DO2C 4M02A 5TPWL 5D5ME 4AMKL 4HV8A 5IB5B 5DRWB 2WUCL 1MCDA 1RAMA 1C5DA 3F62A 3FO1A 4FQCL 5JW5A 4WUUE 3KPSB 4B7LA 3ILQD 4G6JH 3QDAA 3QNYB 5L6YH 4M62H 1HH9B 4LEOB 3C8DA 1DBJL 4XP9L 1ZT7A 4YUEH 4S2SA 2AJSL 3MACL 4HS6B 1YEIH 5JHDE 2D0GA 4XNMA 1FE8L 3MFFA 3RP1A 5C0AB 4NQDD 1BREA 4PREB 2X4QA 2BNUB 3HAEG 5CD3B 5A3IC 4Z8FH 5A2LH 4CL7A 1AQKH 4Y19E 5F9JA 4CDGC 2APVA 2A83B 4MHHG 5T33H 4MS8D 4U1HA 3QEGL 2PW2A 3K8KA 2N7AA 1NAML 4OLVL 4YAQB 1XZ0B 3ISWA 4K3EL 3SKNB 2VL5B 4PTUA 3NCYP 2ITDB 3ARDA 4L4TB 5T1LD 1NCBL 1S9XB 5E00A 3QO0A 1SYVB 5KSAC 4LLYA 1IAOB 1I8KA 3LS4L 2W1NA 5K9QI 1NFDA 3T2QA 1JGLL 5LXGH 1GIGH 1IJ9A 4LHUD 3M8OH 1E0OB 1QO3A 1Q9WB 3LKQB 3JV6A 1XF1A 3OZ9L 3UJJL 2Z4QA 3LSOB 4HV8B 4S1QL 3T08A 5CZVL 1ZHLA 4BKLB 2GW5A 4GS7C 4RX4D 1KB5H 1JL8A 4JO3H 2BRRL 2LFGA 3X3GL 1YPZF 5K9JH 2EH7H 4OJFL 2F54E 4ODTH 1JGUH 5A3ID 1I7RA 4OZFA 4PD4K 4L8BB 3HZYA 1HNFA 1ZT7B 5ESVA 5DURB 1I3UA 1QQDB 2VAAA 2YUVA 1F4YL 4XNMB 1T2QH 3L3OB 4P9ML 4XCFH 2ZOKB 4YX2L 5KVGL 4XVSL 3HNSH 4F2MB 1MRDL 3W5NA 2NW2A 2A6JA 3WCYA 1OAXL 5KSAD 2EEDA 4JB9H 4Q74A 5F9JB 1U8LB 4R4FL 1YMMB 5GZOC 2ZUYA 5D7LA 3CDFA 3WUZA 1KN4H 1YQVL 1TFHA 3EBAA 4Q97A 1JHLL 3OKKA 4JLRB 3VXMA 5D1QC 1JPGB 3QPQC 2I25N 5C09E 3BZEA 1KIQB 2MKWA 4HUXB 3FQRB 3HE6B 4RGMC 4OZGE 4Z7QF 5EO0B 1EA9C 3BIAX 4MNQD 1XGQB 4CU7A 5J1SC 1K4CA 3M17A 1IEBA 2CJUL 4L1HA 3FCTA 3BZFA 5EFIB 4KKNA 4D94A 3GSNL 1CFBA 4IDLA 1RQ5A 5ICYB 4NQDB 1A9EA 2NY4D 3LD8B 4S11A 4QHKJ 4HCRA 2NPLX 4NQVA 2X05A 1EZVX 5ID1A 1NJ9B 2NNAB 5DFTA 3OKEA 3O2WL 3QUXA 1OQOA 1I1RA 4XPTL 1AIFB 5C0DB 2I9TA 1WBZB 2EEBA 4TNWK 5FYLL 3UBXI 1MIML 3DARA 1I3GH 5T1LB 4Y4KA 2UUDK 1R3IL 1T2JA 1A8JH 1DVFC 2EE9A 5EOCJ 3FFCE 4S1DC 3PWPE 5D1QD 1XEDA 3QPQD 1A6UH 5MEPA 1MCWW 5F1IB 5ALCH 1QVOB 2DJ4A 2VSDA 4LHUB 4MJ5A 2M1KA 1RZKL 1P84J 2X7LA 2OR9L 1L9MA 1QNZL 4YFLF 1U8PB 1CYGA 3MLRL 5IHUL 3D6GA 4Z9KB 3U9PH 4H20L 5F9DC 4BUGA 1JVKA 4O2CB 3BJLA 3QDGA 5BRZD 2O93L 1KTDA 5DQDL 4YDLC 4J12A 5E9DA 2CH8A 3BZFB 5I75C 5F89A 1AO7E 43CAB 4L29A 4V2CB 4XMKH 4NOFA 3G6JF 3G5XA 1UXWB 2R9HC 3ORJA 1DVFD 4EI5A 5KSAB 3TFKC 9CGTA 2XTLA 4S1DD 3P30L 4WNQB 1CT8A 3OKEB 1XGTA 3IF1A 2AJVL 4MA3A 1JF1B 3U46A 4TVPE 4N0UA 4YFEA 4PJDB 5GGUA 2Y06L 3R0NA 5JOEA 2W9DL 1YUHB 4LSRH 1WIUA 5TDOA 5J1TC 4UQ2A 4A6YH 3TV3H 4GS7B 1A1NB 2VUOA 1DEEB 2W38A 2Z35B 3KJ6L 3S36X 5IW6A 3SDCA 3IJYB 3LZFH 5IFJA 5SX5H 5BVPH 1OT1A 3CIQA 5CFHA 4YHOH 2KBGA 4X80H 4JFZL 3VXOA 3LPGA 5FYKU 3WSQH 4CVXB 3LKRB 3ROOA 2W92A 3MLSH 3CPLA 1AY1L 1JJUA 2Q8AL 3B6SB 5IB1A 2BVQB 2Y1VA 2CMRL 2R9HD 1JUFB 3GM8A 4V1DD 1FVCA 5EOTA 2XWBB 4YXHL 3O2DH 3PGDA 1MH5B 5F89B 1M1SA 4L29B 5L2JA 4PGCA 3P4MB 5EC2A 3PQYA 3E0GA 3NN8A 2YEZA 5D1QB 2DTML 3G5XB 4FHBD 4RGMB 5FIEA 1NH6A 1I7TB 2ADFH 1V7NH 4CN6A 2NY5H 1EH9A 3ARFC 3OKMB 4Q9QH 3OSKA 4RISH 5J9PB 4GG6B 1OAZH 1T4KA 4KVCL 4YBHA 5TQ0H 3PGCA 3SCMD 1A6VH 2OZ4L 4M7ZC 2B2XL 2AEPH 4UQ2B 4QTIH 4FS0A 1KJMA 3HNTL 4TTDC 5C08E 5BRZB 5LGHH 4QHKI 1T66C 3B9VA 1IMHC 5FO8B 5JORB 2G5BB 5FYJU 3TPUB 3FN0L 4GQPH 5BZWB 5IFJB 2GK0A 3KPTA 4G9FA 1G9NH 2F74B 5DWUL 1KELL 2XG5A 1DVFB 2CUMA 1N3NB 3VI4F 3PWJA 2WINA 3CPLB 1EZVY 3UAJC 1X4YA 5GGRY 1EK3A 1BQLH 3NFPA 1X5AA 2QKIB 2V2WB 3VMNA 1FLTX 2GTWB 5GGTA 2AEIT 3ARFD 2ED7A 2EIDA 5DI8B 1SEBB 5T3XE 5EUOA 5EC2B 5JIPA 3NN8B 4PJXE 1IGYA 2YEZB 4PYGA 2VR4A 5L9DH 1A3RL 1GGIH 1RPQA 4BK5A 3F7PC 1HXYB 1FLRL 3ZMRA 1DQJB 1N5YH 1XGYL 1INEL 4TTDD 4LPUA 5HHXH 4YDLB 1INQA 3LPWA 5ACMA 5I75B 4RBPK 2FNBA 4JY5L 4G7YH 2WV3A 2MPAH 1MHEA 4JFYA 5FUCE 2B20A 2LAAA 1T4KB 3HPJB 1DQQB 3PGCB 1I8MB 2NY6C 3G5VA 4JRYD 5JZ7D 1KJMB 4V1DB 5EUKB 1NANH 4M6AA 3UAJD 3VXUD 2J6EA 5C0ND 3OQ3B 3BP4B 4L3CA 4R4NC 4G6AC 3RDTC 3VFTA 4RZCA 3T3ME 2V17H 3GKWH 3RL2A 2V2TA 4LIQL 4PBXA 5C09D 3V5KA 5JPMA 5DEFA 2QHLA 4MA1C 5IJVB 2BNQD 5IIEB 5DMKA 1AFVL 2OJZL 1W0WB 4ONOA 5D1XC 4W68A 3DO7B 2BOBA 3WFHB 4N9GB 1DR9A 1RVFL 1N64L 3SE4A 4OZHB 3BI9X 3TNNB 3VE0B 3BO8A 5DD3L 5EG6C 2HTLD 2VXSL 5GGVY 4H0GA 4P49A 3OBAA 1E28B 4U1MA 1NMBH 1CICA 5E4EC 4M7JL 4XNYH 3UZQA 4Z5RA 5DK2A 3GMLB 5FGCE 2MWCA 1G6RA 3GGWA 1CDHA 3RPIA 3SJVE 4DJMA 3F58H 4WFHE 1IARB 4NM8L 3ZKMD 4R4ND 1IT9L 4G6AD 2W9EL 3TT1L 3RBGA 3HMXA 3HLAB 4Y2DC 5B39B 1PSKH 1R5WB 3FFCD 4Q2ZB 1QSFB 2FYYB 2J12B 3QQ3A 2UZYB 3PWPD 4PJDF 4RAUA 5JIHA 4AQ1B 4GLRH 4F7CB 1YNLH 5EOQH 5IWLA 1BD2E 3ARFB 5J11C 3GJFH 4DN3H 4AL8H 3BKYH 4GUPB 4AG4L 3L3KB 4NFCA 4RZCB 4XGZA 2IANA 3NIGE 1BIIA 4ZFOB 2HFEA 2BX5A 1AP2A 2EC9U 3JVGC 5I1HH 4M7ZB 4F80A 4PR5B 3P9MB 3DXAD 2A6IA 4ZPTB 1W72L 2M8XA 1ZT4B 3SDDA 5I18H 3D39A 5F93C 3U0WH 3JTSA 4HKZB 3QQ4A 1KLGA 3VFNB 2D7PA 3LKPA 4NC0B 2ZNWA 4M48H 3ELAT 4JJ5A 4JRYB 1L4IA 3NOIA 5JO5B 1WITA 1IM9A 2ATPA 5KBNC 3VXUB 4U1MB 4DN4H 1A7NL 3GI8H 1J0HA 5GSVA 1G6RB 2VQTA 3GGWB 3QT2A 4TVPD 5DLMH 1J05A 1QA9B 4UIMA 1QLFA 5CWSA 5I19L 1P1Z