1BLNB

Anti-p-glycoprotein fab mrk-16
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
218
Chain Sequence
EVILVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATISSGGGNTYYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYYCARYYRYEAWFASWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (MONOCLONAL ANTIBODY MRK-16 (LIGHT CHAIN))
publication title Mode of binding of anti-P-glycoprotein antibody MRK-16 to its antigen. A crystallographic and molecular modeling study.
pubmed doi rcsb
total genus 46
structure length 218
sequence length 218
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1blnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1blnB01
5I75C 4XX1G 3BE1H 2AJVH 1KPRB 1JGLL 5GRJL 1U8PA 3MGTB 3FO9B 1QRND 1FCGA 2CIIA 2EH7L 1KBGL 3JSSA 4QGYA 5E6IC 1JNLH 5C2BH 3FAWA 2FECL 3MXWL 3W9EA 1C5BH 3HC3L 2FWOA 3DYOA 4MS8C 2DBJA 4Z18A 2X9WA 5MEPB 1LHZA 1ZVYA 4JPKL 1JWMA 4K8RH 1EMTH 3IFLL 4OLYL 2H2SD 2VJXA 3RL1B 3GSOA 1KLGA 1XGRA 4QWWC 4XNQB 4U6VL 1HEZB 1XR8B 2RB8A 2DQEL 4EVNB 5CLWA 5CINL 3GSNA 1NAML 4Z76A 2W60B 4R0LC 2QSQA 4JZJB 1HYSD 4L3ED 3G08A 1KT2B 2I24N 5KSBF 1HE7A 4JJHA 4GBXD 5D5MA 5F3HA 3IJHA 3L5XH 3QJHA 1XGPA 2VR9A 3NPSC 5DO2D 4AENB 4IS6B 1PKOA 2YHGA 2FJGB 3DUUA 1CXFA 4OTXL 1JN6B 3MSPA 2C1PB 1IGIL 4PB9H 3W39B 4WO4C 2R2BB 4YWGL 2RHEA 1N26A 4MNHB 3BN3B 5J6GB 1OPGL 5I2IB 4YEFA 1GGCH 1H8OA 3DO3A 2XY2A 3QQ4B 4N1HB 1JGDB 3RGVD 5KVGL 3QDGD 1LE9A 4XNYL 5AG8A 5E7FA 2AJ3A 3NN8B 1QRNA 1HXYB 1NKOA 3OG6B 4Y4KA 1KB5L 2AJSH 4QRPD 3CU7A 5IV2B 1IFHL 3LV3A 4F9LC 1NCBH 2B20A 2ZSVB 3WLWC 2QR0B 5ENWA 4PLKC 3TJEL 1NMBL 4RGND 1X5XA 3BP7A 5I75B 4P48A 5I1KH 1KCVL 4NGHL 1A6WL 5BRZB 5CBEB 1OD7A 1QEWB 5DVMA 3BD5A 1I8MA 5E5MA 3GB7B 3DSNA 4ZOEA 2WIMA 3T77A 1DL7H 4XH2B 4PJXB 1P5UA 4EZMA 1I9EA 2VABA 4L3EA 1QNZL 3U7YL 5FKAA 1JV5A 3V4VL 4F8TA 3BAEH 3H3PL 2GI7A 1KIUA 2A6KA 1KELH 4NFBA 5FOBA 2KQNA 3CVHH 4UDUB 3TWCL 3ULVE 1U3HB 1RZIB 1WUNT 3HUJA 3QEGH 1LNUB 3DOSA 1JF6A 5EBLA 1U3JA 4OZIB 5L2KE 1ZA3B 3B2VL 3E2HC 1ZHBB 4MJIE 4LPUA 1WK0A 2X4TB 1NGQL 1OAZH 1Q9LA 3S6CA 5INDB 1MELA 4TQEL 1T1XB 1UCBL 5ADPL 3RGVA 4TUKH 3QDGA 1RUQH 2AXHA 2F54E 4XVSL 3T1FB 1XCTA 2JB5H 4K9EL 1ZGLB 3MXVH 1I1CA 4WO4B 3G9VA 5GSRA 2IJ0C 3P9MB 5TE7L 4PJBE 5DUBB 1IEAB 5E2UH 4LCUB 4D9LL 3V5KB 4X9BA 3LQZA 4UILH 3OJDB 3KHOA 4OLXL 4Y88A 1YY9C 4P2QE 3KPQA 1MFCH 4XNUL 1NLBH 4PTTB 2P8PA 3O4LB 1CBVH 4XCYB 4RIRA 1I7TA 25C8H 3OR7A 5DHVA 2XACC 1M6OB 3DUSA 4XNMB 3O4OC 1KCSL 4I48B 5B4MC 5DUML 4PLOB 5DMKA 1FVEB 2VLKB 4I5BA 1NAMB 3GK8L 3HNTH 4HUNB 5KSVA 2F19L 1MNUH 4U1GC 5L9DL 1ZHKB 2X4QB 2XRAL 5JUEL 3KS0J 1WICA 2VZTA 3CH8A 5FGBC 3PL6D 2BSSB 2XIDA 3SY0A 4F8QA 1JGLH 5GRJH 4DKEL 4CNIA 4OZHB 2EH7H 4UMGA 1NCWL 4CVZA 4WI2A 1UG9A 1BJ1H 5L0QC 3MXWH 2QLVB 1F8TL 4Z7VE 4YDJB 1A9EA 4JM2F 3ECBB 4PGEB 2PXYD 3ZKMD 4KK9C 4CU6A 4NWUL 3REWA 3TIEB 5ABDE 2ORBL 1L0QA 4JPKH 1RHHA 2GY5A 3DTXA 2NYYC 5BQ7B 1SYVA 3IFLH 2DTML 4OLYH 4OZ4A 5D8JL 5CJOL 5I1IL 1X3DA 4DKFL 2ZUSA 5F7HA 5GIRB 3KYOB 4B7LA 2CDGB 4G6ML 3GHEL 4FNLH 3VH8G 1NAMH 2X1OA 3E6FB 3VWJB 3ZSTA 5JHDA 1ZHNA 2BCKB 2DKSA 2ICWB 3JV5A 4ZSOA 3TA3B 1ZK9A 1Y0LA 3EYSL 5D6CA 1ZA6A 2YD1A 4F7TA 1FFOB 4OTXH 1CICA 4JRYE 3ORJA 5FHAL 3SGJA 3HPLB 1WEJL 2BJML 4ZFOB 1QLFA 4YWGH 5IQ9A 4U1SB 2K3TA 1QPXA 3MRKB 1P7KA 3QDJA 1ZAGA 1JPTL 3OAUH 3PL6A 1L4IA 3NTCL 1IAKB 3ARRA 3T4AA 5KVGH 3C60C 2YA0A 4HGWB 2DQFA 3G5ZB 3S3JA 1TNNA 5EZOL 3L7EB 1BLNB 4GMSL 3KPNA 1KB5H 3PHOB 2GJZA 1JNHA 2C3VA 4JR9L 5E94A 5DFWH 2XY1A 4NO5A 2PXYA 4PTUB 3OZ9H 4Z7WA 1FG2B 1EJOL 1X4YA 4MB3A 2R2EA 4U1GB 2E6QA 3TJEH 1NMBH 3TPUA 2PW2A 1KCVH 4NGHH 4X6DE 2GHWB 1A6WH 2E8YA 3IFNL 4ONFL 1I75A 1BIIB 1X5HA 2OTWA 2P42B 3MLWL 1U0QA 4L8BB 4LVHB 1N3NB 4YXKL 3PG2A 4MD0A 1AKJA 1OGTA 1FORL 4NHUB 2O5YL 2COQA 2YD7A 1CFVL 2AXJA 2BOCA 3V95A 3MQIA 3CSYA 4S11A 3LN4B 4N5EC 3V4VH 3MRJB 1ES0B 1RIUL 1T66C 3H3PH 5ICZB 1B88A 5DMIL 3VXUB 4PGCB 3CZJA 4KFZC 5EPMA 2DN7A 2N4IA 1JF5A 3NOIA 3BPCA 5GQBA 2D3VA 3TWCH 2XQYG 1A1OB 1IQWL 3MRBA 4JY4A 5CKGA 3DVNA 4BQ8A 3QFDA 4HUWB 3B2VH 2HT2D 2B0SL 4GAGL 4KUCF 3WNPA 1XF4B 5HI3C 4MXQC 1BQSA 3JV6B 1E6JH 4TQEH 1UCBH 3M1BA 5ADPH 4JHAL 2C3GA 3JWDL 2X5PA 3RTQD 1BVLA 3FAXA 3R8QA 4XVSH 3L5JA 4GW5A 2ZOLB 4K9EH 4BFIA 3GMMA 5TF0A 4QXTB 3DBXA 1FVDA 1JWSB 4YHKL 1ZE3C 5TE7H 12E8L 5TE4L 3KLSA 4OGAD 1L7IL 5I0DA 4DK6A 1WQVT 4LLDB 3L1OL 3TN0D 1PZ5A 4OLXH 3C60B 4XNUH 2XKSA 3B4NA 5FOJA 2OL3B 5IMKB 3O3EB 2FCBA 1J8HD 3BZ4B 4FQLL 4HJ0D 4LLMB 1ZVSA 1AIFB 4HIJA 1FZOB 1Z3GL 5DUMH 5FM4A 4U1KA 1LDSA 1K4DB 5J3HD 1II4E 1YQVL 2FHFA 3CD4A 3GK8H 1EFXB 4X6EB 1PDKA 2F19H 5ESQB 5L9DH 3Q0HA 4HIIB 1IBGL 2F5AL 2XRAH 5JUEH 2VQ1B 2XQYK 1N5AB 4HZLB 3IDMA 3L3OA 4DKEH 4O4YL 1NCWH 5KSBA 1C8PA 3VDBA 3QHFL 1AO7D 1J88A 4LKXB 1F8TH 3WJLA 2FR4B 2IANE 1TDQA 4KPHL 4NWUH 3UTSE 5J1SC 3D25B 2MOVA 2WWMC 3P0YL 3EJZD 2ORBH 3AXLB 3STBA 5C0AE 5DJ0B 2PYFB 2ICEA 1EHXA 3UDWA 3OQ3B 2DTMH 4K7FB 4PJDE 4WI8A 2HJFB 4CMMA 4HG4K 3MCKA 5CJOH 3B9EA 2Z4QA 3U30B 5I1IH 4Z7NF 2JCCB 4NP4L 4KJYB 3IDJB 2IF7A 1P1ZA 4G8IA 4G6MH 1U58A 4AIOA 1SYSA 2XWBA 1FZMB 3GHEH 4S1DD 1G9MC 2HWZL 1MCEA 3TN0A 5C0IA 5IKCA 4FABL 3QCUL 2HG5A 5BS0E 4RISL 3KPOB 2J4WL 1GVIA 1NPUA 3U0PB 1WIUA 4YHPB 3EYSH 5FGCE 4IJ3B 4MJ6A 5D7LE 3B9VA 4IOIB 4JRXD 5JIKA 1I1FB 2J1KA 2NY2B 3BRGC 3D0VB 5FHAH 3V6ZA 1WFUA 3F12B 4NJAL 5C07B 1JHTA 2YBRB 2EYTA 3L6FB 3OGCA 2PR4L 1IAIM 1IJ9A 1JPTH 1RZGB 4AH2A 1RJLA 4J4PC 5I19L 5CJXC 2NY4D 3NTCH 5CHNB 3UTQA 5SV3A 2DDQL 1QSFE 3WNMA 2B4CL 2DJUA 2M2DA 1C08A 4X6FB 2VDPL 2OI9B 5EZOH 5I71B 4GMSH 5DD6A 3BQUB 5I73B 1YUHB 1AO7A 3QB7C 3WUZA 1I3GL 1FDLL 5FYKL 2E9IA 1X5ZA 1RFDL 1V3JA 4E41E 1AGEB 1EJOH 4Y5XA 1OCWL 2MQ0A 4U7MA 5IBLC 4GRLB 2AV7A 4WTXA 3ARSA 4G8GD 2IQ9L 3IFNH 4ONFH 5KG9B 3RVWC 3MLWH 3JTSB 3QUMA 4JM2D 5B8CB 4YXKH 1T7ZA 2IMMA 2NQCA 1FORH 2O5YH 4K94L 3TO4C 1CFVH 1OF2A 1CGTA 5FV2A 3CU1A 3FT4A 5BOZG 5DMIH 1WGOA 4MA3B 4H5SB 3IJSB 3ZE1F 2W0KA 3GJFK 1PJ9A 3MJ8B 4CMHC 4D8PB 3D0LB 1IQWH 3QXUA 4P2RE 3DXAD 3G5XA 5H35A 3BH9B 2BXYA 4J23A 3GBLA 3VDAA 1IM3A 2ZP0T 1A3RL 4GAGH 4XBGA 5HD8D 1KCLA 1DQML 3QDMB 4WJ5B 1HHGA 3EOTL 5JDJA 2CKBA 4JHAH 5GS1C 3JWDH 3OAYK 3SOBL 1JGVL 5C09A 4J2XA 1CE6B 2WBWB 4ONGL 4PJ7F 3KLHC 5D7JB 1IL1A 4YR6A 4ZMAT 4PJEF 4XMKL 3EOAA 4XBPB 1RIHL 3QPXL 1HDMA 5JXAL 3UC0L 4QTHB 4YE4L 4YHKH 1X5IA 12E8H 3DURA 3VFUA 5IB3A 3AGVA 1P4LB 3U7WL 2J8UF 5DR5L 1L7IH 1C16B 1BZ9A 1UENA 5JOFB 1CLYL 5C0BE 4BUGA 2W1NA 5ISZE 1T0MA 1BD2B 3VMNA 4XVUD 1FNGA 4FG6C 4G8GA 1CFTA 4M1GL 5JW4M 4N8VB 4UDTA 3BOVA 4JM2A 4N1CA 3JVGC 3NCCB 1FNEA 4X8XA 4XNZC 4FQLH 3SGDI 2F8OA 2MJWA 3N9GL 1RK1B 4ACPA 1QO3B 3AS3A 5AZEL 1Z3GH 1U8HA 4M93C 5F9DC 5EIQA 4DZ8A 2X4OA 3GM0A 1ONQA 3VFGL 3ULUD 2BSRA 1IBGH 2F5AH 4N9OB 1ACYL 1U95A 1CVSC 4O4YH 3EZJB 3DXAA 2VLRB 3SBWA 4KK6D 3QHFH 3CVIL 4L9LC 5GS2D 4UB0L 5T1MA 4KJPD 1AXIB 5ICXB 4KPHH 2ADIA 1MLCA 3UPRA 3K7UA 3P0YH 3V7AE 5JXED 3PDGA 1MCDA 2P5WE 4JZOB 1G6VK 4I0CC 2I9TA 5E00B 2PO6B 2XICA 5AWNL 2BNQE 3ARQA 4JG1L 1UXWA 4GG8A 4NP4H 1VKXB 4KUCD 1NFDE 3MMEB 3ZL4L 2DB8A 4M1DL 1JK8B 1U93A 1AD0B 5D96B 1XR9A 4MNQB 4DCQB 2ED8A 1W8OA 2HWZH 4I18A 4FABH 3QCUH 3GO1L 5T3ZD 3X11B 4RISH 2J4WH 1G7QB 3P0VL 4HWBL 3S34H 3U48A 3MGOA 4ZOBA 4BJLA 4EDXA 4KK5D 2YN3A 1NEZA 3L3GA 4C4KO 1UACL 4OIIH 5LWYL 2W07A 1KACB 3L3KA 1XF5B 3V8OA 4PJHF 1JUFB 1N4XH 2BVTA 1S7TB 3GMOB 3O3BA 4NJAH 4AJ0A 3HMXL 2N7BA 5HYJB 3P30L 2PR4H 4K3DL 2DLHA 4I1NB 3KPPA 1QFWI 1TJGL 3UJIL 5D4QA 3CPLA 3HAEB 3MV8B 1UB5B 3WL9A 4NC2B 2DDQH 3TBSA 2VDOH 2B4CH 4XPBL 2VDPH 5HGBA 4DAGL 3U9UB 4F7PA 3ZYZA 1U2CA 2XNAB 3C09C 5J1AA 1CFNA 4WV1A 5EU3B 1I3GH 1UJ3C 1FDLH 3UAJD 5ICYA 4M93B 4M5ZH 2LAAA 5FYKH 8FABA 1RFDH 1AGCA 3JV0A 1TVBA 4ZFZB 5A2JH 3H42H 5JXEA 1OCWH 1GHFL 1NQBA 1KB9J 1U8LA 4HUMB 4LSQL 2GW5A 1MCKA 1MLBA 2IQ9H 3CSBA 4AMKL 1T7XA 2CLZB 2HT3D 2KH2B 4H8WC 4P23C 3UJTL 3ULVC 4L9LB 5F9OH 1N64L 2AXFA 4UT9L 4HV8A 3G5YA 3G6JF 2AQ3A 3V7AG 3HB3D 3SDCD 2XTJE 5F3BA 3Q5OA 3BW9B 2CK2A 5A43C 4G9DB 5IOPA 3KPSE 2VSDA 2HLFC 3FFDA 4XRCB 5BZDA 1BHGA 2DS4A 3AREB 5FO8B 5F1OB 3CLEL 2VAAB 2ICES 4HPOL 3S5LG 2VUOA 5CFHA 1T89A 4JFEE 1O7VA 1MCHA 2Z92B 2EIZB 5EO1B 5DEGB 5HSFA 1JPFA 1A3RH 2GITB 5J6HB 1UEMA 4ZO7A 1J1OL 1Q9OB 1RZJL 1TENA 4GT7A 3EOTH 3RY6A 1IM9D 1D5MA 1I7ZB 5CEYA 4I2XA 4BA8A 1T4KB 2BDNL 4KMQA 2Z31B 3SOBH 1JGVH 3OKMA 3QCVL 3L7FB 4ONGH 1J5OL 4MMXC 5IVNA 2V2XB 4ODUA 2MMXA 4LLWA 3Q6FB 3EAKA 4KKLC 1FZKA 2DQJL 3GKWL 1RIHH 3QPXH 4XMKH 5JXAH 1T7YA 3UC0H 3VXRE 4D0BB 4YE4H 1TQBC 4KROD 1P5VA 1OAYL 3BZEB 3RPIA 4WFED 5DR5H 3OMZA 5DK2A 1CLYH 4PRPD 4O2FA 4Q6IC 4X5LA 5IF0B 4DOHB 1WWWX 1G9NC 4Y7MA 4M1GH 3TYGL 2OP4L 3MBEC 2EDBA 4LP4A 2Y7QB 1UVQB 1FO0B 4BSWB 2YOCA 4PP1C 2CIKB 3PWJB 2GUOA 5D1XC 5BXFA 35C8L 4X7TB 32C2A 3N9GH 4RFNC 1GH7A 3FB6A 5BCAA 5AZEH 3SDCA 4ALAL 3WLBB 3VGFA 1H15A 4B50A 5HY9B 3SCMD 2VSCA 3FCTB 3VI4E 1CTNA 2W0LA 2N1KA 1F3DH 2EDQA 4P23B 3ZHDA 1ACYH 3QNZA 4HDIB 4XTRC 2F15A 3QEQA 4ELME 4NO2B 1A14L 4D9RD 3WO4B 3P2TA 4QRRA 3E8UL 1A21A 3GMLA 3QUYC 5GHWL 5DQJB 4MCZA 2W0FB 3CVIH 4LSTL 2AEQL 1UKQA 5GGVH 3L5IA 1S7QB 3HG1B 4Y2DC 4PJIE 4WEBL 3O3DA 4MAYD 4XBEL 3VH8B 1IM9A 4HC1L 4P9HH 5IHZA 5FYLD 2W0PA 3W82A 2ARJA 3LS4L 3SN6N 5MENE 5AWNH 4GKNB 4LCWD 4F3FA 3O81A 4JG1H 4OZGB 3C6LB 4GXVL 2AEWA 2ED9A 5GRUL 1TLKA 2BSTB 1JNJA 4HQQL 4C59B 4M1DH 4W4OC 3CXDL 4PRPA 5LBSL 5HHQA 3GO1H 4Z0BH 1BEYL 2BC4B 4P2QB 4RDQG 3AAZA 3VFSB 3P0VH 4HWBH 3K1DA 4P5TC 3W0WE 2X4RB 5HPMB 2RCSL 5LWYH 2B1AL 3C87A 1ZS8B 1NDMA 5EO9A 5MP6L 1I4FB 4DEPB 3HMXH 2NW3A 3P30H 4K3DH 4QOKB 1TJGH 2A6DA 2JELL 1GZQB 3UJIH 1J05A 4JFDD 3MBEB 1R5VB 3ARGC 2C7UA 4ETQB 3SKNA 1XGQB 3PWPB 4FTVD 5EOQL 2D4DA 2L7UA 2DJ4A 1A7PL 4DAGH 1S7XB 3SGEH 2K9UA 4H1LA 4ETYA 3WN5C 3U6RB 2I60L 4Z7VB 2A38A 2J88L 4MAYA 1HSAB 4BZ2L 1PSKH 4YQXL 2G5RA 2YPVL 1P7QB 3V5HB 4TULL 1GHFH 1BFTA 3QDAA 4LSQH 3ZKSD 5EZLA 3JXAA 4LCWA 4AMKH 5IFHL 3B2UD 4BYHA 3QUYB 4GOSA 3UJTH 4LDOB 3EYFA 2FBJL 2ENSA 5HDBF 2A74B 3MJ9H 4UQ3B 4NM4L 1N64H 4L9DA 1NFKA 2ZNXA 2W9DL 1JZ7A 3ESUF 4UT9H 3LN9A 5FECA 4ODSL 4R4BA 1YEDB 5IESL 3LSOB 2CLRB 5C0FB 4PJ7A 5F9AC 3VXPB 2DWEA 4KGJA 1FLRL 3R0MA 2B7DT 4PJEA 4Y19D 2FGWL 1K2DA 4F33A 1KOAA 5E6ID 3PDOA 1JYWA 5F7DB 1NGYB 5DJ6B 5DJAB 2R2HB 3CLEH 2J8UA 4HPOH 4XGZB 3QYCA 4MS8D 3F7QA 4XPTL 4F15C 1AH1A 1HXMA 5FF6A 1U8KA 1J1OH 1RZJH 1YEIL 4TNVK 4G80A 1MFEH 1H5BC 4HIEA 4ZAKB 4JFDA 2OR9L 1N0LA 1KJ2A 2BDNH 4P5TB 4QWWD 4YPJA 2BFVL 4FTVA 3QCVH 4LSSH 4UT7L 1X5YA 2P45B 4Z7UB 1AGFA 2HJLA 4GQ9H 4F7EB 3GKWH 1IGJA 2OTPA 2CXGA 5I30L 1OAYH 4QNPE 4HS6B 4FRWA 2BMKA 1KIPA 4M8VA 3O45B 3BPNB 5I8KH 4X0KB 3K8MA 2Q20A 2D7NA 2VE6B 3TYGH 2OP4H 1BWWA 3P4MB 1EUTA 2Q6WB 3F5WA 3MLTA 4CADA 1A7NL 1G7IB 5DJDA 3PNWA 5AYQA 1DQTA 4QRQA 4NQEE 3MLXL 4ALAH 3KYKL 3PJSA 5HYSA 3I6GA 3GM8A 3BKML 3MROB 4LGSB 5I74B 4G8EB 3ZYJA 4Y19A 5E6IA 3FQUB 3O4LD 5JNYB 4LLVB 3GMPA 3LPFA 1A14H 3E8UH 1YNTA 5IFJB 5GHWH 3WLWD 4PLKD 4ZUSB 4LSTH 1X6NA 2AEQH 4NFDA 5KS9F 1ZT7B 3MRGB 4XWOD 1IGYA 3OKEB 3VMPA 4WEBH 4XBEH 4QHNB 4HC1H 5HHPB 1FV1B 4HXAL 3FB7B 1D9KC 4PJHA 3F65A 4BH8B 4HWZA 4F15B 4R0LA 4GXVH 5FA4B 3WUWG 2Q3AA 3FT3B 5GRUH 3VRJA 4CVUA 4U1NB 5HPOA 2DWDB 4HQQH 4HFWA 3CXDH 5DXWA 5I1DA 1H5BB 3OXSA 3I02B 2EECA 5LBSH 4UAOC 4QHLB 2JJVA 4K23L 1R24B 5K93A 2OMNA 3U0WL 1MCRA 5SX4I 3CX2A 2A73A 4HWNA 2WANA 5FYKE 3H6JA 3VG0L 4XHJC 4JFOA 5HHOB 3B3IA 4CVXB 2LABA 3F7RA 1Z9SA 3PWLA 1LK2A 2B1AH 4FXGB 3LB6C 2ZNWA 5I16B 4YHLH 5JPMA 3BXNB 1U8JA 2EDLA 1MF2H 4ZFFA 2ZCHL 2JELH 5KANG 4AY0A 3J7HA 1MJ7L 2HRLA 5FO9A 4F9LA 5TE6L 5EOQH 1BZ7A 4ZDHB 3U4EB 1A7PH 3CXHJ 4M3JA 5EBMB 3G6JA 5DGQA 4LPYA 3HE7C 3HC4L 3VJ6A 2AGJL 5D7IA 3C2AL 2I60H 5AG9A 4PG2C 2J12B 1YY9D 2J88H 4LEXL 2ZOKB 2P24B 5E4IA 2IANB 4BZ2H 3AC0A 4OIBA 1M71B 2VR5A 2YPVH 4KK8C 3FQNB 3I75A 4TULH 1B2WH 4N90E 1OWRM 2V2TB 3UTTE 3ET9F 4JN2A 3AUVA 4L4VE 4OSUL 4MD4B 1SM3L 5IFHH 5B4MD 5E8NA 5C08D 5CILL 1XFPA 2FBJH 1IGTB 1DBJL 1I3UA 5KSAC 4O2CB 1MWAA 3TH4T 3C8KA 2W9DH 4ODSH 2BHUA 5BS0B 1L9MA 4PJGB 5AAWA 1FLRH 1D9KB 1XH3B 3IS1X 3MRNA 3SE9L 2FGWH 5EIIA 4KMLB 3FL7A 1B9ZA 4LQ1A 2NY3B 4J12A 1CZ8L 4GKZB 1BFOB 1F2QA 5FB8B 1MHEA 3TNNA 1A3LL 3NGBC 4XPTH 4KK9D 1ZLVH 1ZV5A 5C9JB 1PVHA 4MHHI 4YIQB 4ZOCA 4UAOB 3JUZA 1BWMA 3A6OA 4R7NA 1A1NB 2NYYD 3QWRD 4NRYA 1BMGA 4HH9A 4GLRI 2E6JA 2OR9H 3ROOA 3WE6B 1JMXA 1FBIL 2BFVH 1QSFB 2HVJA 4HKXA 4NOBA 4UT7H 3PP3K 2NY5L 2H6PB 3MO1B 1G9EA 3MLPA 4P0DA 3OTTA 3P4OB 5FGRA 4B53A 1DP0A 4XCNA 4YLQT 2BNRD 3ZLQC 5TGBB 2CPCA 2BRQA 1YNLL 5I66A 1VB9A 2D7OA 2Z91B 4NPYB 2ZSWB 1PEWA 1YJDL 3V5DB 1SY6L 3VXNB 1Z0NA 3EFDL 4NZJA 1KIQA 1R3IL 4WFGE 5ECJE 3T09A 5K9QG 3HE7B 4LL9A 5C08A 5DRNB 1A7NH 2GSGB 5IIEA 1HINL 4L8CB 3ARDB 4I9WE 5IHUL 4GRMB 3KYKH 3GMQB 3BKMH 3IF1B 3KNBB 4WUKL 3C60D 3MNVB 3P4LA 1IKFL 1CQKA 1LEIB 1TVHB 2NLJB 4GRWF 1JP5A 2R23A 3BSZL 4LHUD 2P46B 3W9DA 3NCMA 1CIDA 5GRXG 3FT2B 2A6JB 1N7ML 1KENL 1MIML 3IFOB 3QWRA 5D9SA 3UZEA 3O6FC 2AKRB 4LVOB 5EN2B 4M62L 4PV8A 1CD9B 4JVWA 1YEHH 3CCHB 4U0RC 4Q74A 1G84A 5DJZA 4EEEA 5D5ME 1J1PL 5AD0B 3KDMA 4TUJA 4GUPA 2WM0A 2BNRA 4N5ED 1Z9MA 3WFBL 1T66D 5IW6B 1EHAA 5GGTL 1ORSA 3MBXL 5ISZB 5EU6D 2GY7B 3U0WH 2V7NA 3AMLA 3VG0H 2VXQL 3MFFA 4RNRB 1QQDB 2R0ZL 3Q3GB 2ZUUA 5E6YA 4NCDA 5HI3D 3BPOB 4MXQD 4NNPL 4P2OB 2ZCLL 2EDNA 4JDVB 3QXAB 4RFEA 3WS3B 3KR3L 1ZT1A 3BEWA 1NGWB 4PRHE 3TBWB 5D2LB 2BY3A 5EA0L 1MJ7H 2VZUA 3IDIB 2YUWA 4PR5A 5TE6H 5CUSL 1WLHA 5LKNA 1UM4L 1G6RL 1RPQA 1BPVA 4LHUA 1INQA 3HC4H 2AGJH 2ESVB 4Z78B 3LEVL 5F1KC 1YYLL 1LEGA 4TSCH 1S7WA 4WENB 5J8OA 4F7MB 1EIBA 3NZ8A 1NAKL 5IB5B 5KBNC 2XTJC 1IQDB 1KNOB 2EIEA 4DW2L 2P5WB 4BUHA 3ZE0E 3IETA 5D1QC 3D39A 4OSUH 1HI6B 1SM3H 2VWEE 5HJ3B 4P99A 5CILH 1KB9K 1NFDB 1JNNL 3VGAC 5K9KB 3GEWB 3PWNA 3O6FB 2X2YA 1HNGA 1W0VB 3VFPA 4YDLB 5EU6A 4R4NC 3VXTB 3SE9H 3NCYS 3VXSA 1ZLUH 1WIPA 4CJ0A 2X4SA 3ZDYE 1CZ8H 1NEUA 4QKXB 3BYYA 3FQTA 1A3LH 5D6DC 4MQ7A 1QSZA 2QBWA 1EEQA 2WWMD 4GKSB 2YK1L 1KXVC 3OXRA 3DETC 2XZQL 5F1IB 4UNTA 1FL6B 4GW1B 4NQCB 4K2UL 5F96L 1FBIH 1W8NA 3NCEB 1DVFC 2YD9A 6FABL 5SWSB 2NY5H 4OZFA 2VL5A 4WHDA 3EYVB 4JN1L 1FLTX 1NSNL 3GSUB 1CVRA 4LEOA 2E6PA 3MRPA 2WSKA 3DRQB 1YNLH 1CDCA 1GAFL 4U1MA 1QYGL 3C5ZB 1K4CB 1G0DA 3QR2A 1SY6H 3EFDH 3EDKA 4K3EL 1R3IH 3MODL 2ADGB 5IGXL 1HHHB 2XTLA 5KS9A 4LFHD 3ARBA 2VLJD 4Z7QE 1GC1L 3V9FA 3PWVA 1HINH 5IB1A 3IRZA 5C0EA 2QKIA 5IB4A 4GG6B 4J4PD 4NQXB 5FYKU 3DO7A 3CUPB 3WFHB 5IHUH 1BD2D 3TCXA 5C71A 5CCKH 1B0RA 4WUKH 1OHQA 5HGAA 1BQHG 1SMAA 2C3HA 4WFFE 5D1QB 3ZHLA 3KPSB 2YPKB 2O5ZH 1IKFH 4UBDC 3OHXB 3O8XB 3AMKA 2FYYB 3DRTB 4HCRL 3B6SA 4NQDE 4LNVA 3Q1SL 1I9JL 4EKXA 3RL2B 5GS0C 1HKFA 3BSZH 4PJ9C 1QBML 2CGRL 1OGAA 1UYWL 2G5BB 1S9YB 3R1GL 5BJTB 5IBLD 1B0GB 1N7MH 3OV6A 1MIMH 4JDZA 2VXVL 3IRPX 3ZO0A 1RSFA 5GSVA 1K5NA 1F42A 3RVWD 3IYLW 4NWTL 4LCCC 5JHDE 1JZ8A 2EKSA 5F1SA 3L5WA 3WV0A 2WNGA 4PRBB 1MPAL 3I2CL 1J1PH 5T3XL 3TO4D 2H32A 2LE9A 3X13B 1G6RB 1XGTB 3WFBH 4ODHL 1IC5L 4NZRH 1CDUA 1A1MB 4HIHA 4BQCA 5EOCL 5GGTH 2GTWB 3L3JA 4V1DB 4BK4A 3THMH 4OLWL 1QR1B 4UUJA 1DVFB 1XZ0B 3EDFA 3QDJE 1U91A 2VLJA 1NLDL 4HK0A 1DN0A 2VXQH 4XP4L 3R06A 4LPTA 2R0ZH 2CRMA 3OR6B 4JPVL 3I50L 4Z5RA 3K4AA 5H94B 4MNQD 4DKDC 4NNPH 4J4PA 2ZCLH 4KTYA 3WFDL 5CJXA 1U8OB 4YDIH 3BDBA 4POYA 3KR3H 5FO7A 1R5WB 3N85L 4OCWL 3KLHD 4NT6A 4HGKC 4MJ5A 3RWIA 5EA0H 1WJ3A 2W9LA 4G9FE 1XF3A 3BUTA 5T1KD 3RVVC 3RBGA 1G6RH 3GSRB 5LG1A 4JANA 2VH5L 4L3AA 1BFSA 1GOHA 4NQVB 4CU7A 3LEVH 1YYLH 5HYJD 4FG6D 3IXTB 4E5XB 4LAQL 1I7UA 3TBTA 4PJIB 1A6TB 1V05A 2ATPA 4U6YB 2WBJC 3O6LL 1NAKH 1OQOA 2D9QB 1EHNA 4DW2H 4JKKA 3FTGA 2P8MA 4JVPA 4LLUA 4XP6L 1SJEB 1AXSB 1YDPB 2ZUQC 3QO1A 4QRUA 3TO4A 4HGMA 4L29A 3TYFA 1JNNH 4NHCL 5C1MB 2OQJA 3T2QA 3V6FB 1LO3L 4LF3B 5K9OA 4ZO6A 4PJ5E 2XWTB 4LCCB 5T5NG 1YC8A 3QA3B 1XCQB 3RWHB 4ISVB 1AXTL 5EUKA 3RI5F 1I3RA 2UYLA 5A3IC 5JA9A 2V5TA 2XWJB 5GGRY 4YUEL 5GS1A 4Q58C 5LAXA 4PBWD 2YK1H 3FKUS 5ID0A 1JI1A 1T20B 2JK5A 3HMWL 3VFRA 5CBAA 4OFKA 5ACZB 1Z5LB 4K2UH 5FHBL 3RWJA 3OB0H 5F96H 1OB1B 5T1KA 4CJ1A 3EO0B 5KVEL 4MMZC 3ARYA 1UKTA 3QNYA 1WZLA 4JN1H 4JFFB 1NSNH 1J0KA 1PX4A 1X5GA 4O2EA 1AGBB 1CN4A 1FAIL 4KRLB 2NY6C 2WP3T 43C9A 1R3HA 5IMMB 5IJKC 1GAFH 3JVGA 4EN3B 3LKRB 5JW5B 4K3EH 5SX5K 3QUZA 3IXAA 2F74B 3MODH 3MC0A 5IGXH 3JWOC 2KZWA 4Y5YB 1GC1H 3BUYB 4ENEC 4N0YL 3ZTNL 4F2MA 4L4TA 3FN3A 2CLVA 4MDJA 5KSBE 1CTOA 4NRXB 2IH3B 4XB8A 1O0VA 1IAIH 5AUMA 3E1F1 1S9XB 2D31B 1C5DA 1H3GA 3Q1SH 1I9JH 1D6EA 2P49B 2VLLB 4KGLA 3GSWA 3NIFE 3QG7L 1QBMH 2ATKA 2CGRH 3P3YA 4Y0GA 1UYWH 1MH5B 2FX9L 3WXVH 3O2DL 4HKBA 3EHBC 1F3JA 1E4XI 1S8DB 2VXVH 2XXCB 4RMVA 4EDWL 2KKQA 3NFPA 3PABA 4Z77A 2B4CC 3WD5L 1FJ1A 4P23D 3CDGA 1CE1L 3VWKC 4NWTH 3ULVD 4M7ZC 1ZT4B 4H88L 1FL5A 4R26L 1MPAH 4PLJC 4XCEA 5T3XH 4WW2B 4PJDF 1ADQL 1MCWM 1Y18A 1JBJA 1PX3A 5TDPA 5L2KD 1BBJB 4MJID 3REVA 2XZAL 4WHYH 3DYMA 2EDKA 4ODHH 2Q8AL 1IC5H 5F7UA 1XF1A 1DANT 5EOCH 1AC0A 2HLFD 1I7RA 4P49A 1MUJB 1JPGB 4OLWH 2F54D 3DVIA 5TDOB 2MPAL 3ZKQD 5ALBL 2V5RA 3WEXA 1NLDH 2H3NB 2NNAB 4XP4H 4QHUB 4JPVH 3I50H 4G3YL 3H9SB 4OCRL 1CG9A 5CJ8A 4YHML 3WFDH 4OFVA 4ZYKA 5EH1A 5IMOA 3NCBB 1G7JA 4P2QD 1M7IA 3N85H 5EO0B 4CDGC 5BMFL 4IOFC 1VCAA 4KKLD 1UJ3A 4BZ1L 2H8PA 5E5UB 3VGEA 1FNAA 2VH5H 4OJFL 2IAMC 4GXUM 2J8HA 3O9WC 2H26A 3E6HB 3OKOA 4LCYB 1CGWA 3S36L 3VD7A 4LAQH 5I1JL 3LEYL 3CXHK 4HUVB 2RGSA 3O6LH 1KLUA 3MBED 3SKUD 2CDEB 1DUZA 1TJIL 3TGXA 4XP6H 4PP1D 2XPGA 1LO5B 1FFRA 4X6BA 2HFFB 1DEEB 5D1XD 4PGBB 5L2KA 5DT1L 5FM5M 5CMAA 4MJIA 2BVOB 4NHCH 1B3JA 1WAAF 4LDEB 1LO3H 3HR6A 5E8OB 5I17B 1BX2A 4NCC2 4L3CB 4PGDB 4WNQA 1RI8A 1FYHB 1QOKA 2F54A 4XTRD 5JLZB 2DQDL 3DGGB 4M8QB 3QI9B 4DZBA 1EEUA 4XPGL 4DUWA 1AXTH 4JFQA 4LLYA 3QUYD 2A2QT 3MNWB 1XEDA 4Q2ZB 1HHKA 4C83A 1AD9A 4PJBA 1RJZB 4Y2DD 5C09E 4YUEH 5B22A 4H0GA 1KG0B 2GJJA 5SWZB 3UZQA 1JYNA 4JFYA 1JGUL 3QAZC 3HMWH 2R29L 1K8DB 4Q7DA 4NN7C 1EGJA 3WIIL 4K3HA 5B3JF 5FHBH 5ANMA 3C08L 2WUBL 3B5TA 2OJEB 3MRDA 4JRYD 2EE2A 5KVEH 5HTSA 4OCYL 5J13B 1S9KC 3PQYA 4S1SH 1V7NH 2H45A 1J0IA 4Q6IA 4BKLA 4P9HC 1U41A 1FAIH 1IZKA 2ARWA 3L9RA 4M7LL 1OP3K 4I0PB 2ITCB 3EIFA 4X6CB 3PHSA 1I1YB 4P5TD 2Q8BL 1UQSA 2X4NA 5A16A 3UTTB 4P5MB 4JY6B 4KI5F 2BOBA 5D1XA 3STZB 2Q7YA 1FNHA 5KVFH 2UZIL 3QHTC 3V6OE 1MFBL 1S3KL 1NGZB 4CL7A 4N0YH 3ZTNH 3TCLA 2AJZA 5FK9B 2X7LA 4MJ2A 4OD2B 1F11B 2HAZA 5BW7A 3ARGD 4JFPA 2WLYA 3V0WL 4IHOA 1RZKC 3FRUB 1IKNA 3QQ3B 1ULVA 4ZQKB 4DGYL 2CDFB 5L6YL 1PYWA 1UWXH 4ZS7L 3BFOA 4GXUN 3KPLB 5I1AB 2DQIL 2NX5B 4IMLB 4FQXB 4I3GA 1T2JA 4Y2DA 4LRNL 2A83A 3MRFA 4LSVL 4U1IA 4PJ8C 3QG7H 4I4WA 4B5EA 2FX9H 3HR5B 1BIHA 3O2DH 3WKNA 4HBQA 3L3DA 1OW0C 4EJ1C 1JHKL 3MRIA 4EDWH 3WD5H 3VGHA 4UT6L 2FZ3B 1D5IL 1CE1H 4F37F 3IU3B 3BIKB 4JRYA 4NZDA 4ZPTA 4R7DA 3PF2A 4R26H 5F88B 3KPRA 1RQ5A 4U1JB 1ADQH 1KYOK 4RGMC 4RZCA 2XZAH 3QUKB 2Q8AH 1A8JH 3WSQL 5IMLB 3F7VA 5FCSH 4NN7B 4Y4KC 1GPOL 3DIFB 3GSQA 2YD5A 3FO1B 4Y4HD 1WWBX 2MPAH 5ALBH 3LKOB 3O11A 2ZWLT 1SJHA 1X5JA 4OCRH 1U8PB 4ZTPL 4YHMH 5KAQF 1BJMA 3MYZA 2CIIB 4S0TD 3ARGA 4X6DA 1FZJA 1PKQE 3NAAL 3OBAA 3W9EB 4YHZL 2P8LA 1DSFL 2FWOB 2VC2H 4X7SL 4H20L 4Z0XA 5BMFH 2XXMB 5DQ9A 1NL0L 3WN5A 4WY7L 4BZ1H 2ZKHL 5ITFA 1JWMB 2VWEC 2X4UA 1RUPH 3GBNH 4W4NA 3GSOB 4OJFH 1KLGB 4NO0D 3EO9L 3T0DA 1XGRB 2UVEA 3S36H 2VDLL 2PCPA 4PRDA 3MOBL 3AY4C 4S10A 1CGYA 3GSNB 2FO4A 1TJIH 4Z76B 3G08B 3S37L 3TH3T 3ELAT 5D5MB 5F3HB 4AT6A 3IJHB 5BZWA 3QJHB 1XGPB 1WT5C 5DT1H 3DARA 2DL9A 5FA3A 4LSRL 4NZTL 3DUUB 2IAND 1DTUA 3UTSD 5A2LH 3WHXA 2QSVA 2JJSA 1NCUA 1Z9OA 3IVKA 5C0AD 2DQDH 5I1LA 2EE3A 4Y4HA 1BREA 1EO7A 4XPGH 3LRSA 3GJFA 4G6AC 4KI1A 1LE9B 3S98A 2AJ3B 3ARPA 5C0DA 3RHWF 1QRNB 1OM3L 4Y4KB 4HSQA 5BS0D 4XXCA 2UZXB 4CN1A 1D9KD 1JGUH 3LV3B 2R29H 3WIIH 2NXYC 5D7LD 3C08H 4KU1A 5ENWB 2WUBH 5LGJA 3PGCA 4P46C 3BP7B 2RJMA 4OCYH 4NO0A 3VU2A 1I8MB 5E5MB 1L6ZA 5ACLA 1MAML 4ZUWA 3T77B 2EICA 3VXMA 1OAXL 4MLSA 1YMME 2HH0L 4XHJD 1UZ8B 1QSFD 4L3EB 5AYUL 3FO0L 4YC2B 5FKAB 4QXWA 1JV5B 3RWEA 3LB6D 1YEEL 2XI9A 4Z7NE 5E6ZA 2A6KB 3LN5A 4M43L 1S3KH 2WK2A 4E41D 5FOBB 3UTSA 3QEQE 1I9IL 4RQQA 3HUJB 4QRRE 3MRQA 2VOTA 5C0AA 5EBLB 5T3XE 2LU4A 5HVHC 3HKFA 4PJDA 4DGYH 5L6YH 2GK0A 4ZS7H 3EO1A 3VI4F 3HE7D 1Q9LB 2DQIH 4P4KA 3RGVB 5F8RC 3VE0A 3QDGB 4LRNH 4WW1A 4ELMF 3MRLA 4LSVH 2CSPA 3ABZA 4KK8D 1MQKL 2GT9A 1XCTB 4BSJA 3RKDC 5I1CL 1P6AB 3VFOA 5GSRB 1FNFA 4BSVA 1CICC 5IT2L 1JHKH 3VXQA 4ZG1A 3SGJC 4JO4L 5D7LA 4UT6H 4FXLA 4HBCL 1D5IH 3LQZB 2DIBA 3NA4A 4RGNB 5KSAD 3S7GA 4P2RD 5TQ0L 4QLRA 3W2DL 1W72L 3KPQB 5JW4Q 3ARZA 1CU4H 3SDDC 4KRMB 5FUOL 1MCPL 2P8PB 4RIRB 1A2YA 2BRRL 1I7TB 3OR7B 1EK3A 5DHVB 3DUSB 1GPOH 5BV7L 5DD3H 3H9HA 1RVFL 1KXTB 4JG0L 15C8L 1P69B 5DMKB 4I5BB 2Y6SC 5KSVB 3PDDA 2XKNA 5FYJL 4QF1A 2R8SL 1GGBL 4E41A 2P47B 3SY0B 3CVHA 2P5EE 4L8SA 4CNIB 4ZTPH 3KLAA 4KV5E 5C0BD 5ISZD 4RBPH 2LVCA 3NAAH 3L5HA 4YHZH 1DSFH 1A9EB 4JGJA 4X7SH 6CGTA 4H20H 3RDTA 1NL0H 3REWB 4WY7H 1WAAA 5EC1A 5IBUG 4PG2A 1NCDL 2ZKHH 5DSCA 3OB0K 4C56A 5IJVA 1RHHB 3DTXB 5I1HL 4KRPC 3RIFK 1F00I 1SYVB 3IDGA 4OZ4B 5KSUA 2LTQC 3EO9H 1HK6A 2VDLH 1HWGB 1CT8A 4LBEA 3MOBH 1W0YT 3T3PE 3FHAA 4FQQA 4WHYG 3QSKB 3WDIA 3PGFL 3VFTA 1CL7I 5JHDB 1ZHNB 3GMRA 5KSAA 3S37H 4P2RA 3NACL 5C0CE 5C0JA 4ZSOB 3ARUA 3SE3C 4UDUA 4M4PA 1Y0LB 5D6CB 2WIIA 1ZA6B 2ID5A 4LSRH 4NZTH 4F7TB 2D4FA 2AK4A 1HHJA 3VRIA 4CN4A 1CICB 3DNKA 2IBZY 2P5WD 4RAVA 5EZIL 1QLFB 3CFDA 5IQ9B 4C58B 2CR3A 3IDYB 1IE5A 3MTRA 3EDJA 3CNKA 2BNQD 3UP1A 1P7KB 3QDJB 2CRYA 5GGQL 2GTZA 4XMLL 3PL6B 3T4AB 4X4MA 3RWCA 4CUCA 4JM4L 3O6FD 2DQFB 3NA9L 1OM3H 4I3RL 1WBYA 5C0BA 1LILA 2VXUL 3KPNB 5F9WC 2GJZB 1JNHB 2C3VB 5E94B 4XMPL 2H1PL 4OF8A 4NO5B 2PXYB 4JKPL 4Z7WB 3QWQB 3K46A 4BELD 1VPOL 2R2EB 4WHCA 1TFHA 4PYGA 3TPUB 4Q9RL 2PW2B 5E1HB 2VZ1A 1UEYA 2GAZA 2X1QA 2Y9RT 4FFZH 4ZXBC 2OTWB 2WBKA 3BP6A 4MGXA 2D2OA 4OUUA 2QQNL 1MAMH 4MD0B 1IEHA 3AROA 1DN2A 1OGTB 1OAXH 2HH0H 2Y36L 2BOCB 5AYUH 3FO0H 3JV4A 3CFCH 3CSYB 2B5IC 1PG7X 3FQWA 3B9DA 4WEMB 1WC7A 2CUHA 3S4SA 5EPMB 2LTQB 1QFPA 3BPCB 1I9IH 3D3VA 1X9QA 1WBXA 1UFUA 3IDUA 5CJBA 3MRBB 4JY4B 2PF6A 3DVNB 2HJKA 1AR2A 3QFDB 5DZLA 1SEBA 4JFXA 4HT1L 2FRGP 2BNQA 5BV7B 4J8RA 2GCYA 2EDWA 1A5FL 1UCTA 3M1BB 3S5LA 1MHPL 1LWRA 3SKMA 1BVLB 4UTBL 4EIGB 3DV4A 2E7LC 4ONHA 1W0WA 1MQKH 4GW5B 2XTJD 5CP3H 1KB5A 3GMMB 4N0RA 2EYRA 5I1CH 2B2XL 1X7QA 3DBXB 5D1QD 1FVDB 3KPSD 5IT2H 1NC4D 2V7HA 3BESR 5F8QC 4JO4H 4HBCH 2HFEA 5MERA 2Z35A 3LQAH 1PZ5B 1R0AL 5TQ0H 1CF8L 1K3IA 4JFED 1W72H 4UIKL 1IC4L 5DTFA 5E9DA 5LXGL 1MCPH 4EQ2A 4NRZA 4R4ND 3NCJL 5CIPH 3WFZA 1ZVSB 2W59A 5BV7H 4HIJB 5GGSY 2FJHA 1VEMA 4JG0H 4U1KB 15C8H 3MR9A 3H2WA 3WJJA 2CKBL 3MZGB 3RWDA 4Y5XC 3D6GA 3VXRD 1EX0A 5FYJH 2R8SH 1GGBH 5J9PA 1M05A 1MCLA 3DETD 2OK0L 3IDMB 2J5LB 3L3OB 5E8PA 3O41A 2Z8SA 5KSBB 5EU7E 3MA7A 3ALPA 1DVFD 4NBZB 2B5IB 1V7ML 5HYSG 2NMSA 4MZ2A 1XIWA 1NCDH 1MCJA 2IWGA 4PREA 5I1HH 2ICEB 2A6IA 2EDXA 4TVPE 3M07A 4CMMB 3QPQD 5EBWA 4DN3L 4YFEA 3MCKB 3LKNA 2Z4QB 4QCIA 5JHLL 2E7HA 4MSWA 4N9GA 5DQDL 1NC4A 1P1ZB 1JHLL 4G8IB 3MOQA 1U58B 2UUDH 4APQC 1SYSB 2XWBB 4EI5C 3PGFH 3TN0B 5C0IB 5IKCB 1IGML 1JZ4A 2HG5B 2VDNH 4PJCE 4EUPH 3NACH 1MHHA 4JFEA 4ZTOL 3N1GC 3TM6A 1QUNA 3EW3B 2DLTA 4D94A 3D87B 4Y5VC 2Q1EA 4MJ6B 1RJCA 3FFCE 4UBDD 1PG7W 3PV7A 3V6ZB 5DWUL 2UVFA 4HF5L 5IM7A 5MEND 5D6DA 3V7MA 1JHTB 5GS0D 4M48L 4F7CA 2EYTB 3OGCB 3BISA 4PJ9D 5GGQH 3VXRA 4AH2B 1RJLB 1E4JA 5C8JA 4XMLH 3UTQB 3TZVA 2CD0A 4JM4H 1C08B 3NA9H 4I3RH 5DHXB 5DD6B 4QYOA 2VXUH 1AO7B 1RHFA 4XMPH 2H1PH 1Q8MA 4JKPH 4EXKA 3W0WD 1VPOH 1H3PL 4Y5XB 1KJ3L 1NUFA 4Q9RH 2BVQA 4LQFL 2AV7B 2DKMA 2EEAA 1CXEA 3CDFA 3V6OC 1OTTC 3U83A 2RBLA 3QUMB 2QQNH 4ELKA 4NN5B 3QXVA 3SBWC 1FAKT 2HTLC 3ULUL 1OF2B 4ELMA 1A47A 4AM0A 3QNXA 1A4KA 4LLQA 4HUUA 4X5WA 5L8JB 4WGVB 4YFLI 3OKDA 3G5XB 3BD3A 1UJTA 5H35B 5MENA 1E6OL 4HT1H 3NCYP 3RVVD 1IM3B 4XBGB 4TYUA 1NDGA 4PJ9A 1HHGB 1QFWL 1A5FH 1ZXQA 4I18C 2VUYA 2NY4B 2CKBB 3U36A 1MHPH 4I13B 1OSZA 5C09B 5DUPH 3OKLA 2WBJD 3ZKXC 2RIKA 2UWEE 1IL1B 5E7BA 4YR6B 4K55A 3EOAB 2B2XH 3KPMA 1HDMB 4I8DA 2SEBA 1YECL 1AJ7L 3I3BA 3RA7L 1N0XL 3DURB 1MREL 3VFUB 3W0WA 5IB3B 2PUQT 4NFCA 5DD0L 1BZ9B 4QO1A 3U0PA 1T0MB 4YNYA 1R0AH 1FNGB 4G8GB 1CFTB 1CF8H 4B41A 4UIKH 4MNGA 1IC4H 4UDTB 4NKMA 5LXGH 4JM2B 5CEZL 1FNSL 3CLFL 1FNEB 3NCJH 3MV9E 3MV11 4OZGF 3QO0A 5SWQA 4A6YL 4U7KA 4WV1C 1DQDL 1U8HB 1PAMA 3S8WA 4DZ8B 2CKBH 2X4OB 5A3ID 5L2JA 1ONQB 2BSRB 4FMFA 1J12A 3WKML 3AU1A 1F90L 1F6AA 1U95B 4N68A 2OK0H 5DRXA 2E7CA 5IVXF 4R8WL 4YHYB 4NQTA 2G2RA 3DXAB 1FSKC 4YGVA 1JGEA 2QADC 3IU4L 2G60L 3SDXE 5H37G 3VRLF 4ZUVA 5T1MB 1U8NA 2IQAA 1YN6A 3CFIC 2ADIB 1MLCB 3UPRB 1GGUA 4D0CA 5HGGS 5HGDA 4X7EC 2I9TB 4HS8L 2WBJA 3D39E 2NY6D 4FN0A 3MJ7A 4HWEL 3O2VL 1G7MA 4NQED 4DN3H 2DTSA 2FEEL 1UXWB 3SKOA 3KJ4B 4GG8B 1JRHL 1KCUL 1KSRA 5DQDH 1RJYA 5ID1A 3BKYL 3JBG7 1JHLH 1U93B 3MREA 1XR9B 1NMCC 2VL4A 4M00A 1AR1C 4MCYA 4I18B 1QVOA 1IGMH 4ENED 2EYSA 4ZTOH 2EKJA 3WUWA 2O5XL 3MUY1 3VXSE 3ZKXB 4XC3H 2Y23A 4NC1E 3MGOB 2IG2L 5FDYA 4EDXB 3QULA 1JE6A 1NEZB 3CMOL 3F6LA 3L3GB 2J3SA 5HHNA 1JMZA 3IKKA 1UH3A 1FC2D 3L3KB 5EWIH 5DWUH 2AJXL 2IFGA 2O61A 2WMPA 3O3BB 4ODTH 4P2YA 2MKLC 3BMWA 2XN9E 4M48H 2P1YA 5AEAA 3BVNA 3KPPB 4QEGA 3CPLB 3ZDYF 3E3QE 3WL9B 3EHBD 3TBSB 5HGBB 3KAAA 2CH8A 1KTKE 4F7PB 3VWKD 5J1AB 1CFNB 4WV1B 5ICYB 4PLJD 1Q1JL 4AEEA 8FABB 1AGCB 5FYKD 5TPWL 1H3PH 1TVBB 3HB3C 4IMKA 1KJ3H 3UYOD 5DK0A 1U8LB 4LQFH 3CAFA 2LU7A 1MLBB 3M45A 4NQEA 1F4WH 2IBGA 5IJKA 2FX8H 4MAUH 1XGYL 3LCYA 4LVNC 2VITA 3SO3C 4NUGL 5DLML 4HG4J 2AXFB 2QQQA 4X80L 4HV8B 3ULUH 3G5YB 4EI6A 5C0GA 1OQXA 2FEDC 1HILA 5F3BB 4LU5L 2GFBA 1CFSA 5IOPB 2C9AA 1I9RL 3FFDB 4UQ2A 4S2SA 5BZDB 2DQHL 1SVCP 5H8DA 4POZC 5GS2H 1NMCB 4N90D 3FQRA 3H7BA 4IOFD 4O58L 3UTTD 1OGAE 1BM3L 1E6OH 3RNQA 4L4VD 2HP4A 4KKBC 5FYLL 2CRZA 1JPFB 1Q72L 3HZVA 3EJJX 1R3KA 2AV1A 2IMNA 2OX5A 3WNKA 1D5MB 1MVUA 2IAMD 3QXDA 4LRIC 5TFSL 3O9WD 5CEYB 2EC8A 4I2XB 4N0FA 3OKMB 4GW4A 2E9WA 4ODUB 5GRZA 1FN4A 4LLWB 2CO6B 3VWKA 2NZ9C 1FZKB 3HPJA 5C3LD 1RIVL 1TTGA 1YECH 2GYSA 5FYJE 1AJ7H 3RA7H 2IALA 1N0XH 3RPIB 1QHOA 1V5JA 5DD0H 2F58L 5DK2B 2C3WA 1RAMA 4O2FB 4JHBA 1FE8L 3LY6A 3S35X 1CQYA 1UWGL 3ES6A 5GZOC 2WINA 3HS0A 2DM2A 5CEZH 1FNSH 3PXJA 3CLFH 4J3OC 1QLEH 4PPTA 5CAYB 1URLA 3QEUA 2GUOB 2DI9A 5BXFB 3SQBA 32C2B 1TETL 4A6YH 1DQDH 3FB6B 1OL0A 3SDCB 3F58L 4JEGB 1H15B 3EZ8A 4R2GC 5FUCE 3W5NA 3B5HA 1ZHLA 4WWKC 3WKMH 1U92A 2VISA 1F90H 3QNZB 1DBKH 5HYQA 1HN1A 3QEQB 5F7WC 4R8WH 2X05A 5DC4B 3WS6C 4QRRB 3GMLB 5L88L 1KC5L 2GSIA 4IRSA 4L4VA 2G60H 4LPXA 4MCZB 3S96B 4WFGD 5J12C 3KLDA 3O3DB 1IM9B 2IAMA 4P3WA 5FDWA 3O9WA 1I1AC 5IHZB 5DRWA 4PG9A 2KPNA 4BM7A 2ARJB 2APVA 1CLZH 2PETA 4HS8H 3VCLA 4I9WD 5IW1A 3O2VH 4F3FB 4NKIL 4YHIA 2XZZA 4CDHA 3NIDE 4EOWL 2NR6C 1JRHH 3U0TA 1KCUH 4OKVA 1MFAL 3T04D 5FAAA 4HHAA 1LP9E 1V3MA 1K6QL 4PRPB 5HHQB 3I3DA 5HI5C 1A4JA 5IWLC 2F8XC 3AAZB 2O5XH 2HFGL 2VXSH 7CGTA 4O02L 4D9QE 2IG2H 3T0EE 4NBXB 3HLAA 2FSEA 1NDMB 3BPLB 1KGCE 5EO9B 2AJXH 2GITA 1IGCL 5D7KE 4HLJA 3QH3A 2N56A 2NW3B 2V17L 2XT1B 1V3KA 3TBYA 4PJ8D 4E0RA 1NGXA 4ERSL 2A6DB 3ZDZE 5EFIA 1J05B 2EZ0C 4PJGF 4WEUD 2J6EA 2C7UB 5IG7A 3SKNB 1MJUL 4YDKL 1JF1A 5JORA 1N59A 4OCSL 5E95B 3TPKA 5M94B 5EUOE 4Q97A 3GHBL 4H1LB 5DEFA 4FZEL 4UI2A 1Q1JH 5CGTA 4MAYB 2ERJC 4R2GB 1H0DA 5TPWH 1OARL 3GNML 4GRWE 4JAMA 1T5XA 5E99H 3PXHA 5EZLB 2Y1VA 2Y7QA 4BSWA 3MLYL 2X9XA 4LCWB 4Y4KD 4EUPG 3KXFE 2E9JA 3RUGE 3EYFB 4PRHD 2JKXA 2OTUA 3RIAK 1Y6MR 2DQTH 4NUGH 4J3XA 3LQMA 5DLMH 4GFTB 3QFJE 3TVMC 1DLHA 4L4TE 5FECB 4R4BB 4PJ7B 2DWEB 4LU5H 4PJEB 3SGKC 5B39G 1I9RH 4HWBA 1K2DB 4F33B 1C12A 3PDOB 2X1XR 3ARFC 2DQHH 3SGEI 3V4PL 4MQSB 2O93L 2J8UB 5IB2A 3EFFA 4LP5A 3UYPA 1IEBA 1EEZB 3QZWA 4O58H 3DYPA 4TTDC 1HXMB 1RU9L 5FF6B 5GRVL 5FYLH 3HMXA 4S1RL 1U8KB 1Q72H 3FMGL 4PJ8A 4DKAA 2B8OT 4G80B 3BHBA 4HIEB 4JFDB 3I9GL 5TFSH 2RR3A 1JTOA 3HI1A 2WLZA 1OW0A 1KJ2B 4WU5A 4N0UE 3FONA 4KJQC 4FTVB 3OAZH 4FFWC 1QFHA 1TJHL 3NIFF 4Y1AA 3U1SH 1TQCB 1AGFB 2HJLB 4P2CG 1IGJB 3HCVA 4LNRA 1RIVH 4RRPG 1CDJA 3H3KA 4HAFA 2CK0L 2LV4A 3K81A 2BMKB 3OX8A 2F58H 1KIPB 4ODWB 3DMMA 4IEFB 5IVXA 1FE8H 3SJVA 1IRAY 4NNYA 5GJSL 1UWGH 1NFIA 2C1OA 1WTGT 4PRHA 1FIGL 3F5WB 4WTZA 3MLTB 1NUNB 1KPUA 4NNXA 1YA5A 2P7TA 4CADB 3MJ9A 4Q9CA 5DJDB 3PNWB 5EU7C 1PG7L 4QRQB 3F58H 4G6AD 4XWOC 3PJSB 5HYSB 3I6GB 4Z9KB 1PW3A 1SVZA 2P4AB 4Y19B 3LVEA 1BOGA 1JWUA 4UIMA 3STLA 5E6IB 4ZFOL 4OM0L 3PGDA 4JGMA 3GMPB 1JCKA 3JTTA 2NXYD 1TZGL 1QSEE 1YNTB 5L88H 1BQHA 4S1QL 1NMAL 2HLAA 5I0ZA 4P46D 1P7QA 1IGYB 4YK4C 3UTPE 1JFQH 1F4AA 4MXVE 1PY4A 1T5WA 1HH9A 3AY4A 4PJHB 1J9CT 5D2LF 4HWZB 2D9CA 1IAMA 2MQ3A 2V9RA 2FIRT 2R0KL 4NKIH 4R0LB 4E42A 2BERA 4EOWH 4WFFD 4HFWB 3U79A 1MFAH 1ZSDA 5B38A 1WT5A 5I1DB 4NQDD 3NPSB 3OXSB 2R1YA 4JPIA 1K6QH 1PQZA 3QIWC 1MCSA 2NY1C 1OAQH 2HFGH 2PN5A 4AEFA 4O02H 1DR9A 2K1MA 2A73B 1FL3A 1EAJA 1MRDL 4JFOB 4LGPB 3B3IB 3PWLB 1LK2B 3O6KL 1U3ZA 3VG9C 1IGCH 5JHDD 2YD8A 5MEQA 2ZZUT 4O9HL 1NBZA 5JPMB 5HYIA 2C26A 1U8JB 1VACA 2V17H 4ZFFB 5I76A 4ERSH 4K71C 4UNUA 5ANME 3RKDD 5D1ZA 4OI9A 5FO9B 1MJUH 1CICD 2BSED 1BZ7B 4YDKH 1A6VL 3G6JB 4OCSH 3S3PA 4O51A 1FYTE 3VJ6B 3GHBH 4GH7B 3PQYE 5D7IB 4K7PL 1EPFA 4FZEH 4P46A 1EBAA 1FFPA 2XV6B 4AG4L 5FM8A 1ETZA 1R3JA 3QDJD 3BEVA 4JVUA 3SDDD 1OARH 3GNMH 3I75B 3WFCL 1ZLWH 1WCBA 4JN2B 2AP2A 5FYJU 4KUZL 1KBGH 3MLYH 4AIXA 1NCAL 1FFQA 5HDOA 5JA8B 5E8NB 3HC3H 3CH1A 3IGAA 2Y6SD 1MWAB 4EQ3A 4YK4B 2PYEA 3C8KB 4NQDA 4LMQE 4XCFL 1MCCA 4G9FD 5HHME 2OL3L 3BGMA 4ZNEE 2DI8A 2OXHA 1K85A 2EH8L 3MRNB 5EIIB 4V2CB 4RWYL 4FHBD 3DHMA 4U6VH 2DQEH 2UZYB 3V4PH 1MJJA 1ORQA 3E2HB 5CINH 1MHEB 3TNNB 2FATL 3T8XA 1AKJD 2VDRL 5GGRA 4XPHL 1WIOA 5DVOA 3GRWA 2Y06L 5CWSA 1RU9H 1KUMA 1T1YA 4R7NB 2JTDA 3FMGH 3ZT7A 1QKZL 5CEXA 3FB7A 4KRPD 4NRYB 5CEZE 4HH9B 3FN0L 3BIBX 4FA8A 3I9GH 3ROOB 1IAOA 1IGIH 3HN3A 2HVJB 3GI8L 4HKXB 4PP2A 5FA4A 4NO3A 5GXBB 3KPRE 3PV6A 2MKWA 2YS4A 1VA9A 4PJ5D 4YHOL 1MCBA 3ZE2E 5L8LB 4XCNB 1OPGH 1C1EL 3WHE1 3SDDA 3MZTA 1R24A 2CK0H 1MRCL 5I66B 4XNYH 4XNXL 4JQIL 3K1KC 5GJSH 1KIQB 3GGWA 4R96A 3O4OB 4XXDA 5C08B 3MX0A 1IFHH 1FIGH 2BVUA 4NOFA 4I3SL 5IIEB 4GAYA 4G9FA 2IBBA 1X5LA 1E4KC 1MHCA 1A64A 1FH5L 1L9NA 3T3MF 1K3ZA 3NPZB 4BZYA 2BNUA 5DURD 3FJTA 3QUXC 5E24E 1BQUA 1AQKL 4ZDHA 3H7LA 4OM0H 5L0QB 2ENYA 1NCCL 2Z9TA 2MSPA 2R23B 1TZGH 1QNZH 3U7YH 3W9DB 2EDEA 4S1QH 3EJYC 3B9KA 4Y4FC 2VXTL 5D9SB 2QQKL 5E1AA 4JO1L 5GRYA 4JHZA 1HOCA 4ZXBD 2W65A 4PV8B 1KTRL 2I9LA 1KN2L 5KTEL 2DIJA 5HYEA 5DJZB 4HUXA 4JO3L 4NC1C 4TTGA 2PTUA 5DEZA 4PJ5A 2R0KH 1OP5K 3GUTA 3E0GA 5I9QC 1NBVL 4TUJB 4GUPB 3VW3L 2BNRB 5IR1A 3MGAA 1NGQH 3SE3A 1CCZA 1PGRB 1ORSB 3PIQA 3PP4L 5TH2A 3HFML 5CS7A 4M6OL 2V7NB 4XC1L 3E3QC 1YEGL 1MRDH 1MFDL 3MFFB 2LAGB 2DOCA 3C6SA 1BF8A 2ADJA 4D9LH 4MA7L 3O6KH 3RIFF 1A1NA 1UB6A 4O9HH 1U2HA 1CGXA 1LVEA 4RFEB 5B3NA 1ZT1B 3BEWB 2B1HL 2FNBA 1CFQA 4YX2L 1FRGL 2KQMA 4PJFE 1MRFL 5C2UB 1G9ML 4PIRF 4PYHA 4PR5B 1BQLL 1VERA 4XVJL 1CK0L 1A6VH 1KCSH 3LAFA 4GS7C 4CW1A 4LHUB 1INQB 3ARBC 5EC2A 4WFHE 5FEBA 4K7PH 4X9FA 1LEGB 1EO8L 43CAA 4AG4H 1S7WB 4YBHA 4ZXBA 3NZ8B 3VXME 1VGEL 3VXOA 3WFCH 3WHE0 2YWYA 1CFBA 1XMWA 3IETB 2R56L 3D39B 4KUZH 5DRNA 4W70A 5JDSA 1NCAH 4ORGA 1S7RA 1RZ8B 3HRZA 5BO1L 4QXUL 4KMTL 3VGBA 3NABL 5M7QA 2G75A 3LQAC 3F7PC 3AB0C 1XAUA 1WV7T 3PWNB 4XCFH 4YBQC 2OL3H 4TNWF 5EU6B 5C7XL 2EH8H 4W81A 4U6TA 5D8JH 4RWYH 3V52L 3VXSB 1ACZA 4DKFH 2GEEA 3MRRA 5I9QB 4IRJA 1A6UL 3FQTB 1CLCA 5CSGA 2FATH 1F3RB 1YY8A 2VDRH 2A6JA 2YD3A 3B9AA 4MQ7B 4DVBA 5FM5O 4FS0A 4XPHH 2ITDA 4Y16C 2Y06H 3OXRB 2E7LA 1DE4A 1QKZH 3T4YA 3BT2L 3FN0H 1XT5A 2OSLA 5T1LD 2YN5A 2X1PA 3GI8H 4JDTL 4APQD 4OZFB 1WEJH 2BJMH 3DV6A 3U7AA 4EI5D 2VL5B 1BJ8A 1C1EH 4LEOB 4RCAA 3MRPB 1MRCH 4OLUL 3T0BA 1IZJA 4U1MB 5LJYH 3M17A 5JR1L 5C09D 1M7DA 4JQIH 5FUCC 2XZCL 1ZWIA 2AJUL 2E5EA 2EO9A 3RP1A 2HN7A 2H41A 1EEYA 2DBLL 3T2NL 5KS9B 4JR9H 1RULL 3ARBB 5IEHA 5DA4A 2JLLA 2XOTA 1GGYA 4KKCD 4LK4A 4YPGA 3RI5K 4I3SH 3D85D 3PWVB 3P40A 5IB1B 2QKIB 5IB4B 4KTDL 3DO7B 1FH5H 1NUDA 4X99A 1HWHB 4NC0B 1B0RB 5HGAB 3FB8A 2G9HB 4LIQL 1RD6A 4POUB 4KKNA 3VFWA 3P77A 1AQKH 4WUUA 3B6SB 1KV3A 4O5LL 3MRHA 1WAAE 5BRZE 1NCCH 4JQVC 5ERWA 1VFUA 4C56E 4KV5F 4GKOA 2MHAA 5C0NC 1X6LA 1R3LA 1OGAB 2R9HC 3DI2B 1RIUH 2VXTH 5DDHA 4JDZB 2QQKH 4LOUC 3HRPA 4JO1H 2YXFA 5GSVB 1K5NB 5T1LA 1DJSA 1KN2H 1OTTD 2ZJSL 5KTEH 4NUJA 4HLZH 2WZPD 5TQ2L 2EKSB 3L5WB 3DX6A 4APQA 4JO3H 1AI1L 4EI5A 4TN9A 2OZ4A 1BECA 2I5YL 2H32B 2HTLD 3T0EC 1NBVH 2B0SH 3VW3H 4CU8A 2AK4E 4DVRL 3VFMA 3MV01 5F6HJ 4HIHB 3T3PF 1C7SA 5B3JE 4OZIE 1OLZA 4UTAL 2FIKA 3RRQA 3S35L 3L3JB 1KULA 4Y5VA 4KQ3L 3PP4H 4NDMA 4U05A 3HFMH 4UUJB 4M6OH 4XC1H 3LKPA 3TBVA 2NXZC 1U91B 2VLJB 1YEGH 1MFDH 4HK0B 1DN0B 4G8FA 5F72S 3R06B 3BP4A 5TE4H 3D85A 1VADA 1HIML 3G04A 4HIXL 4X4ME 1VFOA 4X4YA 4Z5RB 4MA8L 1U8QA 1CDHA 3L1OH 4MA7H 2D0FA 2OLDA 4NKDA 5F1IA 3CFEA 3WIHL 4KI5E 3MYJB 4GW1A 3KPTA 5FO7B 5ESAB 2B1HH 4YX2H 4NT6B 4RGOL 4PRIA 4QT5A 4MJ5B 1MRFH 3RWIB 4HULB 2BHZA 1X4XA 3X17A 1BQLH 5A1AA 1XF3B 5LVEA 3QUZC 1CK0H 4YAQA 3MLSL 3OAZK 4JANB 2KL6A 1YQVH 1N5YL 1E4XL 1EO8H 2R69L 5DRZA 4CAGA 1I7UB 3TBTB 3V6OA 2ATPB 3T1WA 1E28A 2VLKE 2DKUA 1VGEH 1ZTXL 2P8MB 4LLUB 3IDNA 3U4AA 2R56H 4QRUB 3QO1B 3TO4B 5E5RB 4JREC 3O0RL 4L29B 5BO1H 4QXUH 4KMTH 3TYFB 4OZHE 3NABH 2OQJB 1U8IA 3MRCA 5JTWA 3D3VE 5DS8A 4QHKJ 2JB6A 5K9OB 9CGTA 1FHGA 3K2MC 4YBLC 4CMHB 3QIBC 1FO0L 1S7SA 3HE6C 5I8OL 4X6CF 3V52H 2H2PC 1YN7A 3ROLA 5EUKB 3WO3B 2QADD 5FCUL 1A6UH 3OKYA 1I3RB 2UYLB 2XQBL 4TRPL 3CMGA 1JVKA 1J18A 4NBYB 3SDAA 3KJ6L 5GS1B 3PWUA 5LAXB 4LPCA 5FIEA 2XKUA 5ID0B 1H8SA 2VIRA 4MDIA 3ULVL 2JK5B 3EYOA 4NJ9L 3VFRB 5CBAB 4RMUA 3RWJB 2GQHA 4J3UA 5T1KB 1LD9A 4JDTH 5KOMC 3KYMA 1E27A 1G6RA 4ESKA 1VGKA 1AR1D 3V0VA 3QNYB 4PGJA 5E9DE 3V4UL 4X4XA 1SEQL 4O2EB 4M7LT 1EXUA 3F8UB 5I19H 43C9B 1KPVA 1OT2A 1R3HB 1KTDA 4OLUH 3RNKA 2IADA 4GRWB 4WCYL 4QY8A 2DLEA 1HSBA 2YSSA 1QP1A 5JR1H 2V2WA 2XZCH 1H3UA 1FC1A 2AJUH 4XNZB 5CD3A 3QUZB 3IXAB 4U0QB 5LCVL 4KHTL 1PKQA 2DBLH 3T2NH 5I8EA 1RULH 1YEJL 2DJSA 1ND0A 4J1UA 4OAWA 1S7UA 4F2MB 4L4TB 4MB5A 2CLVB 4KTDH 5HVGB 4MDJB 1QACA 1YZZA 4J3VA 3NCFB 1G7PA 3VMOA 4YXLL 2XFXA 4LIQH 3NFNA 3FQXA 1TPXC 1AP2A 5AUMB 3UPCA 3GSRA 1C5DB 4D0DA 4O5LH 3S4SG 1D6EB 1A6ZA 1VFAA 3GSWB 4K94H 1S9VA 1YMMD 1G9NL 5FXCH 3AFLA 2ATKB 2DLGA 2Y07L 3HAEH 4JZNA 4HKBB 1F3JB 5CSZA 3DX8A 4C54A 3SKJL 3NFPB 3PABB 4Z77B 1Q94A 5D2NA 1FJ1B 2ZJSH 3CDGB 2D7PA 5TQ2H 3QEQD 1G1CA 5MEOA 3ULSA 3VXUE 1CGSL 1FL5B 4QRRD 3QCTL 1AI1H 2V5YA 3MNZA 4XCEB 5BVJA 5T3XD 1Y18B 2I5YH 1RMFL 5TDPB 4X7FC 2FEDD 3REVB 3RX7A 3TIDA 3X12A 4WVRA 1DQMH 2QJDA 5ALCL 4DVRH 4OFIA 4XHQA 1INEL 4UTAH 2EDDA 3S35H 3QIUC 1IAII 1I7RB 4KQ3H 3LD8C 4PJCF 1CD0A 5KAQG 4POZD 2PTTA 3IAGC 3WEXB 1JZ6A 4KKBD 3U46A 4HIXH 1HIMH 3U7WH 1LE5B 2OBGA 1CG9B 4JGUA 2UY7A 2DAVA 4ZYKB 3WIHH 5HXMA 1S9WA 5IMOB 2H9GA 1G7JB 5J7CC 1M7IB 2HKFL 1OP9A 4IIQC 3C09B 1A0QL 2NZ9D 3HZMA 1UJ3B 4JKMA 2X70A 2H8PB 1EJ6A 4GAJL 5F7YC 1YMMA 4F37K 3MLSH 2NTFA 5JOEA 2H26B 4PD4K 3OKOB 1N5YH 1E4XH 2F5BL 2R69H 4LCIL 3VFGH 3RFZC 2BVEA 5BW7C 1KLUB 5GZOD 1DUZB 1ZTXH 2P5ED 1IKNC 2AQ1A 2EO1A 2XPGB 4OFDA 1S7VA 4HW6A 3KGRA 5L2KB 3O0RH 4U4BA 1M4KA 5CMAB 4MJIB 4UB0H 4KZDL 3BH8A 4R2GD 1BX2B 4WNQB 4WWKD 1HZHL 2YPLA 1GIGL 5T33L 2BHYA 2F54B 5D71L 1F02I 2X09A 4GMTL 1FO0H 4FOMA 2EDYA 2LU3A 4DZBB 4JFQB 3GJEA 4LLYB 5EDXA 1HHKB 3ZL4H 4C83B 5FCUH 1AD9B 4PJBB 2Z8WC 2XQBH 4TRPH 2IPUG 2JCCE 4LRIA 1TZHA 4XZUA 1HNFA 3KJ6H 1I1AD 1MI5A 3UCRA 5C0CD 3LD8B 4JFYB 3ULVH 3HUJF 4NJ9H 1GZPA 2EDTA 3FB5A 5ANMB 2KUTA 1F4HA 2NR6D 1UACH 3CSGA 1TQBB 3MRDB 5EU4A 4U7SA 3TNMA 5IBTL 4KQ4L 5K9JL 1CDBA 4FQ2L 2UWEF 4MNGE 3PQYB 3OKKA 4Q6IB 1WFOA 3V4UH 4BKLB 2R4RL 1SEQH 5HI5D 1BVKA 2EDJA 3L9RB 2DYPD 2ILLA 3TJHC 5C07E 4WCYH 1UQSB 2X4NB 4P5KA 2P5EA 5A16B 4XPBH 1EAPA 5F6IC 2BOBB 5D1XB 4BQ6A 5LCVH 4RFNB 2Q7YB 3H9SA 2AJVL 3IB4A 2BY1A 1YEJH 4WI5A 1DANU 3UTOA 1T2XA 1BBDL 1JNLL 1T3FA 1AHWC 1A3QA 3TCLB 1F58L 5HVFB 2AJZB 2X7LB 4WWKA 3ZTJH 5CGYC 2EZ0D 2GJ6A 4JFPB 4IHOB 4LSPL 3OGOE 3QEHA 3RHWK 4YXLH 4N0CC 4U6XA 5INCA 3WS6A 4XAKE 2QL1A 1PYWB 3KG5A 1MCNA 2R4SL 5DI8A 5HGHA 4Y2DB 2A83B 2IPUK 3MRFB 5E4EC 3E6HA 4U1IB 1J0YA 4FXKA 1VFBA 1G9NH 4I4WB 1I1AA 2Y07H 5C0CA 3SDXF 2X40A 3L3DB 3LH2L 1U9KA 3SKJH 2JJSC 3MRIB 4GO6B 2VDML 3BZFA 3KVQA 1J0HA 4OKDA 4AIZA 5LQBL 4Y4HC 4JRYB 3BGAA 1CGSH 4R7DB 4ZPTB 2ADFL 1NCNA 3QCTH 3TVMD 3KPRB 3RZCC 1A22B 1RMFH 2EDOA 3QHZL 4PB9L 4G5ZL 4RZCB 2V9TA 5IWLA 5ALCH 5I15L 3F7VB 1INEH 2DYPA 1T6VN 4UU9A 5IROA 3VGDA 5GGSA 3BGFC 3ISWA 4XXCC 3ARFD 4FQPA 4HXBL 3QDME 1J5OH 3GSQB 4QRSA 4KY1L 2LQRA 3O11B 2DQJH 1IARB 4HKJA 2NCMA 4TTDD 1SJHB 2CJUL 4K8RC 2PW1A 2AJSL 1EV2E 3VD4A 1O5DT 5MHSE 4WI6A 5F7KC 1K8DA 3ARGB 4L8DA 3C5SA 4X6DB 4QTIL 4PGZA 1FZJB 4KJQD 1UXSA 2P8LB 2FB4L 4FFWD 2DD8L 2HKFH 4U1LA 5FV1L 3QQ9C 1JTTA 4YFDB 4Z0XB 5DQ9B 1A0QH 3WN5B 4OUOA 4JFHE 1J1XL 4OGYL 4GAJH 4G7VL 35C8H 5ITFB 4JHWL 4JCMA 4FZ8L 4HWUA 2X4UB 3CFJA 2VZOA 3O2DA 1UGNA 4HKZA 2F5BH 4LCIH 1G1YA 2PCPB 4H26A 4PRDB 1P6FA 3GIVA 2NW2A 1OLLA 2FO4B 4ZUUA 2YD2A 3BI9X 3KWWA 2R15A 3GFUA 3TVMA 3ZT5A 4AT6B 5E4EB 4LSDA 5BZWB 2APFA 1ADQA 1TITA 1S78D 4P4KC 4KZDH 5FA3B 1BP3B 2BZDA 3LKSA 1F2XK 2VLRE 5DD1L 3SGKA 3WHXB 3MV7A 4LPVA 3BJLA 1NJ9A 1HZHH 2BVPA 3ARFA 1GIGH 5F97E 3LS4H 3IVKB 5T33H 1C5CL 5D71H 1OAZL 3FOMA 5I1LB 4GMTH 4TVPD 4JZJC 4Y4HB 4M61A 3LRSB 1T7VA 1MVFA 3GJFB 4RAUA 4M03A 4Y89A 1A9BA 3MACL 2JB5L 3GMNA 1A6PA 1TCRA 5E8EA 5C0DB 4RA0C 4ZS6C 4EXPX 1BAFL 1BEYH 2Y5EA 5FGSA 1T1ZA 3RIAF 1NBQA 1XF2A 5I8CA 1IC7L 1QRKA 2AXGA 3UO1L 5LGJB 2RCSH 3FFCD 1QLRA 3PGCB 3AS0A 5DHYA 5IBTH 4KQ4H 4QRTA 5K9JH 5MP6H 4FQ2H 2XYCA 4NO0B 2Q86A 4MWFA 1NC2D 4NQUA 3QIWD 1A7QL 2NY1D 2R4RH 3ILPA 4L8SC 3DVFA 4G6JL 4ZUWB 3VXMB 4LGRB 1CL7L 3HNTL 4N8VG 3EDDA 5IUSA 4HMCA 3P9WB 1NBYA 3RDTC 3RWEB 3MV8E 3TH2T 5DVNA 3IAQA 3LN5B 3VFVA 3VD3A 1BBDH 2F53A 3LKQA 3UTSB 5DF0A 4YQXH 4KZEL 1ZLSL 4RQQB 1F58H 2X42A 2ZUYA 3MRQB 4HUKB 5C0AB 3HZKA 4LSPH 3OAYH 4PJDB 4P57A 4X5XA 2EEBA 2GK0B 1DBAL 2EIBA 3EO1B 3V0AC 1REIA 2R4SH 2FO1A 3EOBA 4NM4H 4P4KB 3VE0B 1G7LA 4WW1B 3MRLB 1J8KA 5IESH 3DPBA 4KTEL 1U3HC 4PJCA 1RK0A 2GT9B 5E03A 1QA9A 4FNLL 3VFOB 3LH2H 5DJYA 4BSVB 3UTZA 2VDMH 5FGCB 3VXQB 1FP5A 2FDBP 5EZJA 4DGVL 5D7LB 3QG6A 5LQBH 2Y5TA 3FFCA 4JE4B 4XT1C 1M7XA 4JJ5A 2ADFH 5TJWK 4S0SD 1NANH 3L95A 5IVZA 3I6KA 1NC2A 2IEPA 3NIDF 3LEXA 3QHZH 3QIWA 3WXWL 4G5ZH 1EZVX 1YEIH 4G7YL 1A2YB 4J3WA 5JZ7C 2YD6A 5I15H 5T1DL 4P4RA 1K8IA 1B6UA 2IGFL 1LP9F 4KI5C 3H9HB 4U3CA 4DFIA 4HXBH 4A2LA 1KJMA 4KY1H 3OAUL 4OLVL 4QGTA 1XGUA 2XKNB 2CJUH 4QF1B 5I30H 1KLFA 4E41B 1AE6L 2QSTA 3CVHB 4L8SB 3EOYG 4NYLA 3KLAB 1Q9WA 3OZ9L 4QTIH 1B4JL 2FB4H 2DD8H 2DLIA 3HAEG 3BP5A 3V6BR 3ZDZF 3RDTB 4DOHE 5EC1B 1J1XH 4OGYH 5D70L 3MV9D 4G7VH 5DSCB 4C56B 5IJVB 4JHWH 4N5UA 4FZ8H 2LVEA 1F13A 5EUOF 3IDGB 5A2KH 3MLXH 4PUBL 2EDFA 5KSUB 1J10A 2YRZA 3INUL 3P73A 1CT8B 4LBEB 1UZ8A 4FQQB 4GBXA 5C3TA 4RMQA 3VFTB 3GMRB 5KSAB 3FN9A 2L0DA 1DBBL 4P2RB 5F7MC 2FLRT 5C0JB 4Q9QL 4XPAL 2J7LA 2YRPA 3D18A 3RUGF 2WIIB 1KCRL 1ZKAA 2AK4B 1HHJB 4MA1C 3VRIB 5DD1H 4IDJL 1KYOJ 3QUXD 3HI6L 4HXAH 1KJVA 3HG1E 4RAVB 1C5CH 2ZUWA 3CFDB 4FQ1L 4UV7L 2FH8A 3D39D 3VWJC 4DTGL 5ETUA 1E6JL 2UWEA 3NGBB 4E9LA 2DQCL 1OTSD 3TA3C 2GTZB 1PD6A 3EJYD 4Y4FD 3MACH 4ODVL 4QRPA 3RWCB 4OZGE 4ZD3L 2C5DC 1WBYB 5C0BB 3C8DA 3H0TA 1BAFH 4YO0A 4Y1AE 4K23H 3P9LA 1BOYA 1R5IA 3VXSD 5TF1L 4CRPA 1LEKB 1IC7H 3A6BL 4J3TA 3HC0A 3UO1H 3O6ML 3T65A 3MV9A 3QJFA 5IVXE 4G6FD 3WJJC 3BO8A 1G7HA 4H0HB 5GGUA 2GAZB 5T5FL 3SJVE 2YEZA 3BP6B 2W92A 4OUUB 2XN9D 4UOJA 1A7QH 3VRLE 5M95B 2ZCHH 4G6JH 5HDLA 4WHTA 4ONOA 1CL7H 4R3SA 2VDQL 3SPVA 4QOKE 1T6WA 3JV4B 3FQWB 1CLOL 4U6HA 1E4KA 4LKCA 3Q2CA 1JPSL 4GSDL 3SDXA 1P9MA 1WC7B 3C2AH 5I6XC 1XIWC 3PWPE 1DQJA 3S4SB 5KW9L 4WWID 4LEXH 5GGVY 1OTUC 2VNCA 4KZEH 1ZLSH 1N2RA 3D3VB 4WU7A 3QUXA 3DVGA 1WBXB 4LVHC 5EG6C 4K9EC 3PHQA 2HJKB 2IH1A 1SEBB 4JFXB 2QTEA 4AQ1B 2BNQB 1PY9A 1VESA 4J8RB 1DBAH 2GCYB 3ARBD 4FMKA 4HK3J 1DBJH 4Y4FA 4OQTL 3S5LB 4DN4L 1KTLA 1QFUL 3SKMB 4YHNA 3F6IA 3DV4B 4MA1B 1F5WA 2NY0C 1W0WB 4ONHB 4KTEH 2YUVA 4RMSA 4KXZI 1KB5B 3QZWG 4JQXC 3M8OL 4U0RB 2EYRB 3EGSA 3VFNA 3I6LE 1FVCA 1X7QB 2BXZA 2V7HB 4WGWB 4DGVH 3CGTA 2HFEB 4MXVF 3G5VA 5MERB 2Z35B 1CGUA 3DWTA 3L3HA 2HMIC 2HT4C 3CK0L 4YBQD 1OGAD 3CX5K 3N50A 4JB9L 5DTFB 3UPAA 1GRWA 5E9DB 2XN9A 2A9ML 3WXWH 2RFXA 3TZVC 1LO0L 4G7YH 4NRZB 4P3DA 5T1DH 4YXHL 1EUUA 2IGFH 5GS0L 3K74B 1WCQA 1P4IL 1E0OB 4TVSa 2FJHB 2YUXA 3RZWA 3ZTJG 5CP7A 4HMDA 3MR9B 5GS3A 4WDIB 3RWDB 3LZFL 3CZFA 4OLVH 4H25B 4QHMA 3MLVL 2JJTC 4Y16D 3P4NA 3IJYA 4DFHA 5FYJD 4Z7UE 5J9PB 1M05B 3H3BC 1AE6H 3KS0H 4WTZG 3KYAA 3QPQC 5E8PB 3O41B 4MX7A 4OBRA 4HS3A 4OCXL 1YJDH 3MA7B 1CXHA 1B4JH 4PV9A 3RWGA 2MTPA 2PTVA 3EYUL 2FLBT 2VZSA 3Q48A 3HZYA 2E7MA 1XIWB 5I6XB 1JYVA 5D70H 3ULUF 4PREB 2A6IB 2XTJB 4X9HA 4PUBH 5EBWB 5CP3A 3LKNB 4QCIB 3INUH 4MSWB 4N9GB 1KXQE 1NC4B 3EDEA 1YPZF 3GIZL 2PYEE 1EZVY 3VGAB 1DBBH 4JFEB 1MHHB 3X14A 1RUKL 3TC9A 1P2CA 5F9JA 4Q9QH 1W72A 4XPAH 2NY0B 1KENH 5AAMA 3CC5A 1KCRH 2QV2A 3U30C 4XPFL 4M62H 4IDJH 5CIPA 5CZKA 3HI6H 5B38G 1FIEA 1J11A 5IM7B 3C5JA 4FQ1H 4UV7H 4DTGH 4WI7A 4F7CB 2DQCH 5C0ND 5DJCA 4Y16A 3VXRB 2R9HD 5JO5A 1EDQA 3GSXA 5C8JB 3OKNA 1YMHA 2F9BT 4ODVH 3TZVB 1DUYA 4IJ3C 4M4RA 4LOUD 3BZDA 4ZD3H 3MBXH 5IK3A 1EFQA 1CXIA