1BLNB

Anti-p-glycoprotein fab mrk-16
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
218
Chain Sequence
EVILVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATISSGGGNTYYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYYCARYYRYEAWFASWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MONOCLONAL ANTIBODY MRK-16 (LIGHT CHAIN))
publication title Mode of binding of anti-P-glycoprotein antibody MRK-16 to its antigen. A crystallographic and molecular modeling study.
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 218
sequence length 218
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1blnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1blnB01
1I7RB 4PRHB 5EZLA 3ESUF 4L9LB 4DVBA 3TH3T 2JIXA 1MLCB 5DTFB 4ZTPH 4UI2A 3ZKQD 4DGIL 1FN4B 5HPMA 3ILQC 2AXFA 3O2VL 4K94C 5IK3B 4KQ4L 4DW2H 3QG7L 4XP5L 5DJDB 1GGYA 4YHLL 1FNFA 1UENA 4FQPA 1LK3H 5TF1L 3S6CA 3Q0HA 5JNYA 3DX9B 4Q6YA 3L5IA 5I74B 4HBCL 4KVNL 2FBOJ 2VLME 1MCFA 2HA1A 1HSBA 5EA0L 2B7DT 1F11B 4Y5YB 1BOYA 1IZKA 2VDLH 4JDTH 5KSAD 4HV8A 5FF6A 3REWA 3RIFF 3MLWL 2IQAB 3BQUD 4WENB 5F96L 4O5LH 2AJXH 1SVCP 3NCYS 3SGEH 3BJ91 1RVFH 2DKSA 4HUVA 3LCYA 4Y19A 3CZJA 5K9KA 1AQDA 4OLWL 4OCWL 3CXDL 3QDGB 3GSQB 5T5FH 5CP7B 3PWPE 2NY1B 1NKRA 3ARDA 2YPVH 3LIZL 4M8QA 5JOPD 1CICA 4WDIA 1X5XA 3OHXA 5BVJA 4JVPA 1DUZA 2I5YH 2K9UA 4LEOA 4R2GB 3DVNB 4MD0B 1NMBH 3TO4C 4WV1B 4ZFOA 2R0KH 3WBDA 4IRJD 1EHLL 4ODWA 1ZSDA 4PIRF 1JF1A 5FHBL 4KDTC 5F3HA 4JHZA 4ENED 1HHGA 1QRNA 2XOTA 4XP6L 1KOAA 5J56B 1AXSB 5D7SH 4NUJB 1OP9A 1AO7D 5KJRL 4PRPB 5I1GH 5GQBA 4K71C 3IAGC 1FG9C 2DLFL 1EZVY 5C70A 1HWGB 2CRIA 3BIKA 1XGPB 1BECA 1RIUL 4ZFGH 1EEUA 1I7RA 3NH7L 4PRHA 5GZOD 1DEDA 2C26A 4L9LA 1LO3H 4NQEB 5F7MC 1T6WA 3ARDC 3VXMA 1FL5A 4R26H 5FHAL 4I3RL 1SBBA 3MNZB 5IK3A 4AZ8A 4FMKA 3TZVD 3VXPB 5IFHL 3EHBD 3QI9B 3D25A 3EYQC 3DX9A 1J1XL 1V7NL 2GT9B 5DMJB 4ZSOE 4WTZG 5C0RH 1E4JA 1MJ8H 1F11A 4Y5YA 1RZGB 1MCOH 5B39B 3HZMA 1BJMA 3VWKB 4PJXB 4KJWD 1L0XA 1U8JB 4LMQI 3MLXH 1N0XL 3IDJA 4LCWB 2DQJL 4LSVH 2IG2H 2EDEA 4S1DD 3VXRE 2YS4A 5HI4D 4OT1H 4DVRL 3DROB 5CSBA 1NAKH 1MHCB 2A1WH 4X7FC 4MAYB 3MLSL 4N5ED 3SCMB 4RAVB 1X7QA 3QDGA 3AB0B 1NL0H 2DQEH 4OLXL 3Q48A 2Z31B 1KYOJ 2R69L 4GKZB 3UTOA 3FKUS 3V0WH 1IJ9A 5DUBB 1NCAL 2R4RL 5I74C 5I75C 2C9AA 2FO4B 3DVNA 2D2OA 4MD0A 2E7HA 1VFUA 1RURH 3BP5B 5F21B 1XGRA 2DQIL 3FN0H 3OXSB 4TVPL 5E8DL 5E08H 2KPNA 1ORSA 2NXZB 3QUXC 1NCWL 1YC8A 4RWYL 2W38A 1U58B 3U7YH 1IGCL 2IBGA 3LB6D 4M1DL 4UV4L 2BXZA 3GK8H 4NUJA 4OV5B 4GUPB 3LKOB 1YECH 4Z8FH 2HRPH 4PRPA 3ZKMC 2RAMA 4G5ZL 1WEJH 5HGHB 3OB0K 2CDEB 4HWEL 4OCYL 1OTTD 1NC2B 1XGPA 5IM7B 2GCYB 2R9HC 2ED8A 2YRZA 1JZ7A 4U7MA 5C08E 4GG6B 1S8DA 1WAAE 1E6OL 4ELME 3OSKA 3WLWD 2Y7QA 1XF3B 1B88A 4A2LA 3QI9A 3UPAA 1NCBL 3UTSE 1F5WA 3BZDA 2OP4H 4UTAL 2GT9A 4R4BB 5CIPH 5HDLA 5CEYA 1TENA 1AXIB 4OQTA 3LKNB 5C0BE 1UJ3B 4PP1D 1R5VB 1IQDB 5FA4A 1RZGA 5B39A 3QCTH 3FOLB 5EORH 2DLGA 4PJXA 3O9WC 2DM3A 3E1F1 1X5IA 4R96A 3UZEA 1U8JA 5MEQB 3BN9D 2B20A 3F8UB 4UOW1 5EU5B 4LCWA 3PQYD 1X6NA 1KB9K 2CUMA 2E9JA 3DROA 3QIWC 1MHCA 4MAYA 3QCUH 4PB0L 2YPKA 1OP3H 2XICA 1D3CA 2RJMA 2WBJC 5HYJB 5AYUL 3KXFB 1N7MH 2ATKB 3T77B 2Z31A 1MI5B 1HHHB 1TXKA 3BDYH 3H8NA 3BP6B 4GKZA 3WDIA 4OFVA 5D72H 4PJIB 2FO4A 4Z9KB 1A14L 3T0AA 3BP5A 5TDNB 1EO8L 1Z5LB 1JPGA 1F4WH 1KJ3L 1YEGH 3L3KB 4NQCE 5L88L 5J1TC 3MO1B 3DNKA 4HJJL 3OXRB 4DOHE 2R39A 2E27H 1B90A 1Z3GH 3EZJB 4FQJH 3LRGA 5BCAA 1AGEA 4GUPA 3MRQB 5C0EB 5EZJB 1VESA 3QP3A 3I3DA 3L5HA 3P3YA 4EI5D 5IW1B 1A7PL 4GS7B 1KENH 3RKPA 2X42A 2GCYA 1C16B 3O3UN 3EUUA 3BZ4B 3H9ZA 3BPOB 4KV5E 4V2CB 3IAQA 2QSVA 3W9DB 4YDJB 3WLBB 4R4NC 3DHMA 1CLZL 4IIQB 5AAMA 1BQSA 5BS0A 1XF3A 12E8H 3LS5L 4KHTH 2FLRT 1KG0B 2YEZB 1EJ6A 3KPNB 5J1AA 4R4BA 5SWZE 3MBXH 2NY3B 1DBKL 1H5BB 2VERN 1FZKA 1IQDA 4JJ5A 3VGAC 1BVLB 3FOLA 1DFBL 5HPOA 4MHHI 3X3FH 3OR7B 1GIGL 3MV9E 3LEXA 5EU5A 3UTTD 1BFOA 1DBBL 1NAMH 3SDAD 1S9XB 2VLRB 5DMIH 1Q1JH 2P5EB 1S78C 5A3IC 1TIUA 3V0VB 3U48A 1II4E 1QEWB 2YRPA 3VD5A 2YKLL 1YEJL 4P4KB 4QGTA 5DWUH 5A16B 3MZTA 1FAIL 4NZRH 2C3VB 2J88L 1MWAH 4HT1H 3T77A 1MI5A 1FNAA 4KKBD 3RKDC 3BP6A 1DLFL 1CF8H 4URTB 3BOVA 1FNEB 2BOBB 3QIUB 1CXKA 2IWGA 3DXAE 1T1XB 3MV8A 4ODXB 4PJIA 5AWNL 3V5HB 3HNVL 2Z4QB 3ARBC 5TDNA 1Z5LA 3WUWG 4HPYH 3BKJL 4LPTA 1K9TA 1WFOA 3L3KA 4S2SB 2BSTB 4ZPTB 1R3IH 3MO1A 3OXRA 3S96B 2X1PA 4RGOL 4F37F 2GSGB 3FT4A 1O7SA 3MRQA 5DHYB 2CGRL 3JTTB 3UX9B 3QNXA 4JZOB 2P5WE 4ZOEA 5E2TL 3BD4A 5IW1A 1T66D 1TVHB 4F15B 5JORB 1KJ2L 3PABB 5HXMA 3BZ4A 4APQC 5HHNB 4HPOH 4JHAL 1ZGLB 1T1ZA 4HS8L 2IANB 4JKLA 3WLBA 1XZ0A 4K23L 1ONQB 3IS0X 4IIQA 1PW3A 4XP1L 3EDJA 1KCRL 3IFOB 1VACB 1IM9D 1ZA3B 4YWGL 4YHZL 3IGAB 4NBYB 1KG0A 4JPWH 4M4RA 2YEZA 1F4XL 1KPUB 1FORL 1HWHB 3O2WH 3KPNA 4HWUA 4BZYA 2B1AL 1JNJA 1KC5L 3GKWL 2FECL 1FYHB 1IEBA 1P4BH 2LQRA 3C5ZC 5JQ6H 1UKQA 2CMRH 3LN5B 1H5BA 1MPAH 3B8YA 2WUCL 3ARXA 4IS6A 4NO0D 4L8CB 3Q2CA 5CSGA 3SGKA 2HP4A 4PLJC 4X6CB 2BVTA 4PRDB 1RU9L 4KPHH 4TUKL 1ADQA 4ZODA 1S9XA 2VLRA 4HCRL 3V0VA 1JE6A 4JFFE 1A7NL 3ISWA 3ZKNC 1QEWA 5GS0D 4WI2A 5IG7B 1YC7A 4P4KA 5A2FA 2RFXB 2XTJE 3SN6N 5A16A 4P2RA 4JM2F 2C3VA 3P9LA 43C9B 5D1ZB 4PTUB 3PXHA 4G9FE 3V5DB 1OD9A 4PV8A 4UIKH 5L2KD 2FR4B 5I6XC 3QZWB 2X4OA 5TQ2L 3MRHA 1QSFA 5C09D 3CFJB 2HFGL 3PJSB 4CW1A 3IFLH 1PZUB 1T1XA 4ODXA 2KQMA 2OJZH 3V5HA 5GRXG 1I9JL 1RZFL 4G6JH 1ORQA 1LEGA 1MRDL 1Y0LB 4MXQD 2AJZB 2BSTA 3SGKC 4QY8B 4PBVC 1U92B 2J4WH 4X7SH 4EZMA 1XFPA 2XY1A 4M1CC 2VYRE 5DHYA 2F53B 5DEFB 1J0HA 5DHVB 4IOSD 4M6MH 4P4KC 1O0VA 3DRTB 5JORA 4YXHL 4BUHA 5LGHL 1AGBB 1OW0A 3TVMD 5HHNA 4U31A 1ZGLA 1P7QB 2HFEA 1FBIL 1M4KA 1MFDL 2EO9A 3MLUL 1EPFA 1ONQA 1OAYL 3L5WA 5DFWH 3QDHA 1QZ1A 2P8PB 2PYED 3IGAA 5HHPB 1QNZL 1SY6H 5D70L 4M1GH 3CDFA 4WJ5B 2WZPD 1YEHL 4PP2B 4PV9B 3UMTA 4XVTH 1EEQA 2AQ3A 2E3VA 5JW5B 1T20B 1RZ8B 2ORBH 4RCAA 4Z0BH 3PE9A 6FABL 2MMXA 3UXFA 3R0NA 3PG2A 1JYVA 3MPCA 4X6CA 5EUOE 4JZJB 1C5BH 5CEXB 4Y2OA 5H37H 4L3CB 1ZHLB 3NFSL 4ISVB 1LE5B 3C2AL 5C2BL 2RFXA 5BO1L 2LVEA 4Y4FD 5D1ZA 1QFUH 1MJUH 5C6TH 4F7PA 3TFKC 2NQCA 3OAZK 3V5DA 1TPXB 1UKTA 3G6DL 2WMPA 2FR4A 2E7CA 3QZWA 2H45A 2ZNWA 5DVKA 2A83B 3TBTB 1LWRA 3CFJA 3PJSA 1Q9OB 1NPUA 2AP2A 3P30L 4M3JA 5DJAB 1ZXQA 4IHOB 5JOPE 4M6NH 5DVLA 1HNGA 1Y0LA 4QTIH 2QKIB 5E0QA 4F9PA 2AJZA 1MFAL 3K2UH 4GQPH 4NKIL 4MQTB 1JCKA 1U92A 2ZNXA 5EZOH 4CMHC 3FRUA 1NBVH 1U3HC 4FNLL 3VFRB 3GJFB 2F53A 3P11H 2NNAA 5DHVA 1CDHA 5AZEL 3RWGB 5I1JH 3L3HA 35C8H 2AEPH 3AVEA 4OSUH 3U4AA 5DJ2A 2W0FA 3CLEH 1NANI 2F54B 3DTXB 4TOYL 1SBSL 2IADB 2KUTA 2XY2A 1T5XB 2X4RB 3EAKA 1P7QA 4NN5B 1NUDA 1RUQH 4LVEA 3WIIL 3ZDXF 2P8PA 3PHQA 1GH7A 3BKML 1GGCH 2J8UB 4JGJA 4JQIH 4H88H 3MV7D 2X89D 4P2CG 4U1HA 4F9PC 1BBDL 4WJ5A 4NZTH 4PP2A 4PV9A 4ZFZB 4MZ2A 3LS4L 3QUYC 5KVFH 1T7ZA 1T20A 4Q2ZB 5KZCB 5DMGD 3A67L 3GMPB 2VWEC 3JV4B 4KY1L 3MFFA 3EGSB 5CEXA 1TJIL 1ZHKB 4L3CA 1BFSA 1ZHLA 3OKMA 5IQ7H 4ISVA 4Z77B 5C9JB 5C7XH 2OLDA 3ZSSA 2H2SD 1BM3L 1E6JH 5JQHC 1OHQA 1MCJA 2YPLD 2WAHA 1ETZA 2PXYC 2VITB 5F7EL 3MYJB 4MNQD 3KJ4B 5FO8B 1IGYB 1J1OL 1K8DA 3BKYL 1FG2A 3THMH 2O26U 1Q9OA 4ODSL 3QJHB 2MPAL 1C12B 2BC4B 4IHOA 5CZXD 1MVUB 2BDNH 1A8JH 2ILLA 1L0QA 2QKIA 4MA1C 2HRLA 1EVTC 3TIDB 3SKUD 3LVEA 4N0CC 1FFNB 3GJFA 3LPFA 3NBNA 5ENWB 2QL1A 3RWGA 3U7WL 1OGAB 2UWEA 4MNHB 4OB5H 5E2WL 5FK9B 3ULVL 4QRRD 3TT1L 1LVEA 4NSKA 4WTXA 2VSCA 3DTXA 1NGZB 2IADA 4WY7H 3L95B 1RFDL 2JLLA 2X4RA 4HK3N 5BVPH 5ADOL 4GSDH 2GIYA 4I2XB 4NKDB 5EO9B 4NM4H 3WV0A 1NFIA 1UC6A 5JOFB 1KLFA 4Z7WB 5DQDL 4WW2F 2W9EL 4HKXB 1UCBH 4JREC 5D8JL 4L3ED 5F3BB 4TPRH 4ZFZA 2V9RA 4KQ3L 2WIMA 4LAQH 1IGMH 1B2WL 4KZEL 5IESH 1VEOA 4Q2ZA 4FXKB 3GMPA 2ZJSH 3QULB 3EGSA 5EBGA 1QLEH 1UACH 4R97B 4M9OA 1RIVL 5KVGL 4AEIH 5C9JA 1A21A 4LF3A 2HFFB 5F9JB 1LP9F 3GI9H 4POUB 4OZHF 1HIMH 3KDMB 4F2MA 3WFEL 2NY4C 4GQ9H 4LFHD 4UTBL 5CGTA 3QFJD 3LEVL 4OV6F 3MYJA 1CFBA 4LKXB 4XNZC 3DGGB 1UWXK 5AEAA 5FYJL 3LKSB 4ESKA 5K33A 1IGYA 5JPNA 5HDQH 5KS9F 2QHRL 1F3DJ 3QJHA 5F7FA 1C12A 2YD8A 1MCLA 3HNSL 2BC4A 4D0CB 1MVUA 1AI1L 1U36A 4L4JA 4PJEE 4YDIL 4F80A 1XF5B 3IRZA 2J6EH 5D1XD 3TIDA 1I8IB 1KLGA 4H8WC 3W39B 2MHAB 3JUZA 2CIIA 1FFNA 4FFZL 3NIDE 5ENWA 4PD4J 5CD5D 3QA3B 4MNHA 3BESR 4OGAD 3IJHB 3CSYA 4MJIE 3QDAA 2X41A 4O2FB 3IRPX 3RX7A 5D6DA 4O02L 3L95A 4FTVB 3MODH 4BQ6A 1XR9B 3MRBB 5E2UH 4DK6A 4PJBF 1GC1L 4NP4H 3MGAA 5JOFA 1HYSC 2DYPB 4Z7WA 5EIVA 5MEOA 1N4XH 2Y72A 3OF6A 4ZSOB 1RUAL 1SJXA 4N8VG 5GPRA 1G9NH 3WFCL 2CXGA 5T1KB 4HKXA 4BH8B 4PJGE 2KZWA 5F3BA 4YBQC 3QSKB 4BSWB 4JHWH 4XNYL 4XZUB 4ERSL 5E8PB 5KOMC 1JPST 3PWJA 3OKKA 3BISA 4FXKA 1ZLVK 5KSVB 4HUXB 1IAOB 1IILE 1WIUA 4PGEB 4PFEA 4XCNB 3V6OA 2HFFA 3DUSB 3ALWA 5EC2B 3UTTE 1SM3L 3EJYD 1EA9C 3EYUH 1FAKT 5DJ6A 4TN9A 4YHPB 4DKFL 3MJ8A 3NA4A 1IC5H 2JF1A 1KCUH 4GT7A 2EO1A 2YWYA 1AKJD 3G5VB 4JFEB 4RMWA 3HI6H 1YN6A 3IKKA 4X6DB 3KS0J 3RAJH 5ISZD 4O2CB 2NY2D 5DD5H 3JWOH 5BV7L 5HYIA 4Y4KC 4K3EH 1CLOH 1F4HA 4QT5B 3L3DA 1XF5A 4LVHC 2FEEL 4U6HB 4EDXA 5SX4I 5F7KC 3GM8A 3K81A 4XVUD 4G6MH 2X40A 4NGHH 4UNTA 1I8IA 1U0QA 5E99H 1T3FA 4EIGB 3V6OC 4ONHB 3QA3A 1LDPL 4G3YH 1LGVA 2APVA 1BP3B 2E9IA 2R1XB 2VDRH 1AC6A 3DGCR 3TJHC 1S3KH 4I0PD 1A6AB 2BSRB 3Q5OA 3I6GB 5F8RC 3RY6A 4FTVA 5HHOD 2D7QA 1UH2A 3SDDD 3NCEB 2D0FA 3T0BA 2IMMA 5DRWB 3SDXE 4OQ1A 1SVZA 2VAAB 3RVXD 4BH8A 3RVWC 5T1KA 5LVEA 2BY2A 3UROR 1VFMA 1N3NA 1MIEL 4JDZB 1LHZA 1UT9A 2I9TA 1ZVSB 3KPMA 4BSWA 5ALCL 3WNMA 4XPAL 5E03A 3MRGB 3T0EB 4JFXA 2CO7B 2W0LA 2PO6C 4HUXA 1U8LA 4AIZB 2MFNA 5EWIL 4GRLB 1M1SA 3RZCA 2OJEB 5GRJL 4PGEA 3O6FA 1HKLL 3QPQD 2UVFA 3RY6C 4N90D 4DN3H 1FQ9C 4IRZH 3GEWB 3GRWH 3MLPA 1EDQA 3DUSA 1FZMB 4NFCA 3C08H 5IGXH 5CLWA 3E6FB 4PRBA 3G5YB 5FA3B 4JVWA 4YHPA 2XV6B 2AJUL 4IEFB 4WU5A 4I5BB 3G5VA 5KSUA 1YN7B 4RDQG 3P0YL 5FCSH 2UUDK 4Q6IC 5E6IB 5JHLL 5JLZB 5L2KE 4M00A 3W2DH 4M5YH 5CGYC 1U6AH 4M61B 4OLVL 5E95B 5C09E 4U6HA 2BOCB 3U7AA 4MCYB 3RGVD 1KIUA 3IJYB 3NIGF 1A64A 4P23C 2CSPA 4U6VH 4X4YA 4X4XB 3RZCC 5E2VH 2FECI 3O6FC 3GMQB 2A2QT 1VB9A 5FECA 1ZE3C 3SO3C 4PJ9B 5IT2H 2VKWA 3DRQA 1W72A 2L7UA 1A6AA 2MKLC 5D2NB 4Y1AD 4UAOB 2HKHL 3O6LL 3MNVB 2FJGB 3WIHA 4KROB 5J6HB 3DARA 2Y5EA 3WS3A 3GIZL 4ZPVB 1KJVA 4QOKD 1A9BB 3C6LC 5I18L 3FT3A 1MHHB 3B9DA 3KYOA 4LPCA 1J87A 3KNBA 4EOWL 3TH4T 4ZYKB 4LASH 1QFWM 5FGCB 4OF0A 1IKFL 2ZPKL 1YPZE 4LEXH 2G9HA 1R5IB 5AUMB 3M1BB 2PYEE 4UDTB 5HHMD 5IFJA 1U8QA 3QBTB 2YMXL 5D7IB 3RP1A 3WD5L 4AM0B 1KGCD 4I3SH 4O9HH 4RX4D 5TPWH 5I66B 2XN9A 2PCPB 3MRGA 1X5JA 1VEMA 5DC9B 4GXVL 3T0EA 2AV1B 4GAJH 3LKQB 1MF2L 2DIAA 4Y16D 3D39B 5IEKB 5L6YH 2GJ6D 1MELA 4GRLA 2AXJA 5EOTB 4B7IA 1TVDA 2NYYC 5GGTL 1P5UA 5EBLA 4DN4L 3NAAL 1UWEH 2CR6A 1FZMA 2MCPL 3NCJL 3ARFD 4NN7C 1QLRB 4EN3A 3T8XB 1OAQL 2XZCH 4ZNCD 3HE7B 3FMGL 2E6JA 2PR4H 1SEQL 3P0GB 3UJIH 3VFTB 3ZE2E 1YN7A 1MCKA 5GSVB 5DD1H 4YBHA 4NWTH 3N0PB 1KB9J 5E6IA 1IL1A 4P2OA 1GAFL 2HT3D 1Q72H 3RWDA 3T0EC 1NFDE 5E9DB 4MCYA 4OAWB 3TYFB 3IJYA 5E8EA 4N8VB 2VIRB 3QXDB 5DD0L 4X4XA 5GIRB 3BUTA 4MA7L 3MUY1 3ZTNL 5IEHB 3GSNH 5EU6A 4PJ9A 4HFUL 4RGND 4I4WB 1AR2A 3W81A 4EN3C 2BNQD 5D2NA 4FQXD 3DJ9A 4TULH 3SGJA 5HI5C 1MQ8A 3UAJC 3MNVA 3PDGA 4YDLC 3BWAB 4OGYL 4ZPVA 4K2UL 5D7LD 1YZZA 3QHTC 1A9BA 2CR3A 2DQHH 5E6IC 4JY4B 3HG1B 4P2OC 3MSPA 3GM0A 5C0FB 3C60D 4Z7UE 4XWGH 1WT5C 5D93C 3VXSA 2FX8L 5AUMA 4UDTA 1JYNA 5A2IH 4JM4H 3VXUB 4AM0A 2EIZB 3MLVL 4NUGL 4OI9A 3RJQB 3MV7E 1NMCB 5I66A 1UXWB 4P5TC 2PCPA 2VE6A 4CAGA 3HUJB 3SE8L 5MI0B 4ZXBD 5IEKA 3VFUB 1D6VH 2WWKT 2DQGL 3UTZB 3S3JA 5D2NC 3ZKXB 2YZ1A 4ODHH 4TSCH 3SGJC 5CIPB 3RU8L 1ZT1B 3WHXB 1J0JA 1UCTA 3AUVA 4AY0A 1QLRA 1F4AA 3T8XA 4PJAF 1AR1D 3HE7A 3KYAA 2OR9H 2DWDB 3FN3A 5J6GB 2QADB 4Y5XB 4J4PA 1S7RB 3INUH 2NY6B 2VLJE 1MJJA 4MNQE 1WBYB 3L3IB 1DQLH 2J7LA 1UWGL 2AEQH 3MZGB 4HIXL 1S9VB 5TE7L 1UA6H 5E9DA 5T1DH 4XH2A 1BZ9A 2H8PB 1FC1A 4MJ6A 2VIRA 1YEEL 2AK4A 1JGUH 5GIRA 4GBXA 5GRVK 2O61B 3V6BR 5IEHA 2RR3A 5C0AD 1VGEH 4K7FB 3OMZA 3NN8B 3KPTA 1QBLH 1D5ZB 1ZHBB 5H37G 4XNXL 5M95B 2HJKA 4J4PC 3DBXA 1B3JA 4QRRE 3WFHB 2O5YL 3RWJB 3ULUD 1CGXA 2DQCH 1RMFH 4FFVC 3WN5C 4JM2B 4JY4A 3HG1A 1QPPA 5CCKL 5C0FA 2YA2A 1K3IA 5F1OB 2X4PB 4QLRA 3MRJB 3GNML 2CDGB 3MA9L 1KTDB 3QUZB 3AS0A 5SX5H 2YD9A 3VXUA 5I17B 5DK0B 4GBXC 1UXWA 5ESAB 5CINL 4YEFA 5EUOB 3GKZA 2FO1A 1IBGH 1RUPH 2VAJA 3VFUA 2RCSH 5KSAB 1A7OL 5IIEB 2AJYL 1NSNL 4YHYC 2BNRD 3F12A 1CU4H 1Q0YL 1JBJA 2IQ9H 3ZKSD 4XPFH 3RWHA 3S37H 2FZ3B 3DETC 3WHXA 4JR9L 3KPSE 4ZUVB 3SOBL 4G43B 4HLZH 4K8RL 1UJTA 1MCWW 4Y5XA 5DI8B 1A6UH 2BHYA 5IB3B 1NAMB 1S7RA 3D3VD 2QQKL 4U0RB 4HWNA 3QFJE 3TM6A 2BRRH 4EXKA 1EBAA 2D7MA 3C09C 2ZCKL 5T1LB 4L8SB 3D0VA 3SDCB 4PRIB 3CCHB 3FT2B 4M48H 1S9VA 5IV2A 3LN4B 3ZDYF 5ITBL 1MWAB 2OX5A 1I3GH 2H8PA 3J8F7 3U9PH 4S1RH 4KGLA 2VH5H 3Q5YA 2NTFB 4OF5A 3U46A 3IXAB 1FNSL 1ZANH 2YD5A 1DBJL 1B6DA 3BP4B 1AO7B 5FKPB 4QRPB 1HHJA 4MA3B 3FQTA 1FH5L 3JWDL 2Q3ZA 1FCGA 1D5ZA 3HNTL 3QXUA 2X7LB 5TE6L 1ZHBA 3TNMB 2R56H 4OZIF 4TSBH 4RWHA 5JIIA 4MJ2A 5F6HI 1T5WB 4P59H 1FO0L 4JM2A 1N59B 4GAGH 4XCFL 5I30L 2OCFD 3JZ7A 1SYSB 4FP8H 3HC4L 3S37X 1EJOL 2X4PA 3MRJA 5JR1H 3NZ8B 5C07D 2EZ0C 5I17A 1KTDA 3QUZA 4MMXC 4R3SB 3WL9A 1QKZH 2FBJH 3MJ9L 1DQQB 5J7CC 2V2WA 5ESAA 1WQVT 1IFHL 4XNMB 2D03H 3MOBL 4ZS6D 4ZUUA 2Z8VC 4O4YH 3TC9A 2DDQH 1MHEB 4ZTPL 2NX5B 5EU7E 5IIEA 4PGDB 1YEKH 3VCLA 2M8XA 3FB6B 4DW2L 1MIML 4Z7VE 4WHYH 1A6WL 4HKBB 2V5YA 2ICWB 4XCEB 5K93A 2BCKA 3RWEB 4LU5H 3JUYA 4G43A 4GW1A 4X6FB 4PB9L 8FABB 4R7DB 4KAQL 5DI8A 3T0DA 1CXHA 4OD2A 5F9AC 2K3TA 1BJ8A 1JZ6A 2VDLL 5I0ZA 3QUZC 4JDTL 5T1LA 4L8SA 3SKJH 3SDCA 3TA3C 2ITCB 1JGLL 3CCHA 3FT2A 5E00A 5F97E 2C3XA 2WLZA 3LN4A 1WIOA 4PYHA 2AJXL 1UYWH 1E4KA 3IDYB 4WUUD 2X09A 1PD6A 4OLEA 1T2QL 5D2LA 5IB5B 5ISZE 3BPNC 1P53A 4LLWB 2NTFA 1OAZL 3X11A 1LNUB 1U8HB 1P4IH 3BHBA 4OJFL 5GRVL 4F8QA 3ILQD 1LEKB 2YK1L 4LSUH 3QIBD 1DVFB 2YPVL 3V8CA 4HQQL 2P45B 1ZLUH 4M7JH 3TNMA 1C5DB 2HFTA 3IDNB 4CU6A 5CS7A 3A6OA 5D7JD 5I8EB 3NOIA 5LKNA 4BQCA 1TNMA 1T5WA 3QFDB 1B0RB 3D5OF 3WSQH 1N59A 5KANG 1WSST 2XT1B 5HHOE 3BT2H 4JPIB 4RFOH 3V7AG 3SDCC 1CDJA 5B4MC 2UYLB 1B0GB 1SYSA 1CCZA 3HAEA 3ZYOA 3NZ8A 4F8TA 5I1GL 1DQQA 4PJ5B 3GJEB 3SQBA 1XIWD 5D4QA 2FIKB 4XNMA 5DQ9B 1I7ZB 3SEPA 4ZFGL 1U42A 2HVJB 3H9YA 2JIXD 1Y18A 1I7UB 1K4DB 2NX5A 3TBVB 4F7TB 5IW6B 4J8RB 2XWTB 3PQYB 4OCRL 1U2HA 5IUSA 1AY1H 4HHAB 2D9CA 4XBGA 5AZ2L 4X6FA 4N90E 8FABA 2CDFA 4GMSL 5C0RL 1ZA6B 4CNIA 4WWKD 2YD4A 1MJ8L 1N8ZB 5I1LA 4L5FH 4PJFE 1MCOL 1KB5L 3N1MC 4NC1E 1TCRA 5C8JB 2A73B 4NZJA 3HC0B 1T1WB 4HDIB 2PETA 3MLXL 3TT3H 4WW2B 1X5FA 4LSVL 2IG2L 4ODTH 5EG6C 1I1FB 3IDGB 4OT1L 4LIQE 4D8PB 5IB5A 4YC2C 1NAKL 2A1WL 2BVOB 2QSCH 2BXYA 2IGFH 3HFMH 3GSOB 4UINH 4Y19D 4LLYB 3B6SA 3HZYB 1IAII 3DVFA 1U8HA 3CFCL 3S7GA 3ULUH 1NL0L 5K9QI 1DN2A 2EXYD 5HHXH 1LEKA 3EYFA 1GPOH 4J12A 3QDME 1CICD 4CADB 1RUML 1ZGLP 1Q38A 5JOEA 3ULVC 1C5DA 1GSMA 3FQWB 3IDNA 4KWUA 1BZQK 3PWUA 5I8EA 3WKNA 1CFQA 2W1NA 1RURL 4YXLH 3JVGA 3EYQD 3FN0L 3UO1H 4JRWA 3QFDA 4OZHB 3CUPA 4Y1AE 5J3HD 4M7ZB 2D0GA 4JPIA 1G7PB 1DBMH 1T4KB 4S1SL 2UYLA 3FQRB 1B0GA 1U8PA 2EKSA 2DI7A 3MQIA 1QRND 4HGKC 4QOKE 4L1HA 1I1AB 3GK8L 5EU4B 2ICES 3T1FB 4KKNA 5KS9B 2E8ZA 2Y06L 4PJ5A 4LCIH 2JKXA 4JRYB 3GJEA 1MREL 3PWLB 3SBWA 2GK0B 5DQ9A 1I7ZA 1OAXL 1QRKA 2HVJA 4PRHD 1G9MH 4MXVE 4FQCL 1I7UA 4U1JB 1KGCE 3TBVA 1I3RB 3U0WL 5FYKH 2A0LC 2ADIB 3T3PF 4J8RA 2XWTA 2IPTH 1AIFB 3HB3D 4HHAA 5GJTL 5FYLE 3IU4H 2GJ6E 5EOCH 4HSQA 3HI1B 4TNVF 4XAWH 5MHSD 3E2HC 1F8TH 1A6TA 1BZ7A 1DANU 1ZA6A 4PGCA 3VI3F 4FQ2L 2DICA 2AQ2A 1N8ZA 2E7LA 4CU8A 1BWWA 2W60A 1AFVH 1HSAB 5KG9B 5ALBH 3QCTL 3BIBX 1MLBB 4NKMA 4JFZH 1PY4A 2R4SH 3GB7B 1I7TB 4HDIA 4WW2A 3RUGE 5HYSA 2X70A 1S5IH 4Z7NE 4D8PA 3I9GL 2BVOA 5LJYH 2P7TB 2ZP0T 4YGVB 4Y89A 1MAKA 4MD4B 4LLYA 1T03H 3HZYA 3ARPA 5D1QC 3QDGD 1LEIB 2NY1D 3JV6A 4ETYA 4CADA 4B7LA 1P7KA 3ZE1F 2AXGA 4R2GD 4LCUB 4G8GB 1IVLA 1LP9A 5EUKB 2BNQE 4OZHA 2MKWA 4G8FB 4Q9QL 1GGUA 4X98A 1FP5A 1UM6H 1T4KA 3FQRA 5TH2A 1GC1C 1Z3GL 4A6YH 4PJDF 4O51A 3VGEA 2WNGA 3ETBF 3Q1SH 5D7LE 3UYRL 1I1AA 1V3JA 1IC4L 4UV7H 4PRPD 3T1FA 4L8BB 5KS9A 1TDQA 4XC1H 4C59B 4JRYA 3U30C 3PWLA 1J1PL 2GK0A 1KENL 3EBAA 2AJ3B 1BPVA 5JXAH 4U1JA 3CPLA 1I3RA 2OL3L 2ADIA 4H1LA 5ID1B 1AIFA 12E8L 3QI9D 3K4AA 1U93B 4KHTL 1J10A 1I9IH 3UPRA 3N85H 3HI1A 1UZ6F 1INEH 4KRPC 3MBXL 4YDKH 2V5MA 3O8XC 5FUCE 3B2UD 1TQCC 1UM5L 2D7TH 1A3RL 1HSAA 3JTSB 3VWKD 3QDJA 4LDOB 1MLBA 4XHQA 4PJBA 4KKCD 2F8XC 1MNUL 1FL6B 3EOAB 4LCWD 2I9LA 3FZUC 3GB7A 1A4JB 4HAGA 3DMMB 1NAML 2LAGB 3MACH 2HN7B 5DMIL 1Q1JL 3IETB 4LLUB 4MAYD 5BV7C 2P7TA 2YD1A 4YGVA 1FVDB 3SCMD 2BSSB 3P4OB 5DWUL 4MD4A 1Z6JT 5I1EH 3W5NA 2VR4A 1AGDB 1MWAL 5CBAA 2Z31D 2VDKH 5AG8A 4DEPC 1IQWH 1OTSC 4LFHG 1QR4A 2GUOA 3JXAA 3I50H 1CF8L 4D0BA 2EDTA 1UEYA 1NGYB 4MQXD 4CJ0A 4LQFH 5BOZG 4PY8I 1MEXH 5GRYA 3OKOA 4U4BA 5HGAB 4HPYL 4G8FA 2NXZD 4KJPD 5F1NB 4JO4H 4K3JH 2D0HA 1JWUA 5D96C 3OG4B 4LARL 1R3IL 5DUML 5HVWA 3MROB 3UPCA 2IPKB 1GGIH 3TIEB 3LY6A 4N5UA 4OLYH 4JQXA 3RY4A 1P7HL 4DQOH 1D7FA 2XQBH 2XNAB 4P4RA 3MRLA 3BH9B 5J11B 1CVSC 2MSPA 3G6JF 2IAMB 5A3ID 3CJJA 2AJ3A 4HPOL 3MJ7B 2LTQC 4UT7H 5BS0D 3LQZA 1U93A 5ID0A 1EERB 1RSFA 2J1KA 4L4TA 5FGBA 4RAHA 2BNRE 4K7PL 1ZHNB 3N06B 1JZ8A 3O2WL 5D9SB 3OB8A 4MXWL 3QUMH 1A6VL 5IFAH 4Y4FB 3H7BB 2A9NH 3T09A 1GYAA 1D6EB 1P4BL 2CMRL 5EC1B 4JG0H 4Z7OF 3ZO0A 4JQXC 2GFBB 3KLDA 3D85B 3EOAA 1FL6A 4QXTB 2I25N 3D3VE 3VFMB 4KPHL 3L7FA 2HN7A 4KI5C 3IETA 1HQ4A 2DLEA 2DLTA 4LLUA 1ITBB 3GBNL 3MOAH 2BSSA 3P4OA 4U49A 4MQ7A 4AEEA 4WI5A 3S34H 5HYJD 3TNNA 1AGDA 3KXFD 3O6MH 5FOBA 4YHOH 1MI5D 1KTLB 1RZ7H 3FRPA 4H5SB 4XVJH 4CU7A 1Z0NA 2XKUA 3NIDF 2CK0H 3L1OL 4D0DA 1R5WB 4WEUD 4NNYA 3IFLL 1NGYA 4P9ML 3VMOA 3IAPA 4TVPE 2BVEA 1VHPA 2NW2A 5HGAA 1JZ3A 5I76B 5F1NA 1KTRL 5HGDA 5LQBH 1DSFH 5IVOA 3FB5A 1FGVL 1DCLA 4LSRH 4Q58C 4QCIA 4NQVB 3MROA 4X7SL 4BH7B 2IPKA 4OM1L 4CUCA 4GAFB 3TIEA 1HK6A 5I1CL 2F15A 2XNAA 3UBXG 3BH9A 3NCMA 4M6ML 4LOUC 1PX3A 3K1KC 5CJOL 4PJGF 3KGRA 3QCVH 3RI5F 1D5XB 4HGMA 5C07E 3MJ7A 3GSRB 1QSVA 2IMNA 3PHSA 4YE4H 4OD3H 3ELAT 4CVUA 1TJGH 1FV1B 4NN6C 1T0PB 1BHGA 3BDBA 1SY6L 1ZHNA 4M1GL 5BZWB 2Z35B 5D9SA 2HLFD 2R0ZH 2YPLB 5IJKA 1CL7H 1D6EA 3AREC 2NY3D 3OZ9L 4MB3A 1L7TH 3LH2L 4XP4H 4Z0BL 5HY9B 4YAQB 1NUGA 4HMDA 1FCCA 2GFBA 2EYTB 1YY9C 2BVUA 3D85A 1HYRC 1P1ZB 3CGTA 4QXTA 4PPTA 1CTOA 1LMKA 2VLRD 1C5BL 1DJSA 3FHAA 5DFVD 1OAKH 3UEZA 2NXYB 1KEGL 1QO3B 3F7QA 1HDMB 4AL8H 2VISB 4NBXB 1UFUA 4P4KD 1P2CA 4U6YB 2FIRT 5H94B 2GKIA 1M6OB 1QFUL 4WUUE 1PJ9A 3JSSA 2G75B 4XXDB 1Q0XH 2B39A 3W0WB 4E5XA 4FABH 4R0LB 2V5RA 3QIUD 1R5WA 1J11A 1XR8A 3BGFC 5IJKC 2APFA 4DFIA 2W0PA 5CFHA 4M93B 2X4SA 3FQNB 4A2MA 5K59E 4XPHL 5I76A 2IALB 4JPKH 5I19H 3K2UL 2MNUA 3MUZ1 4HLZG 4GLRH 2C3GA 2Q76B 4PJAB 5EZOL 1KULA 4HIJB 3QRFM 5CD3B 2OXHA 4HS3B 3B3IA 1Z9LA 5DUPH 2Q20A 3LKRA 1VKXB 5I71C 4L3EB 4NBZB 5I1JL 2EIBA 5F1KC 4F58L 1TCMA 2AEPL 3PWPA 4OSUL 1CD8A 1PG7W 1D5XA 1H9VA 3CLEL 4UZGA 2F19H 3P73B 1G7IB 5JW4Q 1FV1A 1A7QH 1KIQB 4Y5VB 5FCUL 5L7XH 1K2DB 1K3ZA 2MTPA 1GGCL 4JQIL 4EIZC 3GZKA 3U0TB 4NNPH 3TN0B 2DL9A 2UVEA 5L8KB 2WWMC 3LRHA 2AW2A 5BQ7B 5BZWA 2Z35A 1HH6A 1B9ZA 1OAUH 3EFDH 3PDOB 5E4EB 4RZCB 4CN6A 5KVFL 1QQDB 1MCIA 4Y4HC 3FONA 2CJUL 2EYTA 3RZWA 3GRWA 3C8DA 3OKDB 4X9GA 5LGJA 1DQJA 4HWBA 1TETH 1RK1A 1JRHI 5IQ7L 3CMOH 1HDMA 4J3OC 2O5ZH 5FKAB 5C7XL 4U6YA 5H94A 1UG9A 1D5IL 4GJTB 3DVIA 1M6OA 1E6JL 5D1ZD 1YNLL 2AK1H 4OLZH 4XXDA 1CFTA 1M71B 3LDBC 4R0LA 3THML 4KGJA 4XI5C 3RX8A 4WHYG 2BDNL 3GIVB 2O5XL 2XZQH 2Y36H 2DWEA 4X6EA 2IALA 3ZLQC 3V7MA 3GSNB 3NCCB 5JIHA 4P9HC 2Q76A 2D4DA 4PJAA 2ZUYA 3WFDH 1JYWA 4HIJA 4LHQB 2F53D 3EOBB 3EW3B 1VKXA 2BK8A 1RK0B 2FSEA 4OB5L 2HH0H 5IB2A 2M2DA 2XZZA 5BOPA 5GGQL 4QO1A 4DGVL 4WY7L 1P7QD 4OBRA 5BVPL 1JF5A 3P73A 1FNGB 1I3UA 1IGFL 2C4FT 4GSDL 3D0LB 3GMLB 2NZ9C 1KIQA 3OX8B 4HK0B 4PRHE 4PJ8A 1JGEA 4Q9CA 1BX2A 1GOGA 1WZMA 2LU7A 2FHBA 3TN0A 4MDIB 5BQ7A 1UCBL 3PDOA 3NA9H 1I8KB 1F90L 4LAQL 1QQDA 5ICZB 5IESL 2H41A 4OZIB 1JI2A 1WWBX 3FAXA 2B2XH 2I27N 4IDJH 3EO1B 4QHLA 2V6HA 2VQUA 5MHSE 4Y2DB 1PGRB 3MC0A 3MBEA 3BKCH 4ZD3H 2ZJSL 1KYOK 3UJJL 3G04B 1JV5B 2ERJC 4F57H 5DT1H 1BQHG 4M5ZH 1FJ1B 2XYCA 4AEIL 3TPUA 3I02A 3WO4B 1T7WA 3OAUL 5F6IB 1WFUA 3M8OH 1HIML 5H2BB 3KYMB 3UBXB 3RBSA 3NCBB 1CS6A 1IEAB 4PJ8C 3UTSA 1T2XA 2V2XB 1PQZA 4CVXA 1QFWL 4PY7B 4YHNB 3LRSA 1M71A 1LQSR 4CVZB 3DO7B 2H9GB 2OI9C 5L0QB 4HAFA 4H26A 5C0BA 5HDQL 5J9PB 3QXAA 3QDGE 3MJ6A 3PL6C 5IJVA 4K9EH 4WIQA 4I0PB 3RX5A 1MHPH 1OSZB 3EYSH 3JWDC 3QHZL 2V17H 3GIVA 4N68A 4UQ2B 4XMKH 2J6EL 2MQ0A 3MBEC 2UZYB 2NY0C 4XNUH 1S7VB 4HC1L 2QR0B 5JHDB 2ADGB 3X12A 2E9BA 1EAPB 3O6KH 3RTQB 3EOBA 2QTEA 1RK0A 5IQ9A 1K4CA 4OFYA 3UYOD 1ZAGA 5BW7A 4JHBA 4PRPE 1HH9A 1KXVC 3HPLB 1MY5A 4JO2L 1MCBA 4I48A 3PP3H 3MODL 5FB8A 1FNGA 3D0LA 3I3BA 2PTTB 5E2UL 3OX8A 5J13B 4HK0A 2X4NB 4OLUH 2HTKC 1JTOA 4NQEE 4NKOB 4HXBL 2FYYB 4MDIA 1O5DT 1KEML 3NIFE 1ADQH 2GJZB 1D5MB 1I8KA 1FDLH 2R29H 4CDHA 3MRIA 2ARJB 5ICZA 4OZIA 4KTDH 4U3CA 3EO1A 4JHWL 5JDJA 2V7NA 4Y2DA 4MVBC 2DQTH 2IFFL 4S0TD 1TZGL 3G04A 1JV5A 2EDYA 1YYMH 2NW3B 4ZUWA 4EDWH 4PJXE 4ZAKC 4GW4B 2BSED 4LCWE 4LL9A 4JG1H 5H2BA 3EYUL 3KYMA 3UBXA 3RJDA 1IEAA 1URLA 2V2XA 3IVKB 4JRXA 1FFQA 4I13B 1IGTB 4PY7A 4JGUA 3KPPA 1KCUL 4DUWA 5KAQG 4CVZA 3MGOB 1I1YA 3EO0A 3DO7A 2VQ1A 4LCCC 5J9PA 3HI6L 2OMNA 1OSZA 5EIIA 5E24E 2X1QA 1OL0A 3JWOL 5IROC 1OM3H 1U3ZA 4K3EL 4NO2A 1KLUB 1JNLH 4LBEB 3HE6C 3MREB 4PBXA 4YBQD 3STZB 3VWJB 5LCVH 3KYNB 1MOEA 2QR0A 3HZKB 5JHDA 1IM3A 1MCRA 5E99L 1G9EA 1W8NA 1EAPA 5J1SC 2ITDB 4P49A 4P3CL 4RFNB 5FO9B 4YZFE 2VDPH 4G3YL 2JK5B 5HHMB 1NCDH 2VDRL 2EDQA 1C1EH 3ILPB 3DSFL 2H32H 1S3KL 3HMWL 4YNYB 2OM5A 2DTMH 4KMTH 1F97A 3DXAA 3MR9A 1WITA 2X4NA 3E0GA 3WMSA 4GG6E 1TVBB 2Z8WC 1E4WH 4JQVA 4NKOA 3OF6D 3U2SB 2FYYA 1A0QH 1JN6A 4E0RB 1A1MB 5D5MF 1PG7H 2Y25A 4POZD 5MERB 5JXEC 3Q6GH 1CLYH 3QQ4B 5ILTH 3LZFL 3J7HA 4I8DA 4D3CH 3ARGB 2A9MH 1GGBH 2BZDA 2PTUA 3L5XH 4FHBD 4D9LH 2FX9H 2NW3A 3GMRB 3QNZB 4TSAL 1RULH 4GW4A 3A6BL 3C08L 1A22B 5IGXL 2WUBH 3K7UA 4PLOB 1DUYB 4ORGB 3MRFB 1CYGA 1IGTA 4XHJC 4JQVC 4DWHA 3P4NB 3MGOA 1J0IA 4U6XB 3LMJH 1FIEA 5LAXB 1NGQH 4RGNB 5HYJE 1R3JB 3KXFE 1X5KA 2EYRB 1MI5E 3RVVC 2ZSVB 4IDLA 4M5YL 1JF6A 4WVRA 2HG5A 4YXKH 4LBEA 4FQIL 3MREA 3VWJA 2OQJB 4PJIE 3QEGL 3STZA 3BMWA 3KYNA 5BRZB 4RAUA 3DURB 1T0MA 3FFCA 4HJGB 1JPSH 4X8JA 2VN7A 1YEIH 5FO9A 1EFXB 1Q9LB 5C1MB 4G9FA 2G60H 2JK5A 1EO7A 3ILPA 1PG7X 2JB5H 4FTVD 2H2PC 4OKVB 4ZTOH 5B38A 3MV01 3G9AB 3BUYB 2APXA 4ZXBB 5JTWA 4OZGF 2DYPD 1FLRL 1QVOA 1JHLL 3PDDA 4ZNEA 1TVBA 1A4KA 4YO0B 4LASL 3UP1A 5T1KD 4E0RA 1N6VA 1A1MA 7FABL 3RVUC 5MERA 5HHVH 2XA8L 4I3SL 4O9HL 5EBWA 2XTJC 3QQ4A 3ARGA 3WYRA 2ZUQB 5E8NB 2ARWA 4K3GA 3GMRA 4ZUTA 3U79A 4PJDB 4FQ1H 3QNZA 3WNLA 4Z18A 4PLKD 4S1QH 1DBAH 1FZJB 1RQ5A 2ICWJ 5HDBE 2VLRE 3BGMB 3KPLB 1DUYA 4P46C 2P4AB 1T04A 4L3AA 4X4ZA 3O3EA 1PZ5B 1OTUC 1OSPH 4QRUA 3P4NA 4JFED 2WBKA 5C0AB 2YN5A 4U6XA 3NPSB 5TFSL 3SQOL 5LAXA 1ED3B 3S35L 1R3JA 5DD1L 2HVKB 2IFGA 4NWTL 3RPKA 4RA0C 3GJFH 1N64L 2OL3A 4X9FA 4BSJA 4AT6B 4ONFH 1N5YH 2FEDD 3NMEA 1DQMH 1WBXB 2OQJA 3O45B 2Y4SA 2R1YA 3BAEL 4LRNH 4NZUL 2V2TB 4UIMB 4BFIB 3IU3A 3WHE1 1EXUA 1EHXA 3FCTB 4HJGA 1J18A 3PGFL 1Q9LA 3B9KB 4J1UA 4MSWB 4ODVH 2AJSH 4LNRB 3O2DA 4M62H 4X7TB 4MZ3A 4L29B 4PREB 3O4OC 1HCVA 2DMCA 4TULL 1B4JL 4NC2B 1F42A 4OKVA 3DI3B 1RJYB 4DGYH 2FJFB 2DQHL 2VL5B 2EH7H 3CH1B 2IANE 1ZWIB 3D18B 5T1MB 5F7WC 4XWGL 4I9WD 4C55A 4LSPL 3BE1H 3T4AB 3FN9A 1DQDL 4G9DA 5CILH 3CVHB 4JM4L 1LO2H 1QP1A 3FO2B 2R1WB 5IMKB 2R0LH 3PHOB 3BQUC 3T0ED 3RA7H 3GSXB 4X99A 3WE6B 4NT6B 5F9WC 1U8IB 5E8NA 2C4XA 4GRLD 1I8LC 4KK9D 4JO1L 4PJFF 4JAMB 4J3XA 4PJDA 4TSCL 2IC2A 3BH8B 1ZGLM 1QHOA 1ZLSH 4X6CE 5I8CB 4C4KO 1FZJA 4PJ7B 5IP4A 3BGMA 4DGIH 3C2SA 3W11D 3RL1B 1H3WM 3G6JB 3UAJD 5IB1A 1J0KA 4UU9A 1PZ5A 2OR9L 4F3FA 3EKCA 5DJYA 5CGMA 4RGMB 3INUL 3GMMB 4IRJC 5E6ID 3TWCH 3D2UB 4U1GC 4POYA 4HBCH 3K2MC 4KVNH 4AT6A 3O11B 2AEQL 4GAYA 1UA6L 4WHTB 4ENEC 1TTUA 1WBXA 3O45A 1VERA 5T1DL 4MS8C 2AABH 3CLFL 4WW1B 4M03A 2V2TA 3LD8B 1NANH 1LD9B 4UIMA 4BFIA 2CRMA 2IH3A 3AY4A 3ZL4L 1JGUL 1T1YB 3FCTA 2CD0A 1CWVA 1I85C 4PJ9D 4QNPF 5ACZB 5KSBF 3B9KA 4MSWA 1GVIA 3WIFB 1VGEL 1PKOA 3MMEB 4X7TA 5DS8B 1GZPA 1QYGH 3TLRA 4PREA 2VDQH 2F53E 1WZ1H 5FUOH 1QBLL 2GITA 3RDTB 3CXDH 5C0IA 4A6YB 1IKNA 3PV6A 2UZIL 1PAMA 4IOFD 3GUTB 1RJYA 1V3LA 3L6FA 2I07A 4MXVF 4MB4A 1BIIA 2D31B 3CH1A 3T2PA 3D18A 5T1MA 3VXSD 1JYXA 3T4AA 1ROWA 2W59A 2F8VA 3CVHA 3MTRA 5FHBH 4KJWC 3FOMB 2R1WA 4LVNC 5IMKA 1NBQA 1ODAA 3PHOA 3WE6A 4S1DC 1A7RH 3U4EB 4WO4B 3D39D 2Q7YB 3I75B 1RUPL 2DLFH 3VG0L 3VDAA 3DIFB 2IQ9L 3LEYH 4WCYH 4PRAB 2P46B 1SJHA 4M43H 5I8CA 3ZHKA 4M02A 5INCB 3S36H 4OUUA 4LIQL 4RBPH 5FHAH 3RL1A 4Z7NF 3HE7D 1XEDA 5DD6A 1J88A 3G6JA 2ZSWB 4YIQA 1A6UL 4K3DH 4LHJB 5DURB 5KVDH 2B0SL 3GMMA 2BRRL 2GTWA 1V7NH 3D2UA 1QSEB 3BVNB 4C56B 3VFNA 3O11A 5B39G 5DLMH 4M48L 1SYVB 3V0AC 1MJ7H 5E9DD 5F9DC 1L7IL 4HBQA 4AIXA 4WW1A 1I3GL 5AD0B 3U9PL 1LD9A 4S1RL 2AK4D 1CE6B 1RUKL 2VNCA 2Z92B 1T1YA 1WCBA 3K74B 4N8CH 1XF4B 4DZ8A 1OTTC 2BNUB 1ZANL 5ACZA 4DVRH 1WUNT 1LO0H 2A6KB 3B5HA 4HX1B 2G2RA 3FQUB 3OAYH 1L4IA 2E5EA 3WLWC 3AC0A 3RDTA 2R56L 2X1OA 3DETD 5EZLB 1U9KA 2DBJA 3G08B 2R69H 3B5GA 3VFPB 4P59L 2F54E 5E5RB 2AXFB 5DSCA 4DJMA 3HG1D 4PS4H 2R4RH 2D31A 4GAGL 2YC1B 4N9OB 4FP8L 3RHWK 2DQIH 5E8DH 4OI7A 1QFWI 4PP1C 3F7RA 2VB5A 1EGJL 5JR1L 3VXUD 4Y0GA 3LD8C 2EDKA 2VZVA 1QKZL 2FBJL 2OK0H 2YR3A 1IGCH 3BN9C 5I1KH 3BI9X 4MJIA 4M1DH 4UV4H 3TO4B 3U4EA 3SE3C 4O4YL 2DDQL 3VFGL 4AEFA 3I75A 1NQBA 4HV8B 1DLHA 2CKBB 1NEZA 3BX7C 1SMAA 4OZ4A 4OCYH 1YEKL 3DIFA 3QUMB 1UH4A 1MCEA 4PRAA 4EKXA 1BREA 1I75A 5B8CA 1BWMA 1FGNL 4K71B 4LU5L 3H3PL 4EVNA 4MGXA 4JEGB 2M1KA 1ACZA 1J0YA 2ZSWA 4Y19B 4AG4L 4PJGA 2QADD 5K9KB 4OGXH 1TZIA 1Y6MR 2NY6D 3ARDB 2Q7NA 4WDIB 1KNOA 3OHXB 3BVNA 4UILH 4C56A 1RZJL 3GBML 3SKJL 4AH2B 4LEOB 1SYVA 4ZFOB 5K9OB 1JMZA 1W72H 2JJTA 1UYWL 2EZ0D 1ZSDB 1J12A 5DR5H 2XWJB 3SY0A 1KELH 1R6VA 3VGDA 1CE6A 2KDGA 3WJJC 2Z92A 5F3HB 1ZKAA 2XTLA 2R2HB 3EJZD 4UQ3B 3SDAA 1QRNB 1EMTL 2BNUA 4OZFA 3PUCA 2A6KA 2HJFB 2WSKA 3ALPA 3ZE0F 5B8CC 1QLFB 4U7KA 4OTXH 3KS0H 4J2XA 3P77A 3FQUA 3OJMB 4PB0H 1WJ3A 4KK8D 2W91A 4OCSL 1U95A 4ALAH 3E6HA 5BJTA 1D9KA 3G08A 3SE4C 4BM7A 3VFPA 3VXMB 3FB8B 2CIKB 5ESQA 1MFNA 1FL5B 4JM2D 5GGSA 1G7JA 3CK0H 4NJAL 2YC1A 1UB6A 4QGYA 4RFOL 1DL7H 4I2XE 5SWQB 1HKFA 3D25B 4LHUA 2JJTC 1CGVA 4Z7WE 5HYEA 3QUZD 5L9DL 2B8OT 3WUZA 3NABH 1XCTB 5I75B 3SDAC 3TO4A 1R3HB 3H9HB 1XH3B 3HZMB 4RMUA 3QUXB 4B53A 2CKBA 2F58H 2VLLB 1A7PH 2CLZA 2FJHA 4KDTA 3IDJB 3QUMA 2PUQT 4TTDD 2JJSA 1FYTA 2YA1A 2VZ1A 1D9KC 4KKBC 1QBMH 3VFSB 2YD2A 4QRTB 5E1AB 1MRFH 4NRZA 5JIPA 1HXYA 4WFGD 1CLZH 1Z0MA 1X7QB 2KH2B 3LS5H 1I8MB 5KBNC 4QF1B 5SX4H 2VJXA 2DMBA 3W5MA 4L5FL 5GRZA 5T1LD 5CJQH 3HMXL 4W70A 3V4UL 4CKVX 3MNWA 3SDCD 4PRID 5B4MD 4AH2A 3SJVB 1DBKH 4ODTL 1XGRB 5K9OA 1JZ5A 1I3VA 1DFBH 4X80H 4NO0A 1ORSB 1KN2L 2XWJA 5ESVA 3ABZA 2QSCL 1K85A 3F6LA 2AGJH 4EI6A 1GIGH 3HFML 1DBBH 2OTWA 2R2HA 4OIIL 4UINL 4UQ3A 1L0YA 4L4VB 2JJSC 4QRPD 1EH9A 3ULUL 2C5DC 1TITA 2HJFA 4X7DC 1QLFA 5IBLC 3O9WB 4XMLL 5HHXL 2YKLH 1YEJH 1GPOL 3MJGX 2VZSA 3BPLC 1HHIB 4NQXA 3TO2B 5LXGL 3QIWB 4YPGA 5L2KA 1S8DB 3FB8A 2CIKA 4FFYH 1NGPH 4FTVE 1BVKA 3OV6A 2Y7QB 1OLLA 2WBJB 1DBML 3UJTH 2YUVA 1P69B 5SWQA 4ZOBA 4KVCH 3BKJH 4TQEL 4R8WL 4LLQB 1WZLA 1XCTA 2EDWA 5CEYB 4LCIL 1G0DA 4HEPG 3ME0A 3IF1B 4H25A 1ZTXH 4NCC2 3PV7A 1R3HA 3QR2A 3H9HA 1G9ML 5FA4B 2WBWB 1XH3A 2NX5D 3QUXA 4YHIB 5E5MA 5GS0C 4R96B 2VLLA 1IAKB 4PJCF 3QG6A 1KJ2H 4QHNB 1WLHA 1QHPA 4NQSB 3OB0H 1A2YB 1FVCA 4HC1A 2HWZH 4JHAH 3ARWA 4LLVA 3Q3GA 1ULVA 2NLJA 3IU4L 3VFSA 4PG2C 2J2ZA 4QRTA 5E1AA 4XWOC 4W4NA 4XAWL 2YPKB 1R0AH 4PGZA 5IB4A 4QWWD 1F8TL 1YNTB 3IFPB 1I8MA 4QF1A 4WI4A 1UH3A 2N4IA 1YEFH 5C3LD 5F9OL 4CMMB 1AFVL 4MXQC 4HIHB 5ALBL 1KC5H 5IHBA 3WJLA 4JFEE 3SJVA 4U6TA 4YFLI 1CDBA 3VXOB 1S5IL 2WUCH 4MHHG 4X6DE 1JPGB 4OM0H 1X5AA 5HD8C 2AS5M 4KJQD 3DX6A 4TUKH 1RHHA 1T03L 2WM0A 1SJEA 2JCCF 3DHJA 3N9GH 4L4VA 1AGEB 2EEDA 3VGAB 1WWAX 4KKLC 4LSSL 3TVMC 5I1IH 2VXVL 3S9DB 3O9WA 4LRIC 1DVFD 3T2QA 3ALXA 2A0LD 4YQXL 2Y5TB 4DAGH 5DK2B 3C6SA 1HHIA 3HCVB 1UZ8B 3QZWG 3TO2A 3QIWA 4QHUB 1E28A 5TQ2H 2J3SA 3MLYL 2HFGH 2AVGA 5BS0B 5L8LB 3WJLC 1F2XK 2WBJA 3H0TB 4U1SA 3MUGA 1DQTA 2RB8A 5AYQA 3EJJX 3OQ3B 4PJHF 1I9JH 4Q9RH 3Q1SL 2W9DH 4UV7L 1SHMA 4LLQA 1KFAL 5J1AB 2CQVA 3F7YB 4PJ5D 4XC1L 1D5BA 4P57A 1F4YL 1VFAA 2GSIA 5ICYA 4I9WE 3ARBB 3IF1A 3BRGC 2E7BA 3V4PH 1OP5K 1FZKB 4JJ5B 1KCVH 1XCQB 4YHIA 5JXAL 4JKPH 1BLNA 4DUVA 3KLSA 1KCLA 1FFPA 1IAKA 4MAUH 3CDGA 3LEXB 4QHNA 1BFOB 3T0EE 3CXHK 4OF8A 4NQSA 2Q6WB 3QAZC 1A2YA 2CPCA 4PG9B 2FDBP 4XPBH 1MCPH 2VDOH 3IYLW 1I9IL 1PEZA 4FQLL 1KIPB 3PNWA 1CQKA 3VMNA 2YBRB 1YNTA 3IFPA 4NYLA 1DTUA 4APQB 4QXGH 4YDKL 4CMMA 4UNVA 2AKRA 2BHUA 3NVQA 1YEHH 4HIHA 4R90L 2Y23A 4IRSA 3MV8B 2J5LC 3PGDA 4N0RA 4KRLB 2FD6H 2H3NA 1VCAA 1WFNA 3MACL 2OMBA 2QQNH 3VXOA 1JGVH 2H26A 2VXSH 4KTEL 3BZEA 1WGOA 4JN1H 5D5MB 3C5ZB 4B50A 2JJVA 2DQDH 5I1EL 1M05B 4FXLA 1V05A 3FT4B 3ESVF 3C2AH 2VDKL 2QQLH 3QNXB 2QHLA 1WVZA 3GO1H 5DJXA 2Y5TA 3RIAK 1U3JA 5DK2A 3ARQA 2VLJA 3HCVA 1UZ8A 5EU3A 4MNQA 2R8SL 2FL5A 3ZHLA 4QHUA 3TJEL 1T1ZB 5D2NE 5AG9A 2N7BA 1XZ0B 4JO4L 4K3JL 4OFPA 4HJ0C 4IRSC 3H0TA 4WUKH 2GK2A 1M7DB 3TESA 3V95A 4GH7B 1I1AD 4PLNC 3C5JB 5I6XB 4OLYL 1MFAH 4YBLC 4DQOL 4KMQA 5DMGC 2XQBL 4BSVA 3F7YA 4NKIH 1IEBB 4JRYD 1GJIA 2AAVA 5FGCE 1TQBC 2DIBA 3ARBA 2EEAA 3D1MC 2B4CL 5D7IE 3UZQA 2BVPB 4IS6B 1XCQA 4Z78B 4P2QA 3BGAA 2DAVA 3V2AR 2H2SC 4UT7L 1BD2B 2Q6WA 4YUEH 2DLHA 2AI0H 3D39E 4TOYH 3QXWA 4J3TA 4PG9A 2BVQA 2SEBB 3WIIH 1JUFA 3UC0H 2EC9U 1KIPA 2HKFH 3P9LB 4P2RB 2YBRA 5IFAL 1GOHA 2A9NL 4APQA 3HHRB 2VDNH 4PV8B 4CN1A 5CZXC 4JG0L 4NZDA 2G5RA 2X4OB 3MRHB 1QSFB 3HRZB 4CW1B 4MNGB 2OYPA 3BRFA 5ECJE 2EDBA 2Z8SA 3DOSA 3L3OB 1ORQB 3LPGA 1LEGB 2FGZA 3VI4F 3A67H 3VRLF 1FRGH 4NRYB 4ONGL 1G7LB 5D5MA 3MOAL 3C5ZA 1TJIH 3QWQB 5E9DE 1PSKL 1M05A 3S34L 1RV6X 3KPSA 4AMKH 4ZFOL 2VQTA 4HS6B 4YHOL 4XVJL 1RZ7L 25C8H 5FGRA 5T5NG 4LP4A 4NRXB 2CK0L 3QPXH 3R1GH 2C3WA 3HAEH 1UM4H 1T22A 3IDMB 4G8GD 3GHEH 1XGQB 5IVXF 3NCFB 2HFEB 2FLBT 1NDMB 4JVUA 3BKYH 5LQBL 3L5WB 2MPAH 1EVUA 3WEXB 1M7DA 4LSRL 3QUKB 4IJ3C 4K07A 5B22A 2H32B 3C5JA 2A6JB 2FHCA 4AYFA 3HG1E 4F7CB 2ATPA 5D1XA 3STLA 2A77H 1T80A 3EYVB 2QEJA 3O4LB 1RZKH 2OZ4L 2BVPA 3VXUE 1E4XL 5IBUG 4Z78A 4J6RL 5DRXB 3RGHA 1G6RA 1L9MA 5A40E 4D2NA 4OD3L 4CMHB 1TJGL 3HUJE 1BD2A 1U3HB 1FE8L 4L4TD 2SEBA 4X7CC 2DQUH 3MRMB 4EUPH 5EB9A 4F7PB 1MFCH 2R0ZL 3IS1X 1CL7L 4GKSA 2VLKB 1L7TL 4XP4L 4PRNB 4DTGL 4E41B 2HTLD 1U91B 3O41A 3C9NA 5D8JH 1XGUB 2VXQH 3HRZA 4KQ3H 4MNGA 2B5IC 5D1XC 4OZGA 5C0NC 1B2WH 3DMMD 3LQAC 1N0LA 5I8KH 3L3OA 3K4ZA 4HZAA 2WP3O 4AL8L 5CD5C 1X6LA 4NRYA 1G7LA 3QUYB 4OGAC 5E8OA 6CGTA 3FRUB 2EDLA 2CUHA 1AHWA 4OFDA 1RIVH 2O93L 1WIPA 1JPTH 1MCDA 1IZJA 2NNAB 3QQ9C 4HS6A 1EX0A 1Q0XL 3L3HB 3TBWA 2YA0A 3WFEH 5GSRB 4FABL 4NRXA 5DJ2B 4XMPL 4OD1H 2W0FB 4BK5A 3IDMA 2D7PA 1XGQA 3OAZH 1NDMA 4JPKL 5I19L 2QHRH 4Z6AT 2R23B 4PR5B 2PXYB 2B1HH 4G6FB 3PHQB 3WEXA 2VO5A 3HNSH 1NEUA 2BJML 3QUKA 5EU7C 2H32A 2A6JA 4LQ1A 4U1HB 4W6XB 1FIGH 5DUPL 4GG6F 5D2LF 4F7CA 1MCCA 4OFIA 5KW9L 1MQKH 3EZ8A 5GRWA 1U8OA 2H1PL 4MMZC 3EYVA 4H0GA 5I1DB 2IAMD 3O4LA 1AHWC 3S88H 3PP3K 2PW1A 1MFEH 5EPMB 2F19L 2MQCA 4ZOCA 1YEDB 5DRXA 4MA1B 4UNUA 1T0NA 4LGRB 1YJDL 3MFFB 1IT9H 2YUZA 4OQTL 1A7QL 1U3HA 5C6PB 1AGFA 5L7XL 3OKMB 4MYWB 2PYFA 2ZOLB 3SDDA 2EC8A 4YHML 3T3MF 3MRMA 1GC1H 1OAUL 5ETUB 1ETZB 3NFNA 1Z9MA 1XT5A 2VLKA 4NM8H 5GRUH 3D87B 3UTPD 1OLZA 4PRNA 4E41A 4KK5D 1U91A 1YA5A 3D85D 1K8DB 4WI8A 1XGUA 1FG2B 4XVUC 4D94A 1H15B 1TETL 1CXEA 4U1NA 4NQTA 4X5WB 4XAKD 4ERSH 1CFVL 3V4VH 1BF2A 1T7XA 2WQ8A 1S7UA 4JREB 4G8IA 2O5ZL 4PRIE 3QUYA 3QQNA 1HQRA 1JVKA 32C2B 4OCXH 4BQ8A 2AK1L 3TBYB 3RWIB 4U3HA 4OLZL 2UWEB 1OGTB 1VSCA 1SM3H 5DVMA 3SDDC 4QXWA 5GSRA 3ULVF 4JKWA 4JLRA 4U1KB 4NSKB 3SKOA 4PJFA 1AO7E 4QRPE 3QJFA 3HI5H 4FZEH 3RVXC 2D7NA 3SDYH 2CK2A 2XZQL 1CR9H 4X4ME 2NY4B 4LVOC 1OD7A 2QQQA 2R23A 4PR5A 2PXYA 1Z9OA 1NFIB 3F7PC 4GFTB 4XNZB 3WFDL 2DJSA 4RFEB 1G84A 5DVOA 5BV7H 1BQLH 2K1MA 1B0WA 4H1LH 2VUOA 2HH0L 1QFPA 1BEYL 5E70A 5I1DA 1BGXH 1U2CA 4NHCH 3QDMA 2YSSB 3QPQC 5EPMA 5BZDA 1YEDA 3KHQA 1LDPH 3K0WA 1PLGH 4N0UB 5K9JH 4B0MM 4FRWA 1CFSB 4S0SD 4LCYB 4I1NB 5GS1C 2NX5E 4NC1C 2ZOLA 2Q8BH 1FHGA 4LF3B 4J7RA 3EO9L 5KSBA 3KPOA 5DQJA 2P44B 1X5ZA 4F2MB 4BJLA 5ETUA 2A6IA 4TNWK 4Q0XL 5HDBF 1AE6H 2WV3A 4IDJL 1F6AB 5HI3D 3KLAB 3HR5A 4N1CA 5JPNB 5E7FA 1ZEAH 3RGVC 1IAIH 3BKCL 3N1FC 4ZD3L 2LAAA 1H15A 4X5WA 5ALCH 5DT1L 2NXYD 4KFZC 1J05B 4ZMAT 4M5ZL 3AAZB 3ZDXE 3EIFA 1CBVL 3GHBH 3M8OL 1KLGB 32C2A 2GJ6A 5GRJH 4KUCF 1NMAH 2CIIB 3DYOA 3TBYA 3X3GL 3U4BH 1A9EA 3RWIA 1VENA 3W0WD 1OGTA 1KXQE 1M7IA 1AGCA 3CSYB 3S4SB 5E6YA 1ZVHA 5IBUB 4P3DA 4U1KA 2AJUH 4ZO7A 4K9EL 3STBA 3MV11 4GRWF 3I2CH 1V5JA 2BFVH 3MCKB 1O7VA 4NOFA 4XMKL 1UWXH 4LDLB 1BIHA 3P0YH 2VC2H 2G5BA 4M9PA 5HVGB 4W81A 4XNUL 5FFLA 1LO4L 3F6IA 5MEOB 4RFEA 1OT1A 1LE9B 4OLVH 1OWRM 5CJBA 2ZUSA 1XGYH 4GMTH 4Y16C 3IDXH 4HFWA 1K5NB 4Y4KB 2YSSA 5LWYH 5I8OL 4QKXB 3PWJB 3OKKB 4LVHB 1CFNA 4PJ5E 5BMFL 4N0UA 1UVQB 3ARFC 2X9WA 1CFSA 15C8H 4WEBL 4LCYA 4OLUL 1MCHA 3GMOB 2HT2D 3TN0D 4BFBD 3GIZH 3PQYE 5DJ6B 5D7LA 3BZFB 1ADQL 5I18H 3GSVB 3MJ8B 4KTDL 5JUEL 2HT3C 1F6AA 1L6XA 3TH2T 3KLAA 1EGJA 2X1XR 2DQTL 3MBED 2NY0D 4YX2L 5JW4R 1YN6B 2YMXH 5FO7B 1PDKA 3WD5H 5MEPB 5DA4A 1YYML 3KLHC 4KHXL 1RZJC 1J05A 3L3DB 3AAZA 3ZMRA 4EDXB 5T3ZE 1MF2H 1KJMB 1G7HA 3X13A 1P6FA 4HUMB 3BYYA 4WRLA 2VDML 1ZLVH 1BJ1H 4JG1L 2IH1B 1T3FB 2DD8H 1RPQA 1RJLA 3LSOA 3OR6A 3QYCA 4FQXC 2ENYA 3NAAH 4PUBL 1CG9B 3C8HA 1AD9B 3AMKA 2PO6B 5C0BD 1KCKA 3S4SA 4BA8A 3GJFK 4CGTA 5E4IA 1EHAA 2EDDA 4G80A 2ZWLT 2X9XA 3FMGH 2C7UB 5IMMB 1SEQH 1HINH 3KWWA 3MCKA 1F6LL 1JNLL 1CXLA 4LPVA 1UKSA 1B4RA 5IHUH 2APTA 1LE9A 4WNQB 4JO3H 3ARYA 4OZHE 4BQBA 4MVBD 5I9QC 4TYUA 1RI8A 1N3NB 2R0WL 3QWOA 1YQVH 1P4LB 2VDPL 2I9TB 3KPMB 4Q6IB 1OB1A 4OFYD 4YHKH 3DV6B 4JY5H 1DZBA 1K5NA 4Y4KA 1K8IB 5CLTA 5KS9E 3NACH 4MCZA 4C54A 5HVHC 2DTML 4KMTL 4AIOA 4JFXB 4JRYE 4HFUH 4P23B 1UVQA 4B5EA 4I18A 1U8LB 3HR6A 5FUCC 4ELKA 2FH8A 3RZCB 3O6FB 1UADC 1AR1C 4RMRA 5GISL 2L0DA 3GMOA 3SO3B 4PRBB 4X9BA 4MJ4A 3BZFA 3QWRA 3GSVA 5T3XD 3LV3B 1ZMYA 5CUSH 4WU5B 3Q6GL 4HUWB 1CLYL 4Y2DD 1F6FB 3V8OA 5KSUB 5ILTL 5T33L 4D3CL 2FX8H 2A9ML 3U83A 3C6LB 2GTZB 5FO7A 4NUGH 2DL2A 3L5XL 3TCLA 5MEPA 4D9LL 5CJ8A 4KI5F 3W82A 2FX9L 4RRPG 2COQA 3HA0A 1RULL 2ZUVA 1KJMA 1BOGA 3S5LA 3D48R 3OJDA 1RD6A 4I18C 4NQDB 4Q7DA 2DQGH 4X4YB 2IH1A 3SPVB 2BNRA 4JRXD 4BKLB 4H20L 5FECB 1CG9A 1AD9A 5I1AA 1JPFB 2PO6A 3VFOA 3DRQB 1W72B 3LMJL 1NGQL 5JDSB 4PJCB 3B2VL 4BZ2H 3T2NH 2C7UA 3F7VB 5IMMA 4HIIB 3B9EA 4IM8A 5DJ0A 4NN7B 1FLTX 3WS3B 3WNOA 1KJVB 2CKNA 2IBZY 1KIRA 4JFHD 3FT3B 4G8GE 1ZLWH 5JHDD 3KYOB 4HZLB 3KPRB 3EFFB 3MGTA 3KNBB 4HF5H 4FQQB 4WNQA 2WINA 5FM5O 4HIXH 3RTQD 5TE7H 2LFGA 5EZIH 3AGVA 1JPSL 2G9HB 1P4LA 1YEIL 5IFJB 1U8QB 2G60L 4Q6IA 4QHKI 1IAIM 3DV6A 1CTNA 4FXGB 5J0BA 2XN9B 1ND0B 1K8IA 5J12C 2J8UF 3LKPA 3GI8H 4P23A 2C1OB 1G9MC 5D6CB 2Q8AH 5HYQB 1PVHA 5EBLB 2JCCB 5ACLA 4J3WA 4P9HH 4CJ1A 3UDWA 4HWBH 3LHPH 4MJ5A 2FCBA 4EN3B 1YUHB 3LV3A 4XTRD 4Z7QF 4UDUA 5CCKH 5HHVL 4CDGC 5SV3A 1X9QA 4YDLB 3KYKL 4HUWA 2EDNA 5EDXA 3P0VL 2EXWC 3VXQB 3C6LA 2GTZA 4P48A 3PXJA 1IL1B 4P2OB 5CINH 3ARRA 2AERT 3CNKA 3RWDB 4PJHB 1U8KB 5D93B 4S1QL 1DBAL 4ZQKB 5E8EB 4N9GA 4NQDA 3QO1B 1G1CA 1NSNH 2VZOA 3SPVA 3V7AE 1Q0YH 4QHKJ 4J3UA 5D71L 2H2PD 4P5TB 4BKLA 2A38A 1OSPL 3NTCH 5EU6B 1JPFA 4F7MB 4JR9H 3UDWC 1E4XI 5JDSA 3SOBH 4PJCA 4ZS7H 2X4QB 1J5OH 3F7VA 2J8HA 2M26A 4HIIA 4ONFL 4D9RD 4JN2B 3RIFK 3VWJD 1E0OB 2AJVH 1DQML 1T83C 4HZLA 4LRNL 2FWOB 3EFFA 3KPRA 4N1HB 3BDXA 3FFCD 4FQQA 2BHZA 1RZIB 2XTJD 4JFYB 2AEIT 4EBQL 5ITBH 1K6QH 4ZS6C 3MXVH 3VXSB 5IMOA 3CFBA 2EKJA 4WUUA 2AJSL 4KXZI 5LBSH 4M62L 4W4OC 4FXGA 1ND0A 3OJVC 3TF7C 2VE6B 2ZOKA 5T3ZD 1DBJH 1RY7B 5KVMC 4XX1G 1F02I 1NLDL 2C1OA 5D6CA 5C6WH 3JWDH 1L6ZA 3QIBA 1VFOA 4DKEH 5HYQA 5TE6H 5F70A 1OTUD 1ACYL 1KPRB 4GXUM 2JCCA 1ZOXA 5D7JA 3F58L 4YK4C 3FTGA 1FO0H 3BE1L 1KF9B 1J0ZA 2ESVB 5CILL 1PYWA 1YUHA 2GAZA 3HAEG 5I30H 4S10A 4I77L 3F62A 1KJ2B 1C7SA 5E1HB 2R0LL 3ARGD 5FUZH 3RA7L 2VABA 1MJJB 5DRNA 3VXQA 3D69A 3CXHJ 3WN5B 3UTPE 1EHNA 5TE4H 5I73C 1PBYA 1XIWA 4PJHA 4FFWD 3MOBH 1U8KA 1A6ZB 1H3XA 1TZHA 1WT5A 4XH2B 1ZLSL 4ZQKA 1BZ9B 3QO1A 5F7DB 4MJ6B 4XAKE 2AK4B 3QIBC 4GBXB 1JGDA 4P5TA 3DPBA 1MIMH 1A6WH 3OKNA 3BD3A 1H8NA 5AAWA 5D7JC 4F7MA 4LSQL 1S7XB 4YHYB 1KPVB 2X4QA 4PB9H 3TWCL 4KAQH 5GS2D 5HHQA 1CK0H 4I0KA 3OKYA 2HJKB 5CWSB 3DBXB 1AJ7H 4JN2A 4WWKA 5BRZD 4LNVA 3E8UL 1RJZA 3HS0B 2AABL 4EUPG 3V6ZB 2WWKO 3R0MA 2FWOA 1RZIA 1JGLH 4JFYA 1XIWC 4W68A 3MRCA 1FNHA 5E94A 3S3PA 1EFXD 2FB4H 3C09B 1T2QH 2W0KA 4Q9BA 2NY5H 3VJ6B 1QYGL 1OCWH 2RGSA 1OAZH 2VDQL 4GRMB 5GHWH 1WZ1L 5FUOL 4FZ8H 4OJFH 4ACPA 2B4CC 5T3XH 2YK1H 4HQQH 3BWUC 1NH6A 3F12B 1KPRA 3RWHB 3EDKA 3HC3L 3VG9C 1W0WA 4WWKC 1NJ9A 4JB9L 1JRHH 2ESVA 7CGTA 1UB5A 3VH8G 3RQ3A 1KJ2A 2XA3A 4HW6A 3KR3H 4GW5A 5IVXB 1A7RL 2YPLE 4MS8D 3VDBA 1NLBH 3WN5A 3E3QE 3D0VB 1G1YA 1TJHL 4G7YH 3H7LA 1BBJB 4XPGH 5IV2B 4C83A 1FSKB 3LEYL 3MCLH 1A6ZA 4KU1A 4WCYL 4M43L 1EEZB 3NPZB 2YHGA 1U3YA 1MLCA 5DTFA 5F7DA 1IGIL 1FN4A 2EXYC 3S36L 3P4LA 2YOCA 1OWWA 1CICC 4X6DF 1LK2B 2DM7A 3U46B 4OCRH 1I9RH 4FQHB 5DJDA 4K3DL 4JFDB 5KVDL 2OZ4A 5AZ2H 1HHJB 4BK4A 1S7XA 3FQTB 1KPVA 5J3HC 5CEZD 4M8VA 2ZKHH 3W0WE 4GMSH 2N1KA 4NJ9H 1CGSH 5CWSA 2KKQA 4KH2A 5DLML 1A3LH 5BXFB 4HCRA 1MJ7L 3HS0A 4KKAD 1NFKA 1KB5H 1NUFA 3V6ZA 2I26N 5HYSG 3U9UB 1WAAF 2IQAA 4ELMF 4N8CL 2F9BT 1JHKL 3B9KD 2VUYA 4PJAE 5GGVH 3BSZH 4L9LC 1LO0L 1V7ML 3WL9B 4UT6H 3VJ6A 2HT4D 4CBPA 3T08A 4GRMA 2V2WB 3TA3B 3NZHL 3CFCH 4L3EE 4ZUUB 1RAMA 4X7EC 1KCSH 3QEQB 3HB3C 3GSQA 5CP7A 4TTGA 4RRPA 5JW4M 1YDPB 2F5AH 1RUMH 3BPNB 4HUUB 3VCLB 4UT9H 2IEPA 4PS4L 4RMSA 3BJLA 4WV1A 2BCKB 3WXVL 1P9MA 4QHMB 5HTSA 4S11A 4Y5YC 1KXTB 3T04D 4M6OH 4GW1B 1WWCA 5FYKD 3TYGH 2Y1VA 5IKCB 4S1SH 2OK0L 5I1KL 4OD2B 5IVXA 1AXSA 1VA9A 1MRCH 3GBLA 5EOQL 2Y06H 1BBJA 5MP6H 2PN5A 1BAFH 1MREH 5E00B 1JNNH 1OAXH 1C8PA 1JI1A 4WFFD 1EEZA 1H0DB 3TP4A 3ES6B 4FQCH 4H1LG 4NQEA 2NY1C 5D2LB 1FPTH 3U0WH 1W2KT 4E9LA 3OL2A 1LK2A 3X11B 3MNZA 4N1EA 3SKNB 4HUNB 3QXVA 1SQ2N 4FQHA 4OGXL 5ITFB 4R2GC 3VXPA 3R4DA 5CKGA 5GJTH 3BHBB 4HMEA 4JFDA 5GXBB 4WV1C 1P9MC 3V52H 5B3NA 3D2UD 1PKQB 2FH6A 3CSBA 3FO1B 4UILL 4FQ2H 3ZYJA 2APWA 5BXFA 1J8HB 3KVQA 4KC3B 3BMVA 3EDEA 1W72L 3TV3H 2UZXB 5DR5L 3CH8A 3VWKA 4KV5F 1KELL 3U9UA 5JZ7D 1IMHC 5T3ZH 1AQKH 4ZO9A 3M45A 4UBDD 3WIHL 1MSPA 8CGTA 1ERNA 1FSKC 3HAEB 2ED7A 2BRQA 3I9GH 4UOJA 1HE7A 4OTXL 3H42H 2Q3AA 3SCMA 3WFBH 3TA3A 4RAVA 3RDTD 3AS1A 5K9QG 4ALAL 3LAFA 3P9MB 4KRNA 3RWFB 3QEQA 3QI9C 5KTEH 2C1PB 1Y18B 3BN3B 1YDPA 1HN1A 4U05A 4YC2B 4YH6A 5M7QA 4HUUA 5D7IF 3ZDYE 1ZV5A 5DUBA 3CK0L 1YJDC 3CU7A 3IXTB 1DL7L 4Y7MA 4JCMA 4XBGB 4QHMA 3OXSA 3B2UC 1OY3B 1LK3L 3C5SB 3RNQB 4F37K 4Q9QH 3JWNC 3VWKC 3IT8D 3X14B 3RWCB 3NABL 2XG4A 4KKCC 1U58A 3U1SH 5IKCA 2CDFB 4MJID 4CNIB 4N0YH 3UYRH 4WO4D 5I1LB 3OPZH 1IC4H 4OV5A 3LKOA 2NR6D 5T3XE 3BEVB 4OZIE 2ZUXA 5MENB 4MAYC 1TCRB 5HGHA 2F58L 3SCMC 2CDEA 3UZVB 1J1PH 1NC2A 4EUPB 5IM7A 3CSGA 4O5LL 1NBYB 4H0HB 3AB0C 1H0DA 3ES6A 3H3KA 5FYJU 1RVFL 1OP3K 2Z31C 4GG6A 1QBML 2OL3H 5GS2H 1MRFL 1UQSB 3B6SB 3SKNA 5ITFA 3ZDZE 5DURD 2EH8H 4MQXC 4F9LA 1X44A 5T5FL 2H6PB 2NPLX 5E56A 5I15H 3EYFB 3KJ6H 1P5VA 4JRXE 2NXZC 1PKQA 1QSED 4KJPC 5CJQL 4ZO6A 4C56D 2YD6A 3FO1A 3PWUB 2I5YL 3LKNA 1TMCB 1CFQB 1J8HA 1NMBL 1UM5H 1UJ3A 1R5VA 2R0KL 5DXWA 1A3RH 3O2DH 3CUPB 1OT2A 4X80L 4OF3A 3E2HB 2KBGA 1NCUA 4P2YA 5MEQA 1MNUH 2AGJL 1KBGH 1U8PB 2EKSB 5D7SL 4U2ZA 3VH8B 4JFHE 5JHDE 2E7MA 1IAMA 4IBLT 1FL3B 4HGWB 4J3VA 3O0RH 3MOQA 3FRPG 3CDYA 2GEEA 3IDIB 3P9MA 3RWFA 5HYJA 2C1PA 3KXFA 1D9KD 2ATKA 4F9LC 2VXTH 1LO3L 3CU1A 1CDUA 1HHHA 2FEEI 1B6UA 2EIEA 4BZ1H 4FFYL 4R26L 1NGPL 1MAMH 5D1QB 3IXTA 3UJTL 4LHUD 1H8SA 2R15A 1UJ3C 3HUJF 4KVCL 4RMTA 3C5SA 3RNQA 1BVZA 3X14A 1JL8A 3RWCA 4LARH 1F13A 1A6TB 5DUMH 1BZ7B 4MDJB 4PGCB 3TO4D 1HEZB 4GRWB 1ZTXL 5GGRB 4R6UA 2W60B 5C0EA 5EZJA 3BEVA 4XB8A 5F7LB 5MENA 2GJJA 4NKMB 4WHDA 1MH5B 5E6ZA 4EUPA 1C16A 5HYSB 4NQUA 4LK4A 2X70B 1NBYA 1FYTD 2HWZL 5IBLD 2F8OA 4IOIB 3W9DA 4YDJA 3Q6FB 5CEZH 2XXCB 3U30B 1R0AL 1UQSA 1RHFA 1IE5A 2ED9A 1YEFL 2DQEL 1C08B 3ARDD 3JV6B 2H6PA 1Z2KA 3VA2C 4K7PH 4AK1A 2BY3A 5SWSB 4MXWH 1A6VH 1P7KB 4P5KB 3V0WL 2AXGB 3QB7C 1EFQA 3MUJA 4K9EC 4BUGA 1LP9B 1BVLA 5E08L 4OM0L 3FO0H 4X98B 4KRPB 1MCQA 3OR7A 5ANMB 4NCDA 5DGQA 4D9RE 4GS7C 5TH2B 3U7YL 1GXEA 3O8XB 4O51B 5JA9A 2P5EA 3VW3H 1TQCB 3N9GL 3VH8A 3BPOC 1YECL 3DUUB 4Z8FL 5I1IL 2HRPL 3GBNH 1U41A 3FFCE 1FL3A 1WEJL 4HGWA 2NTSP 4DAGL 3H3BC 4IIQC 3IDIA 3OKLB 3QRGH 5HHME 4EQ2A 3CVHH 3VXMD 3CPLB 5BV7B 3MXWH 4XWOD 1A1OB 2I60H 5TJWK 3L1OH 4H1LB 1H3GA 1FNEA 3QISA 2BOBA 4RDQF 4F33B 5D1QA 1QTYT 3QIUA 2HLFC 1INDH 1C5CH 4P9MH 2Z4QA 4HKZB 5EUOF 1FC2D 2NY3C 3UPRB 1H5BC 4Q9RL 4DEPB 5GZNC 2W9DL 4V1DB 4ZNEE 2JJWA 4S2SA 2OP4L 4ZPTA 1FGVH 4MDJA 3S96A 4AEHH 3TEUA 2J12B 4OM1H 1HEZA 5DFVC 2GSGA 4ZO8A 5GGRA 3V4PL 3JBG7 4WTZA 1KCVL 2YRLA 3QUXD 5I1CH 2FRGP 3JTTA 3QDJB 5EORL 4X8XA 4JZOA 4K7P