2P80A

Solution structure of the complex between nitrite reductase and pseudoazurin from a. faecalis
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
335
structure length
335
Chain Sequence
TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
publication title Low resolution solution structure of the 152 kDa complex between nitrite reductase and pseudoazurin from A. faecalis by paramagnetic NMR.
rcsb
source organism Alcaligenes faecalis
total genus 68
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2p80A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2p80A02
2GC4C 1BXVA 1JOIA 3T71A 4A2GA 2R7EB 4G7SB 2PLTA 2J57A 2Q5BA 1URIA 5IY5B 1SHWA 1L9SA 3PXLA 2HRGA 4N8UA 3CVBA 4NB7A 4G71B 4Q8BA 2QPEB 3FYIB 2FQGA 3X1BA 2BP8A 1IKOP 2AZUA 1RZQA 1OF0A 2OV0A 3SBQA 4YSUA 2PPAA 3S3BB 2AVFA 1IBZA 3OQRA 4HCGA 1JVOA 1YLBB 1OV8A 1BYPA 3TU6A 1OE1A 4BDVB 4X4KA 4YSDA 3V9EA 1OCRB 1JXDA 3IN2A 2IDTA 2EIKB 1JZFA 3TASA 2GHZA 1KBWA 1CYWA 3AG2B 4FAAB 1DZ0A 3T6ZA 4WTQA 2YAEA 2R7EA 2H5UA 2ZONA 3FU8A 2FQEA 2PP9A 1M9WA 1VLXA 1JZGA 1PNDA 2JFCA 5PAZA 2EINB 3CG8A 3ZDWA 1WA0X 2UXGA 1BEXA 4E9WA 3WNJA 1FA4A 2YXWA 1NWPA 2P80A 2GC7C 2VN3A 1AG0A 5I6OA 4AZUA 2XWZA 4W9ZA 1V54B 3PPSA 2Y1AA 1EZLA 1AZBA 1CUOA 3N2JA 2B08A 1OCCB 3NJHA 1X9UA 1SF5A 1TEGA 3PAVA 2TSBA 1ET8A 1A4BA 2HZHA 4BDVA 2W88A 3NYKA 3ASOB 2UXFA 4CSPA 2NRDA 3X2QB 1BXAA 1ZDSA 2XX0A 1ASOA 3PAUA 2MTAA 4PAZA 1SDDB 3QJQB 3HEIB 4YSRA 1ETJA 6PAZA 3IN0A 3SQRA 1KV7A 1KGYE 2HX8A 3AY2A 3ERXA 2IDUA 1IC0A 1SJMA 4W1TA 4KOBA 1XB6A 4G7QB 1OOWA 2DYSB 3NJLA 3UADA 1TKWA 2VW6A 2YAPA 4KNSA 6PCYA 1PZBA 2XU9A 1XB3A 4JHVA 3EH4B 3FQYA 3AG3B 5AFAA 1A65A 3ABGA 2AZAA 2JXMA 1PLAA 5I26A 4AKQA 2DV6A 5F7BA 2Y69B 1J9TA 2GI0A 1V55B 5B7FA 4A2FA 1AZUA 1AG6A 1AIZA 2IH9A 4CSZA 1HAWA 1JZHA 5B3SB 1SDDA 2GIMA 1GS6X 1NDTA 1OCZB 1WAEA 4FA7B 4ENZA 3ASNB 5B7MA 2PCFA 1AANA 2H3XC 4BXSV 3JT2A 1NIBA 2LLNA 1A8ZA 2XUWA 3H56A 5ANHA 4BWTA 2BW5A 3EHBB 1L9PA 1KCWA 4UAHA 1ASQA 1GR7A 1A3ZA 2EILB 2UX7A 3OMNB 4L0PB 5EHFA 3ZX1A 4MFHA 4E9YA 3AG1B 3NSDA 2PPCA 3OD3A 3DIVA 1MDAA 2VM3A 2BZCA 3S3DB 2IH8A 3NJIA 3TBCA 1J9SA 1CYXA 3UAAA 1JZIA 5TK2A 2IAAC 1TEFA 2YAFA 5F7AA 1W6WA 7PCYA 5AZUA 2BW4A 4HCFA 2YQBA 5B1KA 3U25A 1A4CA 3X1EA 3NP4A 3WI9A 2X87A 1SFHA 2GB2A 1GY1A 1ZIAA 4WKXA 1JZEA 1AAJA 4KO7A 3OMAB 3UABA 3UAEA 1A4AA 3NJFA 4DP0X 3CDZB 3SBPA 4DP8X 4DP4X 3FU7B 4HZ1A 2DYRB 3QJUB 4AKPA 3WKQA 3X1FA 2ZOOA 5FC9A 5PCYA 3NSCA 4DPCX 2VW4A 2AFNA 2QT6A 2X88A 4F2FA 2CALA 2FT8A 4JKNA 1PAZA 3GDCA 4G72B 1I53A 2CAKA 3EF4A 5I28A 1NTDA 3EH3B 1RCYA 2YAMA 1ZPUA 3MBWB 4HCIA 2PP8A 1GYCA 3QJTB 4KO5A 4NAJA 3T6VA 4A67A 2YAHA 2UXVA 4YVUA 2CCWA 1J5CA 1TU2A 2B3IA 1V10A 1WA1X 3NJKA 1AZCA 4P5SA 4DP9X 4YSCA 4BWUA 5TK4A 3N55A 4YL4A 1JVLA 1QNIA 3NJGA 1BAWA 3CDZA 1JXFA 2PCYA 2BWIA 1WS8A 2XXFA 3FU7A 1IBYA 1NIEA 2UX6A 1EHKB 1KCBA 1E5ZA 3FQ1A 1AZNA 1BQKA 5I6PA 1ASPA 2J55A 3G5WA 2CUAA 3QJSB 4YSEA 3QQXA 3AZUA 2E86A 4KNTA 2PP7A 5D4JA 1L9TA 2XV2A 2BP0B 5I5JA 3GXUB 4HAKA 3FT0A 4YSTA 1J5DA 1OCOB 4ZK8A 4A2DA 3FSAA 3DTUB 3MX0B 3ZIYA 3QJVB 4GY4A 5I5MA 4E9RA 5AKRA 4DP7X 1OE2A 5I6MA 2QPDB 4BK5C 1E5YA 4YSPA 1GY2A 2HLEB 3UGEA 4HHWA 1SF3A 2YAOA 1JZJA 4M3HA 2I7OA 4AKOA 2VM4A 2YXVA 2DY2A 3PLYA 1MG2C 1PZAA 1X9RA 2VW7A 4F2EA 4YSAA 1GS7A 2AANA 2FWLB 1AACA 1ILUA 3FPYA 4GYBA 1MG3C 1NWOA 2BO0A 1AS7A 1GS8A 3DKHA 2BP0A 3NJNA 3NJJA 4NERA 1AS8A 4Q89A 4GXFA 3OM3B 4DP5X 1PMYA 4GP8B 3JTBA 1AZRA 1JXGA 4E9VA 3GYRA 1BQ5A 1W6LA 4P5RA 2W8CA 3NP3A 3ZBMA 4G70B 2JKWA 3FU9A 5D4HA 3H4FA 1R1CA 3UACA 1L9QA 2ZWNA 1DYZA 1PLBA 3HB3B 2XV3A 2TSAA 3CVDA 4HALA 3NT0A 3FPXA 1L9OA 2YARA 4KO9A 5I6LA 4QKTA 1BXUA 1PZCA 1J9QA 2PPDA 3CZUB 2N0MA 2QDVA 4YVNA 4DP1X 2EIMB 4QLWA 3FSZA 1NIFA 4G7RB 1MZZA 1OE3A 2CJ3A 2XVBA 3BVDB 3NJMA 3ABMB 4AX3A 3C75A 1HAUA 1SNRA 3RYMA 1ILSA 2FTAA 1NIAA 3TA4D 4KO6A 2XYBA 5B1JC 4DPAX 4E9SA 2BZ7A 5B1JA 4A2HA 4E9QA 4BXVA 2J56A 5I5IA 3AG4B 5B1AB 3X1GA 1PF3A 4KOCA 2IWKA 4UANA 1SFDA 1GW0A 4DPBX 1AQ8A 2RACA 2XLLA 2I7SA 1RKRA 3WKPA 3FSVA 1RZPA 3ABLB 3FS9A 1NINA 2HRHA 2HX9A 4EF3A 7PAZA 2H47C 4A2EA 1ZV2A 1N68A 1L9RA 2OJ1A 3SBRA 4DP2X 4AI7A 2VMJA 5A7EA 2XXGA 1UATA 1NZRA 3TBBA 1KDIA 1ET7A 2VSMB 4A68A 3FYEB 2IWFA 4GP4B 4HIPA 1E67A 2IWEA 3L45A 1W8EA 3V9CA 2P80D 2QDWA 3FSWA 1IUZA 4TXVB 2IDSA 8PAZA 1XMEB 4PCYA 3IBOA 1ZIBA 1PNCA 2FQDA 3PAZA 2BWDA 3QJRB 1KDJA 1T5KA 2A3TA 1PCSA 1J9RA 1GSKA 5B7EA 4N4YB 4E9TA 2OCCB 3KW8A 2IDFA 3IEAA 4K9JA 1KBVA 2XX1A 4M4RB 5I6NA 3S8FB 1FFTB 1NIDA 1WA2X 2I85A 2Q9OA 3QPKA 2DWTA 2PPEA 3WNIA 3X1NA 1ET5A 2IDQA 1AR1B 1NICA 1ID2A 3BQVA 2FQFA 2XV0A 1N70A 3CVCA 3NSFA 1SHXA 1BYOA 2HX7A 1MZYA 2VSKB 4F7KA 9PCYA 2HXAA 3T6WA 2PPFA 3WIAA 3OMIB 3EH5B 2FNWA 3PCYA 1KYAA 5E9NA 2GBAA 4UF7C 3FQ2A 1E65A 2UXTA 2FJSA 3ABKB 4BWWA 1FWXA 3H4HA 1WS7A 1QLEB 1HFUA 2YAQA 2DWSA 2WSDA 2J5WA 1CC3A 4DP6X 1BQRA 4YSSA 4RH4A 2FT7A 3T9WA 2CBPA 2WO3B 1PY0A 3NSYA 3WG7B 2BP8B 1AS6A 1AOZA 5I6KA 2GSMB 3AW5A 4JHUA 1PLCA 2EIJB 2ZXWB 4GP5B 5B1BB 4KNUA 1ZDQA 1CURA 3S8GB 4HHGA 4YSOA 1NPJA 1NPNA 1QHQA 3IE9A 1B3IA 4YSQA 2FT6A 1M57B 1E30A 3KW7A 4A66A 3T6XA 4E9XA 1XB8A 1ADWA 3D12B 2BHFA 2WO2B 3S3CB 5D4IA 1M56B 2MRYA 5LDUA 1F56A 1JERA
chains in the Genus database with same CATH superfamily
2BOLA 3HG5A 1PJWA 4LSRL 1D5IH 5D7LA 3EXJA 4YAQA 1HJBC 3VXUB 1DQQA 5I30H 4Z7UA 2WLLB 1V27A 4JFEB 3KNBA 2Q86A 2VISA 3NSJA 4G42B 4YDLC 1GHFL 4PBDA 2R8SL 4Y19D 1IKNC 3ZE1F 3GKWH 1B4LA 1TETH 2E9WA 3ILDA 4PH8A 3WUWA 1WZMA 3L54A 5HHOA 4X42A 4WEEA 4W9FC 1U21A 4AZ8B 1OV8A 3GHPA 5BVJB 2DM4A 1ZLUH 4EI6B 3DIDA 4UINL 2NX5E 5CEXB 5LUMA 1WO2A 1OP4A 4UNVA 3E80A 2NY6D 3UTQA 2VDLL 3MCLL 4X80H 5D9SB 5AYQA 5EU4B 1AGEB 4JFPA 4IHOA 3UEQA 2R1YB 3TCXA 1WICA 1YNTB 2OMYA 1KWGA 1G9MH 4PJ6A 2W0FA 4IKNA 4PHXA 1CICB 4EIGB 3ZDYF 4DN4H 3TPUB 3QNXB 1FVCA 4R7LA 3UEZA 4Q6IA 4DVBA 3W37A 1NOAA 4N68A 2RB8A 1FPTL 4LOUC 2J44A 1FFOB 3RDTA 5D70H 3MJ9A 1P7KB 1PKQA 3WE6B 3VXMA 5C0EB 2DBJA 1AXSA 4GT7A 5JUEH 1LEIB 4ENED 4LSSL 5BS0A 4HS3A 1MCFA 4JRFA 4U6XA 4NKMA 2OXGB 2FWUA 4O2FA 4N2MA 3ESPA 3LZLA 3VD0A 3MV9A 4Y5XB 4QRRE 1YMMA 3H9ZA 1HEZA 4PRIB 1YY9C 5GISL 5TFSL 2UY7B 2AEQH 2AW2A 1N18A 3EOBA 3UBGA 3HZYA 5HD8C 2HLFC 1OPGL 3CX5J 1LWRA 1T89C 3DX2A 1RJYA 5LCVL 4YDKH 1X5GA 3EZ8A 3PAUA 3BUPA 5FKPB 5AUMB 4ZUTA 4PSPA 5D96B 3QUHA 1J88A 5DQ9A 1PLGH 3ARWA 4CVUA 1CDBA 4DOHE 5FKAA 3MACH 5E5UB 5E94B 1G84A 5JZ7C 3NJLA 2L7EA 1C16A 2PR4L 5DS8A 1GTFA 4G7VL 5FO8B 1HHGA 1XF2B 2PCPB 1VFBA 3QAQA 3T4YB 1TPXC 3V5HA 4KKAD 4P2AA 5HJBA 5DQDH 3CZSA 2APXA 4TNVF 3E1ZA 1A1NA 1GOGA 3WMPA 3FC8A 4MJID 1AD9A 2YGOA 2QSCH 1YQ2A 3VTAA 4J39A 2XFGB 4HH9B 1T6BX 4D7BA 2G2PA 4YFLF 3VXPA 3LRKA 2OFQA 3I9GL 3VXOA 4NZUH 1B88A 3WN5C 4B3EA 4Y19B 1VGEH 3INOA 4XI5C 4L05A 4LBEB 5IB1A 3RL1B 5MEND 4OJFL 5FFLA 1UWFA 4XVSL 3SO5A 3TNNA 3ZKXC 4L0PB 1S78C 3QSKB 2R0KL 5GRUH 3CMOH 3M8OL 4MQXC 4XVTL 2NY6B 1UM4L 3V0EA 3SKOB 4P5TD 1Z6JT 4FEMA 2Y36L 3B1UA 4PJ7A 43CAB 4XXWC 2K8MA 2FJGB 2FDBP 2ZE0A 4M48L 2ZWYA 2VN4A 1PSKH 2YZ1A 1P5UB 3MA9H 1OQXA 3B5GA 3IJEB 4C56A 2DZEA 4EDWL 4I5BA 1ZVSA 5BQ7B 5ID0A 1I1YA 1OEZW 5E0FA 3DRQB 3N5AA 1NMAH 5EZOL 4KHXL 1TZ8A 5MI0C 5GS0C 5DLML 3TCLB 3RZCD 4ZUWA 4G5AA 4XNZC 4QIRA 2X87A 3C9NA 5C0JA 5DJ8B 1A6WH 2YD7A 3BD4A 1QMUA 3GBNL 3GM8A 2WXQA 3L9RB 5E9DD 2CDGB 1XGPB 1IKFL 3KEHA 3LPGA 3BXNA 1NCBH 3K6DA 4UUJA 1KIQB 1WRFA 2ZXCA 4HZ1A 4JCLA 4MQTB 4OLWH 4WWID 1AO7E 3ROOA 2BVQA 3DHUA 1HNGA 3WKQA 3UTSA 1YAZA 3MV7D 4PMEA 3QEGL 4YPGA 3V5DB 4ZFGH 1NUNB 1KPUB 2XTJE 4XNBA 3C8DA 1A9EA 2NNAA 3FTXA 4KK9D 2ZKHH 4DPCX 4ZS6C 5EEZA 3P4MB 3B56A 3RWIB 2X4UA 5C7XL 2OSYA 4GAAA 4ZFFA 4FCHA 2Y07H 2CHNA 4YE4H 5AW9B 5KANG 5I28A 3BT2L 3EH3B 3EO0A 5IF0B 5DVMA 1RJZB 3VRJA 1BZ9B 4I0PC 2OMNA 1A7NL 2J8UA 1LQSR 3FTVA 1THCA 2GY5A 5EBGA 3A6BL 3IDXL 3RILA 3B3BA 4N5EC 4YHOL 5TTRA 2RCSH 4AL8C 1GRWA 3IFOB 3MVSA 5IW1B 2O5NA 4C4BA 2VMCA 3DVNA 4MJIB 3FMGH 3O4LE 4XVJL 5JHLL 2H1LM 4I3GA 1MRCH 4UT9L 4LCIL 2IQAB 3P30L 1J5OH 1ASPA 5JIMA 2F68X 1TIUA 3SGJC 3IDNA 3NIDE 4GLRH 2OW7A 2OCFD 2K1MA 2DQEH 2DIEA 4HMCA 1IGFH 4AVHA 4GW1A 1DLHB 2E86A 32C2B 4NC1E 4P2YA 2Q8AH 5IHZB 1DQDL 1BMZA 4N2HA 1L9TA 2MSPA 5HPOA 5MENB 5CGTA 5DR5H 4YSTA 4X50A 5EWIH 5D5MB 1OANA 1T5WB 3OXRA 5LWYH 4GAGH 4L1HA 4YR6B 3BSGA 3AGWA 4GY4A 5CIPH 1PG7W 4ZX3A 5I5MA 1PD6A 1U8IB 4P5TB 5EORL 2GHWB 4BK5C 2EE0A 5JQIB 2DWDA 2MCG1 1X4ZA 4Z3TA 5FM4A 3OWRA 2JIXB 5CAYB 3QDME 3Q5YA 4P46C 4UYPA 2YOCA 5DUMH 1NANH 4AKOA 1R5WB 4X7CC 1KIUB 1QSED 4LOEA 3F7YA 4F9PA 2WIIA 1QO3A 3GB7B 5E00A 5E23A 1LTXA 3VG9C 4PY8J 4F2EA 3QIBD 4LSVH 1LMIA 5K9JL 2N1TE 3SPVA 5L4JA 1VFAA 2QZQA 4AV0A 2C7UB 4U1IB 1X5LA 1D5MB 4F5CE 3RZCB 3QG6A 5LGJA 2IJ0C 5E9DB 4X9GA 2HWZL 4XN8A 4YMPA 4H5SA 3NN8B 2G0KA 5DHDA 1BQ5A 1UB6B 3BPOC 3EADA 3P11L 4NP9A 1ZA3A 3NG5A 1GL4B 3NP3A 2IDCA 5EIQA 3WDJA 2BDNL 1KTLA 3RIFF 4N2BA 1JF1B 2BVOB 5F96H 3RUGB 2EQDA 2ZWNA 4IRZL 3B9KC 5LXGL 2HFFA 1QP1A 3BVWA 3I02A 2IG2L 5FXCH 4HALA 5D1XD 2Y6SC 3B6SA 3SDDA 2WBWB 4F58L 1E43A 4NBZB 4K8RH 1UGNA 4XBPA 3NRFA 3AUVA 2QDVA 5IGXL 1BQUA 5DD0H 3KVDD 1BBDL 2QV2A 1ZTXL 2AJVH 1OE3A 2O5ZL 1K2DB 1OSPH 3BHBB 5EU6E 3JV4A 4ZO8A 5AZ2H 1NBYB 1EJOH 1OB1B 4HZAA 4EVNB 5IHUL 1UJ3C 3TA4D 3KPQA 4Y2DA 1D5IL 1M6OA 2E8ZA 5SWSD 2WLIB 3V6OA 1T21B 3ZT7A 2CU9A 2B3RA 1YPZB 2H8PB 3G04B 3RVVD 5I30L 3MI6A 4MNQA 2ZJSH 1DVFC 4LT7A 1BLIA 1OGTB 4D7PA 1WT5A 2CO4A 3IDIA 1DSFH 4UANA 3LQZB 4JL2A 1YEHH 4ZW5A 3BD3A 3GKWL 4GG6E 1P9MA 1LGVA 2CM6A 1B6DA 1VRSA 3HMXH 4HWZB 5CLWA 2OJ1A 2RQ8A 4G2AA 4Z7NE 2AJSH 5F70A 1XSIA 2EUZA 4HOWA 6FABH 1HCYA 1NDGA 1G9ML 4PJBA 2L8AA 5F1IB 1E50A 4U6TA 3ZTCC 1IUZA 4DN4L 1NAMB 1LE5A 1NC2D 1ZIBA 1UKTA 5DVPA 5J3HC 1U8HB 3HUJB 1XZWA 4FXGC 4N4YB 3GRWH 1QSEB 2BVEA 3DGGA 3GPSA 3NIFE 5D70L 5IBUB 2G3XA 1R3KB 3PPEA 4WJ5A 5JUEL 2DLHA 3QIBB 1ZHBA 2ZQKA 4EKJA 4LCVA 3GSNB 4MJ2A 2LU7A 5HYFA 1TFHA 3HRZA 2W9DH 2H4EA 3DSNA 1NBZA 4NUJB 1TZHB 5GJSH 2ZUSA 1I8UA 2WOBA 3D85D 2FQFA 1N70A 1MQKH 4K3HA 2AEQL 5JMOC 5D7JD 12E8H 5CJQL 3IVKB 5F9OH 5D71H 3B7UX 4ILDA 1H6EA 4M8UA 5I1LA 1ED3B 2FR4B 4X0KA 4XZ4A 1G7JA 1Q94A 2N1KA 1OXYA 2GW5A 3FO2A 4QHMA 3M45A 4A2LA 3MRLB 3O11A 1Q0YH 3CZFB 3IKCA 3MRIA 5D1XB 4A6YB 5IOPB 3R8BB 1QZ1A 1DSWA 5CO1A 3MACL 4L8SA 2EVHA 1CC3A 1RZ8A 2HG0A 3PUCA 3LD8C 1N8ZB 4NNXB 3AXLA 4IU3B 4NENA 2MWCA 4BZ2A 2FT7A 3G5YB 3MCG1 3U0PB 43C9A 2D7NA 5IBLD 1OAUH 1RK0A 3FBQA 5CJ5A 1HWHB 5EDSA 1J5HA 2F6AA 5DQDL 3ULAB 5DXWA 5ELIA 4OAWB 5D96C 4JLRB 3SY6A 1MWOA 2AJYH 3EUUA 4LLVA 5SWSB 3BIAX 2BSSB 1H9DA 3A24A 2XBZA 2QSCL 1KJ2B 1OGAE 4O2EB 5A6MA 3D3VA 1AHKA 1FIGH 2X6VA 5LN8A 3CXFA 5T5FA 2JJWA 1IL1B 2ICEA 5D4IA 4NZUL 4W9GC 1EUTA 1U3HC 1VGEL 2FX7H 4AIXA 5EU5A 1PZ3A 4L4VD 1GZPA 1XVSA 1DDHA 1JOIA 1CFVL 1UB5B 3DRTB 2IADA 3NH7H 4ODXB 4TQEH 3FAXA 1FVEB 1NEZB 4B41A 4PJAB 1DE4A 5GRUL 1CB4A 3CMOL 5IMKA 3WFEH 4LLUA 3VW3H 1URIA 5FF6B 3SYCA 3MLXH 4PJFB 4KH9A 2X41A 2IFFH 4G71B 5CLZA 4F7EA 2WAQA 3EJYD 4MCNA 4Q6KA 1HXYA 2A0LC 3NIDF 1S9YB 3JWOC 4K2UH 1PTZA 2D31A 5B22A 3N42B 3DX6B 4U6YB 2CA4A 2XY2A 2X0WA 3B9DA 3PFUA 5EH1A 3SBQA 4YSUA 1NC2B 2XPZA 1JGEB 5FAAA 3MA9L 4XNXH 4FCAA 4M8QB 1SY6H 3KL0A 3TU6A 1KYOK 3BMVA 1E5AA 4IBWA 1NMAL 4X98B 4DSYA 2FJUB 3HBGA 1K5NA 4ONOA 2MH4A 3E7JA 1U91A 4CAGA 4ECNA 5J0BA 2NY6C 2IV9A 3RPKA 1VKXB 3UZEC 2GG1A 4FYSA 1KJ3H 3LY6A 4L2LA 4OU3A 4DK6A 4Q6IC 2YBGA 2YD8A 3JBG7 3CVHB 3VXSA 3FB8B 4HIJB 3FU8A 1F6AB 3U9WA 1JN6B 2F58L 4OLWL 1FYTA 4KZDL 2YMOA 3D85B 2ATKA 1E4XI 3RDTC 1F00I 2FAUA 3RZWA 3PHOA 3ZDWA 5D7JB 4ZFGL 2XSKA 4ZMTA 3MLTB 4FFTA 4TSAH 3UTZB 3WNJA 2AV1A 5CMAB 4RMSA 3NFNA 2ZKHL 3D18B 4L48A 4P23D 3IFNH 2BFVH 5B3JF 1R17A 4PLJC 4MX7B 4ZXBD 4DEUA 1ZTXE 5CLXA 1EVUA 1A1MB 2Y07L 3NJHA 4I13B 4LGSB 4YE4L 3QNYB 1JWSB 2MKWA 1SQ2N 4D2NA 1Y6NR 3JVFC 2TSBA 4O02A 1Z9PA 1G94A 2PYFB 4N2KA 3QEHB 5CHNA 2PXYD 3KLHD 1ZDSA 2G2RB 4TOYH 2MTAA 4HUXA 3VE0A 5IREA 3QJQB 5L4IA 1IC4H 2EYTA 4JGMA 2YIHA 4XX1G 1DBBH 5D2LA 3BPNB 2RCSL 3S0PA 4KKZA 3SE4A 2JB6A 1ZSHA 2FH8A 4LLMA 4RGNC 4HKBA 3FMGL 1U0QA 1MRCL 4WV1A 1FG2A 5ANMA 1J5OL 3FOLA 2WXRA 1TYJA 3R8QA 1RHHB 3S6CA 4Z77B 2FBRA 2DQEL 3M7FB 1IGFL 4Y9CA 3CFQA 4GMSH 4WGVB 5IW3A 1A65A 4UQIM 1N0LA 1UASA 3JXAA 3KLLA 5DR5L 2QGEA 4L4VB 5I26A 2DH2A 5F0JB 4AKQA 4NQCE 3B2MA 5EWIL 2AK1H 3TH2T 4YBLB 5HGHA 5LWYL 4M6OH 4GAGL 3NFPB 3GSOB 5EC1B 5GGRA 5B3SB 2ZTBA 1CF8L 4GXUM 4QRQA 3VSVA 4FLRA 1GVIA 3GRGA 3I6GA 5LLIC 1SXNA 1Q0XH 2J43A 3NEXA 5IWLA 5DUML 1AGCB 2XUWA 2FE0A 4PP2B 4Z7NF 5J1AB 3US1A 3ARSA 4NGHH 5DRNB 2B2XH 3ZMEA 2BY2A 4LSVL 3QJFA 4E9YA 5KTEH 1JGDB 3T65A 4XAKE 3RTQA 2XVKA 1FGVH 2E7LC 5I1EH 1JXJA 3T2OA 5E8EB 2VXQH 3B1TA 3QISA 4LCCA 3SPHA 1J9SA 2CLVA 3VRIA 5KYXA 2CRMA 2HTKC 4BSWA 3PWPE 3F65A 4NJAH 2IAAC 2X5PA 4OCSH 3RX9A 3NIFF 1WGOA 2YEZA 2GUOA 2N0KA 3NA9L 1U8NA 4G80A 4GQRA 3T1WA 3IMBA 5CBEA 1GYVA 5F96L 3NMEA 3RGVA 2EEDA 4HQQH 7PCYA 3GPEA 5D55A 1KBGH 2ZWLT 4P23B 4B95C 4FYQA 2Y2TA 2KERA 3H55A 3HCVA 3WI9A 4FMFA 2YEVB 2WXNA 1RZJC 3PV7A 5D1ZA 5DUBA 4ZMNA 1I3UA 2GTZB 1DFBH 4ZXBB 3TXAA 3EHBC 4K8RL 3CLWA 2JCCA 3VFTB 2X9WA 3QEUB 1NAKH 5DD0L 5I1CL 1AMYA 1ZT4B 2V7NA 2AJVL 3RFRA 4Z7WE 4AKPA 4WI7A 1OSPL 1N3NB 3ZR6A 5AZ2L 1F42A 2PXYB 4B9CA 2BOBA 3ZGHA 3NRQA 5T1MA 4JE0A 2APVA 4N0FA 4GINA 2YR3A 1Y1UA 3OPUA 3EAKA 4QWWC 4U1KA 1R33A 3UDWC 4F1ZA 3GZOA 3RRQA 3RTLA 3I50H 5AB2A 5HXMA 2ZJSL 3DVIA 4A67A 1LE9B 1DSFL 1FL6B 2NSXA 4Z18A 1YEHL 1BOYA 3BP5B 2O6EA 1EFQA 4AENA 3HG1E 3O3DB 5I8OH 5IFJA 1HQ4B 4YDNA 4AY0A 3HMXL 5INDB 3QEQA 3MODH 3POHA 5FGCB 1XGQB 1XGUA 4POUB 3CDZA 3VGFA 4CADB 1IGTB 1CD8A 2AJSL 2ZSWA 3FU7A 3HC2A 1BQHB 4G6MH 1P2CA 4P4KD 1DVSA 1A6ZA 5FCSH 2QKSA 1QACA 3H0TA 4MZ2A 4GRLA 2Q7AA 4R4FL 4YDJA 4Z3FA 6FABL 1ZGLB 3RVTD 1AZNA 3S9DB 2R4SH 3KPNB 4BV1A 1D6VL 2UYLB 4UZUA 3RWEA 3PJSA 1LO4L 4YFEA 3QJSB 4PTTB 2EEXA 2ZUXA 2AJUH 3PGDA 3LH9A 1AXIB 3RWFA 4M7LH 4MCZB 3MBEA 3GRWL 3DOHA 4WEUD 1TCRA 2NPLX 2EC9T 5A7BA 5I0XA 2ZG3A 2CHWA 2IAMB 4D0DB 1E28B 3DTUB 4LNRA 4ZUUA 1IAKB 3CN1A 4OF6A 3RPIB 3HFMH 4NQVB 2QSQA 4HJIA 1BEYH 3QQ9C 2W9DL 2WYTA 5GJSL 4P8QA 3QXUA 3K2UH 1BG9A 3B9EA 1X7QA 4F9PC 1MQKL 2AXHA 2FJHA 1R3JB 1CLVA 3BW9B 3D09A 5F9OL 1MG2C 4JZNB 4XMKH 1RJLA 4LGPB 1IQDA 5DEGB 3P2DA 3G5XA 4AIZA 1MFVA 4QRRD 2WIMA 2QKIA 4BK8A 1JPEA 1Q0YL 3FQTA 3MV11 1FL5A 1WZ1H 3SHSA 3HOGA 3S37X 4Q58C 2VB5A 1PMYA 2P47B 3QIWD 4KJPD 3TVMD 5BXFA 2WKLA 2XTSA 1IGJB 2H32H 4LIQH 1RIUH 3GYRA 4PJGA 2N59A 4JREC 5ABAA 3FU9A 5ES4B 3OHMB 2LOEA 1BMWA 2X0UA 4YFLI 2EDHA 5E5MA 3UTPE 1L9QA 1ZHNB 3EW3B 2XICA 4EKXA 2GJ6A 4GW5B 2Q2LA 2AJYL 4F7TA 3SDDC 3WLWC 4A39A 1DN0B 4A38A 2J2ZB 4L18A 1MJUH 5GZNA 2HMID 1EGJA 3RVWC 2AXJA 2G60H 1FIGL 2ZZUT 4JHAH 4Y88A 3MV8E 1FV1B 1XCTA 3MNWB 2Z7ZA 4UAOC 2FX7L 2YBRB 5DFVC 4LLYA 3MTRA 5H2BA 1ILSA 3H7LA 3JQOB 4Y5VA 1WFTA 1KGIA 1OW0A 3SPIA 4WTZG 4NRXB 4QXUL 2FYVA 4TQEL 3VMOA 1O7DC 2IIJA 3ZJAA 4G8IA 4DPAX 4POYA 2ARWA 5HYJD 5B1JA 5EBMB 3WFEL 5FOBB 3CSGA 3VW3L 4EIZC 2JELH 1MW1A 2XNAA 4P3DA 5E6ZA 4G9FE 4HGMA 3MLXL 1J0HA 2AEWA 4P4KB 2IFFL 3H9HA 4BZ1H 3VXRE 2BM3A 3X1GA 2L7UA 1OT1A 2CO3A 2JLPA 4YDZA 3OF6D 3N9GH 4K2UL 4B7LA 4URKA 1GW0A 1GOHA 1P9MC 5G4NA 3P02A 4EZLA 3EZJB 3MU3A 3FS9A 2Y5TA 4WW1B 1H15B 1KXVA 4QI3A 4XNXL 3GMMB 4U1HB 1SY6L 2VABA 4FQHB 3J8F7 4JO2H 1W72A 1VENA 3QZLA 1X5AA 2XPGA 4JCMA 3SEPA 2P5WE 1EDYA 1C5DA 2XXCB 1AD0B 1D5XB 4MJ4A 4RMTA 3DV6B 4JY4B 1XAUA 2V9QA 1KJ3L 3DJSA 1L6XA 2Q10A 5FDWA 3EJSA 3FSWA 3LIUA 8PAZA 5EO9A 3GSUA 4KMQA 3DXAA 3SKNA 3BVUA 3IJYA 4P4RB 3IBOA 5CF3A 3MREA 1Q9LA 3K4AA 1Z5LA 4XH2B 3MROB 1ORQA 2VITA 4GJTB 1MFCH 3FXIC 4UOQA 4TSAL 2VLJA 7TAAA 2V7HA 2XG4A 4M4RB 5DK2B 1IGCH 3RGBA 4H0HB 1W8OA 2PKDA 2BFVL 2PNDA 3D9AH 3KS0J 4LRIC 4LMQI 4OZ4B 2LLLA 4QRRB 5CU9A 5DHVB 1MFBL 1P4UA 5GGTH 1AO7D 5IMLB 2ZOLB 2G75A 1X3DA 3HRZC 5C97A 1U8MA 1Z3GH 1UVQB 3BDBA 5ICYA 1OB0A 1O6SA 1YEJH 3QIWB 3TVMB 2NUTB 2LTQB 4KRNA 3QAZB 4UTBH 1RZGA 5IB3A 3FU5A 3UAFA 4PREA 4AMKH 5C0GB 2QLYA 4TOYL 3WFZA 4M02A 2FNWA 1N6UA 1IC4L 3D50A 1DBBL 1RV6X 4Q7DA 4P5MB 1E65A 2UXTA 4ABVA 4TVSa 1E8WA 4Y9FA 4FFYA 2RJMA 1XHHA 4F7PA 2OMVB 3OJDA 3ZKSD 1IU1A 5F0PB 4OT1L 4KKQA 4O9HH 3WFHB 2A9BA 3DUSB 3EFFA 3A0OA 1HQRA 4N1CA 3P69A 5JHDA 2WO4A 4J4PD 3OX8B 3DX1A 1PY0A 3O4LD 4NRYB 1ZK5A 1CDYA 1JPST 3MR9A 2AK1L 4M6OL 2JTYA 1PFOA 5B1BB 5HYJB 1QA9A 2VQUA 3TURA 3DO4A 3S8GB 2Z6FA 2E4FA 3CHPA 2XQYG 5AVZB 4RAVA 4P2RE 1DDTA 2QQNH 4N2AA 4YHIB 5DT1H 3SDXE 3H3KA 3QFDA 4QO1A 1S46A 1B4JH 3GKZA 3KPSA 3F7QA 5EOCJ 5J6GB 5EZJA 1Q0XL 5DRXA 5I1HH 1G6RH 4J8RA 4FG2A 5HHNB 1URLA 4MASA 1RZKH 3P73B 4BCXA 3K6NA 2MQ0A 3O3BA 2SEBB 3P77A 3R06A 5DJZA 5I17A 4M6MH 4TNWK 2RA1A 5F3FA 4PGBB 5KTEL 1OTTD 3D25B 3V55A 5FYJH 2PW1B 3QDMD 5I2IB 4ZPTB 4L8CB 2FEEI 1FGVL 3KYAA 3V4PB 1MH5B 2FEDD 1TTFA 5I1EL 5KS9A 1TOXA 2VXQL 4I4WA 3Q1EA 2YKLH 1KIRB 4QT5B 1FSKC 3AY4A 5KBMA 4PLKC 5GPRA 4IU2A 2AGJH 4NJAL 5K9OA 4OCSL 3CIQA 1MHCB 3V6BR 1GKEA 1TITA 1T0NB 1U8QB 1N10A 2VDQB 4HQQL 1JDAA 1KBGL 2VRQA 5AOLA 4BH8B 4R84A 4B9FA 2WN3A 3CSTA 4JW3A 3QPQC 4HCRH 1FN4B 2IH3A 3R19A 3RNQA 4WF7A 1N5AB 2XG5B 4OFIA 4H1LA 3T6ZA 2YOAA 4B96A 1NAKL 2E56A 3P9MB 4QF1A 5ENWB 1FZMA 1I8LA 3ARPA 3BE1L 1BJ1J 1KGJA 1FZKA 2XKNA 3QDJE 3CBRA 5E6RB 1TVHA 5JIIA 1O9ZA 4MDIA 3TV3L 4YHYB 4PN6A 5H37A 1J11A 4IBSA 5IVOA 5C71A 3THMH 4P23C 4W9ZA 2J1YA 2E8YA 5I8CB 1NFAA 2LHAA 4WFGD 4KV5E 1BA9A 3PAVA 3ILPB 3S37H 2YD4A 5M95B 4J3OH 4AYSA 1W8NA 2VT0A 4FKKA 3V6ZB 4KNQA 2FB4H 4ZTOH 4LKCB 5B38B 3PWLB 25C8H 3QFJA 5I8OL 5KYYA 5T3ZH 2PXYC 3KLHC 3IMTA 1KCLA 3MODL 3WD5H 3SE4C 5HGDA 3O4LB 4H26B 1PEZA 4K5PA 2Z31D 5F8QC 3VGEA 5L2KA 1EHAA 3F2LA 3UROR 1O0VA 1U8JB 3DX9B 1SJMA 4IOIB 4OD2A 1I3GH 4WV1C 3PWUB 2IV8A 2VDLB 2NUPA 3EFOA 4KVNH 3ZDZF 1C08A 2WTPA 1CG9A 3LVEA 2B4CC 2AJUL 3I6LE 2Y7NA 3EDJA 3PNRB 1UWXH 2IC2A 3C6SB 2Z1KA 4PV8B 5G5DA 1WHPA 4M7LL 5KUKA 2XWEA 1BZ8A 4A7QA 2KLRA 1LNUB 3CFKB 4DIXA 4FQXA 3BKJH 3IMWA 1F86A 3QDMB 1TQSA 3HFML 4O2CB 3WLBB 2LFGA 3GZQA 1BEYL 5DHYB 5CM1A 2IGTA 1RUPH 3GLDA 3VD4A 4HUVA 1AANA 1I4FB 3K2UL 2C9RA 5IJVB 3LEXA 4FKHA 4BGDA 2BSTB 2GJPA 3O3AB 4RRPA 4BWTA 4XMKL 4ES8A 1SMAA 1GR7A 4CNIA 3QWRD 1U58A 2IAMC 4LP8A 3MN8A 2E9BA 1DANT 4RESB 3SOBH 4LL4A 2AV7B 1KBKA 2HTLC 3T1FA 1WZ1L 2FZ3A 3C2AH 1R5VB 4TYUA 4F2MB 1YEFH 3CU1A 5IZ7A 3L8QA 4LIQL 1RIUL 2IBBA 1M1XB 4GNKB 5JXAH 3DMMD 5I66B 5MEQB 1I31A 4M62H 3RGVC 1FCCA 2LGNA 4R0LA 3E9TA 2HVKA 5FYKH 4U4BA 4PLOB 4XNQA 5C0RH 4QPEA 3APNA 2XTLA 4HCFA 4Y4FA 3SPJA 1EEYB 1TU2B 1IBGH 5D1ZC 3X1EA 3NP4A 4W4NA 4GB9A 4QRTA 1U4FA 5CGYC 1SFHA 4NKDB 3H42H 3FOMB 5EZIH 5EPMA 1AAJA 4U1NB 2ZAHA 3F6LA 4AH2B 5TGBA 2G60L 1K8IA 3OKNA 1FH2A 5JA8B 5HYSG 3KGSA 1TNNA 5J9PA 3L3OB 8FABA 3NBNA 1X5KA 4BELD 4L9LB 1HOEA 1Y18A 4YBQD 4HK3N 1VEOA 4X6DA 3SKJH 3WL9A 1PG7X 3NZ8B 4KRLB 1U9KA 4QRPD 4L0YA 2Z31B 3UBFA 2JELL 2IOMA 4U1MA 4G72B 1PZ5B 1F4YH 1YC8A 3KXFE 1CQKA 3VVWA 2XN9E 5DI8B 4BZ1L 4N2LA 3S96B 4V2BA 4GG6B 4KO5A 1G7HB 5K39B 1OPOA 3GJFB 3N9GL 1YEGH 1KT2B 2V3EA 3I3DA 5CGMA 3VFSB 1DR9A 2ZSVB 4KK8D 1BLNA 4LPTA 2WVTA 1U42A 4JO2L 5EOTA 5ACZA 4Y1AA 2N01B 5TD4A 3ILQC 4K7FB 4MTMA 4GRLC 1RVFH 2UX6A 1JGLH 3KD4A 3HAEB 1FGNH 2X89A 1L0XA 2CO7A 2ZUYA 3SDXF 1F18A 1E90A 4PWJA 5FUOH 5CZVH 3VM5A 2EIDA 2ENYA 5F8RC 4ZG1A 3U4EB 4BFNA 3L6FB 3H53A 5ESQB 4UDTB 3ARDD 1ZJBA 2XV2A 1OY3B 3LSOB 2VXUH 2VDML 4P0DA 3FRUB 4KXBA 1BZDA 1A7PH 1IGCL 3P0YH 4FRWA 4HD5A 1E4WH 2FL5A 3ATEA 1RSFA 3D9AL 4GOSA 4S1DC 5DQJA 2R69A 5GGTL 4NN5B 3ZIYA 3STZB 2EE3A 2EXTA 4GKNB 5MP6H 3MXWH 1J8HE 3DIFB 1A5FL 4AUUA 3LV3A 1Z9LA 1BX2A 3HHMA 3IXTB 5HDOA 4K71B 2UWEA 1LJMA 1JG9A 3PWJA 4QKXB 5HSFA 2YAOA 4UTBL 2D0HA 2IGLA 3GSXA 1XBDA 4TNVK 1MWAA 3DMMB 4AMKL 5F89A 1X9RA 4XRCB 2D2CC 2QKIC 1O7VA 1OP5K 1XF4B 2AC0A 3DECA 3GNMH 4YEEA 2CIKA 2A9AA 3PY9A 4G8FA 4IRSA 1ZT1B 4H8WC 1GS8A 3QQ4A 1QUNB 2R29H 4DP5X 4C55A 3KBPA 1FJ1A 1NGXA 1ZA6A 3S88H 4O9HL 1DUZB 4XMWA 3RL2A 3B2DC 2OSLB 3QIWC 3WMSA 4ZX6A 1CXFA 5TH2A 1LO5B 3KJ4C 4Y2OA 4ALAL 3CBKB 5JLZA 2X4RB 3UO8B 2DQCH 2JKSA 2GEEA 2AQPA 4GAYA 5FFOA 4GI6A 2F61A 3TZVD 5FLUA 4LASH 4JRXA 2YJLA 2K9UA 3EBIA 2HT4D 4D3CH 1QFOA 4QRPB 1L9OA 3WTXA 3F04A 4V1DD 4R7VA 5JIPA 2XN0A 3N0AA 1I7ZB 3FN0H 2EVIA 4Y2NA 2QQNL 5TQ0H 3FQXA 1V8HA 3QO0A 4CKQA 2VMFA 4IQHA 5DT1L 5A2JH 5JPMA 3O2VH 1B4JL 2GAZA 1U3NA 3SGEH 4HWBA 2HP4A 2G5RA 4M56A 4Y5VC 4OW6A 1N19A 3MFFB 1AMXA 1G6RL 5K33A 3W2DL 3RFZA 2FTAA 1RZKL 3E6FA 5B1JC 4Y0GA 1HX0A 4M6ML 4ZD3H 3FW6A 3TO2A 2WUCH 5JHBA 3KL5A 1HN1A 5FYJL 2BJML 4NNYA 4MD5A 3V8OA 2OMWB 1XCQB 1I9RH 4LB8A 4FNTA 1HK6A 4LSDA 3GBEA 4K3DL 2ZX8A 2YKLL 3HB3C 2UVFA 2Y06H 4MDJA 2A83B 1P5VA 4OZIB 1A9VA 1KXVC 1MCKA 5JIHA 3QB7C 4NQXB 1KXTB 4M9OA 1U8OB 2AGJL 2F7QA 2NW2A 1EVTC 4BKTC 4HOXA 3AREA 1FLRL 3ARDB 3MJ7B 3ZQWA 1OWWA 2IANA 1NZRA 3HNTL 1ET7A 4HUCA 2F19H 2BMKA 4I18B 1E67A 4LIQE 5SX4H 4RGMC 3PWPD 2P80D 4H7VA 2QGBA 3PHQB 5AW4B 3QUXD 5I6XC 4Z23A 1SYVB 2B39A 3QI9A 3ECBB 3ULSB 4L1TA 4X7TA 1A6AB 3BWZA 2WLJA 3E0GA 1MY5A 4E5XG 1MI5A 2G30A 1QFHA 3NA4A 1I7UB 3ZE2E 3F01A 3KM1A 3K0YA 4QXWA 1IAIH 3O6KH 1LQBC 3NTCL 4K9JA 5DK0B 3HS0B 3BDYL 3L5IA 2I85A 5DD3H 1JVKA 2HJKA 3THML 1WSST 2J5LB 3SY0A 4E0RA 4Y16D 4KK5C 1GGIH 5JDSA 5EBWA 1COBA 5E24E 4GO6B 1IGMH 3RY6A 4DO5A 2X2JA 3S37L 1MUJB 3UX9B 2X6UA 4UM9D 5HI4C 3QQ3B 4JFDA 1HHKB 4PRAA 3W38A 4HP5A 2FB4L 1FLTX 1E27A 1CGVA 2X70B 3Q6GH 5I74B 1BVNT 4ZTOL 25C8L 3T6WA 2PPFA 4MWFA 4YLBA 6TAAA 5T3ZL 1GAFH 4QCIB 4QRAA 4OFYD 3WD5L 1OGSA 3TZVB 1WFIA 3RJQB 2ZWSA 4UF7C 4YHPA 3MRKA 1S7VB 3LKSB 2HVBA 3T0VA 3HZKB 5FO9A 2CHXA 2PTUA 3MNDA 4EQ3A 3MMEB 4HGWA 4RIRB 5MEPB 1EXHA 4V1DB 4YUEH 1N4XH 5E03A 4KVNL 3EBGA 4YXKH 1B2YA 2CNZA 2MIZA 35C8H 1SOSA 1G87A 5DVKA 1XR8B 4I3RH 5ILTL 3UO1H 3Q2CA 4GUPA 3FT3B 4J4PC 4JBSA 2R15A 3FRPB 4URTB 1PLCA 1WITA 3BKJL 1KPRA 5IFHH 1PG7H 2OL3A 3QHZH 5ESAA 4D94A 1M3JA 3KPRE 4MS6A 3OAWA 3OKDB 2FT6A 3TS8A 3L3HB 1ZMYA 4M93C 3BO8B 3FONA 1BFOA 2KHAA 1UD5A 2H9GA 3GS0A 4JJHA 4Q9QH 2ZOKA 1RUPL 1EHLH 3MAWA 3IU3A 3VI4E 5IW6A 3FQ4A 4IIQB 3AAZA 3VXTB 2P8PB 4M3HA 3OSKA 3S2AA 4OV6F 1L5GA 3MSPA 4JRYD 3R18A 4HETA 4MMYA 4CVZA 3MGTA 2XWXA 2R7EB 5JW4R 2EKSB 2NDGA 4G7SB 4GIOA 4HHAA 5GGVY 1S6NA 4PG9B 4KKLD 3SOBL 3TO4A 4DKAA 1EV2E 1YVLA 3CHXA 4NWTH 5AAWA 3AMKA 3OZKA 3PWPB 3AY4C 2OXHA 4YGVA 2H6OA 4NWUH 1YEFL 3QUXB 2QPFA 3ROLB 5BJTB 1KB5H 3MV7A 5JXAL 2FATL 3L3JA 3WDHA 4PRHA 1Y6KR 1JPFA 4X6FA 3BH8B 1ONQA 5FYKL 1P53A 1NH6A 1OTSD 2FH6A 4AGPA 5C0RL 2BVUA 3ETBF 1PBYA 4BH7B 1IBGL 1WCBA 2IXQA 1KCSL 3ZKQD 2EIKB 1QVOB 4R3SA 1C5CL 1ZSDB 2QTEA 2WTRB 3TASA 3CXHK 1UACH 3IS1X 4Y16B 5EZIL 4TVUA 4Z7WB 4ODWA 2AS5M 1XWVA 3V7AE 3UTPD 2XA8H 3RURA 3WNOA 3KPTA 4G1EA 3DJZA 4OF7A 4AQ1B 3WS3B 4UM9B 2OCJA 2JFCA 3VJ6A 1I3RA 1ANUA 4AXWB 4NN7B 3GIVA 5E7FA 4R4BA 3RBSA 1TKWB 3L1GA 1RJCA 4K0OA 1SLVA 4DF9A 2V2TB 3SKJL 3MRJA 1CL7L 2XWZA 1D5ZB 1JPTH 2ZICA 1YAIA 3WJMA 2B08A 1F4YL 5E5RB 3GXMA 4JPVH 2D7QA 3EXLA 3TIEA 3DETD 4ZYKA 1WAAF 1YEGL 4N28A 2NY0C 3SE3C 2E5EA 4XPAH 4OZHE 4LARH 3IRZA 3D7PA 4XHJC 5AVUB 1AQKH 3S5LG 4G9FD 4WHTB 2PN5A 3RNKB 4TLUA 4F92B 5FYJE 5HHPA 5JQ6H 2AXGA 1P84J 3VGHA 3MNMA 3OAYK 3M7OA 3H2WA 3ME0A 4PJIA 1JNHA 3AY2A 1MREH 1RVFL 4I9XA 3TA3A 1N5YL 1AKJA 4YN3A 1FGNL 4G7QB 1MLBB 4JO4H 1CVSC 4HAFA 2EIEA 2BNUA 4NN6B 2JV6A 5FUOL 3OHXA 5CZVL 6PCYA 3ZYJA 2CH8A 3QS2A 3OL2A 4W6YB 1EDQA 1JNLH 3WFCL 1CFNB 2EUWA 5GJTH 4XWOD 5IROD 3PP3K 5TE6H 1TVBA 1MFAH 1XSOA 3RDJA 3ML8A 5DJDA 1TQTA 4FQXC 2DV6A 3BPCA 4JRYB 4ZAKA 2GI0A 3ARYA 1JJUA 1A7PL 4NQED 3VU1A 1E4WL 1T7WA 4XVUD 5EEWA 3BEWB 5MP6L 3MXWL 1J5IA 1HZLA 4WK2B 5FA4B 3HNSH 3POCA 3RAJH 3FFDB 4PRDB 1CIUA 1KCKA 4K8RD 2GSGB 3VFWB 4KUZH 2F0CA 3FCTB 3LRSB 3BP7A 3MJ6A 4Z7VE 1EEUA 4TF4A 2ZD0A 2ARJQ 3T0EA 3NCJH 1D7FA 5JW3H 2BNRA 3NSDA 1T1YB 5DMYA 2FLRT 3GNML 5AAPA 2BY0A 1P84K 4NN5C 4ZJ9A 4XMXA 4ZFOA 3OC5A 1E8ZA 3R7QA 3MV01 3JWNG 1HYRC 4D9QD 3CUPA 4ANXA 3S88L 5T3ZE 4FLSA 4IGBA 4K71C 3QR1A 1Z9MA 3ZE2F 2FSDA 3ESVF 4R0LC 3U6RA 1Z9OA 1JZ7A 2DQCL 2YA0A 1TEFA 2AK4A 3DMMC 3LPWA 4Y4FC 3CFEB 3CN3A 4M6NH 4HLZH 3I3EA 4LASL 3U1QA 2GJRA 2NXZD 4HXAH 3J27A 4OTXL 4UQEA 1OSZB 4G43B 4D3CL 3GRBA 3KYNA 2D3NA 2K45A 3CWGA 4HIQA 2ZWZA 5FGBC 5E6YA 3QCVH 4DP0X 3FN0L 4NUMA 3UAJD 1IMHC 1IBBA 2VMDA 5TQ0L 4L3AA 1NFDE 4LCWE 3FQUB 2XDHA 2DYRB 3HE7D 3QJUB 5CIPB 1YMHA 3CFBA 2RTTA 3L5WA 3DSFH 4QXGH 1ZY9A 1XH1A 5TDPA 1FO0A 3QS3A 1J18A 4YXHH 3L2NA 4G9FB 2Y1ZA 2QHLA 3L4VA 4HSAC 4P2RD 2OMZA 3IJHA 3QDGA 1GXEA 4N86A 4ZD3L 4F8OA 2WUCL 4OKVA 5GS0H 2EICA 2J1WA 4JUSA 3VG0H 2E74C 1I9RL 1ZPUA 2C3HA 2RGSA 4NM4H 5L88H 3KPPB 4NYLA 5EEVA 2D0FA 2Y06L 3AVEA 4NQSB 4YSCA 1VA9A 2ADGB 4WFHE 5D6DA 5EB9A 2AEIT 3EJPA 4MXQD 1JK9B 2GY7B 5EU3B 3LPOA 4XNMB 1IGIH 1QNIA 4PJHA 1AGBB 1BAWA 4KK8C 1UQSA 4X98A 2AJZA 5L0QB 3EYOB 1S7QA 3DPBA 5F7WC 4NQEB 2D0GA 2F19L 2PO6D 4EUPG 2VAAB 3AU1A 4HJ0D 5F7FA 2D7OA 3G5WA 4JY6A 3RWHA 4PJ8A 4IBZA 3VI4F 3DURB 2WVSA 4AV5A 5FYKE 4XCEB 3OXSB 4XNYL 2FIKA 4G82A 1N7MH 2CKBH 1Q38A 1RK1A 4BSJA 4PJ5D 1IAIL 3O6KL 4X83A 3SE6A 2LVCA 2ZP9A 2NNXA 3FT9A 5DD3L 4AL8H 5D1QA 5FO7B 1GGIL 5AKRA 1VADA 2WSKA 4OLVH 1IGML 4JB9H 3EDEA 3RKPA 4ELME 1JFQH 3C5ZA 3NQKA 2H0PA 2CCVA 3JTSB 4C47A 2E6PA 4U2ZA 3G6JB 1S9VB 5ICZA 4EZMA 3AMLA 1HL8A 3Q6GL 1PZAA 5KVMC 3X11B 4PWHA 1DJZA 4P04A 4MAYA 1BD2D 4RSVA 1GAFL 3P3YA 2LV4A 3HS0C 5T1LD 5IG7A 2NXZB 2J5LC 1PD1A 4PPTA 3CVIH 2Y7QB 4J12A 4ZSOB 5ID1A 3VMNA 2HN7B 3HJ0A 1AS8A 1DL7H 1I7RB 1F3JB 2P4AB 4YUEL 2O5XH 1N4XL 4JPIB 1Y0LA 4GKZA 3L7FB 4R83A 4YXKL 1MHHB 2CJTA 4E9VA 1LL1A 1NGYB 2DJUA 35C8L 1NANI 2FK9A 3UO1L 1GZQA 4I3RL 3HE7B 2ALWA 2EIZA 4L4VA 1UA7A 2XWJA 3GBDA 4PRPE 3UACA 1XF5B 3RI5F 4XP1L 2VJ8A 2A1WL 4JJ5A 4NO0D 5EZLB 4AYFA 4P2RB 3TZVC 5IEHB 5K93A 1MPAL 1PG7L 5DJXB 4BFRA 3GSWA 2EYSA 1BZOA 5A2CA 5HI5D 2Z8SA 5DF0A 2EKJA 3J7HA 4YVNA 5JPMC 2EIMB 3R0MA 4UIMA 1H3TA 2AQTA 1JUFA 4OZHF 3MRNB 2CGRH 3KBFA 4FFZA 4Y8AA 2TAAA 1EHLL 2UZPA 2DKSA 3VFPA 3PDOA 4NIYE 5E8DH 2XBTA 3UYPB 5DJCB 5CXPA 3F7RA 3U9UA 1Q1JH 3TESA 3C2SA 3BP6A 2TRYA 1MFDH 3ZE0E 2AQQA 1KELH 1DVZA 1QSVA 3SGDH 3NZUA 2PO6B 4RFNC 2OTUA 1N6VA 1WE5A 3VDBA 1W0VB 5I76A 1LWJA 2ZYSA 4MGXA 3B3IB 3PREA 2I7SA 3WO4C 4JG0H 5HJ3A 2BC4A 2ITDB 3ABLB 3SPGA 5IB5B 4B7IA 4J5VA 4YQXH 2KZWA 5AKSA 3DYPA 3K6SA 4TUOA 3TIDB 2JJUA 3VA2C 4PJ5B 3REVB 5C0BE 5JOFA 2EVJA 4EJ1C 5E2UH 1XD1A 4D0BB 3IB4A 4KZEL 4X8JB 2WK2A 1IM9D 1IEBB 1N59A 1ACXA 5KYYB 3KH3A 1UACL 2GITA 1Z7JA 1K4CB 3QI9C 3QWOB 4OF5A 4RZCA 3RHWF 2Z4QB 3W9EA 2XA8L 3STLA 2EH8H 3B9VA 4PCYA 3TEUA 1CFQB 3RBGA 2FQDA 5BZDA 4Z7VF 2AEOA 4ATTA 3VDAA 4NI6A 1VZIA 4E9TA 4PV9A 1IB5A 4OQ1A 4RAUA 3DROB 3J07A 3VWJA 5FUCC 1BIIA 4BE6A 1BD2B 3BC9A 3TPKA 2X4NB 4J3OF 4Q2ZA 4AIOA 3DX4A 1KCUH 1DEDA 4QTFA 5T1LB 1O7SA 2TRHA 2C4XA 3LN9A 4ZMYA 1JPTL 2NQDA 2M8XA 3LHPL 2WNWA 3OKKB 4JPVL 3MCYA 4Y16C 4HX1B 4EPSA 4M7LT 3BUYB 2IDQA 4S10A 1MVYA 2B1HH 3MRMA 4CUCA 3V0WH 1OAJA 3SCMD 4OBRA 4F15B 4AQ1C 4LARL 5IVXB 2D3LA 1EFXD 1MZYA 2AQNA 3MRGB 1AQKL 5T5NG 4ONGL 1KTDB 5JQ6L 2Y1VA 3KXFD 4ZOEA 5F6IB 2BINA 5DVNA 2B59B 3CTTA 1ZWIA 2YPVH 3GUTB 3CSYA 2JKLA 4UQCA 1MREL 4NFBA 5F3BB 3N1PC 1YUHB 2R9HD 4JM2F 1TQBB 3GMLB 3KGUA 1NFDF 3N40F 2WSDA 2GK0A 4JO4L 3Q6FB 5J6HA 1HCZA 2VQ1A 3IGUA 1QI5A 4YSSA 3QUKB 3AT0A 1G0YR 1A3QA 1PIGA 1UEMA 1JNLL 4XP6H 1WZAA 4Z7OE 5AVXB 5GJTL 5C0ND 3FTGA 5ECGA 3KYOB 1Z9NA 4FX5A 1YEWA 5TE6L 1MFAL 2LT9A 4ZMLA 2BP8B 1BXXA 5I6KA 5ICXB 4PRNB 4NRZB 4PM1A 1P1ZB 3GSVA 1UH2A 4JQIH 4YE0A 1KCRH 5K59E 3M1BB 3INUH 3LQMA 2VXVH 5CSZA 5JPNB 3HNSL 4NN6C 3RAJL 1JPGB 2NLJB 1KN4L 4F8QA 3S3CB 1TJXA 4KUZL 3WHXB 4W9DC 3BSZA 3GC3A 2YMXL 2WQXA 4ZUSB 3H9SE 4AGNA 1P6AB 1BXVA 3IFLH 1T3FB 3HJEA 5L6YL 4NUPA 3L48A 4LK4A 3NCJL 2O61B 4N22A 4FABL 5JW3L 3TO4C 3TBTA 2ZCHH 3RWDA 1QKZH 4WIQA 5AAWC 1OO2A 3V0IA 3CHQA 3C60A 4MHHI 3AADB 1IM9B 5CWSB 4WZ9A 3SBWC 2IF7A 3K8KA 2VUKA 4IBTA 4ODUA 3TBYB 3IJSA 1RP8A 3KCPA 4JDVB 3VYPA 3MRPB 4X4XA 2RBLA 5EUKA 4NQQA 3N43B 5IVZA 4M6NL 1ZHKB 4GRMA 5LO7A 1X5IA 1ZLUK 2D3JA 1J10A 4HXAL 1M3IA 1OTSC 1A4KB 5EEXA 1NEUA 1KBWA 5AW5B 3WIIH 2EDNA 1LP9E 4ELMF 3LKRA 3MOBH 4OIBA 4HBQA 2X4TA 5DEZA 4F9LC 4WTQA 4XWGH 2YAEA 3BWAB 5DMKB 3VI3B 5AL0A 1VLXA 3DOSB 1PNDA 4FZ8L 3GBLA 5FB8B 3SCMB 4K5OA 3CG8A 2AKRB 3DSFL 4QXGL 4BFGA 1EFXB 2UXGA 1I8KB 4YXHL 4X5XB 3DX7B 5TF1H 1CGXA 3KXFB 2VN3A 4F3FA 1CTMA 2NNFA 4UT6H 5SWZE 1A6TA 3MRDA 1IVTA 3DHPA 3X3FH 4NSKA 1OCCB 5GS0L 2W38A 2ESVB 1IJNA 4XAWH 2BSED 4XBMA 3VG0L 3NEOA 4YIQA 4NM4L 4PGCB 2GSIA 3MO1B 3DETC 2NX5A 5DMJB 1A2YB 2YLKA 1S8DB 1BXAA 1ND0A 4PAZA 4F91B 1I1AA 1I7TB 2ZG1A 3B5TA 1X5FA 3HEIB 1IGIL 2FUQA 3VFMB 3W5MA 5CNHA 4KRPC 1XCXA 1HNYA 1KGYE 3TA3C 5JDJA 2FJFB 4R2GD 4ZMOA 4Z7IA 1WBZB 4OZFG 4WLCA 3BLBA 2H0JA 3Q7JA 3ZHDA 3UCQA 4B97A 1N64H 3OHXC 3Q01A 3A47A 1ZEAH 3HA0A 5A1AA 5A2FA 5JHAA 7CGTA 2VIRB 1QPPA 3MXVH 5DD5H 3SDCD 5KW9H 3HPLA 2IPUG 4N8PA 1GPOH 1N7ML 1XT5A 2CKBL 4PY7A 5E51A 5IROC 4M5TA 2N7SA 4TSBH 4XWOC 2JXMA 3LN4B 2WZAA 4ZAKC 3TYFA 3BYTA 2O6DA 4B53A 2UVEA 1FAIH 3ZE0F 1NGPH 4FTVE 4KVCL 3LAFA 3DK2A 1AZUA 1ZAGA 1KV3A 3HKFA 2BSDA 5DEFB 5FA3B 2FGWH 5BRPA 1BZ7B 3RJOA 4AL8L 3W0WB 1P7QA 4OZGB 5C08B 2VERN 3UBHA 2CR6A 2F53D 3DI3B 4XVUC 1NBVH 2VNCA 3GMNA 4KXZH 4OLVL 4G8AC 4JB9L 2DN7A 4IBYA 3P4LA 2LLGA 1JFQL 2PCFA 4AT6A 1SXAA 3G9AB 1T6VN 3SJVD 1FFRA 2R56L 3C8HA 5HPMA 1F4WH 3X3GH 1QNZH 5BRZD 5HGBA 5FK9B 2AI0H 4UI2A 5DC0A 1KTKE 4MJ5B 1DQJA 4QJ4B 4G6AD 2EDEA 1ASQA 2UX7A 2QR0B 3SN6N 1SEQL 5E8OB 2ZCZA 4UV7H 4OSUH 1KLUB 3T2PA 1TMCB 1IILE 2E7DA 3I6KB 2ENSA 3CVIL 4N8VA 1DL7L 4IGBC 4M00A 1XMWA 2O72A 5BZWA 2O5XL 2KLSA 4PJDE 3UZQA 1CYXA 1RXLA 3MDJA 3T3ME 1A6PA 2EABA 4J2XA 4MQ7A 1GA2A 1YHPA 2PWGA 1CN4A 2IPTH 3IMSA 3VACA 4PJXE 4WI0B 5F7AA 4HJUA 1JYXA 4HKJA 5AZUA 1AP2B 1A8JH 4NPYB 5HGAA 3C09B 3LN5A 1MN4A 1JWMA 3G6AA 3ZQXA 4WKXA 1JCKA 3MRBB 3GXPA 3MUY1 2J4WH 1S9XA 2F08A 3KPMB 4WO4A 2BVPA 1UD4A 3IGFA 1KUMA 3TEZA 4XB7A 5F9WB 4NFCA 5DA4A 5F7UA 1F5WA 5E8DL 5PCYA 1HXMA 3U0TB 5EF1A 1PX4A 4QHLB 4KGLA 3LB6D 4WUKH 1MFDL 1TQWA 4YK4B 4J8QA 4R2GB 1K3ZA 4AYID 4Z95H 1MJJB 1B0RB 2Q20A 1RZJH 1B2WL 5DRWB 1W2KT 3QE5A 3QJTB 3FQWB 5SV4A 4Z7OF 4UV4H 2VSDA 1V10A 5LDSA 4JG0L 3TNMB 1J0IA 4NO3B 3L95A 4YHNB 4ZW7A 5FFGA 5I82A 4JANA 4YQXL 2HB0A 4LF3B 3H3PH 1IX2A 1LK2A 3TTYA 4ZZFA 1BAGA 2UZIH 3OG6B 3PNWA 2X05A 1J8SA 1RK7A 2MKLC 1WZKA 4IMKA 4LDLB 4ODVH 1DBJH 5E2UL 5K59F 3EH1A 5IHWA 1AO7A 1FZJA 4Y4HD 1C1EH 3R0NA 4PJ8C 3EGSB 4IDLA 2PO6C 1D6EB 2F53B 5C9KA 1F11B 5F9JB 2WGXA 3K8LA 3PGFH 3VXQB 5IKCB 1WC7A 2PETA 2EH8L 3BAXA 2CPCA 2WYHA 2E9GA 5AOIA 4ZPVB 3O4OC 3SJVB 3VGAB 4JX0A 1O75A 5HDLA 1YUKB 1MVUB 5BRZB 3L08A 5FECA 2FO4A 5CD3A 4OCWH 2V17H 2WVVB 1M42A 5E6UB 1KCUL 4MMXB 1R3HA 4LQ1A 1ITCA 2B5IB 4D8PB 1ORSB 2O6CA 4ONHB 3HS9A 1ZOXA 2HJLB 5DU7A 5IQ9A 4HKZA 4JFFA 4WUUD 3C5ZC 4S0HA 1WG3A 3HBPA 2B1HL 4WU7B 1TR7A 3LMJL 2YSSA 3L3GA 1SF3A 2OR9H 3PL6D 1JZJA 2WINB 3T0WA 5C0CA 4ZFZA 3QQNA 5JYMA 5A16B 2Z92A 1ZLDA 3O4LA 1RUQH 2CPUA 4DCQB 5C9JA 2AANA 4F20A 2YPVL 3AACA 1MG3C 3VNZA 4XN2A 1LP9F 3LKQA 1S7SB 5HHXH 2K3TA 4NX0A 3ORJA 5FYJD 1JXGA 5C0IA 4K7PX 2CQVA 1AZVA 1W6LA 3ECVA 1I8IA 4F15C 4XP6L 2F18A 2DDQH 3QJHA 3KS0H 2KYIA 1JV2A 2IWGA 5F7MC 4F27A 4DQOH 2I07A 1D9KD 2P7TB 1WQVT 4N6RB 5DLLA 1QI4A 2HT2D 3BI9X 4JQIL 3V52H 1KCRL 2VDMB 1VJSA 4TLSA 1G7PB 1TQBC 3INUL 1N2RA 5F21B 3T77B 2NOYA 5HI5C 1R46A 3TWCH 3DOIA 4HDIA 4P05A 3KWWA 3L1EA 3CFJB 1HILA 5JR1H 1JBJA 2P8MB 1A02N 1T2QH 5JW4N 2EE6A 4YNYA 4B50A 3IFLL 5DSCB 3VCLA 3VWKA 1XZ0A 5LCVA 3FT2B 3I3BA 3LH8A 4IBVA 1OT4A 1QSFA 5EV7A 2ZCHL 3V4VA 1QKZL 4XOAA 3UZVA 3VQ1C 2YPKA 4Y4HB 1NCWH 1AHWB 1KTJA 1U95B 2WB7A 5JPNC 2BOCB 1SJHA 1SFDA 5DVOA 3TV8A 4FHJA 2HT3C 2XLLA 2F9BT 2R59A 1AHMA 3HHRB 2Y4SA 1NINA 4OGAC 5D7IE 4OI7A 3E6HB 4DP2X 3FUFA 4PV1C 2CO2A 3JSSA 5JW4M 3E3QC 4QYOA 5J5EA 4FD0A 4KZ0A 2CA3A 4NKDA 3RX7A 1HHHA 2CGZA 4GFXA 3WIIL 5DYOA 5EU6A 3MOBL 1S5IH 4Q9RH 1KJ2H 4XWGL 4WUUB 4N9GB 4Z8FH 1A9BA 1MCOH 1O6TA 3JWOL 2JMRA 2L7QA 4BHUI 1DP0A 5EG6C 2A3TA 3PL6B 3D39A 4KTEH 2OX5B 3U36B 1AQMA 3ZZ1A 3O81A 4DJMA 4GUCA 2IDFA 4UQ3B 5B1CA 2GI7A 5TF1L 4HJEA 3D2UD 2DWEA 4G8GD 1FNSH 4HZLA 4OGYL 5C09E 3OAUH 1M05A 2COQA 4LCWD 4UT6L 1KJMA 5AENA 5DI8A 1JK8A 3X3FL 1NPUA 3O45B 4TMPA 4PJDF 4CW1A 2WCGA 2WBJD 4N1HB 4OCRL 1MEXL 2ZCLH 3T3MF 2RQEA 3I9IA 2EACA 3LKOB 4FQJH 4L5FH 4JVWA 4LVHC 1UFGA 4PJXF 2YMTA 3REWA 5EU7C 3F5WA 2YZ8A 3OB0H 2D4DA 3PWVA 2A73B 2XY1A 4F7KA 4PB9H 4PMFA 3QGVA 1MAJA 3VFVA 1QI3A 2GTWB 3X14B 4BCYA 1FVDB 3E9UA 3H2QA 3CZGA 5IQMA 3NCXA 1WZLA 2OI9B 3QXDB 1YN7B 3AABA 3OKEB 2FJSA 4BWWA 1D9KB 3B37A 3SPCA 4CVXA 3QCUH 1ZT7A 2P45B 2JI1A 1BJ1H 5ISZE 4KKBC 1M53A 2R9HC 5KJ7E 1N64L 1KLFB 1ZEAL 5J4MA 1G7LA 4JZOB 2NTFA 4HAGA 3CVHH 3MXVL 1TJIH 1KG0B 4UZSA 5DD5L 5JNYB 5KW9L 1GPOL 1KPVB 1NJ9A 2D7PA 4QTHB 3CFMA 3IF1B 3O8XD 5C0NC 4TSBL 2V5SA 4LE8A 1Z9SA 1FAIL 3HI6H 1NGPL 2YPLA 4MXWL 3OKLA 1OIOA 2FGWL 3QUZA 2HFEB 3B2PA 1NPJA 4A7TA 5HYSA 2F74A 3S36X 2NDFA 5J7CC 2G9HB 1NBVL 4KI5C 5F9DC 2R0LL 2LR4A 4H0LC 2HVJA 3FB7B 2DMKA 4DTGH 1VGKB 5E56A 5FEBA 1HH6B 1M56B 2Q3ZA 4ZRGA 4FYTA 4HSCX 2B1AH 4HOMA 2PF6A 2XJLA 4BZ2H 1F4WL 2O5YL 1QNZL 4J6IA 3X3GL 3QHFH 2ZX6A 4PSRA 1XR9A 1XIWD 3AB0B 1W15A 4PU2A 3BLKA 4MD4A 1H5BB 2BH0A 2MOGA 4UV7L 4JFEE 1MVFA 5SWQB 2EJ1A 5BPPA 1RU9H 5DWUH 1INDH 1ZCRA 4OF0A 4XGZA 2A6DA 4TN9A 2OSLA 1P7BA 1V7NH 2F54A 3KPOB 1LO5A 5JHLA 5MERA 4X8XA 1H3WM 2WXLA 3K72B 1JVOA 1IBFA 4QHNB 2MCAA 2YUZA 2IPTL 3LCYA 4HJSA 3GTVA 1OGAA 5B3NA 5LG1A 5A2AA 3U1SH 4PYGA 5ALCH 1A3RH 3D2UB 4G8GB 4LRNH 4LDEB 2AQRA 2GHZA 3KLAB 3QO1A 4LCWB 1NCTA 2ENQA 2BPBA 5F3HA 3UMTA 2V5RA 2ZWKA 5EF0A 2J4WL 4R4ND 2WBJB 1RZIB 2VN5A 5CJXC 2CO1A 4KX7A 4OLYH 4BFIB 4UQ2B 2I27N 3QA3B 3FNKA 5F1NB 3ZPDA 5HDBF 4IYKA 1CD9B 5AB1A 1OAXH 4WU5B 2E76C 4N24A 4LLQB 1QRNE 5F7YC 1AG0A 4FG0A 4XTRD 1JWUB 1BHGA 1NDMB 1U2CA 2DI7A 4WUKL 4KHTH 3PPSA 3ML9A 3QCTH 4M61A 4B9KC 1EZLA 4U3CA 5ADPH 2MFNA 4K9EC 1X9UA 4MQSB 4YH6A 4Z95L 3F12B 3PIQB 5KYWA 3M6DA 1RZJL 4NQDE 4PRIE 3TFBA 1IAOA 5LNDA 4QY8A 1ET8A 1A4BA 4UM8A 4BDVA 7FABH 4OH2A 1LDSA 1U8CB 2W92A 4UV4L 5F9WC 2ITCB 3OZ9H 4K7PH 1BIHA 3DTXA 3GMPB 2O30A 4A37A 4ONFH 2Z8RA 3ZHKA 3S35X 2FYYB 3H3PL 3O8XB 2UZIL 3OTTA 3TN0D 2JI2A 4UQ9A 1G7MA 2IEPA 4CU7A 5C70A 1XBRA 4QOKD 4ODVL 2Z7WA 1DBJL 4MSWB 4IRZA 4BFKA 4FQ1H 4R2GC 4PVBA 1BDYA 1IC5H 2CIIB 3ZYZA 3ZRCC 4FG4A 3GI9H 2VW6A 1A7BA 3BQUA 4O02H 4LL1A 1T1ZB 2XU9A 5C0BD 1E9QA 2NXYD 3U2SB 2J6WA 4DEPC 3AITA 1M7DA 3OGCA 4UDUB 4J1UA 3DNKA 1M7IB 2FBJL 2R23B 1UENA 1FL3A 1F1GA 5FIEA 3G5VA 4UU9B 1R0AH 1XIWB 3ARGA 4Y5YB 4OCWL 3WV0A 2WNKA 4BUQA 1LK3H 4ELMB 1MHEB 3UPRA 3QPXH 1RIVH 1SXZA 2GIMA 2X1XR 2IPKA 1R19A 1GH7A 1IV8A 4GKLA 4I88A 1XGTA 2WY3B 2DQGH 4Y19E 4HUWB 4X7FC 4X7SH 5D7IF 2VUOA 5IIEA 1S3KH 4D9RD 3MNVB 1SHMA 3VGAC 4L37A 4NO5A 1JHTB 1CE6B 3MGOA 2EXWC 3U7WH 4IKKA 1RUQL 1Q9KB 3L3IB 3F7VA 4UAHA 5TQ2H 1TTRA 3RA7L 4UTAH 2F8XC 4G6AC 1SHSA 2DYPD 5GRJH 4PHZA 2QADD 4MMXC 4JN2A 2B5IC 1NA8A 1E40A 2WWKT 3IETA 4MCYA 4D9LL 3S3SA 4WNQB 4RSYA 4PS7A 1JMXA 4DZBA 4NQCA 3GZKA 1LEGA 3GXDA 4DN3L 1KJVB 1A4JA 1PKQE 2CSPA 3VXME 4DERA 2IVFC 3D0LB 3FO9B 4UZGA 3OBAA 5BS0E 2DDQL 4L8DB 1MRFH 4JZJA 4Z76A 5KSUB 3M1OA 1XXFC 4ZUVB 3WXWH 4DQOL 4HKXA 4Z7QB 4Y1TA 1BOGB 2OKMA 3D69B 1YMME 4R5XA 3WEMA 1PJ9A 1ZIAA 3V52L 1JZEA 3PGCB 5EN2A 5I1IL 5KG9B 5E6ID 1A4AA 4N0UA 4X99B 5DD6A 3L7EB 1GCYA 5FLVA 2ID5A 3P0VH 3TWCL 2XFXB 2C3GA 2VJXA 2OTWB 4U49A 3VXTA 5AWNH 5I9QB 4PWIA 5JR1L 3GSRB 1T2QL 4NOBA 4LFHD 2VW4A 3I74A 1G1KA 4PJCB 3WO3B 4YBHA 2FT8A 4RGNE 1B6UA 1HH9B 3TN0B 4J3TA 2V2XB 3LB6C 4GQ9H 3QXTA 3CPLA 4QOKB 3GXIA 4QHPA 2NZ9C 4MNGA 4GAJH 2H41A 3MYJA 4BINA 2YN3A 3CC5B 1NCWL 4JPQA 4ZDHA 3MLRH 2DJSA 2A6IA 3O6LL 3H1ZA 1HDMB 4IRJA 4M43H 4JO8A 3Q9PA 4OCYH 2I24N 3DV4A 3F83A 2K0RA 2NXYB 4K3JL 4L9DA 3F7KA 5C0BB 4IKJA 5B4MD 1RHFA 2QZ5A 3F3HA 4G11A 1M6UA 2X4QA 1FC2D 2W60B 2W65B 2Y5EA 3O6FA 3W39B 1MCWW 3IGAB 1E9OB 1EEZA 5DRZB 2BWIA 5I16A 4N2IA 1X7TA 1EAQA 1IBYA 4MJIE 3V6FB 3TJPA 5EA0L 4YC2B 4AQ8A 2Z0BA 1L0YA 4Y4HC 5K1JA 1S5IL 4MVBD 4YLQT 3S36H 4XMTA 1KJ2L 4Z8FL 1CXLA 3NPSB 2QHRL 5MENE 3WNNA 1T04B 3L3KA 2R1WA 2R2BA 3ZL1A 1TUPA 1XXDC 4KTEL 3QUYD 5D5ME 5B8CB 2Q7YB 5FCUH 1OD7A 5M7QA 4DW2H 4JFYA 3DUUA 3MA7A 1T5XA 1FNSL 1KENH 3N1QC 3OAUL 4QRUA 1BFVH 3IDGA 2DOCA 3TL5A 2DYPB 1UT1A 2QADB 4EZJA 3HG1A 2X4PB 3HZVA 3TBSA 1V7MH 2E6JA 5D7SH 4R96B 4J3XA 2ZCLL 1ZLVH 4C56E 3IDYC 1SYSB 4XNUH 3FUHA 3QUMB 1J05B 2YQ3A 5GQBA 1H0DB 5AW1B 3UBXG 3TBWA 3ZW3A 1S7UB 3N50A 4QNPE 4PB9L 2XZQL 2DQTH 3WGVB 1JRHL 5GZOA 3FUEA 1YNTF 2EDTA 2ARJA 1WK0A 4KFZC 4E5XB 3BIKB 3CH1A 5C07A 5IHBA 2CHDA 2Z35B 4FJZA 3EYFA 1OVZA 3QCUL 2AEPH 4ORGA 1IGYA 1NFIB 1TSHA 3UTSE 3ARFA 5K9QI 2QTVA 5E6IB 4XZUA 3WAJA 1YG9A 5KYUA 1RERA 3HE6A 4X6BB 3VFNA 3CVHL 4XB8A 1J9CT 1TJIL 1RD6A 1RZFH 4EN3D 2R1XB 4APQA 2X28A 1CT8B 3S97C 1R1CA 3H7BA 4P59H 2VDPB 2IMNA 1MIMH 3LPPA 2OI9C 4KK6C 1SEBA 1YN6B 1WBYA 3HR6A 3F84A 4I77H 2HT2C 1G7IB 3ARTA 3EG9B 4POZD 5FA4A 1CE1H 5DHVH 3WNMA 1LM8V 1I8AA 2H7WA 4H8WH 4QLWA 4WHYG 3EBHA 4B9YA 1NIFA 4PGDA 4DTGL 2CJ3A 5D72L 1CGWA 2DD8H 3QR2A 3NJMA 1KB3A 2B1AL 1DCLA 1ZHLB 4OD3H 4XCFH 2BSRA 2XPYA 3C75A 4BZ2L 3ZKMC 2W95A 3SQBB 1IC7H 3QHFL 5EIIG 2XYBA 1IM3D 5GRZA 3WJLA 4F7CA 1BMGA 4WEBH 4JHZA 3S35H 2BZ7A 5GRWA 5LBSA 1YPZE 4L3CB 5L9DH 4KPHH 4AWJC 4LSQH 4I0CC 3LZQA 4BXVA 5IB4A 4R7NA 1RU9L 2DQHH 3BFQG 1S9WB 5DWUL 3UTTA 2XT1B 4YLCA 1INDL 5I8EA 3S5LA 4L8BB 1F1AA 1V7NL 1AGDB 1REIA 5AG9A 1BVKB 4AE1A 4PR5B 4IOSD 2I9TA 1HHIB 2Z0UA 4CC1A 2K78A 1VFUA 2QQKL 2EDFA 1YEDB 2H3KA 3QUYB 1QLEL 1UATA 3AB0C 1T4KA 1S7RA 4A68A 1LP9B 2CLRA 3U1SL 5ALCL 3A3YB 1A3RL 4WWKA 4LRNL 3MV8A 2ATPA 4HIPA 4LOUD 3KHOA 2MCMA 3CDGA 4EDXB 2AERT 4H2CA 1RUKH 2LQRA 4JDTH 1S7XA 3CFDA 1G7QA 2H6PA 1Z3RA 1CBJA 2FSEB 2KT6A 4FL4B 4ISVB 1HKFA 1PNCA 3DVFA 3F62A 3HUJE 4IS6A 4NZFA 4OLYL 5FX3A 1KDJA 3BSHA 4HFWA 4NHCH 1GSKA 1X9QA 3LXAA 4HIHA 1T1WB 1EHXA 2WLYA 1OAXL 1U33A 2J73A 3VXRA 1J8KA 2Z7UA 4IJ3C 4G1MA 5I6NA 3S8FB 1DEEA 3BZ4A 3ZUCA 4P2CG 4ODSH 5DURD 5HD8D 2HLFD 4KHTL 2G5BB 1QFPA 1X9LA 2G3NA 3QCTL 1L9MA 4NAQA 5DC2A 3I75B 3Q44A 3WMQA 4BQ9A 4CA4A 2WZ0A 4Q0XL 4A63A 5ADPL 3OB8A 4FQCH 3KJ6H 1VCBC 1NICA 4P5KB 2WD0A 3L9YA 2HLAB 5F7DA 7FABL 3QWQB 2P5WA 3OZ9L 1CVRA 1MCQA 3MUGB 4K7PL 5AL8A 2ZUTA 2BWQA 4EN3B 4RFEA 5TE7H 5JZ7D 3SQOH 3EH5B 1IAII 4JDEA 1T66C 3V7MA 3A21A 4A7GF 1ACYH 3GGWB 2IALA 3Q0HA 2EECA 3KDMA 2FX8H 3G7TA 2C1PA 4E42A 5GGQH 5C3LD 3KLKA 1IC5L 2EXYC 3Q5TA 3X12A 4AQAA 3ETTA 3OJ2C 5I18H 4CC4C 3KDPB 4JG1H 4O02L 2EZ0D 2WLZA 2BVYA 1CJYA 3UTOA 3WFDH 1WVZA 1NCAH 4ERSH 1BWMA 4RGOH 3L13A 1O7DE 2CKNA 1AR1C 4ZQTA 1CXEA 3PDGA 5IV2B 3B7YA 2X44D 5SWSE 1AOZA 4YDLB 4G6JL 3UBXI 1IM3B 2DH3A 3P4NB 5HJGA 1R0AL 2UZXB 3QUZC 4ZOAA 3FCSA 3H54A 1LK3L 4P2OA 5DGQA 4FFYH 4U1LB 2J1ZA 2BCKA 4WHCA 3PAYA 4X9FA 1G4MA 3QPXL 1RIVL 3TJHC 2JJTC 2X0VA 2XQBH 2DQGL 5JYLA 4PTUB 4WFEE 3RI5K 4X7SL 2MRYA 4GSUA 5KSVA 4ICWA 3GMQA 1F56A 1JSYA 2BP3A 1Q9WA 1FNGA 1OM3H 2B4CL 1GJWA 3APDA 4N0CC 3U7WL 5TQ2L 3WTUA 4UTAL 2R8SH 2OK0H 2WW8A 3HMXA 4PJFE 4L3EB 1AY1H 1YDPA 3DHJA 4N8UA 5GRJL 1HS6A 5IY5B 1EO5A 4L5FE 3FFCA 5D2NB 3BP4A 4MA7H 1QPXA 2VR6A 2WMPA 2UZYA 3ISWA 1XV8A 5GS0D 3S3BB 4RLDA 5DJ0A 2F1BA 4C83B 4HCGA 3HKZA 4XOCA 1CLOH 5D5MF 1CQYA 3WTTA 1YLBB 1NLBH 4HV8B 3NIGB 1XGZA 1BYPA 1HSAB 3QP3A 2ZAGA 4KJYB 3V0GA 4DAGL 1MRFL 4CJ0A 4FXKB 2VR4A 3TH3T 1FFNB 3O3EA 4LHUD 3WXWL 3SDXA 2OQJA 1LEKA 4IK7A 1U2YA 1JZ8A 4HK3J 5ESVB 5GGSB 4AM0B 2CRZA 2UY6B 5DURB 3EYUH 5GS1A 3ULUD 2CO6B 4ZS6D 4MYPA 2ZONA 4XCYB 5FWQA 4LBAA 3P0VL 1KIPA 4HMDA 3UYPA 3TF4A 2OSWA 3VH8G 4P2QD 4S0SD 3FCGA 4GBXA 5IT2H 2VTFA 5JW5A 2GC7C 2M26A 4I0PD 4HA1A 3T0DA 4HIEA 3DC0A 1S7WB 1E2VA 3RHWK 3S8WA 4GQ9L 3K71A 3N2JA 1OPGH 2FEJA 3WTSA 4N5ED 1TPXB 5CJ8A 3VGGA 3T8XB 3MLRL 4H1LH 2HZHA 1TTAA 3WELA 4TNGA 5J12B 5AW3B 3WTWA 5D7KD 5IK3A 3X2QB 2VDNH 4OCYL 5HYQA 4S2SB 3IDJB 4RBPH 4AM0Q 4OIAA 2PR4H 2X3BA 3D3VE 5IMOB 3TN0C 4C4UA 3JV0A 4NZRH 1Z5YD 2WGNB 1IZJA 2WAHA 2A7BA 3NCMA 4LPXA 5ETUB 3VXNB 3QDJA 4HS6B 3BQUC 2DYSB 3P9LA 3FF7A 1FZOB 3TX4A 1HHJA 2M2DA 3S36L 1CI5A 5C0FB 3BZFA 4JHVA 3P3TA 1CI3M 3BESR 2YC1B 4LL9A 4MXVE 4JVUA 5DJAA 2DS4A 1PLAA 2GFBA 1YPZF 1UWXK 5HY9A 1J9TA 1JHLL 3GXFA 4DW2L 4HK0B 3MUZ1 3HFFA 4P46D 3B7RL 1FIEA 1OD9A 5GRXG 4L29A 5DUJA 4YC2C 3CBJB 1QLRB 4OIIH 3NACH 4G9DA 1QHOA 2M83A 1V7ML 1NGWB 3G08A 2DI9A 4XNUL 2BHUA 4Q4IA 4PJ9D 2CDEB 1SJVA 3NPSC 5C09D 4X4ZA 3GJFH 2QVFB 4NPJA 4EUPB 4Y4KD 4Q56A 1FH5H 2DQTL 3CFIC 4PGJA 5B8CC 5IB2B 3VD3A 1JPSH 1SZNA 2VLLB 4M5SA 4NO0A 1SLUA 4BQ6A 1SY6A 5DTFA 4LHUB 3VXSE 3DX8B 3H3BC 1MDAA 2X7LB 5BO0D 2H26A 4U3HA 1RI8A 3EF7A 2AEPL 2CR0A 1TVDA 2IH8A 3OZLA 3GSQB 3K6FA 3OLGA 3ZZSA 4EDWH 5CD5C 1KN2H 3B9KD 2XWBA 3HUJF 1EJ8A 3CQFA 3ES6A 5IBTH 4KHXH 1SVZA 2EEAA 2J88H 2YQGA 1QLFB 1RZFL 4JZJC 3TFKC 1B3JA 3MJ8B 1GGCL 4P2QB 3HNVH 5DO2C 2X9YA 4NKOA 2ZKWA 2YWZA 1MIML 3OKMA 3U46A 4I0PB 3ZO9A 3IAQA 3Q9QA 1R9FA 4XO3A 4NS0A 4F33A 4I77L 1UXSA 5DJ2A 1MCPH 1CE1L 1G6VK 5F72S 1ZGLP 1YYLH 4H8WL 5E6IC 1LXMA 4HUUB 2XV6B 1CCZA 3P0GB 1SUJA 2F8VA 1UOVA 3WNPA 4ZZKA 4ETQB 3HG0A 2DD8L 3GMRB 5HHQA 3MCKB 2BIHA 3QZWA 4OD3L 4PBXA 5C7XH 4K73A 1DVFD 2G2NA 1BBJA 4RRPG 2OMTA 3QYMA 4KKCC 1IC7L 4PJEB 4X6EA 4JGUA 2NW3A 1H3PH 2GJZB 2AFNA 3DK0A 4BSVB 4GUOA 3WIFA 2CALA 4LVNB 1JD9A 4WEBL 3S35L 5L9DL 4L4JA 2PYED 2CBOA