2P80A

Solution structure of the complex between nitrite reductase and pseudoazurin from a. faecalis
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
335
structure length
335
Chain Sequence
TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Low resolution solution structure of the 152 kDa complex between nitrite reductase and pseudoazurin from A. faecalis by paramagnetic NMR.
rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 68
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2p80A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2p80A02
4YSEA 3T71A 4KNSA 2XWZA 2FQGA 3AZUA 2AANA 4YSQA 3PPSA 4AZUA 4YSTA 1L9RA 1AAJA 4E9WA 3IN0A 4HCFA 4GP5B 1ID2A 2I7SA 1OF0A 1GR7A 3NYKA 2VSKB 2GI0A 1L9OA 4YSOA 2IWKA 2TSBA 2W88A 1BQRA 1GY2A 2I7OA 5ANHA 4BK5C 2WO3B 3NP4A 4G7SB 5TK4A 5B7EA 1WA2X 3GXUB 1IBZA 4MFHA 2VMJA 4E9TA 2FT6A 4AKPA 1NTDA 2OJ1A 2XV3A 4FAAB 4E9XA 2YAMA 4BWUA 2CCWA 2J55A 3DTUB 2VW6A 3UACA 1JXDA 2BW5A 4JHUA 2HXAA 2HX8A 1OE2A 1PLCA 3HEIB 3EH4B 1KGYE 1JXFA 4QLWA 1KV7A 1J5DA 2FQFA 2GB2A 1GY1A 2I85A 3AG3B 4UF7C 1NIFA 5B1JA 2PPCA 1KBVA 2Y69B 4DPBX 1OCRB 1OCCB 2BO0A 2YXVA 3NJGA 2H3XC 1SHXA 2QT6A 3ASNB 1KBWA 1PZBA 4HAKA 4N4YB 1AR1B 3ZBMA 5AKRA 4QKTA 2W8CA 4CSZA 1B3IA 1NIDA 2AZAA 3KW8A 4YSSA 2XVBA 6PCYA 1QHQA 5LDUA 1F56A 1AIZA 3OD3A 1J5CA 3WIAA 2HLEB 2UXTA 2XXFA 3S3DB 2YXWA 4CSPA 1UATA 3L45A 4A66A 1HFUA 3NSYA 2IH8A 4AKQA 1E5ZA 3WNJA 3FQ2A 2PLTA 4G7QB 1NWPA 2FT7A 1JERA 2TSAA 2YAEA 2HX7A 1W6WA 3FU7B 2WO2B 3CZUB 3NJJA 3SBRA 4PCYA 3JTBA 3C75A 4YVNA 1ZPUA 2BP8B 2DWSA 2IDUA 3FU7A 3N2JA 3ABLB 4KO7A 1EZLA 3OMNB 1KDIA 3NJLA 1CC3A 1E65A 2BP8A 3PCYA 1DZ0A 1L9TA 3S8FB 2LLNA 2ZOOA 3BQVA 1ZDSA 1JZEA 7PAZA 2YAPA 3G5WA 1PZCA 4DP5X 1JZFA 3NJKA 1BXVA 1ET8A 1BAWA 1ASOA 2ZXWB 3IBOA 4DP4X 2ZWNA 5PAZA 4F7KA 3FQYA 1M56B 2UX6A 1L9PA 2CBPA 2B08A 2RACA 1NPNA 3DKHA 1PF3A 1I53A 2PP8A 4ENZA 4DPAX 1NICA 1FA4A 1AZUA 1SNRA 2P80A 2GC7C 4WKXA 3S3BB 2EIJB 1SJMA 4HIPA 3X1NA 2QDWA 1NWOA 1WS8A 3IN2A 1A8ZA 2HRHA 1A4AA 4PAZA 5IY5B 4G71B 1WA0X 2VW7A 2WSDA 3NJIA 2FWLB 2YAQA 1L9SA 2IDFA 5F7BA 2J57A 1CYWA 2BZCA 2XUWA 1ETJA 3TU6A 2MTAA 4BDVB 4DPCX 2OCCB 1SFDA 2FTAA 1YLBB 1TU2A 9PCYA 3FQ1A 3SBPA 2A3TA 2JKWA 4BDVA 4BXSV 4BWTA 2UXFA 1ZDQA 3AW5A 3WKQA 3KW7A 3X1GA 3T9WA 1RZPA 1TEGA 2AVFA 4AKOA 1W6LA 2BW4A 5D4IA 3PLYA 3QPKA 2BWIA 1L9QA 1E5YA 3NT0A 4NAJA 1NIBA 1AACA 2XX1A 3FPYA 3FT0A 3UADA 3PAVA 5I5JA 2J56A 1QNIA 3T6VA 2BZ7A 1OCZB 1BYOA 2Q9OA 4YVUA 2IDTA 3TBBA 4KOBA 3NJMA 5AZUA 2IH9A 1ADWA 3EF4A 3X1EA 2FQEA 2YARA 5B3SB 3ABKB 1M57B 1GSKA 4BWWA 1E67A 3SBQA 4YSDA 5F7AA 1RKRA 1HAUA 2GSMB 4K9JA 2VW4A 1GYCA 3UGEA 1XB3A 1MZYA 1GS8A 1KCWA 3FU8A 2B3IA 2CUAA 5D4HA 2XU9A 1BXAA 1JZGA 3EHBB 4E9SA 5AFAA 2H5UA 2IDQA 1NZRA 3PAUA 4HCGA 3BVDB 7PCYA 3JT2A 3TASA 1CUOA 1SDDB 2FJSA 2JXMA 4E9QA 3HB3B 2GC4C 3FPXA 1W8EA 1MZZA 1NINA 5I6MA 1SDDA 3MX0B 2GBAA 3FSVA 4L0PB 4DP9X 4G72B 4KO6A 3PXLA 3FS9A 2Q5BA 1JXGA 1A4BA 3FSAA 4E9YA 2ZONA 4AX3A 2OV0A 1IBYA 1N68A 4DP1X 4W9ZA 2PP7A 3WKPA 4DP6X 1AS7A 2QPDB 2HZHA 2XLLA 1AZNA 2P80D 4HCIA 1N70A 1MG2C 3H56A 3NJFA 2E86A 4A2GA 1VLXA 1J9TA 2DYSB 1OOWA 5PCYA 1JOIA 4DP8X 2PPFA 5I26A 1AOZA 1NIAA 1AZRA 2VN3A 5I28A 3QJTB 1AS8A 1FFTB 3CVCA 3FSZA 1PLBA 2UXVA 2AFNA 2EIKB 1FWXA 3QJRB 4A67A 1SF5A 1X9UA 2XXGA 4A2EA 4YSAA 2Y1AA 4JKNA 4KO9A 1V10A 1GW0A 1XB6A 1V55B 1WA1X 2MRYA 3GYRA 4YSUA 1A3ZA 2BP0B 2IDSA 5A7EA 5I5IA 3NSCA 2HRGA 5B7MA 1IUZA 1BEXA 3RYMA 3QQXA 1PNDA 1ASPA 4M3HA 3NJNA 2VM4A 3V9EA 2BP0A 3OMIB 1ZIBA 3MBWB 3ERXA 1J9QA 3AG1B 5B7FA 3TBCA 2XV0A 3UAEA 4DP0X 5I5MA 2HX9A 1ZV2A 4HHGA 4KNUA 1PMYA 1WAEA 1ASQA 4A2HA 1RZQA 1PNCA 1DYZA 3D12B 4UANA 4RH4A 3NSFA 3QJVB 4Q89A 5E9NA 2CAKA 1MDAA 5EHFA 1QLEB 2QPEB 2N0MA 2DY2A 4DP2X 1J9RA 4G70B 5FC9A 1JZHA 4YSRA 1PLAA 1PY0A 4FA7B 4A2DA 3IEAA 2J5WA 1NDTA 5TK2A 1KDJA 1PZAA 3NJHA 1OV8A 3AG4B 3FYEB 1HAWA 1XB8A 2UX7A 1BXUA 3QJQB 1AG0A 4TXVB 5I6KA 1V54B 2UXGA 2H47C 5I6LA 3WI9A 3T6XA 1GS7A 1BQ5A 3UAAA 2VSMB 2IAAC 4E9VA 3FYIB 3S3CB 2JFCA 4UAHA 5B1KA 4Q8BA 3WNIA 1RCYA 3H4FA 1AS6A 1X9RA 2PCYA 3T6WA 4G7RB 2GIMA 1IKOP 1JVLA 2DV6A 4AI7A 1SHWA 4GYBA 5B1JC 1TKWA 2CJ3A 2PP9A 1NIEA 3T6ZA 2IWFA 4NERA 1J9SA 2QDVA 2DYRB 5I6NA 4GY4A 1AZBA 2GHZA 3X1BA 2PPEA 3ASOB 1KCBA 2BWDA 2VM3A 4NB7A 3ZX1A 4EF3A 1T5KA 4E9RA 2AZUA 2YAHA 2YAFA 4F2EA 3H4HA 3DIVA 2X87A 1ILSA 2R7EB 2PPDA 1AG6A 2XYBA 1TEFA 3ABGA 3PAZA 1M9WA 1OE1A 3QJSB 3S8GB 4BXVA 2YQBA 3NSDA 5D4JA 1XMEB 4WTQA 4P5RA 4X4KA 5B1BB 1ILUA 1JZIA 2EIMB 2EILB 2R7EA 3X2QB 4F2FA 4YL4A 3NP3A 2NRDA 1BYPA 4W1TA 1WS7A 4GP8B 3FSWA 5I6PA 4DP7X 4ZK8A 3CG8A 3SQRA 1ET5A 2XX0A 2PCFA 1KYAA 5I6OA 4YSPA 4M4RB 1OCOB 3IE9A 3CVBA 4YSCA 1BQKA 4GP4B 5B1AB 1MG3C 1CURA 1NPJA 4HZ1A 4JHVA 2X88A 4P5SA 3AY2A 1JVOA 1PCSA 1E30A 3ABMB 1A65A 3X1FA 2FNWA 3CDZB 2EINB 2IWEA 1SF3A 3TA4D 6PAZA 4KOCA 1AQ8A 1ZIAA 2PPAA 3CDZA 3N55A 3WG7B 1CYXA 2XV2A 3U25A 1IC0A 3OMAB 1A4CA 1ET7A 1OE3A 2DWTA 3OM3B 2BHFA 2FT8A 3EH5B 1R1CA 3CVDA 2CALA 2YAOA 1URIA 4GXFA 1EHKB 4A68A 1JZJA 1AANA 8PAZA 3ZDWA 3ZIYA 3V9CA 1SFHA 1GS6X 4HALA 2FQDA 4N8UA 1PAZA 3EH3B 3QJUB 3AG2B 1AZCA 4KO5A 3FU9A 3OQRA 4HHWA 3GDCA 4KNTA 4A2FA 3UABA
chains in the Genus database with same CATH superfamily
1FH2A 3UYPA 4G8FA 4YBQC 3WHE1 4DF9A 4YAQB 1HK6A 2V17H 3T2PA 1A4JA 1RZJL 1SEQL 4JHWH 4JN2B 1LO4L 3OKOB 1CD9B 4WENB 4XP6H 1ID2A 4M61B 1HEHC 2FEJA 3BAWA 3S88L 4Q7DA 2X6AA 1U8NB 3AY4A 2H0PA 3LD8C 2KYIA 3GI9L 4OM0H 3BLPX 4AVIA 2FJFB 5DJ2B 2QQLL 1E4JA 5F0MB 2GW5A 4HQQL 1Z7JA 3SGKA 1JPFB 5ANHA 1H3PH 2CMRH 2JH2A 2Y5TA 4I88A 1IGIL 4NCC2 2IBZX 3E9TA 3ZYZA 4O2EB 5EA0L 4E9TA 3OG6B 1KLFA 4FAAB 5H4ZA 4E5XG 4NJAL 4NZTH 1C16A 4PWKA 1A9BA 3FOMA 1LP9B 3SDCA 4M7ZB 3S97C 3ZN6A 1G7MB 2XPYA 1Z32X 2G3NA 5IOKA 2Y4SA 2XVLA 4NUGH 4YFLI 3BP6B 3ZKXB 2PCPB 1KB5A 3VG9C 1A1NB 1TZIA 4F5CA 3MLVL 5F44A 4JFDE 5C09E 2VR4A 1TF4A 2UZIH 5IMKB 3H0TA 3UDWC 1YEJH 2VDKH 4XWOD 4BKLB 2CDFB 2FK9A 3FRPG 4NO5B 3HBGA 5C08A 2HFFA 3KBEA 4OH2A 3EYSL 1KBVA 3HNSL 2FL5B 1CVRA 3HBPA 4N90D 4ETQB 1CBVL 3WY3A 4YXLL 1QLRA 4YN3A 1RFDL 3DTXB 1WRFA 1NUFA 2P5EB 4P5TB 5E6ZA 4EVNA 2F1BA 4FQ2L 1MI5D 2WXGA 5LBVA 4QI3A 3T1WA 2X9WA 1WIPA 5JOFA 5A2AA 2VZUA 2Z8RA 3HS9A 2OXGB 4QPEA 3B5HA 1HHKB 2WW8A 4KKRA 1INEL 3TYGL 5JZ7C 4XN1A 4AJ0A 1UWYA 1AIZA 4MCYA 1JPSH 1OSPH 2HLEB 3WIAA 3KG5A 1KGCE 5DZJA 5KSUA 4KZ0A 1E2VA 1XGUA 4ATWA 4L1HA 4X42A 3UXFA 3VXUD 3G6AA 4N0YH 4OCRL 5FKPA 2K6WA 4NC0B 4FFYH 4FABL 5C6TH 1JERA 4AE1A 5JHLL 3AS0A 3I75A 4YIQB 3FO9A 3PJNA 1LE5B 1SXZA 4DAGH 4BFRA 4MQXD 1XEUA 3I6LE 2C1PA 2O72A 3V4UH 4AK2A 2ZOUA 1DQJA 3N91A 2XWJB 3KPRD 2H3NA 3QO1A 4TVPE 4GG8A 2QLYA 1EUUA 3RTLA 1EHXA 3ARWA 1ZK9A 4E36A 4PIBA 1DZ0A 3PIQB 4UT6A 5GGQH 1Q0XL 3BQVA 3IPBA 5KZCB 1FL6A 5IIEB 1AXSA 1NCUA 1PZCA 4P8QA 1QRNA 1TZOA 4JRXD 4N2HA 4ZOAA 1RI8A 4K7PH 5IFHL 4AC4A 3DRQA 2HKFL 1MCCA 2YRLA 3KYAA 4K0OA 5IGXH 3MJ8B 1QSEB 1CXKA 4H20H 4TVPH 1R9FA 5E8OB 2H6UA 3FUMA 3FO2A 2X4PB 1OPGH 1M56B 1UZ6E 3DYMA 2UZXB 4HCRL 3ZDYF 5IHUH 4NLAA 4UQ2A 2EDWA 3K6OA 5E94A 3V4PL 5I1GL 2OAAA 4H4NA 1F3DH 1E6OL 5HDWA 2H26B 2QJDA 3CPLB 4GW1A 5KTEH 1H8OA 1SJMA 3GD1C 3Q1SH 1IZKA 3UTSD 4RSVA 3T8VA 4AEHL 4CKVX 3R1GH 3ME0A 1HX0A 5IY5B 1C12A 2YGNA 1WA0X 1XXFC 2VMFA 1UD3A 3GEWB 2B2XL 2OYLA 1WCBA 3HS8A 2EEDA 4P46B 4LEBA 3MFFB 4WFGE 4ZX6A 1DBJH 2B16A 3MODH 3FO1B 4JPKH 4FL4C 1ETJA 2CE6A 3QXDA 3MA7B 3CUPA 3HS0C 2A74B 1UM4H 2BCKB 1G7LA 3IJ8A 4ODTL 4A2LA 5KSBB 3U0PB 3MRIB 2FGWH 2K9FB 3FQ1A 2ODIA 4UM9B 3L9BA 4BDVA 2J7LA 2CGRH 4L4TB 5MEPA 5DRWB 5DR5H 3P2DA 3OKNA 4H5SA 2CCVA 4NQSA 5D93B 4HGMA 3V0EA 4F27A 3B2VL 2G60L 5KS9F 4QHKI 4FQHA 1NBVL 5ABZA 2EDYA 1O5DT 2Q7YB 3G5YB 4A1RA 3KYOA 1Z0MA 4QJ3B 1MFNA 1FG9C 3D1MC 2PMZA 3Q5OA 1D6VL 1E43A 2WWMD 4FCAA 1RURL 4G9DB 4HX1B 1NC2D 1J0HA 2MHAB 4D0BA 4KK6C 5D7SL 3I3DA 1CI5A 1K5NA 1VFMA 4L8SC 4I77L 4M48H 2GUOB 5SWZB 3WE6A 4N6QA 3ARGA 1S5IH 1RU9H 4N8VB 4NYLA 4MA1C 3X11A 3DBSA 1EHLH 2CGZA 4C8XA 5AG9A 2ZXEB 5KBPA 1EHAA 3ZZQA 1MZZA 3MQIA 3QCUL 4HD5A 4NBZB 4R7DB 1BQHB 4XMTA 1P5VB 3BZEA 1Z5YD 3PYCA 1GTFA 2YWZA 5EZPA 2O4EA 3MUHL 3ARQA 2ZONA 4R8WL 4TL4A 3V4VA 5I71C 2WB7A 2Z93B 4GKZA 4PY7A 2HKAA 5I1LA 1DCEA 3K71B 2QPDB 5DZLA 5D7JD 2OYPA 1K8IB 2VN4A 4Z7UB 3TGXA 1I7UA 2J12B 1C5CL 3SY0A 2JJTC 4FQXA 5E8DH 1FO0H 1H15B 5E1QA 1MRDH 1QUPA 4JGJA 1OM3L 1FFNB 3D34A 4NFDA 3HZYB 1F90H 1UM5H 2YUVA 4BFFA 4W4OC 3ZO0A 4DP8X 3FULA 1PG7L 3NSXA 3EJCA 4X6EA 3CDYA 1NIAA 2VN3A 1GGCH 3CLWA 3GMOB 4Y19D 3BISA 3CVCA 2APBA 4ENED 3CLFH 3WFCL 4A67A 3L3OA 3JWNG 3RWHA 5FA4B 5B38G 4DVRH 1ZLUH 4OF5A 1GZHC 3PU7A 3CH1A 3QJXA 5IEHA 4RFOH 5BVPH 4YSUA 3H53A 2Q87A 1ZSDA 2IDSA 4FFWD 2Z31B 4P2QE 1JHTA 1XMWA 2IIJA 4S11A 2GK0A 4Z7NF 1UYWL 3RYMA 2VXUH 5IVXB 5AVYB 3G5ZB 3THMH 1XF1A 4UU9A 5J13B 1CF8H 1IAII 4TUOB 1NBCA 3V9EA 1T3FA 2E6JA 3IDJA 4O51A 4UIKL 1JYWA 3GKZA 3QWOB 4PJGF 5BV7H 3MBXH 5CWSB 4PWHA 1DEEA 3BKCH 4OJYA 4HC1A 3SCMA 1PMYA 5E9DA 1ASQA 4KKCD 1EEYA 3N06B 2O6PA 4KVPA 5EU3B 1BYNA 3BSZA 4LKCB 3IS1X 4RH4A 1A6VL 3AY4C 3GJFH 5HHXH 1RUML 2V3DA 2PW2B 3HZVB 4NSKA 3SGKC 4JO5A 4NRXB 1PLAA 4HT1L 3ATFA 2MOQA 4WJ5B 5IW3A 3RUGF 2D2OA 2V5TA 3EJZD 2N7BA 3KXFA 5INDA 2ZKMX 3H7BA 5D7IF 1BXUA 2V0AA 2XV6B 3HRZB 3KPSB 4P5TD 3BPNC 4LNRA 5MENE 1K72A 2UYLB 1FSKC 2Z7YA 2Y5EA 4IRSB 4KJYB 3SDCC 1OK8A 4TUJA 4AYBA 1T04A 2ZG2A 1AGFA 1GS7A 1FJ1A 3BC9A 2VSMB 2XI9A 2ZOWA 1NFAA 2WBJC 5DVNA 2WKOA 4NIYE 3ZRSA 4NHCL 3P77B 4XN2A 1HHHA 5B1KA 4WEUD 1VADB 2B1HL 1E6JL 5HGHA 1M1XA 1J11A 3S2AA 1XXDC 2WLLB 4F1ZA 4WNSA 5K33A 3C6LB 3FB6A 4RGNE 3HBZA 4E9LA 1T1WB 1R47A 3ECBB 2DQTL 3HG0A 1PKQA 5E56A 3IVKB 1BA9A 1E5AA 5HHMB 1HOCB 3QNFA 2RAMA 1MLCA 4KROB 2GITB 4NGHL 1TYRA 3A4AA 4U4IA 3DGGA 3BPOB 1I4FB 5GRVK 3ULVC 3TBTA 3BGMA 2I26N 2ATPB 2JELH 1NAML 3L7FB 5HHQB 2C1OB 3WGVB 2AZUA 3WTVA 1XVSA 1U6AH 4ELKB 3DIVA 2XQBL 1XGTB 1N2RB 1G0DA 4UB0L 4YHPA 4CC0A 1L5GB 3MYJB 3RX5A 4UV4H 4DN3L 3U46B 1ILUA 1MLBA 2VWEC 4LHUA 1Z2KA 5D2NA 4KZDL 4ONOA 4X6DA 5SWQB 1SY6A 3ARFB 4JY5H 3T3MB 3VXSE 2Y25A 3IMVA 4ADIA 1G9MH 1B4TA 4YHLH 2YUZA 3UZQB 1TTUA 1U3HD 2BIQA 1UVQA 2YGPA 3NAAL 4XZ4A 3PHSA 4B9CA 4DTGL 2D2CC 1P7QD 4GO8A 5LNDA 1VDGA 1R5WB 3F12B 4OFYA 4QRPA 5I1AA 3STZB 3L4TA 1ULVA 5TTRA 3BIBX 2YOCA 4GP4B 5F88B 4AEIL 3K6FA 4IRZH 2AEPH 3IDNA 4WHCA 1HCZA 3ZR5A 1FNSH 1RHFA 4JFZH 2R15A 5C97A 5FGRA 1XZ0B 4I4WB 3W1ZA 2NNAA 1NCCL 4YQXL 3WTUA 1NCWL 5LHDA 4JJHA 5MI0B 3FQXB 3N55A 3WG7B 4QTFA 1CYXA 1G7JB 5DD5L 5AUMA 3C5ZA 5LWYL 1WC7A 2VDPB 3B9DA 4OZIF 1GXEA 4P2RE 1LM8V 2MCPH 4Z7VE 2Q86B 4N2BA 1AHKA 2J6WA 5FA3B 2O26U 3TBSA 5DK0B 1GTNA 4GI8A 4PRHB 3EJSA 3TM6A 4Z0BL 4AGMA 3O4LD 4BUQA 2ICES 2BDNL 4HALA 4G7VH 4X7CC 1JBJA 2NPLX 1A6ZA 4G9FD 1IRAY 1UM6H 3U2SB 1ORSA 4WNJA 5HYQA 4OZGF 4GLRI 3H7LA 1JPGA 1I8MA 5D2LE 2X4NB 4QIRA 4XC1L 1M9SA 3KWVA 4ZUVA 3VXRE 5EIIB 2WBJD 4LLQA 3UG3A 4F92B 4YDZA 4N9GA 2KZ1B 4RCAA 5EOCH 5DA0B 2R0ZH 4CDGC 3OKKB 5GGVH 1KEGL 2P5WA 2WD0A 5IVZA 4ONFL 5FKAB 3L95A 5EV7A 4TOYL 2FCBA 4WEEA 2YWYA 1KCVL 5HGGS 1ZLEA 2P5WE 4RNRA 4R84A 1HIMH 1I1AD 1OTSC 2HSIA 4X5XA 4HSCX 5CJQL 2NSMA 3WELA 2JQAA 2OCFD 2VDRH 4N2DA 4CJ0A 5FAAA 3RWGB 3RTQA 3QA3B 4GKSB 5FHAL 3NZUA 4P57A 4HMEA 4N5ED 4E9XA 4F91B 2O61B 1YYLL 2QTEA 3K4DA 5IW6B 4UT7H 3A4FA 3ARDA 4PV8B 1SVBA 25C8L 3OVUB 3EYOA 1E2ZA 3MLSH 1TDQA 5JXED 1J0KA 4PLKD 4P2OD 5T1KA 5HGBA 3U6RA 4LCYB 4MZIA 4N87A 4X6CA 3VH8G 4UAOB 2IQ9H 4QO1A 1N6QH 1H3WM 5K39A 3GSVB 4L29B 4YZFE 1M3JA 3MACH 5DURD 3MOBL 4CU6A 3D8MA 1HSBB 1QFPA 2XC8A 3CFIC 2N1TE 4DOHE 4UM8B 2VXTH 3ULAB 1OCCB 1C5DB 3CFQA 3C5JB 3MV7E 3T0XA 3B9KA 3VI3F 5CEXA 4GG6B 3B37A 2PUQT 1FRGL 3D33A 4B7LA 3DHMA 4FRWA 1XBRA 3FRUB 1I9IH 2VLKB 4IMLB 4O5LL 4F33B 2IO5A 5FUOL 5T3ZE 1FPTH 1B3IA 5I8OL 2CO6B 2X6CA 1DBMH 3KLSA 1UWGH 1VA9A 3ZDZF 5CUSH 4ANWA 1A6PA 5ETUB 4L37B 3RL2A 3EJJX 3HMWH 3LH9A 4FQXC 4U6TA 4X9IA 4NKIL 4Q6IA 5D1QC 2NW3A 1J5CA 3Q5TA 5EZLA 1C8QA 4NM8L 2E0PA 3ARXA 3L45A 1L7IL 2DQJH 4ZMYA 3D0LB 1OAJA 5DJ8B 2MCG1 1QBMH 3O2DH 2D3JA 3N43F 5I15H 4N2NA 3WKNA 2PWFA 4AYFA 5HYSG 3FUJA 4TULL 5HHOD 3KPQB 4WI9A 3REVA 4EDXA 2P7TB 4QGTA 4H1LA 4YXHL 3L3OC 2LU5A 1DR9A 1WLHA 4K9EC 3GXTA 5H94B 2JQZA 2X05A 4K94H 4MA7L 3LRHA 4JR9H 4RISH 4WJKB 3VCLA 2VLLA 3P69A 1A9VA 1YY9D 4M93B 5I6XC 4DKAA 4KVNH 3K4AA 2A5UA 5ALCH 3LRSB 4HG4K 4NQDB 1DN0B 3KPSD 2XBDA 4IBUA 1JZFA 3IDYC 3NZ8A 1K8DA 5CEYA 5E7FA 1AJ7L 4PIRF 3IBOA 3ELQA 3BWSA 4AGQA 2YXMA 2H0EA 2BH0A 2YO3A 2CBPA 2QR0A 1NPNA 1WFOA 4WK2B 5J89A 1FZOA 1IX2A 3BE1L 2DJ4A 2YK1H 3QWRD 1NICA 1BMGA 2BXYA 2NQDA 3MRGB 1FA4A 1U8MA 5DMJB 4YL9A 1F86A 1KG0A 1OTSD 4WKXA 2PXYA 3RNQA 1WS8A 3GSUB 4HBCL 3EH2A 5IM7A 4G1MB 4M7LH 4N0UB 5I73C 4IBTA 2CWRA 3FT3A 2WSDA 1BAFH 2H2SC 4KRLB 3EYFB 5CGTA 2IDFA 4ZODA 2B1AL 3CFTA 2CLVB 4P4RA 4GSRA 3A6BL 3PPEA 1T0OA 4ANKA 2OZ4A 1BQUA 5DFAA 2FH6A 3U1SH 4O00A 4U1GB 3M86A 1ZVHA 1CE6B 2J6EA 3FTGB 5MERA 2IG2L 3P54A 4PLJD 5GRYA 3IDMA 3MLYH 4MHHI 4RFEB 5D9SA 4XMKH 5IB2B 5E4EC 2R2EA 3V6OC 2A3TA 3G6JE 5A7BA 3BKJH 1T5WB 5C07D 1XGRB 3MVSA 5E2TL 2WXMA 3IU3B 2GKIA 3CBRA 1AP2A 4GAJL 3N42F 1W6LA 1T0MA 3AS1A 3PLYA 2CO1A 2KLTA 4XP4H 4Z7WB 3VA2C 3ARFD 3LEVH 3PP4L 1BPVA 5KG9B 3HC4L 2CD0A 1QNIA 5LQBL 2PYEE 1OM9A 3IU4H 4HK3J 2H6PA 1SBSL 4JM4L 2OMTA 3NFNB 2J71A 3RWIB 1S9YA 4PJ7F 3X1EA 2IAMB 2QQKH 3KDPB 2EVFA 2ZOKA 3RBGA 3KYNA 1ZT1B 4XNYL 2VW4A 3IDIB 43CAA 2J3SA 5FUCC 3VX0A 3SDYH 5I1DA 5D1QD 2CUAA 5DJCB 3QPQC 3V4VL 4M7KL 4HLJA 5E2VL 2RH0A 4GO9A 2XKNB 4DKDC 4PP2A 1PJ9A 2DKMA 1MCOH 1I3GH 1IBGL 5D2NC 5EN2A 3O3AB 4LLMB 5C8JA 2FECI 4BCZA 5KBNC 2FHFA 4NQCB 4GOSA 4UYPA 3OKMB 2CIIB 4JFYB 4LCWA 4S1SL 1IMHC 2MFNA 3VRJA 1KJ3H 3J2PA 2VJ0A 3GHPA 3MX0B 3TPUB 4ZZFA 4GRWF 1O9WA 2BNRA 2VNCA 1K4CA 1JK8A 4G7YH 3ZQ9A 2OMXA 3QR0A 4JUTA 4LCWE 1E3FA 2BOCA 2Q5BA 4XBMA 1DO5A 4DP1X 3APDA 4M6ML 2OM5A 3P0VH 2DQCL 3P9LB 3MV8D 4K9EL 2VXQA 4RMVA 3ETBF 4APXA 3ZE1B 4CUCA 1UB6A 4S1QL 2G3ZA 5JOEA 3BD4A 3CTTA 4PRPB 4K23H 5E5MB 2WNWA 32C2B 3DV4B 3RVUD 1VLXA 1D9KD 1LILA 4AM0B 1I85C 5EU5B 2EEFA 2O5ZH 2ALAA 1Y18A 3C5ZC 1KGJA 2VE6B 2BSRB 3GUTA 4OT1H 4ZXBC 1CN4A 4QRSA 2ZTBA 3QCTL 2CRIA 1JWUB 4LLWA 2VO8A 1PLBA 4NPYB 1RIVH 2A9BA 4CBZA 5IVNA 3N9GL 1L7TH 4I1RA 4Y5XC 3DMMC 3SYPA 3BSZL 4E41E 5DK2A 5HGDB 1A3LH 4LPWA 1BF8A 4J39A 3DLQR 3UMTA 3CIQA 4Y5VC 2A77L 1TFPA 5F3BB 5E99H 1PZSA 3NSCA 4UI2A 2PKDA 5SV4A 5F9AC 3RLSA 4Y7OC 5D5MF 5LXVA 3BIKA 5SX4I 4ODHH 3O9WC 2Q8BL 2IBGA 5L6YL 3V8OA 1FNAA 1KENL 3ZPDA 2YMXH 3LKOA 2UWEB 4NN7C 3VXPA 4XZUA 1Y6MR 4U1IA 1EFXA 3NGBB 5EOQL 3EADA 1CK0L 3L9EA 1WAEA 2A4EA 1F41A 4PJ8A 4UOW1 4BH8A 1NSNL 4UANA 1WHOA 5HPMB 2R39A 4PTTB 1GYVA 1LMKA 4WUUD 4DO5A 4HWUA 2EXTA 4ACPA 1RZKH 4PV9A 2NSQA 2DLEA 1KXTA 1R3IH 1JNNL 4FJZA 4YR6A 4NFCA 1J0JA 2VDOL 4PHZA 1A6TB 2UX7A 3CC5A 3PG2A 4HEMA 3TCTA 1NMBL 9CGTA 5T1LD 3RWEA 1E9OA 4KJQD 3ZDYE 1E4KC 3O6KL 3MNZB 4J1UB 3BZFB 2VLKD 3MRJB 4HHAA 4LCUA 2R4SH 4ZSOA 1DSYA 5JW3L 3NFPA 4KTEH 5F9JA 4HK0A 4FQQB 5J4MA 2AGJH 3QPQD 4XVUD 4RMBA 3OXRA 3P9WB 1AGBB 2ESVA 4AIZA 3ES6B 1RCYA 4GSXA 4P4KB 5DUPL 4X0KA 4JK0D 4LRIC 2BVQB 4RAVA 2GYSA 4O4YH 4HKZB 1VACA 4YWGH 1OW0A 4ZMXA 1WK0A 1HILA 4PN6A 2G5BB 3S36X 1WAAA 5DQJA 5EBMA 5BZZA 3HNTH 1S3RA 3LH8A 1NIEA 4KQ3H 4XXWC 1S3KH 4Z7OF 2YRPA 5E8NB 2DMBA 5IQ7L 2FAUA 3BWZA 3D30A 1SY6L 3VJ6A 1AZBA 4A6YA 5J6GB 1K3IA 4QHMA 3IGLA 4G59C 2IOOA 3O2WH 4IQHA 5BUAA 4EMZA 4BQCA 2BWQA 1EVUA 2XQYA 4X9FA 5CSZB 2EVHA 3UCQA 3WNLA 3NCJH 3VFMA 5BZDB 5HYFA 2IH3B 1EX0A 1KTLB 4Q6IC 4NQDD 5KS9E 1ZLUK 4B9YA 2BMKA 2IV8A 3ULUF 3ZXAC 5JIMA 1IT9L 1OSZB 4AUUA 4HH9B 1CFTB 1P4IL 1RJLB 3SQOH 4YO0A 1T4KA 5FYLL 3QZMA 3C9NA 4AT6A 4GP8B 3GIZH 4JZNA 5DRXB 2VXVH 1X5KA 3LZFH 1CXLA 4LVHB 4NFBA 1ZTXH 4XBGB 3TBWB 5EIQA 2HLFD 3HC3L 5CINH 2WHVA 3RFZC 4Y1SA 1L3NA 5E70A 1MUJB 1YMMB 3UO1L 3CJJA 1R4XA 4EI6B 4AENA 3KYMA 1KIQB 1SXCA 3NH7L 1VPOH 1MFAH 3VRIA 1EEZA 4CADA 3ISWA 4YFEA 1Z9NA 2HJFA 3GJFK 1CVSC 1JFQH 5DLLA 2VERA 3H54A 3X1FA 5D8JH 5LUMA 3ISYA 4ZTPL 1TR7A 1A7QH 1BEYL 1I8IA 3OLIA 4Q14A 2B8OT 1L6PA 4HF5L 4PREA 5IHBA 1QLFA 3FTXA 1TTBA 5F6HI 1QTSA 4YBLC 4EE2A 3PL6B 5EORL 2CH8A 4DGYH 5E7BA 2Q8AL 5IBLC 3OWEA 4E2OA 2XFXA 1KJMA 4IJTA 1EAQA 1E7UA 1DQQB 3EGXB 4NBYB 3RFRA 1QR1B 2X1PA 1R1CA 1S5HA 1FIGH 3RNKB 3TYFA 3PWJB 4RQQA 5TGBA 2WQXA 2GJZB 4DPRA 2Y0SA 3V9CA 2BNQA 3BDBA 3E38A 2H2PC 3TNMA 2JQMA 5TE6L 1AMYA 2AXFA 3QXWA 1UZ8A 3CX2A 3FFCE 4QRRA 4KO5A 1QMUA 2R4RL 4Y2DB 2I60H 3C5XA 4M1GL 1KN4H 1C5BL 2IAMD 2AMGA 4GH7B 3MRRA 3VXTA 3FQNB 5BQ7A 1DBBL 3H42L 4QOKE 3JWOC 1P2CA 3F5WB 4E5XA 4YSTA 3BUIA 1AAJA 4FEIA 3DVGA 1F11B 2JLLA 5ITFA 3AXLA 1CLVA 3VFVB 3Q3GB 4K3EH 3RVVD 4GP5B 2WLNA 3HZMB 4UBDC 5FUZH 3WJJC 4DCQB 2DTMH 3QORB 4QRTA 1U8LB 4ZQKB 3UP1A 1JTOA 1KJVA 1L9OA 4P23B 2WY3B 4IDJL 4Z7NE 5C0BE 1XR9A 1U8KB 4U6VL 4PHXA 3WN6A 3L4YA 1F3JA 2MPAH 1MWAA 3KBHE 3S4SB 2DLIA 1IKFH 1AGDA 3CHQA 3POHA 4XP9L 4XT1C 4PI0A 1ZS2A 4KGLA 3UZVA 4PJGE 1IBZA 1KFGA 3HG1B 1JGDB 1JV2B 3US1A 4NQXB 1D3CA 3JTSB 3CXHJ 3QAZB 3D51A 4I0PB 4ISVA 3H9HA 3FFDB 2X10A 5F7DA 4TPRL 4CVZB 4QTIH 1FH5L 1U91A 3BT2H 2B77A 3MRPB 4A39A 3QUZD 3LXAA 1F1AA 2Z8VC 5EO9A 5D1XB 3TF4A 3T0EA 5CMAB 4ZW8A 5AZ2L 1IM3A 1CLYH 1Q94A 2B4CH 2HRLA 2CJTA 3EH4B 4JM2C 4H44C 1PLGL 4XAKD 1XCTA 4PJDA 3RUGE 1IARB 1XSJA 3OKDA 1Z1WA 2X7LA 2F53B 4JDEA 2KI6A 5I9QB 2F0CA 3D39E 4MDIA 3AG3B 5D7IE 4U4BA 3F7VA 3WDIA 5J06A 2L8AA 4ELDA 1A7RH 4ODXB 1A21A 3TIDA 3LPGA 3W82A 4MDRA 2HT2D 5DO2C 3IYLW 1QFUL 2GTWB 3HB3C 3UTPD 1BIHA 2EH8H 1KBWA 3LRLA 4ERSL 4CNIA 1YPZB 3I02A 2CKBA 1PU0A 3FUHA 4YSSA 2XQ0A 3JV6B 5CLZA 4P9ML 1FAIH 4HWBH 4IGBC 2O1AA 3VD0A 4AW4A 4H25B 2GCYA 1HU8A 4XNXL 3QHZH 3DXAE 3CDGA 5TDOB 2VQTA 3L5XH 1M53A 1PKOA 5B21A 2ZJSL 3WNJA 4N26A 1PX4A 1FN4A 2OW7A 5E0FA 1IE5A 2W9EL 4OZHA 4QXUH 2TSAA 5BS0E 3LNIA 1U8CB 1O6SB 4FI7A 4J3OC 5L2JA 3UBXA 2XTJC 3NJJA 3ZTCC 1KPRB 4AIXA 3KLDA 4R83A 5DJDB 4JQIH 2AQ2A 4N2LA 2NY1C 1SYVA 3ABLB 1KUMA 4M8VA 1X5IA 3A67L 4JHAH 3UYRL 5JNYA 2A6JA 3PRZA 5GS2D 4WTZG 3SBWA 4WW2F 4GIPD 5K9OB 5AYUL 5GRUL 4NCC1 1QSFA 3KYKL 5DD6B 2EYRA 4Z78B 4XI5D 5B39G 4P3DA 5DO8A 2DEYX 4OZFB 3W2DH 2FBOJ 1YVLA 1JGEB 4MMZC 5PAZA 2IADA 3RZCA 5CNHA 3U4BL 2OZ4L 5IFAH 1HKLL 4P4KD 4A04A 1AO7E 2J6EL 1JXKA 1QSVA 3JWOL 4FTVD 1QO3B 4B9PA 5BMFL 1LO5A 4Z95H 3ZTNL 1LEGA 1X5LA 2VN5A 5D1ZA 4LLYB 3QHFH 1HESA 5CCJA 1GSMA 3T3PB 4PR5A 2EDLA 2NLJB 4HPOH 4CVXB 1GYUA 1HINL 2DIBA 5EPMA 4AV5A 1GGBL 2E74C 2YAQA 3RKDD 3RX8A 4DVBB 1MFMA 3QH3B 2O6FA 2DIAA 1B6UA 1F58H 5F7BA 4OZIE 3V4PB 1CD0A 2V3FA 3D2UB 2XUWA 1CQYA 3GSOB 1CFBA 1XWVA 2CDGB 4C4UA 2J4WH 1I8AA 3DURA 2PWGA 2CDEB 4V1DB 1TSRA 2OTWA 3EYVA 2OXHA 1GCFA 4F3FA 2ZCLH 4NP4H 4KJWD 2JK5A 4W9JC 1EXHA 4B50A 3TBYB 1S7SA 3GSXB 4QKXB 2ATKA 5E1AA 1INQB 5CN2A 4OZGE 1YEIH 4DQOH 3R0NA 4LRNL 1I1CA 4JJ5B 5DWPA 4MKTA 1AACA 1JFHA 3GM0A 4LOEA 2JJSA 5I5JA 1TPXC 4KXAA 3GUFA 2R69L 2BVTA 4XWGL 5AG8A 3L4WA 1MW0A 5KSAD 3MRCB 4QEGA 5AZUA 5FECA 4ILDA 5J11B 4OFKA 3ULSB 2JB6B 1UKQA 1BMWA 4LO9A 3CLEL 5I18H 2WMPA 5J6HA 4IGBD 1R3KB 2EYSA 2OX5B 2CIKB 3FTVA 4MMYA 1O7SA 3K72A 2FWOA 1SXNA 4KAQL 2ADYA 2NY5C 2YBRA 1UGNA 2Z92B 3NACL 2OR9H 1CDHA 2H5UA 1KT2A 1D5BB 5A2FA 3BVDB 2DQGH 2VXQL 2F54D 3KPMB 1OTUC 3TURA 5IG7B 5DJ0B 1NOAA 1E8YA 1EWHA 1EXUB 2FBJH 4Z9KB 1AYOA 1HNGA 3U1QA 4F9PA 2E9IA 4POYA 3NTCL 3SKNA 3HVNA 3UC0H 1PZ3A 2ZAHA 2YR3A 4OF0A 1A14H 3GLAA 4JGNA 1MFUA 4G1EA 2OI9C 2NY1D 4GO6B 5T3XH 1UWXK 2CLRB 2DQEL 3VGGA 5ELIA 5F3HB 3V5KA 3VW3H 2OTPA 1I75A 5E1IA 3FTZA 4K5LA 3SJVA 1OWRM 4WU7B 1IQWL 5B38A 4AL8H 2C9AA 1BPLB 4OQ1A 4PWFA 4ALAH 1TIUA 1G1CA 2X9XA 2K0RA 4XPHH 3HAEH 1KNOA 3MU3A 5FM8A 4R7VA 3O0LA 3ALPA 3W57A 3BEVA 2FEDD 3V0WL 2F1AA 1J9TA 3R8BB 4PGCA 3VI3E 7TAAA 2C9XA 1QPPA 4GS7B 1BVNT 1WV7T 1T2QH 2F15A 4NZRH 4X80H 4JE0A 1GW6A 1DJSA 3RU8L 4HYTB 3FSZA 1AR2A 5EU7E 3WFEH 4AV4A 3AWEA 1N7MH 2LGNA 3ZDZE 3QJRB 1MPAH 1SF5A 3MUY1 2R0WH 5ESVB 2E75C 4OCWL 4NM4H 1SHSA 2AERT 1GHFH 1BREA 4KO9A 4OIAA 2Z4TA 4WI5A 3WUWG 4BQ9A 1BBDL 1MJUL 3BQUD 3HJ0A 3L48A 5FYJD 4C58B 1X7SA 1ODAA 4F7CA 4PJ6A 3DSNB 1E9QB 4IIQA 4C57C 3FMGH 4QCIA 2VSDA 3HG1D 2LE9A 1ASPA 1JMXA 4I1PA 3AGWA 3NJNA 1AI1H 4F8LA 3E0GA 4ANXA 2Y3NA 3TESA 2DW5A 3GBEA 4X8GA 3IKCA 4GQ9L 2P8PB 5FX3A 3BOVA 2YC1B 4LVNC 1MFBL 4A2HA 5DGRA 4RWYH 5ENWB 4C56B 3IS0X 1QOKA 3KNBA 4NJ9L 1QEWA 2AK4B 3CSPA 3UTTA 1RIUL 5HHPB 5DT1H 1WCQA 5DYFA 4WWKA 3WTYA 3VXME 4XRCB 4KKNA 4ZFGL 1GJIA 4A2DA 1XX9C 1FHGA 2C4XA 3GZOA 4GKNA 5KVMC 6CGTA 1PZAA 3WIFB 3D85B 1HAWA 1D5MA 3ZHKA 4LNVA 3HS0B 4D9LL 3MRLA 2GY7B 4F2ME 3ZT5A 5HD8D 3QULB 5I6KA 5JLZA 4PGDB 1OHZA 1LK2A 5H37H 4LPXA 3ZDXB 1PIGA 1W0VA 3GGWB 3R4RA 4J8RA 4MNQD 3HIZA 4A6YL 4N2EA 5D7EA 5ESQA 1HYSC 4IU3B 3BP7A 4KC3B 4BKSC 3T0EC 4Z0XA 4B97A 4NZ8A 5DMGD 4PJEA 3ZRFC 4JZJA 3WNIA 3QYNA 2CUMA 5I1CL 2ZAGA 4ZS7H 3IJEB 3PNWB 5FF6A 1FG2A 2YSSA 5KANI 2NY3B 2FSEA 1WZKA 1NCHA 1GVIA 2NY5L 3U36B 4HXAL 1QPXA 3IGUA 1JDDA 1OGAB 4G11A 1V7NL 5ALBL 4JN1L 4NERA 5D55A 3ZHNA 5JOPD 1YEKL 1B0RB 3ILEA 2VL5A 1H0DA 4HOMA 4MXVF 4FFYA 4UUJA 5DMIL 1EJ8A 3VFPA 5I6NA 3FONA 2XWBA 3OAWA 2A1WL 2W0FA 5DJYA 1MVUB 4FDWA 3SO5A 2OMWA 4F93B 5BO0D 1D7BA 3QJFA 2BSEA 1NGWA 3AREB 1QBBA 1MFDH 2ENJA 4L8SB 4L9LA 1BIIA 1IV8A 1PFCA 1S8DA 2PPDA 1FORH 1IGTB 1NQBA 1V27A 3BH9B 4PJ5D 2YA0A 1TNNA 2J8UA 2AAVA 5CAYB 3FUFA 2YA2A 3MCLL 4IKJA 1IC5H 1BXXA 1P9MA 1YEDB 1NAMB 3MNWB 2WXNA 4PJ7E 3DX4A 2VTFA 4Z7UF 5A2KH 2XZCL 3UJJL 2AP2A 4WHTA 4KITB 1FAKT 2ZOTA 1JHLH 1GZQB 2DWDB 5I16A 1ZV5A 1WZ1L 1H5BA 2C9QA 4FGMA 1UWEH 4TQHA 43C9B 5I6OA 3C6SA 1ND0A 4M4RB 3OKEB 5DQDL 4H26A 1BJ1J 3QUMH 4LCIL 4PJIB 1MG3C 5A2BA 2CHZA 3EJPA 3OXSA 3MLTA 4HZ1A 5KVEL 4M02A 4W9LC 3MBEA 4G6JL 4JRYD 4AGOA 3PAYA 1DQVA 4UDTB 5HDLA 4LL1A 4MNHA 5FW8A 2MOGA 1A5FL 1I1RA 2DMGA 3TA4D 1F4WL 3L3GB 3FT4A 5JO5B 4GRWE 2O6CA 5DF0A 1AQ8A 2DDQL 3I50H 3JVGC 2WIIA 2WQ8A 3MV9B 3QDGE 4FFZH 2QHRL 3DBXA 4GMTL 4OBRA 2ZF9A 5IVXF 5KOVC 3C09C 5JQ6L 4E68A 3ZLQC 2KLSA 3OJMB 1R0AH 3EZ8A 4NDMA 3L3KA 5DYOA 1TQCC 2F8VA 2J8OA 3CVHA 4FZ8H 3G04A 1MQKL 3LPOA 4LHJB 5J57B 5DJXB 4I9WD 3Q7JA 4LESA 3S36L 4ZD3L 3KL0A 4PJCA 4BYHA 3ENEA 4W68A 4N8UA 2K45A 4UT9A 3UYPB 4G8FB 1E8WA 1PS3A 4MXWL 5E08L 3VACA 3QDME 4P9HC 5E6RB 2V2XA 3MLWH 4IBSA 1A4JB 1MWAL 2JF1A 4DGIH 1B90A 4ZFFA 4I85A 2XTLA 2FQGA 4ZG1A 4XB3A 3VGDA 3T8XA 1AZVA 1M2OA 1Y0LA 3GM8A 4HCFA 3U2IA 5ILTH 3AU0A 3HI5L 3UERA 4MAYC 4FYTA 4MJ5A 4GI6A 1RJZA 3UGXA 2YIHA 3OKLA 2Y5TB 4YK4B 2X89A 4MASA 1BQRA 4JANA 5D5ME 4XHJD 2WVVA 4MNGE 4UZSA 3VH8A 1KLFB 1TZGH 1C16B 3BPNB 1A9BB 1KB9J 5E6IC 3FOMB 3U1PA 1G7IA 3SDCB 1N67A 1QRKA 3SOBL 4H7VA 1FDLL 5JYMA 2XV3A 1FFQA 1E9PA 3CDFA 1KB5B 3ZKQD 1TZIB 3DTUB 4NOBA 1WICA 1RMFL 3F65A 4FQJL 4XVTH 4Z3TA 2QV2A 5CEZE 3T4YA 4L3CA 4AVHA 3H0TB 3MI6A 4L18A 3MTXA 4WSJA 2LAAA 1I9RH 2RB8A 2YPVH 2HFFB 5C08B 2VZVA 3MXWL 4KKAC 5ABAA 4HULB 1A7NH 2CKBL 4JG5A 4ZTEA 5JPNA 4UOJA 1UC6A 2CO4A 3K0YA 3REWA 1QLRB 5DU7A 2DJMA 3C6EA 4KK9D 3WD5L 1YEFL 2DN7A 5EFIA 4NWTH 5DEGA 4EVNB 1JYXA 1N8ZA 3GO1H 5JOFB 1U95A 4IHOA 3TWCL 2E27H 4NO0D 5HYSA 2X4OA 2V2TA 3T3MF 5DJ6A 1NMAH 3ZBMA 4D3CL 4F7MA 1A6WL 4PWGA 2RQEA 4ADJA 4MCYB 3JWNC 3P2TA 1NKRA 2G9HA 5IHLB 5F7EH 3HAEG 5KSUB 1XGUB 1R24A 3G6AB 4Z7OE 5J3HD 5FKPB 2XXFA 5L88L 4H2CA 3QSKB 3I75B 4JVUA 3S35H 3FO9B 1X5JA 1DL7L 4TNFA 1XBDA 5F1KC 1KBKA 1BD2A 2C1PB 2LVEA 4QYOA 3CFUA 1DQJB 4C56D 3QO1B 2H3NB 3SKJL 2NNXA 5AW1B 3CFBA 1C8PA 2AK4D 4EIBA 4MLIA 3SPCA 3MZTA 2C3XA 3ECVA 4D8OA 3L3JA 1IGFH 2GK2A 3GJFA 3ULUE 1FL6B 2ZWSA 4BFJA 1ZGLA 1AXSB 1QYGL 4HWEH 3GKWL 1QRNB 3B7YA 3NEOA 4N0RA 1CC3A 1IE4A 1TVBA 1YC7A 1QG3A 3GEFA 4I87A 4IIQC 4J23A 3DRQB 4JDTL 2YPLD 4FXGA 2LLNA 1TETL 3Q2NA 5BO1L 4JFHE 3FO2B 3HPLA 3VFUA 2LQRA 1U2CA 2FATH 1HHJB 1ET8A 1JS4A 3P02A 3FU5A 1FVCA 2D9CA 4UQ2B 1PG7W 4P9HL 3WTXA 3PNRB 5E94B 2BY1A 3K8MA 4OCSH 3DROA 4GW1B 4PRIA 1PF3A 2ARWA 1CFQA 1N64L 1DJWA 3GRGA 3ME0B 2NY3D 1C12B 1NMCC 3HNVL 5JQIB 1CTOA 2EIJB 1WCBB 2EE2A 5E6ID 1LHZA 1LEIA 3B2PA 2LT9A 1AYRA 1JD9A 3KJ6H 5AAMC 2HVJA 2FWLB 3QXDB 3CUPB 5GZNC 2EC9U 1AD0A 4XXCA 2GABA 1G7LB 2J57A 1I9JH 1CYWA 4I0CC 4XH2A 4Y4FD 5H37G 3BJLA 4YDKL 1S7VA 3MKKA 1FLTX 4ESKA 3VMPA 3T5WA 1RK7A 4BDVB 5L4FA 3GXNA 5MEPB 3D3VA 3SDAD 4JQVA 4K7PY 4XMLL 4OD3L 4L8CA 5DJAA 1JZ3A 4KKAD 3OKNB 4H5SB 4NQSB 5JIIA 2UXFA 1MCJA 1FYTD 5JDSA 5C1MB 4Q0XL 1ESOA 2OJZH 2JVUA 3CMOL 1MJ8H 4F9LA 4FQHB 3QNXA 4PBDA 2BWIA 1ZD6A 3NT0A 2GQHA 3KBPA 3RDTB 3KPRE 3KYOB 4ZFQA 4NNPH 3UIZA 4FQLH 4LSPL 3A4EA 3T6VA 5IWLC 2EACA 4GUQA 4NUJA 4DEUA 1UXWA 5K93A 3V5DA 3ZL1A 5L4MA 2VLRD 4D0BB 3M1CA 3EF4A 3AACA 3ML9A 3KL5A 3QXAA 4PRBA 5CLWA 2HUHA 4JRXE 1WD8A 3B56A 1GMEA 1K5NB 1OAXH 3Q9PA 4K5MA 1MIEL 3NQIA 4MMXA 5AVRB 2AJVL 3WE6B 2R0KH 1XB3A 2OLDA 3ARGB 4GG6F 4NYLB 5C0CD 1KCUH 3X11B 2XU9A 1BXAA 1JZGA 3B2XA 2EDEA 4RBPH 2ED8A 3ZTJH 1BLNA 1HL9A 2F8IA 3EXJA 3UZEC 4AK1A 2EABA 2JXMA 3DYPA 2CK0H 3BZEB 5DD1H 1MCPH 3UOAB 2H3KA 2JKRM 2BS8A 5KVFH 1QD0A 3V4VB 1H5BC 3HLKA 2AC0A 5I1LB 4GKZB 4PY7B 3I84A 5F9DC 2QQQA 1VGEL 2LW3A 2V17L 4E9YA 1YNTA 1U36A 5M94B 4JHWL 3SY0B 3S6CA 4FQXB 4XP6L 3LVEA 4JFEA 5LJYH 1VEMA 3MBEC 2Y7LA 2XLLA 4N68A 4PBVC 4OM0L 3LPWA 4X6EB 3WFZA 4BEIA 2ADFH 5LGHH 2Z3FA 1H3PL 4LOUC 4GAYA 4ACTA 2DYSB 4A7QA 4K73A 2ZUQC 2XWTA 2ICEA 3L3OB 1G1YA 3RWHB 2J43A 5JHMA 4HBQA 5L4JA 4NZTL 3APMA 5DFWH 5E51A 4OFVA 1DQDH 3CH1B 5IEHB 3DO7A 4P2YA 5F1IA 1UACH 5E5LA 3ZK0A 2CPCA 1ZSDB 5JHAA 3K91A 5I6XB 1JHTB 3CMGA 3N04A 4NUGL 2GK0B 2WO4A 4JKNA 4LGRB 4QMEA 5T1DH 3QRGH 4MD0A 4UU9B 1O7VA 2P9RA 3HE6A 4HUVA 2MRYA 1YJDH 3GYRA 1T20A 5IBUG 4HOXA 1T3FB 3IDYB 4WWOA 2HRGA 3B83A 5EWIL 1YEJL 2VDKL 3IDJB 3QFJE 3ARBC 4HUNB 4JFDD 1ANUA 4LSVL 4O51B 3MAWA 4Y4HC 1BBJA 1SDAB 4HS6A 5JHDA 1DEEB 1TITA 1TZ8A 3SCMB 2IANE 5E9DB 2AAAA 1EEYB 2BOBA 3FUIA 5BZXA 3ZW3A 5L2KA 3RA7H 1HWWA 2KPNA 2N7AA 2WYIA 4GBXD 4CU8A 3TA3A 5ABDE 5E24E 1X5XA 3EJYC 4WW2A 3P4OA 2AF2A 5C08D 4NSKB 3SN6N 4AYID 3QAQA 1AHWC 3BZ5A 3OAZH 1BSIA 5I73B 4XBPA 2PYFA 2E6QA 4MX7A 5C0AE 4JFFA 3KXFB 1VAHA 5INDB 3H7BB 3MLRH 4UNVA 4LNRB 4LSDA 2ENYA 2XN1A 1UD6A 1JPSL 2HT3D 4TUJB 2X41A 1T04B 2P8LA 3SQBA 4Q2ZA 1AGFB 1WF5A 4DZBB 3ETSA 2BX5A 3QJQB 1FJ1B 4WUKH 2QVTA 3VXOA 3NA4A 4Z7WF 4N0YL 1TSHA 3WEOA 2X0UA 4FFYL 5DZVA 3EYQC 4YC2B 5C6TL 2V7NA 2WLYA 3PGDA 1P7HL 4I18C 5IK3A 5HGHB 1M1XB 3ZTDC 3EGDA 4R6UA 4CC4A 3FYIB 4DAGL 2BSBA 4HIEA 3DVNA 2P48B 2P43B 3RB5A 2X6MA 1DVSA 3FB6B 4P48A 5JA9A 1PKQB 2YEVB 2DV6A 3I6LD 5FYKL 5HTSA 1SHWA 4DESA 5KJRH 1XCXA 1MLCB 3ZZ1A 4TVPD 3TONA 3DGGB 5GGQL 1E3XA 4N24A 1ZJBA 1CR9H 1Y6NR 3TBTB 4PLOB 3O2DA 4F80A 2XN9A 3BGMB 3EBGA 3WNKA 3OGOE 3JYCA 4U6HA 1D7FA 3OWRA 2BSDA 3ASOB 5CZXD 1BM7A 3BZDA 5F8QC 1IAKA 1OPGL 1UADC 4YHPB 2QFPA 5GGUA 4IOIA 1SXSA 3WHE0 3F7QA 5L4IA 2DLGA 1I8UA 1QRND 3GHBH 4H8WH 1LK3L 4KXBA 4ZQTA 5IHUL 2DQIL 1MLBB 4HD9A 4LHUB 4NOFA 5D2NB 2Y72A 3EFFA 4HS8H 3S8GB 4X6DB 2MKLC 1W72A 1WISA 3AB0C 5KTEL 4CKQA 4FNLH 2WGXA 4LPCA 1UVQB 3T04D 4LEEA 3ZE1F 3MZGB 4KKZA 1FYHB 3VI4A 5BV7C 4QRPB 5I1AB 4MLSA 1KTBA 2XZAL 1YN6A 5CZVH 1DBJL 3MODL 5AD0A 3CVIL 2EDKA 2P5EE 5BQDA 4WFGD 1EO8L 3AM8C 3IDNB 1NCDH 1UM4L 4TTDD 5AOZA 2F5BH 3RHWF 1MW3A 2O30A 3PS6A 1BQLL 3H2WA 5L7XH 3IJ9A 3CVHL 2CGRL 3MOAH 2NNAB 4JHVA 4M5YL 3UC2A 4U0RB 2I9LA 3MROA 3P0YH 3N0PB 4FQCH 4FXGC 4JFSA 5MEQA 4ABQA 2EINB 1VEOA 3HI1A 2X2YA 1USQA 5AUMB 3C5ZB 4UT9L 1WC7B 5HI4D 3WSQH 4ZAKC 4L9DA 3RIAK 5JIKA 1R17A 2PPAA 2V9UA 4Q9QH 2YKKA 3OC5A 1NGQH 4TLKA 1PW3A 4OLEA 4A2MA 5HYIA 4XN5A 4NP9A 2BM3A 1IC0A 3TBSB 5C2BH 2IPTL 4Y4KC 3AC0A 4G8EA 4OFDA 4XE5B 1JGUH 3PP3H 5HPOA 4XNUH 2VSCA 2O93L 2AVGA 1E4WL 2WXQA 4DQAA 1A6ZB 4NZUL 2UWEF 1ORSB 1NJ9A 1AANA 2JIXA 5HYQB 3I3EA 3ZIYA 2QEJA 2NXZB 1JPGB 4M9PA 3RDTD 1YMHA 1GS6X 2DJUA 5C3LD 5EEWA 1I8MB 4ODSL 4ZUVB 1LWHA 4LLQB 1FE8H 2HJKA 1S5IL 3QVAA 1RU9L 4M3JA 4AWJC 4N9GB 3L7EA 3EFDL 2EIEA 2VMEA 3WEMA 3G6DL 2DMCA 1CU4L 1U8OA 2P5WB 4JQVC 5IVZB 3L95B 2C3VA 4QRFA 3U4EA 1QSEE 5CJ8A 4BK4A 4KTDH 5E2UH 1WE5A 2OSXA 3ARGD 5IB5A 3QYMA 2ITCA 2WZPA 5ID0A 2CK2A 1DLHA 2R2CA 4P3CL 4RNRB 4F24A 4DFIA 2MCAA 4X5XB 3K2KA 2IWKA 2Y2TA 2PO6A 2W88A 2R29A 3CSYA 4YHOH 3RTQB 3RWFA 4ETYA 4P57B 3M8OH 4BINA 3K7UA 4W9FC 4OIIL 2ZG1A 5E8PA 1F6FB 3MRNA 5E8DL 3GXUB 1G9MC 3ARDB 4K5NA 1D5ZA 4Z7QB 1HT6A 3EYOB 1BGXL 3MGOB 2DYPD 2BK8A 1J8HA 4N3TA 5T1KB 1CGVA 5HGBB 3U6RB 2VW6A 1GGCL 4MMXC 4QRBA 5F96H 1Y1UA 2LABA 4L3FA 1M4KA 3CV5A 5TFSL 1DQTA 1KV3A 4QO1B 1KIRA 3CLFL 5K39B 2VLJA 4AJYV 3PABA 3P3YA 2AQNA 4QXTA 1KGYE 4DVRL 2EDNA 4L4TE 3QUXD 4QLWA 1OAZH 5KSVA 1JZ5A 2FQFA 4A7GF 2GB2A 3WS3A 1P6AB 2QBWA 2FUTA 4JPWH 4R7NA 4RFOL 2N4IA 5MHSE 3B9KB 1MOEA 5CEXB 2Y1ZA 3NG5A 4LGPB 2VXUL 3ESOA 4L23A 3RIFF 5E9AA 1CFSA 4P2QD 1WDAA 1CF8L 2DICA 2V5MA 3ARYA 4B53A 4JKKA 5DS8A 3S48A 3D87B 5T5NG 5CJXA 1A9EA 5FGBA 3AXHA 5EF3A 3CZNA 5BV7L 3MBXL 4X7FC 3DJZA 3RL2B 3BKCL 2W8CA 5TE7H 2NW3B 4Q6IB 4Y9GA 5EZLB 3KW8A 4BZYA 2NMSA 3K5RA 3C2SA 1QHQA 4OCXL 3ZKMC 3OD3A 4HUXA 3U7YL 4AYFB 4WTZA 5FGCB 5SWZE 4MXVE 3WFBL 3V6ZA 1ACYL 5KYUA 2F7PA 1HFUA 3REVB 2QVMA 4EDXB 4H1LB 3DOHA 3IBEA 4NPKA 3VSTA 1WBZA 5B39A 3UPRA 1IBHA 1UA7A 5DK3A 3IDGA 3U0TA 2X4RA 1UEMA 3G9VA 2AQPA 2J1XA 4WY7L 2VLLB 3VCLB 3H9SA 3F01A 5MEND 1CL7I 1P1ZA 1ACCA 2VCOA 2X42A 3W9EA 1HL4A 5C0GA 4HIJA 5DZAA 3HE6C 3CN3A 4G6FD 3KPTA 1G7HA 2EJ1A 1K8DB 3NZ8B 3S37H 3HMXH 4EQ2A 5HYJA 5CEYB 3LEXA 4Z7UE 2APXA 5TDPA 3D50A 4YBLB 3OHMB 4L5FH 2NY4C 1BF2A 2XYCA 2QR0B 1O0VA 4LBAA 1FZOB 4IW4C 4OV5A 3I2CH 1KY7A 3TA3C 4RGND 4P59H 3LXBA 1GPOH 1U8MB 1U8QA 2YA1A 1KG0B 2PXYB 3RNQB 1FF5A 2EYTA 4GPVA 5IM7B 3T65A 4DPAX 1E4XH 2JELL 1BOGA 3LX9A 4G6KH 1QBLH 3FT3B 1U6AL 2P80A 2RBLA 4QT5A 5E03A 2VITA 1VB9A 4P4RB 1CLOL 4UV4L 5IVXE 4FQPA 3O3BA 3BIAX 4G8IA 3TV3H 5HXMA 1A7PL 1WIOA 3PWPA 3IDMB 3QIUA 3FH5A 5D9SB 4JY5L 1BX2A 2R2EB 2ADJA 1G9ML 4HJTA 3SPGA 3TVMD 5CD5D 4YHLL 3VXSD 2V2TB 1HNFA 3PWPE 3TNNA 4CC4C 1AP2B 3CSGA 5AYTA 3WAJA 1T0MB 5EB9A 2JKWA 3EBHA 5F9WC 3BKYH 3Q8BA 4UQDA 3D4YA 1TEGA 1EDHA 1Y07A 5JW4N 4AKOA 1TQVA 2BW4A 4IRZL 2H6PB 3QQ9C 4Y16A 1UXLA 1HEZA 2OMTB 3LVTA 4UOZA 4JFZL 1S9YB 3MRKA 3RDJA 2ERJC 4NC1C 4OFYD 3BEWA 2ZOKB 4RDQG 4OJEH 3KYNB 4BFKA 5EO0A 3SE8H 5KYYA 3HUJF 3WNOA 1KELH 43CAB 4PG2A 5I1DB 1EH9A 2W07A 1XGQA 3IAQA 3B7SA 4OGAD 2V5YA 2LAGB 5F7AA 2ZX6A 1FGVH 4K94C 2MCPL 4PP2B 5LG6A 1JPEA 1KCWA 2VRQA 1DFBH 1XGYH 4P2RD 4WI4A 5EN2B 5C8JB 4J3WA 3MUJA 1K6QH 3H8NA 4KDVA 1OP3H 5DC0A 1FZKA 4N8CH 3MGTA 4LCWB 4HCGA 4DKFL 3A3YB 2OMVA 1OB1A 3N41B 3TASA 3VRJB 3CK0H 2DQFA 1UM6L 2BNRB 1K4CB 1JK8B 2QHLA 3N5AA 1F02I 5EOTA 2OMXB 3VFRA 3HB3B 1W8EA 1E8XA 2BOCB 1DQLH 3Q6FA 5HHME 2HJLA 1DE4A 4J4PA 3QR1A 4X6FA 4DP9X 4JO1L 1JNLL 4KO6A 3VXRD 4Z77A 4APQA 4EOWH 4APXB 1ACZA 1AE6L 2YHGA 1UB6B 4FC3E 1VF5C 4NIKB 3QIBA 2R0ZL 3KR3H 5EOCL 1NKOA 3W37A 4KX7A 4W9ZA 1RHHA 4XCFL 5GGVL 3IJ7A 4BFIA 5SV3A 3KGRA 2YXFA 5I82A 1ORQA 2XICA 3OLEA 1NCGA 2PR4H 1NEZA 1Y18B 4LQFL 1XF3A 3GUTB 3WUZA 4QRSB 1HIML 2VL4A 4JFUA 1RPKA 4LLWB 4YEEA 2P5WD 1J1OH 2VDRL 5E6SB 5PCYA 5I26A 3IRZA 5I0XA 3T3ME 2HFTA 1L9MA 2QELA 4X8XA 3O2VL 3QJTB 2R2HA 3NIFF 5DK2B 1A66A 3I6SA 4BZ2H 1BV8A 4AUYA 1G6RA 3UJIH 3VFSA 5GGSA 4ZFZA 1CD8A 3NQKA 2H41A 3MLSL 2Y1AA 3U7WH 1CBJA 1JV5A 1ZGLM 1Y1DA 3BIKB 2EKJA 5I5IA 1DSFH 2IQ9L 1LO0H 3ARDD 3LKOB 5J6SA 4L1TA 1GJUA 2CSPA 1N6QL 2V2WA 3VXPB 4XZUB 1EFXB 4WO4A 3MACL 1QW9A 2UUDH 1OSEA 2NX5A 1QLEL 5GJTH 3T3PF 1J9QA 2YFNA 3W81A 4PJ8B 2VXTL 5GIRA 4BH8B 5AALA 3UAEA 2XV0A 4LBEA 5FYJU 5CIPA 5BZWA 2FO4A 4NN5B 4GLRH 3FW6A 5CJOL 4ZUUA 5E1HB 3MV7D 1LO3H 4EZMA 4PV9B 3DNKA 1I9IL 3AMLA 3ZO9A 3WDHA 2VIRA 1KXTB 5EDXA 3QQ9D 3QEGH 4AE0A 4YR6B 4G70B 1UWGL 3CC5B 4OJCA 2K1MA 4PRHE 5CUSL 4DW2H 5T3ZD 4LP8A 1JCVA 3SKMA 1CYGA 3RWEB 3HMWL 1E9OB 4I0KA 4HHAB 4RBPK 1U2YA 2D0GA 4LCUB 2DQUH 4ZSOB 3AQXA 3NFPB 5F9JB 4HK0B 4XPTH 1N0XL 2B59A 3GTNA 1BHGA 1QBML 3O2DL 3OXRB 2UXGA 3DPDA 2ESVB 4AIZB 4X0KB 2JI2A 5JQHC 4RAVB 3QDHA 4LIQH 1VACB 1HILB 2CHXA 2AHIA 3BSHA 5DQJB 5EBMB 5B4MC 4XR8C 2QZQA 3FNKA 2EDBA 3WOVA 4XNAA 4K94L 3NZHH 3GBNH 1SOQA 2GIMA 1JVLA 4JR9L 4LL4A 4RISL 1JXJA 2EZ0D 2ROYA 3VFWA 5BUGA 1W72L 3VJ6B 1WJ3A 4KVNL 2Q7AA 1U4EA 2B3RA 4RMRA 5ALCL 3UCRA 3MJGX 8CGTA 4QHMB 1RVFH 3TZVD 4AXWA 3TT3H 3T0DA 1WHPA 1RUPH 2NXYD 5CJXC 2K9UA 1YN7A 4FX5A 1EJ6A 5FGBC 1HHIA 2A9ML 1U8IA 2F19H 4KUCF 1B2WH 4G82A 3O6FD 3VFMB 3VB8A 4HPHA 2AJSH 1MCEA 4X4MA 4XPFH 1QWHA 2BMKB 2C26A 2G9KA 2DAVA 3KCPA 4JQIA 4WU5A 1HSAA 4R7XA 2Z8WC 1OGTA 2YK1L 1HXYA 1M9WA 1T4KB 2WPGA 4YO0B 3C9NB 4AT6B 4BH7A 3TF7C 2YRZA 4JZNB 5A2IH 4CL7A 4M6AA 1DJGA 4HZLA 3SYAA 4M7LL 1N5YL 5L0QC 3K6IA 1BAFL 5E95B 4DP7X 3FSWA 4LDEB 3VFOA 4HISA 2AW2A 4Y89A 5G55A 2E5EA 1G7PA 3S0PA 1BQSA 2PXYD 1G5GA 4AENB 1DQKA 1G94A 3KYMB 4D9QD 1T1XA 3TN0A 3U1SL 4GG6E 1KYAA 3GMNA 3VRIB 1EEZB 3C8HA 3V0DA 4CADB 4XP5H 1EEUA 4BQ8A 2AJUL 2HJFB 1NOLA 1PEZA 3MLYL 2VLKE 4XMKL 2X1OA 3BKJL 1I8IB 1RZKC 4UOQA 1KSRA 3ZRCC 5EMYA 4PREB 2APSA 2AK1H 3DX1A 1RK0A 4NT6B 1QLFB 3OAZK 3QE5A 4KY1H 5DEZA 1BQHG 3MJ6A 3OGCA 2HTLC 4XP4L 2G5RA 2EXWD 5LKNA 1OIOA 2XFXB 1KJMB 4KOCA 3BD3A 3CDZA 1BZOA 3IU4L 3W39A 3ZYOA 5C9KA 2RTTA 3GRWA 3TYFB 2C9VA 1ZXQA 2PYED 4RQQB 5TGBB 4NBXB 3GLEA 3FCGA 2BHFA 2QQKL 2BNQB 4J3BA 1S7RA 1WWWX 2YD6A 3TNMB 1CI3M 4GXFA 1EHKB 4FQ1L 1UZ8B 4QRRB 3V0VA 2DKSA 4R0LC 3SDYL 1CDCA 3EO0A 1P69B 4WV1C 1YNLL 2F2HA 5F21B 5DD0H 4RMUA 2R29L 3MRRB 3UPAA 4K07A 5BQ7B 1MCOL 1Z9MA 4RLDA 1P2CB 4E5XB 1JDCA 1MJ7L 1OARH 3BWUC 1QFOA 3DVGB 5HI3C 5ITFB 3AXLB 4LVNB 2HG5A 3B5GA 2F9BT 3OJ2C 5DTFA 2XWZA 2KQNA 3WIIH 2AANA 4QRTB 3LJ3A 3IPFA 1KJ3L 1KJVB 3OF6A 3NSJA 2W38A 3GPSA 2J44A 3KVPA 1XR9B 1K2DA 3A23A 1IGYA 1MIMH 1F3JB 3ZDXF 1MWAB 4BRVA 4TUUA 4LP5A 2NY0B 4H2AA 2XJLA 4LCWD 3B2MA 3M07A 1GAFH 1AGDB 3Q9QA 4JREB 4IRJD 5MERB 3S5LG 3UZVB 1XO8A 1CXHA 3P0VL 3UYOD 5DUJA 2Y6SC 4PGEA 3HE7A 5C0IA 4ISVB 4I3SH 2D8KA 3WO3B 3H9HB 4N0UE 1F1GA 4K23L 5F7DB 5AAPA 4GRLD 1U91B 3CHSA 1DJHA 4PG2C 2YD0A 4XE0A 4B41A 2JJVA 5EO9B 4BWUA 3KLKA 2O5ZL 3Q13A 1MSPA 3T0EB 1OTTD 3WKML 3GC3A 1IM3B 1Q94B 3D69A 4OT1L 3IFLH 4JDVA 4C4KO 3OJDA 5M7QA 1XCTB 1MHCA 4NQEA 4PJDB 3OKDB 4AQEA 2X7LB 4JDEB 4MDIB 5BRPA 2FYYA 3BWAA 5DEJA 1T2XA 1M3IA 4OW6A 2OMUA 1L7TL 3F7VB 1WEJH 5IQNA 3TIDB 2WP3T 1MHPH 4TN9A 2BNUA 1V3LA 1A3LL 3B9AA 5DC9B 1GY1A 3EHBC 2Z7UA 1UD4A 5E99L 3QZPA 4E41D 4CGTA 4Z7WE 4AGPA 2A99A 2VMDA 3W5MA 3O4OC 2H1XA 2DMKA 4PW9A 1TO5A 2OMYA 4CNIB 4J4PC 2H3XC 3I02B 2CKBB 4I3RL 4K3JH 4ELMF 1T1YA 2VMCA 3K1KC 2YMXL 4FLSA 1B3JA 1AQKH 3MCKA 4APQC 5CFAA 3QIBC 3VWKA 2F18A 4ORGA 2GCYB 1PAMA 3BDYL 4KHXH 5CN1A 2QTVA 3CDGB 1CF1A 4FE9A 3PXJA 1T0PB 1U93A 4XNDA 2Z9TA 1AY1H 2UXTA 1EFXD 2Y23A 1ETB1 1FN4B 4PJIF 5ITBH 3SE3C 4OZHB 1Y6KR 4ZW5A 3FJTA 4PJ8D 1R3IL 5L2JB 1OQOA 1KJ2H 3UBXB 5KW9H 1Q38A 4NQCE 2CO2A 3X3FL 1EJFA 5F89A 4LU5H 1BM3H 4OCYH 5DVPA 1SYVB 5HGAA 1TQTA 3M1BA 1QACA 4MZ3A 2R4SL 2A9AA 5JNYB 2A6JB 1RY7B 4KTEL 4KMQA 3FU7A 1QSFB 1XFPA 3DPBA 1FLRH 2EYRB 3UAJC 4ICWA 1N5AA 2YPKA 2L7QA 1J8RA 4P3DB 3FQUA 4X9GA 2XY2A 4O4YL 2XY1A 1JPTH 4PS3A 4M4PA 3ZE1E 5EEVA 3N50A 4WO4C 4PVMA 5EDSA 1KWGA 4QXWA 2IADB 2PNDA 1MEXH 2NUTA 3RZCB 3TLRA 3C09B 4PRPE 1XL6A 2FZ3A 1MFCH 4WF7A 2A9NL 3QO0A 4TSBL 5H37A 2ZWNA 3VD5A 2YFOA 3P1VA 3D25B 1G0XA 1LO5B 1CZ8H 2UX6A 1LEGB 2NY2D 2D0FA 4X4YA 5D1ZB 2C7FA 3LH2H 5JR1H 1DZBA 2XA3A 5SX4H 3TEZA 1JI1A 3O2WL 1B0GA 1HE7A 2B4CC 3EZJB 4PR5B 2IPUG 3EAKA 1M42A 3SEPA 4YHZH 2Y6SD 5EPMB 3NEXA 3BVWA 4UV7H 2RMNA 1JGVH 2ZP9A 3NCJL 2W95A 3GZPA 2E76C 3MRHA 2R8SL 2EXYC 4HJ0C 3ILPA 2X09A 5BW7A 2ZKXA 3NJIA 3QEQA 4AH2A 2CJSA 4QJ4B 4XNQA 3DURB 1L9SA 1BECA 3EF7A 4NUQA 3SQOL 5TJWK 2OTWB 3EYVB 2OXHB 4GUPA 4F3FB 3GIZL 3NCYS 1CICA 2VXVL 5IROA 2JK5B 3LZFL 1DBAL 1U8HA 1ZTXL 2I25N 1S7SB 1VRSA 2ATKB 5E1AB 3AXIA 2UWEE 1E90A 5I8EA 3D5OF 3FUDA 1ECYA 2WXJA 5LXGH 5EC1A 1W9XA 3GLZA 3VE0A 2AVFA 3O8XD 3QJZA 4MVBC 4PJ9A 1CFVL 4V11A 1MFAL 1UURA 4I2XA 3WXVH 3ESPA 2Z4QA 1TG8A 1L9QA 3IETA 4LLUA 1QTYT 1VESA 2XX1A 5FECB 1SQMA 5LBSA 1JFQL 2J56A 1GOGA 1HOEA 1A7QL 4N1HB 1FI8C 5I1EH 1MCNA 2E7BA 2JCCA 1NA8A 3ROLA 2WMPB 5J6HB 2EYSB 4N2GA 2IH9A 4MMYB 4B95C 3K72B 2FWOB 4UYQA 2YBRB 1KZYA 4DGYL 5T5FH 2Q76A 3V55A 2ZOLA 3LIZA 5AOKA 1XSOA 1WUZA 1UWFA 1KT2B 3QUMA 1ADQH 2DB8A 4FULA 2BVOA 1GS8A 3E1ZA 1GL4B 2B3IA 1FIGL 5GS2H 3ETTA 1Z5LA 3PQYA 1RUAL 4G3YH 1E5CA 3VWJA 1Y7VA 2CGYA 3SKNB 5FO8A 5ICZA 1QNZH 3L4VA 3C60C 4AJVA 1SN5A 3SD5A 4G1EB 2WANA 3QG6A 3FFCD 2I60L 1NINA 3RGVC 5FK9A 5I6MA 3V5KB 1L0QA 3SJVB 4ODBD 3S35X 3FSVA 4L0PB 5B38B 1GYAA 3ZSSA 1Q4NX 1A4BA 5BCAA 3P3SA 1MAMH 1KNOB 3C87A 4K3EL 4QOKD 4XMPH 3WS6C 1G6RL 3LS5H 1K5WA 3CQQA 5CJBA 2ENPA 2DTML 1JCKA 3BEVB 4HU8A 2BFVH 1OB0A 4PGCB 4YNYA 3S7GA 3H56A 5F9OH 4E0RA 1FNFA 3IDXH 2E86A 4WEMB 1A0QH 5C0NC 5F7LB 5C0BD 5I23A 2MPAL 4NS0A 3L5WA 3V95A 1IKFL 2TRYA 2PPFA 1HL5A 3TJHC 3Q6GH 4G42A 3B6SA 1AS8A 2X2HA 4LCCA 2EIKB 5AW0B 3LKNA 1YMME 1X9UA 3BT2L 3JV5A 4MXQD 3VO0A 4F7CB 4IIQB 4EIZC 2NSXA 4QCIB 2WWKO 4OFIA 1V10A 2DI8A 5CKGA 1ED3A 1CLYL 2B4CL 4QRAA 2Y06H 4OKDA 5SX5H 1IUZA 3MXVH 3QQXA 3IKCB 4BE5A 3KLLA 4AQ1A 1VENA 1IJNA 2VM4A 4KJPC 1A7RL 2Y36H 1PX8A 3AG1B 3OHXA 1J0YA 3L2LA 3KNBB 4NX0A 5I5MA 4IU2A 1QEWB 4OLUH 3ZVVA 4M6NH 4QR7A 3IAPA 3WO4C 4GT0A 4L0ZA 4WWKB 2WNGA 3FQRA 2EH8L 4L2LA 3MLUH 1RK1A 3OLGA 4ZTOL 1QFHA 3GF8A 4GKNB 1XIWA 3LZLA 3RZWA 3LQAL 3K4ZA 3QDJA 1FAIL 4HWBL 1D5MB 4YSRA 3RIKA 2LHAA 3VUAA 3MRLB 3VSQA 1BZ7A 5GGRY 2CRZA 2J88H 5JLZB 1J8SA 1ZPLA 2DBJA 1LK2B 1NDTA 4M03A 1OP3K 3QHZL 1IFGA 1OV8A 1W0VB 4J8RB 2KS0A 3L5XL 5ESQB 2ZX7A 1FV1A 3BP7B 5FLVA 4KMLB 3DXAD 4Z0XB 3CXDH 4OQTH 4PJEB 2TAAA 4JZJB 3KM1A 3RVWC 4QXUL 5FF6B 3A0OA 3PE9A 2LFGA 5BNXD 1FG2B 1BQ5A 2EC9T 2YSSB 4R5TA 4C4BA 1I1YA 2FSEB 4WGKA 2JFCA 3D18A 4AL8C 1JNHA 2EDQA 1OF2A 4ALAC 4QHNA 3J07A 3SDXF 4JQIL 4XOAA 2YN3A 5DD3L 5FOJA 1TZAA 3QUYA 1HI6A 4EAEA 4JHAL 4UILH 2VL5B 1H0DB 3A21A 1F42A 1VHPA 3CD4A 4KI1A 4UUJB 2OSWA 2FX7H 3VFPB 3FONB 2UZPA 2XWBB 2W0FB 5DJYB 3RGVD 3T6ZA 2OMWB 5IQ9B 4NENA 3OR6A 1S7WA 3I9GL 2QDVA 3TJEL 3QJFB 2YLKA 1NGWB 3L5HA 4TL5A 2F08A 1IL1A 1Q8MA 3KBFA 3HG1E 3W2DL 4L9LB 3RWDA 1BIIB 2EH7H 3B1TA 3VWKC 1S8DB 2W1NA 5F7NC 1QSFD 4E9RA 5IFAL 4KFMA 2J8UB 3BSGA 4HMCA 2AABH 5FYJH 3RVTC 4GSDH 5D1XE 5CBEA 2W81C 1N12A 3HUJA 4Z95L 5GJSH 1AO7D 5C0ND 1KCSL 3A47A 3RZCD 5EU7C 2F53E 4FKKA 3QT2A 4WHTB 3LZOA 3WFHA 5I16B 5E1GA 2FGZA 4HPOL 3C8DA 2NRDA 2DIJA 4GRMA 3VXQA 3GI9H 1H5BB 4AMWA 5I6PA 4PRDA 3C6SB 3CG8A 1ND0B 2PN5A 3EO1A 1IC7H 1F58L 4H26B 3NCFB 5D1ZD 1IGIH 2UUDK 3QBTB 2IQAA 4PGZA 4UQIM 3OXSB 2Y1YA 3MLTB 5I0VA 2J4WL 3MBEB 4G6MH 1Z9SA 3CZFA 4NP4L 3IMSA 4MNHB 1X9LA 4BSVA 4EDWH 3BPCA 3SGDH 1NBZA 4LE8A 1KC5L 4N6RA 3FT4B 5BOJA 4R97C 4PB9L 1M7DA 3N1FC 2WIIB 4IBWA 1VCAA 3DBXB 4DQOL 2IPUK 3KJ4B 3FZUC 2XT1B 2ZUQB 3DV6A 4PGBA 1NGZA 5GS3A 4KRPC 6PAZA 3ZY7A 4NDMB 3L3KB 5DYOB 3BAIA 1XD1A 2MQ0A 4H0GA 3UEZA 1MI5A 3E8UL 3EYSH 3CVHB 3SO3C 4KK8C 3G04B 4BSWA 3MUUA 2ARJA 1X5ZA 4B9FA 3N1MC 4J3UA 1WPCA 4PJCB 2QSVA 5I18L 2IGLA 5IEKA 2YSTA 5EUOA 4LOFA 4O2FA 5HY9A 1KYOJ 3QIWC 1O7DE 3FQTA 5GS0L 3Q44A 1EZSA 2DQDH 4PSPA 1L0XA 2V2XB 3QZBA 1I3UA 4LOVA 4XC3H 5BW7C 5I8CA 2MNUA 2OR9L 4NKDA 4ZFFB 3VXUA 1INEH 3TYGH 4N2AA 3OB0H 4RA3A 1HQ4A 1IJ9A 2NYYC 3T8XB 1Y0LB 1EBPA 1WH0A 2QADB 3W56A 3P3UA 4JVWA 4KKLD 3VTAA 2LU3A 3W38A 4N8PA 3UC0L 1RJZB 4IKIA 3ZMNA 4Z3IA 3OKLB 1A14L 2CJUH 4EUPA 4OCRH 4EI5C 1YEWA 1A64A 2XZZA 5KAQG 3W0WA 4JANB 4FABH 2WKOF 2WVVB 2GJJA 5T3XL 2I7SA 3VH8B 1GR7A 1XTLA 3PWNA 3NYKA 1VKXA 3GSNA 3VW3L 1J87A 1G7IB 1QA9A 3W0WE 4ALAL 2VR5A 4OZFH 2I7OA 1E9PB 2FO1A 3T3PE 2E4TA 3BAXA 1JF1A 4TV3A 1H8SA 3EOBA 1BCIA 1WA2X 1MDTA 3GSQA 1QFWL 2BRRH 3SJVD 1Z3RA 3QI9D 4L3CB 4Q52A 4N9OB 3T4YB 4BIKA 5J1TC 5LCVH 1AXTH 1JNJA 1T2QL 1MCSA 1JJUA 2GIYA 4NZRL 3DUUA 3DJSA 4KXDA 2ED9A 3EIFA 1T5XA 4XVOA 5JPNB 3WFEL 3GK8L 2ZZUT 3ILQD 1N7ML 2NNCA 4V1DE 2A9DA 3REWB 3DA0A 4AGLA 2NY6C 4WNQA 3UTSA 2R0WL 5FLUA 5EFIB 5DEGB 1CMOA 4HCRH 4NM4L 1WITA 4QNPF 1N0LA 1D6EA 1KV7A 1J5DA 4Y2LA 1N8ZB 3EFOA 1U95B 1ITCA 1E6OH 4IHOB 4I9WE 1JL8A 2Y69B 1BZ8A 1XD0A 5F0LB 3FMGL 3LMJH 5HYSB 1BDYA 2X4OB 4X6DF 3FUEA 4N2FA 4OAWA 5J1AA 4DK5A 4PEEA 3BYTA 5DJ6B 2EVIA 4F7MB 1QZ1A 2Z0BA 1TUPA 3MSPA 5IOPA 3CFCH 2B2XH 2G9HB 5AVXB 4WTXA 3T0AA 3UDWA 1HXMA 2C9SA 3ZR6A 1R24B 4QRUA 4QKTA 4BQBA 5DQ9A 4RWYL 3AB0B 3K3QA 2XVBA 6PCYA 1PSKL 4LPTA 4Z6AT 2E8ZA 4L3AA 4U3SA 1BJ8A 3NCBB 4HETA 1BD2B 3GB7A 4QYOB 4ZW7A 3GRBA 2N7SA 4DUWA 1X7QA 5K9JH 1G7QA 2XWXA 3VXMD 1L6XA 3CFBB 1UD5A 3FQ2A 4BV1A 3B2VH 4X9HA 2P44B 3L3JB 3GJFB 4WWKD 1NC2A 1KZQA 1ZGLB 3DGCR 3CZUB 5F7KC 1TQSA 1ZVYA 2A83A 5ICUA 1I31A 1TVBB 3OG4B 4X5LA 4FXGB 1NEUA 3SDDC 4M5SA 5CF3A 1MCQA 4ONHA 1D6VH 2JSFA 3HPLB 4ZS7L 3VFUB 1PD1A 2BXZA 3PUUA 1OP5H 4JFXA 5D7SH 3SYCA 4Z8FH 3N44B 2ICWI 1FVCB 3ZKNC 5JPMA 4EN3C 3G5WA 3DX7A 4UMSA 3CBKB 5HJ3A 4YGVA 4I77H 3DROB 1CDGA 5CP7A 4PRIB 3NIDB 3KM2A 1CFQB 2FJHA 3KPLA 4G8GA 4FZEH 1H6EA 3BGFC 4HJUA 4GAGH 4FHBD 4XX1E 1N59A 3RB7A 1EMTL 4U1MA 1CG9A 1Q9WA 3V0IA 3QCUH 1LEIB 4PY8I 1CXIA 3INOA 1OSYA 1MFDL 1Q9OA 2WAHA 2QGCA 3Q2VA 4HIIA 1TQUA 1KYDA 2HVJB 2KKQA 4FHJA 3BAEH 3AITA 1CGUA 1AD0B 1FORL 4PU2A 1OAKH 3MJ9A 4XH2B 1MW1A 4PTUA 1OKEA 1DVQA 1S7VB 5GRZA 4X7DC 4G71B 1WWCA 4AYSA 4PLNC 1IC5L 1OD9A 3T2OA 2RCSL 4JFQA 3D3VB 3BUTA 2ICCA 4Z3FA 1KACB 5LBSL 4L8CB 3GXDA 5DJAB 1C5CH 4GQRA 2VDQB 2EIZA