2P80A

Solution structure of the complex between nitrite reductase and pseudoazurin from a. faecalis
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
335
structure length
335
Chain Sequence
TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Low resolution solution structure of the 152 kDa complex between nitrite reductase and pseudoazurin from A. faecalis by paramagnetic NMR.
rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 68
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2p80A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2p80A02
1AS7A 2HRGA 2P80A 2W8CA 4E9RA 1KCBA 1AANA 2BW4A 3WNJA 2GI0A 5B1BB 3JTBA 1XMEB 1AIZA 1ZPUA 1CYXA 2PCYA 2CALA 2JXMA 4DP0X 4YSCA 1TEFA 3WNIA 4AKQA 1FA4A 2VN3A 2CBPA 2GHZA 3FSAA 2I7OA 5TK4A 2VW6A 4NB7A 3QJVB 1A4BA 2BO0A 4A2DA 3D12B 2HX9A 1NWPA 1PNDA 2IDFA 2QPEB 3TA4D 4E9YA 2WSDA 2XV0A 1SF5A 4N4YB 1A4AA 4YVUA 2HX8A 1JXFA 4YSPA 3ABGA 4AI7A 2BWDA 1URIA 1ASOA 5D4JA 3AG4B 4P5SA 4BXSV 3CZUB 3OD3A 3WIAA 4GP4B 1J9RA 1RZQA 2IWFA 2VM3A 3T71A 1L9SA 4F2EA 1AZNA 4F7KA 4NERA 3NJHA 3OMAB 3QJRB 1BQRA 1CURA 2WO3B 2FWLB 3OMIB 2CCWA 7PCYA 2XX1A 2MRYA 2BW5A 2PP7A 2VW4A 1XB8A 3FU7B 3U25A 1FFTB 1WAEA 4BDVA 4BXVA 1AS8A 1A8ZA 1DZ0A 1AACA 1WA0X 4KO7A 4ZK8A 4DP5X 2FQFA 4YSAA 3WKQA 2YQBA 3N2JA 2BZ7A 1SJMA 4GXFA 3CDZB 1L9TA 1VLXA 3GDCA 1XB6A 4HCIA 2R7EA 3CG8A 5I28A 2GSMB 5F7AA 1RKRA 2HZHA 1GY1A 4NAJA 4YSTA 1W6WA 4E9VA 2HX7A 1MDAA 3FQYA 4GP8B 4MFHA 1AZBA 3G5WA 3EHBB 2DY2A 1GS8A 2OJ1A 2RACA 1IKOP 1CC3A 2YAHA 2LLNA 3DIVA 4DP4X 2YARA 3PCYA 3NJLA 1A4CA 3OQRA 4JKNA 6PCYA 1PLAA 1GS7A 3EH5B 3EF4A 1ASPA 2CAKA 3FSWA 3WI9A 2XXFA 5AZUA 3GXUB 1M56B 2FQDA 2BZCA 3ERXA 4N8UA 3TU6A 2I7SA 4PAZA 3NJKA 4GY4A 1X9RA 4YSQA 1E67A 2AANA 1WS8A 1X9UA 4GYBA 2UXGA 4HAKA 2GBAA 2PP9A 1NIAA 4KO5A 5A7EA 3DKHA 1CUOA 1FWXA 8PAZA 3IBOA 3L45A 4A2HA 2OCCB 5I6PA 1GS6X 2UX6A 3PLYA 2J56A 2PP8A 3H4HA 3HB3B 1JZGA 1TKWA 1JZEA 2YAEA 2YAMA 3PXLA 4KOBA 2J57A 1ZV2A 1PNCA 2ZOOA 1NTDA 3S3BB 1HAWA 2GC7C 3EH4B 3MBWB 7PAZA 2XV2A 3QJQB 4E9SA 1BYPA 1OV8A 2QDVA 1NIFA 3KW8A 2H5UA 5B7EA 5I6OA 1J5CA 5IY5B 1NDTA 1JVOA 4ENZA 4HZ1A 5E9NA 1AG0A 1NINA 3CDZA 4BWTA 2QT6A 4X4KA 1AZUA 3X1EA 2PCFA 1GW0A 2FQEA 1GSKA 2XX0A 4K9JA 5B1KA 2WO2B 2ZWNA 2FTAA 1ASQA 4DP9X 1SFDA 1OE2A 4BK5C 3ZX1A 1MZYA 4YSOA 3H56A 3S3CB 2EIKB 2JKWA 1SDDB 1ILSA 2PLTA 4HCFA 4TXVB 2PPAA 4YL4A 2J55A 2HXAA 5F7BA 1ILUA 4G7RB 4M3HA 1SHWA 1F56A 2IH9A 3FPYA 1JVLA 1ZIAA 2Y1AA 2IAAC 2OV0A 2IDQA 1JXDA 1AOZA 4HALA 5PCYA 2IH8A 4DP8X 4Q8BA 3H4FA 3NJGA 4QKTA 4YSDA 3PAUA 2MTAA 2AVFA 2FT7A 1A3ZA 5D4IA 3UADA 1M57B 4F2FA 3OM3B 2XYBA 3V9EA 2AZUA 4A66A 3S8FB 1OCZB 1XB3A 3X1GA 2FT6A 3NYKA 2BP0A 1NIBA 4JHUA 5I5JA 3NJMA 1V10A 2DV6A 1EHKB 1JZFA 2BP8A 1QNIA 4DP1X 2YXWA 2EILB 3NT0A 3MX0B 1BEXA 3FQ2A 3FU8A 1L9RA 2FQGA 2A3TA 3NSFA 2GC4C 3NJFA 4DP6X 3AZUA 1KDIA 2P80D 1ID2A 2PPCA 5B1AB 1OOWA 4HHGA 3QJUB 2XWZA 4JHVA 3ZBMA 1OF0A 4E9XA 1JZJA 3IN2A 1L9QA 2IDTA 2Y69B 1SNRA 3FYEB 1JZIA 2XV3A 2GIMA 2PPFA 4GP5B 1ZIBA 1WS7A 2NRDA 5D4HA 3X1FA 4EF3A 2IWEA 1AR1B 1TU2A 1MG2C 3NSDA 1NPJA 3QJSB 3NP3A 1NICA 3T9WA 4E9WA 1SFHA 3AW5A 2TSAA 5PAZA 2VSKB 2CUAA 2UXFA 2AZAA 2FJSA 2DWTA 4W1TA 2IDUA 3TBBA 3ZDWA 4KNTA 2N0MA 1GY2A 2PPEA 3UABA 1PZBA 1UATA 1A65A 2QPDB 3FSVA 4A2FA 3GYRA 2BWIA 2YAQA 4M4RB 1JZHA 3PAZA 3CVCA 3RYMA 4YSEA 4KOCA 1OCCB 3AG2B 3UACA 4WTQA 3S3DB 1QLEB 2UX7A 3NP4A 4QLWA 1KDJA 2E86A 4Q89A 4P5RA 1JXGA 1OCOB 1ZDSA 4G72B 3X2QB 2FNWA 3FYIB 4CSZA 1J9QA 3QQXA 4E9QA 3N55A 3NSYA 4G7QB 2XUWA 2J5WA 1RZPA 4KNSA 1DYZA 3WKPA 3QPKA 1R1CA 2XU9A 4A2EA 3OMNB 1T5KA 1PAZA 2I85A 3PAVA 4UAHA 1JERA 3T6XA 1BAWA 3IEAA 3ZIYA 5B7FA 4DPBX 1AS6A 2HRHA 3CVBA 1E5YA 1OCRB 1IBZA 5ANHA 1TEGA 3ABMB 2QDWA 5FC9A 1E65A 3ASNB 1AZCA 5I6LA 1HAUA 1EZLA 1MZZA 1KBWA 1V55B 1N68A 5I26A 3FU7A 2GB2A 3KW7A 1J9TA 1W6LA 2DYRB 2B3IA 4KNUA 3AG1B 3X1NA 1PZAA 4G7SB 1PLBA 3T6VA 3UAAA 1ET5A 3NSCA 3FU9A 4DPCX 4AZUA 1BXAA 4CSPA 2EINB 2BHFA 1M9WA 2W88A 2BP0B 2IDSA 3TASA 1AQ8A 1WA2X 1N70A 1ET8A 1PZCA 2CJ3A 4G71B 3TBCA 4PCYA 2R7EB 3FT0A 1IBYA 3UAEA 2FT8A 3NJJA 3T6ZA 4RH4A 5B7MA 4AX3A 4YSSA 2EIJB 2HLEB 1ETJA 2ZXWB 3NJNA 4DP2X 1V54B 1KBVA 1KCWA 1WA1X 2UXTA 1E5ZA 5LDUA 1GR7A 2EIMB 4KO6A 4BWWA 1IUZA 2AFNA 1NZRA 4W9ZA 1J5DA 4FAAB 1BQ5A 2VSMB 5I5MA 2XLLA 3WG7B 3C75A 1NPNA 4UF7C 3FSZA 1BYOA 2TSBA 2Q5BA 3ABKB 3AG3B 1KGYE 1JOIA 5TK2A 3FQ1A 5AFAA 5I6NA 1NWOA 1ET7A 2XXGA 3IN0A 1NIEA 1OE1A 3SBRA 4FA7B 3FPXA 3HEIB 5B3SB 1PLCA 4DP7X 1AG6A 3QJTB 3SQRA 2ZONA 1RCYA 3X1BA 2YXVA 3IE9A 1GYCA 2X88A 4YSRA 2YAFA 2XVBA 3EH3B 3PPSA 4L0PB 5I5IA 3BVDB 3SBPA 1PMYA 5I6KA 3JT2A 1L9OA 1PF3A 2DYSB 1E30A 2PPDA 2X87A 1L9PA 1MG3C 2H3XC 2VM4A 4HHWA 2DWSA 1PCSA 4AKPA 2UXVA 9PCYA 2H47C 3FS9A 1HFUA 1ZDQA 4YVNA 3ASOB 5B1JA 1SDDA 4WKXA 4AKOA 1SF3A 2BP8B 1QHQA 2VMJA 1KV7A 4HIPA 1BQKA 4A2GA 1NIDA 2YAPA 3BQVA 2Q9OA 5B1JC 4BWUA 1BXUA 2VW7A 3AY2A 1I53A 3CVDA 4A68A 1OE3A 2JFCA 4A67A 3DTUB 3SBQA 1YLBB 4YSUA 5EHFA 4DPAX 1IC0A 4KO9A 1PY0A 1B3IA 3V9CA 2B08A 5AKRA 1KYAA 1J9SA 3UGEA 4HCGA 1AAJA 4G70B 1ADWA 2IWKA 6PAZA 3T6WA 1AZRA 1BXVA 3NJIA 4UANA 3S8GB 1SHXA 1CYWA 4BDVB 1W8EA 4E9TA 3ABLB 2YAOA 5I6MA
chains in the Genus database with same CATH superfamily
1TEYA 3L16A 3GUTA 2OZNA 2W8CA 1JGVH 5DI8A 2BC4A 3B2VH 2RTTA 4UB0L 4G83A 2XBTA 3Q5YA 4LSTH 5CJBA 3DURA 1J0JA 3C08H 1YEGH 3HS0C 3FFCA 4RA3A 1NUNB 2VN3A 4IRZH 5L88H 4MD4B 1AD9A 1YC7A 1QHPA 3D3VB 1A7QH 2Y7SA 3SPVA 4HKXA 2WIIA 2L4OA 3SQOH 2DI7A 1YMMA 3RUGB 3JTTB 3HMXL 3P2BA 4OZGF 4DSYA 3ML9A 4G9FA 5BJTB 1KTBA 2B1HH 2BSTB 5F88A 5FHBL 2NZ1A 1A7OL 1EV2E 1T83A 5KW9L 2V2WA 1G1KA 3ZZSA 1RVFH 1NM9A 4JS7A 5GZOC 4K7FA 3VXTA 1ASOA 3FTVA 3HUJB 1VFBA 3OD3A 2BOCA 4FN0A 1KWKA 3PABB 4NP9A 1K85A 2AKRB 3RA7L 4ZDHB 3BSZH 4R8WL 3WJLC 5ACZB 3SE9L 2IGFH 3UTSE 3RFZC 3GHBL 1BQRA 4KZCA 4JRWA 4FQHA 2X4TA 2OMWA 4OD3H 3LQZA 3MZTA 1D2OA 4XH2B 2QFPA 4NQDE 3AREB 2AJVH 4UILH 2VW4A 4X6EB 1E9PB 4I1NB 3VXUE 4BD4A 5I1DA 2PYEA 1U8KA 2WQRA 3FQTB 1A5FL 3CDGA 4QXUH 1VZHA 1ZLDA 2FQFA 4UV4L 4UIKL 3F00A 1F4HA 5AOMA 3ATBA 4KJPC 1TMCB 4XVTL 4HC1A 1BEYL 3NFSL 1TTUA 3CXDH 1H9DA 4LXFA 1OCWL 1SBSH 3VB9A 3CG8A 5J1AA 1BFOA 3ROOA 4ZSOE 3D30A 4K5LA 4JN2A 4YSTA 1A1MA 3TO2B 2H6PB 3X17A 2WLJA 1JTPA 4I18A 4YLCA 3DVGA 3JUZA 3HMXA 5GPRA 2XFGB 2GTZA 3ZE0E 3I50H 3MRIB 1NEZA 3MVSA 5E5UB 3WLWD 2NY4C 3D2UA 1I7TA 1UC6A 1UURA 3NZSA 1OGTB 2V7NB 3V4VB 4BQCA 4DEWA 3SPGA 4QAWA 1KJVB 4Z7NE 5C0AD 4D7PA 2F58H 1N64H 1N5AA 2B1AH 4FLSA 5EF0A 4QXGL 2E9WA 3O9WC 3FMGH 4HKBB 1OSPL 5EBMA 2DWYA 3VVVA 1ASPA 3HBPA 1QPXA 1Z7JA 1FIGH 4XPTH 3FO2A 3WD5H 4UV7L 2FQDA 3GIVA 5G4MA 2X10A 2I9LA 3QWRA 1JV5A 3RWHA 4LRIC 1ZGLB 5FGSA 4J8RB 3UGUA 3WOVA 3FUMA 2GBAA 3FH7A 1BLIA 4EN3C 4ONHA 3ZKMC 1OO2A 4E0RB 4OCMC 3I74A 3EGSA 4GAYA 1CE6B 3S3JA 2EUZA 4XBPB 5T1DH 5DSCA 3LQZB 4TUUA 1MY7A 3HB3B 3H4HA 2JJSA 4WHTA 5AQ0A 5EN3A 4CDGC 2ERJC 5L4IA 4XP4L 1JZEA 1OM3H 1B3JA 4APXB 1HXYA 4TVPD 1GGIL 5AEAA 2G75A 4PN6A 2O6CA 1UEMA 3HUJA 2QDVA 3BW9B 1XIWD 4LGPB 4HWUA 1C12A 2Q86A 1HH9B 2AEQH 4PJBF 3DPDA 4Q6KA 3OZLA 1KEGL 1SHSA 3UEQA 3FMGL 3P77B 3HI5H 3WTTA 5BJTA 1JZ2A 2FX8H 3KR3H 4HUXA 2EZ0D 4G1MA 3CU1A 1WZLA 4QOKA 2LFGA 3C6EA 3RBGA 3DXAE 4EZLA 3D3VA 3F65A 4MJIE 5J57B 4KXZI 1VEOA 3BH8B 5GGSA 3ZX1A 1DP0A 3HC0B 4TQHA 2W80C 1H8NA 2D4DA 3G9AB 4LLVA 1HEHC 5LGYA 2R0WH 4P5TD 1PGRB 4NBZB 2X4QB 4OGYH 5MHSD 4M3HA 3GUTB 3ILPB 3IPEA 2VH5L 1ZD6A 1BREA 1HIML 1UWXK 3II1A 3BP6B 4IU3B 1S5HB 4PVLA 4XHJD 3NIFE 5PCYA 4DP8X 3QI9B 3E0GA 4I0PA 2ZP9A 3H9SA 1CL7H 4RGNB 2FK9A 5CFAA 3CV5A 5I1JH 3ZE1F 4N6QA 5IGXL 2FT7A 4CMMA 3EJTA 5K9OA 1GMIA 4F2FA 1IQDB 4TULH 4IHOA 3DBXB 4I77L 2C26A 1A7NL 4OLVH 4WWID 4X5WA 4Y9CA 1C08A 2ZOWA 4UT9L 4D9LH 3RWGA 2Y7LA 2AERT 5D2LE 5DRXB 4YWGH 2Y7MA 3KJ6H 3EXLA 3I84A 2BRQA 3REWB 4PGCA 1N5YH 2NNFA 3EOBB 4AGPA 3PGCA 4DUXA 1OF2A 1UADC 1U2CA 2OSLB 2VO8A 3DOIA 1XL6A 3MBEC 4L4VD 2BSRA 4GMSL 5KYYB 2MNWA 2NYZA 2MCMA 2DJ4A 5DRZA 2OI9B 1IGMH 1QFWL 1SJEA 4JY6A 3SKMB 1AR2A 4Q2ZB 4ETQA 2R15A 1PZ3A 4S11A 3L9YA 1P53A 4ECNA 3ELQA 1YMME 3BE1H 4M3KB 3HG1B 1UB5B 2AJSH 1M42A 3CDFA 1NJ9A 2GJ6E 1WS7A 1WE5A 2NRDA 4X6CA 4V1DB 1NFKA 4O2EA 4O00A 3G5XB 5DHMC 1NPJA 1I8IA 3M7FB 4K94L 5DHXB 3UJTH 5E9DA 1CI5A 2VSKB 2UVEA 2CUAA 3O4OB 1EFXB 1C9SA 1EEYA 1F6AB 4WUUA 4HJ1A 5DRWB 1ZRUA 2IDUA 4OKDA 1E3ZA 4NNYA 1IILE 3OBAA 4BQ8A 1JV2A 4GBXB 3FB7B 4B9CA 1XH2A 2E6JA 3O8XB 2IQ9L 2JWYA 4J3OG 3PJLA 3EJSA 3C6LD 4XTRD 4FQJH 4J39A 4ES9A 4MJ6B 3TT3H 4A2FA 5FX3A 5GGVY 1ZGLM 4QT5A 1MFBL 3PWLA 1OB1B 2J25A 3IJHB 5C09D 3D69A 1MF2L 4GAJL 3BKJH 3FN0H 4I3RL 2D3NA 1RU9L 2AJUH 5EO9B 3NUKA 3TBYB 2BM3A 2UWEE 1ZDSA 4XVJL 1CG9A 1SYSB 3LJ3A 5ICZA 5CKGA 3GSQA 1DQQA 4YHML 2A9NH 2N1KA 3VRIA 4RBPH 2D0GA 2FX7H 2O72A 1OSZA 2HSIA 3E6HA 1TTRA 1PVHA 3LD8B 3FU3A 4ZAKA 3K8LA 3N0PB 3SQBB 2JI1A 4Y2LA 3ARYA 4DN3H 1IEAB 5LWYL 4FNSA 3IEAA 2D7TH 3UIZA 4G82A 4KVCH 4C56D 2V5TA 3FCBA 1A7QL 5JPNB 5HGDA 1MCEA 1S7UA 1M9SA 4NI6A 3OR6A 5DK2B 4WWKA 2PWGA 4Y1SA 5KSBB 5DA4A 4M6AA 5I26A 4KITB 4IMLA 1JN6A 3RWFA 4ANUA 2J1ZA 4DO4A 4XNUL 3OF6D 3BUQA 5TGBA 5BZDA 3L54A 4MS8C 4ZPVB 3R7QA 1AP2A 3C5SB 1DVTA 1XGUA 3CQQA 5TDOB 4AENB 3RX7A 4JM4H 1WFOA 5MEOB 1L7TH 2V9RA 2OX5A 3ZKMD 4BE5A 1RURH 4GMTL 3I75A 3E2HB 5IHBA 4UDTB 2VLKE 1PZCA 5IMOA 1A1NA 4NQDB 3RDTD 5J4MA 4E41E 5EBLB 1N59A 4XN8A 2VABA 4PWKA 2FT8A 2NX5B 3UAEA 2EYTA 3LKQA 3V0JA 4F91B 4MCNA 2WINB 3JV6B 5B7MA 4XCCL 4X4YB 1RMFL 4AX3A 5JYLA 2A9CA 1HJCA 2AMUA 1ONQA 1UXMA 2EIJB 3HZ3A 3NJNA 4X99B 1UZ8B 4PJ7F 2M2DA 4D0DB 3GZQA 1XCQA 3WDJA 3VG9C 5MENE 5DVKA 2EH8L 4O02A 3CVHA 3PYCA 4U0QB 3FU0A 2DRUA 4B9FA 1N0XL 1XIWA 3P4OA 4FNLH 4LDCA 1RZGB 3ZGHA 4FTDA 5IHWA 2Y7QB 1HHGB 5CJXA 3L5XH 3CFKB 4F7EB 5HD8C 2ZYIA 3MV9D 4M62L 2IMNA 3FQNA 2VLJA 4B5ZA 4Y1AD 3SQRA 1TNNA 3X1BA 2IV9A 1S9YA 4ABVA 1N6QL 1JK9A 2X88A 3OV6A 2YAFA 3EYUH 1TJMA 3PPSA 5IROD 2H32A 3OXSA 4YNYB 4OBSA 3Q2LA 1FIGL 5I5IA 4JPVL 3BVDB 4LLDB 4A1RA 4ZMZA 3MLUH 2YD8A 1VHPA 3DO7A 5D2LB 1AGDB 2BIMA 3MA9H 4NXSA 3H2QA 1U41A 2ADIA 2XNAA 3GEWB 4EMZA 4WNJA 2YD6A 3LS4H 1BQSA 2HJKB 5FGCB 2FX8L 4GRLC 5A16B 4ZI8A 3U46B 4PGDB 5ACMA 4EDXB 4LLQA 2BOBB 3ALXA 4AQEB 3F58H 2OW6A 4KRNA 1S7WB 5B22A 4B9PA 5CKAA 4KKBD 4IIQA 3ASWA 1G43A 4HIPA 5KN5A 5HDBE 2C7UA 4XCNA 1NIDA 3TT1L 4GQ9H 2CUIA 3CVHL 1S3RA 1N0XH 5IMMB 2AP2A 4OGYL 4DKEH 3CQFA 4HQQL 2CXKA 3SBQA 1KGJA 5EHFA 1FG2B 2ZP8A 1EHAA 2EXWC 5CZXC 5SX4I 5CMAB 3KPNB 4OD1H 3TWYA 2I32A 4HX1A 3BC9A 3IJEA 2IAMA 2BP3A 1U2YA 5IQ7H 4Z0XB 5M95B 4UIKH 1F42A 5ID1A 3NFPA 4ZTOL 4L5FH 1FGNL 3PGFH 4MZIA 5SV3A 2RQ8A 5DDHB 1W8EA 4N2OA 1G5GA 4UBDC 1DDHB 3ECBB 4GI9A 3UDWA 3WS6A 4EXKA 3FB5B 3UZEC 1HHGA 4GKNB 2O4EA 2BWQA 1JNJA 4HIHA 1T0PB 2QSCL 2VR4A 1KLUB 4PJ5B 4UQEA 5TTRA 2GI0A 5IVXB 1FYHB 1KYUA 3O6MH 2NTSP 5SWZB 4ZUVB 1MPAH 3UZEA 2JB5H 4XN4A 4XMLL 1DJXA 1KT2A 1WT5A 2I7OA 4OCRL 1FZJA 3TA3B 4M8RA 2BO0A 1PS3A 3J8F7 3SDCC 2FEDC 2H1PH 2ZOKB 3FL7A 1A6PA 1ACXA 3NZ8B 4L9LC 1X7SA 4FP8H 3NCYP 4A38A 3SHSA 2ICWB 2H26B 4WW2A 4XN9A 3K6FA 5FM4A 5KYXA 3ARGB 5FHAH 2WSDA 4W70A 3WUWB 3KLDA 2P49B 3STZB 1T0OA 4OCSL 4ZS6D 5EPMA 4P2QE 4TM9A 4OLYH 3SKOB 4OD3L 1Z32X 3BGMB 4NQVB 1RAMA 5FM5M 1JZDC 3II2A 1UFUA 4XOCA 5CLXA 2R23A 3NVQA 4MMZC 1VADA 3Q3GB 4YHIB 2MPAH 5HTSA 5KBPA 4JY4B 2WQXA 4G7VL 1DVZA 2DQMA 4BFBD 2FWLB 4JKMA 4QJ3B 3B3IA 3MLRL 1HHJB 2DIBA 4LLYB 4BDVA 5CN3A 3TH3T 1Z1WA 1RZKH 2JIXB 1FYTE 2ITDA 3WKMH 3DTXB 1SVCP 4KMQA 5DS8B 3W5NA 3FRUA 2X28A 3W5MA 4MD0B 1H0DB 5DWPA 5LXVA 1GGBH 5FK9A 1J1OL 1I1FA 1L7TL 3RP1A 1L9TA 3GXTA 4CN1A 3RIFF 2XWRA 4C4KT 1BG9A 1AKJA 4MQSB 3D0AA 1R24B 1MXDA 4X6DE 2IFFH 3BAEL 1EANA 1LD9A 3D06A 1MHCA 3KBFA 4X5PA 3VFPA 3ZY7A 4EDWH 4GP8B 3ZZQA 4ODTH 2NSMA 3F7VB 3UO1H 4RGND 2V8LA 4DQOL 1IKOP 1JRHI 4EO5A 5LBVA 2J44A 3H6JA 1NANH 5ICZB 4P2QA 3TPUA 3WNPA 1CG9B 2F5AH 3EGDA 3VFUB 4LVNB 4UOW1 1PQZA 2NY4D 2VE6B 4H20L 1KIUB 5C0JB 1FFNA 3FSWA 25C8L 3WI9A 2V2XB 4KQ4H 2DMHA 3WJMA 2WB7A 4DKFL 4GKSB 3CVIL 4JHAH 1JYVA 4ZTPH 4IRSC 4O02L 4ODUB 1WS8A 4ZMVA 4HBCH 1FVDB 4KKLC 1MI5B 1SN5A 1T6WA 4U1KA 4WFGD 2X53A 2FO1A 4N9OB 2WPGA 1FWXA 8PAZA 1U8IB 3ES6A 3RUGF 4A2HA 4HLJA 2J1YA 3O3BA 5KSUA 4MAYA 3PWNB 3EYUL 1F11B 4OGAD 1I8IB 1RPKA 3CSYA 3FUJA 2DTML 4OZHF 3DUUA 4UTBH 3EDDA 3VW3H 5D5MB 5DEGA 1PZ5B 4X6DA 4URKA 1PNCA 2XY2A 3VTAA 5JQ6L 2FJUB 4GRMB 2XV2A 1ACYH 1SLXA 4X9GA 3KR3L 4KUZL 1NL0L 3VRLF 3GMNB 3OKYA 5DRZB 1RUQL 2DTMH 3ARBC 3TIDB 4OM0H 4L8SB 3QXTA 3GPEA 3SGEH 3JWNH 3K80A 1F45A 4M7LL 4X6CF 4XXWC 1HH6A 5B1KA 5HVHB 4TPRL 1EAPA 5EEZA 2DMCA 2BVUA 5IJVA 1N0LA 4M61A 3EFOA 5FYKE 4A04A 2VDOB 1AGBB 1OE2A 4WNQB 4HWBA 4BK5C 4QHLB 1XGYH 2EIKB 3VSUA 1E2WA 1RP8A 4X5WB 4XCCH 3WNMA 4JFFD 4EUPH 4MMYA 4R96A 2KKQA 3VXQB 2VLKD 3IE4A 4BCXA 4P2OD 4FG0A 4BFEA 5SWQA 4Z7VE 3NIDF 2CO7A 5ACLA 4DAGL 5BW7A 4CN4A 5C0AB 5DUJA 5E8OA 1I8LA 2OP4H 3I9PA 3ZR5A 2IAAC 3IFNH 3RVTD 5AAPA 2FECL 2ZF8A 3DIFA 4FXKB 4KBPA 4AGMA 1HZLA 2IPTH 5E2TH 1SOSA 2AVFA 2HTKD 5KBMA 1EX0A 5LCVH 1FPTL 4JRXA 3STLB 3CD4A 3DX7A 1TFPA 1H15A 3FB8A 4HJIA 2B4CL 4WKZB 4BINA 1E90A 4HLEA 1C8PA 3BKJL 3P69A 4I3RH 2W07A 3OXRB 5LAXB 3CFDB 4FNRA 2YSTA 4B7IA 1LM8V 1D6EA 3K0YA 1MELA 2PXYC 1JD7A 3L1OL 1FNLA 1EHKB 4PWIA 3S88H 1Q8MA 5E8EB 5IG7A 4QHUA 1A4KA 5AVUB 5DRNA 3LPOA 3QNYA 1HSAA 3LH8A 2Z7ZA 3F84A 4WI4A 4JO1L 3NJFA 3CUPB 5KTEL 1I7UA 1T5WB 3ARED 5DUBA 5AVXB 2WC7A 2P80D 4AM0B 4HS6B 4KKZA 4LSUL 3HFFA 3BD4A 1JDCA 3QZNA 5HJBA 1K2DB 2GJ6D 5IR1A 1S9WA 3BP5B 5JOEA 3DYMA 1VGKB 1QA9B 1R0AL 4R7DA 1XSIA 1TJXA 1X7QB 4J1UB 4DGIH 1KGCE 1DJGA 2PO6D 1HQ4B 4PI2A 1NC2A 3QUMH 1EUTA 2BK8A 4M56A 1IGIL 4TSAL 4YS4A 5C3LD 5IMKB 1QBLH 3KYNB 1KPRB 1IAOA 3RNKB 5DFAA 2EAEA 1I9RH 3G6AA 4OQTL 1KEGH 4I2XE 4CU8A 5JNYA 2HN7A 2K78A 2ZCKL 4Y5YB 3EGSB 4Y5YA 3HR6A 2VQ1A 1RSYA 4LB8A 3MKGA 4HGMA 3CFBB 4YHZH 1CIDA 3QULA 2JJTA 1JFQL 2EDQA 2ZNXA 5AB1A 4RFOL 4D9RD 5MERA 5DFWH 3AXLB 2PCFB 1DL7L 1UATA 2WUCH 3OGCA 4NZRL 1KXQE 1MIEH 3KPRA 4B3VA 1ZGLA 4CBZA 2JJTC 3GSOB 2VITA 4NIYE 4MVBC 5DO8A 3US9A 1OAKL 3ILQC 4LZKA 1JZHA 4P23B 2AQNA 3B5HA 1IFHL 4GQPH 3VXRB 4GIPD 4P4RA 3RQ3A 4NKMA 3MRLA 2RALA 1D5ZB 2R4SH 2ZCKH 5HYQA 5IB2B 2C9PA 5CR8A 3LRHA 2R1WB 4U7MA 2V7NA 3V4VA 2ZPKL 3NSYA 1OT1A 3UYRH 2X1QA 1PKOA 1IGTB 5DRNB 2Q10A 2CKBH 3WFEL 3QR1A 4JFHE 3NCMA 4LVOB 2FVNA 3CLEH 1QQDB 2X1OA 3X11A 5EWIL 4PUBL 1D6EB 3LS5L 3TO2A 3MZGB 4K3JL 2IADA 5I1GH 1A3LH 3L9RA 1O5DT 1BFOB 2W07B 2CPCA 3OXRA 5D2NE 3VGEA 1S78C 4XMLH 5CIPA 3NZHH 3BGAA 4HKZB 5CCHE 4ZFOA 4FLRA 2WYHA 1C16A 3H85A 4HKJB 3OX8B 3UIYA 2GFBB 5IB5B 1BA9A 4RIRA 5I8OH 2JQAA 3FQTA 5A6LA 5IBLC 4LSVL 1HVXA 4F7TB 1LE9A 2COVD 4BUQA 3SDDA 2AXFB 5F1SA 3FQWB 4P2QD 3GXMA 2HPOA 3R4RA 4H25B 4WI0B 3MJ9H 5FYLD 4R0LC 3T2PA 1LE5A 3OKNB 3AQYA 2VQTA 5HHPA 5HSFA 2X9XA 3NDYE 5AOLA 3AT0A 4MMYB 4YQXH 4LSVH 2IOMA 4NWTH 3U6XS 4R4FH 1ZSHA 2GY7B 3PNRB 4ZDHA 1MW0A 2QHRL 4MNQD 2DQUL 4AZUA 2BHFA 2MSPA 2BP0B 1SY6L 3OC5A 2CJ3A 3PL6C 4ANXA 3IMSA 3ARGC 3WMQA 2EABA 1B6UA 3ZHNA 4Z23A 1MW2A 1USZA 4N2EA 4XP9H 3AM8C 2DN7A 1JPGA 3W0WE 3F6IA 3GSWB 3MCKB 3CVIH 4IOSA 4CKVX 3LEXB 4J3OC 3N85L 2EIMB 1CCZA 3P4NB 5IOPA 1IUZA 4XNDA 1JYNA 1QX1A 1BQ5A 1R3IH 3QIUB 4NXKA 5ERWA 1FORL 2AEOA 4O4YH 4WSJA 4KKRA 4X6DB 5DEGB 1CDCA 3UAFA 3HFMH 1G9NH 2WJ7A 3ZE2B 3KLLA 1XGPA 5FYKL 2EIEA 4NUMA 1HILA 4G6JL 1I3VA 1ODAA 4K5OA 5I6NA 2ZKYA 4GG6E 4DETA 3VFNB 3U0PA 5FLVA 3ES6B 5AW7B 3KCPA 1U8IA 3B9DA 3L7EB 1EXHA 4DCQB 4PJFF 2DLIA 2HWZH 3CXFA 1KTDB 2F74A 4R97C 3T8XB 3IE9A 3HI1A 1MCWM 1WO2A 4KPHH 2BXZA 2OBGA 2OQJB 2XHNA 4WENB 1XGTA 5I1LA 5K1NA 4MA3B 1JWMB 1L9OA 1PF3A 4YGVB 1E4WH 1R3HA 4LFHG 3RGVD 4NO5A 3R06A 1CXEA 4Q56A 5IQ9B 15C8H 1I9IL 4TV3A 4FQXC 3MRKB 1KCRH 2Y1YA 1O6SA 5KZCD 1T1WB 1WBYB 2GAZA 3BGFC 2LU7A 3I9GH 4U1LB 5CEZL 1BAFH 5I75B 5EIVA 1KJ3H 3SB3A 5A1AA 1H9VA 4AQZA 3WN6A 3H9SD 3ECWA 3F64A 4ZMOA 1SXNA 3ZDYB 3TBTA 3BISA 5BVPH 2XA3A 3C87A 2JCCF 1H8OA 4X7FC 2VZUA 2VXVH 3IXTA 3V4LA 2XWJA 3DTUB 5I19H 4YSUA 3CH1A 4DPAX 4FYTA 3NFNA 4FTVA 3R1GL 4MAUH 5AKRA 2R56L 4JJHA 1FHNA 5DHEA 2DEXX 5H2BB 2D3JA 4TNWF 1OTUD 1KACB 3A67L 4GW5B 1FFQA 3MLZH 4BDVB 4TSCL 1YEIH 4LBEB 4PS8A 4I3SH 3ABLB 2HKHH 1REIA 2WLKA 3QDGB 2WZ6A 2WLMA 5FOBB 2LAGB 2WBJC 3GSNB 3L95B 2P5WA 5DQ9A 2A5UA 4G6KL 4NPJA 5DUPL 4I48A 3VXME 4BIKA 4I48B 2GVYA 5HHOB 2CMRL 4R5VA 1A66A 2R23B 1UOKA 3VXRE 2XBZA 3MBEA 2GCYA 2R2BA 3IAPA 4YSCA 3B9KA 5F9WB 2W9LA 4P8QA 5EO0A 5K9QI 2EJ1A 5F7NC 3EYOB 5IBUG 5T1KD 5IMLA 1BVLA 1NFIA 1O0VA 3DDFA 4FGMA 4I3GA 4L48A 2GSGA 2R4RL 4L0YA 3MUZ1 4FMKA 4GH7B 5H2BA 2K9FB 4KROB 3T1FA 5F9OL 2FBRA 2DWEB 3M1BA 1DBAL 5B21A 4X80H 4BFGA 4LEEA 4QY8B 1RK7A 3K1KC 4YSPA 5DD0L 4AI7A 1N4XH 4OW6A 2EDOA 3UOAB 4BZ1A 4P5SA 4PCTA 2CRYA 3BH9A 2AQ3A 3B2XA 5GZND 3FU6A 3GK8L 5LXGL 2VM3A 1J8RA 1ADQA 5J12C 4Y2OA 4QRPB 4V1DE 2LAAA 4R90H 2AQSA 1A3RL 2CHNA 4LARH 2R39A 4C59B 3KGUA 4MXVF 4WO0A 5KVFH 1PPIA 3ULVE 1KIRA 2Y5QA 5ID1B 3V2AR 4NQDD 4JX0A 3RDTB 3D4ZA 1DQIA 3VXPA 4W6WB 3OAYH 1QRNE 3VXMA 2BVPA 2OP4L 1A2YB 2F53B 2G2PA 3MFGB 4XB8A 3LRSB 3HE6B 4NQEB 4UV4H 1TXKA 3JTSA 3EIFA 4ZPTB 5D7EA 4S0SD 4CVXB 4Q4EA 1UM5L 4PRNB 5F89A 2ZUWA 3BHBB 3UMTA 4F5CE 3WLWC 2ZTBA 4H40A 3HAEH 5A2BA 4F8PA 3TIEB 2ZWZA 1V3LA 5FWQA 1VZGA 1XSJA 4X6FB 1TZGL 3KLHD 3CPLB 4YEFA 4DJMA 2RACA 3VH8B 3LRGA 3MRMB 4ZXBC 1CC3A 4OGQC 4MTMA 3D4CA 5F7FA 3AY4A 1H19A 3QIUA 1AIFA 5ERWB 2JV6A 4IBLT 1JIBA 1OW0C 2F54E 1ZHNA 2KLTA 2N59A 3BWAB 2H3NB 4H1LG 4X7CC 3EF4A 3BZ4A 3O3UN 1R75A 4Y8DC 3G5YB 3AY4C 4XO5A 4GLRH 4NZJA 4CAGA 2FIKA 4WRLA 4ZPTA 3PL6D 5D9SA 4RAHA 1G9ML 5DYOA 3T77A 3DRTA 3T2LA 4QIRA 4UV7H 2AANA 1TCRA 2DLFH 2F61A 3QXUA 1AZVA 3EJCA 1NIAA 3FTZA 3T0WA 4N5ED 4I0CC 2GABA 1D5RA 4KXZH 3ETBF 4JFHD 5I6PA 2ITCA 4RMBA 4YL9A 1PX8A 3QEQD 1T04B 4QNPE 3H7LA 4EKXA 1EUUA 2G0KA 3EBIA 5HHPB 2AW2A 4Y2OB 3CHRA 1LO2H 5I74B 1OARL 1PZSA 1R5IA 4MCYB 2VR7A 1NPUA 5LDSA 4LCYA 2AXFA 2DI9A 2R0LL 3RPIB 4O02B 3GBEA 4CSSA 3ZDZE 2FWOA 2H5UA 4Y88A 1T03H 4QY8A 4C47A 5DLMH 4FEMA 3EF7A 5JDSB 4EN2A 2GFBA 3KJ4C 1S46A 3EHBD 2WLLA 2NR6D 3CDZA 1IGYB 2QT6A 5G55A 1JXKA 2Q8BH 1UUSA 1SEQH 3V5HB 3RZCD 1K8DA 2HMIC 4GRWF 4TLUA 4AJVA 5BS0D 1OGAB 3WUWG 3ZO9A 4Y1AA 1CFMA 4HWNA 5I1HL 5E4OA 2K3TA 5CSZB 5JHLL 1NDMB 2OX5B 2R2BB 2VDQH 1M7DA 3QJHA 4Y19E 1CFQB 1BM3L 5MEOA 3IFNL 4JM2A 2DL2A 3MACH 3WDHA 2EACA 4LU5L 1BBDH 3GSNA 3L95A 5DQ9B 1KGCD 2G3XA 2XXCB 4HPHA 3AABA 5DK0A 2RGSA 1BD2A 1ND0A 3L5WA 2ZXQA 3NK3A 5KSBA 2Y72A 5BXFA 1R3IL 3VI3B 2WZ0A 3OKLB 3ARDC 4KQ4L 3OR6B 4L1HA 4BFKA 2QADC 4X6BB 2QSTA 1IAIM 2CSPA 1NAMA 3SGJC 3VMOA 4RAVB 5F70A 2BSBA 2VDMH 5I8OL 2CUMA 3IJ9A 3IXTB 1P7QD 1I9IH 2XYBA 2JMRA 1ZY9A 4PRDA 1MI5D 1P4IH 4XBGB 2HT4C 1OTUC 5EV7A 4NQXB 3W39A 1I1YA 1Q72H 1CWVA 1NUGA 2DV6A 2H0FA 1F4AA 3EFFB 4KKPA 4QF1A 3T2QA 1CDUA 5DHYB 4QEGA 4K8RH 3QUMB 4TVPL 4AYFB 1FL5A 1VEPA 2A4EA 3KYNA 4PB0L 2QHRH 3ZKXC 2PXYD 3FQ2A 4RX4D 2NCMA 1J05B 1EK3A 4JPSA 2D9QB 2C9RA 1LXMA 3ARZA 4HJSA 5HJDA 4BK4A 3UBXA 1OP3K 4KGJA 3AZUA 1TYRA 1DBKH 3H2PA 3B37A 1RUKL 4G3YH 1CXHA 4JKKA 4X7TA 5CLZA 3W1ZA 3T4AB 4MBOA 2P5WD 3UAJD 3D69B 4YGVA 1WEJH 4FZEH 4IS6A 2C1PB 1S9VA 4G8FB 3IDXH 1OB1A 5I1LB 1UB6B 3K6OA 4FERA 1NCHA 3IN2A 2DEYX 3WHXA 4L3EA 3FFCD 2CK2A 3NCXA 1OK0A 4YUEL 4UZSA 1PG7X 2IWEA 2F74B 3BEVA 4LLUA 4NOBA 1K4CB 1WWBX 1JV2B 4DCQA 1U6AH 5E8EA 1D2PA 1KJMB 1T80A 4PGJA 5I8KH 1I7RB 5GS0H 3VXUB 1Q9LA 5GZNC 5E9DB 4KUCD 1WBZB 4DN4H 4MNGA 4JANA 1DBBL 2Q1EA 3V4VL 2DQEL 3V7AE 1JWSA 1FZOB 3U9PH 3NBNA 2MNJB 3FB8B 4WKZA 4X6CB 2X4UB 1K6QH 2FJFA 3CSBA 4UTAH 3UTZA 2JI2A 3M1CA 2WNKA 3CMOL 1J12A 2BWIA 4NM4L 1E6OL 1IFRA 5E7FA 3TZVD 1X7TA 3HKFA 5D71H 4TTDD 2X2YA 4LAJH 3O9WB 4GEJA 2VTFA 2QZ5A 1MFEL 1TZIA 2QL1A 4KDTC 1JXGA 4MMZA 4QR7A 2VLLA 4ZUSA 3D87B 2ZKHH 4CSZA 1A1OA 4XX1G 5HBBA 3ULVC 2B4CH 1JF1B 2R83A 1QOKA 2MEJB 5GS2H 2DOCA 1O5PA 3VXMD 3WN5A 1YYLL 5EFIA 2NZ9C 3BE1L 3EOAB 4L5FE 5FYJE 1PD0A 3WGUB 1JI2A 5AD0B 4N2LA 2HG0A 3JWDH 3OWRA 1E7VA 3WN5B 1HYSD 3PAVA 1DVFB 4XPAH 4LBAA 5D7LE 2MCPH 4PJCF 4P2RA 4CDHA 1L6ZA 1AS6A 3N1QC 3OKNA 3FT3B 4UZGA 3CSFA 5ANHA 1MAJA 3LS5H 4LIQE 4TLTA 1INEH 2IIJA 1S78D 1DLHB 5JOPE 1VCAA 2HRPH 4HEME 3SDAD 4ZMNA 5FECA 3QUYC 3KLQA 4UTAL 1LLAA 1ZT4A 5TDNA 3UTZB 1L5GB 3ZDXB 4B9JA 1MHPL 3DUUB 3U7WH 1MLBB 4J4PC 1ET5A 1CDJA 1F11A 2NY3C 4EN3A 2L7EA 4FADA 4YLQT 3L1GA 4OJEH 1AHWC 1WDAA 5E2UL 2MKWA 5KVEE 1EJ6A 5JIIA 4G71B 1K4CA 4U6XA 2JJSC 3Q7JA 3S36L 4QRRD 2GBUA 4IRSA 5AAMA 1Q9WA 5CCGE 4R7NA 3DK2A 1YPZA 4B41A 3X3GH 1TTGA 1U3HB 5JIDA 1ETJA 3DV4A 1V54B 3GMQA 2C1PA 2X4OB 3QO0A 1E5ZA 4WY7L 1MWAA 1X5AA 5JA8B 3BW9A 4BGDA 1F41A 2C7FA 3HS0B 4J3BA 1H5BA 4L0ZA 2VDPB 4HK0B 4OSUL 5B39G 4FAAB 3UBXB 2I25N 2QQKH 3KPRB 3CN4A 3ISRA 3LHAA 2B1AL 4FKEA 5FYJH 5KVMC 4YBHA 3QNZB 5E2UH 2Y25A 1E4XL 5MERB 4OLWL 2YUWA 2XPYA 4LSTL 1CB4A 4FNUA 4FNPA 5K9JL 5DHYA 4J3XA 1MAMH 2YR3A 1D7DA 3QWQB 3KM1A 1EJFA 1JUFB 4YZFF 3TN0C 5LGHL 4BHUI 1G6VK 1AQDB 3L2NA 3C6LB 1FNHA 1XT5A 1KPVB 3INUL 4X4MA 2PXYB 3C8DA 5IZ7A 3QJTB 4NUGH 5T1LB 4PJ9C 5F6IC 4NIKB 3V8CA 2XQYK 2NLJA 2YXVA 5JXAL 1JV5B 1RULL 1TQCC 3RWHB 2CNZA 2Z31B 1M7UA 4XVUD 4AEHH 2Q76A 3DSNB 5A43C 1QLRA 1NGYB 4ABUA 5DS8A 2FSEA 4GLRI 1RJYB 1RZ8B 2DYSB 2FE0A 2OTUA 5HYEA 3RVVD 4DN3L 5LWYH 3OKDB 2NY5H 5T33H 1B90A 3E7JA 2DWSA 1BD2B 5IVXE 1F58L 3ENEA 1HJBC 3VDBA 4QXVA 4TQEL 3G6JF 4JREC 4XI5C 3QG7L 1NEZB 1A4KB 2NY1C 3GO1H 4KK5D 1FNSH 1NH6A 1M7DB 1SRDA 4KRPD 4PJFB 3S5LB 4MNHA 5CSZA 2Q87A 5GGQH 1F2QA 3BZ5A 2BHZA 2H6PA 4Q58C 4EI5D 1H8LA 1SXSA 3QUHA 2P5EE 4YUEH 4Z8FH 4PJHA 3WUWA 5GGRY 5CU9A 43C9B 1B3IA 5DURB 5D5ME 2DJMA 4Z0BL 5LNEA 4PGBB 1S5IL 3T0EE 5I1EH 1EA9C 2YUVA 5DC2A 5JDSA 2V3DA 4LSRL 1M05B 1C5CL 1QW8A 5FUZL 3WUZA 5IUSA 4X4ME 4RMQA 2PYEB 2B77A 2YQ2A 1NMCC 4UANA 2CH8A 2UWEA 5ELIA 2YPKA 3RVXD 2AABL 4LCYB 5J6GB 2WWNA 1RZIB 1YECL 4L5FL 5I6MA 3AREA 3ZHKA 1R5IB 1FFOA 1DQDL 1L7IL 3ZKNC 1KCUL 4NDMB 1IBGL 1HS6A 5JHLA 1I3GL 5DZOA 4R96B 4BFIA 4K4KA 3N1MC 3TGXA 1S7RA 3ML8A 1FYTB 3UL4A 5IJDC 1BVNT 3UGXA 5FW6A 4C56B 5SX5K 3EFOB 2GTWA 1VFBB 2VW6A 1BZ7B 3QJVB 3QC6X 1ZLSH 3BQUB 4JFPA 4JFWA 2IH3A 4Q4IA 1EAPB 4OCRH 3WJJA 4Z0XA 2MTPA 2Z4TA 4ZMWA 4KK8C 3OL2A 4NX0A 5T3ZD 4ODVH 1WITA 3KPNA 3RL2B 3MREA 4HLZG 3GK8H 4FZEL 3N9GH 4OLEA 3PQYE 1SMDA 4U1JA 4HETA 2DLTA 1N12A 1URIA 4UI2A 3OKEB 5KS9F 3RY5A 2LLGA 1FH5L 4Y5YC 4BXSV 1J9RA 1EDYA 5KBDA 1XGRA 4FQIH 5GIRB 3ARBB 1OP3H 1AIFB 4D9LL 4IIQB 1WG3A 1EFQA 1OT4A 1A7PH 3MRCB 5D5MA 3TCXA 5IHHA 1YNTF 1S9XA 1F90H 3QAZC 4NYLB 4AQOA 3MRMA 4CN6A 5JHLH 4OY9A 4RMWA 5C0BA 5E1AB 3BCFA 2OK0L 5FGBC 3V6FB 2ZX9A 3F12A 3VD1A 5GISH 1H3XA 4Z7VF 4MGXA 3DPBA 3ISWA 1IO4C 1PKQA 1LQBC 5C9JB 3ZQXA 5TF1L 5K93A 2WYZA 1X4XA 2CU9A 5J06A 3LPPA 1Z9LA 4YBQC 5HGBB 1JZ8A 2VYRE 1EHLH 4LPCA 4LSPH 1AGDA 1ODUA 1TT6A 4PRNA 3ZDXE 3EDJA 1LEIA 1ETA1 1FVDA 4NKIH 4F2MB 4M6NH 4XBMA 4JUSA 3MXWL 4CJ1A 4M7LT 4UQAA 3ATFA 4GW1B 4KZ0A 5IJBC 4POYA 1X5ZA 2EDMA 2VC2B 1OXYA 3RTLA 1BVZA 2HZHA 1MNUL 2ZUYA 1ZE3H 1RQ5A 3G5VA 3FQYA 5I1AA 1KXTB 4P57B 4I2XA 3N9GL 4E9LA 1SMAA 2DQUH 3GMOA 4OFKA 4LCWA 1W0VA 2F54D 2MCAA 3V52H 1XIWB 3TC9A 1BZOA 5LBSH 3O8XC 1F18A 3EZJB 4PWHA 4NPYB 3FHEA 3MV9E 1PLAA 1R5VA 1SM3H 1MCQA 4BUGA 5C07A 3FN3A 3GS0A 3WMPA 2YKKA 4AW7A 3BIKA 3B2MA 3FCSB 5DWUL 3BKMH 2BZCA 4JRLA 2H8PA 3VA2C 3GBNL 5DJAA 4NP4L 3EUUA 1AQKL 3FO0L 4F58L 3MLWL 1BVLB 5A7EA 2F53E 1UHVA 2V5RA 3QQ4A 1ID5I 5K5YA 1DSWA 4JQIH 1LO2L 1BQHA 1WCBB 2F7IA 4P2YA 1J11A 1EJOL 1TLKA 1LP9F 4Z7WE 1KXVC 5C6PB 4L2LA 4R83A 1PX4A 4MHHI 4FQCL 1TKWA 2EDXA 2O26U 4JDEA 4N5EC 4R90L 4YXLL 2LOEA 5T3XH 2DM2A 3PXLA 1CFVH 3P3YA 4ZPVA 5FOBA 1DEDA 2X41A 5C9KA 2ZAGA 1NTDA 5KYWA 4LBEA 1Y6MR 5FM5O 3QJQB 1HOCA 5ICXA 3G08A 4J12A 4LLWB 1U8LB 1U95A 3I3DA 2NY6B 2VRKA 4DK6A 1A8JH 1YDPB 2WXGA 1ZHBA 4JO5A 2UZXB 5DJDA 5HPOA 5E2VL 2Z8RA 2YJLA 1ITBB 2E7CA 2XWJB 3MV9A 4OGZA 2X05A 5IFAL 1JHTB 1MCNA 1IGFH 3GIZH 2BSSA 1NCGA 1CFNB 4KY1L 3RVVC 2A73B 2YO3A 2VNCA 3S3CB 4I85A 4GMTH 3QIBB 5HPMA 5IVXA 4M43L 4V11A 1OSZB 1Z9NA 3OAUH 4XP1H 1CN4A 4H88L 4RQQA 1UKTA 4PJ5A 1P5UA 3MLWH 4AYID 3QP3A 5J3HD 2E9JA 4RAUA 4JZOB 4PCKA 2EH7H 5IP4A 4YHNB 3VD0A 4XZ4A 1CI3M 3INUH 1HKLH 5DZ9A 4F9PC 5IQ9A 1U8QA 4MZ2A 2X12A 2QZQA 3OAUL 2CBTA 3WD5L 1XGTB 1BZ9A 2EH8H 2OA9A 3QSKB 2NYKA 2DM4A 3M17B 1DE4B 3MRNA 3BP7B 4F9PA 4ZG1A 4N8VB 3AS2A 1G0YR 3DMMD 2VDPL 3HI1B 3QDGE 4XPGL 2WLIB 1T6BX 1KYOJ 2YBGA 4LSSL 5E6ZA 2NXYB 5FA3A 4OCLC 2CK0L 2BMKB 2DJSA 2X2IA 3D2TA 3DVNB 4KFZC 3O4LB 2IANA 1V10A 5D1QE 1KB5H 4Z76A 3JWOC 4PRAA 4H0LC 3BLBA 4LLQB 2G9HA 5C0EA 4O2EB 2YA1A 2YZ1A 4IBWA 3D34A 5A16A 2H9GB 1NBYB 4RSYA 1UB5A 2P47B 2HJKA 2NY0B 1MRDL 1OTTD 2PPCA 3Q44A 4M7ZB 4XP1L 4U3HA 2XWZA 1RK1A 2Z4QB 2AJYH 3B56A 3GGWA 4BFNA 4YJZL 2BHYA 4UBDD 3K6NA 3M46A 2VRQA 2F1BA 1SNRA 4S1SH 5CUSH 1P7BA 1QFPA 4XNYH 4DUVA 5C0CA 1IAKB 3NSDA 3BPCA 4GT7A 3PQYA 3RIAK 4NZFA 3EJRA 1EZSA 1OOAA 4KK6C 3UC0L 4PG2A 4ZNEE 4ZJ9A 4FRWA 2QV4A 1FL6A 4W1TA 3SCMB 3FTSA 1NCBH 1RZGA 3B9EA 1HEZA 1HIMH 1CICD 2AJ3A 5INDA 1BJMA 3CHSA 2CKNA 4L2YA 1A65A 1BJ1J 2F58L 1CDIA 1ZA6A 4JN1L 4O2CB 1S3KH 3FSVA 2ZSWA 2IGTA 3T0ED 4WI6A 4YBQD 2AV1A 2FO8A 3RJOA 5BRZA 1S5HA 1T7VA 4KQ3L 3MRJA 3ILPA 4JB9H 4L8CA 1U93A 1XL4A 12E8H 1FLRL 4HKZA 5E8DH 1BBJB 3HC4L 5HVGB 3ALPA 3BDXA 3RB7A 4JKLA 1N59B 3EJYC 2DBLL 1A1NB 4NQDA 3IRZA 5D7LD 2GT9B 5J11B 3TL5A 2Z8SA 3B2UD 2XU9A 3I6LD 5BV7C 3GM0A 3KH3A 1LILA 2W91A 3LD8C 1T5KA 1B9KA 5CP3A 1QSED 4QO1A 4FLOA 1CLOL 1F4YH 1WGVA 3LZLA 4G1MB 5TDOA 3V10A 3WFZA 1QI3A 5HI3D 1V7NL 4PR5A 3VI3F 2RR3A 2HFFB 2LTQC 3CFJA 3TBWA 2VC2L 1IM9A 4NEHB 4Y4KD 3WY1A 4B96A 5B3JE 4OCSH 3LKSA 4XCEA 4A6YB 1RZJC 3QQ3B 2EVGA 2JELL 5INCA 2YEQA 1XDTT 1AXTH 3F83A 2FJHA 3QZBA 5ENWB 4U1GB 5JPNA 3KPOA 2LGNA 2LVEA 2Y24A 4QTHA 1UCBL 3KWVA 1BZDA 1JPFB 1ZK9A 3OJVC 4FKKA 4WU7B 4XP6L 3UAAA 2BVEA 4AYSA 3FU9A 5I17B 4AVHA 1BPLB 3ARGD 3CFBA 4DEUA 4FOMA 3WEAA 3ARSA 1A02N 5ITBL 1M9WA 4IBZA 2IDSA 4EIBA 2EVIA 2OAAA 1OKEA 4LAQH 5HGAA 1WFUA 4POZC 1JPEA 4JPQA 1W91A 2J8HA 4J3OD 3IMRA 3KNBB 3QEGH 3AQXA 1CD8A 3LZQA 4HGWA 4AT6B 5FB8B 1AD0B 5C6WH 4UCFA 1OB0A 4J1UA 2X4RB 1QYGH 4MAYD 3N85H 5ESAB 3M7OA 4PBVC 4DP2X 3C8KB 3KPLA 4U3SA 2XKNB 3NRQA 1E8WA 4HH8A 1BQLH 5IQ7L 4X7SH 5FUOH 1U42A 3LKOB 4F8OA 3E80A 3NH7L 5HYSB 1MHEA 5EC1B 1QAWA 3SD2A 2BDNH 2KHAA 1ZLUH 3A4DA 3F01A 4JM0A 1MIEL 4F5CA 2VSMB 1KCLA 3ECVA 2XLLA 3IDMA 4NRXB 3TESA 2JKSA 3ARDB 1PZDA 3K91A 3CFIC 5MEQB 2EEBA 3P0GB 3D2UB 2Q5BA 5EU3B 1XHHA 1J8HA 2O5NA 3UBFA 4N87A 3RAJL 4N86A 2XZQL 4Z7WF 1SEBA 2GTZB 1W72B 1ZHLA 4RETB 5DWUH 1FAIL 1NIEA 1ZE3C 4JFZH 4FA7B 2XRAL 2N0KA 3ATDA 4AYDC 1HX0A 2ADGA 1YJDL 2N4IA 3CFDA 4DP7X 2RA1A 2QGDA 1CK0H 4Q6IC 1DVFD 2JE8A 1T7XA 1NOAA 2CDFB 1NGQH 4BYHA 3RX9A 3H9YA 4WCYL 1S7TB 2Z91B 5F7KC 1BQHG 3HZMA 5I6KA 4MQ7B 3UMNA 2FNBA 2NXYD 3SKMA 1I8LC 3QUZB 4PJ5D 3FZUD 4DTGH 2ZXEB 2FUQA 3OHXC 2OSLA 2QFRA 2XG4B 4L1DA 2BIPA 2HVKB 3PFQA 4U1IB 2WJ5A 2CR3A 3VXQA 4NHUA 3SDXE 3GJFA 5D4QA 2ED8A 3QXDB 4IRZA 4NZTH 5MI0B 3HZKB 4AZ8B 1P1ZB 5DMKB 1MXGA 2RCSL 2VMJA 3PABA 1BQKA 5JW5A 1DBML 5GGTH 4LL1A 3UX9B 4P2OB 2QEJA 1N0LB 4TVSa 2YSSA 4KK5C 5B1JC 3SD5A 1QLEL 3BKYH 4XMTA 2OR9H 4JUTA 1U8HB 3EG9A 1UH3A 2AMGA 2ATKA 3EOYG 4XMWA 3QIBD 3EYQC 4H8WC 3LXBA 3EUDA 1DR9A 2DPKA 4I1RA 4EI5C 3IU4L 4NWUH 1J9SA 4G9FB 3TIDA 4OZHE 3B2VL 4I0PB 4OT1H 1OSYA 1G4RA 2JKNA 3WEOA 4N26A 4OCWL 2V9TA 3AU1B 3S8GB 1GGTA 4Y9FA 4XP5H 3MR9A 2NY2C 4H0IA 3B8SA 1Z5LB 4BQ9A 5CLYA 4ISVA 2NOYA 2QQNH 4IOFD 2HRGA 5G5DA 4IGBC 1QR4A 4QXTB 3QFJE 4L05A 2B1HL 1K72A 1DQMH 1R4XA 2C9XA 3P1VA 4MAYB 5M7QA 1TEFA 2PO6A 2QADB 4N0YH 4UIMB 4LDOB 2HFEA 2P7TA 4KDWA 1GOGA 1PG7W 5AYUH 4M8QA 3L4VA 1MVUA 1IM3D 5EEXA 3SDXA 5D71L 2PO6C 3T65A 4ZTPL 2OYKA 5F7EL 1ORSB 2Y2TA 3UZVA 2XV0A 4HS8H 1CGWA 3WV0A 1JXFA 3BFWA 3ABGA 4G9DA 4X4ZA 4L4TD 1Q1JH 2BWDA 2BSCA 3K3QA 3LKRA 4JCLA 5JHMA 1TYJA 3BKCH 3M1OA 5LB1A 3JVGC 3L2MA 3O4OC 1IGCH 1WUNT 4XPBH 3X3FL 5BRZE 1E9OB 1MFVA 3AAZB 1HXYB 1QNZL 2ZNWA 5AW1B 3KGSA 3LVEA 3NJHA 4ZFZB 3FHQA 2ICWI 1BQUA 2C34A 3CZFA 4LEXL 2NY4B 1NMBL 5EU4A 4HOWA 2ZCLH 1U92A 3CZJA 4MVBD 1YEEL 2YRPA 3KHOA 3U79A 1A7PL 2C1OB 1G5AA 4FHBD 4BXVA 1QWHA 3AUWB 2MCG1 5ADOL 3I3BA 2XYCA 4X83A 4GBXD 1QFUL 4KO7A 4XX5A 2QGBA 4RMTA 2H1LM 5KJRH 3K6DA 5IQNA 1OK8A 3TFBA 5IKCB 5FK9B 3BCDA 5CD3B 4LP4A 1MWAL 5H35B 5E08H 3BFOA 4CA4A 5H37G 1BYNA 4MZRA 3V4PB 3KWUA 3OPZH 1VFMA 1IKFL 2HUHA 5E4IA 1ZK5A 1IM9D 2ENSA 3MRQA 1YQVL 1OGTA 3PWPB 4HOZA 5BMFL 1GSMA 4JW3A 2BNRA 4XNZB 1Y18A 3RWCA 3OKKB 3MRIA 2BNQD 1IAII 2KMWA 4NRXA 2AAAA 4HFUL 3EDKA 4JFTA 4HEPG 3T0BA 4P46A 1GS7A 2PKDA 1A1MB 4G6ML 2M26A 2F19L 3OAZH 2YPLE 3BZDA 1ROCA 5EPMB 2OMXA 4HIEB 5GS3A 5J1AB 2XXFA 4GUQA 3GXUB 1QSEB 1NCCH 4PJ9B 4EBQH 3N1PC 3PHAA 4R26L 2ADJA 1QACA 2H26A 2YPVA 2ZAIA 3QIWC 3WO3B 5KYXB 1PJWA 2O5ZH 4GNKB 1RJLB 1MQKL 4G5AA 4GYBA 2JF1A 3T04D 1NDGB 4HAKA 5DJYA 4ODBD 3SEPA 3VFVA 5F7WC 4AC4A 4HK3J 2QGCA 1WTGT 4HUVB 1E9PA 4LVOC 4OLZL 4NENB 4LKCA 3MLRH 3MRBA 5LGJB 1PD6A 1M2OA 4AQ8A 5I17A 2XTLA 3DNKA 4JG5A 3ZTCC 5C09B 3VRJA 4NSKB 3LPFA 2JKRM 4GXVL 2LHAA 3VGBA 5I1CH 1SYVA 1DBKL 3BXNB 4NUQA 5F6HI 2J57A 4JO3H 3M6DA 2EDWA 4XP4H 4LEOA 3DUHA 3JZYA 2O5ZL 3ZYOA 4HPYH 1T6VN 1YN7A 1JYWA 4FQCH 4L3CB 5ESVB 1JF5A 5INCB 4P5MA 5I2IB 4M7KL 1SQ2N 1OP5K 2P43B 5I0XA 5I6OA 4K8RD 1QSFA 1SEQL 3VJ6B 4PRPA 2VC2H 3FU5A 1G7PB 2Q6WA 4BWTA 4B60A 3WNLA 1ORQA 5A3ID 2FX9H 1LMKA 1YHPA 1G7MB 1DSFH 5IROC 4W9EC 1S2EA 3RPBA 1TF4A 3KYAA 2VLJD 4LE8A 4IKNA 2NY3B 5EDXA 1K5WA 4HFWA 4I4WA 3MOAL 2V9QA 5DD3H 3EH1A 1SFDA 3MLXL 3QQDB 4PS4L 5EEUA 2XWXA 4P4KA 3VWJB 1WAAA 3BJ91 3H3PL 2F9BT 2BOBA 4HCFA 3BDBA 1I9JH 1MH5A 2DEWX 2VN4A 3T0EB 4WLCA 4QCIB 3BIAX 4FD0A 4AITA 2KUTA 4MMXA 4H44C 4N8CH 2N56A 4Q9QH 1HU8A 2NY0D 2QADD 1D5MB 1A9VA 2BSEA 1FFPB 4XE0A 4LPTA 2VOTA 4YIQA 2Q2EB 3BD3A 1BM3H 4MMXC 5F0PB 2BIIA 3PWUA 5JHDB 5F9WC 3FF8A 1IC4L 4D8PA 1CYGA 3O11A 4FP8L 4W68A 2H32B 3OXSB 4YNYA 1Z9PA 2Y2YA 3ET9F 5CBEA 4LPVA 1A3ZA 1FSKB 4HXBH 5FKPA 5A2IH 1AHKA 1AQKH 2YD2A 4GSUA 2OCJA 3CDCA 3RU8L 3FULA 3SGKC 1S9KC 3S8FB 2VMCA 3UC2A 2X0WA 1FL6B 2X40A 1CXLA 2G30A 4JHUA 5I5JA 4F24A 5DJ6A 3CFKA 2XTSA 2KH2B 3MGAA 1EGJL 2EDHA 3S96A 1CZ8L 3SGKA 2YXWA 2FYYA 3Q8BA 1BFSA 1K4DA 2DM3A 4X8JA 1TETH 1X6NA 1OAXH 4JFEA 1L9RA 3FQRA 4QRSA 2AQ2A 4P48A 4DP6X 1BECA 3BKCL 1CF8L 3QFJA 3QVAA 3QS2A 5A40E 3BO8B 5DT1H 3FQXA 4BA8A 1CLOH 1F4YL 3V6OC 5HY9A 3MOQA 3FO9B 3KLSA 4X4XA 2FLRT 1ZSDA 4XMUA 1KB5A 4XAWL 1KJ3L 1F5WA 2FEDD 2WQ8A 4NUPA 1L9QA 3MBED 4N3TA 5MEPA 1E6JL 5EIIA 1MFAL 3JV4A 4L1SA 3LEVH 1JK8B 2H9GA 5CZRA 3P2TA 1HNGA 1T0NB 2L3BA 3B1UA 4QCIA 5L0QB 1Z3GH 3DJTA 1THCA 2IFFL 3BAEH 4LOEA 1LEKA 5I9QB 3P0YL 3Q8CA 4G9FD 4MQTB 3KXFA 4JFUA 4NC1C 3OKMA 4ODXA 2IANB 5F9DC 4AJWA 2E46A 2N0MA 4KK6D 1VCBC 1Q38A 2WLIA 2CE6A 3ETSA 1ORQB 4LL4A 2NT0A 2QPDB 1UOLA 3FRPB 5FF6B 1JN6B 3V0IA 5HXMA 3FHAA 3CH8A 1I85C 2EYRB 3E9UA 3D09A 3MXWH 5CEZE 5IOKA 1MFEH 2XKSA 1HHIA 5HI4D 3AC0A 5ESVA 1X5XA 5IHZB 3NP4A 5KYNA 3T8VA 1TQVA 4JFEE 3GJFK 2VXUH 3CC5B 4F27A 2Z8WC 1XR9B 2CRIA 2NW2A 3GQFA 5BRPA 3T0EC 4HS3A 3T2NH 4KWUA 2Y07L 5GGVL 2H2PD 4G7QB 4RQQB 4MRCA 1ZVHA 3QK0A 3OAWA 4WO4A 1SJXA 4PHZA 2VZVA 2FLBT 5HGHA 4U1SA 3QXAB 3HE7B 3U1PA 3QXAA 4G5ZL 1OL0A 5EUKB 3V5KB 1KBGL 1S7QB 2I85A 4OD2A 3QRGL 5KG9A 4OBRA 4U6TA 4WO4C 4HF5H 5JMRA 2JJWA 1EO5A 2B8OT 2GJRA 3LS4L 4TVUA 1R3JB 2D7NA 1INQA 1OCRB 3PP4H 2H0PA 4OFYD 1IL1B 4Q14A 1SQMA 2WANA 1YEFL 1HHIB 4FLHA 1NGQL 3EOTL 1TTFA 3F58L 2NXZB 3P4LA 2VDRH 1QBLL 1MCSA 1MLCB 4P46B 2D7QA 1UWYA 3FB6B 5C3TA 3GMRB 5JLZA 4ZMPA 4WJG3 4ZXBD 5GS1A 1AI1H 3QIWD 3X1NA 3GWJA 3O8XA 3O2VL 5GSVA 3T6VA 4M1DL 1M2VA 4KKLD 2F8OA 2X7LB 3WMSA 3BPOC 3FT2A 3MRQB 4K3GA 4YGAB 3SO3C 4Y19D 3VGFA 1GJIA 4B9KC 4FI7A 4MA7H 1K9TA 1ZS8A 5E4EC 2ZUQC 4PRHA 3C9NB 4XNXL 4KMTH 3WY2A 2R7EB 2HRLA 4OGAC 2X09A 4GRWE 4Z77A 2ZX6A 1I4FA 3GSRB 1T0NA 3CZSA 3NJJA 3F6JA 1MJUH 3UPRB 1RZJL 5EBGA 3HG1A 2W94A 4PLJD 1I1AA 5GGRA 2WZPA 5CEYB 1A6ZB 2F15A 4AWJC 3HVDA 3MMEA 4GUPB 4POZD 2UXTA 3KS0J 3INOA 1SJEB 3QO1A 4M1DH 4FCAA 4G80B 5HY9B 2ZPKH 1FNGB 2AFNA 5KVGH 1I1AC 2WLHA 1PSKH 4JN1H 3O41A 2WW8A 1QD0A 1GL4B 2E8ZA 43CAB 4PJXB 2Q3XA 1DSYA 1MI5E 3HZVA 4PGCB 3K72A 1NEUA 5E70A 4KROC 4Z3TA 2FYYB 2OCFD 4OV5B 2X6AA 3G04A 1QSFD 3ZQ9A 5TK2A 3FQ1A 4XNAA 3S96B 4PY8I 3SE9H 4R6UA 1VZIA 4JPVH 5EC2A 1JNHA 4S0TD 4AM0Q 3QDME 4XO9A 3HNTL 5ECJE 3HEIB 5FA4B 5GRVK 3TCLA 4DK3A 1N6UA 1AG6A 3LZOA 5AUMA 4FXTA 1YEEH 4WI8A 2EVHA 2E0PA 3QUKA 4KI5F 3RNQB 4G8EB 1T21A 2ENQA 2GUOA 2ZOTA 2XRAH 4G6AC 4M7KH 2NY0C 2R2EB 4PJBE 5ANME 3PWUB 1LEIB 2N7AA 1MVUB 3HN5A 4TNWK 2NX5E 3DHJA 3VFTB 3BP6A 3VTTA 3N40F 1ZHKB 3T4AC 1D5MA 4JMXA 3THMH 4N2NA 4JK0D 4QXTA 3KPTA 1ZDQA 2APBA 1KENL 4YVNA 5GGUB 3FZUC 7TAAA 1MH5B 2OK0H 4NYLA 1S7SB 4OLZH 3TBSA 4MJJA 35C8L 4JR9H 4Z1PA 3HC0A 3HA0A 2CXGA 1NBVH 1YQVH 2MQ3A 3KAAA 5KVFL 5EA0L 1L9NA 4GKOA 4HFWB 5AL0A 2A0LC 4ZO9A 4QHKI 4N8CL 4UT7L 2OYMA 3CVDA 4MDIB 4A68A 2P8LB 3BT2H 1OE3A 2JFCA 5DVMA 5I76B 5EG6C 1A6UH 1FDLL 3CTTA 3KGRA 4AY0A 3FUHA 3HZYB 5I1EL 2VJXA 4UT6A 5IIEA 1IC5H 2P5ED 3NAAL 1KYAA 2QMJA 5E8PB 5ADOH 4C4KO 2NTFB 1W8NA 2Z1KA 1ADWA 2IWKA 1KENH 6PAZA 1CO1A 4RDBA 2HT4D 2YFOA 3BD5A 1BXVA 3GXFA 1DHKA 3T6WA 3V4UH 1RHFA 2YSSB 3U2SA 1SHXA 5F7MC 4YDLB 1B0IA 3OAYK 2FAUA 2B59B 2VDNL 3MRPA 4PPTA 4QKXB 5BO0D 2G75B 4KVPA 2YAOA 4U0RC 2R69A 1FYTA 2OULB 5FYKD 4ONOA 4APXA 3HHSB 2D3VA 1KG0A 3BVUA 3PP3K 5L0QC 3V6OE 2KZ1B 4RNRB 2EE2A 5LNDA 5K1JA 2GJ6A 4ALAC 1EEUA 2PWDA 3JTBA 5HDWA 3WS6C 3HMWH 3QCUH 2F7RA 3VI4E 4KZDL 4LKCB 3ZVVA 2J8UE 4NENA 3O3DA 3FSAA 4NFCA 5CWSB 1NC2D 3VFSA 4F8LA 4Z7AA 3VWKB 3U0TB 1A4BA 5HVWA 1HCZA 3CWGA 1TIUA 3T2NL 3RG1C 3WTXA 1PLGL 2YIHA 3IGUA 8FABB 3IU3B 3RWDA 3KWWB 1VGEL 4UT6H 1P2CB 2CD0A 4PJHB 1HI6A 4L9LA 3ULSB 2UVFA 2F0CA 5HYJB 4EAEA 2QGEA 4XWGH 2D03H 1GGIH 2G2RB 4OZHB 1MVFA 1KYDA 4MNHB 4F3FA 4G8IB 1UXSB 2I07B 3S9DB 3LQMA 2DYPD 4ZS6C 4PJ8A 2CBOA 3DO4A 4HDIB 3BSHA 1V3KA 1I7TB 1Q9KA 3FDWA 5DGRA 3S5LG 2WNXA 3U9UB 1Q0YH 1IRAY 1J48A 1CE1H 1LK3L 1NFDE 1PZ2A 1WAEA 3HBQA 3QUZC 2VLRD 4MDRA 4JN2B 5BQDA 4CU7A 4X98A 5HYSA 1SXBA 1EIBA 1JPTH 1U3YA 2K7PA 4FLQA 4XMPH 1JNNL 3BSZA 3KDMA 2BPBA 3ESMA 2ZUTA 1VA9A 3P30H 5EDSA 3T1WA 5TE6L 5IV2A 4JG0H 5IM7B 1VLXA 2H3KA 4LRNL 1R9FA 1RUAL 2GSMB 2W9DH 1KPVA 1GY1A 1WICA 2A6DA 5BZWA 2WXMA 4U2ZA 5EOCJ 3HE6D 4FQQB 4NQED 4ZD3L 1AZBA 1U92B 3VGAB 5AB2A 1NGWB 4H88H 2CZNA 4G1EB 4HEPA 2E9BA 2PW1B 3C8HA 3FCGA 5LJYH 4HT1H 1FUNA 2GJ6B 2LLNA 2Y6SD 3DIVA 4H1LB 2HPTA 2X89A 4ZFZA 4JY5L 4Z9KB 5IEKA 3H9HB 3HHSA 2EDYA 5F0JB 4QTHB 5I74C 1IBBA 3KPOB 5D7HA 5LCVL 3EH5B 1MDTA 4QDGA 2KYIA 3AWGA 4OQTA 5KSBF 3N41F 1MWAB 1BIIB 5JMOC 4R97B 3C5ZC 4PMEA 3GMQB 4EN3D 5J6SA 5FO9A 5D7IE 3UP1A 2V2WB 1UA6L 4MNQA 4TSBL 4P99A 1Z9OA 3WTYA 2HLFC 2H6UA 1H3PL 4M29A 1N67A 3CFUA 5E2WL 4MXQD 4Z7UB 3IAQA 4PLJC 1KBBA 1OLLA 2NY3D 3C5ZA 2EDEA 2PP9A 4MWFA 5B4MD 4HHAB 5CAYB 1MW1A 2VLME 3PE9A 4PTUB 2PO6B 3LMJH 4N85A 1DLFL 4HS8L 3FQUA 3GLAA 4MB3A 4ES8A 2CIIA 3ARFD 4I8DA 1J5HA 2JB6A 5E94B 2CNYA 3U6XA 4XBEH 3IFOA 1DO5A 3MLTA 2PCPB 4Y5VB 3CIQA 1BAFL 4OH2A 1KZYA 3CZGA 3L6FB 4NM8L 1RPQA 4Q0XH 3RVUD 4PRIA 4MJ5A 3FC8A 4D0CA 4NWTL 4XVTH 5FO2A 4LO9A 1B0RA 5EO1A 5BQ7B 2P8PB 3IDXL 2P3YA 1QWNA 1CL7I 1KIQA 1T1ZB 4FQ2H 2CLVA 3MLPA 3BUDA 4DO5A 1YEJL 1ZLWH 2X1PA 4C57C 3UJIL 3EG9B 2JH2A 2ZXCA 2DL9A 5FYLE 4RFEA 4BH8A 5K59E 3QPQD 4KY1H 1KSRA 4HYTB 4PJBA 2FTAA 1DVFA 2VAAB 3OTTA 4RGMC 4ALAL 5JW5B 3WFDH 1FO0B 4AZ8A 2WXLA 4Q6IA 3ARQA 3ISYA 5FYJU 1XAKA 3ESUF 4QMEA 3DVFA 1KN4L 3B4NA 4GO8A 4U1IA 5GRYA 1ZLVH 4XVUC 1QLEH 3BKYL 4PS4H 4S2SA 3FF7A 1D3CA 2XG4A 1BG1A 1I9EA 1RZKC 2CIKB 1JMZA 1NCAH 3C5XA 1C5BH 1ZXQA 2VZ1A 3QO1B 4Y4HA 5CINH 2A0LD 4Q8BA 2APSA 4FHKA 4J7RA 4FFWD 1LO3H 4Y8AA 5CSBA 5GGRB 2Z91A 1D5BA 4MCZB 3UG4A 1SJHB 4NZUH 4AQ1B 4OFQA 2XN9D 2E7HA 5F72S 1M57B 2YGNA 4NQQA 4HMDA 3SO3B 3I6KA 1AFVL 1CT8B 4YBLB 3QE5A 2NY1B 3B7UX 1WBZA 3MYJB 4HAFA 2QPFA 1WTLA 2HTKC 4Z76B 4IU2A 4K94C 1IAMA 1KF9B 4M9OA 2BP8A 1QFHA 2ORBL 2BMKA 3FT2B 1Q4NX 1T22B 3OZ9H 1M1SA 4QD2E 4BQ6A 3BPNB 1PY9A 1RZFH 5GSVB 1F4XL 5JW3L 1BFVL 4LP5A 4YXHL 3BEVB 5EORH 4FTVE 1FP5A 4XPTL 3TT1H 4N0RA 2PN5A 4XAKD 3BP7A 5GSRA 4PJCB 4MB5A 4N2HA 2X70B 1ID2A 1UB6A 3JV0A 4OB5H 4P5KA 5CJOH 2D4FA 2QPUA 3J7HA 2VDLB 2VWEE 2OZ4A 4AG4H 4X9HA 5CILH 5ESAA 3D0LA 5KANI 2Z35B 1AJ7L 5FB8A 2Y6TE 2P44B 4OIFA 4ZFGH 4LOUC 1I3RB 5I8CA 5J13C 4JDVB 4NN5C 1KCSH 4ZUTB 1PL3A 5ALBH 5PAZA 4D9RE 1ZT1B 2G2NA 4GIOA 1B2WH 1YEDB 3D85B 4Y89A 5CS7A 4XMPL 1WK0A 5F9JB 1I1YB 1IJNA 4W9GC 3D6GA 3CSPA 3ZDWA 4A7GA 1X5KA 3MJ7B 2HJLB 4JPIB 4ONFL 4RWHA 5TDPB 2K8QA 3S35X 1ETB1 3MODL 4RRPA 4ODSL 4EI0A 4MKMA 4F7CB 4JG1L 3FFDA 4CGTA 2EECA 5L6YH 1P69B 3QBTB 3V0HA 2NDFA 4UU9B 4KC3B 4KOCA 2VZSA 4ICWA 3AG2B 1KXHA 1WVZA 5ICXB 2FX7L 5A7BA 4NAMA 3NCYS 2KI6A 2E86A 4NQCE 3VYNA 5KYWB 3WJLA 3CX5K 5K39B 4G72B 4WUKH 4WJKB 4A6YL 2IPTL 1WFMA 5E6IA 1J9QA 2TAAA 2DMKA 5GJSH 3VDAA 2HTLD 3V6ZB 1X9QA 1Z9SA 4DERA 3FN0L 3IDJB 4NN6C 5DTFA 2E7DA 1MCOL 4QHNA 1DYZA 3UJJL 1QO3A 4Z7NB 4J3WA 3APMA 2J1WA 4M6ML 1BQHB 1C7SA 1WCBA 5HI3C 1YN6B 5I30L 3S35L 1JVKA 4F57L 2VO5A 1TETL 3WFHA 3DX1A 5AG9A 1MEXH 3MV8E 1WPCA 4OIAA 2AK4D 4JRYB 1EZVY 3HNSL 4MXWL 4ZFFB 2YA0A 3EO0B 3PV6A 1F2XK 3LDBB 4HOMA 3BIKB 1ZPLA 3MRGA 5CD5C 4GOSA 1R46A 3QEQB 5BUAA 2HAZA 2JCCE 2R0LH 3KW7A 4HC1L 4OTXL 2DYRB 1RZ7L 3P3UA 4KNUA 5E5RB 3GHPA 3TBVA 4MA1B 3V4UL 3K71B 1UASA 4KKNA 3LTVA 4JFEB 4MA7L 5I5RA 3NABH 4IBTA 2YUXA 2P24B 4X8JB 1XEDA 4ZS7H 3UTSA 3PL6A 4U1HA 3PGDB 4R0LA 1LK2A 4CSPA 5ES4B 4N28A 3WDIA 5EEYA 4NQCA 2NX5D 1IX2A 2EIBA 1JXJA 5L9DL 5DJ0A 3BPCB 3HBZA 1SN0A 1O9VA 1QRND 5D2NC 2LU5A 3O11B 3MACL 4Y2NA 4N22A 2OR8A 3Q8EA 3A24A 1VFAA 2EDRA 1P84J 2APFA 2ODHA 1QSEE 1U9KA 4ZMTA 4KO6A 3GS4A 1HHHB 4YIQB 3EBAA 1KGUA 1CD1B 2B3RA 3I6GA 1E8ZA 3RVWD 1A7NH 3EHBC 1WV7T 1QLFB 5L7XH 1CDBA 1BYOA 2J5LB 3HRZA 6CGTA 4Z18A 1KGYE 3LH9A 2AQQA 1KULA 5JIKA 5L8LB 4NKDB 4KTGA 1XFPA 4LASL 3MLVL 5D55A 1OLZA 3O6FA 2XZQH 1YMHA 2OXHB 4O2FB 4UYPA 2Y07H 5GGVH 3QZWG 4G42A 3BHBA 2H1XA 3D25A 1Z3RA 5DMJB 2ZCHH 1YY8A 5IBTH 3VAEA 4LPXA 1Z0NA 4JE0A 2RH0A 1RSFA 4JO4H 5F96L 2N01B 4XGZB 4L0PB 1IC4H 2WAQA 3GSVA 2LE9A 3VXMB 1INEL 3L5JA 1UJ3B 4DW2H 4KRMB 3BQUA 1URLA 1LEGB 3ARDD 2OR7A 4Z5RA 4AKPA 4DGYL 4JE4B 1EXGA 4RSVA 4YHNA 2UXVA 5EA0H 1SYVB 3FS9A 5F3BA 1NKGA 1HFUA 2FL5B 3SDAB 3ARRA 1O9ZA 4WWPA 3WKNA 1SY6A 2HJLA 2JKLA 2VDRL 4UQCA 1ZTXL 1NCOA 2OMVB 2D31A 4HUKB 4A63A 5IESH 1SF3A 3F7PC 3DI3B 3MRBB 1QHQA 1BMGA 4ICXA 5AL8A 1MVYA 3HPLB 3W11C 4X8XA 4OJAA 2BFVH 3X3GL 4NS0A 3SKJH 2BCKA 3F7YB 2V3EA 4OF6A 4QJ4B 3A67H 1JHTA 1N4XL 1TU2B 4PWEA 4IW4C 4UDUB 1I3RA 3PHOB 3M1BB 4M6NL 3VWJD 3B2DC 3NCWA 4YX2H 2XZAH 3CMOH 4PY7B 1OAYH 2H45A 2NY2D 3FONA 2E47A 4XNQB 1RJZB 2OL3A 4RZKA 3KM2A 1VJSA 2VXSH 3T0XA 5BS0E 2R9HC 3GFUA 3GIZL 2Z92B 4U4IA 5A2AA 5I73C 3J07A 3WSQH 1J1XH 5C7XL 1DVQA 2GCYB 4DOHB 3S5LA 4JZJC 3LB6D 4FEIA 5E95B 2IEPA 5EU5B 1DQJB 2MQCA 2YD9A 1CYXA 2YLHA 2VWEC 5DQDH 5F71A 1F3JA 5FUCE 1MIMH 2YRZA 3V6OA 1JZ4A 1NC4A 3N42F 1RIHH 1KN4H 3DX9A 1FRGH 1JGUL 5HYFA 2CO6B 4NQEE 4AL8C 2UZIL 4LK4A 1NGYA 4ETYA 2DWDA 1UWEH 5K9QG 4FFYL 4JFXA 5DQDL 1VESA 1J18A 5CD3A 4TTGA 2Y22A 2Z31A 5FCSH 4JKWA 3B83A 3EXJA 2NLJB 4ODWB 3K0WA 2OJZL 1AC0A 1RP9A 4JFOB 2D3LA 3FTGB 5ESQB 1CGVA 3WU1A 3AG4B 4V1DD 5C07B 1RZFL 3VXSD 4PQXA 4C83B 2C1OA 2HVJB 5BO1H 3IU4H 4NWUL 4S2SB 3RHWF 3TXAA 3I02B 1M6OB 3FO1B 3CZFB 5GJTH 2CHXA 3QNXA 1W0VB 3VD5A 1BVOA 4TQ8A 2DLEA 4OJDH 4YPJA 4J2XA 2EUXA 2DQCL 4I2XB 1VACA 5F9OH 4HQQH 1FO0A 4HK0A 2V4LA 3FU7B 4G43A 5F3HB 3G5VB 4HWEL 3AS3A 1PY4A 4K94H 5E6ID 4ZUUB 1RHHB 2QTVA 3I6LE 1AACA 3NCCB 4XMKL 3VDCA 2X4OA 4EJ1C 1G9EA 3DUSB 2OQJA 4JFVA 4Y4FA 2AV7A 3WL9B 3N2JA 2WK2A 3NQKA 1YEKH 4R4BB 4BK8A 5DA0B 1MCWW 3LIZH 4B9GA 4C56E 4NKOA 3ZDYF 5CO1A 4QRTB 4QYOA 1R3LA 3SPCA 3ATEA 1IGFL 1WH0A 5KAQG 1F8TL 1G0DA 2UZIH 5EIQA 4DGIL 5A6MA 2W0FA 4WUKL 3ZW3A 2P7TB 4E9VA 1C1EH 1J8SA 3CLWA 3DMMB 5CHNB 1UT9A 2XQ0A 3EHBB 3G5WA 3MLTB 2Q3ZA 3BDYL 3V6FA 2LV4A 3MNVB 4ANVA 2ARWA 5E94A 2CGYA 1I9RL 5C2BH 5BV7B 1AQHA 1OPOA 1A14H 1MUJA 4HIXL 4K2UH 5SWZE 3CZEA 5TDNB 1Z5LA 3C5JA 1A3QA 1XGRB 2EDTA 4ZXBA 1SMOA 3AT9A 2ZUXA 4HHAA 1BGXL 4Q9BA 3LCYA 2J3SA 4WWKC 5CSGA 3A6CH 3P9WB 1TDQA 1OAUH 4JY5H 1N6VA 4N6RA 4NN5B 3ZE0F 2WCGA 5J9PB 1QABA 5HYIA 4FXGA 4Y9GA 2WKLA 3L1EA 4Y19A 4BZ1L 4TQPA 3TFKC 1WZ1H 1E67A 4MNQB 4NQCD 4F33A 4HOXA 3OZKA 2RAMA 1A22B 5LBGA 1H3GA 3TYGL 1WAAF 2YMOA 4KO5A 4H7VA 1FC1A 3QEQE 4YHLL 3GMMB 4G8GD 2ZCHL 2HLFD 2P1YA 2DQIH 2ZSVA 2AXHA 1T0MB 4XWOC 3GSNH 4MXWH 2AK1H 2UZYA 4PGEA 3LSOA 2PYFA 3BVNB 1UH4A 5K59F 1QATA 2HVKA 2J20A 2KERA 3F5WB 3PNWB 4B7LA 3FUKA 5F7UA 2PABA 2YOCA 4BE6A 3PUCA 4YN3A 3W81A 2X2HA 1BFVH 4DGYH 3QC5X 1J8HD 4N5UA 2DMGA 3OB0K 3SYAA 2CO1A 2Y36H 3QG6A 5JOPD 4WTZG 1UQSB 1OAKH 1NINA 3DX0A 4NM8H 4GI8A 5KS9E 4TRPL 3I9AA 1GJWA 3BOVA 1JWSB 4K9JA 1F4WL 1T7ZA 1M3JA 4X98B 4PBXA 4PLOB 4HC1H 5F6HJ 3EJUA 5HI5D 2GY5A 3X11B 5GRJH 2J43A 4PJ5E 5FO7A 2HMID 3MO1A 4K9EC 4GPVA 2CCLA 1P6FA 5FKAA 5D7JB 4O51B 4QNPF 2WQUA 5EU3A 4I87A 2QLVB 5DLML 3RGVA 4OSUH 4D94A 4JHZA 5BZZA 3GNMH 1CXFA 3ZE1E 3ARDA 1GZQA 3EYSL 1OGPA 1SHWA 5D1XE 2GKIA 5GRJL 3SGJA 1R33A 4TRPH 4FJYA 2R2CA 1D5ZA 4BZ2H 1VRSA 2K6WA 5GQBA 4TQIA 5JXEA 1RJYA 3RY6C