2P80A

Solution structure of the complex between nitrite reductase and pseudoazurin from a. faecalis
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
335
structure length
335
Chain Sequence
b'TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Low resolution solution structure of the 152 kDa complex between nitrite reductase and pseudoazurin from A. faecalis by paramagnetic NMR.
rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 68
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2p80A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2p80A02
3AG3B 1URIA 1NPJA 2PCYA 5LDUA 1T5KA 2UXFA 5AFAA 4W1TA 3EH4B 2ZWNA 2W88A 1IC0A 1JZGA 3OMAB 3OMNB 3T6XA 2EIKB 1JZFA 2UX7A 3DIVA 3QJUB 2VM4A 1ET8A 2XX0A 1DYZA 3QQXA 1GS7A 1EHKB 2HX9A 1GS8A 3TA4D 1RCYA 1JZJA 4M3HA 4YSPA 1GR7A 3GXUB 1IBZA 2CCWA 1V54B 3NJHA 2YXWA 3X1FA 5A7EA 5B1AB 1KDIA 3BVDB 2MRYA 5IY5B 2B3IA 3NJLA 1E30A 1X9UA 2PPAA 3PXLA 5FC9A 4DP5X 3UACA 1W8EA 3V9EA 4E9SA 1JXFA 3UGEA 2GHZA 5E9NA 1A3ZA 2ZXWB 3KW8A 1J5DA 2IDSA 2RACA 3S3CB 2UX6A 3EHBB 1M9WA 1KBWA 4AKOA 1BXVA 2VW7A 1BQRA 2BP0A 2WO2B 3TASA 1AACA 3AZUA 1ET7A 4YVUA 1VLXA 5TK4A 4ZK8A 1FFTB 2VW6A 3IEAA 2WO3B 1BYOA 3ABLB 2ZOOA 4YSDA 5I5IA 2BWDA 2JKWA 1ASOA 3ASOB 3S3BB 1M56B 2IDUA 1B3IA 2PLTA 1OCZB 4KO7A 4G70B 4GYBA 4YSRA 3QJVB 2CUAA 3WIAA 3FYEB 4GY4A 1AG6A 2XV3A 2XXGA 4AX3A 4HCIA 2GC7C 1PY0A 3NJMA 4PCYA 3OM3B 2XX1A 2B08A 3N55A 1A65A 4JHVA 2MTAA 2R7EA 1GW0A 4AZUA 3QJSB 7PCYA 2Q5BA 4N4YB 2AFNA 1KDJA 1ASPA 1AS8A 4YSUA 3CDZA 1NWOA 1SDDA 4GP8B 4A68A 1PZCA 3UAEA 1NINA 4KNUA 2VM3A 3SBRA 1ILSA 5B7MA 1N68A 3HEIB 4NAJA 4CSPA 1NICA 4E9RA 4QKTA 2PPCA 1NIDA 5I5MA 1MG3C 3PAVA 2PPEA 2GB2A 1TEFA 3JT2A 3PCYA 5I26A 2GI0A 4WTQA 5AZUA 1E67A 4FA7B 2I7SA 3QPKA 5F7AA 1FWXA 1AS7A 2BW5A 1MZZA 1SJMA 4DP7X 4A67A 2IH9A 1SNRA 2X88A 3CVCA 2IDQA 4HZ1A 3NJKA 3FPXA 1PCSA 1R1CA 3X1NA 3X1BA 1AZUA 4ENZA 3NJFA 1AOZA 5PAZA 3N2JA 2YAOA 1IKOP 4X4KA 2XXFA 3FQ2A 1AS6A 4E9VA 3T6VA 1BQKA 1ZPUA 4DP8X 2BWIA 2HZHA 3IE9A 2DY2A 4A2FA 4YVNA 1E65A 2EILB 3MBWB 5AKRA 2Q9OA 2PP8A 1J9QA 1W6WA 3AY2A 3L45A 1WA0X 4W9ZA 2TSAA 3NT0A 3DTUB 4GP5B 1AR1B 1HFUA 5EHFA 3S3DB 2QPDB 1OE2A 3NP4A 3NJJA 4F2EA 1JVLA 4DPCX 2QDVA 1MZYA 1DZ0A 3OQRA 2CJ3A 2UXGA 2XYBA 4CSZA 1L9RA 3FU9A 2HRHA 2WSDA 1RKRA 3FU7B 2IDTA 4YSCA 1J9RA 1ZIBA 2GIMA 1XB6A 5I6PA 1SF3A 1PNDA 2HX8A 4DP6X 2IWKA 2X87A 4G7RB 3U25A 3D12B 4Q89A 3T6ZA 1AG0A 2P80D 4HCFA 2I7OA 3NSFA 3AG4B 2IDFA 2OJ1A 1HAWA 2BZCA 4AKPA 1KCWA 1WA1X 4MFHA 2JFCA 3PPSA 5PCYA 2A3TA 1F56A 3PLYA 2XVBA 2BO0A 2QDWA 2VMJA 3GDCA 3NJGA 4DP4X 1SHWA 1ET5A 2XU9A 3ABKB 4DP2X 4L0PB 3AG2B 2CAKA 1CUOA 1SFDA 1JERA 5F7BA 2BP0B 3NSYA 1NIBA 3FT0A 3WI9A 1J9SA 3FYIB 4PAZA 2FTAA 1TKWA 1BAWA 1JXDA 1W6LA 4G7QB 1ADWA 2YARA 2FWLB 1AZRA 4E9WA 4UF7C 6PAZA 4G71B 4E9TA 3FSVA 2VSKB 3EF4A 8PAZA 3PAZA 3V9CA 2EIMB 2YAPA 1NZRA 1ZDQA 1XMEB 2XUWA 2IH8A 1M57B 3WKPA 1MDAA 4YSSA 1AANA 5B7EA 1JZHA 2HRGA 1YLBB 2XV2A 1A4CA 3CZUB 4BDVB 1AZCA 1J9TA 1IUZA 3EH3B 4JHUA 1FA4A 5I6MA 1AIZA 2XWZA 4KNTA 1KV7A 4Q8BA 1OCOB 2DYRB 1BYPA 2DV6A 3TU6A 4K9JA 3BQVA 3WNJA 2IAAC 2VW4A 2BP8A 3HB3B 3QJTB 4UAHA 3H4FA 2H5UA 3FS9A 4BXSV 2AZAA 2E86A 3TBBA 3NYKA 2YAFA 3C75A 3PAUA 4YSOA 1KBVA 4E9XA 2P80A 4HCGA 1PZBA 1PZAA 1L9QA 1A4AA 1L9SA 1PAZA 3DKHA 4AKQA 2ZONA 3NP3A 1OCRB 1TEGA 1E5YA 1QNIA 1WA2X 2FQDA 4KO9A 4BK5C 1JXGA 2QPEB 3FPYA 2BZ7A 2LLNA 4KOCA 4EF3A 2PPFA 3H56A 1BEXA 2J57A 5ANHA 3OMIB 4P5SA 1AZNA 3IN2A 1L9TA 2J5WA 2DWTA 2H3XC 3NSCA 3FQYA 1ETJA 3ZIYA 2PPDA 1NIEA 1ASQA 1PLBA 4WKXA 1GYCA 1SFHA 4E9QA 3KW7A 1UATA 5B1JC 1X9RA 1GY2A 1V55B 5B3SB 5I6LA 1A8ZA 1JOIA 4KOBA 3FU8A 2QT6A 4DP0X 4TXVB 2HLEB 2BW4A 2XLLA 1BXAA 3X1GA 2J55A 1BQ5A 1JZEA 1NIFA 2CALA 3IN0A 5D4IA 2Y69B 2DYSB 3T6WA 1WAEA 3ASNB 4YSTA 1J5CA 4DPAX 2FQFA 3CVDA 4DPBX 1RZQA 3SBPA 3G5WA 5I5JA 3NSDA 3AG1B 4HHGA 4YL4A 3FU7A 6PCYA 2EIJB 4E9YA 4GXFA 2FQGA 1PF3A 3FSZA 3JTBA 3ERXA 2NRDA 4YSAA 5I6OA 4NB7A 1QHQA 2YAQA 2I85A 1JZIA 1AQ8A 3ABGA 2EINB 3WKQA 1CURA 3GYRA 2CBPA 2GBAA 4KNSA 1SF5A 2VN3A 2JXMA 1XB8A 4HAKA 4HHWA 3TBCA 3FSAA 4UANA 4AI7A 1PMYA 2TSBA 3X1EA 1OV8A 4F7KA 1EZLA 3ABMB 2FT8A 3X2QB 1AAJA 3UADA 4BWTA 2UXVA 2YAEA 1IBYA 4P5RA 2FT6A 5I6KA 5D4JA 2PP9A 2UXTA 3NJNA 3CVBA 4YSQA 4G7SB 4JKNA 4HIPA 3T9WA 4A2GA 1KGYE 2H47C 2YQBA 3IBOA 4BWUA 4F2FA 1E5ZA 7PAZA 1OE3A 1AZBA 1WS8A 3ZBMA 5I6NA 1QLEB 1TU2A 3OD3A 2J56A 2YAHA 3S8FB 4A2HA 1ID2A 4KO6A 3SQRA 3S8GB 1MG2C 1PLAA 3ZX1A 1L9OA 1ZIAA 4BXVA 2OCCB 2YAMA 2DWSA 1OE1A 4BDVA 3EH5B 1HAUA 2PP7A 2W8CA 3RYMA 1CC3A 1XB3A 4A66A 1PLCA 4QLWA 1ZV2A 4GP4B 5B1JA 2YXVA 3FSWA 2R7EB 2FQEA 3NJIA 1SHXA 2GC4C 3QJQB 1PNCA 4YSEA 4A2DA 1NDTA 3H4HA 2GSMB 4A2EA 1KYAA 5D4HA 1CYXA 4DP1X 1GY1A 3CDZB 2BP8B 4RH4A 3CG8A 1SDDB 1A4BA 1BXUA 1KCBA 3WNIA 2IWEA 1L9PA 1GSKA 1NIAA 1ZDSA 1JVOA 4NERA 1OF0A 3MX0B 3WG7B 5B1BB 2VSMB 1CYWA 9PCYA 1NWPA 3ZDWA 5I28A 1OOWA 3UAAA 1GS6X 2AZUA 2FNWA 2FJSA 4N8UA 4KO5A 2FT7A 4DP9X 3T71A 1I53A 1NTDA 2IWFA 2AVFA 1WS7A 2HX7A 4HALA 4M4RB 2BHFA 2PCFA 4FAAB 2OV0A 2N0MA 2XV0A 1RZPA 1NPNA 5B7FA 1N70A 3SBQA 3UABA 5TK2A 4BWWA 3QJRB 1V10A 1OCCB 2Y1AA 1ILUA 2AANA 5B1KA 3AW5A 2HXAA 4G72B 3FQ1A
chains in the Genus database with same CATH superfamily
2O5XH 1DBKL 5MEPB 2E4TA 2ZAGA 1BVKA 3MLWL 4HXBH 3MBXH 5C0GA 4AGMA 5E8EB 2WAHA 1O5DT 2E27L 3BT2H 1CDCA 1IC0A 3KPSE 3TT3H 3UMTA 3OMNB 4GPVA 3CFMA 4PPTA 2WZAA 1Q9KB 3K5SA 3T6XA 4BZYA 3ZE0E 2EDTA 3GJFH 3WAKA 2YN5A 2NSQA 2VN7A 5FK9B 2B59B 3WEBA 5D1XA 1HVXA 1Q1JL 2DWXA 1TZOA 3QQXA 3S36L 1RLWA 2CGYA 2OJZH 4NENB 4K9EH 4R7DB 4U6HA 4XO5A 3B5GA 4NNPH 1OSZB 4YSPA 3LKOA 1THCA 4H26B 4H1LH 5HHPB 1T66C 3CPLA 4Z7NF 2NYYC 2AEQH 3JV4B 3KHOA 5BMFH 4H13C 1MCBA 3ULUL 2DIEA 3Q6GH 1RFDH 4HEPG 5HGGS 3GBLA 2H2SC 1HHGA 2IG2H 2VXUH 4AEIH 1KIQA 2WLLB 1R33A 2CUHA 2HT3D 2IFGA 2MFNA 2X4NA 4HIEA 4P9ML 3C6LA 5C0EA 2AK4A 5HYJD 2R1WB 3N41B 4JVUA 4JL1A 5JYMA 2AJ3A 3MLTB 2P28B 1LHZA 4X6BA 1BXVA 3ZZSA 1MFCL 1Z9SB 1MHHB 2WGNB 1WC7B 3QIWC 4XX5A 2WO2B 3L95A 4HJGB 3RIKA 1F3JB 3HG5A 4U4IA 2PCPB 3FBKA 3AZUA 2XZAH 3PFUA 5JLZA 1ZVHA 2A6IB 3I02B 2A38A 1YAIA 3VG9B 1VADA 2WO3B 4R4FH 12E8L 2IIJA 2W95A 1KSRA 4QMEA 1VGKB 1MLBB 3LZRA 3ASOB 5BRZA 4Z9KB 1ZT4A 1RLBA 3CFEB 5DD5L 1TPXC 4QY8B 1EX0A 1M71A 1G7QA 2Z1PA 4TUJA 2IH1B 1GJUA 2N1KA 4G8EA 4Q6IC 4S0TD 1IBGH 1PY0A 3RNQB 2CRIA 1DBBL 2A7BA 3LXUX 5J1SC 4NNXB 4U6VL 5MEND 3TGXA 4N2DA 5SX5K 3WFCL 2BJMH 3K71B 3P77B 1A1MB 2SEBB 4KJPD 4IRSD 5KANG 4CGTA 1ITBB 1UXWB 4X5WA 4XPHL 5E5RB 2BIOA 1BPVA 3HEIB 4K3EL 2Q20A 5D72H 4WFHD 1NIDA 2BNQA 2WYTA 2YBRA 4FMFA 3FRPA 2MNJB 3OKDA 2LFEA 1H3PH 1ZSHA 3P9WB 4GAGL 4L1TA 2EUZA 2IXQB 5HGAA 3H42H 3B2UD 4O2EB 3CUPB 1UVQB 3RWGA 5CCGE 3V79C 1L7IH 4JFED 1FZJB 3OHXB 4M4RA 4TTDC 4H20L 1CMOA 3D4CA 2Y06H 2P49B 1FH2A 2WYHA 3LNDA 4LVOC 2J6EA 4U4BA 5JDJA 5IB2A 2BC4A 1KB9K 1QVOB 5FGCE 4AL8L 4R96A 4K7FA 1AGEA 4RWHA 1R3JA 3NAAL 2P52A 5E9DA 2ZUTA 3GTTA 2EC9T 3BUIA 4UTCA 4AH2A 4S0HA 3ULUF 1HL5A 2AV7A 2R4SL 1TFHA 4E9VA 5CM1A 1ZPUA 2VR4A 3DUUB 1U3JA 1Y6NR 3U2SA 3O8XD 1VFBB 4JNXA 3GJEB 1IFHH 3L4VA 4L4VD 4ZYKA 1ZANL 4N2FA 5CJQH 2PP8A 1G7LB 4NNYA 3U1SL 1QFWM 1R17A 2PMZA 2Q7YB 2OZ4A 2FX9L 5H37G 3LPWA 5HSFA 1AR1B 3PYCA 4L9DA 1AQMA 3QWRA 2I25N 4GT0A 5I19L 4NC0B 4F2EA 4OLXH 4WGKA 4HVBA 2IMNA 3IXAB 2PYFA 1CLOL 3ARFB 5A3ID 3FU9A 2I9LB 4N22A 3U79A 2DIAA 1UWGL 2WCPA 5C07D 5CBEA 3WD5H 2MPVA 1N67A 2OXHA 1WBXA 1ZIBA 1WFUA 2IH3B 3JVGA 1N0XL 1U6AH 2WP3T 3S3PA 4DP6X 3BDYL 4MDJA 4JFFA 2MCPL 3QZWA 4G5AA 2GI7A 4J6RL 4OCNC 2BCKA 1RD6A 1HL4A 3TXAA 1P5VB 1HAWA 1RSFA 4W9LC 1I3RA 5IZ7A 5HDQL 3C6SB 1NAKL 2HB0A 2WSKA 3K8LA 3QUKA 3MV9B 4O4YH 3DYOA 4G5ZH 1RV6X 3I2CL 3PLYA 3R4DA 2XVBA 4XCYB 5LBVA 1ACCA 2AERT 4WCYH 4P4KC 5F1IA 5T1JA 2QSTA 3HRPA 4EN3D 4K55A 3OKEB 3KXFB 5CLXA 5FHAH 3H3BC 4AQOA 5J11B 2CAKA 3ZE1F 1JL8A 4KH2A 1UWEL 5FCUH 1NJ9A 4G42B 5JIMA 1SEBB 3AABA 2UVEA 1BP3B 3FT0A 1V5JA 1DUYA 4QTIL 1HSAB 4XPTL 3U36B 4NWTL 1MCWM 4WW2A 3UG3A 4H25B 1G7PB 4MD5A 1K4DA 2NXYB 4UF7C 1H9DA 2H6UA 3DROA 3KYOB 2X4QA 4GOSA 4PQXA 1HHIA 3FB5B 3BE1H 1U8HB 3LKPA 1GJWA 1BFSA 3FCBA 4FULA 1OM3H 3U6RB 3CHQA 3JWDC 1DANU 1JGUH 4NZDA 4HG4K 4LGRB 5JMOC 5CD3B 1PLGH 3NCMA 4DOHE 4BDVB 2NZIA 3CHOA 4W9GC 5A2AA 4OAWA 2WJ7A 3S4SB 2QVTA 1WFOA 1HKFA 3WE6B 2EUXA 1S8DA 4JHUA 2CKBA 3I6GA 1XGUA 4DEWA 2IGLA 4MWFA 2DQUH 3IDGB 1T7VA 3CN0A 4LLQA 1H3WM 3IU4H 1JF1B 4GRMA 1KTLA 1M6UA 1NMCC 1A1NB 3BSGA 3KPSA 4YJZL 1M05B 5D1ZA 1B6UA 3L2NA 3EJCA 3KCPA 3RDTB 4OF8A 3P0VH 2BY1A 2XWBA 3QWOB 5E6IA 1MHPH 2VZ1A 4KDVA 4U1GC 1EEYB 2ARWA 4HGWA 1J8HB 4X9HA 1T5WA 5MEQB 1N8ZB 1KTRL 3LRLA 4H8PA 4I2XE 2DIBA 2UZPA 2WB1A 4WU5A 5KN5B 4Y19E 5HI4D 3UAJD 1L0YA 1IAIH 2J8UB 2HTKC 3TPUB 1EPFA 3F12A 3TCLB 5FYKE 1PQZB 4PJ9A 4TPRH 3UTOA 5JQIB 1BVZA 3W9DB 4M1CD 5CLZA 3LRMA 1DVSA 5C09E 4ZSOE 4KUZL 2J43A 2VGLM 4U6YB 1NSNH 4OFIA 3NIFF 4XN9A 3HS8A 3CXHJ 4PYHA 5FO2A 1ZV5A 3F84A 4KKNA 1ZAGA 1TYRA 2PPDA 4YHIA 3DUHA 4JVPA 5FA3B 5FO9A 3E6FA 3M7FB 1NC2B 4JK0D 2XBZA 1L7TH 2CZNA 4P5TA 4HWZB 2LVEA 2A6KA 2HVKB 3HE7A 2WBJB 5L88L 3HB3C 3RBGA 3X13A 5BRQA 2IQAB 3QVAA 2YOAA 2G9HB 4XO3A 1NIFA 2V3FA 5D4IA 3OGCB 4PVNA 1QRND 2R39A 2C1PA 4YX2L 4PJ5B 1UZ8B 2CR6A 1GC1H 4XH2A 4MYPA 3MRIB 4BHUI 4LHUA 3NIDF 1F42A 2L04A 4C56E 4F7EA 4P2QB 3RFRA 1WWCA 1XGRB 2V9QA 4L8BA 2ENQA 1JV2B 2YN3A 3EYQC 1YYCA 3MCG1 4UOW0 2YC1B 3BPCA 2MTPA 4E9YA 4GXFA 4IOIB 2Y22A 1EV2E 3PV7A 2DI7A 2W9DL 4JZNB 1JGLL 4NPKA 3WFDL 4YSAA 2FX7H 1XO8A 4PJEF 5JW3L 5C0JA 1UM4L 1YEGH 2D9CA 4UI2A 2I69A 1PD1A 2CUMA 3ZYJA 4ESKA 2FH6A 1JGVH 4NPJA 4UNUA 5EEUA 4RMVA 2F8VA 3G6JE 4N1CA 1J5OH 4P9HC 5F9AC 4H1LG 4Q6YA 5K1NA 2F1BA 2AJYL 2KS0A 3TV8A 4FMVA 4BA8A 2VZ3A 4N3UA 3FFOA 4B96A 2YA2A 5LXGL 4BKLA 3VFTA 5LBSH 4GRWH 1HT6A 4KTDH 4S1SH 2XYCA 2GTWA 4JY5H 3AXIA 1TFPA 2NZ1A 2F18A 5F70A 3X11B 4XZ4A 3Q1SH 3V4UL 1XF4B 3DRTB 1DSYA 3DBSA 3L5XH 4JO1L 1E5ZA 1I31A 4ONGL 4Q6KA 1FIGL 2EKJA 3QRGL 1MNUH 3L3HA 4OSUH 3ZBMA 5E94A 4C4KT 1BQLH 2ZUSA 1KCSL 2XA8L 1G7MA 5DK3A 4PP2B 4DERA 1P7QA 4OZHB 4JKKA 4AE0A 4MMYA 5FOBB 4UTAL 1LD9A 1VFAA 3GSOB 4NN7B 3DYMA 1E27B 1P5UA 2W8CA 3KLQA 4CVZB 1T20B 4HWNA 3TVMA 4H2AA 4BYHA 1V3MA 1U9KA 2NNCA 3GSXA 1QSVA 4OFDA 1CCZA 3RURA 2GC4C 3U7WL 1EGJH 2DEXX 3H4HA 4GRLB 1DBAL 5D4HA 1JNNH 4F93B 2JJVA 4R2GB 3T4YA 5C70A 3H2PA 5K9KB 1KCVL 1KCBA 3CU1A 4MQ7B 4AYSA 3B9VA 1GSKA 3EBHA 3MRGA 4BCZA 3VXSB 1T6BX 4PFEA 3W56A 3QRBA 4JRYB 1O75A 1S9VA 1KEGL 2VR6A 3FQNB 3WOVA 4HU2A 1YEKH 1CGYA 1OOWA 3MV9D 4XCNB 3U6XA 1RJYB 4ZMZA 5AL0A 3G7TA 5HYEA 2FT7A 4I3GA 2AVFA 3FAWA 1PD6A 2EP6A 1UB6B 1AGCB 3PXHA 2VLMD 4I87A 1FG2B 3KXFD 1IC4L 5LNEA 4FAAB 2XZQH 4TUKL 1ZS2A 3D48R 2Y36L 4O00A 1NKGA 1IGYA 3QEGH 4NX0A 1CGSL 4V2CB 5BV7H 2VQUA 1G9MH 3AUVA 2ZXGA 2NX5D 3QR2A 4XN7A 5TK2A 1U8MA 3D3VE 4UDTB 2MCMA 2R4RH 2X1OA 1MF2L 5B1KA 1CDUA 3WN6A 4G72B 4TL5A 1KV3A 3L4YA 5LDUA 2AJSL 2NXYD 1ZHBB 3ARGC 3MBWA 4UQ3B 3WTVA 3MOQA 3VI3F 1FVEB 4UILL 3EH4B 4FFYH 2ZG1A 2AC0A 3QIBC 2KHAA 5KVGL 3WTXA 1W8OA 2NXZB 4KZEL 3STZA 4KJQD 3KG5A 4FKKA 4MXVE 1BGXH 2LAAA 1AP2A 3BUYA 3E9UA 5EZJB 5DJ0B 2YSSB 3IDNB 5B8CC 3BKCL 1KXVA 3H54A 4FXGA 2EO1A 1HYRC 1RHFA 4PWFA 1JZJA 2ADYA 1C08B 1XGTA 3Q9PA 1YN7A 3E3QE 5ACLA 3OB8A 4FJ6A 4MXQD 2LABA 4Y2DC 1SYVA 1N0LA 4MVBC 5F1SA 5IV2B 4JN2B 3RDTD 1YAZA 3SQOL 4Q9BA 1MIML 3TFKD 3RWCB 2G75B 2PPAA 3QHTC 1RHHA 2K0RA 4FRWA 4DP5X 4R90L 3EDJA 5GS1A 1IGFL 1QLRB 3B2XA 4IBSA 3STLA 3BKYH 4WK0B 1PX3A 4E9SA 4XPBL 1XR8B 3MLPA 4DZ8A 2W0PA 1S9YA 1A3ZA 4RX4D 1DDTA 3Q9QA 4F3FB 1HQRA 4TTGA 2L7QA 5I1DA 1DFBH 1UA6H 3VXNA 2A77H 4D0BA 1QSED 1GAFL 5DZAA 4HOMA 5GRUH 1EVUA 2Z35A 4HJ1A 4AKOA 2QFPA 4WJ5B 4W4OC 3GSNA 4W9HC 2EE6A 1OAZH 3EYUH 3VWKA 2IQ9H 2OMVB 4F7CB 1DSWA 5AKSA 4XOAA 4IMKA 5EWIL 2OSLB 5KW9L 1BZDA 3MO1A 1YEHH 1IM3B 3AWEA 4OLYH 3HG1B 4I2XA 1L5GB 1R5WA 1JZDC 5C0RH 5EUOF 1KLUB 3PIQA 3T0XA 5K9OA 2AABH 5HHMD 5I1GH 2HJFA 3CH8A 1BZ7B 4XBGA 1I7RB 1BV8A 1NC2D 4WFGE 3T0VA 1SLVA 3IGLA 2BIQA 4P3WA 5I5IA 1E6OL 3AU1B 4ELKA 2WBJD 1VDGA 3CFNA 2VLJE 4QHLA 4CN6A 2WXNA 5C09A 3QUXA 3JWOL 5ESQB 4ZSOA 5I1IL 3OR7A 4ABUA 3L2MA 4WI0B 3QJOA 3RWHB 4G6FB 1AYOA 1S5HA 3RX5A 4PJ5D 1DVZA 4M6OL 2QSCL 1AG6A 3BZFB 2J72A 5DWUL 4XN5A 4P2QD 1A14L 1E8YA 1J05A 1U92B 4LPYA 2CCLA 2CSPA 2YKLL 3INOA 4PRHA 5KBLA 4EO5A 3JV5A 3APDA 3US0A 3EOAA 3W2DL 2HRPL 43CAB 1L9MA 1JRHI 3FB7A 4HKJB 4OJFL 1NFIA 3TESA 2NUTA 1XF2A 5D2LB 5E0QA 3L4XA 3AREA 1ZHLA 2WWOA 3VI4B 3QT2A 4ZW3A 4PJGF 4LVHB 5E51A 5B7MA 5LQBH 2BHZA 3GDBA 4QHMB 4E9RA 1PPIA 4KK8D 4F7TA 3SKNB 2IAMC 4C56A 2EECA 4XCFH 1UM5L 3N40P 5I18L 2XPGA 1M6OB 2BP3A 4ZW7A 3JWNC 2HCZX 2CHZA 5AOKA 4ZFFB 2I9TA 3Q48A 5K33A 5GZOA 3N42B 2BW5A 4WK4B 4WWOA 3HG2A 5JORA 3VU1A 1T4KA 4DP7X 1MCIA 3QULA 4WEEA 2X88A 3CVCA 4IQHA 1ETA1 4G6KH 2F53B 1ZGLP 1DQJA 3G6JA 4C47A 2VUKA 1A02N 1J18A 1FORL 3M7OA 4PY7A 2VH5L 1Q72H 1FNEA 3GI8L 2CLZB 5HHXH 2NZ9C 2IPTL 4LSDA 4A2FA 3F65A 4YEEA 5J0BA 4O2CA 4F15B 5CEZD 4DUVA 4ZMOA 1KYOJ 1WA0X 5ACZB 5C08B 4W9EC 1SVZA 3ZSSA 3CXFA 5BVPL 2ISDA 4UT9A 5T1KD 1HFUA 4HBCH 4XPGL 1LO5A 1Y0LB 3S5LB 3TO4C 4DPCX 1PDKA 1Z5YD 1FVCA 2V6HA 3BW9A 2VITA 3V5KB 4XXCA 4S1QL 2OTPA 3QUMH 4DKEL 1RZ8A 1FCGA 2ESVB 2HRHA 1TTAA 4GRLD 2D3VA 4R2GD 2K3TA 3NQIA 1SY6H 1ZA3B 4HUWB 3VQMA 3APFA 5HYQA 2A74A 1ZA6A 1I4FA 3MREA 3UPRA 2JK5A 2JV6A 4GG8B 1W72B 4JRYD 4NGHL 5E8DH 5EPMB 2NW2B 3QO1B 4ZOCA 3AG4B 2DQDL 3OWEA 4N5EC 5E4EB 1KN2H 3L1EA 4P2AA 4PJIB 2QPUA 5GRJL 2CO6B 3RWJA 2Y7QA 1UWXH 4GBXB 4Y4HC 5F88A 3SYOA 4HS3A 4UM9D 4XC1L 4LU5H 4N26A 4MX7B 3GDCA 5TQ2H 4POZD 4X50A 2P5WE 2CO7B 5D9SB 4MJ6B 4Y9GA 3IFNH 5D2NE 5FYLD 1DDHB 4HIIA 4CL7A 4NDMB 3RTQC 3KLSA 5KANI 4M7KL 3CZGA 2VO5A 3CDFA 1A3LH 3HC4H 1A7RL 2ZX5A 4OFYA 4Z7UE 5ABZA 2ZE0A 3J2PA 4Z1PA 3FYIB 3H8NA 4Y5YA 1E8ZA 3KM1A 4LE8A 4U1LA 4YZFF 5KJRH 4G83A 3LV3A 3LS5L 4V11A 4UV7H 1ADWA 3FQTA 2JB5L 1CICB 1FL6A 5HHOB 1WGOA 4G9FB 2OTWB 3W5MA 3PAZA 2YAPA 4G80A 1ZDQA 4JFQB 1XMEB 3R1GL 4DW2H 4LPUA 1FCCA 2PXYA 4GI6A 4K23L 2NXZD 5AYTA 2C5DC 5H2BA 4CKQA 3BO8A 3X14B 4F8OA 3RPIB 3T8XB 1OSEA 2B4CC 3NJXA 3D3VA 2AK1L 1XAUA 1T21A 2QGCA 1I7ZB 2LU4A 3IS1X 5T1MA 1DVFB 3B2VH 1Q9LA 2SODB 3FT2A 1T0NA 1EEQA 2NT1A 4M00A 2R29L 2EH8H 2OMWB 4Q14A 3I9AA 3TU6A 5HPOA 3TBTA 2VW4A 1T5XB 1U8JB 1OF2A 2ILLA 2YRZA 5KVFL 1X7QB 1KC5H 5IB4B 5IP4A 2J25A 1R34A 5J12C 1FJ1A 1L6ZA 2OP4L 4NS0A 1E5AA 1F18A 1KT2A 3FT4A 4UZSA 1XQ4A 4L1LA 5I9QC 5K69A 4Z18A 5EU3A 5HJ3B 2Q8AH 1L9QA 4RFOH 3NZHL 1JZ7A 3NSJA 2GPZA 3UBXA 4ADGA 4O51B 4PJHE 3SGDH 3UZQB 3B8YA 1CXKA 1NCTA 4N2IA 4HIXH 1TLMA 4HS8H 3TBVA 3A4AA 3HRZB 3HE6C 2E27H 4OZIE 3NGBC 5CF3A 2WCSA 4LO9A 3QJXA 3UJTL 1WWAX 2LLNA 4ENED 4EF3A 5T33L 2RCSL 5DRNA 1RUKL 2BVOA 4WF7A 1XF5B 3DX7A 1A3RL 1JTOA 3D09A 2OYLA 3T04D 2Z3FA 5I2IB 2F15A 1Q1JH 3SYQA 1JWSA 4FD0A 2G60L 1JWUA 4QKXB 2BERA 4J2XA 1U8NB 3D30A 3S48A 3HG1D 1T83A 3CX5K 1EEZB 3T3ME 4PGDA 1AQDA 2AAAA 1Q9OB 3PWNA 4LLVB 4NUGL 1SFHA 3MDJA 4N2LA 5TDPA 1UATA 5B1JC 1KZQA 1AQHA 5IEKB 2HTLD 3P9MB 1H8NA 4R0LB 5FPIA 3ZK0A 4Z76B 3OSVA 2AS5M 2ZWKA 5MI0B 3U7YL 1UKSA 4E42B 1TNNA 2WIIA 4IK7A 4FQLL 5DMIL 5DMKB 3I50H 2M1KA 4G6FD 4JHBA 3VXOB 1HZKA 3WIHL 3VCLB 5AZ2H 5KOMC 3CWGA 4M7JH 1JBJA 1B4LA 3HZKA 3NCJL 1FL3A 3BI9X 1SN0A 3VSVA 3T3PF 1CDYA 1X5JA 4N8CL 2HT3C 5E2WL 3UYPB 1MFCH 2VLJA 3NSDA 3CVHL 1FAKT 1KXQE 4G8GB 4GAYA 4AGOA 3TWYA 4PLNC 3FW6A 2FHFA 3ARQA 1WTGT 4U49A 3TN0A 5IFHL 5D7IF 3EYFA 1JF5A 3GEWB 5DMGD 3DMMB 5IQ9A 3SDDA 3UC2A 3ULVL 3UPAA 5I6OA 3KLHD 1LE5A 5JXAL 1E4JA 2H26B 2FO8A 1DVQA 3MJ9L 5ESVA 2YD3A 1YDPB 4KXAA 1HJBC 4XNYH 1JHTA 4KV5F 2A9NH 5INDB 4RMBA 1MCRA 3CDGB 3CFIC 4YNYB 1WGVA 2DKMA 4J3XA 4P57A 4RMSA 4UANA 2F74A 1QR1B 4NT6A 2TSBA 3IS0X 3TBWB 1MW3A 1CXIA 3MJ7A 4YUEL 1EZLA 2E0PA 3KWVA 5F0LB 1GZQA 3VXPB 5JPNC 1JNLL 2XWXA 3MSPA 3P40A 3P4OA 5A16B 2F53D 3GB7B 4B6ZA 4BWTA 1UXSB 1XGPA 4F80A 1LP9F 2W07B 1MH5A 1DBBH 5ESAB 3A4EA 1OQXA 1D6VH 3NK4A 4WVRA 4BFJA 1D5MA 4U6VH 4HIPA 4HFWB 7PAZA 1YMHB 2DTSA 3WFCH 1OE3A 1TKWB 1WUNT 2WNWA 4LIQE 4XVOA 1T1ZB 1H3XA 1LEGB 2UZYB 5KZCB 5IK3B 1K8IB 3GS0A 4A2HA 2CK0H 1KENH 5C08D 1JK8A 2Y72A 5DQDH 1UGKA 2FEDD 1L9OA 4KDTC 3OG4B 3L3OB 4ABWA 4KI1A 3TCTA 4IRSC 4GAGH 2R59A 1GTNA 1CC3A 3IAPA 4AYMC 4NO3A 2WWKO 4LLDA 4OY9A 4TQPA 4KITB 2OK0L 1NGYB 4DCQA 1WO2A 2ESVD 2PR9A 3BH4A 3I74A 3INUH 5E1AA 4GKLA 5KSUB 4UCFA 3NTCH 4V1DB 3ASWA 5ANMB 3MODL 4XNQA 3B2UC 5IQ7L 4BZ2L 3NAAH 4D9RE 3G5YB 1GA2A 4X7SL 3OLEA 3QNYA 1GXEA 4FQJL 3VVVA 1DQQB 2OFQA 5C6TL 5I28A 1K2DA 5BNXD 1U8OB 4HXAH 3SDCB 1KB5A 3FUJA 1AGDB 1MFDH 2LAGB 3BLPX 2IPKA 3I3BA 4UT6H 4IS6B 3HZVA 3U1SH 3RZCC 2EEDA 3VRJB 4FZ8H 2C1OA 4JM2B 1V7MH 1INEH 4IIQB 3V7AG 3QR0A 4X5LA 3ECBB 2ZWSA 2ODIA 4LQFH 1AIFA 3IETB 4L9LC 1AXIB 1CLOH 2ZX8A 2HXAA 2DEWX 3CVIL 3FQ1A 3VH8A 4OZGB 4BZ1A 1CICD 3MLRH 4TNEA 3ULVF 5HHOD 1YVLA 3TNNB 5KSBE 2HKHL 1MRFL 4FQXB 4PRPB 2JKTM 4OQTA 4PV1C 2P5WA 5EIIA 1NFAA 5A3IC 4K2UH 4LB8A 1FYTE 5D2NA 3Q8EA 2VLLA 1S9XB 1NCBH 4J6RH 3OMAB 3QNXA 4KXZH 2D7TH 3FFCB 4B9KC 4Z7UA 2JJTC 5HDQH 1NAKH 1DVFD 4TULL 3E8VA 3PHAA 2Y1ZA 2MIZA 1I8KB 1OSPH 1GS8A 2R1YB 3KYMB 1FL5B 1YJDC 5I8CB 4HUMB 3SYPA 1F4HA 3EG9A 3NABL 4QJ4B 1MJUL 2O6CA 1MCQA 5CILL 2ZAIA 1SBSH 3FQXB 5ICZB 1XCXA 2MRYA 3UCQA 3IU3A 2ITDA 1LO0H 2V9RA 5AW9B 3MROB 4QYAA 4EN3C 1R0AL 2R0ZL 3CSBA 4JRFA 3SE9L 3WHE1 1ZCRA 3N44F 3MNZB 1W8EA 4XBEH 5EN2A 3WEXB 1RZJC 3AT0A 5D7SL 3MJ8B 5CN1A 2GITA 1L0XA 2W0FA 2QKIA 4Y9FA 3RWIB 4OUUB 5T3ZD 1MAMH 2FR4A 3CSPA 3O2DH 1G94A 2UV3A 3T4AA 1JV5B 1XIWB 5F0PB 1KBWA 2HWZL 2YQ3A 3K6SB 2ZKXA 1EO8L 1O7VA 5D93B 4JAMA 2RB8A 1IKNC 4URKA 3MV8B 2X38A 4NKOA 4PJHA 1KACB 5CUSL 3ATAA 5L4MA 2ID5A 5T3XE 3DURA 3TT1H 4JHAL 3ME0A 4OZIA 3WE1A 4H1LB 1BZ8A 2YMTA 4J3WA 4GB9A 5JDSA 1ASOA 4N1HB 4PBWD 3GXNA 3ZRSA 2VOTA 4FTVB 1HWGB 4AIEA 1F11A 1NMAL 1ZLDA 5BVJA 1CFNA 3W0WB 1H8SA 3A6CL 3QORB 1A47A 5LDSA 2VXSH 5KBMA 3UG4A 3REWA 4FXKB 2QTEA 1TYEB 3K5RA 1ORQA 1Q0EA 3VNYA 3E6HA 4HEME 1T3FB 3HFFA 4GKOA 1J1PH 5HI4C 1IFGA 4G8GD 4PS4L 4KUZH 4PS7A 3UAJC 3U9UA 4AZUA 4L4TB 1MCSA 4IK6A 4KAQH 3AT9A 3DMMD 3CDZA 1AKJA 4OTXH 5DJAA 4HYTB 1CK0L 3G5ZB 1JZ4A 1S7QB 1NINA 4ZMAT 1JIBA 4W9IC 3WXWH 1CFQA 5HYSG 5IQOA 4TQEL 1RVFL 1EUTA 1OTUD 5I1JL 5CEXB 5E6SB 1HI6B 2P24B 1U8KA 2EYRB 5DK2B 5EC2A 5L88H 5HGHB 5DRWA 3BGMB 4M62H 3VG9C 2A4EA 1G1YA 2MHAA 1KXQA 2H41A 4LEXH 3IJYB 3KLKA 3BUQA 5ETUA 1VACA 3O3BB 3ECVA 3PGCB 5BO1L 5F8QC 4YX2H 2EDWA 2Z7ZA 4DTGL 1XCWA 2OZ4L 2IDQA 2ZP9A 2GKIA 3ZR5A 2YQGA 1PCSA 3IJ9A 3OKMB 3ZYIA 5KYWA 2UY7B 4KMTL 4P5MA 4HJJL 4WI2A 3LB6D 5KJ4A 2YAOA 5HVWA 5HI3D 3PP3K 3NBNA 3CMGA 5I17B 1EVTC 5KZCD 4IEFB 1U2HA 1VESA 3T2NH 3QWQB 4FLOA 3QFJE 2E9BA 1U4EA 2YA0A 5F21B 2BFVL 4XOEA 3RGVA 3DTUB 3HBZA 4O58L 4KC3B 2AJYH 2MKLC 5EHFA 4JFOB 1OE2A 2A1WL 1KTJA 2QDVA 4OFKA 1MCCA 3OQRA 2VLRB 4GW5A 2WXMA 2F8OA 3AROA 5CWSA 3QQ3B 2X53A 4XXDB 1BD2B 4V1DD 5HY9B 4J8QA 4DO6A 1OPGL 5L2JB 2V17H 4L37A 5E6YA 3RWEA 5KSAB 4AITA 4HH8A 5EDXA 3IDXL 3HLAA 2R23A 4Q89A 3FCSA 1PU0A 4LPVA 2HVJB 3H7LA 4L5FE 2IDFA 4PV8B 4ONGH 1F58L 1FIGH 3SDCD 1S3KL 4OCRL 3QRGH 4UNVA 2VZSA 3ZL4L 2O5YL 5BUGA 3GZKA 4PJBE 3JVFC 4LBAA 1KCSH 2DYPB 2EDHA 2XA8H 4DKFL 3CH1B 1TF4A 1TZHB 1KJ2H 4TVUA 4JM2D 3QH3A 3VFMB 4XX1E 3MRPA 3P2DA 4AM0B 4P0DA 4YHLL 3EYOB 3MRFA 2X4TA 1F3RB 4GJTB 4BFRA 3ZMNA 1JERA 1X4YA 1A1OA 3NSYA 3L4CA 2JH2A 1ORSA 3MZTA 2CKBL 4J27A 5EO0B 3L54A 2Y6TE 3QFDB 2LR4A 2YARA 4FQXD 3D0LB 4PRPD 5DWPA 5F7UA 5E8OA 35C8H 4JJHA 1RZIB 4LCUB 5E2UL 1SEQL 2DWDA 2YS4A 2AP2A 4MXWH 3F7QA 4EXKA 1O6SB 4QF1A 3Q06A 2DQJL 4BRJA 1KGJA 3FFCD 3RILA 5GGTA 1N4XH 4BUHA 1YLBB 1XHHA 2AQ3A 1BPLB 2BMKA 3GBML 3VWJB 2LOEA 2FIKA 2ZWZA 2ATAA 1P4BL 2WLJA 3SPCA 4YXLL 3IM1A 1LEKB 1IAII 4IU2A 4D2NA 5KSBA 4YHOH 4OGAC 3P3TA 3DVNA 3V4PH 2BP8A 1A0QL 4TUKH 2Y36H 4PSRA 3FS9A 1FYTA 1CGSH 1J87A 4TSCL 4P46B 4UINL 1PFOA 3RVWD 4EUPA 1NEZA 1MRDL 3RQ3A 4MCZA 1TVBA 5FFOA 4U1NB 3ZQ9A 2EDYA 3QJFB 1I3UA 3G08A 5KAQG 1Q1PA 4I9WE 1BVLB 4KUCF 3MYJA 3G9VA 1BMZA 2J4WL 3FU5A 1G5AA 4AGQA 4GG6E 4ODWA 2VWEE 3UL4A 1XIWD 4HF5H 5KVGH 2KT6A 2NXYC 1XTMA 1UKTA 1OTSD 3C12A 4ZO9A 1RUQL 4E41B 5CSZB 1HL9A 5SWSB 4S1RH 4MMZA 3FK3A 2Z4TA 3I6LD 5ALCL 1XH3A 1G7JB 2RHEA 5ANHA 1YMME 5D7JB 3SQBB 3D85A 4N87A 4KJQC 3I3DA 4F24A 3FQYA 5JXED 2ZPKH 3EO0B 3ROLB 5FO7B 4W4OA 4ISVA 2XWTB 3FONA 4PJDB 3C5JA 1T03H 3SQOH 3VFNB 1KLFA 2HJLB 3O0RH 1MIMH 3UXFA 4U3XA 3B1UA 1AHMA 4H5SA 1HNGA 3QDAA 4ZS6D 4MXQC 4K0OA 5E6ZA 5IR1B 4URTB 2B15A 2BNRB 3BAIA 2F68X 4WW2F 4FTVD 3RDTC 1RUAL 1YY8A 3HAEA 1IBFA 3W0WD 3QORD 3TFKC 2ADIB 1LNUA 3ASNB 4F5CE 3CVDA 3SOBL 3T8VA 1H6EA 1R5VA 2B2XL 3WKML 4C4UA 3G5WA 3TZVB 5EFIB 5IJKC 2BY3A 2YGVA 1NGQH 5D6CB 2ZJSL 2X4SB 3HUJF 2QHRH 2FJGB 4L4TD 1QA9A 4LSSH 1RZKL 2JIXA 4KI5F 2EIJB 5EWIH 4DQOL 1ZWIA 3L17A 4DAGL 4FFZH 2FJFB 2C3XA 3SGKC 3ERXA 2WW8A 3IMTA 4PRID 4IJTA 1QHQA 2NYZA 4Z7VE 3F7RA 3ARXA 1C7SA 1AQ8A 5FA4A 3FMGL 3MRLB 3Q6FA 3SE3A 1O9WA 3GYRA 1DBJH 1RAMA 2NTSP 4HX1B 4Z8FH 5AWNL 4K3DH 3ALXA 3ZE0F 3IPEA 4HEMA 3ZO0A 3M88A 1ZS8A 3JWOH 5I1IH 4U3SA 2BSBA 5K39B 2KPNA 2FBJL 4P23A 3T77B 4UTBA 5DRZA 2DEYX 4ZQKA 3PU7A 5E5UB 2WBJC 3ZKXB 3X2QB 1T04A 3NRPA 4DHLA 2P9RA 4PJ8C 3UADA 3NPSB 3F05A 1OGAB 4JGUA 1QHOA 4YHML 4NQVA 2IBGA 2WQSA 4A2GA 2HRPH 4LCCC 3NK3A 1M7DA 3O3DA 1UYWL 1KGIA 2A99A 5TE6L 2CRYA 4OCXH 4XPFL 2V7HA 2BXYA 4NP9A 5IFAL 3M1BB 2V2TB 2B16A 1TJGL 3B6SA 2VERA 3GSRB 1INDL 4ZMNA 2OCCB 1UM5H 1OE1A 2AJUL 5DEGB 4MCMA 4DSYA 3VFOB 2L4OA 2XBTA 3LPFA 1R5IA 2VLRD 3N91A 3OMZA 4IMLA 2Z91A 1IQDA 4LF3A 5IW3A 4Y2LA 4KK8C 2DWEB 4R4BB 4LSUH 5IMKA 1BD2D 4QHNA 4JFEE 4R26H 4YXHL 1KYAA 1EHLH 3LRGA 4W9FC 3RP1A 5F1KC 5FB8A 3BIKA 4MD4B 4JREB 1NCWL 2C9UA 4GRWB 4Z5RA 5KSAD 3QFJA 3WTYA 5CP7A 5T5FA 3MR9B 5FM4A 4HPOL 3REVA 1L9PA 1ZDSA 5TPWL 1C5DB 4P48A 1BWWA 1N5AA 1MVUA 3HCVA 2JELL 1TZIB 3L4UA 3Q5TA 3T0EA 2VH5H 3WUWB 2I07A 4JDTL 4QHPA 4RAVA 5F7LB 1UQSA 3DX8B 3Q5YA 2IPTH 5IVXE 1XEUA 1LK2A 1L0PA 2DYPD 1IZKA 4PVBA 2DLHA 1WS7A 4KKRA 4L4VE 4OR1A 2N0MA 1RULL 1NEUA 4APXB 2XRAH 4N0FB 2XQBL 1N70A 3LKRA 3TNMB 4FQ1L 1MCOL 1UJ3B 1HH9A 5ECJE 2EVHA 3EO9H 5FKPA 1DVYA 2AANA 3IJSB 4N9GB 3AQYA 3DGGB 3SDXB 1MFEH 3K6IA 4NN7C 5I66A 1S7RB 2AW2A 3LQMA 2IDCA 3MRHB 3U30B 1T1WA 2YPVH 4UQ2B 4PJBA 1IMHC 3LZLA 3S96A 3VXRE 3RTQA 1FZKB 1OD7A 3OC5A 3FCTB 3KBHE 2O72A 1GOHA 3BZ5A 1A7NL 1LLAA 4D0CB 1EAJA 2V7NA 4GRLC 4NGHH 2C9AA 3DVIA 1U8QA 1DBMH 3J7HA 4R2GC 3VWJD 2DQDH 3F7LA 5LNDA 4B9PA 5E2VL 2NY3B 2E76C 4KTEL 4J3VA 1CLYL 3QI9B 2EO9A 5GRJH 5IQLA 1FPTL 2ROYA 3EGXB 1VFUA 1EHKB 3FO2A 4AJVA 4XC1H 4F7MA 5KVMC 3SO3B 4M48L 4OIFA 2F8XC 2CQVA 1U58B 1XF3A 2GFBA 2ZXEB 4F7PB 1HHHA 3X1FA 5CKGA 5A7EA 2WQAA 1VCBC 4AQEB 3IGKA 1P84K 4P46D 1DHKA 4RQQB 5DQJB 3F83A 3AFLA 3GSNL 3H85A 4ZZKA 2VTFA 3RNKB 2PTTB 1MUJB 1YEJL 4PLOB 1MCKA 4EVNA 4GMSH 5FC9A 4WHCA 5BV7B 2W80C 5K9JL 4MA8L 2OSYA 4OW6A 1XGYL 2JB5H 3ZDZB 3SDAA 3BAWA 2Z31B 5T8IA 3D08A 4JE0A 4RESB 4RSVA 4B3EA 1M9SA 3V6OC 5IHUL 5G5DA 3WFZA 4QEGA 3S3CB 2BVQA 3GXFA 5FYKL 3WMPA 4F58L 3AQDA 2ZSWA 5AVTB 2X42A 4L0YA 5SV3A 3LHAA 4QAWA 3O4OB 3BZEB 5LBGA 5FECA 4OZ4A 4Y5XA 3KYNB 4UB0L 5D7JD 2NXZC 4ZDHA 2MPAL 3U0PA 1AACA 4TQ8A 4U7KA 4GG6A 2PR4H 2WKLA 3QA3B 5FWQA 1JNHB 3VG0L 2XXCB 4ODXA 2VW6A 4TSBL 1A4KB 1IL1A 2VAAA 3MOAL 4YDKH 1NM9A 2YLHA 5A2BA 3U0WL 4Z3HA 4UWQB 1OXYA 3ARBB 5CINH 2BNRD 1M56B 3IRZA 3LNIA 3NZHH 2PLTA 3F62A 5ENWB 1YMMA 1X5LA 3SY0A 1UH4A 2CUAA 3KH4A 4TSAH 3VJ6B 4K15A 4GY4A 4BD4A 4LLMB 4OLWH 3ZDYE 3HR6A 3TZVD 1XL4A 5T33H 2RCSH 1RUKH 3HZYB 4RAUB 1A65A 3MLUL 1FGVL 2MTAA 2R7EA 3GRWA 1I1YB 4LVNB 1YEFH 1MQKH 4PTUB 3VTTA 2H9GB 5ITBL 3B9EA 2G60H 4LLWA 1T80A 1PZ3A 3OZ9L 4NRZB 4ENEC 5BS0B 1TQBB 4G9DA 4OLZH 2KQMA 2F7OA 5CHNA 3BWUC 2CHDA 1BFOA 1NC4A 3FQRA 1N68A 4LLYA 4QRPE 4F5CA 1NICA 1HSBB 2IOOA 4LCWB 1HDMA 4NUGH 3HS9A 4G1MA 4ONOA 2AQ1A 3SN6N 4XP6L 2C9VA 2WXJA 4AW4A 2CO1A 3T1FB 3U7YH 5JOFA 3QWNA 3GRBA 2Q8BH 3D69A 3IFOA 3MCLL 3TO2B 3ARYA 4FQLH 3WFEH 2R1XA 5JUEH 2JCCE 4IRZH 3LZFL 2HTLC 3KEDA 3WO3B 3QO0B 3HNSH 2QR0B 3FUNA 4N6RB 4LKXA 5G55A 3UCRA 3L4TA 3HPJB 3TTYA 4Z7VA 1OGAD 1NDMB 5I30L 1R1CA 4LEOB 4OD2B 5EBGA 5DLLA 4UT9L 1YEDA 3MRDB 1AOZA 1OAUH 1JUFA 3BVTA 5DYOB 4KHTL 4LCIL 3ZKQD 5BZWB 4QXWA 1C12B 3H1ZA 3IJHB 4WTZG 2BWIA 3RUGE 1AGBA 1G7IA 4GAAA 4DEPC 4YEFA 1DEEA 2VE6A 3ULVH 1EHXA 3GIZH 3MNVA 4HJ0D 1WZ1L 3DOIA 4OVVA 1VHPA 1LO3L 5JXAH 3K4AA 2ENPA 4XMVA 3K8MA 2KZ1B 3NT0A 4X7TA 3CFUA 2ITEA 3DPBB 1A7PL 1WQVT 5DK0A 5DMGC 3DXAE 4PWHA 1B4RA 4CDGC 3KLHC 1KIUA 2F19L 4LVHC 4EAEA 3C60D 4J1UB 3IF1B 2YWYA 5FW8A 1KIRA 1F4YH 4Q58C 1HOCA 5JHLH 4RA3A 4M7ZB 2VRAA 4NM4L 4FS0A 1CD0A 2EKSA 3BAKA 3IFPA 1RXLA 3K6OA 4J7RA 4YSCA 1OZUA 4AZ8B 2E7LA 4LPCA 1G6RH 3CC5A 3U25A 2WB7A 2A9ML 1AG0A 2OSXA 2IFFH 1CO1A 1G5GA 3QNZB 1U4FA 4RZCA 4K5PA 4NEHB 3L81A 3QIUB 4YL9A 3DIDA 3BGFB 5DJCB 1PZ5B 4AQAB 2P8LB 4JFEA 3TJEL 4X4XB 1IM9B 2X3BA 3PUCA 3AB0B 5I6XB 3HW7A 5JW4R 1UG9A 2EC8A 3N1MC 4AMWA 2QGDA 4F15C 1CF1A 1ES0A 2HN7A 4WKZA 2W0KA 3AGVA 2BP0B 4HUVA 5HHVL 2FEDC 3DV6B 2OK0H 2XQ0A 5EBLB 5GISL 3ZZQA 5HVFB 2V37A 1G7HA 3ILPA 5IVXA 2FWLB 2HJKB 3N85H 5M95B 3O8XA 4NKIL 3ABZA 2NLJB 3H2WA 3KGRA 1FE8H 3MODH 3QUMB 4L4VA 3MXVH 1UT1A 2K4AA 1OAXH 2YKKA 1DP0A 3Q7JA 4KRMB 2IH8A 1JK9A 4N8VA 5DHVH 1CT8A 2OXGA 5IW6B 2NY3D 3CZUB 4NM8L 3QI9D 4W6XB 1AFVL 2X0UA 4B41A 3QEUA 3X3FL 1E9PA 2EYSB 1CXHA 4OFVA 2ZCLL 1U91B 3QQDA 3VXRA 4I0PB 4IDJH 4KVNL 5E4EC 1YUHB 3N1QC 2H45A 3H9SE 3NFPB 1UOVA 1IGJA 3BWSA 2VDNH 2VLME 1CDJA 5ITFB 1NCGA 4NQXA 1OVZA 5DI8A 5CKAA 3QXDA 4P5KA 4E9XA 4Q0XL 3MJ6A 1CXLA 3ZSTA 3UJJL 4AGNA 4I3SH 1PAZA 3CVIH 5DHYB 1NLDL 4PVMA 1Q8MA 3B2DC 3W39A 1JPFA 4PTTB 1MJ7L 2HKHH 2NQ3A 3LH9A 3LTVA 4KXCA 4PG2C 1J48A 3B56A 4PCSA 4KO9A 4HC1A 1MIEL 5K5YA 1X4ZA 4DN4L 1CICC 3O9WB 4WY7H 4ZO8A 4L3CB 1UJTA 4U1MB 4F8TA 5IQNA 3KHQA 3SPHA 5C97A 4TULH 4DWHA 1P2CA 1SN2A 4HWBA 2WZ5A 1KXTB 3IJEA 3PNWB 2I60L 3LKNA 3WBDA 3PGFH 4C83B 3ES6B 1BJ8A 1DVFC 4TNFA 1F13A 3KVQA 5HYSB 5CILH 1F4AA 2DMHA 4DZBB 4C59B 4DK6A 5J56B 4YWGL 1B9KA 2EAEA 1WIUA 3RWDA 3IKCB 5ABDE 3DRQB 1CFSB 3OAZK 4MQTB 3FFDA 5EZOH 4F57L 5BXFB 4MCYB 2Z0UA 2ARJQ 2B59A 2J55A 4PREB 4J4PC 3O6LH 1J8HE 5EA0L 3CU7A 4NENA 3T6WA 3U4EB 3G3LA 1OSZA 3OX8B 4H26A 2Q7NA 4P59L 3PNRB 2ATPB 4PUBL 3VRLE 2HWZH 1J88A 1CF8H 2VN5A 3JV4A 1IQWL 1ONQA 3LZQA 4BGDA 1EO8H 3HRZC 4IBZA 1HU8A 4HCRA 5TTRA 5CJOL 2NNFA 3NH7H 3MLVH 3SKJL 3U4KA 3VXTB 2ITCB 2WLLA 4QXGL 3AWFA 5CUSH 3MOBL 3GM0A 4NZRL 4HK0B 3GO1H 2NY6C 2YAQA 2I85A 4P49A 4LCWD 5LAXA 3ABGA 4C54A 5HVHC 1CD1B 4JHAH 1WD9A 4XN8A 5FHBL 4BRVA 5ABAA 2GBAA 2HLFD 2R1WA 3WTUA 2N7BA 3AGWA 4HISA 2I26N 3A23A 2Y9RT 1JPTL 2NY1B 4MXVF 3KGUA 4XAWL 1C16B 4Y7OC 4HD5A 1JDCA 4HA1A 1KIPB 4OI8A 1BZ9A 3TV3H 4R0LC 5GPRA 3VA2C 3ARDB 2PCPA 3ZR6A 2V9UA 3P02A 4IBTA 3KR3H 4JFHD 4QRAA 3RAJL 2HG5B 3NCEB 1RUMH 1EDYA 2BOCB 4QRPA 5DD0H 3I02A 1IBYA 3VX0A 2A4ZA 4Z3TA 3VW3L 4GKZA 4B5ZA 3CVBA 1J7VR 2NY5L 3V0WH 2BIIA 3VUAA 2F61A 4CGUB 4XP1L 1LWHA 2YQBA 3IBOA 4PS4H 3WJJC 1VGKA 2XN9D 4YHNB 5JOEA 1KY7A 2XPYA 5AVSB 2JCCA 4GAFB 4N8PA 5I1CL 3QXVA 2J6EH 2ICEA 1MW2A 4PB9L 4OJDH 2D4FA 1GYVA 4NQDB 4WTWA 2IH1A 1DO5A 4UM8A 3DMMC 5AVYB 3N40F 2DWSA 3Q5OA 5GGVH 3IRPX 3M45A 5FF6B 2XFGB 1PLCA 1CXEA 1JFQH 4JGJA 1PG7X 1JXKA 3CK0H 4DVRH 3WHE0 3C8KA 4RDQF 4M6NH 2BX5A 1KB5L 2OMNA 3P77A 1IO4C 3RUGA 1BECA 1OTUC 5BO1H 1A1MA 5F1NB 3SPVB 1UT9A 4MJ5A 1E9QB 4HGMA 2OZ4H 3NRQA 4N90D 1JPGB 1UC6A 3FUKA 1PEZA 2OJEA 3P3YA 1SOSA 2EDDA 2NUPB 4JANB 3RX9A 1RL1A 3DXAA 3VA6A 3VFPA 1YQVH 5CR8A 2GY5A 5C7ZA 1E43A 4WNSA 3PV6B 2QV4A 5AW5B 2IGFL 2XWCA 3QIUD 1I1AB 5LB1A 3ZE1B 4LLUB 4YK4B 5IREA 1ZLUK 2AZUA 2CJUH 3DTDA 4BZ1L 3LB6C 3LEYH 3KVDD 2Z8RA 3OHXA 5TF1L 1IM9D 2R69A 5HI3C 3TYFA 1Z0MA 2X0VA 3MNMA 5IFJA 4KXZI 1QO3A 4Z95L 2R2BB 1Z9MA 3JSSA 1RZPA 2H8PB 4OU3A 4RGNE 4BJLA 1ACXA 1O6VA 2HUEA 5AVZB 4DVBA 1DR9A 3LN9A 4JKPH 4PBXA 4MAYB 5CGYD 1VEMA 1TTBA 1V10A 4WUUB 1BZEA 3L3OC 4JPVH 1LGVA 4TUOB 3H0TB 2GHWB 2FE0A 3MV7B 3GTVA 3WMSA 2ETWA 3HNTL 4IM8A 2ZUVA 3V6FA 3GJEA 4E0RB 1RPQA 3JWDL 4LEEA 3ZO9A 3HR5B 5HGBB 1G7LA 3VFGH 4P2OD 1UB5A 3FUEA 4OD1H 2W88A 3HPLA 1PIGA 3DOSA 4YFLI 3VXSE 4JRYE 2UY6B 2YMXL 1JZFA 4AC4A 5IB5A 4JO4L 2GK0B 4G6JL 1HK6A 1S3KH 4JPIB 1D9KB 1N7MH 3D9AL 3ARFA 3Q2WA 5DO2C 3L9BA 2VDML 5AG8A 5IMLA 4DKFH 1XZ0B 4I0PD 2RTTA 3UTSB 2NY7H 3HS0B 1EZUA 2W65B 4KPHL 2YD0A 2IH3A 1LL1A 1B3JA 4QRTA 1RK0B 3OKYA 3QBTB 4GMTL 1MCPH 5E24E 3BVDB 3UYOD 2VNCA 4BH8B 2VYRE 3V5DB 2GJZB 4JM2C 1HYSD 1FN4A 4IIQC 2NTFA 2CKBH 4MKTA 4DQAA 4WFFD 5F9OL 1A64A 4NSKA 1X5MA 4LPWA 1JWMB 1REIA 3BDXA 2AQSA 1K6QL 4XO4A 2ZF8A 3H9SA 5L4JA 5F7HA 2VCOA 5CCKL 3O9WD 3D50A 1A21A 3OKEA 4FQXC 1BMWA 2GUOA 5EEXA 2VT0A 3GBMH 2VW7A 4D8PB 1SXZA 3W9EA 1SEBA 2RAMA 1MCJA 3EFOA 3MRRB 4WWKA 3T65A 3X17A 4PYGA 3FOMB 5B21A 1A9VA 2AQNA 3U36A 1X5IA 2EDXA 4WFED 4H25A 4M3KB 3R18A 1O7SA 1RPKA 4XE0A 3OF6A 3D25B 3QHZH 5SWZB 2OI9C 4ODUA 2MKWA 1BYOA 1OAKL 2EDMA 4JQIH 4TSCH 4UINH 5HDRA 4Z7QF 5CD3A 1IAOB 1HQ4B 2DBLL 2W38A 4LNRA 3S4SA 1QEWB 3BWAB 4NKMB 4WHYH 5I16B 2WQWA 3QDJB 3RVWC 3BIBX 3WIAA 3ZE2B 4OFQA 4F8PA 3BRDA 3QCUH 4PR5B 1CDBA 3MMEB 4PJEB 3N04A 2BLFA 1A1NA 3OM3B 3QC6X 4R7LA 3P73B 4Z77B 1M05A 4Z7UF 3FHEA 4YHZH 3V5HB 2HMID 1CZ8L 4K8RL 1XIWC 5ALCH 2AFNA 1X6LA 3QWOA 3L4WA 5B38G 1N9PA 1K4CA 2APVA 4W6YB 1J8HA 3P4NB 1I9JH 1OTSC 1N8ZA 1X5KA 1RJCA 5D93C 1KPVB 4K7PX 1U8LA 1BA9A 1GGIH 4MMXA 2CR3A 1MREL 2D7NA 3TPUA 6CGTA 5F0JB 2PPEA 2GB2A 2NY1D 3PCYA 3ZYOA 1UFGA 3BSHA 3QJZA 4O5LH 3W9DA 4UUJB 5F3HA 5JXEC 3KLAB 4IOSD 4S0SD 5I8KL 2PW2B 3ULUD 3QPKA 1DCEA 4S11A 3LYRA 2NW3B 4U6YA 3SE4C 3ARDD 3HN3A 2OTUB 4A67A 2PCFB 4ZS6C 1M2OA 4NQEB 3FSOA 2PCXA 3WKMH 3KPNB 4GUQA 4ETQB 4JEGB 1OT4A 3BP7A 3QORC 4DUXA 1GW6A 1XR9B 2CG9X 1VF5C 4L2YA 4FXKC 3QUYA 1JGEB 3ARRA 3IGAB 2CDFB 4PJHF 2G9HA 1E65A 1YA5A 2Q9OA 4ODTH 4L23A 3OGCA 1CGWA 4LMQI 4U0RB 4NQDD 4L05A 4ZPTA 1UZ8A 4GLRH 5IKCB 3WS3B 3RL2B 3UTPD 4OZIF 3ZT5A 4GP5B 2QKSA 4EIZC 2ZOKB 3RKDD 4IGBC 3NP4A 4J3BA 3F7VB 1NBQA 2CJ3A 3DIFB 3GMLB 2YJLA 1GL4B 2YC1A 4IOIA 2EIZB 5F3FA 3EGSB 4H0GA 1KPRA 4U0QB 3T3MF 3VD1A 3AAZA 2YJQA 2ZP8A 4PV9B 2EH7L 1WCBB 5DJXB 4YHMH 2AJZB 1A7OH 3NCBB 4G7YL 2EYTB 4UOJA 1P4IH 1T1YA 3CLEL 1C1EH 3IT8D 4GQ9L 3DV4A 5E99L 1IGCH 5HGDA 3DTXA 3BH9B 3O2VL 3LHPL 2P8MB 4OF3A 1I1AD 4KK6D 4X7FC 4BQ9A 1EHAA 1L6PA 1UYWH 3LSOA 2OZNA 5TE6H 4OIAA 3KYKH 2VDQH 4UIKH 3V6BR 3CFKB 3GUFA 5IFAH 5JIKA 5EUKB 1JI1A 2V5TA 2CM5A 1S7XB 4TMPA 4PWGA 1S7UA 3ABKB 1QFWL 1F6FB 2AJUH 1RK1B 4GUPB 4HW6A 2WLIB 3EYSL 4MAYD 4ONHB 3IMVA 5GGTL 1ZLVK 5F7BA 4ZUSB 5C8JA 1JPSL 1QQDB 4JCLA 4OBSA 2WQUA 4WUUD 5IJBC 1XF4A 4FQPA 4UV4L 4AJYV 1FDLH 4H4NA 3MV7D 1QTYT 5I1HH 1EA9C 1A5FL 3PS6A 4YBHA 5I0YA 5F7NC 3VD4A 2A6JB 1GH7A 1YJDH 2J71A 2X2UA 4TVPL 4NFBA 4BSJA 1XTLA 3TONA 1JD7A 2DAVA 1V7NH 5TPWH 4X5XA 2B0SL 2XUWA 2FCBA 5EZIL 2F2HA 3WIFA 1ETZB 3BP5A 5IOKA 4JJ5B 1QBML 3FRPG 1T20A 3FKUS 1F02I 1OAYH 5KSAC 4PWKA 4D9QD 4Z78B 2MNWA 4K07A 5B39A 4I9XA 1E6JL 3IMUA 4XBPB 1RZJH 5KUKA 5DHXB 3UTSD 5FUZH 1OCOB 2VL5A 4K3GA 2VUYA 1QNZL 4EOWH 3G6AA 3BP4B 1KELL 1UASA 2J21A 2IAAC 2CO4A 2XQBH 5K9KA 5IBTL 4L8SA 5BJTB 4EI5A 3HMXA 4MQ7A 1HNYA 1JHKL 1KJ2B 3TWCH 5IJDC 4NJ9L 3VXSA 1KB9J 1V3JA 3NIFE 1LK3H 3WTWA 2Q3ZA 3CMOL 2G3XA 5I75B 3U9PL 3HI5H 3KE0A 4KZDL 2XCMC 2X6AA 5HHOE 4G9FE 1M2VB 5DDHA 1UB6A 5AYUL 2HA1A 3ETTA 3WS6C 1M1XB 1JYXA 3FPYA 5EUOB 1QD0A 3IDIB 2NNAA 2APSA 4LL9A 5HTSA 1BEXA 5D4QA 4G59C 4GO6B 3KPLB 3T5WA 1A6AA 3PL6A 4UDTA 2F5AL 1FPTH 3ZRCC 3CQFA 3D39B 4M48H 3IN2A 2DWTA 3VWJC 1NCNA 1QPKA 2C3WA 3CQQA 5LCVA 8FABB 1QAWA 1OO2A 1ZHBA 5SWZD 1OARH 4I0CC 4LARH 4UQ3A 1NIEA 1XD1A 5T3XL 2J1WA 3CSTA 4HT1L 1DQML 2OMTB 5DEZA 5CGMA 2WV3A 1MOEA 2ZSVB 4UQBA 3V4PB 1M1SA 3QZPA 1F4XL 1L0QA 3QZWG 1I7TB 5EZLB 1YEJH 3NCFB 1X9QA 4MA8H 2Q1EA 2YSSA 3A3YB 4U2ZA 4P46C 3QDJD 1XGYH 3OKKA 1JZEA 1GZHA 1W0VA 4PJAB 1OB1B 1A22B 4WHTB 2X6UA 1SYSA 5C3TA 5IQMA 2E9WA 4BSVB 5IHUH 1I7UA 4P3DA 5DGQA 2FD6H 3VTMA 5FYKH 1MKFA 4A7UA 4ZXBA 5IV2A 2PWHA 1GPOH 2L7UA 4JN2A 5DT1L 4PGZA 1QLEH 4ZX5A 5L7XH 43C9A 1QUNA 5ID1A 3RWCA 4UTBL 5C0BB 3WL9A 4CSTA 4ODVL 2X4RB 2BDNL 5KSBF 3X3GL 1ZGLB 4QYOA 1NPUA 5T5NF 4PRAB 3R7QA 1XH0A 1MSPA 3TBSB 1TPXB 4HPHA 1VA9A 4OT1L 4P99A 4DJMA 4N2EA 5CEYA 3PG2A 1JVKA 3F00A 1D5BB 4K94C 3CSYA 3MOAH 4EQ2A 3QYMA 1NBYB 3LN4B 3DVFA 1XB8A 1Z3RA 3FSAA 1E7VA 4WJ5A 3UZVA 4BM7A 3MPCA 2K9FB 1U95A 5IWLC 5AZEL 2FYYB 4OJCA 5TDOB 2OSLA 3BKML 3HNVL 3ZHNA 1I1FB 4HG4J 4KKQA 1IM3A 2GTZB 2V8MA 1L5GA 4P2RB 1FRGL 4LRIA 2BSED 1F0LA 3UC0L 3O11B 4R8WL 1FGVH 1UGNA 3S36X 1NDGB 5CZKA 2J6WA 3VYOA 3GS7A 5ITBH 2H3NA 3FTGB 4BK5A 5I1LB 1BFVH 4B9CA 3NZ8B 2Q6WB 5JA8B 3TZVC 4M1GH 5CAYB 5JIIA 3D2UB 3FB8A 2ALAA 2GW5A 3OLDA 3ARZA 3RWHA 4KO6A 5BUPA 5T5FL 3TA3A 4AJWA 1XCTA 4BXVA 4XP6H 3BZFA 5KUMA 1U92A 4OGYL 1GZPB 3MTXA 1P4LB 5IBUG 3MCKA 5FV1L 2Y4SA 1FVDB 1VGEL 1HZHL 1X5XA 1Z0NA 2YXVA 5DJ6B 4FLQA 5GHWL 1AMXA 3ILQD 3LZFH 2F58H 4GSRA 1NDTA 1KNOA 2IBZX 3GIVB 1G0DA 3LMJL 3NA9H 4AUYA 3WHXA 1NLBH 5MHSE 4WHYG 4I18B 4JO2H 1NKOA 1NFDF 4W9KC 3S34L 4QHMA 4RBPH 2YUVA 4UU9B 3MX0B 5B1BB 1QW8A 2EEFA 5DQ9B 5G2NA 3T2OA 2ZOLA 3HC2A 1M6OA 1HKLH 1Y7VA 5EDSA 1Y6KR 3NPSC 4JM4L 2BIMA 1B2YA 4MJHA 4CC4A 4IKIA 4A6YA 4EPSA 4GKSB 4ZFFA 1I53A 1ND0B 2CU9A 3QG7L 1LO3H 5GGVY 32C2A 2GBTA 2HLAA 1M42A 1YYMH 3FQUA 4ZNCD 1GGBH 5DUBB 2QPFA 4LHUG 2EDKA 4BWWA 2YPKB 3EGDB 3QJRB 2XWEA 3F85A 1U36A 4H0IA 3DYPA 2WXFA 2XQYK 1CFBA 2Q86A 3VYPA 4L3EB 3FZUD 2AQQA 3NCXA 4NM4H 4K3HA 4PRNA 4MHHI 1C5BL 1BWMA 5FDWB 3BJ91 3C60C 5FGSA 1T5KA 2WPGA 5ANME 4XP4L 4F92B 4NN5B 1G4RA 3GLAA 2VDRL 1I3GL 4NHUA 4FXLA 4Y8DC 4TM9A 3EKCA 1SOKA 3C9NB 1RH8A 1QFOA 2A9MH 3GSWB 1CL7L 4AYFB 2EIKB 3LRSA 2NY0B 4YO0B 4JREC 2VJ0A 5IG7B 4L3AA 3VQ2C 2UX7A 3S5LA 2DQ6A 2J8OA 1XL6A 3NZUA 2FB4H 3BHBB 3P0YL 1ZSDA 2H2PD 1Z3GH 2F0CA 3ALWA 3L48A 1RCYA 3MGAA 2GT9B 4JZJA 3MBEB 4X5RA 4XR8C 1I85C 4AQZA 2MEJB 1OAQL 2H7WA 4JFWA 1KTDB 3DX9A 4EI0A 3KNBA 5ALBL 3O3AB 3AU0A 2FSEB 4RLDA 2Z92B 3EZJB 5DS2A 1X9UA 4RMTA 4BFKA 3V0EA 3QO1A 4JFYA 4CBZA 3QPXH 1U3HB 1GVIA 2ADGB 4TYUA 1UJ3C 1WK0A 4GBXA 3QZNA 5JQ6H 4MJJA 3O6FB 2P1YA 4M8UA 4MCNA 4ZAKB 2CPCA 5E9NA 4QHUB 4MZ2A 5A43C 4ZX4A 1J5DA 3DX4A 3U30C 1DDHA 4KHXL 3ETBF 5JOPE 5DJ2A 5EEZA 3U6XS 1XZWA 2OYMA 3H55A 3NPZB 4ZNEE 3L5WA 1NMCB 2ZTBA 1QG3A 1DQIA 1W91A 3X3FH 5DRXB 3D39D 3H2QA 4K5LA 3QDGB 2ZCLH 4JR9L 1FAIL 2NY3C 2CDEB 3GSUB 5GZND 3CN1A 1XEDA 3QI9C 5HHOA 1RMFL 3TEUA 4G9FA 2P7TB 3O41B 3KWWB 3SO3C 2NDFA 4YSDA 1QSFD 5JW5B 1EIBA 4FLSA 1MJ8L 1Q9WA 4APQA 2JKWA 5IMMA 3QNFA 3T3PB 2LTQB 2YPLA 4PGBB 4KY1L 3UJJH 4R83A 3UTTB 5IJVA 1FLRL 2R2EB 1OGTB 1I7ZA 4WU7B 5C92A 5I0DA 2F1AA 4PJBF 3GT6A 5J57B 3OPZL 4G70B 3O6KH 4X4YA 5JHDD 1E7UA 2ADFL 2OMWA 3K4ZA 3U82B 5BV7C 3CZFB 3VD9A 4LSQL 1VEPA 2BVEA 1MRCH 1T5XA 4P04A 1EXUA 2EDFA 3U4BH 3A4DA 4B60A 1X7QA 4POYA 4IBUA 4FKHA 2XX1A 1SBBA 4N0RA 3WU1A 4PS8A 3S37L 2V5YA 5IHHA 3VFWB 4Z3FA 5A7BA 5C0BD 3H3PH 2Q5BA 3Q01A 4KMQA 1HIMH 3MV8E 3OR6A 4JUSA 2WAQA 2I60H 3CLWA 1CXFA 2X3AA 3UZQA 4AUJA 2F7RA 3O4OC 1P9MA 3AUWB 3SBRA 5C0CE 1DN2A 3ZTEA 4QLRA 2E8ZA 2PPCA 4HSQA 4L29A 4P8QA 4QT5A 5I5MA 3KPRB 2JCWA 1EFXB 3RA7L 3VU2A 4AE1A 2RBLA 1EZSA 5FYJU 3D6GA 1LP9B 1P7HL 4QRFA 3WFHA 1A6TA 2HFEB 1N2RB 2I7SA 1HXMB 3DETD 4ELMF 4DF9A 1M53A 2P42B 3FBQA 5JMRA 4MNGB 4P2RD 1GOFA 1SNRA 2P4AB 2VMCA 4P59H 4A39A 4LLVA 2X7LB 4AV4A 1JYWA 1HZLA 1D6EB 1E4WH 1RIUH 1NANI 3LKSB 3DJTA 4XAKD 2C9RA 1KBGL 2G3MA 3FQ2A 5LGKA 2AXGA 2DLEA 1XX9C 2R15A 1IJNA 3EOBB 1ZKAA 4DP8X 5CJOH 4XNBA 3D2UD 1A6WL 4H88L 3CZNA 4Y9EA 4JQVA 5DMKA 2Y7MA 2A83A 4QXGH 5LWYH 3VXOA 3Q2NA 3MOBH 4GG6F 4JRLA 4HWEL 1BQHB 4NZRH 2OA9A 4JZOA 3RE0A 3L45A 4LCYB 3H9HB 3FO9B 3PP4H 4HH9B 1U8CA 15C8L 1TQBC 5CIPA 4JL2A 4X6CB 4CMMA 1AY1L 4ZUWB 2HFTA 3VRIA 3R8BB 1HHKB 2QPDB 4XAWH 3BD4A 3TIDA 1MZYA 1WPCA 2B7DT 3CGTA 2XYBA 3ZKND 4ZOBA 3BC9A 2HLFC 2FLBT 1D5XB 4NP4H 4PGCB 3FU7B 4PJFB 2BS71 1X5GA 2WTPA 3IVKA 2IDTA 3DJ9A 3SCMB 2P44B 4XOCA 3RAJH 4XRCB 2GUYA 3D7PA 3UZEC 1FO0L 1R3LA 3SPGA 2H26A 1FNGB 3VW3H 2UZXB 3A6BL 4TN9A 2NY5H 1LE9B 3JQOB 4HCFA 2HFGL 2M2DA 3MRKB 5INDA 1SXAA 2JVUA 4LSTH 4YDVA 4MAUL 2IV8A 3ENEA 2APFA 4L18A 4Y1AE 5EMYA 4ALAL 3TBWA 1CVRA 1F56A 3RPBA 2EACA 3MJGX 4ZS7H 4PB9H 3MACH 1I8LA 3DDGA 4FG4A 5KYUA 2O5ZH 5JO5A 4FQIH 2ODHA 1MY5A 3GB7A 4G1EB 2XHNA 1K72A 1SFDA 5D70H 2R9HD 1CQYA 5ESAA 3FN0H 4HFWA 4L3ED 1YMHA 1KB5H 4M5ZH 4NCC2 5DJ8B 3RL1B 1BAWA 1NBVH 1TKWA 3WY4A 4ADJA 4BE5A 5LG6A 1T1ZA 1LEGA 3ECUA 5DZNA 4NQSB 4RWYL 1BD2E 1XCQB 4HHAA 2UUDH 1K8IA 2VXQH 4L48A 3CAFA 4WO4B 3IMSA 5EOQL 1W0WB 1BIHA 3LXCA 2XTJE 1QOKA 3MV11 1JS4A 2FIRT 2NY0D 4ZPVB 3F58H 5B7EA 1G6RB 3CBRA 3H7BA 1U21A 2BSSB 3FF8A 1GOGA 4D9LH 4JFDB 4PW4A 1S3RA 4TLUA 1WIPA 4YFDB 1ZHNB 5J4MA 2X2HA 1NGYA 1T0MA 2VRQA 3GMQA 5TF1H 5GJTL 1G9EA 4OQTH 2LFGA 5AAMA 3MBED 1EANA 3QIUC 4Z95H 1X44A 3BGFC 5ANMA 5KVDL 3RJDA 1E40A 3F7KA 4HC1L 1P6WA 2XJLA 1DJSA 1B4JH 1R9FA 1AI1L 2WXLA 1KOAA 3KZ8A 1XH2A 4LVEA 3AB0C 5I6XC 3KPPB 1KYUA 1YRKA 1PZAA 5KYNA 1WZKA 5GS0H 5H35A 2OLDA 5DSCB 1U3HD 1I8MB 2O6EA 3GSVB 1BREA 1N6UA 4HWBL 4BK8A 3FT9A 4WEBL 3HNTH 5CGYC 3SDCA 3AM8A 3O6FD 4KKBD 4UTAA 2G5RA 4ZAKD 3RY5A 3VGGA 4HIJB 2GSGB 4IS6A 5IUCA 3VSUA 4P2CG 2FQDA 3KJ6H 3VRJA 3KCWA 1JXGA 4PRDB 1N6QL 3JZ7A 3LPGA 3ECBA 4WJG3 4G6JH 1IVLA 2X89D 3QCTH 3IETA 4P2OC 5F7KC 5DHVB 1Y6MR 1E9OA 3D9AH 5I0XA 3QDGD 4FYSA 2CLVB 5B38B 4UT7H 4A2LA 1AZNA 5EBWA 3UIZA 5DXWA 5FM5M 1F8TH 3KBFA 4KPHH 3OZKA 2FEEL 1PZSA 2XZZA 1K5NA 3NA4A 4ZZFA 3D06A 1NCAL 3K2IA 1IBDA 4NXKA 5AOIA 4G8AC 3GI9H 3B7UX 5ADOL 4B7IA 2OCJA 4I0PC 3O6MH 3RI5K 1PFCA 5CN2A 4ZNEA 2VDNB 3UTTD 3UTZA 4HCRL 1N64L 4XHJD 4GQRA 5GXBB 1BXAA 1IC7L 4J6IA 5IVXF 1MCHA 3A4FA 3EJRA 5D1XB 2R1YA 2DQMA 1HYSC 1RJZA 1K6QH 1FL5A 3WLWD 4U6HB 5CCKH 3LKOB 2JJSC 1R24A 4AEHL 4PJCE 1EXHA 2EIDA 1F1GA 4FHBD 1E42A 3WY3A 4OM0L 5ICZA 2J1KA 4E41E 4F2MB 4B9FA 1ZD6A 2WBXA 3MROA 1E28B 4MAZA 5FGBA 3O9WC 2FGWH 5SWSE 4FYTA 4C55A 1IAMA 3BD5A 3N1FC 4L8CB 4TOYH 1HHGB 1UWFA 2LU3A 1KIQB 2CGRL 4OUUA 3ARTA 2X4NB 4HIEB 1KN4L 3HC3L 4BINA 2QGBA 5C0EB 3KPRD 1B0IA 1EFXD 4PJDE 3CXDH 3GBEA 1XIWA 2E7HA 5AAPA 5ICYA 2L3BA 4CRPA 5JW4N 4QHKI 4X6BB 2DBLH 1OV8A 3MV8A 3GJFA 1BM7A 4NWUL 1CGUA 2FT8A 5F2FA 4G43A 2HG0A 5C7XH 1A6ZA 1YQ2A 2H6PA 5C0CA 5JLZB 1FNSL 2PTUA 4F20A 2FT6A 4GIOA 5A1AA 2R0WL 1AQKL 4Y5VC 4BWUA 1EAOA 3ESPA 1KGYE 4QRBA 5FO8A 1UCBH 4QTFA 1QTSA 1IGIL 4K8RH 5I1KL 2FO1A 5BRZB 2Y1VA 4ABVA 2BHYA 2FHBA 1V3LA 4FQHB 3RU8L 2NR6D 3UBXG 2HMIC 3SQRA 4RMWA 4IOFD 1MG2C 4YE4L 1NCOA 4H0LC 1LO4L 1CE1H 2ZYHA 4PS3A 1F41A 1MREH 4TUJB 3A21A 5HPMA 1OAJA 1QLFB 6FABL 3CN4A 4M6ML 4BK4A 2WXKA 4WEUD 1O7DC 2JKRM 2V0AA 4KKPA 4LSVH 4GP4B 3ESOA 5IVZB 4UNTA 3ZTDC 3NJIA 1MAJA 2GJ6B 3QUGA 4XMPL 1NAMA 5GRZA 4PRBA 3SCMD 3WFBL 1PKQE 1S78D 3EJYD 1NCCH 4Y4FA 4KBPA 3ULUC 2I24N 2IWEA 3P11H 1OGAE 5ERWB 2BVUA 3ARDC 3SKOB 3CX5J 2BNQB 2CM6A 4Z3EA 4BSWB 3O2WL 5I0ZA 4BQ8A 3DC0A 3OKDB 4LFHD 5DK2A 3KWUA 5HGHA 1FQ9C 4AEFA 1H5BC 4LIQH 4Z0XA 1GGCH 3HHMA 4PMEA 3RWGB 1V8HA 2HX7A 4M4RB 4RDQG 4AV0A 5F7EH 2P5EB 1ZLSL 5FUCE 1UD3A 2ZOUA 3OAUH 4R97B 1ZLWK 4AVKA 3C6EA 1UENA 3DGCR 5MP6H 3ZIMA 5IB2B 5CZRA 3THMH 4R96B 2N4IA 2XTLA 1AGEB 2HSIA 5FW6A 3T8MA 5JZ7D 3C8DA 3OBAA 4YPGA 4GO8A 1USZA 4AH2B 3UO1L 4QRRD 4Y1AA 4M7LL 1QWNA 1T2QL 2G2NA 4W93A 2BRRL 4N85A 3AG3B 3RKDC 2FBRA 1NPJA 5J13B 1I3VA 2X1WL 3VACA 3AY4A 4ZYKB 2UXFA 2EH7H 4IHBA 4LCVA 1S7SA 4WO4D 4ZTOL 4W1TA 3ZKMD 4NNYB 1JZGA 5AW3B 2WWMD 3LXBA 5E9AA 5E99H 3F6LA 2VM9A 3O2VH 4JFDD 4X7DC 1KGXA 1OPOA 4HJSA 4KRNA 2JCCF 4MNHB 3WXVH 2OQJA 2PYFB 5F7DA 3QQ3A 4LGPB 1KGCE 1BD2A 3GXUB 5D1ZI 1I1AC 2E7CA 4KK6C 2O30A 1A6UH 5IGXH 2OXHB 3NSXA 4GSXA 4FNLL 5F9WB 1S7VA 4CN1A 1KDIA 3EYSH 1K5WA 2WINA 1BCIA 2FBOJ 3MLZL 4JVWA 1MCLA 1JPSH 4JFFB 2B3IA 1E30A 3TBYA 4MRCA 2IALB 4UV4H 3PXLA 1SQMA 3L3JA 4MAYC 1DANT 4F9LC 5JR1H 4K4KA 3QUKB 5AKTA 4PD4K 5GSRA 5D96C 1BEYL 2QBWA 1JFHA 2B0SH 2G2RA 1M9WA 5IF0A 2OMXB 4EUPH 2MMXA 1R3HA 4NZUH 4O9HL 4X6FA 2B1AH 2H0EA 4FEIA 1F97A 4AL8C 2DQHL 1E6JH 2E74C 4OF7A 1AMYA 5I9QB 1P7KA 4XCCL 2R0LL 1DUYB 4ZX3A 3CQPA 1KELH 3OAZH 4WW2B 4HLJA 1RZIA 2ADJB 4MD5B 3E8UH 1C5CL 3ABLB 5TQ0L 3DROB 1JHKH 2X4QB 1HHIB 5DZLA 3WO4B 3NGBB 5FM8A 5FYJE 1KCRL 2ZKHH 1F4WL 5D1XD 1Q0YL 4OAWB 1XBDA 4GYBA 1S8DB 2CKBB 5DHDA 3WEMA 1XGUB 3QHFL 4OB5L 2XV3A 4MWFB 4HCIA 5FWRA 1RZGB 4JPQA 4LLQB 2YOCA 3MFFB 4TRPH 3TF7C 4GRMB 5ISZE 1KTLB 5H4ZA 3KPSB 4PSPA 2FX8L 3PJSA 4LNVA 2E59A 5AD0B 4KXBA 5IOPA 2F5AH 3KCPB 1SLXA 2HFFB 3ZE0B 5DFVD 1ASPA 4YSUA 1ZGLM 2XWBB 3HAEH 1NWOA 1SDDA 5E6IB 1MELA 3S7GA 4AVHA 4MZIA 1XFPA 1RP9A 1I8IA 3UP6A 4HGWB 3L5IA 4YDJB 1T5WB 2XOTA 3VH8G 4ZO7A 4E5XA 3UX9B 4WU5B 5E4IA 5GGSA 3C6LD 5DA0B 5EIIG 4PJCA 3WENA 3D34A 3JT2A 4BCXA 3F12B 4I77L 1SM3L 2GI0A 5EN3A 5IBUB 5AOMA 1IGML 4PJ9B 1RPUA 4E41A 1NUNB 1U41A 2R29A 3LQZA 4FA7B 5SWSA 4FLRA 5F8RC 1D5IL 1FWXA 5TH2A 1AS7A 5D1QE 3I75A 1WEJL 5D7JA 3COOA 2YA1A 3SQBA 4HKZA 5LN8A 3QAQA 2G0KA 2B77A 2QADC 5B1CA 3NCYP 3EO0A 5FO7A 3VDCA 4YHIB 4PJDA 5IW1B 2WLYA 5FO9B 2XXFA 3KJ4B 2X6MA 3T6VA 4U1IB 4P5TB 4YAQA 4W4NA 4UTBH 3HE7B 5BRZD 1TZGH 1JN6A 2BDNH 3X13B 1K3IA 5BS0E 3CCHA 2PYEE 1ZVNA 3MUZ1 4OT1H 3BEWB 3VFVA 2ADIA 5ILTH 2C1PB 5JPNB 3HVDA 4XH2B 1NCHA 2AV1B 4LHUB 1BVNP