25C8L

Catalytic antibody 5c8, fab-hapten complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPAIMSASLGERVTMTCTASSSVSSSNLHWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCHQYHRSPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for antibody catalysis of a disfavored ring closure reaction.
pubmed doi rcsb
molecule tags Catalytic antibody
molecule keywords IGG 5C8
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 25c8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 25c8L01
3I6KB 4I3RL 4AG4L 1ZLWH 4UZGA 5DHVH 1INQA 4P3DA 3HI5L 3DV6B 4Z0BH 4TTDC 1AP2A 3Q1SH 2GJZB 5E2UH 5DSCB 3VFPB 4DEPC 1XZ0A 5KVDL 5ACLA 1G7IA 1CS6A 2YMXL 4M4RA 3L7EB 4JANB 2IPKA 2H32H 5EOCJ 1EEYB 3SOBH 3SGJA 5B8CB 4OIIH 4R26L 2AJ3A 1I1YA 2H9GB 4CVZA 1YDPA 4QY8B 3OKYA 4O9HL 1BP3B 1QFWH 3IDJA 4XP6H 2BNQD 1XF2B 1FP5A 2VZUA 4I2XA 1U8PA 3O41B 3RY4A 4KI1A 3IYLW 4OD1L 3ARVA 4MCYB 3HPJA 2F8OA 4QF1B 1I3GH 2VLRE 1Q9OA 2EH8L 3TBWA 4AIOA 1ORQA 3LCYA 3U0WH 1HILB 2YA2A 4MXVF 4NO5A 4CKVX 3LKNB 2PYFB 4QHKJ 2F54B 1N2RB 2J8UA 4A6YL 1NKOA 3JUZA 3WNOA 1IAKA 4HKZB 1MCFA 3OKDB 5I15L 1VPOL 1HZHL 2QQNL 1IRAY 5DMJB 4QTIH 4YDKH 2D4FA 2ED8A 1S78D 2QSQA 1IM9D 3BI9X 3MRIA 4LHUA 4PJ5E 4Q74A 3Q1SL 4R26H 4JFEE 5C07D 1TTFA 1UWEH 3GSNA 1RU9H 1PZ5A 5H35B 3ZKND 3SE8H 4HPOH 3MV7D 4ODXB 5BV7L 2E5EA 3VFRA 4OLZL 4OCRL 1FSKC 5FA4B 3C6LC 4FQ1H 4O58H 4YH6A 5C71A 2EDNA 5FYLL 2LU7A 1OSZA 4PV8B 3AB0C 1J9CT 4PJ5D 1AH1A 4BQ9A 3QR2A 3U1SL 4JKLA 1A6ZA 3D2UA 1Q0YL 4D8PA 3CMOH 5EO0A 4OZIE 3W0WE 4X6CA 1NFDA 3MLWH 4JPVL 3MXWH 1LILA 2GIYA 2KDGA 5C0EA 1NGYA 2DMCA 1C5BH 4F37K 5IQ7L 1UCBH 3VGHA 5JUEH 5CEZH 4MNGB 3BT2H 3MJ8A 2VIRA 5DVNA 2R69H 3OJDA 4N1CA 4QTHA 4EOWL 1P53A 4GXVL 4C55A 4HPOL 3DO3A 1XGUB 1NLBH 2P48B 3RPKA 1RVFH 3F6LA 4HKBA 3X11B 3F7VA 3QQ9D 1YMMB 3WS6C 2AV1A 4M61A 3B9VA 3VCLA 2IH3B 4B0MM 5HSFA 3GZKA 4JCMA 2NXZB 3VRLF 5FHBH 1PLGL 5T1DL 2ZSWB 3DX9A 4LPXA 2ZWLT 4XC3H 3NCYS 1LO3H 5A2FA 4RGND 3UBXB 2AI0L 3LVEA 4QTIL 5FO7B 4LLMA 1W72H 3RJQB 5CEZL 3QUYA 1ZOXA 5L9DL 1D9KD 4KAQL 5GSVA 3RA7H 4I3SH 5ID1A 5KG9A 4BZ2L 4YWGL 1F6LL 4JVWA 4F9LC 2HLAA 5K33A 1BZQK 3DRTB 5B8CA 3O4LE 3S36X 5HPOA 2WZPD 3GDBA 2VABA 4FMFA 1KT2A 1KPRB 2HH0L 3QDGD 2EICA 2CR6A 4WNQA 3PWLB 3RBGA 1ZT7B 2QJDA 3O41A 4I2XB 2OZ4A 1G6RH 2AJSH 2W1NA 2J5LC 3BH8B 3DVFA 4RRPA 3WFHA 1X5HA 2R0LH 2MPAH 3PGDB 1YN6B 1OP3H 3QIBD 3O6KH 2BNQE 2V6HA 2VYRE 3QNYA 4ONHB 4K23H 4HS8L 3QJHB 4LDLB 4NWTH 4Z7OF 4XNXH 3GB7B 3IU4H 1J11A 1KB5B 4XBPA 3WDHA 2PN5A 3BO8A 4APQA 5BRZB 5GGUB 3HUJB 1A3LH 4RFEB 2R1YB 4KQ3L 1LEKA 2V5RA 5DQJA 3UPRA 5FGBA 3IJHB 3VWJC 5DJ2A 1F4YH 3DX9B 2KQNA 1GHFL 2CLRB 5ID0A 4Z95H 4PRIE 5DK3A 4A2LA 2GSIA 5D1ZB 2AW2A 4K2UH 1IGFL 2P5WE 1F90L 5CINL 1PY9A 1P69B 4D0DB 1UC6A 1YQ2A 5HHXH 4XVJL 3O3AB 3GBNH 2ADFH 4G80A 1NBVH 4TSBL 4LDEB 1QFHA 2A73A 5C7XL 3F65A 4LRNH 2ADGA 3MOBL 2JKXA 2GK0B 2GUOB 3CVHH 1KLGB 3WKMH 4F7EB 3TPUA 2CJUL 3ARRA 1JNLH 3MFGB 2ZG2A 4LLUA 1VEOA 1PJ9A 1V3JA 3O3DB 3W81A 3QFDA 5C08D 1E6JH 4LCCC 4LSRL 1WLHA 1ZSDB 4PRPD 3C60A 4TN9A 1T3FA 4IOSD 3NN8A 4KHTH 5EU6E 1CD1B 4PJXB 5GQBA 2N1KA 1ZLSL 1CIUA 1MCJA 1NBYB 4LF3B 3TIDA 5EUOB 1KXQE 4MZ2A 4NO0B 5AD0A 1KB5A 4AZ8A 5JOPD 1GAFL 3RWJA 3MO1A 4X5LA 5INDA 1X4YA 2CGRH 1FL5B 4PY7A 2DKUA 1OGTA 5CEZD 1NMBH 1P5VA 1M7DB 5EB9A 3HS0A 5KOVC 2ICWB 1X9QA 3MBEA 1D5BA 4OD3L 2RIKA 5ID0B 1QFUL 3MLVH 5HGDB 5D1ZA 4JPKL 2KBGA 1NANH 4QHKI 1AGEA 2CKBB 3OAYK 5F3BB 4PJ7F 4P4RA 2Y72A 4PJFE 1QLRB 5ANMB 1YEHL 5E5RB 5TQ0L 3H3PH 4BK4A 3UC0L 5I1IH 3C09B 1BQHA 4ODUA 1EH9A 1KLGA 5DD5L 3WIIH 1NEZA 5IKCB 4LKCB 3UJTL 4EKXA 4DZ8B 4WUUB 4HKJA 1BQSA 1YEDA 5FYJL 1ZVSB 1BWMA 3O4LB 3KR3L 3BPNC 1JZ7A 1FVDB 4APQC 2CDGB 5F1IA 3RIAF 1JZ3A 1FDLH 4KHXL 1NBYA 3TWCL 4O2EA 4Y19D 4GRMB 3GSUB 4RFNB 1DQQB 2D4DA 2X7LB 4NN5B 1CD9B 5CBEB 3NGBC 1GJIA 1LEKB 43C9A 3MFFA 1T2JA 2ARWA 2GTZA 4NZTL 3T0AA 1JJUA 1Q8MA 1VSCA 3LD8B 1ZTXL 2C4FT 2PO6A 1JYVA 3QHZH 5EO9A 1ITBB 3FN3A 2JCCA 5I19L 3S88H 4PS4L 3L5HA 3BKJL 5CD5C 2YPLB 5J06A 5ICXB 1U2CA 1RD6A 1UXWB 5F3BA 3DECA 3MOAH 2DYPA 3D85B 3VXPA 1D9KA 4Y2DD 4OI7A 4R3SB 1BVLA 4WHTB 3UAJC 1W72A 5JPNA 1QLFB 3GK8H 1NEZB 3BH9A 5IW1B 2NY3D 4ODTH 5DC9B 2X1XR 1KCSH 4GAJL 5TE4H 3QEQD 1PBYA 4U1KA 4CRPA 4ACPA 1KJMB 1EGJL 3TYGL 4NFBA 4QRPD 3HZMA 1RHFA 3KYNB 4KK5D 1YY9C 5D4QA 4EQ2A 4HUUA 1OARL 1ZGLB 1ED3B 2ZUVA 3DLQR 4LU5H 3CCHA 1R3JB 2XN9B 2YSSB 3LN5B 2D9QB 4L3EB 3WIHA 3WS6A 3TCLA 5C0DB 1G9NC 2IMMA 3HZYB 4UQ3A 1Q72H 3QHZL 3UBXG 4B50A 1VACB 5F89B 4Z5RB 1OY3B 3NTCL 1YZZA 2OTUB 2D7OA 4S1SL 4U05A 3DMMC 3FQWA 3GIVA 2R8SH 1WCBA 5DI8A 1QYGH 3I50L 4BK5A 2E7HA 4IOFC 4NQTA 1RJLB 5I1DB 2HTKD 1TDQA 2VKWA 1HYSC 4EUPB 2VXTH 4DW2L 1FG2A 1GGCH 3DURA 1OQOA 3LS5L 5DO2D 4MXQD 1QACA 1R3LB 4LCWA 4PB0H 1DL7H 1K8DA 1T0MB 3MRJA 3HE7A 3G04A 3MGTA 5HHOE 1Y6NR 1QLFA 5EZLB 3BW9B 3RL1B 1QSVA 2BNUA 4Z7UB 2A38A 1UVQB 3VFSA 5E2TH 5I71C 3KPRE 1RV6X 4Y7MA 3ZSSA 3LEVL 3MOQA 3KPNB 5SWSD 2VQ1B 4F8TA 4R0LC 3OG4B 4D8PB 2R8SL 2AVGA 2LTQB 1IQWH 5E00B 3HZMB 4KTEL 3I9GH 1NFDB 5EOQL 3SCMA 1SBSL 2E9JA 3MTRA 3WFBH 5IT2H 4BFGA 5KVMC 1AXTL 4LSPH 5IB4A 1FZMB 4PG9A 5DQ9B 1FPTL 1XIWD 5I1GH 4NCC2 4UUJA 4AM0B 2ZKHL 3I6LE 3CFEA 5MEQB 2Y7QB 3D0VB 3SKOA 4UQ3B 3VGAB 4NYLB 1BHGA 4XWGL 3MFFB 3VXQB 2R23B 5DMYA 5KSAC 4QRPA 2G2RB 4HIIB 1XF3B 4LVNC 3PWVA 2P5ED 3QSKB 3QHFL 1ORSA 3QDMB 4NQDA 3G5VA 5DJ8B 1T66C 4LHUG 1NGZA 2AXGB 4NKOB 3E6FB 5B3JE 1FV1B 3RGVD 2ZUQC 2Z31D 5HYJE 4CADA 4F7CB 2DQCL 4CU7A 1KN2H 4WI6A 3Q2CA 4JVUA 4MMXC 1J05B 1G6VK 3K0WA 4Y16A 1F11A 1BF2A 5FXCH 1TMCB 2LU3A 1X4XA 1E4WL 5GS0L 4OCXL 1IC4H 3Q6FB 5EBMA 2FX8H 2JJVA 1EIBA 2BNUB 1RAMA 3QXAB 2CK2A 1DQJA 2B1HH 4ZUUA 2IGFL 4JZNA 4JFZH 2D2OA 3O8XA 1TZIA 3V6ZB 5IVZA 2YWZA 4Z7QE 3QHFH 3D48R 1BD2E 3BD5A 2EDJA 5JNYA 1RUKH 4JRYA 3Q5OA 1DUZA 1FZMA 3TA3C 3W9EA 5F7FA 2IMNA 4N90E 2BVEA 1MOEA 3NFNA 4I0PC 3QO1B 5CGYD 4JFFE 1B4RA 3D3VE 1KIPB 1LO0H 2BDNL 5DD3L 4HC1L 1FPTH 3EOTH 5LWYL 3FO9A 5DUPL 3AS0A 2HKHH 4IDJL 1VGKA 4Q9QL 2EDDA 3VFNB 2J88H 2VDLH 3OKOB 4PJEE 2Y4SA 2H26A 4BZ2H 5DJ2B 1JFQL 2YD4A 5LCVL 2P49B 1UWXK 1WTGT 3AREB 4FG6D 5FGCE 4WCYH 3AXLA 3CFCL 3E2HB 1OVZA 4PJ9B 5DEFB 3LZFH 3VFPA 4EI5D 1XZ0B 5KJRL 4HUXB 4P49A 4X7EC 4KMTL 3HE6B 1E6OH 2V5MA 1RUPH 2AJSL 5IIEB 2HN7B 1MJJA 4KGJA 4PRID 5ICYA 1MCWM 1EXUA 1MRCH 3LPFA 4YR6B 1U8QB 4I48B 3RUGF 5HHOD 3SCMB 4HMEA 1OTSC 3SGEH 4ENEC 1CVRA 1L9NA 1Z3GH 4H26A 4MHHG 3C5JA 5HI4C 4CMHB 4OZ4B 1ZLVH 3ZL4H 5L9DH 3O3DA 1J0JA 1YN7A 1I8LA 1ZA6B 3LRSA 1J1OH 2IEPA 4MZ3A 4PJGF 3EYSH 2HKHL 3NFNB 2YEZA 3C60B 4IDJH 5IBTL 5I9QB 3QWQB 4R6UA 1HXYA 5JDSB 3ILPB 4M7KL 4MA1B 1ZT1B 2XWJA 3B43A 1KXVC 1AY1L 4IMLA 3QIUB 2ESVE 5I16A 3ARFB 1DBMH 5D1QA 4MB4A 1Q38A 4QYOA 3LIZH 5ECJE 5D7IE 2ILLA 1SMOA 2NW3A 3U79A 3G9VA 5J9PA 1E27A 3FO1A 4HF5H 3GBNL 1LO4L 4GLRI 1RZJH 3MXVH 5C07A 5D9SB 5D7SH 1U41A 4GBXD 4UOJA 4XMPH 3ZT6A 1JF1B 2NY2B 4JFYA 3QUMH 2ZOLB 1IEHA 4ISVA 5J56B 5AWNH 4M1DL 2AJVH 2J7LA 1UWEL 3K8MA 4NJ9H 4CU6A 3QXTA 3ALPA 2FECI 3KPSA 3CDGB 4R4FH 4GH7B 1I1AA 1A3LL 1KC5H 3MRHB 1G7HA 2LV4A 1ZVHA 1V7NH 3QZWB 5IHUL 2D7NA 2EO9A 2FGZA 2R2BA 3RHWK 2Y5TB 3ECBB 2OL3H 6FABH 1LDPH 5FHBL 3BOVA 5EOTA 4RSVA 3ME0A 4XNUL 3OJVC 3RP1A 4I9WE 3IDMA 4HF5L 1A64A 4IS6A 3SCMD 3TVMB 2AP2A 5FV2A 3BPCA 3WIFB 1EHAA 3MZGB 4GJTB 1CBVL 1VFMA 2X70A 4JRXD 1VB9A 1K8IB 4RWYL 3EYSL 1VDGA 4XP4L 2NW3B 1MQ8A 3BP5B 4JPKH 5KSBE 5LKNA 3DNKA 3VXOA 4QOKA 4F7PB 4X9HA 1P9MC 2X2YA 2WLYA 3FT2B 2IADB 3KLSA 5KS9B 3F7PC 4P4KC 3UC0H 4WVRA 3CNKA 5DTFB 3HE6A 4PRHB 1QG3A 4FQCL 4YHPA 4OD2B 3ZE1F 4HUVA 2BSED 3HE7D 2YPLE 1OLLA 1RUAL 5INCB 1JWSA 1MCHA 4PD4K 1U8LA 1U8KA 2CDFB 3MRKB 4RGMC 3DMMD 1CGUA 3K1KC 4XXCC 2VDPL 1BVLB 3CSBA 3UTTE 3MLVL 1XGPA 3C5JB 1BREA 1P4IL 2W0FB 2DWDA 1S5HB 1MHPL 1PAMA 1K4DB 3CU7A 4ZOCA 1I1RA 1DQLH 1NUGA 4X0KB 1KYOK 3QUXB 4M6OH 4RWYH 5FOBA 5FEBA 1SBBA 5SWSE 3DI2B 2WWMD 4JHZA 1NGPL 4RFNC 3OAYH 1R3JA 2XN9A 1A7OH 3M45A 1KXTB 3RUGE 2FJHA 3RZCD 5I1JL 2A6KB 4LSVH 2V17L 3QFJE 3EZJB 4F7PA 1T5WA 1GGBH 3VRJA 2OZ4H 1IQDB 1C1EL 3DYMA 4N8PA 2NY0C 35C8L 3IDNB 2YRPA 2ZNWA 4OSUL 2IBZX 1QVOB 1YEEL 4WI3A 5INCA 3TFKD 1J5OL 2XV6B 2FBOJ 5FKPB 4PG2A 4ZMAT 3TJEH 2HKFH 3QWRA 2DI8A 1MHPH 3DXAA 2ZSVB 1UQSB 3Q48A 3DWTA 1MIEL 4D9LL 4H8WL 5F7DB 1F58H 4Q2ZB 5BO1H 3QFDB 1QSEE 4K8RL 5D6CB 1CN4A 5TDOA 2PO6D 5I8OL 4R97C 5D70L 1YQVH 4JHAH 1BFVL 3RQ3A 3ULVH 4YBQC 5D5MF 2NXZC 3RGVC 3TNNB 1PGRB 1IT9L 2ICCA 3HR5B 1UWGH 1ZWIA 5K9OB 3B9KD 1A5FH 4L29B 1H3UA 2FEDC 4KJPD 1FL5A 4L4VA 3VW3L 4QOKB 5E8EB 3ULUL 2BCKB 3O6FB 3OKEB 4X7FC 3CC5B 3EOAB 5KSVB 3O0RH 4JZJC 4ORGB 2DQEL 3U36A 3GSOB 3AMLA 5JPMB 2CLVB 2W9LA 1OW0A 3VA2C 1DFBL 1JWSB 3CH8A 1BMGA 5DGRA 3ARGB 3AU1B 3LD8C 3STBA 1S7RB 3PHOB 1F11B 2IPUG 3OZ9H 4GMSL 5F97E 4GAYA 4R2GD 4LPTA 4RMWA 3GMLA 5C0CA 4NRYB 3C9NA 3HMXA 4U1IB 5BZDA 4CJ1A 5E2VH 4ONOA 5DYOB 5DMGC 1JHKL 4MVBD 3MMEB 4XRCA 1JGLL 5GIRB 1S7SB 2NY6D 1HIMH 5C2UB 2EEDA 3D39A 1TQCC 3MUHL 5TJWK 2H2SD 3ES6B 4HBCL 4NNPH 5MP6L 1KCVL 2DD8L 2XY2A 4RGNE 4HCRL 4BKLB 1A6PA 2CXGA 4NQXA 4JG1L 2I5YH 3M1BA 3OB0H 1HH6A 1F5WA 1QUNA 1Q9WA 2X4OB 1A1MB 3TJHD 4B7IA 3VRJB 3VFTB 4F15C 5BV7B 5IB3B 2J8OA 2ESVD 4DZBA 1U8MB 1A6UH 1BOGB 1X5IA 1U8OB 3FAXA 3IDYC 4NZTH 4M6NL 3QA3A 1WBXB 5HVWA 4LL9A 1OP5H 2VLMD 2V2XB 2PW2B 4OLXL 5I1LA 3U82B 3S88L 5GGQL 1EMTH 5HI4D 4RMUA 1BBDL 3SDAC 2BFVL 5DHYB 5HGAA 3BAEH 2ZSVA 4JY4A 3KYOA 1K2DB 2GHWB 3MREA 4U1SA 4GQPH 4LARH 3MUJA 4G5ZH 4LNVA 3ARED 1KOAA 4JO1H 3MJ7B 4G8GA 4JPWH 4GBXB 4GKZB 1FFQA 2NY5H 4U6VH 2BC4B 4HBCH 4NNPL 4HQQH 4P5KA 1FNEB 3JTSB 4Y4HD 1DSFL 2E27L 2WBJB 3RWIA 2OM5A 3LKRB 2J8UF 3MLUH 5HHVL 4WWKB 5HYEA 2WM0A 2BVQB 1JBJA 3WN5C 4NNYB 1I8LC 2X9WA 5DHVB 4BSWB 1LWRA 1OTUD 5HHME 3MGOB 3SO5A 5KN5B 1A4KA 5F6HJ 4QRSA 5D5MA 5DR5H 3VWKC 4YFEA 5C09E 2UZIH 1SVCP 2WP3T 2NNAB 2FR4A 4OV5A 4WTZA 2BFVH 1FE8H 4OF3A 3O3BB 4JO1L 1J87A 3MCG1 1AXIB 3QG7H 1WIUA 5FKAB 2VE6B 5DJ0B 4L8DB 5GZOD 4IHOB 1JF1A 1QBLL 4XAKE 5EU7C 3SE9H 1LO5B 5IB1B 1A3RH 1DDHA 3HE7B 1L7IL 4LCCA 5C0CB 1K2DA 5E8PB 4U1SB 1B6DA 1MFAH 5F1SA 1BD2D 5CHNA 3K7UA 1P84J 1NH6A 2E8YA 2VOTA 1CL7L 4P9HC 1CXLA 3GSRA 4PJIA 1IFHL 1T6VN 1MHEB 2HFGH 2H2PD 3QCVL 4OFIA 4QXTB 3KYAA 2DKSA 4KY1L 1A7NL 5LGHH 1NC2D 1QBBA 1YYML 2AJZA 3V5DA 4LSQH 5BVPL 2C1PB 4NQSB 1B2WH 2ZCHL 5DZNA 5I8CB 4HW6A 5ERWA 1OD7A 2NQCA 2EDBA 5ITBH 5J3HD 3PV7A 1UFUA 4JPVH 1FE8L 5IHLB 4P2QE 5HY9A 1U8IA 1IAOA 3T0WA 3TH3T 1CFSB 3GUTB 1G7LB 3LOWA 1NMCC 3SDDC 2L4OA 4JM2A 4NPYB 5DFTA 4KKAC 5I76B 1EO8H 2QQKH 2HFGL 1FZOA 4KKNA 2VN4A 2FGWL 4UIMB 3UDWA 1ACYH 4PB9L 5TE6L 4YHZL 4NBZB 2UZIL 1H3XA 5MENB 3NABH 3JVGC 3U7WH 3FQUB 4LIQE 3LSOB 3MLSH 5JHDB 2MCPH 3WSQH 3C5SB 2ENSA 5H37G 3GMOB 4JZNB 2BDNH 2IANB 1QBLH 3G6JA 2ICWI 3HRZB 1Z0MA 5EUOE 3IDXL 4EUPH 2QQNH 4J3XA 4FFYL 5CD5D 2VLLB 4DUWA 1G7PB 1SMAA 3RKDC 1K6QH 1YPZA 4X5WA 2DWDB 3IFOA 4I4WA 4OGAC 1OP5K 3HN3A 2R0KH 3BGFB 3EJYD 4H20L 4MQ7B 4ZSOE 5I8CA 3D69B 3NACH 1UB5B 1KIPA 2NY0D 3T0DA 2HH0H 1HH9A 4DKEL 3MRCA 3L3IA 2BX5A 1A4KB 2BVYA 3V95A 4CN4A 4ELKB 5HDBE 1LDPL 5IB5B 4MDIB 4WFFD 5DJAA 4QRQA 4C57C 1KIUA 4P2QB 4M8VA 2R4RH 3MV01 5DD3H 4HEPG 3ZHDA 4NZRL 4N0UE 3B5GA 2VDNL 1I9RL 2ITDB 4KRMB 3R1GL 4GRWE 3ZDYE 2WUBL 2HT4D 1LK3L 3VXMA 1M71A 3PIQB 2HJKA 3WEXB 5TF1L 3JV0A 2ZCKL 2EE9A 2NLJA 1OB1A 3RVWC 4P5TB 1G9ML 4FA8A 1T1WB 5CJOL 3VGBA 5ICYB 1JGUH 3T2OA 4PJ7A 3I6KA 2EKSA 4QXUL 5DK2A 5F9DC 3UEZA 5JO5A 4XP9L 1CLOH 2X1WL 1EFQA 2BSRA 3HTLX 3V0WL 1NFKA 4XHQA 4OCMC 2BNQB 4R8WL 4POZD 5AUMA 3GMQB 3RDTA 3ZT7A 1NGPH 1EEZB 2WQRA 1T7YA 1A7OL 2ERJC 3GHBH 1XGRA 3HG1B 1FRGL 3SHSA 1NSNH 2VRAA 3O9WA 4JN1H 5JUEL 5IQ7H 3TESA 2O5YH 1HQ4A 1U58B 5A16B 5JXAL 3CVHL 4DGVH 2YOCA 3MRCB 4IMLB 1MRDL 4D0CB 1T04A 2VXQH 1P4IH 5D1QB 1C1EH 2VDRL 2NZ9D 3PHQA 5JW5A 2CUMA 2EDHA 1KFAH 4L1DA 1X5LA 1RZFH 1V7NL 3SE3A 4ZO8A 2J5LB 3TN0A 4XB7A 5C07B 3ARPA 2NY6C 4P2QD 3EAKA 1FFNA 2J4WL 1G9MH 2YD2A 3PIQA 2DBLL 4K9EC 4ZS7H 4OZFG 1AO7A 3TBYA 3IFLH 3OAZK 1CXEA 1WZLA 3C5SA 1HNFA 4MJIE 3FTGA 1AIFB 2WAHA 5CMAA 2B5IC 3IU4L 3NIGF 4X6FA 2EKSB 5JO5B 2GW5A 1KBGL 2P46B 3FQRA 1FVEB 1I85A 1MAKA 5E94A 1ZMYA 1EHLL 1QFOA 3VXRE 4OQTA 5LJYH 1IT9H 5E6ID 4LMQI 5D7LD 1OAKL 1DBJH 3FB6B 1UWGL 5DUBB 3TJHC 4CL7A 3QAZB 4JHBA 4JKMA 5HD8C 3RIFF 1A6ZB 3SDAD 1PEZA 3QIBA 3SDYL 3DYPA 4JREC 4XC1L 4RAHA 3X14B 2JJUA 4DCQA 1KV3A 4J8RA 4IM8A 1MF2H 2ZJSH 4M7JH 3IKCB 1ACZA 5B21A 3WS3A 1UKTA 2X9XA 2EC8A 3SJVE 3V8OA 3VMPA 2Q6WA 3MOBH 3UJTH 4ZDHB 3HAEB 4ZXBD 2IH1B 4ODVH 1P4BL 1ADQA 5D72H 3PNWA 5HDLA 1YQVL 1CFQB 5FF6B 1DVFD 2ADFL 2EDKA 4WHYG 1FNLA 3UTPE 5IJVA 3GSNH 4M6MH 4ZAKA 4ZUVA 1FFPA 1EEYA 4XNZB 3QUZC 4GAGH 2DDQH 3BIAX 3O2DL 1F00I 4DVBB 4PLKC 4PRIB 3KYKL 4YC2B 3LN9A 1IC7L 4WFFE 3R4DA 4BH8A 2FECL 4IOIB 1B0RA 2HT2C 4PJ8D 1OAZH 2DLGA 3A6CL 5CJQL 3UTOA 4MWFB 5IJKC 4P5TD 3WXVL 4JFFD 4YHIB 2FL5A 4G7YH 4E41B 4ONFL 1WWAX 2HLAB 3X3GH 2X4NA 4HHAB 3VMNA 3BEWB 3BIBX 4AYFA 4LSTH 1GGBL 2UWEB 1CU4L 1FC2D 4FQ1L 3BPOC 1U91B 1NCUA 4DN4H 1G9MC 1GSMA 5I1KH 2NXYC 3NIGE 5AZEL 4LLAA 3JWDH 3SE4A 3JWNC 5ABDE 5JHDE 3DVNA 2A6KA 5T3XD 2D31B 3VFVB 3VFRB 2WBJD 4WV1A 3BPOB 3MXWL 2PXYB 1JWMA 3PABA 3EOYG 1U36A 1PG7X 3QJHA 4NM4L 1AD0A 4QRSB 2K1MA 4PV8A 5DMIL 5D2LB 5E5MB 3P9MA 2GTWB 4ZUTB 2QLVB 3ZYZA 3QQ9C 1FYTE 1P5UA 3WD5L 1A9EB 4P2OC 3NIFE 4Y4KC 5DWUL 2VZ1A 1WZMA 1SY6H 2PTUA 2V7HB 3WO4C 4EDXA 1OAXH 1UM4H 3BD4A 2UY6A 5D1XC 4L8DA 1FGVH 4X6FB 3MCKA 1BIIB 3X12B 4KKLD 1FVEA 1XFPA 1NJ9B 5FCSH 4PYHA 4RAVB 3CUPA 5IQ9A 3LB6D 5LGJA 5KTEL 1YEIH 3O3AA 4L4JA 3RAJH 1XIWB 3B9KA 4JANA 1K5NA 3SGKC 1T1YA 2AV7B 1IGCH 3S96A 3L5XL 1I1FA 5E24E 3BXNB 3ROLA 1PG7W 4N8VG 4DN3L 1MJ8L 5F88B 1B88A 3KPLB 1RJCA 4OFYD 2ZOKA 4LARL 5JIKA 5DWUH 1BQHG 4XCFL 2G75A 2P8LA 4ZDHA 1TJGL 3RTQC 3VH8B 3LMJL 2VXSL 2BSTB 3KPOB 5DMIH 2BRRH 2BOBB 3UYRL 3GMNB 4S1RL 4P23A 4HH8A 4AQOA 1KCSL 5TE4L 4H5SA 1IAOB 5EU7E 2BVPA 4PJBF 4N8CH 4OF8A 1LNUB 2C7UA 3B9EA 4M48L 4PD4J 4PGCB 5E8NB 4ZYKB 3KPSD 3QEQA 2AXJA 4G6MH 2IQ9H 4KDWA 5LBSL 5IF0A 3IAPA 1HE7A 3P9LB 4WNQB 3QUYC 5SV3A 5CEZE 1AFVL 2M26A 3DTXA 2DD8H 5HGHB 1LDSA 2X42A 3CUPB 5IQ9B 5M95B 2C4XA 2ORBH 4YHIA 5SWQB 4PJDA 3EJZD 1AJ7L 1JPFA 5FDWA 5JHDA 4HK3J 1CE6A 4JE4B 2X4QA 1MWAH 4EI6A 2ADJA 4OCSL 3LEYL 3U0TA 1QP1A 5GGSA 5E6ZA 3I02A 3MNVA 3MLXH 4HIHB 4GKOA 1BFOB 5E8OB 2EDXA 1BX2A 3H6JA 1MFBH 2XG4A 2YD9A 4NQED 3IETB 2BMKB 1T7VA 3IRPX 1DBAH 1MJ8H 5ADOL 4ZPTB 1TJIL 2XZAH 1X44A 1X5GA 1VFAA 4XPBL 3TNMB 1Q0XH 1YMMA 2VKXA 4L3AA 2G9HB 4Y89A 4G80B 4OGXL 4IMKA 4HFUH 3GSQA 2QSTA 1IMHC 1ZT4B 4JFQA 3I50H 2IG2H 1ZHNB 2XY1A 1F13A 5J6HB 3KXFB 4LLQB 5L8JB 3X12A 5I2IB 3KYMA 3LEVH 2A6IB 1T21B 2Z8SA 1DZBA 3C8DA 4G42B 3W9DB 3P0VL 2WBWB 1EBPA 2NY1B 5E70A 1MREH 2SEBB 1CICD 3D85D 3WFBL 4E0RB 1AGBB 4KPHH 4PJ7B 4XXCA 5BS0A 4WI8A 3RPIA 2FH8A 2J3SA 3U9UA 3QXWA 1D9KB 1HWHB 2ATPA 2R9HD 1D5IL 4KTDL 3NCFB 4HIHA 3K80A 2ZOKB 5C08E 1MFEH 3BH8A 3EGSB 5KSBF 3DX6A 2G75B 2P8LB 3MLSL 3QEQE 4LHJB 1YC7A 4LVNB 1IILE 3VH8A 3HE7C 3LKOB 3QDJD 1A7BA 5L2KB 2P43B 4KVCH 3SPVA 4Y4HB 5AAWA 3HNSL 4D0BA 3HNVL 3WFZA 1KJ2A 4PJXF 1P7QA 3HB3D 5IP4A 2VLME 4KRPB 4EI5B 3TVMC 1IC1A 2C7UB 1I1AD 4JM4H 4JR9H 2YWYA 5FCUL 4APQB 1UA6H 2ZP0T 4XH2A 5IF0B 1FAIH 5AYQA 4Q9CA 2CUIA 2FHCA 1BZ9B 5JW4N 3FQWB 3GIVB 4XTRC 3BESR 2FZ3A 1A3QA 2PW1A 1DDHB 32C2B 5ISZD 3S8WA 5LVEA 5T3XH 3LQAL 4MAUL 2PYEA 1AC6A 2EO1A 3GM0A 5TH2B 4AEEA 3AM8A 3FN9A 3DVGB 5CP3A 2QQQA 5DJ6B 3MYZA 4XCNA 4BUGA 3THMH 3MYJA 3UO1H 4O9HH 4FXGA 4UV4H 4U1GB 4Z78B 2HTLC 5JIPA 3HUJF 2VC2H 4YDVB 3CU1A 3DROA 4AQ1B 2WP3O 1TVBA 3GJFB 3DPBA 1CFTA 1CDYA 1HHKB 4OCLC 5JA8B 1QRKA 3PDOA 4MNQB 3WS3B 1AR1C 1RZ7L 1UXWA 2NY3C 3FONB 1MCRA 3BN9C 3U2SA 5KJRH 3D0VA 3SKOB 3RGHA 4UDUA 3ULVD 5T3ZL 4QHLB 4KC3B 3NABL 4YDKL 1XF3A 3SCMC 4G6FB 5EPMB 3OB8A 3BKMH 3P30H 4TPRH 2DM4A 2DRUA 1CCZA 3D18A 4P57A 4FMKA 4G8EA 5DJCA 2QQKL 4HLZH 32C2A 1KYOJ 3EZ8A 5GZNC 4UI2A 1S7UA 4F7CA 4PRIA 2NW2A 4OGAD 5DVOA 1FSKB 5DA0B 1GOFA 2ED9A 3INUL 4YHYC 1ED3A 3OAUH 4RISL 2VDQH 5EBWA 5J12B 3UO1L 1HKLL 1IGML 3HC0A 5GSRB 5DF0A 4R96A 1KCLA 1ZV5A 1U93A 4K7FA 1FYHB 3NZHL 1Q9LA 5C0AB 1Q1JL 3EOBB 4J1UB 2JIXB 3VXUD 1ZGLM 1R3IL 5H2BA 4Z78A 1JGVL 5HYIA 3G5XA 4YO0B 1T0PB 1UEYA 1RY7B 4P2OD 4P4KB 3FFDA 3LV3A 4AH2B 2CDGA 5F1IB 5EIIA 2XFXB 4MQXD 4L4TB 4BSJA 3B2VH 3BP4B 3LY6A 3CDFA 2VC2L 1L6XA 3GKZA 2Y9RT 2X4TA 3C5ZC 3V4UH 3JV4A 3MRFA 4YE4L 4PRHE 1NGQH 1VERA 3BZ4A 4RGMB 3S5LA 5MEPB 5DLMH 1IC7H 3FO9B 1RZIB 2V5YA 1UVQA 3KLHD 4GW5B 4JFFA 5JW4Q 4WO4A 3DBXB 1PX4A 3MV9A 4MQSB 1SYSA 1JZ6A 4R2GB 4HT1H 1MCWW 5F93C 2EDLA 4DKAA 1CR9L 1F2QA 1YEFH 1E28B 1VGEH 1GVIA 2V5SA 2ZCKH 4ODXA 3JV6B 1X5ZA 2Q3AA 1ERNA 1NKRA 1IAMA 4OUUA 5JZ7D 4OF7A 3VXNA 4U49A 5ADPH 3TBTA 4GSDL 1CDUA 1H3VA 3WL9A 3O3EA 4XNXL 1GHFH 2HN7A 3BKCL 3UCRA 1A1OA 5HHNA 5J6GA 4HS6A 3EOBA 4Y19A 3SDXF 3AAZA 4JEGB 2R0LL 4I2XE 3RWCA 2AK4E 1TJHL 4D94A 5HI3D 3PP4H 2VDKL 1NCBL 1I7ZA 3FFDB 5A2JH 4MNQA 3LN4A 3VI3F 4K8RH 2HVJB 5C0DA 3REWA 5IV2A 2AJXL 4HZAA 3SDAA 3JTTA 3WLBB 2Y07L 5JOEA 1DQDH 2ATKB 4L4VE 4PREA 3IXAB 1J1XL 1KIQB 1CT8A 4NQCB 4PGCA 4WO4B 1J18A 3QCTH 3QRFM 1HQRA 1PQZB 3QEQB 4XI5C 3EYUH 5JIIA 4IEFB 1U8PB 3ULUH 5IROC 1TITA 3ALXA 4W4OA 3MRJB 5ID1B 5FYKL 3TZVC 4FQJH 5DRZA 5D6DC 3CDGA 2R2HB 5C0AA 1CGVA 5GGRA 2LU4A 2OSLA 3EYOB 3VWJD 3Q5TA 4YC2C 1YUHB 3X14A 5EBGA 4LSRH 4DQOL 2E7LA 1FLTX 4LVEA 1DQLL 3NCMA 4G9FE 4L4TA 4CNIA 2OR8A 3IJSB 3KJ4B 5DQ9A 3RZCA 4FXKA 4P46B 4TNWF 5JZ7C 4GRLB 4JGMA 4LPUA 4UUJB 1BM3L 2A74A 4Y2DC 3VDCA 2APVA 4CMMB 5I1JH 3A6CH 4HV8B 5CJQH 1IAII 2CGRL 5E2WH 2VWEE 4PP2B 1UCBL 2DWEA 1IBGL 3BT2L 1GC1L 2V17H 1R3KA 5EORL 5D72L 1X3DA 4YR6A 1CGSH 3MJ9L 3ZE2E 1N8ZB 3V4VL 5DDHB 4CADB 4P3CL 2DM3A 4JDZB 1M6OA 5L2KD 1MUJB 2AK4A 4WWKC 5FYKH 4OQTH 5J1SC 1YN7B 4Y2DA 1TLKA 1BFVH 4GMTL 4F3FB 4M00A 1G7IB 2VQUA 3WUWG 4E0RA 4WTZG 4YK4B 1G6RA 5FYKU 3NCBB 2I25N 4FS0A 1SEQL 3SJVD 4UIKL 2WK2A 1KACB 1U95B 1HCVA 5AZEH 2YPKA 7FABL 3RY6A 5GRUL 1YNKH 4FQJL 4ZFGH 5CUSL 1H3WM 3BHBB 4CNIB 3AROA 3GMMB 5DRNA 3RZCB 5C6TL 4GRLA 2P45B 4JRXB 3REWB 2DJ4A 4M5ZL 4KJQD 4PG2C 1AGCB 2IG2L 3DGGB 1C5CL 1RUQH 3BP6A 5D71H 4PLNC 3WMSA 1CI5A 4F7TB 2YBRB 1XGQB 4OCWL 1TNNA 3CXDH 4OFYA 4YXHH 3KS0J 4MJ5B 1CD0A 3HS0B 2UUDH 3PWLA 1QRNA 2Y5TA 3AREA 5I75C 5GRZA 5I1HH 5HDQL 1AR1D 3V4VH 5DUML 5BMFL 4M4PA 4J6RL 4C56E 5IIEA 2FYYA 1ZHKB 1NFIB 1KJVA 5FKPA 5EO0B 3B9DA 5KW9H 3R06B 1T1XA 3C6LA 4KJWD 4OF5A 4PRPA 5EU4B 5B4MD 3MYJB 4X8JA 2UVEA 5KSAA 4X80H 1L7TH 5DQJB 3UPRB 4OZ4A 3IS1X 4FFZH 2Z92B 1T5XB 1MAMH 4Y8DC 4XVSL 4L5FH 3VGGA 2VLKD 3OKKB 1ZANL 4X6DB 1NBZB 3E8UH 4HLZG 1JHTB 4JCLA 3VXTA 1NGWB 2HG5A 4XMKL 4FTVE 1P7HL 1TCRB 1CFVH 3VXUE 1A7NH 1Q72L 5LGHL 4PFEA 4S0TD 3B3IB 1KJ3L 4HUVB 2I5YL 5KSUA 3HR5A 2IH3A 5I16B 2VLJA 3PWUB 1Q9KB 1P2CB 3W5NA 1SJEB 1AGDB 1BLNB 3GBLA 1YEJL 4ZYKA 4QHLA 3H0TA 1NCWL 1NL0L 1AXTH 4LSPL 5JW4M 4F33B 1XGPB 2B2XL 3HE6C 2O5XH 4OLEA 1BEYL 1D5XB 4IMKC 1BAFH 4ISVB 3NPZB 4CDHA 4FXLA 3RJDA 3SO3B 1C08B 3KPSB 3EYQC 1MELA 4CJ0A 4HK0A 5IMOA 3RX8A 2HAZA 5ESAB 5J1TC 2WIIA 4UV7H 1S7RA 2FB4L 2DL2A 3RWEB 1HNGA 3VGEA 2W9EL 2GKIA 3C5ZB 3MO1B 3WUZA 1UCTA 3WNMA 1I9EA 4HULB 3UTTD 3R06A 3RVXC 5E8OA 1CLZL 1NDGA 1I8IB 4ALAL 2OJZH 3OXSB 3U30C 1A14H 1HHIB 1RULH 3IETA 3EFDL 5F44A 2Z35A 5MEOA 3D5OF 3MLUL 4EI5C 1A3RL 1IGJB 4P5TC 4HFUL 4LRIA 5HYSG 3DVIA 1JNJA 4MDJA 1LD9A 2QQLL 3THML 2AQ3A 4H20H 4NQEA 3L6FA 2NY1D 2FB4H 2IC2A 5DR5L 3DXAB 4ZD3L 4NO2A 1A1MA 2F8VA 5T3ZD 2VB5A 5D7JD 5F96L 3RVTC 3SGJC 3PQYE 3DBXA 4HKJB 5IJKA 1UKQA 2LABA 1JIBA 5DUPH 5CBAB 1I9RH 1DE4A 3U30B 4WY7L 4LSQL 1M05B 1U8KB 2CDFA 5BVPH 5JOPE 3SKNB 1WT5C 5GGRY 5D1ZD 4TOYL 2GK0A 1HSAA 4N0CD 1OHQA 5CZXD 4UDTB 3G04B 3TPUB 4GKSB 1HSBA 5KANG 5J0BA 3MREB 4JY5H 1CICB 3G5YB 1EO8L 1T03L 4ONGH 1NMCB 1RJYB 5GRXG 2P5EE 3P11H 4EIZC 4L8SA 5BRZD 3VRLE 4NN7B 5EO9B 1YYMH 1ZSDA 3LKSA 3VD9A 2KZWA 3QXDB 4JM4L 1NGQL 4TULL 3NCJH 4TTDD 5IB4B 1P1ZB 5IVOA 2CRIA 4MD5B 4BZ1L 4XPFH 4I18B 4JO2H 5GGVY 4GW4A 4XCYB 4PY7B 1O7SA 3IDXH 3QEUB 3MLWL 4MVBC 5DRXA 2HP4A 5DD6A 2XZQL 4D2NA 4DAGL 2MHAA 4K3HA 2Z91A 4F33A 5D1XA 2MCPL 1GYAA 1P7KA 4BFIB 2E9IA 5EBLA 3L7FA 4HIXL 2L7UA 1OAYL 5LCVH 3MZTA 4LAQH 3E6FA 5C0CD 4OCYL 5GIRA 5CILL 3ARSA 1S7TA 4KMTH 4H88L 2YA0A 4FHBD 4IHOA 3QUXD 3QQ4B 4PJXE 4RMTA 4OM1L 3KPPB 2AGJL 5DO2C 4N1HB 3NFSL 2LQRA 1AQKH 2VDNH 2I07B 1CE1H 1UYWL 3C2SA 3EYOA 5GGQH 3RU8H 1K4CA 3FZUD 4YDVA 3V6ZA 5HJ3A 2VN7A 4LHUB 1G7QB 1URLA 4RBPH 4EDWL 3BWUC 1KNOA 4HIXH 4WEUD 3WKNA 4JDTH 2ZG1A 1U2HA 4PJ9D 3TNNA 1UM6L 5CIPA 5C0FA 1Z9SA 4O2EB 1NUNB 2VMFA 3MRQB 2YUWA 5T1LD 2E9BA 5CBEA 3V2AR 3BKML 3P30L 5J12C 1ITCA 3OR7B 43C9B 3QI9D 2DLFL 1JYWA 5F7YC 5DHYA 2Z4QB 1OAYH 2OL3L 4EXKA 2GSGA 5A3IC 1FVCA 3G9AB 4XPFL 5IUSA 5FHAH 2DWEB 4P99A 4F9LA 3D2UB 1IL1B 4NUJA 4UU9B 3RL2B 4UT6L 5DJZB 4U6XA 2XXMB 3NFPB 4X9IA 4NQDE 5FM5O 4TSAH 1VEMA 5EWIL 2P5EB 4XPGL 5HHPA 1LK3H 4PP1C 1RHHA 3V0VA 43CAA 4GBXA 3IAGC 4MAYB 2FHFA 2A2QT 4M1DH 1I9JL 2H32A 1IM3B 4YXLL 4HPYH 5CCKH 3EHBD 4WHTA 1QFWI 4PRAA 5ALBL 5FM4A 2Z31C 5DJYA 1I3RA 4TNWK 5T3ZE 3T0EC 3WNPA 4R96B 1DVFC 5HDOA 3WE6B 4XBGB 5HHOB 3BZFA 3CDCA 3MA7B 2F58H 3LQMA 3PWJA 1Y0LA 5JHLL 1X7QB 4R4BB 5KN5A 3VD4A 4F80A 4Y4FC 1IGFH 5DLML 4YZFF 4M43H 3OXRA 4L9DA 4PJAB 1PEWA 3ULUE 2VITB 3UAJD 3WNNA 4YGVB 2APTA 4WDIA 2HVKA 1J86A 2YSSA 1M7XA 5CIPB 2PTTB 5C0FB 3RU8L 1ZA6A 1F90H 2Y36H 2HT2D 1GGIL 4YQXH 3GKWL 4YDLC 4QXGH 3O6FC 1N6QH 1XF1A 3FOMB 15C8L 2WINB 3FZUC 4FNLH 1RZIA 5C09D 1F4WH 1DBJL 3U9PL 1EFXD 5CZVH 4JDVA 1OAQH 4PJIB 4QRQB 1YY9D 4YHNA 3DO7B 1RHHB 4PJ5A 43CAB 4U0QB 1QBAA 4Y4FB 1D6EB 5FUZL 4ZNCD 3I6LD 5BW7A 4LVHC 4LCWB 3RWHB 2X4RB 4PV9B 4M62H 3QRGL 2JJSC 2YD1A 5C8JB 4HIJA 4LGRB 1MI5E 4Z7UA 1IAIM 2GEEA 1I3VA 3MA7A 5BV7H 1FFOB 4W6YB 3ZHLA 5DEZA 5HJ3B 1KELH 4G8GB 2I60L 5C0CE 3GI8H 4XNYH 4YGAB 4XXDA 1KNOB 1UZ8B 1T1XB 3C6LB 5EU4A 1S7XB 5FAAA 4KI5C 4HWEL 4YWGH 2WBJA 3ABZA 4GXUM 5KTEH 2NY0B 4GAFB 4GMTH 1J5OH 3T4AA 3TLRA 5D2NB 4J4PD 3CFEB 3CFIC 4WU7B 3TT3L 1XAUA 1F4WL 1NGWA 2HG5B 1GXEA 2BY3A 3RGVB 2NX5D 3MGOA 1NC2A 4FQHA 1TVHB 1R24B 3RL2A 3IXAA 1CXFA 2GUOA 2AEWA 2HTLD 4JDVB 1JPTL 5E1HB 4I48A 4JFED 5C07E 1RIUL 3WIHL 1J05A 1FHGA 3WFCL 2NXYB 5J89A 3S36L 2VSDA 3ARQA 4LCUA 4ZAKC 4F57H 5JMOC 1J1PH 4GQ9H 4KZDH 4PJEF 3M17B 1U92B 4ZO7A 5EC2B 1LO4H 2A6DA 5MI0C 3FN0L 3BWAA 2F5BH 3QWOA 2IFGA 3TT3H 4X6CE 4R4BA 3KPSE 1ETZA 2OSLB 1UWXH 3R1GH 1CG9B 1QZ1A 5DC4B 5IBLD 4PPTA 2VITA 1OGTB 4K2UL 3C5ZA 1MLCA 4KK9C 5J4MA 4G7YL 3CX2A 4MDIA 4ETYA 1X5YA 5ESVB 4NNXB 3SGDH 2R56L 4FOMA 1X5JA 4GMSH 1QQDA 4FQXB 3CFBB 3VD5A 4QHUA 4WFED 3L9RB 1A6VL 2VTFA 2XA8L 3DRQA 4R8WH 2A9ML 4KDTA 3PL6B 3MC0A 1S7VA 1WFOA 2XQYK 1LGVA 3QZWA 4OZFB 4GLRH 4LGPB 1N8ZA 2XZZA 3PG2A 3SJVA 5CUSH 2GFBB 1UM5H 2CIIB 3PV6B 5TF0A 4M3JA 3ETBF 5B3JF 4HIJB 1J7VR 2MOVA 4P3CH 5JLZA 1MCLA 1NMBL 4HXBH 1FBIH 4MA8H 2DTSA 1JGEA 2DLHA 3ARWA 5F7NC 2NY5C 4MQTB 3Q5YA 1N26A 3VDAA 2YPKB 2GTZB 3ZE0F 1FZJA 2RCSH 1QKZL 2XKSA 4K3GA 2DJSA 3MLTA 3H9SB 3OSKA 4MS8D 1KSRA 1KIRA 4P2OA 4ZTPL 3VXOB 3VG0H 1HIML 1A2YB 4YZFE 4X5XB 4Q6IA 1I3UA 1EUTA 1YEGL 1JCKA 4OBSA 2BHUA 1JYNA 4HCRH 2CLZA 2VLKE 5I1CH 3TBYB 4LSUL 4NN5C 3L95A 5DURD 1RUML 2JB5H 3K8KA 4L29A 5E6IC 4CVWA 4GKNA 1DQML 1MJ7L 1NCCH 5JOFA 1IAIL 4JVPA 5JHDD 4K3EH 5IWLA 4PJHE 3H7BB 1UKSA 5F1OB 3FQRB 5D1XB 2O61A 1U3HA 3F58H 5HYJA 4N5EC 1CF8L 3CC5A 3EOAA 4HXBL 5KSVA 4LLDB 2MFNA 4TUJA 4NOFA 2HJKB 3WEXA 1ZLVK 3BGMB 2Q7YA 2NLJB 1ZA3A 1FL6A 3CH1B 5D96C 1UB6B 5KVFL 5FO8B 1GZPB 1CG9A 5K9QI 4QRTA 4MXVE 1G7HB 1ZHKA 1ZS8A 2X4PB 3DSNA 3QNZA 3U6RA 4PGEA 5ISZA 5DUMH 4GAYB 3V4PL 3VG0L 5HXMA 2RFXB 4Q9RL 1YEKL 3W2DH 1QSEA 5A1AA 1IKNC 1MEXL 4X6BB 3CK0H 4UOW0 3PNWB 1K4CB 3OKKA 1G7QA 3A0OA 2P24A 3DRQB 2X05A 2CLZB 5BO1L 2FD6L 3CSPA 1ZHBB 4MGXA 1KPVA 3SY0B 1A6AB 1HHJA 3MLRL 1PX3A 4NKIH 2YMXH 5B8CC 2VR4A 1CDCA 4XAWL 4BH8B 4N9OB 1OAUH 4Y5XC 2P8MB 1RZ8A 3KPQA 4KPHL 4B5EA 1IL1A 4NUJB 4Z6AT 1N59A 1LP9F 4MB5A 1X5XA 1IKNA 4LPVA 2OJZL 2BVPB 3QA3B 3JBG7 4AMKL 5CJ5A 4EN3D 1WWBX 5TQ2L 4ETQB 4IRSB 1D5IH 3V4PH 2EH8H 5L0QC 1VPOH 5IFAL 3UYPA 3VXME 5ESAA 3UTSE 1S78C 4OKDA 4Q9QH 1QYGL 1J10A 3O4LD 3TH4T 1K9TA 3O11B 4QRPB 1FZJB 5DD0L 2DQGL 1VFUA 3H9YA 3DVNB 4JB9L 5DK0A 4NQDB 3VFVA 1J88A 5FFLA 1T0NB 5EUOF 3I3BA 2OBGA 1R3HB 3L5WA 5TFSH 4YUEH 4KDVA 3E3QC 2Z35B 4X83A 3CX5J 2YN3A 3QIBB 2RAMA 1QR1B 3PGFH 4U31A 5FIEA 3JTSA 3L3JA 3X3FL 4MAUH 1NC4B 5KVEH 2OXGA 4HJ0C 4O51B 1QEWB 4HC1H 1AKJD 3AFLA 3P3YA 3OQ3B 2MWCA 1TVDA 4XPGH 2N7BA 1F45A 3LRHA 2FATH 3E0GA 3MRPA 5B39G 5I1GL 3GNML 2IALB 1UM6H 3F8UB 2G9HA 4J7RA 3MMEA 3DSFL 4U6TA 3ARDA 2CO7B 3DX7B 3BJLA 4DKEH 1ZHNA 3KJ6H 1RZGA 4MXWH 2HWZL 4PGJA 4P5MA 3IS0X 4LRIC 3D1MC 1D6VL 1LO5A 1UXSA 4WGVB 2YD5A 5TQ2H 2D7TL 4N8CL 5IMKB 3HLAA 2UV3A 4WY7H 4ZXBA 1KN2L 4P23C 4L8SB 4JPIA 2DI7A 4H0IA 1QA9B 4WI2A 3VG9C 3UTSD 1HXMB 3RIFK 3TV3L 2EDRA 1KCUL 4TPRL 2C9AA 4FZEH 1MFDL 5I30H 1MNUL 2AV1B 4OTXL 5JQHC 1TQBB 4LPCA 1JTPA 5FK9A 5HGGS 4Z7WF 3NACL 5T5FH 1ZVYA 4G43A 5AZ2L 4G5ZL 1FIEA 2X1QA 4WU5A 1MFNA 4NQSA 3SOBL 5T1KD 1NUFA 4PJ9A 3HZVA 4ELMF 4WTWA 2ZUYA 1XT5A 5HGAB 4U6VL 4PGDA 3QG6A 1JVKA 1UJ3A 3KYOB 4LAQL 5FB8B 4HKXA 4WFEE 4WI4A 3OX8B 1W0VA 2MSPA 2R4RL 5T3XE 3PP4L 2VDKH 4K9EL 3DIFB 3T0XA 2CSPA 4TVPH 2C3WA 4R0LB 3EIFA 3DRTA 3HC4L 2X4QB 5JXEC 5IHBA 3O81A 1KCUH 1XGTB 4X98A 2VABB 5D7LA 3NFSH 1NGXA 2Y1VA 2EIDA 1RZJC 1FAKT 4NHCL 1A6TA 5E6YA 5I1EH 2YUZA 4AT6B 4QCIB 1ZT1A 2OX5A 4PJ9C 4GG6F 2FJFA 1KB9K 2AQ2A 1FZKB 4H8WC 3A6BL 4WWID 1I1FB 5FGSA 5HPMA 3VH8G 3TNMA 3FO1B 2ZSWA 1S7SA 3BXNA 1JHLL 4RWHA 5CEYB 3T2NH 4CDGC 2PETA 1JGVH 5FYKD 3TO4C 3ES6A 1CDJA 3QIWB 1T89C 5DJ0A 3MV7E 4KUCD 4CGTA 1CIDA 1FNHA 3IDIB 5HHMB 3TA3A 4L3CA 2GSIB 1S9VB 3D39D 5DURB 1B9ZA 3L3KB 3BQUC 3JXAA 3WJJC 3T4YA 3UTPD 5IB5A 4U6XB 5CLWA 4A2MA 3B6SA 2OTWB 4OZFA 4J3OC 1E4KC 3ECBA 3U2SB 2GT9B 5IEHB 4I0PB 5I66B 5HHXL 3U4BL 2O5ZH 2UYLA 4MB3A 3MROB 3D2UD 1SYVA 1R5VA 1Z2KA 2E8ZA 4KHTL 2J88L 2VDLL 5C9KA 5HYFA 2HA1A 2NR6D 1SJHB 5IMKA 3RI5F 3RWFB 1HKFA 3L1OH 4FZ8L 3BP7A 1VKXB 3RVWD 4GW1A 4LSSL 3ZO0A 5BV7C 5DA4A 1PSKH 1U6AL 4O58L 1MI5D 3OXRB 5A2LH 1INEL 5HPMB 2D0HA 4HJGB 4YQXL 5EUOA 5AD0B 1N6QL 1KENL 1JF6A 4GG6A 5GGSB 3BE1L 5D2LE 5INDB 4PTTB 1G0XA 1OLZA 1KIRB 4N9GA 1X6LA 1YPZE 1RZKL 2ICWA 1HEZA 2JIXA 1GL4B 4YAQB 2CQVA 2V5TA 1G6RL 2PW1B 1W0VB 2OTPA 4OZGF 3UJIL 4G9FB 5GRUH 5ITFA 2JJWA 3DIFA 4LVOB 4D0CA 3AGVA 1FCGA 4Y8AA 2R4SL 3LH2L 4JFHE 3H9SE 1K3ZA 1N7ML 2HJFA 3QUMA 2J6EL 5FKAA 5IB2A 2F9BT 2VNCA 4EQ3A 2QADC 5CZVL 5IEKA 1RUQL 3CGTA 4IBLT 3S97C 2EC9U 5A40E 3MRRA 4XNQB 1OTUC 3V7AG 2HKFL 5H37H 1LEIA 3U4EA 3W0WA 3BP7B 4OZFH 4LF3A 5C6PB 1UB5A 4TVPD 3BDYH 1KB9J 4OFPA 4XMPL 5E8DL 5GZOC 3U6RB 1KTRL 4XXDB 4X9FA 4P9HH 2ATPB 5JXED 1FGNL 1AE6L 3GSUA 4Z7VB 4RCAA 2X7LA 2XNAB 1BOYA 4RIRB 4QRRB 4LSUH 4TSCH 2JELL 4FQXC 4LNRA 3N0PB 3N1QC 1SJVA 1U8HA 2VDPH 1IAIH 4Y19B 4ODTL 2JCCB 2NY7L 1KG0B 2R2EB 3VFOB 1NC2B 4LGSB 4XNUH 3F62A 4QRUB 4U1MB 2XWTB 4TUOB 1ZHBA 2GY5A 4RBPK 1RK1B 1UGNA 2RCSL 3OGCB 5D93C 2FRGP 1DVFB 1S7UB 3I75B 3K4AA 3PL6C 3ZTJH 5I19H 4Y2OA 3TA3D 5GRWA 3FQTB 1A22B 2X40A 3O0RL 3NIDF 4L5FL 5IEHA 3VXPB 2Y25A 5IK3B 3MRNA 4LKCA 4DN3H 1M7IB 5GS3A 4AK1A 3QT2A 1W72B 3G08A 4HMDA 3TGXA 3B83A 4QNPF 3O4LA 3A67L 1AO7E 3G5ZA 4OM0L 5IBLC 3RNQA 5C86A 2JELH 1RUMH 3Q3GB 4LCWE 1CT8B 1EBAA 2YK1H 4NQCA 4KZEH 2R1WB 2NCMA 3UTTB 4YXKL 4MJIA 3TZVA 3C6SB 1HQ4B 3KPRD 5B38B 2FWOB 3G6JF 5A16A 5F71A 1H3GA 4HJ0D 4PTUB 1QLEH 5EIIB 4S1QH 2VXSH 5EIQA 2ICES 4NRZA 4IOFD 1CFNA 3AS2A 4Q0XH 1UT9A 5K9JH 1DP0A 2FD6H 5D93B 5DK0B 4LK4A 2LFGA 2OJEB 3CFDB 3UJJH 2X4NB 1A6UL 3TC9A 4HHAA 3H3PL 3GSOA 2OTUA 4FABL 4PRNB 3FJTA 1U8HB 4H1LG 4LP5A 3WDIA 1MPAL 5I6XB 1ADQL 1AO7B 2AEQL 5E03A 4NO3A 3OKMB 4HWZA 1CZ8H 1MEXH 4RMRA 1EO7A 4LEXH 4HQQL 2D7PA 2Y06L 4LFHG 3TEUA 1XIWC 3TT1L 1TQCB 5IMLA 5DMGD 3QDGE 4DW2H 3VE0B 1M7IA 2BVUA 3V7AE 3U7YL 1T0MA 2MQ3A 1NC4D 4M9OA 2J2ZA 1NCBH 1AI1H 5L2JB 1RIHL 3BW9A 3RL1A 3TM6A 4R90H 3WL9B 4JFXB 4RZCB 5F7EL 1RFDH 4M1GL 1OL0A 2IPTL 3UTTA 4K7PH 1CFVL 4NRXB 1T6WA 2JCCF 2JLLA 12E8H 3PUCA 4P2CG 5E7FA 4J6RH 2VISB 4U6YA 4PRBB 2W60A 5CEXB 4YEFA 4YXKH 5L6YH 4RIRA 1WCBB 2DDQL 5DI8B 1EEZA 1HILA 4DTGL 4P2OB 1NCWH 1NL0H 4I8DA 1TENA 4JRYE 1G6RB 1QA9A 3FHAA 4ZPVA 4HIIA 3S37X 2FIRT 3F58L 4PUBH 3O9WB 5CD3B 1BVKB 4NQDD 5EDXA 1ES0B 4L4TE 3A6OA 2DI9A 3LHPH 4ONFH 4Y1AB 4LBEA 3SO3C 1VENA 4JB9H 1CF8H 1OM3L 3S3SA 4KY1H 3V5HA 2Z8RA 4S2SB 1UH3A 4WHYH 4GS7C 3TN0B 3VD3A 3H7BA 5T33H 1YJDH 4WHDA 1WAAA 5DSCA 3VFGL 5HYJB 5FA4A 3ARFC 5L7XL 3QG7L 2GYSA 1YNTB 2WQ8A 4K7PL 1U42A 3L7EA 4LASH 1MCQA 1IGYA 3B4NA 5EZOL 1XGQA 4Y4HC 1DQJB 5K59F 5E8NA 2R0ZH 1AGFB 3KAAA 2H1PL 4X98B 1RQ5A 1GPOH 2YPLD 1LP9B 3ZDYF 4XHJC 1BBJA 4DGYL 4NKDA 4PJDF 3ARBB 3ZDZE 1DUZB 3KPMB 1MFDH 5I30L 5E94B 1DFBH 5KVFH 4HSQA 5ENWA 3V6BR 5D7KD 1RPQA 1JN6A 2F74A 1N2RA 2IAMC 5HHNB 5J6GB 4Q9BA 3EDDA 1JPSL 3BX7C 3LHPL 1KJVB 1BPVA 2EIZB 4M61B 1P6AB 5EZOH 1ACYL 2X5PA 4PJGA 3C8KB 4G6JL 3VRIB 3C60D 3SDXB 3OKMA 1PY4A 2X9YA 5C0JA 2JJTC 9CGTA 5T33L 2X41A 1T5XA 2EYRA 4UIKH 3Q6FA 5EBMB 4LLVB 5EFIB 1MUJA 1FG9C 3ZDXE 2I9LB 3DHJA 5T3XL 3QXAA 1KCRL 3VXTB 3QNXB 3OPZH 4OB5H 5TE7L 5LGJB 4UT9H 3QUYB 2XTJD 3N1FC 3P11L 1YNTA 1NAKH 1DEEA 1J0KA 1KIQA 2P7TB 3IRZA 3KWWB 4LLYB 2AKRA 1KPRA 5GRVL 5KOMC 2H41A 3K2UL 4LKXB 4MQXC 2VISA 4Z7VF 1MCPL 3DJ9A 1P4LA 2D0FA 4WW2F 1DUYB 3QUZD 3NZ8B 1ZAGA 4I3RH 2SEBA 4G6ML 3RWGA 4YJZL 3P4MA 4UMGA 3QUML 3AM8C 5C0BD 3ILPA 2R69L 4P23B 3U9UB 5DD0H 3DX8B 3SDCD 3ZKMC 4QRRD 4PRHD 3OV6A 4IRJB 4E5XB 4HBQA 3BO8B 1RVFL 1PKQE 1U8NB 4KTEH 4X99B 1QR4A 5GS2D 1BWWA 2EDWA 5LQBH 2EE6A 1EX0A 4LLVA 2OR7A 4F7MA 2GQHA 2JB6A 3NA4A 3QHTC 5FO7A 1YMME 5ITFB 1OT1A 4Y4FD 1JPFB 5D2LA 1GGUA 5E5MA 5J7CC 5EOCL 3HKFA 5D5ME 3PWNB 2B0SH 3QEGH 4ODSL 1A9EA 3TH2T 3RY6C 3PJSA 4LHQB 4A6YH 1AQDA 1FORH 2FSEA 1RZGB 4KMQA 1LP9A 3NZHH 15C8H 3SKUD 3MCKB 5DEGB 1WBZA 3KPRA 3UTSB 4NQEE 2R2CA 4UBDC 3HMWL 3BUYA 3H42H 3TV3H 4POUB 1DUYA 4TYUA 3L3GA 5IW3A 3OBAA 1DJSA 2WNGA 3P4OA 2ZUSA 2AEPH 4XPTL 3K3QA 4KROC 1MRFL 4D9RD 3GB7A 1DLHB 5BW7C 5L0QB 1IJ9A 5B39B 3MACL 1RUPL 3RWJB 3GSQB 3HUJA 4RFEA 1H15B 3CVIL 3STZA 4FXGB 1MFCL 1N4XH 2H8PA 4LSSH 4JLRB 4YHLH 3EJJX 1UJ3B 4YNYA 1T22A 3QFJD 3EJYC 2XT1B 4FQPA 2BOBA 2A1WH 2FX9H 3WNLA 4OV6F 3I75A 2XG5A 1FN4A 2UWEF 2ADGB 5I8KL 4N90D 2BSSA 1T7ZA 1B0GA 3CD4A 1DEDA 2AKRB 2F19H 2RJMA 1WV7T 1F3DH 1BQHB 4ODUB 1MIML 1WZ1H 3KPRB 2W0FA 1P4LB 3S5LG 1R5IB 3ARUA 4QCIA 2APBA 3WNKA 1I8IA 3GMRA 3OR6B 5K59E 2DICA 3V6FB 3L3GB 5I6XC 1K8IA 3C6SA 5B38A 1N7MH 4HPYL 1YEDB 4XGZA 1WWWX 1BJ1J 4NGHH 3WLWD 5I1EL 4WO4C 3R8BB 4PY8J 2VZ3A 4LSVL 3TIDB 4LLWB 1LHZA 3BKYH 3I02B 5FM8A 5I74C 1Y18A 2PCPA 3T3ME 2QSCL 1Q9LB 4KUZH 1W8OA 4X99A 4U1JA 2COQA 2DQUH 1T7XA 1PW3A 8FABB 1MCOH 4RQQA 2ZPKH 4Z7QF 1A9BB 2GJ6D 1AD9A 3FO0L 1FNSH 5L2KE 4NO3B 4X7DC 5CMAB 2Q86A 5F21B 3ZYOA 3QIWD 3S37L 4NCDA 2Y07H 4E42B 5GS0C 3GI8L 1C12B 3KJ4C 1W8NA 5D7JB 1S5HA 4ELMB 4J3WA 1ZEAL 3BZ4B 4MAYD 4R3SA 2Z4QA 4AG4H 1UQSA 1FVCB 4DOHE 4ZFFB 3FRPG 3FMGH 4JQXA 3ULVL 3ROOA 1CICA 2AK4D 1EAPA 4S1QL 1X4ZA 1RJYA 4PYGA 4G42A 3W9DA 2OP4H 3MV11 3OR6A 3GMRB 1QNZH 2BY0A 1IGTB 4WUUA 5GRJH 4ERSH 7CGTA 1U0QA 5GRVK 1U3HD 3MRDB 4P9MH 4FQ2H 4U1LA 4FP8H 2WIIB 2IAMA 1S9YB 2IQAB 2Q87A 4MD5A 5CGTA 4XP6L 1CGSL 3MJ9H 4ZSOA 1OTSD 2ADIA 3TCLB 2V9RA 1FGVL 5E2JA 4Z76B 1UACL 1NDGB 3W5MA 4XPHH 3BPNB 4H88H 5E56A 5I1KL 4NZJA 1T22B 4PRPE 2ARJB 2HRPL 1A8JH 4G8EB 5DJCB 4NZUH 4AIZA 4JQIL 1G7JA 2F5BL 4N0UA 5D6DA 3VFWA 3QIUC 4OGYH 1FN4B 3ARGA 3BSZL 5IV2B 4L8BB 4KZDL 1QHPA 4G3YH 3PWPB 5C0RH 1QSZA 2ZUXA 4FP8L 1ZKAA 5GSRA 5KSAD 1MI5B 3GGWA 4DKFL 3IB4A 5F1NB 3BH9B 5IW1A 12E8L 4KQ3H 5EZJA 3C5ZD 2IAMD 1EJOL 4LU5L 4Z77A 2HMIC 4MCZA 3NOIA 4PJHF 1V5JA 2DIAA 2HLFD 5K9OA 5MP6H 4OKVA 5D71L 2FIKA 2C26A 2HTKC 3F7YB 3SKNA 2J8HA 2IQAA 4YXHL 3U46A 3RWHA 2PYED 4EN3A 3L3OA 4RNRB 4DUXA 1OGAA 5MEQA 1IAKB 5GGRB 3ULVE 3RKPA 2Q3ZA 5T1LA 4M48H 4U33A 3MV7B 3Q6GH 5HHMD 1OAZL 1AHWA 4Y19E 1BIHA 2XQYG 4QRUA 4U1MA 3PHOA 3MV9B 1CDHA 5D1ZC 1FBIL 2GJ6B 4MA8L 4QOKE 5C0JB 1WBXA 1BIIA 4HAGA 1PDKA 2V2XA 3D3VD 4KVNL 2A74B 1P7QD 4XCYA 5EFIA 5AYUL 2ZUTA 1IGIH 4L8CB 3IAQA 2VUOA 4CMHC 1FNGA 2B1AH 4I0PD 3QZWG 1K8DB 1SEBB 3MR9A 4IRSD 4TQEH 2MHAB 3HI1B 4ZFFA 1TVHA 4Y5YA 1EAPB 2EDQA 5HHOA 3DI3B 3PWJB 2LAGB 4PGBA 5DS8A 1OCWL 3D39B 3TZVB 2FWOA 4GKZA 5DC0A 3RWCB 4NJAH 4P5KB 1I7ZB 2C4FU 5F1KC 3S4SB 3MJGX 5IVXF 3HC0B 4KKBD 1Q9OB 3TBWB 1ZLWK 4EEEA 1ZLUH 5GS0D 1TNMA 4NYLA 3VXQA 5DHVA 4BSWA 2H1PH 2B1AL 4CVXA 2JB5L 3C8HA 1LNUA 4OT1H 3RVVC 2EZ0D 4H8WH 3OKDA 3ZDZF 2ATKA 4OLVH 2ARJA 5ALCH 3MRGB 1VGKB 4XVSH 4Z7WA 1NGZB 2AXGA 1QO3A 5JQ6H 4FFVC 1ZANH 3BZEB 4MA7H 1G7JB 1HQRB 3QFJA 3VFWB 1PQZA 5ADOH 1OP3K 4HWZB 1QOKA 1IC4L 5EN2A 3DO7A 2E7MA 2WUCL 4V1DB 1PZ5B 2Y23A 5CZXC 1CL7H 1FL3B 5B22A 5F9WC 5IB1A 4NQUA 1OQXA 4LPYA 4MX7B 1H5BB 3ESUF 4UU9A 3O9WC 4PJBB 4Z77B 1EXUB 5DFVC 2NY2D 1A7RH 4GRWH 4OT1L 5C0AD 1MFAL 3EO0A 2EEBA 2YPVL 3P0YH 2DQEH 4LRNL 1UZ8A 4DTGH 4KXZI 4JFZL 1RK0B 1RJZA 5CEXA 3FRUB 2QR0B 5ICZA 1CDIA 2VUYA 3HCVA 2ZUQB 4DVRL 2P44B 2VZOA 4GRWB 3T0VA 1YJDL 2BOCA 3F12B 3VFGH 4HJJL 4NM8L 4CN6A 1ONQA 4F9PA 3IVKA 4HMCA 5MHSE 3O3BA 5GGUA 3W2DL 4OLUL 1I9IH 3FAWA 1OM3H 5J57B 3H9SD 4HH9A 4UQ2A 5DGQA 1ES0A 2F5AH 3M8OL 2FBJH 2GJ6A 5BQ7A 1WSST 4Y1AA 1J8HB 1LE9B 3QFJB 4JKPH 3KYMB 4JM2B 4NPYA 2A6IA 5GJTH 2X44D 2EH7L 4S2SA 5D9SA 4W4OC 3WSQL 5HD8D 1K6QL 3SQOL 1EO5A 4Z0XA 4MA3B 1IM9B 1MY5A 4F37F 5BVJA 5SX5H 1FORL 3S35X 1S8DA 3AS1A 1JFQH 1KPUA 2ZOLA 1P6FA 3TO2B 2WINA 2EZ0C 2IBBA 3RPIB 4NBXB 1UH4A 1LQSR 5K9KB 3JSSA 2YD7A 1QSED 4FRWA 5TE6H 1Q9KA 3OHXB 1NEUA 2J12B 4K94L 3DXAD 2FEEI 1QSFD 1IEBA 2FX7H 1G1YA 4OLUH 3DX6B 5EC1A 2GK2A 1SQ2N 3S4SA 4MJID 1FLRL 2ZUUA 3FRUA 4TRPL 3O4OB 2OLDA 2W9DH 1EMTL 5C8JA 1KTLB 5CWSB 4LQFL 4V1DE 1FL6B 4XVUC 3TCXA 4PB0L 2NY1C 5ACZB 1I8MA 2XWJB 4PJAF 3TN0D 4QT5B 3ULVF 3QO0A 3ZKQD 4POYA 3C8KA 3SDXA 1JGDB 2IJ0C 1BZ9A 3QQ3B 4G8FA 5HHQB 3BRFA 3MNZA 3GBML 3MODH 4M7LL 1BECA 1IFHH 2L0DA 4P2YA 5MENE 5TGBA 5IHZA 3NA9H 3K2UH 1EHNA 3UDWC 3LS4L 3FT2A 1AGEB 5I8KH 3GMOA 3HI6H 3BMVA 1JHLH 1H5BA 3EFFA 3KPTA 4P4RB 5IFHH 1TTUA 4MD0B 4J4PA 1W0WA 1F3RB 1JTOA 5ANMA 4HS3B 2WUBH 4OZHA 1A6AA 1R3KB 2ARJQ 2O5YL 4LQFH 2FYYB 4XWOD 2P7TA 1CXIA 2AJVL 4NJ9L 1KTDA 5FYJD 3VJ6B 4P2RA 3EO0B 3GHBL 4M8QA 1CDBA 2VL4A 1HINH 4NQVB 5I1CL 1HOCA 2DIJA 1CGWA 1RJZB 3GMQA 3RDTB 5AG8A 1J0ZA 1S9XB 2DQCH 4XP9H 3WFEL 3C2AH 3QYCA 4ZOBA 1K4DA 1P9MA 3QDGB 4F3FA 2VDQL 1XGRB 5IFJA 3PQYB 1NBZA 1RURL 4CBPA 1FAIL 1Z9MA 3D0LA 4OJFH 5F6IC 3GEWB 5FOBB 1G9NL 3N1MC 4TVPL 1HK6A 4N0CC 5CJXA 4UQ2B 1SJEA 4KDTC 2P5WD 3MLYL 4PJBE 3BHBA 2B0SL 3N9GH 1J8HA 3WV0A 4X6EB 1QFWL 1F3JA 4JRXA 1OB1B 5KVGH 1HYRC 4MNQE 4XVUD 4F7MB 1RUKL 3HC4H 1T1WA 4APQD 4PJIF 1RZFL 4Y5VA 4HDIA 4ODSH 2NPLX 1N6UA 3IDNA 2M2DA 1DANT 2YBRA 4J3UA 2CKBA 1W0WB 3BDXA 3NCCB 3QIBC 5LG1A 5JR1L 4UB0L 3U4AA 5EO1B 5ITBL 1VA9A 1TJHH 5JW4R 4EVNA 1DBKH 4IIQA 3KNBA 3MUGA 1UJ3C 2F53A 4MJ4A 5FUCE 2ZPKL 2HRLA 1VHPA 2EXYD 3MLZH 2ERJB 1PLGH 1RZ7H 25C8L 2OL3B 1KBGH 2IALA 3TO4B 1HHIA 3RRQA 1OPGH 2LE9A 1F6AB 3IF1B 4UTBL 3KDMB 4UT7L 3ARDB 4ZXBC 5FYLH 3I6GA 4M6AA 3HZYA 4QRPE 3DETC 5JDJA 4RAUB 4RGNC 5CSZA 2X1PA 4S11A 4PRPB 3S35L 4JO3L 1KJ2L 5DRWB 1KC5L 3HLAB 3MNZB 3HAEA 2W0KA 4L9LC 1I7RA 1LK2B 2FDBP 2P8MA 1CLOL 2KL6A 4TOYH 1XF4B 5BZWB 5AAMA 4BYHA 3QDJE 3MUZ1 5C0RL 1MVFA 5FM5M 2DQGH 5T1KB 1X5FA 5JPMA 2KUTA 4I77H 3G6AB 1Q1JH 5KZCB 1XCTB 5TFSL 1AGDA 2VR5A 4MS8C 3AU1A 3PDGA 5EZLA 4K8RC 2A1WL 4PJFA 2W0PA 4ZFOL 1B0GB 3QG6B 1SEBA 3MR9B 4U3HA 1NEZG 2WLZA 3O3EB 4IDLA 1H0DB 3KPNA 5E4EC 1KEGH 3IFNH 1YA5A 4YDJA 1YECH 1L0QA 1RMFL 3RDTD 3BEWA 4U7SA 5C0IB 1TZGL 5H8DA 3LKSB 1F4XL 3QUKA 1F6AA 3IF1A 4G7VL 5FO8A 4QF1A 5D7LB 4QRTB 3MLZL 4HUUB 4Y4KD 5ETUB 3MBXL 1F8TH 3LN5A 5TDPB 1SY6L 1NBVL 2F54A 3ARFD 5MI0B 5KS9F 2EXYC 4DGIL 1KEMH 1LP9E 1I3GL 5IROA 5CILH 2YHGA 1NAML 4G8IB 2Q1EA 3KHQA 3O6FA 1J0YA 3OKEA 5EBLB 4WEBH 2YUXA 2EXWC 2DQDH 2RR3A 2ED7A 4N5UA 4Z7WB 3EDJA 3P9MB 1QNZL 1UEMA 2FJGA 1OP9A 4LVOC 4GAJH 3FMGL 2YZ1A 4E42A 1GZQB 1LO2H 5I1LB 1S3KH 3GSXB 1FNSL 5DHXB 2DQFB 4ODHL 4G8GD 1WWCA 3H2WA 5TDNA 2WWMC 4XCEB 1SEQH 4I77L 4ZUUB 1U3YA 1MCNA 1BGXH 4NFDA 2UWEA 4G7VH 1Z5LB 2V2WA 3RZWA 3X17A 2VZVA 1IGTA 1OT2A 1K5NB 1U91A 1HXMA 1FGNH 2NY4D 4ETQA 1KUMA 3IJSA 1ORQB 3C87A 1D6EA 5I8EA 2PYFA 1LVEA 5GZND 3QPXH 3BDYL 1DBBH 2QR0A 4UDTA 2EYTA 5CSZB 1GRWA 2UUDK 4P9ML 2BVQA 2NY7H 4NQXB 1FIGL 4U1HB 1AFVH 4OF6A 4Y4KB 1R5WB 1I9JH 1WICA 3ARYA 4JQIH 5FB8A 2C1OB 3TBVB 3OX8A 4QHNA 5EU3A 2EECA 1MWAA 2W0LA 4TSCL 3QXDA 1TJGH 4R0LA 3BSZH 1DL7L 1QR1A 1JUFA 4GG6B 3ZTNH 2AK4B 3RZCC 1NC4A 4LEOB 4S1RH 1XF5A 3VXUA 1XGTA 4C58B 1CK0H 2HFFB 5F9JA 3DUUB 3CXHJ 2WANA 4I0CC 1U3ZA 2VLJE 4PUBL 1FDLL 4MMZC 2DQFA 1QKZH 3DTXB 2RBLA 2UZXB 4HUKB 1OOAA 3B2UC 1U95A 4XZUA 5B3NA 3ZKXC 1FZKA 1F2XK 1HDMA 2AABH 2DLIA 1MPAH 3SDDD 3DX7A 3BFOA 3VXRA 4G8GE 3QUZB 5I74B 4QTHB 3PGDA 4LCUB 2Y6SD 4WWKA 1A4JB 1QSFE 4HAFA 3QCTL 2C1PA 3MRRB 3M17A 2BVTA 5JDSA 4XP1L 4WFHE 4XWOC 2E27H 1GGTA 2F15A 4NFCA 4X8XA 3TJEL 1IC5L 5CS7A 3V79C 3CLEH 4X4MA 3SE4C 5E08H 1OTTC 5D5MB 1CBVH 5AYUH 3VFNA 1MHHB 4KK6D 1QRNB 3HR6A 2OTWA 4YHNB 4WEMB 2Z8VC 1ZT4A 4KU1A 2VSCA 1CU4H 4L8CA 4BFBD 2IGFH 4M93B 5FDWB 4EIGB 4D9QD 3UZEA 1IZKA 4JQVA 4NWUH 1OF2A 3MRHA 1HHGB 2IWGA 4XX1E 2XWTA 4TUOA 3U0TB 3GRWH 2DM2A 3LSOA 1S7VB 4PGBB 4HXAH 2ID5A 4TSBH 1BEYH 5D2NE 4R90L 4U6HB 3ZE2F 3K4ZA 1BX2B 4HJGA 2H32B 4JFPB 3QUZA 2PYEE 4JY6A 1G7PA 3WFDL 4J3SA 3VWJB 4WUKH 2AJZB 5C0AE 2EDFA 2CIIA 1BFSA 4I4WB 1I3RB 2WW8A 3EGSA 2WUCH 4MQ7A 2X70B 1HEZB 2DLEA 3BD3A 1T2XA 2CK0L 5JQ6L 4GFTB 3MODL 4M7LH 4G9FA 4Y5VC 5J6HA 5HDQH 4RA0C 4HG4K 4D3CL 1IEAA 1GOHA 4OZGE 4JN2A 4QGYA 2XOTA 4LEOA 5E95B 4JJHA 1C7TA 4OGZA 4UIMA 3QUMB 5IB2B 3EDEA 1MRCL 2I24N 2KQMA 2Q7NA 4Y5VB 4ZFGL 4L3CB 1S9VA 5IFAH 3FB7A 5IR1B 4HK0B 5IMOB 3HZKA 3QI9A 4XCFH 1SM3H 1I4FB 3HG1E 1LEIB 1IKFL 4PJBA 4XWGH 4QLRA 1MFBL 1AKJA 5A2KH 4N0FB 1KLUB 2CMRL 4HJJH 3ZT5A 1WITA 2BRRL 4XMLH 4W70A 1MLCB 3PL6D 5IMLB 4U6HA 5DJ6A 2VXTL 4AMKH 2I9TB 4WI9A 1FNAA 2R29L 3IFOB 4TUJB 2OL3A 4X0KA 1HI6B 3SPVB 3FT3B 3D69A 2BNRD 1N5AB 3F12A 4GRMA 5E9DA 5KVDH 4NZRH 3VFOA 1WFUA 5D70H 4XH2B 3PL6A 3RIAK 1SM3L 4H1LA 3PDOB 1WEJH 2M1KA 1MHHA 4NSKB 2W60B 1H9VA 4K8RD 2PR4H 1T5WB 2JJSA 3FQTA 2XXCB 3SN6N 1WBYA 5D7IA 5FV1L 5IK3A 5D2NA 1LK2A 3RHWF 1RSFA 5F7MC 3NAAL 4WU7A 3WJLA 2K3TA 6CGTA 5JW3H 4M3KB 4QXUH 3G5ZB 4OQ1A 4Z7OE 4Y16C 4PRHA 3GK8L 2ZCHH 3V6OE 1CGXA 4WJ5A 4Z9KB 3K1DA 4OLYL 1XH3A 1LE5A 3BGFC 3CFJB 2PUQT 2DTML 1D7FA 3ULUD 4KI5D 5CP7A 4PTUA 2AERT 3JZ7A 2VXVL 3O8XD 3NIDE 5FYJE 3VWJA 3RY5A 5IEKB 4MD4B 1BQLL 3DOSA 3DUSB 4GS7B 3TN0C 3GJFA 1CZ8L 1IGYB 3V0WH 3OG6B 3K46A 2APFA 3NA9L 2A6DB 5FO9A 2QHRH 3CCHB 3RVTD 3U7YH 5DVMA 2CDEB 2FX8L 1AI1L 4TRPH 1FRGH 5F6IB 3VI3E 4H0HB 5TDPA 3FB8B 1G84A 1R3IH 4J8RB 1WVZA 2B7DT 2XFXA 5F96H 1R0AH 2P8PB 3BIKB 5IVXB 3LQAH 1EFXB 3OL2A 4FTVB 2E7CA 3QQ3A 4G8FB 5HHQA 2NMSA 2A83A 1FH5H 2YC1A 3MA9L 1R3HA 1RJLA 4LP4A 5I1DA 5I0DA 3EYVB 4KMLB 2I26N 2NW2B 5IESL 2EIZA 2R2EA 4GW5A 4JFFB 2NY4C 1QVOA 2F54E 5C2BL 3IFPA 1T2QH 4AENB 5IBTH 3LAFA 3RVVD 1ZS8B 3QNZB 1KTDB 3QDME 3GMLB 4K7FB 3BKCH 3VG9B 1E4XI 2DQIL 5DJXA 3CSYA 3VA6A 4XPAL 1FQ9C 3FO0H 3P9WB 5H2BB 3QP3A 1RU9L 3MBXH 1Z5LA 2V2WB 3PV6A 3JWOC 4JG0L 1R6VA 3Q3GA 3PQYA 4XP5L 5IGXL 2G5BB 4KKCC 1FCCA 3KWWA 1JGEB 1N5YL 2UVFA 1J0IA 1LEGA 1R0AL 2BK8A 1BVKA 3UTQA 4BA8A 1E6OL 2QADB 4WRLA 5L7XH 3C2AL 3IDJB 4K3JL 5I8EB 3UXFA 4UOW1 1XF2A 2Y7QA 5F89A 4Z5RA 1SBSH 1DN0A 5IT2L 1KEGL 3MRLA 3MLPA 1EFXA 3K4DA 2JTDA 2XRAH 4ORZC 5JORB 3V5HB 4N8VB 1D3CA 3UPAA 4X6CF 1KULA 3FOLA 1A2YA 3NIFF 2YC1B 2C1OA 3TBVA 4DZBB 3JTTB 1SYSB 2PXYA 4PJHB 4PRNA 5CP3H 3FL7A 3O2VH 4YX2L 4YHKH 2AGJH 1JZ4A 4LQ1A 5GS0H 2PW2A 2H2SC 2BJMH 2GTWA 2CLVA 4ZUTA 4P3DB 2CH8A 1EA9C 1NLBL 4BQCA 4Y16B 1XF5B 2VH5L 2CPCA 4M7KH 4KJYB 2B1HL 3FO2A 3R0MA 1UACH 5JOFB 3F7QA 3IKKA 4PLOB 4XPHL 5DJDB 5FOJA 4IJ3C 3TBTB 3NCEB 3KNBB 2K7QA 1MHCB 4XBGA 4LSTL 3B9AA 3HPLB 4HS6B 5IM7B 1X7QA 4JO2L 3S35H 3LQZB 3KYKH 1JI1A 4S1DD 3P40A 5L2JA 4NGHL 3ZMRA 1L7IH 3DETD 1DBBL 4NHUA 2XZQH 1UJTA 4YGVA 2XTJC 1FNEA 4XBEH 4O4YL 1TQBC 2QSVA 3L3HB 5C0GA 4RX4D 4HFWA 1S3KL 1PYWB 5FGRA 3W0WD 2FSEB 1ZK9A 4QNPE 5CINH 3L3JB 3QPQC 1LMKA 4N5ED 1YMHB 25C8H 4K7PY 4X6CB 4ZO6A 3WJJA 3QIUD 3SKMA 2WWKO 3SKJH 5CJOH 1A4JA 1BGXL 3BIKA 5IVXA 4YHMH 4P4KD 3WCYA 2NTFA 2E3VA 2EYRB 5LAXA 5TPWL 3EHBC 1ORSB 3QDMA 4OI8A 1CGYA 2BSTA 3BE1H 3FOLB 3PE9A 5EU5B 3PABB 5KZCD 3N06B 1XF4A 4ZPVB 4DUVA 2HLFC 5DVLA 2J6EH 4I0KA 5IVNA 1FO0B 4CAGA 1HHJB 4LFHD 2V7HA 3QIWA 4QHMA 2IF7A 4L3EE 2H8PB 4XC1H 1OSZB 4FZEL 4HUXA 4LKXA 5E8PA 2OP4L 2RB8A 1V8HA 1HZHH 1MHCA 1WFNA 1D5MA 3HPLA 1OF2B 5IM7A 1T83A 1Z3GL 3IJYA 2R56H 2DN7A 4JRXE 3D9AH 2LVCA 7FABH 5T1MB 5TPWH 4YBHA 4X6DE 5JMRA 5ILTH 2AJXH 4PBXA 1NLDL 5C0EB 3UBXI 4JRYB 1A6VH 3HG1D 4LCWD 1H3PL 2E9WA 2VDML 4XNMA 4C56A 3QDMD 2UYLB 3BGAA 1KEML 4HUMB 2KKQA 3MROA 3QB7C 5F88A 4C4KO 2VR9A 3SGEI 4WW2C 4W4NA 2R39A 1T1ZB 1XGUA 1SJHA 3KPMA 4O4YH 1BFOA 4NO0D 2XA8H 4S1DC 1DLFH 1O7VA 2ZZUT 4YFDB 4OFKA 2NTFB 2Z0BA 5T1DH