25C8L

Catalytic antibody 5c8, fab-hapten complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
b'DIVLTQSPAIMSASLGERVTMTCTASSSVSSSNLHWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCHQYHRSPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG 5C8
molecule tags Catalytic antibody
publication title Structural basis for antibody catalysis of a disfavored ring closure reaction.
pubmed doi rcsb
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 25c8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 25c8L01
4LPXA 1FPTL 1MFDL 3UTOA 4JVUA 1SY6H 2PO6A 1I1YB 3ILQC 1H8NA 4XXCA 5TF1H 2DTSA 3UTPE 4HDIA 1YPZA 5C0BB 5F8RC 3NA9L 3OTTA 3PWVB 4C83B 1ZGLA 1KTDA 4R3SB 4Y5VC 1FNSH 1T89C 4X7EC 3MA7A 4YDIH 3QRGH 4E41B 1G9NC 3S88H 3HMXH 1HHGA 2Z8VC 4FQPA 2Y06L 3SDDA 3RP1A 4RRPG 3BP6A 3CDFA 2YD3A 1S7XA 2CR6A 1A6WL 3GO1L 2ATPA 3GRWA 2LAGB 3S7GA 5AAWA 4JFHE 2E6JA 3FFCB 4K94C 4HUWA 5CEYB 1PVHA 3H0TB 5FO9B 2EEBA 4HUMB 1HINH 4JRYA 5I1CL 1A1NB 1REIA 1XIWB 1M4KA 2W9EH 4KY1H 3T77A 3LKRA 4KAQL 4NOBA 3ZE0F 3QH3B 3IDIB 4K71B 4ZTPL 1BPVA 4HGMA 4ONHB 3UAJC 4OI8A 2BK8A 2Z8SA 3SE3A 3VXUA 3QNXB 1KCLA 4JR9L 5K9OB 2HP4A 3R0MA 3PHOA 4K3EH 2A83A 3DJ9A 3BKYH 1ACYH 4IEFB 3QA3A 1UWGL 3N85H 3O2VH 1NMBH 4HULB 1FVCB 3BGFB 4UUJB 2AEPH 4QHMB 1J5OH 5SX5K 4QRSB 3S5LG 2A1WH 3KLDA 1JN6A 3KPSE 2PTVA 2FO1A 3VI3F 2C5DC 1KYOK 1K8IA 3HRZB 3UJTH 3GHBL 4U1LA 1IL1A 3S3PA 2BVPA 4G8GA 5E0QA 3HE6A 4FA8A 1Q1JL 3GKZA 3M45A 2NNAB 3OL2A 4RBPK 1YQVH 2ESVD 5D7IF 4MA3B 3D87B 5IVZA 4FABH 4XMLH 1HIML 3C60C 4E9LA 4NQCB 1RJYA 3QJFB 4UT9H 4WW2C 2VL5B 3WIFA 4AM0A 4NJAL 1KXTB 2R29H 3S35L 1OTSD 4OFDA 3K46A 3HN3A 4ZO7A 2CKBA 3O9WC 3DSNA 4KRPB 5IW1B 3RA7L 4I3RH 4BK4A 1M7IA 2NY2C 4TQEL 3MO1A 1I9IL 2X1OA 2R2HB 3RPIA 3UMTA 2QQLL 4FP8L 1QRNB 1NLBH 1NSNH 4U3XA 4CU7A 4MD4A 4UB0H 4WHCA 1TNNA 3QIBD 1KLUA 1W0VB 1P4IH 2ED9A 2ESVA 1T0NA 1CXHA 4YDVB 1BFOB 2AABL 4C56E 1QO3B 1YEHH 1CLCA 4HIIA 4QHUA 4HIEA 3W9DA 1T3FA 2E9BA 4L9LB 1NL0H 5ICXB 4KHTL 1ZHNA 5IB1A 1DBAH 4NRZA 4AENA 4P3WA 3H7BB 1NGPH 1MY7A 3AY4A 4HIHA 1QFUH 4AIZA 2Y5TB 2B5IC 5HHPB 2OMNA 3PWPE 3UXFA 1QYGL 1U8IB 3E2HB 4JB9H 1I85C 4HWEL 4MJID 4B50A 4BSVB 1BJ8A 1T22A 4PB0L 1SEQH 4P3CL 1FZMA 5CBEB 4L3AA 2PNDA 4NUJA 1ZSDA 4X9IA 5CCKL 1JP5A 3MRQA 1MPAH 5E8DH 5FHAL 1E6JL 4PJ9B 4O5LL 1B0GB 5F1NA 5D70L 2JB5L 4OZFH 4JZJC 3AM8A 1JTOA 3CFJB 3U2SA 4JFDB 8CGTA 2MQCA 3BGFC 4QRRD 1KBGH 1F58L 2V6HA 1KJVB 1QKZL 4FXGA 5ELIA 1MLCA 3MUGA 3CPLB 5A43C 3HCVB 4OGZA 1LEGB 5L6YH 2ZUQB 4I18A 5D2LA 1D5MA 3U4EA 2YUXA 5E2VH 1QFPA 1AGBA 1E28A 1PEZA 3G5XA 5I76A 3ARRA 1E6OH 1QD0A 5C0BA 4CVXA 4RGMC 3MRMA 1LO2H 4Y5YC 3EZJB 2A6IA 5D1QD 5DEFB 3SDAA 4DCQB 3QIWD 1BM3H 2VLRA 1CD0A 2W0KA 1RZ7H 3OWEA 1P2CB 5DMKA 5GS1B 3M8OH 3DV6B 4S10A 4KI5D 5DI8B 1JZ7A 2JJTC 3OG4B 5E4IA 2ZUWA 4X7DC 4ZUTA 1YMHA 2R23A 2R1YA 3BW9B 3WIIL 4HC1L 3LKQA 4I9WE 3TNMA 4R8WL 1KCUL 3VFSA 1KJ2A 4JRXB 1DBAL 5FIEA 4JRXA 3G9VA 2Y9RT 1NMBL 1QFWH 4WW2A 1WITA 4WEMB 2AQ3A 4WHYG 3DVNA 4H25B 4DGIL 4NC2B 1WAAF 4M7ZC 4XHJC 2AJSL 2HRPH 2P46B 5FV1L 5DD0H 3JWDH 1B3JA 1UA6H 4M6OH 4Z76B 1EZVY 3KXFA 3OSKA 3IU3A 4GXUN 5GGRA 2DD8H 5J3HC 4IDJH 3DMMA 3RY6C 5IFJA 2OYPA 3GSQB 3VXMA 1FYHB 4OCXL 3QHFH 4RBPH 3QUXB 4EUPG 4MA8L 5EU6E 4NJAH 2BJMH 2VSCA 4ZUSA 5BQ7B 1GGIH 2WBWB 3BXNB 3PHQB 4NQVB 2NY4D 1QKZH 2DWDA 3DYOA 2FR4A 4YZFE 4QRRB 4C59B 1KV3A 2CSPA 1R6VA 2L0DA 3O9WA 3LPWA 3FT2A 1MEXH 2W60A 3PDOB 1CF8H 3ZDXF 3WJLC 1NLDL 1VHPA 3EOTL 1EEYB 1JNLH 2PO6D 4MDJB 4DQOL 3FB6A 1MWAH 1CWVA 2N56A 3P4LA 5TQ0H 2ED8A 1NCCL 1FSKC 1I8IA 5I1DB 1INDL 1OF2A 1DVFC 1UENA 2GITB 3C2AH 2CXKA 1OHQA 2Z31C 4BELD 3D3VB 1KENL 4QRTB 3JWOC 3R0NA 5IOPB 1FIGH 2H45A 5C9JB 3SDDB 3E3QE 2AXFB 2HVJA 1IAKB 4JZJA 4F58H 4Q0XL 2ICCA 3GJEA 4GOSA 4IHOB 5T5NG 1DL7H 1QFWI 2QBWA 3O6FB 4HK3J 1HI6B 1ADQA 3O3BA 5JPMA 2HJLA 4HS8L 2OK0H 4IOFC 5J12C 5ITBL 3PXHA 3DRQB 4WI9A 4M5YL 1MUJB 1DQDH 2B0SL 2B20A 5J6HB 3MLUL 5INDA 1KLGA 3O45B 4M43L 4BQBA 3VJ6B 5ERWB 1U3HB 1PYWB 4I3SL 4TULL 1T5WA 5MEPB 2FLRT 1EX0A 1YEIH 2XZCL 2NY4B 1JI1A 4X6EA 4LSVH 2AJYH 1TTUA 2J6EH 2BVOA 4YXHH 4EXPX 1DBJL 4X6DB 1AGCA 1MWAB 4FTVE 1FZOB 4ORZC 15C8L 3V5KB 2EDXA 3SGEH 2YRZA 5I73B 4RNRA 4XT1C 3FQXA 3QA3B 1UA6L 3O8XC 4RA3A 4H8WC 1SHMA 5C0IB 1DFBH 1J12A 2W9LA 2WIIB 2GJ6D 3EYFB 4PJAE 5D7LD 3MR9A 2D7MA 3QAZC 1H5BC 5DJ0B 2EDYA 4G3YL 1BFTA 4Y1AD 1FRGH 1WC7B 2P44B 2VE6B 3QEGL 3T0ED 1BQLH 32C2B 3N1QC 4C54A 1UZ8A 1IVLA 2AI0L 3CDYA 2PTUA 1NAMB 1W72H 1MHHB 3QWOA 3G6DL 4R7DB 3VGAC 1ES0A 4J6RL 4ELMA 4NO0A 4OZ4A 4GAYA 2XICA 3SBWA 2YC1A 5D4QA 2XQYG 4EBQL 3L5XL 4XB8A 2FLBT 1M7DA 2QHRL 4H1LA 2RGSA 4GRLD 5F44A 3CK0L 3MLXH 1RZIB 1MVUA 3BVNB 4PJ9D 2MCPH 1F5WA 3EO1A 4UT7L 4X7SL 5F88A 4U1MB 1I4FA 1MAML 1P4LB 1PX4A 3BJ91 4IRJA 3MBEC 5ICXA 3H9HB 3V6BR 5GRUH 5FOBA 3V52H 5DD3H 2ZSVB 2P5WB 2FH6A 4PRPA 2DAVA 1N8ZB 5BS0E 3EO9L 1AQDB 2OP4L 1PKQB 3VH8A 1QEWB 3ZDZE 3WFHB 3NACH 5MI0B 5IM7B 4NC0B 5DWUH 4H5SB 4PLKC 2E3VA 3M07A 3KLSA 5F3BA 4NDMB 3NA9H 4BSJA 5C09A 1QLFB 3V7MA 2A6DB 4ZDHB 2V2XA 5HYQB 1EHLL 4JANB 3U7WL 3MCLH 1JZ4A 4YHML 3P40A 4DKAA 2EDWA 1KCRH 3AC0A 4Z7WA 1CD9B 4U1HB 4RGOL 1KPRA 5F8QC 3ZDYE 5HPMB 4G6AC 3P9LB 2GY7B 2ZP0T 3GNMH 3I6GA 3MLRL 4CU6A 4RMQA 4PR5B 4GBXA 1KFAL 3V5HA 4ZUVA 1EEYA 2HG5B 5FKAA 1CR9L 5CAYB 4EZMA 4ODWB 2A6IB 4QHMA 2EXWD 3IS1X 1OSZA 4H20L 3V4VH 1U91A 3CLFL 4HWNA 3ARBC 1HILA 3O41A 5EU4A 1L7IH 4AEIH 1MREH 2XYCA 5D7KE 5ABDE 2FR4B 3QDGB 2IFFL 4HKZA 5FO8A 1HYSC 5CD3A 1BFVH 3ZYIA 2Z92A 3TPUB 5D1XC 2J6EL 4JR9H 1IGIL 4LPCA 3DETD 5BV7L 1NLDH 3PV6B 4X8JB 1MCNA 4DQOH 4I77L 4LRNH 2CQVA 4M3JA 3T3PF 3GMMA 1FFPA 4TN9A 2EO9A 1QSFD 4OF8A 3GKWH 3SGJA 3MLTB 3P9LA 2PXYA 5BS0A 1RIHH 4LU5H 4DVBB 1Q9OB 1QLRA 1HN1A 2B4CH 4KKLD 5T3XD 1DQML 1KUMA 3LB6D 4JFOB 1CI5A 1N59B 5C7XH 2LFGA 3DVGA 3CFDB 3TZVD 5L2KA 2X4PA 4UILL 3FQRA 4ZFGL 5EU6D 1NEZB 3ZZ1A 4F7TB 3UYRH 3D3VA 1EGJA 2IALB 4ODUA 1A6TB 1IRAY 2PYFA 5A1AA 1LWRA 2YD5A 1MCHA 1U93B 1S7WB 2RHEA 1FFNB 4CNIA 1DLFH 3SBWC 2H26A 2DQHL 4WHDA 1IKNC 3E8UL 1EFXB 1FV1A 1T83C 4H88H 4EQ2A 3QEHA 5LBSH 3UZQA 1L6XA 1C5BH 4YNYB 4HBQA 4ODSH 2VLRD 2R4SH 2W38A 1CT8B 1LDSA 3KPRA 4FFVD 4YLQT 2HTKC 3X3GH 1DUYB 2HVKB 5I15L 5C0FB 1WTLA 1NDMB 3LSOB 4QXUL 2UZYB 4F7MA 1AO7A 2UZIH 4XP5L 4GSDH 4CW1A 4X6BB 1C8PA 4X8XA 3V5KA 3KLHD 3JBG7 4HZLB 4WUKH 3RWFB 4XCFH 2HJKB 5TH2A 5IHUH 1S9VB 2K7QA 3GMQB 4W81A 4L1HA 1F45A 3CXHJ 1ZLWK 3WXWH 4LCYA 5MERA 4LOUC 4ZAKD 3MROA 4PGEA 4BA8A 3NIDE 5F9DC 2DS4A 1IZJA 2R1WA 5D2LF 3GBNL 5T33L 2E7LC 4MCYB 4JFEB 5A2FA 5HHPA 2BERA 5AYUL 2Q6WA 2NW3B 4DN3L 5ENWB 3BZFB 1HSBB 4LKCB 4APQD 1KACB 1T22B 2AEQL 5F6IC 4MJ6A 4EI5D 3IGAA 3L3IB 1F3JA 4EBQH 4QF1B 2B1HL 2DLTA 5E56A 4HIJA 3VFNB 4HK0A 3CUPA 1ZT7A 2OM5A 4PGBB 1NPUA 1BBJB 3TYGL 3FO0H 3MXVH 1JGVH 4P9HH 1BEYL 5HYJA 1DEEB 4DGYL 1V7NL 1B0RA 2QR0B 2EEDA 1Z0NA 4L4JA 1D5BA 2OTUB 3NVQA 1FGVL 4QY8B 1Q72L 1DVFD 1F13A 3LEXA 4ODTH 3U4EB 4I18B 5D2LB 3IAGC 1J9CT 5AAMA 4LVNB 5JNYA 4U1MA 3MRDB 4QXWA 5KVGH 5T1LB 3OKOB 4KAQH 2X41A 4XI5D 3RA7H 1I7ZA 4F15B 4UTBL 1G6VK 3VGEA 2HKHH 2GJZA 3RGVC 1T66D 5EG6C 4UOW0 2UZIL 3LOWA 5SV3A 5E5MB 2CKBH 4WTXA 4BKLB 2ORBH 5ALBL 1HE7A 3V6OA 2ZNXA 4TVPD 1JPST 3VFWB 3OQ3B 2XY1A 3TFKC 1K4DB 4U2YA 1RUQL 3V0WL 1K4DA 4N9GA 5AYQA 1OLZA 5FYKH 4Z5RB 5HBBA 1CXFA 1WFOA 1DQJB 1A7QH 3M1BA 1DBML 2KL6A 3D9AH 5DJXA 3F5WA 1QYGH 1N0XH 4JDTL 2KQNA 1RZKH 4HKBA 2AV7A 4MB5A 1U8NA 3DETC 3PWLA 3PL6C 1CG9B 1VEOA 1A1MB 1MRCH 5JLZB 1J10A 3MLSH 3IKCB 4U6VH 1FZKB 4OCSH 3DXAD 1WZ1H 1J0KA 3MFGB 2WMPA 4GKNA 3L3GB 4ODWA 4TSBL 4LCIL 5C0GB 1J0YA 5KTEH 4TTDD 1CLYL 4P3DA 1PG7L 3C8KB 2P45B 4PJHA 4XBPB 5TGBB 2ZUTA 1EXUA 1OTTC 4Y19E 5D1XB 5E6ZA 1Q9LA 4OKDA 1Y18A 1EJOL 3BQUB 5H94A 3MGTB 1D5IL 3EDEA 3NAAL 1NBVL 2O5XL 3BEVB 1RIHL 1J1OL 3JSSA 4LU5L 4JFFE 3O4OC 4PLNC 4XNMA 3WIFB 2DQDH 3WN5B 1T5XB 2EXWC 2APTA 3FOLB 2W91A 3TN0C 1PSKL 1RZ8A 2FJGB 2OR9L 3MV11 2Q86B 2QSCH 1OP5K 3RVUC 1T7XA 5DURB 2EIEA 4X5WB 4HGKC 2XRAL 3S8WA 1MJ8H 4BQ6A 1G7PB 3MRJA 1CXIA 2Z35A 2A83B 3AAZB 3VI3E 2QHRH 1KGCE 3QRGL 4X6FA 1CTNA 5EZLB 3GUTA 5IJKA 3MREB 5D7JB 3D39A 3MUZ1 3ARGD 3L7EB 5F96H 1J87A 3HR6A 4OLXH 3IS0X 1YYML 3MYJB 4NRZB 5DHXB 3SDXB 1U42A 1YEGH 3WYRA 2XT1B 1NDMA 2P5EE 1BZ9A 3DGGB 5D5MF 3MOBH 3QO0A 4G5ZL 5TPWL 2JJUA 1TJHL 2NLJB 3A6CL 3L3KA 3L3OB 4DW2L 1AIFA 3ARXA 1QBAA 3DROB 4X7TB 3UTPD 4GRWH 3UBXA 1FRGL 2YK1L 2DLIA 5J56B 2WAHA 3ESVF 4JO3H 1GPOH 4M03A 3QDJB 5CKAA 4PRHB 2L7JA 4Z8FH 4M3KB 5C8JB 3R06A 1X5LA 2AAVA 3D5OF 4JY6A 2VDQL 4QXGL 4ODUB 1X5JA 3TYFA 5DVKA 1FL6B 4XP1H 4XBGB 1I8KB 3QG6A 1IARB 2XWJB 3O6FA 4POYA 5JZ7C 4LVHB 4MA3A 3VH8B 2EDFA 4Z18A 3T0EB 5IVNA 4U1SB 5BVPH 3RWIA 3U4BL 4F9PC 2MCPL 2UYLA 5FM5M 5ITFA 2AXJA 1CXKA 4TNVK 5C08B 1SJHB 3O3AB 4PRID 2VDPH 1Z9SA 2DLFL 1F6AA 4DCQA 5CWSB 1MH5B 3UYPA 5FECA 4GG6B 1MH5A 3N0PB 3UTSE 3UPRA 3C6SA 4Y2DB 1HNFA 1ZWIB 3GMRA 1DEEA 4D0BB 5GZNC 4GW4B 3TCLB 2OXGA 2OK0L 4PBWD 2J1KA 1K6QL 1P9MC 1YPZE 3QZWA 2J8UB 3QZWG 3HCVA 4U3CA 3SY0A 5KVFL 3LN5B 3WFZA 1KB5L 1ORQB 5EC2B 3PQYA 3CFCH 1AY1L 1R3IH 3RU8H 4L4VE 3MV8D 3GB7A 1BAFL 2GIYA 4GLRH 5CUSL 5D7IA 2HMID 3DI3B 4U2ZA 4XRCB 3S34H 3MRIA 3ZE1F 3L5IA 1JNLL 4LSTL 1T1ZB 5DMGD 3OKDA 1EGJL 3ULVD 1FFQA 4PJBB 3UO1H 2VZUA 4JLRB 4AL8L 3H9SD 4HS3B 5HY9A 4JY5L 4PRBB 1S5HB 3FONA 2GUOA 2X05A 5CLWA 2FWOB 4JFQB 2JLLA 1AKJA 4WFED 5DJ6B 5C09B 5HYQA 4R2GD 4I8DA 1TENA 2RIKA 5F9WB 1MCRA 1OQXA 1J0HA 3TVMA 2DN7A 5EC1B 1L4IA 1FNGB 3C5SB 3IDIA 2OTUA 2PXYB 4JN1H 5BS0B 4JGUA 4EOWL 2RFXA 5DQJA 1IGJB 3DX8A 3EUUA 2XKSA 3MLUH 3BFOA 4OFVA 5EULV 5SWZD 3TF7C 3V0AC 4Y4KA 3JV4B 1UH4A 4GAJH 3FN0L 4OQ1A 3MBXH 4RQQA 1UYWH 1K5NB 4XCYB 3D39E 2ARJB 4F57H 1X5GA 5KVEL 1FVDB 5K93A 1EIBA 1FO0H 1KIRA 5KW9H 2CDGA 3WDJA 2EDKA 3KYNA 2WP3T 4JPIA 1SVCP 4X5LA 4YDJA 5JIHA 1RZJH 1EFXD 3AMKA 3QJHB 3TVMD 3BZEB 2JELH 5FGCB 1JPGB 5HD8C 2H6PB 3NZ8A 4TUKH 2VLKB 4XMKH 3VXOA 2Y23A 4Y5XB 1D5XB 4Q9BA 1E4XI 2DYPD 2VO5A 3ECBA 4HT1H 4NQCE 4UDTB 1KEMH 4PJ5B 3T0XA 3RTQA 1RZ7L 1P7KA 1VGEL 4GS7C 1FJ1A 4WI8A 5JW4N 4JG0H 1QVOB 3RHWF 1OAKL 2DQDL 4XGZB 1TCMA 1JTPA 1FFPB 3ALPA 5GZOC 2XTJD 3QXTA 5T33H 3T3PE 1WWCA 3ZKXC 5TQ0L 3L3OA 2ZCKL 3ZYJA 3K2MC 3Q1SH 2ERJB 3WNKA 1A6VL 2AJUL 5IJVB 1OB1A 4KK5D 4D0DA 4CVZB 1R0AL 1RUPL 3MBED 1WEJL 1ITCA 2GCYB 3NCFB 4PRHD 4JKLA 4TTDC 2W9DL 3H9YA 1G1YA 1J0ZA 5JPNB 3FO9B 1YUHA 2IMMA 3EYFA 3EGSB 2M26A 5MHSD 3BD4A 4M6AA 4V1DE 1SBSL 2VDLL 2VAJA 4K3DH 4LASH 2Q8AH 3T0AA 3IRZA 1F00I 4XP4L 3SCMB 4WGVB 3W11D 3MPCA 1GGCH 2EXYD 1YMMB 4P2QB 1MAJA 3VWKB 5AZEL 4Q7DA 3U46A 2FHBA 2VXVH 3RWEB 4YGVB 5JXEC 4N8PA 3WDHA 3RGVD 2N4IA 1T66C 1E4WL 2P49B 1Q72H 4RMSA 3LMJH 4LLYA 3DRTA 4M5ZL 4XHJD 4Y16B 2HFEB 4ZUUA 4I2XE 1LILA 2IADA 4FXKB 4P57B 4UQ3B 5IUSA 3EYVB 3KYOB 1EUTA 2X9YA 2HH0L 4JFFD 1NKRA 2IBZY 4LAQL 4XPFH 2FIKB 1MRFH 4KMQA 4DN3H 3BDXA 2EDJA 1T20B 5ID1A 4TUJB 2I9LB 3QUMB 5HHNB 4DZBA 5T3ZE 1YN6A 2UWEE 2QSTA 1C5CH 3C2AL 3FRUA 4XWOD 1OGAD 4JQIL 1QBBA 3MUJA 1UJ3A 4HIEB 1YPZB 4OZFB 4R7DA 3TBWB 1VADB 2F58L 5DJAB 4R4FL 2VAAB 1TPXC 3RZWA 1IM9D 4BZ2H 5D93B 3LD8B 1S9XB 1FVEB 1U41A 2PYEE 2QQNH 4KTYA 5GHWL 4DGYH 4TNWF 2IH1B 4RMWA 2UVFA 4LL9A 1XZ0B 4A6YL 4PRPE 1AQKH 5E8PB 1CLZL 3EO1B 1GOGA 3QIBB 3L5XH 4JFXB 4ZXBB 4EOWH 2GI7A 2X89D 4YHIA 2AS5M 5FUZH 4WFGD 3O81A 4KC3B 2V9RA 3T3ME 5HHOB 1D9KD 2BCKB 1FYTB 1YEDA 3HMXA 5GS0C 3EW3B 2CJUL 4Q2ZB 5IKCB 2DQHH 2JIXD 2VRAA 4ZNEE 4X83A 2XOTA 5IK3A 3NIFF 5CEXB 1NFDA 8FABB 1I7UB 1VENA 4XP6H 3RVTC 3CFKA 4TVPE 2VIRB 3RRQA 2D0GA 1RAMA 4L3ED 4FABL 4LLWA 4K9EC 5CJOH 5LGJA 2ZSWA 3NA4A 4EN3D 3S37L 1XGPA 4JM2A 2P24B 1N0LA 1FFOB 4M02A 2ZJSL 1NUFA 5D71L 4GSDL 4S1DC 1JVKA 1G7HB 5I1AA 4G6MH 1KJ3H 5D1XA 2QSCL 1PKQA 4JFYA 5F89B 4JG0L 3BP7B 1NSNL 4TVPH 1HQRA 1I1YA 1OAYH 5C0AE 3FFCE 3G9AB 1YMHB 4YWGH 5HGGS 5D93C 4UNVA 2WW8A 3DV4A 5DK2A 1Z3GH 4N1EA 5AD0A 4N8VA 4TNWK 1QG3A 2XQBH 4G6FD 3S36L 2J8UF 2VXQH 5EZJB 1J18A 4RFEB 1X4XA 2V9QA 1C16A 3OAUH 1DLFL 1UXWA 5HDBF 2Q86A 3GSOB 4BZ2L 3C5JB 1EA9C 3G5ZB 1NC4A 1E27A 5IBUG 4QXTA 5ETUB 4HKBB 1MF2H 5LBSL 1YQ2A 5JHLL 4P2RB 4YO0A 1E28B 4JFOA 1U3ZA 4MAUL 4PJGB 2LABA 4P59H 1I9RL 1YNKL 2YK1H 2VTFA 3C08L 5KS9B 5JXEA 3VFVB 2X4RA 5I74C 2I25N 1U92A 5L2KE 2OQJA 2CDEA 3IDMB 2V17H 3SDAD 1IL1B 3KPSB 3FOMA 3QO0B 2BNUB 5FB8A 4GKSB 5JMRA 3P30L 4M1CC 2GK2A 4UOJA 1PZ5B 5IVOA 1FAIL 3ECBB 1XCTB 4UDTA 5T3XE 2EDQA 1XF3A 1YEHL 5TE4L 4UQ2B 3GKWL 3HAEA 4PRIA 2X70B 4OUOA 2R1XA 2X4UA 4WO4A 1ZGLP 3DECA 1RUKL 4PJIF 4AEHH 3VI4F 2VYRE 1CVRA 4KXZI 4P46A 2A74B 1YUHB 2F19H 3HFML 4K8RH 2PR4L 4YHLL 2F8XC 3SKOB 2O5YH 4JPIB 5D5MB 2Z31D 4KDTA 5BVJA 4OLXL 2VLRE 4UU9A 3R1GH 3RJQB 4OTXL 3S88L 4U1JB 2WWKO 4WDIA 1QR1B 2YD2A 4L8CA 3DBXB 4K9EL 4WFFE 3K1KC 3JTTB 4RIRA 3WS3B 4MNHB 1E6JH 1KLUB 1W0VA 3A0OA 3CVHL 4C56A 1WWAX 3X13B 4A6YH 3CLFH 1FL3B 3WE6B 4XNZC 4OZFA 5INDB 3MRMB 5IHBA 2NY5L 3DTXA 1OCWL 3IKKA 5ERWA 3RTQD 3KLAB 3ZE2E 4M5ZH 1OARL 4AT6B 2I07A 5DJ8B 4OZIB 1NCNA 5GGUA 2R4SL 3H2WA 5I1GL 5IB4B 2NY1D 4MSWA 4S1QL 4XNXL 4LCIH 5KTEL 2DI9A 3ZO0A 3MRCA 2Q87A 3TT1H 4P59L 4ZUTB 1KIPB 4W6XB 3EDDA 4K3EL 5KAQF 2DQUH 4LLUB 1CCZA 4EIZC 2YD9A 2YBRA 3SDYH 3E0GA 3BX7C 5EOQL 4YHOL 1J8HE 5D5MA 5BVJB 5SWSA 2P5WA 1N3NA 5H37G 2Q20A 4JQVA 3KWWA 3QPQD 3LRSA 3OKLA 4ZODA 2EC9U 1PKQE 4DFIA 1LNUA 3VXSE 4QHLA 2I26N 4FG6C 1RSFA 2ZUXA 4JN1L 4WFGE 4BK5A 1AGBB 4MD5A 2HJFB 4XXDB 5CINL 1OAYL 1P53A 3VFUA 2C4FU 3ZSTA 1UH3A 1ACZA 4IMKA 1C5DB 1A7NH 4U1GB 3GSQA 5HYEA 3TJEL 4OF0A 3T65B 3RWDB 4U0QB 1C12B 1NUDA 1MQ8A 1DVFB 3C9NB 3OX8B 4GW1B 1T0MB 2MNUA 2HRPL 3G6JE 3W39A 4ZXBD 5F7WC 4A6YA 5FM5O 4KQ4L 2OL3A 2IPKB 1UQSB 3DNKA 5IEHA 5DRXB 4W4NA 1OGAE 3T2QA 3TH4T 4PGCA 3GB7B 4ELME 5IB1B 3HA0A 2VZTA 2QL1A 3LN4B 4NO3A 3MOBL 3L1OL 2CO7B 4ORGB 1NBVH 4XH2B 3SDCA 1LO0L 3KYNB 3RKPA 1IGYB 4R90H 3BRGC 4JFDE 1X5YA 4K2UL 1OTTD 3KAAA 4S2SB 4XHQA 1SJEA 4LCCB 2P8PA 2KZ1B 3WFHA 2K7PA 1MAKA 3I3DA 1LP9A 4U6YA 1ZA6B 4G9FB 3BPOC 5BJTB 1H15A 5FYKU 3BT2H 1WEJH 1FNEA 4I5BA 4JFHD 3MBXL 3RX5A 4ZOBA 3SGDH 4LCCC 5IMOB 2FL5B 1T6WA 2CIIB 5C3LD 2VXSH 4KVNL 4IMLA 3WHXA 1A9BA 4OAWA 5HGDB 2BC4B 5KVDH 2AV1B 3FRPA 4NQVA 3EIFA 4X6DE 1A7QL 4UT6H 3RVTD 5KSUB 2Y7QB 1A1MA 5LAXA 3D48R 1A4JB 4G9FD 1DN2A 3FB5B 1WFNA 3I2CL 4FTVD 5KSAB 2EKSB 4HKXA 3ULSA 3T2PA 4MJ2A 3TO2B 3WJLA 1UM6H 3VFMA 5EBWA 3IFPA 1EAPA 3L3DA 1NAKL 1W72A 2HFFB 2YUWA 1Z0MA 1RUML 5FAAA 5LCVL 5E99L 5EU3A 1TITA 2NX5A 2FATL 4WI4A 2VN4A 3OXRA 3WFEH 2ITDA 5CD3B 32C2A 2HKHL 4G42B 1K3ZA 3VWJB 1RK0B 5FK9B 4YNYA 4LHJB 4HWBL 5AWNH 3T4YB 3VXMD 1KT2A 3U82B 3U0PB 4CN4A 3ULVL 5HJ3B 1WZMA 3L6FB 1OAZL 5BQ7A 1A0QL 1P4BH 4MQ7B 4K7PY 4PJEB 1T4KA 5ESVB 4OCRL 1YJDL 1JFQH 3SGDI 4YEEA 3V0VA 3B9DA 3T1FB 4MX7B 3NZHH 1FIGL 2HFTA 4KROD 5EIIA 1FZOA 1KTLB 2MHAA 5JMOC 3VFOA 2VXVL 2Z91B 2L4OA 1FZJB 1NC2A 4OD2B 4YAQA 1WSST 3HI1A 4RISL 1AQKL 2XRAH 1BQHA 4M8VA 3BEWB 4TUOA 1NEZG 3MA7B 1CLZH 1NEZA 3E2HC 4EDWL 1S9WA 3KPMB 2C1OA 3FFCD 3S35H 4MNQB 3VRIA 4R97B 4LLDA 4XPGL 1RHFA 1AGEA 1G7QB 2YD8A 2H3NA 1BIIB 5CINH 5SWQA 4ELKB 5MEQA 1BIIA 5SWQB 3N1GC 1IQDB 4WU5A 4I18C 1JL8A 4J3XA 4QOKA 5D8JL 1P6FA 2HJLB 5ECJE 3ORJA 4M1DH 5I30H 4BFIB 5IVZB 3T8XB 4EDXB 1S7UB 4WFEE 4B41A 4JDVB 5I2IB 1C5CL 4UOW1 4LLYB 5DQ9A 4PG2A 3I3BA 3UBXG 4L4VA 2V9TA 1A8JH 2WLZA 3ISWA 4HWZB 1BZ9B 1VFBB 3UTSA 3UO1L 2XPGA 3VRLE 3I9GH 1KEGL 2VXUH 4F7MB 5MP6L 5ICZA 2XACC 2ENYA 2Y6SD 4OSUL 1RJLA 3EKCA 4Z8FL 4OCWH 1UVQA 4X6BA 1UVQB 1B88A 3RY5A 3SDDD 5GXBB 1A6ZB 3SY0B 2NZ9D 4LLQA 4FTVB 3W9DB 1MCIA 3OR6A 3OJDA 4XAWH 2HAZA 2HG5A 1GGTA 3O3EA 1YNLH 2FHFA 4M5YH 2EDDA 2AI0H 5HVHC 5L2KD 3QULA 4LRNL 1WJ3A 4WNQA 3WXVL 1YYLH 3MUHL 2W59A 3KWWB 3U4BH 4Y19B 2VDOL 3H8NA 4MXQC 1A7NL 2PYED 3MJ7B 3BI9X 3L3JA 1S3KL 2IEPA 2AK4E 2AP2A 4ZMAT 1S7VB 1MELA 1BREA 4BH8A 5L88L 4PRNB 1S5IH 3U1SH 4RA0C 3DHMA 4E5XA 3RDTD 4P4RB 1BVLA 4YHPB 4H20H 1AFVH 1BVKA 3NABL 2V2XB 2PUQT 1BP3B 2VR4A 4WI2A 3MRNA 1TVBA 4HCRH 3HKFA 1WIOA 2AV1A 2V7HA 4Y16C 4URTB 5ID0B 5CEZL 5EN2A 1R3HA 3OKEA 3PJSA 4QY8A 2AQ2A 1BAFH 4DVBA 2DKUA 1UB6A 4JDZA 4HXBL 4MB3A 4JDZB 3P73A 4XVJL 4PY7B 3LV3B 3D85D 1K5NA 1G6RL 2AEWA 2D9CA 3IT8D 3IFOB 1T1WB 3U9PH 2ADJA 5FOBB 4H26B 3CVHA 3DX7A 1AH1A 1BVZA 3D85B 3AFLA 4KXZH 3N1FC 2M8XA 2XI9A 3I6KB 4HWBH 1EVTC 2N7BA 2NY0D 2Z93B 2R2CA 2VXUL 2YPLA 5AWNL 4HFWA 3BXNA 3FB7A 3VXRE 3MUY1 4Y5VA 3TO4A 4C56D 4XVSL 2HA1A 2VDNL 4X80L 2DTML 1MIEL 4ZG1A 2EIZB 4KKLC 4G6JL 4JREC 5MHSE 1ZMYA 5FYKE 3BD3A 5FM4A 3MRLA 3O4LA 3K4DA 5F1NB 5T1LD 2BNRB 3C5ZA 5IQ9A 5FDWA 1ZTXH 1YY8A 1YEDB 3LQMA 2H32H 3CFEA 1LO3H 3QUKB 4HH9B 5JIPA 3N06B 1R24B 4NQTA 4U0RB 3ME0A 8FABA 1OCWH 4YHZL 1UG9A 4NBXB 1ZT1B 1HKLL 4G6KH 3JWOL 4ONOA 4CW1B 2JK5A 4RFNC 4WJ5B 5DRZA 5C6PB 2ESVE 4NPYA 5JW3H 5A16B 3AGVA 2BNQA 4R97C 3ARBB 1KTDB 4PJHE 4OZGA 4LPWA 4MVBC 1WBZB 4JHWL 1PDKA 4ODHH 1BQHB 4HIIB 3RY4A 3WSQH 3FO0L 3QIWB 4RFOH 2AJ3B 5ALCH 5F1OB 4FFVC 6FABH 5D7LE 4DOHE 3LHPH 4Z0XB 5E8NA 3BHBB 1KCRL 4MXVF 1A0QH 1P4BL 2G75A 4AG4L 4U6HA 4J8RA 3S37H 4Y4HA 1OAKH 4HK3N 2BX5A 4HS6A 3VFNA 2FECL 4FZ8L 1CFQA 4HS8H 3T08A 3CVHH 4PJAA 3VXQA 3MRFA 1Q1JH 4CVWA 1T5XA 1QBMH 4JO4L 1OW0C 5FYLH 1IAIL 4P5MB 1B2WH 2KZWA 4ZO6A 2AEQH 3LQAC 5H8DA 2NYYD 2ATKA 1DN0B 4XC3L 1GJIA 4WWKD 3LKPB 4IHOA 1BBDL 4L29A 1VSCA 3D0LA 4CU8A 2VERN 2YD6A 4F7CB 3T09A 1GGYA 2D7NA 4MWFA 3MYZA 4WGWB 5D6DC 1JZ2A 4I4WB 4HIXH 1A3LH 1H3PL 4NO5B 4PJXA 4WEBH 1K8IB 5EO9B 4AMKL 4LFHD 1ZT4B 1E0OB 2EYTB 5DEFA 3SDAB 1T4KB 4O9HL 2R0LL 4NKOB 1U36A 2XN9D 3MRKB 2DICA 1AFVL 4P4KA 2PCPA 3GMPA 2BY2A 5DD5H 4G3YH 4CMMB 2YZ8A 1D6EA 2V2TA 1FORH 2MKLC 4YQXH 3ZTJH 3QZWB 2AEIT 3C08H 1C08B 2XA8H 1A6ZA 1RUAH 3AS3A 1SQ2N 5DHVB 2C4XA 5DRNA 4Z78A 2D31A 2EYRB 2HH0H 5JUEH 4NKMA 1SM3L 5GIRA 1CT8A 1MCEA 2IBZX 4L4VB 1JGDB 1KB9K 5FFLA 5EWIL 4LPTA 1D7FA 1VFBA 1NCDH 2FJHA 1MI5A 4XBEH 3WV0A 5LGHL 1GC1C 3BKCH 5JOFB 3BO8B 3GSVB 4QOKB 4M4PA 4GW5A 4DZBB 3MNZA 3CZJA 4N90D 4XPAL 3BSZL 5MENA 4WFFD 1FZMB 3E1F1 5E6IA 1F2QA 3RWHA 5A2KH 5DS8A 2IH3B 4M6NH 1TZGH 5DJCA 5KZCD 4N0FA 4LSQH 3U0WH 5F9JA 1BZQK 5CP3H 5DQDL 5ICYB 1N4XH 3PUCA 5EDXA 4N90E 5F1IA 4HCRA 4AT6A 4NZRH 1J8HB 3ZDZF 4OAWB 3O8XB 4JVWA 1NAKH 3JWDL 3RUGB 3TIDB 4NCC2 3OX8A 4GW1A 1LO5B 2HLFD 4P23C 4OCNC 1QPPA 3DV6A 1CE6A 1RZFL 3LY6A 4DTGH 4U05A 1CDJA 1BM3L 1YDPB 3QDJA 5ACMA 1XEDA 4PS4L 1A3LL 5DFVC 5EORL 4FMKA 4Z95H 5HHOA 3TBVA 1T21B 1OT2A 2MPAH 3LDBB 3QSKB 3SGJC 4WNQB 2PXYC 5KSAC 5DJ0A 1MEXL 1FO0A 5I75B 1RMFH 1YN7A 3WIHH 4QTIH 3V6ZB 4PJDA 3QDMB 4MJ6B 4O2FA 1U8LB 2PYEB 2JJSC 5I16A 3PIQA 5INCA 3C6LB 3FO1B 1VGKA 5DRZB 4WWKB 4OM1H 3L9RB 4MS8C 3FFCA 3DO7A 5DZNA 3SDXF 1GCFA 1SEQL 2WINB 4CGTA 3IYLW 4OT1H 3FQNA 5TFSH 1XF5A 5DC4B 1NMAL 3ARDA 3MCG1 1R5WA 2DM3A 2AJSH 4R4ND 1I1AD 1FNAA 3ELAT 4PLOB 4RSVA 2FEEL 5D7KD 5D70H 4BKLA 4F7EA 3TN0B 4R8WH 4MCZB 4RAUA 4H8WH 5KSUA 3L95A 5C0AD 1BQUA 3SJVB 4Y2OA 4AH2A 1RIUL 4QO1A 5DRWB 3PQYB 5I30L 4KDTC 5FUOH 3UTSD 3MOQA 2IC2A 4RAHA 3SCMD 1A6PA 3KHQA 5CGTA 3QI9A 5JW3L 4KI5C 2JCCE 2VJXA 2OCFD 4RAVB 4JFFB 3KHOA 4D9LH 2EYSB 2NY6B 1T1YB 2X4TA 5T1KA 2Y06H 4GJTB 3OKMB 4POUB 1L7TH 1KNOB 2HTKD 4FG6D 4NBZB 2DJUA 3HB3C 5GGQH 3FMGH 5CFHA 5GS1A 1FFNA 2NY0B 3V95A 4LSRH 4O9HH 2VMFA 3CDCA 2DIJA 3ES6A 4U1GC 3TPUA 3INUL 5EZOL 3CMOL 1QBLH 3IF1A 3TBSA 3MNWA 2D4FA 3T4YA 5EORH 4GRWF 4ZO8A 3C6LC 3PL6B 1CICB 3BYTA 3WFDH 5HI3D 5TDOB 4FQXB 1CGTA 1HCVA 4LCUB 3L6FA 1TDQA 3MRPB 3QBTB 1YNLL 3UDWA 1S7SB 2VSDA 3HPLB 3S34L 4GKSA 1OPGL 3BOVA 3X3FL 3EOBA 3WBDA 2WNGA 3V5HB 4EXKA 5C6TL 1B4RA 4OM1L 3GIZL 3QQ4A 3BKCL 3VDAA 3UPAA 2IGFH 2XQYK 4LDOB 1FGNH 4B7IA 5KBNC 2HRLA 4JVPA 3B83A 1TXKA 1JN6B 3GHBH 3G5VB 5DF0A 4Y1AA 3WO4C 1AXSB 2A73B 3HB3D 4C55A 2VQUA 2N7AA 1IQDA 1AR2A 5F7DB 3B2VL 3DGGA 2XG5A 3TESA 4LSSL 3QDGA 2H6PA 1LEKA 1CD1B 3DOSA 3NOIA 3V4UH 1CGVA 5C0CA 5T3ZD 1ADQL 1CD1A 3OXSB 4LNRA 5BRZA 4XCFL 3X11A 3ROLA 4R7NA 1X7QB 4UV4L 2EDTA 5I8EB 4ZOAA 3LS4H 2CLRA 3GSUB 4MXWH 1KB5B 1RZFH 2WIIA 2FB4H 2XFXB 1JV5A 5GGTA 2G5BB 1L6ZA 2OSLB 4QRQB 3RDTB 4D0BA 3O6MH 2YMXL 1AP2B 5DK0A 2V7HB 2VDQH 4PV9B 1LO4L 2DF3A 1JF1A 2X7LA 4KUZH 1E4JA 1MVUB 3BVNA 3I84A 4OLVH 3FRUB 2XY2A 3PGDA 5ESQB 2B5IB 2EH7L 4X4YA 3GFUA 3ZL4L 4F3FB 5GRVL 4WI3A 3LIZH 3GHEL 4MNQA 3VRIB 4OKVB 3RWCB 4RMVA 4M8QA 2DL2A 5JW4Q 1KFAH 3TYFB 4XNUH 3MV8B 4YDLC 1Q38A 4LHUB 2IPUK 2NW3A 2CDFB 4JZOA 2W65A 4H1LG 2EDBA 4K94H 1EO5A 1G84A 3FQWA 3CXDH 1UZ8B 4P4KD 4PJDE 4NUJB 4IRSD 4XPBL 3X11B 5KANI 3LH2H 1K6QH 2EYRA 2XKNA 1JNNH 5CIPH 3C60A 1OL0A 4U3HA 5CGYD 5I8CB 1TFHA 4O00A 3ZE1E 2R15A 4NQXB 2C1PB 1FNFA 4IJ3C 4S1QH 1HOCA 4XNXH 3VXPA 1FDLL 5D8JH 5EU6A 3EDFA 4XVTH 1CGUA 3SO5A 3AU1B 1AXTL 3I02A 4JZNB 3WIHL 4ONHA 5KS9F 5C0EB 1MHCA 1XGTB 2BDNL 1SYVB 2C26A 1DR9A 2MKWA 4G6JH 3AXLA 1VADA 1OTUD 1U8JB 3E6FA 5E1HB 5GGRB 3EZ8A 3WLWD 5KS9A 3B6SA 3HRPA 2ARJQ 5CLTA 3BPCA 5E1AB 2AK4D 2VITA 1K2DA 3HTLX 3NZHL 2I24N 4M8QB 4KJQD 5J11C 2P43B 4RMTA 4GRLB 5IBLD 3FHQA 3MV8E 3TC9A 4LBEA 1CFTA 2MJWA 3T2NL 1QBML 1IM9A 2W65B 4MQSB 5FYLL 3ZHDA 2O61B 5INCB 3CX2A 2DKMA 2FZ3B 2J4WH 1JGLH 4IJ3B 4OUUB 1A7PH 4HBCL 1OPGH 4U6VL 3B3IB 3BKJL 1K3IA 3EBAA 3TA3C 5CGYC 3MACH 2MTPA 3VFSB 1PD6A 3LKQB 1AE6H 1D9KB 1CICA 3TNMB 3OZ9H 4RFEA 2HLAA 2Y6SC 3MLRH 5CJQL 1JMXA 3VFRA 4HUNB 5HYJB 4K07A 3K8MA 5CD5C 4D8PB 3ZDXE 2CDGB 2XIDA 2B1AH 1O7SA 4WTZG 4GQ9L 4D9RE 3OB0H 3V8CA 1GC1L 3HR5A 4IDLA 2D7OA 3WKML 1NDGB 2AGJL 2GK0A 3VD7A 2DRUA 5HGHB 1P6AB 5EUOB 3G5XB 3FMGL 3CU1A 1GVIA 3ARBA 5FV2A 3C09C 2P24A 4IRSC 2BXYA 3U0PA 4LKXB 1AD0A 2ZWLT 4Z77B 1C1EH 5E03A 4DK3A 2FSEA 4HF5L 1CFVL 3NPZB 1S7TB 4NZJA 5EBMB 4Q9QL 3P4NB 2Q6WB 1AXTH 2PCPB 4ZS7H 4GRWE 5DJYA 3RFZC 2BRRH 1EO8L 3RL2B 1Q94B 5CHNB 5E9DA 3RDTC 5L7XL 2F53E 3RIFF 3ZKMD 3O4LB 3TO2A 1EUUA 3KYKH 4CRPA 2Y36H 1ND0A 3FQUA 5CS7A 1FJ1B 4JPKH 2C3VA 3A6BL 1MHEB 1YY8B 5I1DA 1RU9H 4WV1B 1FH5H 4YHIB 1UXSB 4QYOA 4JKWA 4ZD3L 5J13C 3SE3C 1IEHA 1TVDA 1IAOA 1RHHA 1MIMH 4FNLL 2GT9A 5JW4M 2HT2D 3DXAB 2D3VA 5CCKH 3Q48A 1U8PB 3BESR 2BSSA 1QLEH 2IANA 1NC2B 1T0NB 4OD2A 1WICA 2GJ6A 3MV9E 3PGFL 4GRMA 1RUMH 3GI9L 4EVNA 1NGWA 3UROR 4GMTL 5CEZH 1JPFB 2VLJE 5CJXA 3PWPB 1MCCA 5ESVA 3DMMC 4YBHA 3RY6A 3VWKC 5BV7H 3WUWA 4HWBA 1QSEB 3MBEB 3PDDA 5CD5D 2WK2A 3KNBB 4KTEH 5HVHB 3O6ML 4U7MA 3P77A 3OBAA 2J12B 5BXFB 1YN6B 4MAYB 3BZ4A 4GAGL 3CUPB 4WO4B 2VKXA 2XN9E 4AIOA 2H9GB 2CKBL 1JYVA 4PTTA 2FGZA 4NSKA 1KPVB 3MZTA 4JFDA 4JB9L 1CGYA 5GRYA 1MI5B 3ARVA 5I18L 1NCAH 2Z31A 1NFDB 4CJ0A 1BFSA 4HUVA 4HZLA 3Q5TA 1ZLVK 5FDYA 2VIRA 1DBMH 5C0EA 1JGVL 3G5YB 3IDUA 1N5AB 1KCUH 5IHLB 3KR3L 5CZXC 5KSBF 3AY4C 2ITCB 4NYLA 4S0SD 4DZ8A 5FCSH 3ZE2F 1DUYA 3KS0H 3F58H 4HBCH 4PGDA 4BYHA 4PRPD 4Y5XC 4S1RL 4MMZC 3S96B 4PJHF 2BY0A 1I3GH 1RVFL 5ICZB 4ENEC 4JFDD 3UTQB 4ZS6D 3EJZD 3GSRA 3OGCB 3NPSC 4OZFG 3Q3GB 4CMMA 3V5DB 3MMEB 3OGOE 4TSBH 1JZ5A 1A22B 1P1ZA 1DQQA 2R8SL 5L9DL 3GSNL 3P11H 4PJIB 5CILL 2KPNA 2GJ6E 3MV9A 4S0TD 1QFOA 5C0AB 3F7RA 4OCYL 4OM0L 1B0WA 1VKXA 4WUKL 4NSKB 4JFED 1EAPB 2N1KA 3JVGC 1T03H 1WWBX 3T0EC 5KVGL 2CDFA 2G60L 5I1AB 2CRZA 2R0WH 4I3GA 2X09A 3DXAE 5IG7B 5FGSA 3UX9B 2YSSB 4PJGE 2ZUYA 5IM7A 2J8UE 4PRNA 2GYSA 5F9WC 5FGBC 4YHNA 3B9KD 4LNVA 1X44A 3SDDC 5J4MA 1I3RA 4KWUA 3F12A 5DC0A 3T0VA 2JB5H 1I7TB 2XWTA 1S7QA 2ILLA 5ISZB 3NTCL 4N68A 1LK2B 3T65A 4D9LL 3TM6A 1UWEH 1ZEAL 3ZTNH 1M71B 1A2YB 4YBQD 1U95B 2RFXB 4NJ9H 2C3HA 1IGTA 3HZMB 3KPSD 3KPNB 3TIEA 2I60H 2DM7A 2C7UB 3LQZA 1MIML 5JA8B 5D2NA 5HYIA 2F53A 4PJBF 1MCFA 1T2QL 3SKJL 3O6KL 4I0PD 4OZHE 1UEYA 2VQ1B 2YD4A 4HLZG 3U0TB 1N3NB 3H9ZA 3DX6B 1CDYA 3M17B 2BMKB 1PSKH 4Y2DC 3Q1SL 1PZUB 4YK4B 3U30C 1WIUA 3IU3B 1ZANH 4MNQD 4JAMA 4OM0H 2VLJB 3HE7C 1H3XA 5HDOA 3AB0B 3KJ6L 1AD0B 1F4AA 1QVOA 3W9EB 1RUQH 4G6FB 3MRPA 2AJXL 4LCUA 1T03L 3ULUE 1MCSA 1F02I 4LVHC 4TYUA 2I07B 4P2OC 3QO1A 3U9UA 4PP1D 1QLRB 2P1YA 3VDBA 2APVA 1IAIH 4EN3C 3DLQR 4UAOB 2E27L 2C7UA 2HYMA 2WBJC 4HZAA 4LEOA 3IJSB 3MRFB 1FP5A 4P46D 4QHUB 5DYOB 3MLSL 4CMHB 1ZAGA 4I0PB 1HSAA 3LEVL 1WZ1L 1XGQB 2H1PH 2XN9B 4KKAC 4U6TA 4Q6IA 1DE4B 4U1IB 1VEMA 3RVWD 5D7LB 4WUUE 2Q76A 1NKOA 4HKZB 4HQQL 5FO8B 1DLHB 1GZPB 3JVGA 5C3TA 1VACB 5C0CB 2NX5D 4MSWB 4X6CE 2GQHA 2I60L 3VMNA 4KJQC 4WENB 4G8EB 5F9OH 1U3JA 5C0JA 4AM0B 2VL4A 4JFQA 5DUMH 2R0ZL 3H9SE 1BECA 3O6FC 1QNZH 3SOBH 5JXAL 1ZT4A 4GAYB 2Q7YA 4TPRL 4XP9L 3NN8A 3CFJA 1OLLA 4FXKA 4XP5H 2R2BB 1AJ7H 2R39A 5F70A 1LDPH 2AXFA 2OP4H 1CDBA 4RRPA 1AP2A 5DK0B 3VXTA 3DROA 3QRFM 5JOFA 2Z31B 3I85A 4JPWL 1SYSA 4QRRE 3U6RA 3A67H 2NW2A 3HG1A 5IMLA 3IJYA 4K94L 3W0WA 4OFYD 1U9KA 5KSAA 5DD6B 4FFYH 4UUJA 1B2WL 2WUBL 4BUHA 2GW5A 4MMXC 5TF1L 1RZGA 2GTZA 4LLMB 4DVRH 2KKQA 3QXVA 5TDPA 4DN4L 4RZCB 1NFDE 4M43H 1K4CA 2E7MA 3V6ZA 3GMPB 4M7LH 1H8SA 2NTFA 4YFEA 1KXVC 4X4ZA 1MWAA 3WNPA 4JCLA 4OJFH 5KSVB 1ZEAH 5T1MA 4JDVA 3ZTNL 3LS5L 2XKNB 4N9GB 3G6AA 3ULUC 2OZ4L 1CYGA 5CSGA 3FQTB 1HHIA 2NZIA 1U3YA 4JQXC 1F6AB 3QXDB 5IW1A 4YUEH 1GGUA 2X44D 3UAJD 4JRWA 3VXME 4JREB 1WVZA 4OLWL 2E7HA 2UZXB 3VH8G 2MWCA 3U79A 1KPRB 4PG9A 4HKJB 1MJ7H 4NQDE 3CH8A 2DBJA 5C9KA 1ZVSA 5E24E 5JNYB 4YPJA 1IT9L 4M7JL 5D7SL 4QTIL 5LGJB 2Q8BL 4Y7MA 1YNTA 1OM3H 4C83A 2XZAL 1Q9WB 1ZK9A 3BPCB 2YPLD 4P49A 4RGOH 2EE9A 3FHAA 5GS1C 5IMOA 5TE7L 5I1EH 4F9LC 4JM4L 3UTTB 2FECI 1CS6A 1J11A 1XMWA 3V2AR 4GRLA 5IB3A 1FL5A 1NGZA 1XIWD 4U1LB 3S97C 1MFCL 2IGFL 5DR5H 2DBLL 3S9DB 3EAKA 1VGKB 4G9FE 4LHUG 4J23A 2BRQA 1YMMA 4P2QA 3U0WL 3MRHA 3WFCH 4IM8A 1Q0YL 2AGJH 4G42A 3W2DL 1NCBH 3KLHC 5EC2A 3UDWC 4O2EA 2QQQA 4MDIB 4K71C 4PRHE 2BHUA 5ESAA 4NO3B 2AKRA 1CBVH 1HIMH 4XPTL 1ED3B 1NBYB 5JO5A 1Z9LA 1QACA 1U91B 3V52L 2R69H 4PJFA 3IVKB 4ZTOH 1JRHL 5D1QB 1KIQA 3QFJA 4KKNA 2Y5EA 4MNGE 1VGEH 4ZPVB 4GBXB 5K9JH 4MQXD 1IQWH 4N0UB 4NKIL 2LU7A 4HS3A 1FO0L 1QHOA 5KW9L 4OZIF 3T0EE 1WZLA 5TH2B 1CLYH 4PJGA 5DWUL 5HDLA 2VC2H 1IKFL 1Q8MA 2JELL 2A6DA 1KCVL 2YKLH 1LHZA 2X4RB 3NABH 1QSED 3B5TA 5TDOA 3A6BH 4X4ME 3B9KA 1Z9OA 3HI5H 4WUUB 4PUBH 2BC4A 3F7QA 1P7HL 1X5FA 3CCHA 3O0RL 3IDJB 4Y5VB 5EOCJ 5E8EA 4Y19D 2Q76B 4B0MM 1XGRA 1CGWA 3GIVA 4UV7H 4Y5YA 5DI8A 3AUVA 2I27N 2J3SA 4LQFH 4YH6A 2V7NB 4TVSa 5AD0B 3C8HA 4P9HC 3RQ3A 4W68A 5GS0H 1QLEL 3HI1B 1OF2B 4Y4HC 2E9WA 3MCKA 3NCJH 4JFFA 2CD0A 4FQ2H 4IIQC 2BVQB 5HGBA 4AQOA 4R4BA 2FEEI 1KC5L 3DVIA 1ZXQA 3DWTA 4EDWH 5I8OL 3U9UB 3DURB 5CZVL 4FHBD 4KRPC 1EEUA 5ID0A 5KVEH 2EZ0C 3OAZK 4OLUH 5D1XD 1T1XA 1WGOA 2A77L 3ARSA 3NFPA 4M7LL 4OLYL 3HUJA 4PRDB 5TJWK 2DQTH 3MREA 2PETA 4LFHG 2C3GA 2CLZA 1J0IA 3QJFA 2VLJA 5E94A 5SX5H 2ADFL 1GHFH 4PJEF 1J8HD 4NO0B 5AZEH 3WL9A 2A6KB 4XPHH 1A6AA 5IFAL 5LWYL 4QTHA 1W0YT 3QEQD 4LGSB 1QBLL 1JWSA 3SPVA 5HVFB 1GSMA 3I9GL 2VISA 1HDMA 4UI2A 3GRWL 2QHLA 1N5YL 2J6EA 2Y07L 3PHOB 1E4XL 4XNMB 3REWB 4WEUD 1BIHA 4L3EB 2IWGA 2NTSP 4ODHL 1PG7X 4JHZA 3EOAA 3OJDB 3OR6B 3ARED 5SWZE 2E8ZA 4RFOL 1S9WB 3VWJC 3E6HA 3ARQA 4Y4FD 2UVEA 5CEZD 5I1LB 1HOCB 3VXPB 3GSOA 5EIQA 1JF1B 1YYLL 3KPQB 3SKNA 4PFEA 1N8ZA 4LASL 4NT6A 3K2UH 3OAUL 3BKML 2Q1EA 4PD4K 5T3XH 5HYSB 5L9DH 3GSNH 2UYLB 1YNTB 5BJTA 4JRXE 1BBJA 3ULVF 5DJAA 5E8OB 1BF8A 1SJHA 3O3AA 3VFVA 3DSFH 5ICYA 4EN3B 3AREA 1QPXA 7FABH 4XWOC 5MEPA 2VZSA 1WCBA 2RR3A 5DJ8A 1VEPA 4HEPG 4OGXH 2GFBB 4WCYL 4IDJL 2UUDK 5IV2B 1T20A 4OCSL 3I50H 1XH3B 3QEQB 2OL3B 5D71H 5ILTH 1JTTA 4GMTH 3DUSB 2DQTL 5KSBA 5EZIH 2BOCA 1QZ1A 2RB8A 2IAMB 1CF8L 5IEKA 3E6FB 5E95B 2B7DT 1TNMA 1KIUA 3ZKXB 3VXNA 3RI5F 3PWJB 2D0FA 5IKCA 4XAKD 4H0GA 4XRCA 4G6AD 1I9JH 1H3UA 4U7SA 3U0TA 1L0YA 4KHTH 4XCEB 4XB7A 4EI5B 5EU7E 5I16B 2MQ0A 3BGAA 5DTFB 2P5ED 3EO0B 1KENH 3RPKA 3PNWB 2M2DA 1NGXB 5E70A 1FZKA 4ZQKA 1KULA 3L9RA 5DR5L 2VQTA 4CVXB 5K33A 4G6ML 1H5BB 4KJWC 3ARWA 3VFGH 3VWKD 5L0QB 4KH2A 5DJDA 5JHLH 2DMCA 1DBBH 4JRYB 2CIIA 2W1NA 12E8H 4L4TB 4Z7UB 4EUPA 1UJTA 5IGXH 2R29L 4D3CH 3SE4C 4X0KB 1EEZA 4NBYB 1X4YA 3G6JF 1IEAA 4KI5E 4I3SH 4TULH 4OB5L 1YDPA 4HQQH 3RZCA 1JGUH 1VCAA 2LVEA 4KVCL 1U3HC 4GQ9H 5IF0B 2Q3AA 4MJIE 5GPRA 1N26A 2DMKA 4R26H 4OLEA 1YYMH 1N6QL 3RAJL 1BZ7A 2K1MA 3MLVH 4KKBD 4DKEH 1JPTH 2YA1A 4OV5A 3F6LA 3PWNB 2XTJB 3WSQL 5J12B 2JCCF 4YE4H 2WUCL 4EJ1C 3ZKND 2Y5TA 2O61A 1Q9LB 3TT1L 4YIQA 5D7LA 2F8VA 1CE1H 1QSZA 2ICES 1INDH 1KTKE 3RI5K 4LAJH 1I8MA 3TNNA 5BMFL 5ALBH 4BJLA 3WS3A 2MSPA 5MENB 4KZEH 5C0GA 5DHYB 1FN4B 2A9NL 4I5BB 2A38A 1FL3A 2NY0C 2WINA 4Z95L 3IETA 3KG5A 4MQ7A 3SGKA 1ZTXL 3B9VA 1JHTA 5I9QC 1U8MB 2IQAB 3BHBA 4G8IA 2GHWB 1U8NB 1G9EA 1Z6JT 4XPGH 3FT4B 3ARFB 4XC1L 3DX8B 1D6EB 5I8OH 3IU4L 2F19L 4J3WA 4WJ5A 2O5YL 2R0KL 2E9IA 3V6FA 1RZIA 3BP5B 2BNQB 1D5MB 4OTXH 3QB7C 4KTDH 2WWMD 3RX7A 3FO9A 3EOAB 4O4YL 1ERNA 2COQA 4LLMA 1MRDH 4HPOL 4X4XB 2A73A 1TJHH 3A6CH 4MCYA 5I73C 3G5VA 1IGMH 5C9JA 4XP9H 4L8BB 4DKFL 1E4KA 4G8GB 1DFBL 4ISVA 3SPVB 4TRPH 1I7RB 2FJFA 4X5XB 4F7CA 1G7MB 2BHYA 4LGRB 4Z7VB 4MDJA 1ZSDB 2O5XH 3ROOA 1CXEA 3MFFA 4LOUD 4ZAKC 3NCCB 2DQJH 2YUZA 4XXDA 4N0FB 2LVCA 3NACL 1SMOA 1Z9MA 3CFBA 4X6DF 1I1AB 4MAYC 4JKPL 1Y0LA 4ZDHA 2R9HC 4NQXA 1NCTA 2PXYD 5BS0D 2EKJA 3GSWB 3LDBC 2F5BL 2QR0A 2FO4A 4X6DA 1LE5B 3QDGE 3GSVA 5HGAB 5F1KC 5EIIB 5EPMA 2UY6A 3N85L 4NCDA 3I75B 4X9FA 4HG4J 5EUOE 3HS0B 3IJSA 4P23A 5I74B 4EVNB 4P23B 1ZLSL 4LLUA 2FX8L 1I4FB 1P4LA 5J1SC 3HMWL 5LKNA 1BOGB 4OQTH 5IEKB 4V1DD 1S8DA 4YZFF 2GTWA 5I17B 1NGYA 1VFAA 3OKNB 1K4CB 3RWCA 2D7PA 2H41A 2RQ8A 5DMJB 3O41B 1HILB 3VRJB 1BD2B 4IRSA 2CK0H 1TVHB 5IR1A 2L7UA 2FZ3A 4KQ3L 3RNKA 3W39B 2IH3A 2UUDH 4AYFA 4KK5C 5DGRA 2P42B 5B39G 5IEHB 2ZPKH 2JKXA 1B0GA 4JO3L 5B3JE 5FDWB 3KPOB 4YEFA 4YX2H 5HHQB 3U9PL 1JF6A 1O0VA 1XGYH 4Y1AE 3QUZC 3OF6A 3PGCA 4XP6L 4OZHF 3WJJC 1ZVYA 3IXTB 3O2DL 1IFHL 5JLZA 2ZG2A 4ZQKB 5DHVH 4QOKD 4XPAH 1ODAA 4R90L 3BE1H 4HV8B 1DL7L 4HV8A 1EV2E 5EOCH 1NGPL 1T21A 4JO2L 5JPNA 1NCAL 2ADJB 5ITBH 1EFQA 3MQIA 3WFBL 1UZ6F 5E7FA 1NC4D 3D39D 1ZWIA 4NO2B 1IGFL 3VXMB 5BV7B 4N5EC 1EDQA 1R5VA 1LO4H 4NZRL 4EI5A 4FQ2L 2OTWA 4LCCA 2XNAB 4MJIA 1WV7T 4CN6A 4PJBE 1L7IL 3MJ6A 2W92A 4UT6L 1J1XL 2QKIA 1BVKB 4O51B 2IFFH 25C8L 5JHDB 5IBTH 1F58H 4WW2B 3FAWA 2YKLL 1GHFL 5I71B 1A64A 2C3XA 4X98A 4YO0B 2HVJB 1J1PH 4Y4KC 2X2YA 4KKAD 5KJRH 5J11B 4M6OL 4RIRB 3F65A 1AGDA 2D03L 1U8QB 4M6ML 5F7LB 1GH7A 1TPXB 2J7LA 5B39A 1TTGA 1U2HA 4GKNB 4GRMB 1ZHKA 1SEBB 3MSPA 2O5ZL 4L4TA 4LDEB 1OTSC 4Z7UA 5HJ3A 4EUPB 4XXCC 4J6RH 5D7IE 2ZKHL 3SDXA 2P8MB 2M1KA 1HNGA 4KUZL 2XKUA 3C8DA 5GS0D 1A9EA 3P0GB 2NY7H 1NANH 2NLJA 3L3KB 1RULH 2DIAA 1T89A 3GSXB 2WWKT 1HEZB 1RK0A 5FK9A 3BPLC 1X5KA 3IFLL 2CRYA 1VA9A 1PQZA 5ANMA 5E6YA 1WZKA 4Z7OF 5HHXL 1G7JA 1CFBA 4PRIE 1F42A 4XGZA 4KUCD 4BFEA 1R24A 1I3UA 3IDXH 2H32B 4K9EH 3GGWB 1HHJB 1Q0XL 1QSFE 1S5IL 5FGRA 5EU5B 2FNBA 4YDLB 2NY2B 3QUMA 5HHNA 1R3LA 3MC0A 3SCMC 2ED7A 4L29B 3BAEH 4L5FL 1A7BA 4I9WD 5M7QA 4EDXA 4YBQC 4ZYKB 1EMTL 5ESQA 3ZTJG 1FGVH 3KPPB 3PP4L 3WFEL 2X4OA 1MJ7L 5SWSD 4TQEH 3DTXB 5DA4A 2GTWB 1FDLH 4G8GD 4QWWC 1AGEB 1G7QA 4G7VL 4RGNB 4Z7WE 3LB6C 5JHDD 5E4EC 1MLBA 5H94B 1DLHA 1GZPA 4YHMH 1YEEH 3RVVD 2J88H 3KNBA 1KELH 5F7MC 3QDHA 4HJJH 5EPMB 4JQXA 5KG9A 3U4AA 3HS0A 2OI9C 2IJ0C 1GZQB 1S78D 1CIUA 3L5JA 3MRRA 1BX2B 4MJ4A 1DQMH 2AXGB 5GGSY 2ZCHL 3T0DA 4LEXH 3E6HB 3ZE0E 2CKNA 4IOSD 2V5RA 3HC3H 1V7MH 3LIZL 4FFYL 4UILH 4R4NC 1KGCD 3QG6B 3PWLB 3REVA 1EO8H 5IG7A 3A6OA 3D2UB 4JDTH 5CIPB 3RL1B 4UTAL 3RWHB 3K4ZA 3V4PL 1XIWC 1A6UH 2QQKH 4BH7A 4DTGL 3NCJL 3VE0B 1LO3L 1NAMA 4Z76A 3AXLB 2EDOA 1BFVL 1HXYB 2R1WB 2APXA 2AERT 5EUKB 3TBYB 3HE6C 5E5RB 1MQKH 4OZ4B 4M1GL 2VITB 4WFHD 3S4SG 5K9JL 5EA0H 3B4NA 2LQRA 2W9EL 5C2UB 5FYLE 1DBJH 4Z7WB 4GKOA 4Z77A 1X5IA 1MCOL 4JJHA 4X0KA 4Z7NF 5JORB 1I9JL 2Y7QA 1CZ8L 1I8LA 1JGEA 3UTZB 3DIFB 3CGTA 2EIZA 3BPNC 3IB4A 4NNPH 4LLQB 5IW3A 5F7HA 1V3KA 4P2OA 1MCKA 3G6JA 4G80B 5GGSA 3RVUD 2YEZA 2X70A 5HYJE 1CFQB 4XPHL 3BMWA 1H8OA 2CPCA 1CDCA 4GKZB 3O0RH 3IFOA 3MR9B 5DJXB 4Q6YA 3PWJA 1B0RB 1GGBL 4P5TD 4N0CD 1BGXL 4NZTL 5DMYA 4HPYL 5BO1H 3LCYA 4OBRA 4XC1H 5C09D 4LIQE 4M93B 2PN5A 3RIAK 3MV7B 4U1KA 3CD4A 1BVLB 2J2ZA 4PLJD 4P5TB 4YHLH 4LPVA 1FCGA 4HAGA 4ALAL 1F90L 3VXSD 4CL7A 4HX1A 4P2CG 3S5LB 1UACL 1ETZB 3RVXC 5ETUA 3K2UL 4IMKC 2PKDA 2PO6B 3C5ZC 3L5WA 3RTQC 1Q9OA 4K8RD 4KPHL 4XWGH 4FN0A 4YHYC 1CK0L 3AM8C 3H7LA 2D7QA 1DCLA 2HJKA 1DANU 4AIXA 2BNRA 3HNSH 3O2DA 5MERB 1IQWL 4KRNA 2ZSVA 2GITA 4WWKC 2X4TB 3RKDC 4BSWB 2LTQC 4FOMA 2EYSA 1UB5A 3MLZH 4WU7A 3BWAB 3S98A 5EU4B 4HGWA 3PHQA 4UTBH 1IBGH 1XGUB 2HWZH 5BOZG 2VN7A 2G9HA 1DBKH 4NPYB 3X3FH 3QPQC 3QEHB 3IFNH 5E9DE 1BJ1H 5TQ2H 5D7JA 1B4JL 1PG7W 3BKJH 3KPRE 1QUNA 3WO3B 2A0LD 3CFEB 5I18H 3QUYB 1IGML 3BKMH 5F72S 4LCWB 4DEPB 2ATKB 5LAXB 2DD8L 4PY8J 3KS0J 4L3CB 1BWWA 1N59A 3DSFL 1IC4H 2B2XH 3PWUB 4M4RA 2NY5H 3WN5A 4KRMB 4R3SA 5D96B 5EOTB 4F8TA 1IJ9A 1D6VL 1I9RH 2ENSA 4WCYH 4PJCF 2H8PB 3WKNA 1A6UL 3VG9C 4LSVL 3I3EA 2E9JA 1DE4A 3DURA 4WI5A 3RVWC 2KH2B 5F3HB 3JTTA 4PJCA 1HK6A 4PS4H 4N8CH 1TIUA 1AQDA 2IAND 3F7YA 1AGCB 2CGRL 5DMKB 3UBXB 3P0YH 4XCCH 3MV7E 1F8TH 3ZKSD 3FB6B 2BNQE 5FF6B 1YEKH 4PUBL 3S36H 3V79C 3WD5H 4YDKH 3CFBB 3J7HA 2D0HA 4JY5H 4F58L 1F11B 4PJEA 2Z8RA 3B2UC 4V1DB 3MRNB 3U7YL 5J0BA 1RJZB 2ZCHH 4P4KB 5D96C 5JUEL 5I1LA 4ZD3H 2NXYD 1RHHB 4NZDA 1BLNB 4CVZA 5ISZD 3T1WA 1HI6A 3O3BB 4MD0B 3IJYB 1JGEB 3UTZA 2NW2B 4NC1E 2IPKA 1JZ8A 1AR1D 3O2WL 4OGYL 4QRPB 4I4WA 1CL7H 4K3JL 3TT3L 4J12A 1JHKL 3THML 4NM4L 4Y0GA 3HRZA 3FZUD 5AYUH 1TJGL 4CVUA 4UMGA 2ADGB 4HIXL 4QTHB 3BQUD 1U8IA 2OJEA 5ACZB 1HXMA 5D72H 1AIFB 5E5MA 3FB7B 2PTTB 2XZQH 3VRJA 1BOYA 1XCQB 3QUYD 3V5DA 5DQDH 4KTDL 3GMLA 3BN9D 3PIQB 5CIPA 3GZKA 1JPGA 1C08A 3QR2A 1WF5A 3FT2B 5BXFA 2Y4SA 3KYMB 4X7CC 1ULVA 3WS6A 2IFGA 4KRPD 3ARDD 3CSYB 3KPRB 2YA0A 1G9MC 3SKJH 1G6RB 4L3EE 4GG6A 1A5FL 4F33A 4YXLL 4AL8H 1A1NA 4K2UH 4YGAB 1IEBA 5DSCB 4LRIA 4F9PA 2OX5A 4FQJL 5HYSG 5JR1L 3RPIB 1D5ZB 1D5BB 5CKGA 1LQSR 1M71A 5EN2B 4DKDC 2ICEA 2A9NH 3RWGA 5IHZB 1ZVSB 3I6LD 4PB9L 3P3YA 1MJJA 1AGDB 5E5UB 4YPGB 1OP9A 1PKOA 5DJZA 3HG1D 4LCWD 3RVXD 1PFCA 3HZKA 4OFKA 3UC0H 5F7YC 4XH2A 3SDCB 4DOHB 3ARPA 4OZHA 5TQ2L 4ODBD 4Y1AB 3LKSB 4OD3H 3PWPD 1O7VA 4HMEA 4L8SB 3N1PC 4GAFB 4ZNCD 3ZT5A 2VDPL 4JLRA 1M6OA 3LKOB 1ZHBA 4WW2F 4A6YB 3HMWH 4Y4HB 3VXRA 4GO6B 5BRZE 3ARTA 5GJTH 1L7TL 3NIGF 3IDGB 2DKSA 3D9AL 3P11L 5DO2C 1A6WH 3GO1H 1YZZA 3NCYS 2DQFA 4X6CF 5J1AA 2A74A 2WANA 2AKRB 5D1ZA 3QFJD 2JIXA 4N0CC 4KI5F 1MREL 1WWWX 3IVKA 2P7TB 4ZUWA 2CR3A 3BN3B 5I1CH 1YMME 4P2QE 4ZFZA 2XV6B 3PABA 4HGWB 2ADIA 2CXGA 4WO4C 2VUYA 3LEXB 4JPVH 1XF4B 5HGHA 3LQAL 3MNVB 5F9OL 3LEYL 3RUGF 2YS4A 2DWEA 4OBSA 3KXFB 4PY7A 1EHXA 4NKDB 1SEBA 1LO2L 5EZLA 5C2BH 4NGHL 3GMNA 2H2SC 3DMMB 5IFJB 4LGPB 3TBWA 3EHBD 1YJDH 1KTRL 4ELMB 2QADC 1RUPH 1G7IB 1RU9L 3FN9A 2IALA 3OKMA 3EJZC 4U1NB 5F1SA 2OJZL 4U1HA 3SE9H 3IDMA 3VJ6A 1IFHH 4J3SA 4ETQB 1H0DA 5B3NA 1QQDB 1ORSB 4PBVC 2BVOB 3NFNA 4Y5YB 4P2RE 3GIVB 3DVFA 1MSPA 3VU2A 1IC1A 3X17A 3W81A 4HJGA 4NQCA 4D0CB 3PWUA 3PWVA 2YPVH 1XFPA 4HC1H 3OJ2C 4HFUL 1JE6A 1KJ2B 1GGCL 3CSPA 4FQXA 1K8DA 2AJVH 4RMUA 4ZUUB 1ZLUH 4D94A 4Y88A 5C8JA 5C6TH 5IOPA 4F2MA 1E27B 1UM5H 2EICA 2H1PL 5DZLA 2XTJE 3NFSH 4PJEE 2QADB 1IAKA 4I3RL 4JZJB 5E99H 5CEXA 5HGAA 1ZGLM 2D9QB 2MHAB 1IM3B 1OD7A 4KTEL 4OD1H 5EB9A 2GAZB 1U8PA 3CDGB 43C9B 5EIVA 1DEDA 25C8H 5E4EB 4I2XA 3PV6A 1CXLA 3NCYP 3QG7L 4NQCD 1NGWB 4RGNC 2HJFA 1F4XH 1JPSL 3GSUA 4M62H 4DUVA 4AMKH 3PV7A 5E2VL 4RZCA 4JM2B 3CMOH 1CE1L 5JTWA 1J05B 1A47A 5C08D 4NKOA 2AJXH 4UV4H 1OWWA 4Y89A 3UTQA 4ZPTB 5DXWA 4KZEL 2AK4B 3GM8A 3K81A 4PJ8A 1OB1B 1XCQA 4ZOEA 2VISB 2Z4QA 2CH8A 4J1UA 1XF3B 3ROOB 4Z7VA 4O02H 2LU4A 1DUZB 2JTDA 4XCNA 3ARFD 5H2BB 5BO1L 4P3CH 5FKAB 4LSUL 4FQHA 2JJTA 2BHZA 4MVBD 2VDRH 2W0PA 3V4VL 4OKVA 3ALWA 4DVRL 1H3VA 1CL7I 4RX4D 1LEIA 4Q2ZA 2V5YA 4FZEH 3L7FB 5JW5A 4NNXA 5D1ZC 1LK3H 4P46C 3QCVL 4OV6F 3D2UA 4CN1A 3W0WD 4ZXBC 3BZEA 3REVB 3DUHA 3QDJD 3QQNA 3W2DH 1MNUH 4PRDA 1MF2L 4HEME 2R4RL 4KZDH 4PJ7A 1R3JA 4XVTL 1BOGA 4KGLA 5GGVL 4P3DB 3HLAB 4KQ3H 3ULVE 2XWTB 1PBYA 1FVEA 4PJ7F 4X99A 1UJ3C 4UBDD 5GGVY 2FO4B 1LE5A 1JNHB 4GMSL 1QRNA 3QFDB 5FUCE 4TUJA 3OR7A 1XGRB 3I75A 2DQCH 5DHVA 4Z78B 4QCIB 1EZVX 4Y4KB 3GBNH 2V7NA 1V3JA 1TCRB 3TLRA 2R1XB 2X4UB 5I71C 2IBGA 5L2KB 1XGPB 1KJ2H 5CP3A 4M7JH 5D7SH 4JY6B 5IB2A 4ORGA 1FNSL 3SN6N 3JV6B 3QXAA 4YDIL 4WW1B 1F90H 4QRTA 1EGJH 4FQCH 3QDAA 2VXQL 2X6MA 5HVWA 2F54E 4CAGA 4CKVX 2NNAA 4NUGL 2HKFL 3O9WD 1B6UA 5BW7C 3T2NH 1H9VA 5I6XB 3P0VH 1NMAH 4UAOC 5DJDB 4FFWC 5T1KD 5ESAB 4J3UA 1N2RA 43CAB 4JANA 3K8LA 4LKXA 1CLOL 2RAMA 2IF7A 3QHZL 1FC1A 3D69B 4ONFH 5DJ2A 3S36X 4RDQG 1CBVL 4Y8DC 1WCQA 2AV7B 5HI4D 4OCXH 3WUWG 3P4OB 3PF2A 1EBPA 1FLTX 5IJVA 4JFZL 1NDGA 2DQEH 5DDHA 5GSVA 2GSIA 2YWZA 1F3DJ 1V05A 4P2RD 3MJGX 3WXWL 2QSVA 3QUZB 4XCYA 5B21A 3ZHLA 4WHYH 15C8H 3WKMH 4YK4C 3VGBA 1KJMB 1NAMH 1W72B 5IB3B 3JWDC 3LKSA 5L8JB 4PV8B 4X5WA 5EO0B 2FEDC 2J5LB 4JFYB 1YY9C 4GAGH 5A40E 4WU5B 2AK1H 2X1WL 4YIQB 1MFEL 1S7XB 4M9PA 5DVMA 5KAQG 4XVSH 1I8MB 2PR4H 3HE6D 4K7PL 1OSPL 4Z7VE 3QAZB 1FG9C 3HUJB 4NQSB 5M94B 1OP5H 3MFFB 1IGFH 4NHCH 1GGBH 2F74A 2JB6A 1FFRA 1EHNA 2J8HA 3FB8A 3VRLF 1FPTH 5K9KA 4P57A 2NY1B 5F7NC 3QUYA 5BOPA 4UIMB 3AREB 4BQ9A 1GOFA 1SJVA 4HPYH 1L9NA 2W0LA 3MLTA 4NC1C 1ORSA 3MBEA 4NN6B 3OZ9L 4PV9A 2C3WA 3BH8A 5BRZD 2QQLH 1GYAA 5C0BD 1PG7H 4Z7QE 3HNTH 3FFDA 4TSAH 4ZSOB 1OW0A 4G9DB 4K3HA 3FO2B 4KJYA 1FVCA 2VNCA 1G6RH 3WJJA 3BUYB 3EHBC 1GAFH 3QIWA 2H8PA 4LARH 3VA2C 1V8HA 3SKOA 1RZJL 3K7UA 5EFIA 1YY9D 2BOBA 3BWAA 3B2VH 1L0XA 4R0LA 1EAJA 2ADGA 3OKLB 3BZFA 5CILH 5IROC 1CK0H 5GRUL 3PP4H 4LF3A 1FG2A 2PTTA 4LCWE 1EFXA 5SX4I 5I8KL 1NEUA 1R3LB 4P5KB 4UV7L 2FJFB 4GFTB 4Q9QH 1J88A 5GS2D 5E2TH 7CGTA 1ES0B 2ZKHH 1RZ8B 1CFNA 2FJGA 1A6AB 2E6PA 5F1IB 4P0DA 1RJZA 2R2BA 3CMGA 4YE4L 3BT2L 1RZKL 3D25A 4PJ8B 2HN7A 1BLNA 3VXUB 5K9OA 4GG6F 1FQ9C 4QHKI 4P5TC 5JPMB 1T1XB 3KXFD 2EH7H 2R2EB 1BFOA 4OLYH 3MGOA 1HH9B 1KLFA 2X4SA 5I17A 3LRGA 4R2GC 2FJHB 2AJZB 1NJ9B 3LZFL 3MTRA 5HI3C 2FBOJ 2IMNA 5C92A 3WUWB 3UPRB 4QGTA 4M7ZB 1WBYA 4Y16D 1RFDL 3SKNB 3TWCL 3KVQA 3QHFL 2NTFB 3Q6FA 3STLB 4C4KO 5IQ7L 4DAGH 3MMEA 4QF1A 2EC9T 4LNRB 35C8L 4XTRD 3KYMA 2EDRA 1HQRB 4JCMA 1HHHB 5A2LH 4HUXA 1ZT7B 2VLMD 2XA8L 1W2KT 1ZS8B 3CLEL 3FL7A 2CMRL 1MI5D 4MGXA 1HH6A 5B22A 1DQJA 3M1BB 3X3GL 3LN4A 2DM2A 2OXHA 2XPGB 4AEHL 4QRUA 5MEOA 5DK3A 3QUKA 4HH9A 5JA9A 1KPUA 4FXGB 1QFWL 4I77H 5FCUH 4ZPVA 1TZHB 1NCWH 4PR5A 4KV5F 3K1DA 4LLWB 4JN2B 4LVEA 4P2YA 4D2NA 5DFWH 4H25A 1MHCB 1XGTA 2V5SA 4JE4B 4NN6C 4LSPL 4WWKA 2DB8A 3GMQA 4NRXB 2F58H 2BOCB 1MHHA 1XF2B 1RZJC 2NY1C 1HXYA 4FMFA 5EUKA 3TBYA 4UDUB 3P0VL 4HWEH 5F93C 2YPLB 2ZUQC 2JJSA 4PB0H 2GFBA 5HGDA 5FGBA 3QDMA 3GI8H 4RGND 2J4WL 4ZTOL 5D7JC 4NZUH 3TH2T 3OR7B 5EBGA 1AC0A 1PZ5A 4WV1C 1K85A 4I13B 1HHHA 3MRHB 4EI5C 3B5GA 5FYJD 1FN4A 3TP4A 1KIPA 5D6CB 1X5AA 3TYGH 4M1DL 5CSZB 1HYRC 4K23L 4LIQL 5KSAD 4F33B 3L3HB 3QWRA 1PW3A 4Q58C 4RAVA 3JV5A 2H2PD 3ARGC 3S5LA 2P5EB 1HHGB 4JRYE 4LSRL 1CGSH 3L5WB 3WN5C 5E9DD 5EZOH 3TFKD 5IVXF 3KDMA 1A21A 5FA4A 4N0YH 3KDMB 1P7QD 4MAUH 3GMOA 1D5XA 2KDGA 3MV7A 1I1FB 3SE8H 3FZUC 2DQGH 4E42B 3NBNA 3SJVE 4L4TD 1AJ7L 1KB9J 3DRQA 5HXMA 4FFWD 3X13A 1RJYB 3BQUC 3KPPA 3WHE0 5GS0L 4N1CA 5C70A 4TOYL 4NP4L 1SVZA 5IHUL 5J6GA 1PLGH 2AJVL 4ZSOE 5D9SB 3SO3B 5I6XC 3QIUA 1TJIH 1A6VH 1H0DB 2X1QA 4KGJA 2BMKA 4Z7OE 4BZYA 3WXVH 2XNAA 5D6DA 5DEGA 5DJYB 1FAIH 1JHKH 4TNVF 1UCBH 4YXHL 4HAFA 4Q6IC 3LVEA 2BP3A 1YC7A 3BP5A 2WV3A 3GJFK 5IIEB 4MDIA 5F7EH 5CJ5A 4NKMB 2B4CC 3HNTL 4IBLT 4PJ5E 2R4RH 3FT3A 1F11A 3C60B 1ZHNB 1UB5B 1AGFA 1QRND 4O4YH 2WBJA 4OJFL 2DDQL 1RMFL 5F7FA 5HPOA 3LS5H 4KDVA 4DKFH 4XPBH 2PF6A 4DGVL 1KYOJ 2ZOLB 3G5YA 4POZD 5HVGB 1UJ3B 5FO9A 4NO5A 4PJXB 2EDNA 1J1XH 1VPOH 3G08B 5DQ9B 5FKPA 2A6KA 2CKBB 1QLFA 2V5MA 2A6JA 3BUTA 4UIMA 5J1TC 3DUUA 1S7TA 3CCHB 1G9NL 5HDBE 1EHLH 2ARWA 4G8FB 2HN7B 4FQIH 5IB4A 2FYYA 3NAAH 3QXUA 3QCUL 5KSBE 1U8HB 5BZWB 4HS6B 3MZGB 2YXMA 3IDNA 5TE7H 5I1EL 3O6LH 3BZ4B 2J8UA 4OF5A 1MNUL 2R23B 3UJTL 1HHIB 4TUOB 2AXGA 5IB5A 5EOQH 3QQ3A 5L2JB 4PIRF 3R1GL 4QKXB 3SQBA 5CMAA 1C16B 1JJUA 2V2WA 1P69B 3G04B 5GGVH 1EBAA 4YHKL 1A14H 1CL7L 4K3JH 1D5ZA 4PJFB 3WNMA 2VLKD 1BEYH 5DUBB 1XAUA 2GT9B 1KOAA 1CG9A 3L3IA 3O3DA 3V8OA 1DQDL 4P23D 1LP9E 1X7QA 2XG4A 3S4SB 5B38G 3PP3H 1F6FB 4R9HA 1DQTA 4OZGB 4FRWA 4JG1H 4OFIA 4UQ3A 1I3GL 1RVFH 3OG6B 2FB4L 4BZ1H 1HHKA 1XF5B 4PBXA 4PD4J 2CGRH 1BD2D 1F3DH 1CFTB 2CLVB 1JWSB 5IK3B 4IOFD 1S7RB 3VW3L 1RQ5A 2OS7A 4J2XA 4IOIB 1M6OB 3LKOA 3CFKB 3QIUC 3LHPL 3QG7H 4YR6A 4LDLB 2A9ML 5FCUL 5IFHH 3VXUD 4NUGH 4PJIA 2OZ4A 3DUSA 2EKSA 2B4CL 4I48B 1SYVA 4Q9CA 5H35A 3QUMH 5E2WH 2VDNH 4MQXC 5I19L 4Y8AA 4E41A 5I0ZA 4K7FA 5JO5B 3WMSA 5IJKC 1SBSH 2VDLH 4K3DL 1FLRH 2EXYC 3U36A 3TJHC 3D18A 2WBKA 1S78C 4YDJB 1BD2A 5AG9A 4YWGL 3Q6FB 4JO4H 5GRVK 3STLA 3WO4B 5IHZA 1EHAA 1Z3GL 1NGXA 2H26B 2R56H 3EO0A 5LXGH 1KCKA 5E00B 3MRGB 4H5SA 1LP9B 4OD3L 2WP3O 4XI5C 4EUPH 3IDGA 3H0TA 1FNEB 1JNNL 4HUWB 2YUVA 3NFSL 1QSVA 5D72L 2AJYL 2HLAB 2WWMC 5CWSA 5FECB 4ODVL 1TTFA 4PRAA 4AQ1B 5E6IC 3MA9H 5F7EL 4D8PA 3QCVH 1A14L 4E0RB 1ONQB 5ADPL 4PREB 3OKEB 3PJSB 5F96L 4F7PB 1URLA 3UBXI 3O4LE 4FQXC 2DDQH 4OF7A 2Z0BA 4WWID 4K8RC 3UZEA 4ESKA 4BUGA 5DRWA 1CFSB 3HZYA 4D0CA 4MAYA 5H35B 3T3MF 5IF0A 1ZGLB 2C3VB 2EH8L 3BGMB 1KJMA 4JPVL 1RUAL 1R5IA 3TZVB 3NIFE 1DTUA 4PV8A 2CDEB 1FYTE 3OKKA 3AS2A 3DX6A 3SDCD 1L0QA 2BVPB