25C8L

Catalytic antibody 5c8, fab-hapten complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPAIMSASLGERVTMTCTASSSVSSSNLHWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCHQYHRSPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for antibody catalysis of a disfavored ring closure reaction.
pubmed doi rcsb
molecule tags Catalytic antibody
molecule keywords IGG 5C8
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 25c8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 25c8L01
4H26B 4X6CE 1UCBH 4KK9C 4GG6B 4MS8C 1N5YH 2VLJA 1AXSA 4YDVB 2HLAB 5I8EB 1G7LA 4O51A 5TDNA 5IIEA 1ES0A 3L9RA 1M7DA 4KY1L 4Z7UF 4G9FB 4M9OA 1R3KB 3TVMA 3MRLA 3TN0B 3E6FB 3DVNA 4M7LH 4UV4L 5DHYB 5E8NB 4BELD 1WBXA 1NDGB 4RQQB 3CVHH 5LCVL 2JB5L 4AZ8A 1YJDC 2XKSA 4YIQB 1FL5A 3TVMD 1I9JH 3WHXA 1L6ZA 5FHAL 5HPOA 5BMFL 3HZKA 1QR1B 2BNRA 4MA1C 4ERSH 4J3XA 3MNZA 2IPUK 4F9LC 2O5XL 5CGTA 4XAWL 2CGRH 3FCTB 1IKFL 5DJZA 3ES6A 2E6QA 5DJ6A 5C9JB 3BH9B 3SGJC 5DGQA 4LLVB 4Y4FA 4DOHB 3QDJD 2EH7H 3D3VB 4KK9D 1WAAE 3NCMA 4XZUB 1G9NC 4JRXA 1U8MA 4ZFZB 4MNGA 35C8L 3OKKA 4MSWB 2C1PB 4KGJA 3I6LE 3OF6A 4UBDD 1RK0B 4FZ8L 4S0SD 1Z9MA 4Q6IC 3HA0A 1J12A 3P0GB 2GJ6B 3ULVL 5CP7B 3HC4H 2B4CL 3WJLC 2NXYC 4I18B 5D70H 3SDXB 4IHOA 1U9KA 1BZQK 2G5BA 2YD5A 1VGKB 5IEHA 2VLRA 4TRPL 4APQB 1JV5A 4X4ZA 5HJ3B 5FYJH 5E9DB 4YHOH 3SDAD 3AREA 3ZSSA 4L9DA 2BP3A 1FN4A 3KPRB 3MYJB 3BWAA 4ZO6A 5TF1H 1QRNE 1J05B 5F1IB 1FYTD 5C0CA 1PKOA 1BFVH 2FO4B 3OG6B 1P7QB 3KPRD 3IVKA 2KUTA 2MOVA 1DFBH 3CLEL 5DRWA 5EBWB 3FQNA 4P3CL 5L2KB 3ULUD 1T5WA 5FK9B 3GSUB 4NZTL 4LCYA 4JJHA 3BN3B 4APQD 3RDTD 3TFKD 4M61A 4D0DB 2XY1A 2XQYK 4HUNB 2ZSWA 4AEIH 2ED8A 3KPSD 2JF1A 3QUMA 4NRYA 1KCVL 4NKMB 4KY1H 2R1XB 4RRPG 3RKDC 3HI5L 3V0WH 3IXAB 4F7TB 3N1GC 3SE3C 2X09A 4KH2A 5C0RL 1CDUA 4MNHA 3NCEB 2IAMD 3ULUL 1UC6A 1U3JA 3P77A 3AB0B 3WNOA 2EYRA 1DQLH 3VXSD 4PJAF 4HBCL 3HTLX 3IKCB 4P5TA 1HYSC 1CQYA 2XXCB 1UXWB 1U8NA 2ZWLT 3SKMB 3MJ7A 4ZDHA 4MNGE 3MRJA 1YN7B 4CDGC 5LGKA 5ALBH 3B5GA 1XCTA 2RCSL 3OX8A 2J6EA 2LABA 1G7QB 1TQCC 4OZFB 3VJ6A 1QP1A 1AI1L 4G8GB 3T0EA 3G5YB 1ZLUH 1KXTB 4NNXA 2WK2A 3BQUA 4JGJA 3MV9D 4MQSB 5F7EL 1ZLWK 3RVWC 4OD2A 1FGVL 4JVUA 3T0XA 1JZ5A 1QEWB 4UT6H 3MNWA 3IJYB 1INDH 3FKUS 3HC4L 2ADJB 5F6IB 4X8JA 4JKWA 4YK4B 3MFFB 4P4KD 3MV8B 2PTUA 4LMQE 5IR1B 1IEAB 2BVYA 5CBEB 4UV7H 2UUDH 5B38G 4JRXD 4WDIB 4JG0L 3QRFM 1RZ8B 2BSED 4PRBA 1RUML 4HSQA 3T4AB 4HS8L 3S7GA 2LU3A 5D71H 3ZYZA 3SDAA 1JTTA 2EXWD 4QCIB 4IOSD 2Z4QA 5LQBH 3BUTA 4RMSA 3MACH 2IQ9L 4J3VA 1KXQE 2PYFB 4V1DE 5I18L 4PJ9B 3TIEA 3QO1B 1ITBB 3LRSB 1PQZA 4PB9H 4Y5XA 1MH5B 4Z7VB 4TTDD 4MWFA 4FQXA 1HINL 5I74B 1UH3A 1S7TA 2V2TB 4ZAKB 1GVIA 5INCB 3VFTB 1VEMA 3GBML 1QEWA 4OF3A 1UM5L 5DS8B 1S5HA 3CFDB 4N9GB 3U7WL 4PBVC 1JNNH 3VXMA 2G60L 2VXUL 4L4TD 5CJBA 4YBLB 2Z8VC 4HBCH 4KDWA 3MBEA 2A0LD 2NY2B 4LSSH 1AGEB 1JYVA 4P5KB 3QXAA 1YY8B 1QLEH 4P99A 3IDJA 4CL7A 3L3KA 4XP1L 1NUGA 5D1QA 2HKHL 4BFIB 1GOHA 2EH8L 5L9DL 2PXYD 1F4YH 5FCUL 1U93B 2DD8H 2R69L 1IAIL 2PTTB 1VA9A 4P9MH 4PJIF 3SCMA 32C2A 4OUOA 4YWGH 2AK4B 4Z0BH 3QUMH 3TBWB 3TM6A 3KPMB 4K2UL 5EORH 5F7YC 3GDBA 2OTWA 5DMIL 4BSJA 2DQGH 1HKFA 5BV7C 2Y1VA 4PRHB 5JW3L 3EYSH 5KJRL 4YO0A 4M8VA 4JO1L 4PJAB 2EYTA 1C1EH 1IFHH 5SX5H 1I7RB 1OAQH 2X89D 3CZFA 3E8UL 5E8PA 5F9WB 1T1ZA 5EC1B 1MCCA 3STZA 1DVFD 3H9SD 5IF0B 1HIML 4WWID 4LBEB 3CVHA 2W59A 5JXAL 2CRIA 1BVLB 5HI5D 3P0YH 3SOBH 1L9NA 1IZKA 3E1F1 4X6CA 4E0RA 5ICXB 4P46B 3WKML 4NQEE 4FQXD 2OMNA 5KSBF 3EGSB 4QRPA 2NX5D 2L4OA 5FYKL 4ELMB 3LD8B 1NCCL 3QPQC 5IP4A 4WU7A 3VJ6B 1O5DT 3EBAA 3GMMA 4LIQL 2R4RH 4QOKD 4MJ5A 3DX7B 3NPZB 4KJYA 2Q7YB 3VWKB 4CGTA 1RZFL 1UJ3C 1RHFA 5FUCE 2GHWB 4HK0A 4QNPE 4HEME 2JJTA 4WO4C 1YEIL 4JZJB 2FATH 3BYTA 1T1XB 3MRHB 4FABH 2VLRB 3BGMB 3KYKL 3HN3A 1FAKT 3GIZL 4RGMC 3ROOB 2UVFA 1R5VB 2IALB 3D39A 1XGPA 5DHVB 1I8LA 4NSKB 3BPCA 1RUAH 4HUUA 3TO4A 4ZOBA 1EX0A 4YFEA 4LLYB 1KFAL 2VJXA 4XNMA 4R97C 5C70A 3PDDA 4JO3L 4OFKA 4WHYH 2H26A 3S5LG 4D94A 2O5ZH 1N3NB 1RJZB 5E8DH 3UC0H 5CEXB 5LCVH 3M07A 1WFTA 1XR9B 5FHBH 5IJKA 3EO1B 2I9LB 5DJDB 5DYOB 4JM4H 1Q9LA 1PEZA 4X9HA 3BGFB 1FG2B 4KDTC 2R0KL 1O7VA 3HKFA 1IGJA 5EBWA 1K8DA 3S88L 1CGTA 2KPNA 5C7XL 3MUY1 5HGAB 1TJGH 5MEQB 1AY1H 2YC1A 1S7VA 4XNYH 4KUZH 2Z31D 2NW2B 2XTJC 4D9QD 3DMMC 1K6QH 3RNKA 1SYVB 4NQXB 3I9GH 3RWEB 5C6TH 1T21A 4O58H 1HH9A 1AGEA 1JHLH 3G04B 4H8WL 4MHHG 5I8EA 3SDDC 3TNNB 1CFVH 1WZKA 5CSGA 5F7EH 1JZ3A 1BECA 1JUFA 4PJBB 4Y5VC 5J1AA 4DKEH 3ALXA 3V52H 3SDCD 2W07A 2R9HC 4XP4L 3MMEA 4YE4H 4PJAE 1WSST 1FNLA 1SJHA 5BV7B 3S36H 1T2QH 1LWRA 1FGNL 2IH3A 4YNYB 5L8JB 3CSGA 5IFJB 4I77L 4HF5H 1FLTX 1TVHA 1J5OL 4YHZL 1S5IL 3GJEB 5JW4R 5T1MB 1YZZA 1QBLH 2BOBB 3OKMA 5FHBL 5A16A 4K7PY 4S11A 2FX8H 3BZEB 4OCLC 4MJ4A 1PD6A 3PIQA 3HNVL 4PJ7B 1TTGA 1S7QA 3MLPA 4R7NB 5C9KA 1X44A 1MI5E 4LDLB 4R90H 4ETQB 4YBLC 3CIQA 3OKNB 1YYLL 3G6DL 1VACB 3E6FA 2GJ6A 2J6EL 4HGKC 1IM3A 1HI6B 2HP4A 2PNDA 5IB2B 1PKQE 1U8LB 5E70A 1RI8A 4GOSA 3RA7H 4JQXA 4UDUB 4JZOB 4OLVH 3P0YL 1NCAL 2P47B 1A1MA 2A6IB 4WY7H 3T65A 4QHNA 1CT8B 3WUZA 4HXBH 3VXUB 4Y19E 3U0TB 5E4EC 4KQ4L 3W5MA 4FXGB 2ITCB 3O6FD 4GJTB 5ICZB 1T1YB 3RL1A 4U6HA 4N68A 3VXPA 5IFJA 1N6QH 5ISZD 3SOBL 1MQ8A 3GMQB 1UQSB 5BJTB 1VKXB 1QSED 2ZNXA 1S9YA 4WTZG 4NIKB 3INUL 3QXDA 2D9CA 1YEJH 4OCMC 2IMNA 3OKEB 3QI9C 1UCTA 4TVSa 1FE8H 3WUWG 5D1XD 1LE9B 1MAKA 4DN3L 4DKAA 4LU5H 5KSBB 1U8JA 4YDVA 4M93C 3FT3A 2IPTL 4QXGH 4HAGA 5CLWA 4YR6B 1IM9D 2EXWC 2VDQH 5D7JA 5A2KH 4MVBC 5JIHA 1GGBL 3IFNL 4GW5A 3MUHL 3DYOA 1R3IL 2Y5TB 1AQKL 4XAKE 1A0QH 4NN5B 1GHFH 1B9ZA 1IGYB 4YDIH 3S3JA 4RGNB 3QUZA 1NLBL 4OIBA 4N8VA 5KG9B 2P8MB 4IRSC 1PSKL 3KYNA 4Y4HD 5IB1A 2DIBA 1JNHA 1JE6A 3LKNB 4P59L 4ZODA 3X14A 5LKNA 4LSSL 3UTTB 2A9NH 4ELKA 1AIFB 4WIQA 1JNLL 1LQSR 5H2BB 5EA0H 3F62A 4PJEB 4JQIL 2IBZX 2GCYA 3TYFA 4R97B 4Y4FC 1G6VK 5C0ND 1U8OA 1EBPA 3I3DA 3B5HA 1VFBA 1DQML 4NSKA 2HA1A 1TIUA 1BJ8A 2NY1D 2P8PA 3NCJL 3IJHA 3HE6B 4KPHH 3QDGD 4M5ZL 2MKWA 4OKDA 4LKCB 5DURD 3ZYIA 4XP6L 1KENL 3FFDB 3BN9D 2IF7A 4G42A 5JO5A 2WUCH 3FQTA 5KVDL 3DX7A 5B3NA 3FOLB 1BZ9A 3PQYA 3QDAA 3IDNA 4JO4H 4JANB 5D7LB 4OZFH 4OGYH 1T04A 3FO0H 1M6OA 2E3VA 4BQ6A 1YEFH 1G6RL 4OIIH 4L3AA 5E00B 1JGLH 5I1HL 2V17H 2KQNA 1Q9OB 3FQUB 5FA3B 2AJVL 2IFFL 1PFCA 1NEUA 1VGEH 3CH1A 5HI3D 4OCXL 1F4WL 2FX7L 3L3DA 5C0IA 1V3MA 1KF9B 2VE6A 2GJZA 1H15B 4FFVD 4ONOA 1MJ7H 4NRXB 2CLRB 2FDBP 4ELMF 2ENYA 4LARL 4RZCB 3RDTA 4XNQB 2DQUH 3MODL 4FFYH 1QYGL 3ULVF 2VDML 1W8OA 4M5ZH 1ZHBA 2EC9T 3DX8B 4Z78A 1FSKC 5E08H 4G5ZH 5HGAA 4L8CA 3QH3A 1QSEA 5JW4M 4PJ5D 4M93B 2Z93A 1EFQA 1IBGH 2ITCA 3HZMA 4DZ8B 3U7WH 1HHIB 3VRLF 5KS9A 5DUPL 2HLFC 3CDCA 4O2CB 1LEKA 4K71B 5GSVA 4OV5B 4KI5C 4PPTA 3MBXL 2CK2A 4X6CB 5I74C 5FGCE 5ETUB 2VTFA 5B3JF 5KW9H 3O3UN 2VRAA 5E2VL 3ARBB 4NCC2 3OKOA 4GRLA 4C4KO 2HTKD 3TJHD 2BSRA 1U8PB 2IH1A 3TFKC 4XPTH 2B2XL 3SE4A 1AHWB 4TTDC 4EDXA 3Q48A 4F7CB 1A9EA 1QFWM 3LD8C 4HULB 3Q5OA 1A6UH 2XNAA 1BX2B 2EC8A 5HGBA 3VRJA 3RUGB 3FZUC 1P5UA 4N90D 3KNBA 1FE8L 4NM4L 2VN7A 1D5BA 4PTUB 2AJVH 1YEKH 2HVJB 2FL5B 3MCKA 5JA9A 3MLWH 3WIIL 2BVTA 4HIHA 4Y4HC 1N7MH 2P5ED 3QIUC 4Y1AA 5CEZH 4HJJH 3L3IA 1N8ZB 1KCSL 1IJ9A 4TSCH 1XGRA 4FMFA 1XT5A 3VXMB 2HG5A 1NEZB 5KVGL 2VLJD 5T1LB 2NY3C 4UT7H 2DKSA 4J3OC 4MHHI 2DQHH 2CKBA 4KJQD 4TVPD 3W0WA 2I07A 5HGHB 2WIIA 4JM2D 1NMBL 2O5XH 4GAJL 3QNXB 3T0EB 2Y7QB 3MR9B 4PRDA 4PJAA 4CVXA 5JOFA 5I1KH 6CGTA 3FB7B 2F58H 5DJXB 4JRYD 1F6AB 1MCPH 3BKJH 4ZYKB 3E2HB 3WLWD 1ZOXA 2A9MH 5DJ8B 4PTTA 1KJVA 1MUJB 3BO8B 1DQJA 3QIUA 4JVPA 4LFHD 1AP2B 3LRHA 3BQUC 4WY7L 2XA8L 5E24E 1J0IA 1BD2D 3W81A 3BH8A 3EOTL 4P48A 3DMMB 3ZTNL 4Y16C 1QA9B 5J57B 4HJGB 3OAZK 1T0MA 4J3TA 3EO9L 4EKXA 3PWNA 2R2EA 1IC7L 4OZHB 4YHOL 3TA3C 4YEEA 5GGVY 1K4CA 2MQCA 2V2XA 3UJTH 3WSQL 3WNMA 5K9JH 3VXUE 4HWBL 5CMAB 3CLFH 2IANB 5LAXB 3EYVB 3GM0A 5TE6H 5ADOL 3U0WL 1HHIA 2ZPKH 4M9PA 2ZCLL 3CXHJ 3L1OL 4PJ9A 3TIEB 2AGJL 4LU5L 3TN0C 4HD9A 3G5ZA 1WQVT 1L0XA 2H2SC 3OR7B 3WNKA 1T3FA 1NC4A 4H8WH 3PWPE 3CCHB 4YX2H 4YHIB 1RUPH 4HC1L 1JWUB 3VFGL 1QPPA 4MAUL 1YEFL 1RIHH 4MMZC 2G5BB 4EN3A 5A2IH 3W0WE 1AD9A 4NKOA 3ZT7A 1EO8L 2HT2C 4E0RB 5ESVA 1G7JA 1N64H 1XF4A 5SWSA 2R8SL 4JFDA 1UEYA 4N1EA 3SBWC 2XICA 1LEIB 3P4MB 1MHHA 2XY2A 5DUBB 4QRUB 5T5NF 5IB5A 3HE7C 4JR9H 4LLQA 2P1YA 4OZHE 1B0RA 3A6CL 4YHNA 4QTIL 5D6DA 3VI3F 5E8PB 2J5LC 4R4BA 5AYQA 2FEEL 2A9ML 2DTML 3QEGH 3JUZA 3RGVA 4M3JA 1NUDA 4YDLB 1PDKA 3OJDA 4NHCL 1MFDH 2AQ3A 1IRAY 2OP4H 3G9VA 5I8OH 1WFOA 4DGVH 1F13A 4OBSA 1V7MH 2H6PB 2E7CA 3L3GB 4ZUSB 1MVUB 1OTUD 4E9LA 4JHWH 4KROC 2HT2D 4DAGH 3IU4L 3KPRA 2BNQE 5MEPA 4RMQA 4L4TE 4GAYA 4KQ3H 1MREL 1V3JA 4FQLH 4WWKC 3ZDXF 3SE8L 4QRRE 4D0CB 1F4HA 4KI5F 1FVCB 5JPMB 3V0AC 4M00A 4PRDB 3ULSB 4HXAH 1NBVL 3TO2B 2VXTH 1A4KB 4PJ8D 5K59F 5MEND 1R0AH 3AU1A 2B4CH 5KSAC 1N8ZA 4HLJA 4TN9A 5IVOA 4EUPG 5CJXA 3EZJB 5DVOA 2Q87A 3KJ4C 4PV9B 1QG3A 1KGCE 4K9EH 4WW1A 1B4JL 4PY8J 1AO7D 4Q6YA 1RJLB 4WI9A 2LU7A 4AMKL 2Q1EA 1QFOA 2QV2A 4Y16A 2YOCA 1HHHB 4WRLA 1C5CL 3VFUA 1WWCA 3KYNB 2F8XC 4M1DL 2WBJB 2XQYG 3DXAA 2UY6A 3SDDB 4KUCD 1JN6B 2MJWA 4WUUB 1KC5H 1PG7H 3NCYP 3RL2B 2PYEB 4U1SB 4HKJB 2XWJA 5E6ID 2BMKB 2XWBB 1Q9KA 5HJ3A 3LVEA 5JOPD 4M5YH 2CXGA 5JUEL 4PRBB 5L0QC 2EDWA 3LKSB 4PJ8C 4BKLA 1X5FA 4DQOL 3CH8A 3FN0L 1RUKH 4OIAA 3RPIB 1J8KA 5HVWA 4UINL 5FCUH 1IAIH 2ID5A 3V6ZB 4LAJH 4IDJL 5J6GA 1U8IB 4F7PA 4XZUA 1R0AL 5CWSA 3IVKB 1NMCC 2F8OA 1QLEL 1OAZL 5F89B 3WJJC 3GMPA 1TVDA 5ADPL 4YGVB 3ARGD 4LSQH 4NBXB 4XTRD 5GRVK 3DNKA 3ORJA 2N4IA 1ONQA 2P8LB 4L4TA 4OI8A 5C07A 4IOFC 5I8CB 4IOIB 1A7OH 2O5YH 1ACYH 2W0PA 1NMAH 4KMQA 1INEH 3C6LA 5FGBA 3RL1B 5FYLE 4C57C 2CUMA 1TZGH 2QSCH 1JV5B 3MJ9L 3BYYA 4ONGH 3SDXA 3QCVH 4NQVA 3KYOA 1AQDB 3HI6H 3N1FC 4WFGD 4NBYB 4EI5C 2X1QA 3QUZC 4OZFG 2HRPL 3C5ZA 4C4KT 2R0LL 1CF8H 1MCDA 5ESAB 5C0IB 3RY4A 3DOSA 5DFVC 4NKDA 2R0ZL 3SBWA 3VFOA 5JHLL 4XX1E 2Q3ZA 4BKLB 3DO3A 1F3DJ 4F80A 4P4RB 1FP5A 3ARDC 3SN6N 3S96B 4Q9QH 4K7PX 5HDBF 1G7HB 1KPRB 4K3GA 2P46B 4PJ7A 1PKQA 1JF1B 1JNJA 1AR1D 5C0DB 4WFFD 4L8SB 1R3LA 3M17A 3FB5A 1U42A 1P69B 4GBXA 4HWUA 1NAMA 3OHXB 4YJZL 3MRLB 5L7XL 2PCPA 5DDHB 5F3BB 1CWVA 1G7LB 1OHQA 3RBGA 2PR4H 4NZRH 3HE7B 4F8TA 3J7HA 1AGFB 5C07D 3H6JA 5EU7C 4J8RB 3U4EB 3RWIB 5F21B 4AEHH 3S35X 2PO6D 4XCNA 5FM4A 5JIKA 2I24N 4GW4B 1JYNA 3IJSB 4XP1H 4B7IA 4AG4L 4ALAL 4HFWA 3SEPA 3MLSL 4RGND 4MYWB 4XBPA 5JDSB 3KJ6L 1CD8A 3EO9H 3QP3A 5K9QG 3B9KB 1OB1B 3L95A 4HPYH 3BE1H 3UJIH 4YBQC 4I0PC 2CO7B 1FNSL 2VWEE 1FYHB 1GC1C 2UZXB 1FORH 4Y4FB 1UM5H 4JFOB 2NY6C 1JL8A 2NY4B 3D18A 5EO9A 4LKXA 1AD0A 4XWGL 2DIAA 4NHCH 3DRQB 5L2JB 3HI1A 4GXUN 4PRIB 5ABDE 1X6LA 3MRCB 1DQTA 1KN4L 3ARXA 4YBQD 1Q9LB 3MOBL 4QY8B 5F8RC 5E8NA 5BO1H 1BHGA 4NKDB 5D72L 3RVVD 4ODTH 5DWUL 4YIQA 4OZIB 3VXSE 3JWDL 4NQTA 1U3ZA 4IRSB 1CE6A 2CLVB 3WS6A 1LEIA 4R3SA 1F3JB 5IHLB 3OXSB 1ZANL 4XMPL 4HKXB 2GUOB 4OT1L 3GMLB 1CL7I 4U6XA 1D5IH 5JW3H 1RK1A 2GAZA 3STLA 2DBLL 4WUUE 4XNYL 5EG6C 4OGAC 2BJML 1TJIH 5IMKA 1NFDF 2DLEA 4H1LH 4NJAH 1QO3B 4K9EL 4ODWB 1FBIL 5IJVA 3EDDA 4Q9BA 4RA0C 3WIFA 5E94A 5D2NA 2MMXA 4AL8L 2HJLA 2ICCA 4GRWF 4LEOA 1HZHH 5CBAB 2KKQA 5GGQH 1P4IH 3TEUA 5MI0C 1H0DB 3UCRA 2DF3A 5IK3B 5I8CA 3WIHL 3BD3A 2CSPA 3IF1A 1KOAA 2DMBA 5ITBH 4QT5B 1JMXA 4HWZB 3GHBH 2BHUA 4UZGA 5BQ7A 4Y4FD 1ZHLA 2FLRT 4GO6B 1ZLSL 3VRIA 5HHXH 5DQJA 4P46A 5GZND 4O2EB 1KB5A 3RPIA 3MV11 5SX5K 5GGVH 3KHQA 1FO0L 3UMTA 5FV1L 2O5YL 3TA3B 4OB5L 2ATPA 5EC1A 2DYPD 4HPYL 3STZB 2FZ3A 1WVZA 2LQRA 4ETQA 3T2OA 4X4XA 4BK5A 3I02B 1U3HC 2W9EH 3UAJC 1JN6A 3LB6D 3PL6A 4FQJH 2Y36L 2EIDA 2BMKA 2E27H 1BF8A 3U2SB 3VMPA 3EKCA 2XA8H 3QIUB 1KTDA 3C5JB 2EZ0D 3SDXE 1DN0B 4FQHB 3LDBB 5ITFB 3RWCA 1KYOJ 3F7YB 4N0YL 2JIXB 5K9OB 5AZEH 4EIGB 1RJYA 2VQUA 2FYYA 5DMKA 1G0DA 2ADIA 2PW1B 5IG7A 3LH2H 1BBDL 1FZOB 4RA3A 5I19H 3P4NA 2BRRL 3F7QA 3MLXH 1Y18B 1HHGB 3HMXL 4OZIF 5TGBA 4MJID 2ZG1A 4O9HH 4OF8A 4NQUA 2AJSL 1BIIA 4GXVH 4D0BB 5F7DB 1K4DB 3IU3B 5DD6B 1NGXB 3TBSA 3A67H 5EUKB 4PG9B 3AFLA 3GSQB 4OZGE 2A77L 4MWFB 4CMHC 4PBWD 3PXHA 1MVUA 4DN4L 5MP6H 5DTFA 5JDJA 5GISL 3INUH 5EBLA 1KCUL 4ZUSA 3BZ4A 4UIKL 5DVNA 3A6BL 1I7UA 1S7UB 4CW1A 5IM7B 1CCZA 5E4EB 1IGJB 3NTCH 1ZT7B 3BHBB 4FS0A 3SCMC 5A2JH 2XKNA 3GSNB 2VQTA 4LHUG 3O6KH 1MHHB 4HZAA 5JLZB 5BZDA 5E1AA 3V9FA 3UTZB 1UYWL 4YFLF 3U36A 5HYSB 4JPVL 1DBKL 3O8XC 2HTLD 3CFEA 5D7KE 4NQDE 1KSRA 4ODTL 1X4YA 5DWUH 4QOKB 3N1MC 2V2XB 4WVRA 4JM2C 3WE6A 5C8JB 1WEJH 2VOTA 1T4KA 3NCYS 3AXLA 2NYYD 5HYJB 3VE0B 4OQ1A 2FIKA 5J13B 3AM8A 4IS6A 1I1CA 3JV4B 5EZLA 1KTRL 1KBGH 3E3QE 2X05A 2I27N 4GG8B 3G9AB 5L8KB 2FGWL 4G6AD 4K7PH 4GSDL 5F7KC 1OP3K 2IG2L 1F2QA 4KUCF 4UU9B 5F7UA 3S4SA 4LP5A 2P4AB 3S3PA 3VRLE 3GI8H 2XN9A 4PP1C 1EH9A 3MLTB 1DVFB 3I6KB 4OCYH 2HRLA 4OBRA 2BX5A 3D85A 5IW3A 5DXWA 4RFOL 3IKCA 4Z7VF 3U9UB 1UWXK 1EHLL 1GSMA 1KCLA 2VH5L 5TQ2H 4R7DA 3RHWK 5EC2B 3WCYA 1MOEA 1FLRL 1CICA 4PG2C 4CVXB 3RTQD 3C2AH 2C7UA 3RVXC 5JMOC 5DD1L 1YECL 4LAQL 5EUOA 1CFNB 1EERB 3D25A 5GS3A 2VDRH 1Q9WA 1OARH 5SWZE 4C83B 3P9LA 5C0BD 5L7XH 1ND0B 5I1GH 2G2RB 4G6KH 4PB0L 1N59A 3DETD 5GJSL 1A21A 3S37H 3IFPB 4NN7C 3MA9H 1P4IL 4B5EA 3RGVC 7FABL 1KCUH 4U1KA 1F4XL 2E6JA 3HFMH 2P24A 3ARQA 1F97A 2AP2A 2NY4D 4G7YL 1U3HA 3NIGE 1EGJA 2VDOH 4ZOAA 3F12B 2D7NA 2XN9B 3CU1A 5JUEH 1SHMA 2XRAL 2IPTH 2Z8SA 5F71A 2YXFA 3S4SB 5BRZA 2AJUL 2JKXA 5GHWH 4X7EC 3CVHL 1TCRA 2AK1H 5JQHC 2C4FU 3AUVA 1UENA 1KIRA 3CMOL 2L7UA 1RD6A 2EDRA 2LTQB 4AIOA 2PO6B 5J6HA 4B0MM 1AXIB 3Q6FB 4JDZB 1U91B 4X7FC 4HV8B 4Y2DC 3LEYL 3D2UA 4NC1E 4YC2C 3E6HA 3V2AR 3HE7D 3LPGA 4LLUA 1KB5H 5EFIB 1KN4H 2A74A 2BNQA 2DI7A 4NUJB 3V8CA 1S7TB 2V2TA 4JY6A 1UZ8A 4N8VG 2Q6WB 4M7LL 5I71C 1J87A 1XMWA 3FAXA 1Z3GH 3HMWL 3VGFA 3WYRA 4NOFA 2DD8L 5ID1B 5J56B 5EZOL 3UBXI 1F02I 3VU2A 1FORL 3QEQA 2VUOA 4HS3B 3H7LA 5GS1A 5K9QI 5D2LB 3OXRA 1IKNA 1H0DA 2DQTL 3MOQA 2MCPL 4HUWA 4YHPA 2AEQL 1HSAB 1LO0L 5F8QC 1DR9A 1DSFL 1KYOK 1V3LA 2FECL 3QFJE 4ZTOH 4TRPH 1FSKB 1LO5A 2EEBA 2GEEA 1WAAA 2J4WH 4O00A 1TLKA 3QJFB 5JPNA 4X4XB 1MIEH 4FQCH 1LO3H 1AGBB 3OWEA 1P84K 3R1GL 5AUMA 4RMVA 5I17A 1JWSB 2OJZH 5F97E 3EW3B 1P53A 2JJSC 3FQXB 4MD4A 4N0UE 3WL9A 4G6KL 3QHFH 1JYXA 1K4DA 2I07B 5HGHA 3MV8E 1DLHA 3PHOA 4JCMA 5EOTA 1A47A 5GRVL 2X6MA 4HCRH 4LLDA 3DVIA 1NFDB 4KKBD 3DGGA 3QIUD 4YHMH 3L3JB 4MNQA 1NMBH 2EKSA 1M7IA 3CFBB 4QRTB 3HNSL 1EFXA 3VFVA 3B9KC 4QRSB 4JKPL 3MRCA 1JGUH 5AEAA 1E6OL 1FIGL 1ZEAH 2AJUH 4PJCB 3DRQA 5L2JA 3IDYC 2Z35B 1ZA6A 3MRQA 2D0GA 5DK2A 1KCRL 1CDIA 4B50A 2YN5A 5D4QA 2O26U 4AT6A 2XZCH 1NMCB 4P5MA 3MRKA 5H37H 5AG8A 4QHMB 4V1DA 3SKNA 1GC1H 3RDTB 3K4DA 5E5RB 4LRNH 3LKRB 1I7TA 4UNTA 4JO1H 3PV6B 3LKPB 4PLKD 3MRNA 5IW6B 1KIUA 2ZCLH 1TJGL 1MCPL 1WZ1L 2ZSWB 1QBMH 5JXEC 1UH2A 1A6TA 5F93C 5T1LD 3R1GH 2WUBL 1J11A 4NRYB 3AB0C 2P5EE 5E6IB 4L3EB 3GHEH 2YXMA 2EO9A 4R7NA 5E9DD 4MJ2A 4QRRA 5E00A 3V6OC 2YMXL 3TCLB 1ZAGA 3HI1B 3IDGA 2OXGA 2GW5A 3QIBD 3MBXH 4G8FA 5BS0D 3BRDA 2EDFA 4QHUB 5D2LF 2V5RA 1YPZA 3GJEA 4NP4L 3TT1H 4X7CC 4LSPH 2VDKL 4OFYA 5JO5B 5HGDB 4NFDA 3U79A 2R4RL 4HF5L 3MRDA 1NC2A 3LKOA 1R3HA 43C9A 4GRMA 4WFED 3FRUB 4L4VD 4BH7A 2OL3A 1GOGA 2CIIB 3RU8L 3MBED 1BQSA 2BJMH 4B53A 2DTMH 5MENB 1YNKH 2AV7B 5F7NC 1RULL 3CSBA 3KR3L 3L3HB 4CJ0A 3DXAE 1KIPB 3ZSTA 1MHCB 4ZXBB 4CADA 3LKRA 1I7TB 1MJUL 1HN1A 4H88H 4OD3H 1LVEA 1PX4A 3SGJA 5HHME 3L3DB 1YEGL 1HCFX 3B9EA 4KK6C 2A6KA 2Y72A 1F8TL 1L9MA 1NAMB 4OJFL 4PJEA 1BVZA 1CFSA 4OLEA 3AMKA 4OLXL 3D3VE 5TF0A 4BJLA 3FB5B 1I8KA 1JPTH 3O2DH 3TPKA 3GUTB 1FHGA 3PWPA 1JCKA 2ZSVB 2VKXA 3O6FA 1KULA 3MNZB 4K94H 3BXNB 5TE7H 1FG2A 1C5BH 4PJXF 4N8VB 2Y5TA 2R4SL 4HHAB 5DVMA 3QR2A 1IGYA 1MRFL 5L9DH 1NAKH 1I1FB 4GW5B 1A1OA 3RIFF 3BJ91 1XIWA 4A6YA 4NKQB 2W9EL 1H3WM 1TVBB 5DO2D 1KIPA 1KGCD 4G9FE 4ONGL 4RIRB 5F96H 1AXSB 4WW2B 4MNQD 3I50H 2GSGB 3HG1B 5B22A 1WT5C 5J12B 1T03H 5MENE 3HR6A 4MXVE 4HIJB 2XPGA 3QAZB 4HKJA 5T3XL 3KLSA 2APFA 3LOWA 5KOVC 1IT9H 4MXQD 4TULH 5CJOL 3H0TB 4M6AA 2Y23A 4KAQH 3GSVB 1NJ9A 3SQBA 3QXVA 3O4OB 4PJFF 4NO0A 5EU7E 1JNHB 3LKNA 4NQCE 4UINH 1LGVA 1YEJL 3DGCR 3Q2CA 1VPOH 2XZCL 2P49B 4X98B 1LK3L 4POZD 3IAPA 4KKCD 1HKLL 5IT2H 4L3EA 3ETBF 2Y07H 2ZOLB 3MGTB 2PETA 5HXMA 4KXZI 5BXFA 2XRAH 1D9KA 5C0CE 5L88L 1FIGH 1FDLL 5FDYA 4JB9H 5FECB 4WFHE 5GRUL 3K8MA 1RVFH 4S1QL 1CXFA 3MA9L 2ITDA 4XH2B 3GK8H 3K4AA 5T5NG 4MDJA 1NGPL 2K1MA 3L5IA 1UB6B 1ERNA 3VD9A 1MI5B 1OF2B 4XNUL 4R2GB 5C0NC 5I8KL 4WGVB 1P4LA 1DQMH 3ARGA 1LO5B 2DRUA 4Q9CA 1TVHB 3MRQB 4ZOCA 4HX1A 1NCDH 1HOCB 1NC2D 1FCGA 3QUXC 1HILA 3W9DB 5AWNL 1DBJL 1WC7A 4JPIB 5ISZA 2QLVB 4FXGA 2C9AA 3QO0B 4OGAD 3CNKA 4JFEE 1CLZH 4ZPTB 3I85A 4FABL 4PRPB 4KAQL 4P4KC 3FT4A 2FEDC 1NCTA 1YQ2A 1A9BB 1SEQL 1NL0H 3NAAH 1ZLVK 4Y4KD 5EOTB 3NPSB 4DCQA 4M4RA 3QNZB 1A6WL 2OXHA 4F57H 5EN2B 1XH3A 1UWGL 1FZJB 3B6SB 5HDLA 4OCYL 5IMLA 1MJ8L 1DVFA 1E4WH 2I60H 3I6KA 3PWVB 5DD0H 4KFZC 5CSZB 2VITB 1CXHA 4NZUL 5D7IE 1BQLL 4KJYB 1UJ3A 3AGVA 5GSRA 1RFDH 4CNIB 3QWRD 3HAEA 2I9LA 4PJFB 4KMLB 4HUKB 3W5NA 3LIZL 5TDPA 43CAA 5TE7L 3VDCA 2VO5A 2YRLA 4R4FH 4PJGF 5T3ZE 4MA7H 5L88H 4ZSOA 1JFQH 7CGTA 2HVKA 4FQQA 1W72A 3MLSH 2HFGH 3TO4C 4Q9QL 4WW1B 4Y89A 5E99L 2A74B 2Q8BL 3MV7E 3AS3A 4FXKA 1EEYA 5J1AB 3I6LD 1AKJA 1IARB 4U1IA 3DROB 3RWFB 2DJ4A 3GSOA 2VAAB 1FVCA 3H9YA 4P2RE 4WU5A 4XPFL 1CICB 2YD6A 2Z8WC 3RWJA 1I3GL 5DLMH 5EH1A 1X5XA 2EH7L 4MJ6A 5EU4B 5CD5C 1S7UA 4CW1B 4JDVA 3VFPB 2YEZA 1UADC 4E42B 2JCCF 3CX2A 5GGTL 3ULVD 3GHEL 1CZ8L 3UDWC 2QSQA 5LXGH 2D7MA 4OD1H 4P2OB 4J1UB 1ZK9A 3CXHK 3LN5B 1QNZL 5AYUL 4PG9A 1EA9C 2QQLL 4OGXL 2BNUB 3LB6C 1LD9B 1QFWI 1FNGB 3QFDB 5DUML 1I8MB 3KPLB 4W70A 4UILH 5HYJA 3QEQE 5KVDH 5HHOA 3WUWB 4UBDC 2R1XA 5EZOH 2EZ0C 3MUZ1 4KMTL 4Z7WA 1F3DH 4A6YH 3DROA 3RWFA 4EBQH 3SDCB 4WFGE 4LDOB 2NXYD 1N6UA 5BMFH 1EEYB 2VQ1B 2AJZA 4J3UA 4TUKL 3MRRA 3C6LC 2CDFA 4LL9A 3GK8L 1F4AA 4PJFA 1K3IA 4OCWL 4NRZA 1HXYB 2VSCA 1EGJL 3L5XL 3KDMB 4CMMA 2AERT 1S9WA 3SCMB 4MJIB 2DQHL 1I3VA 4GLRI 5GRWA 4D9LH 5EIIB 4XHJC 4MJ5B 3O6KL 5FM8A 5T33L 2YPLD 1P7KB 3EDEA 4YGAB 4XRCA 3S9DB 2CLZA 3D0LA 2YS4A 4PLJD 4TSCL 3ARYA 4UDTA 2DMKA 3FB6A 3WIHH 3DMMD 5CZVH 4NC0B 1CLZL 1H5BB 4NWTL 1DE4B 1LK3H 1U8QA 3KYMA 4AEHL 2JIXD 3MV8A 5HI5C 3JVGA 4U1LB 4YK4C 4ENEC 3L6FB 1ZWIA 3H2WA 2VDPL 2IAMA 1CDCA 1D5ZB 2EH8H 1YEEH 1I1YB 3WHE1 3TH3T 3TF7C 3X13A 3O2DL 1BOGB 3S98A 4X7TB 1J0HA 5E95B 3B2UD 1EMTL 5E2UL 4Q6IA 4ODSL 4NM8L 1HQ4B 1VADA 1JPSH 4DW2L 5JHDB 5SWZA 3OGCB 4U6YB 4KRPB 4PRAB 1VHPA 3GSNL 5DI8B 2B2XH 4HGMA 4DGYH 4HX1B 2BNRB 4JFDE 1IVLA 3HMXH 1YNLL 3CMGA 3UJTL 2VITA 4KKLD 4F7CA 1KCVH 1G9NL 1AGCB 2IQAA 3ZE2F 4NRZB 3DTXA 1K5NA 2XN9D 1BFOA 1DQQA 4X6FA 3VD5A 3RJQB 4JKMA 3V6FB 4XGZA 1ES0B 3L9RB 5EUKA 3QNYA 3K2UL 1IEAA 4YWGL 2OK0L 4BUGA 2NX5B 5F7DA 1I9IL 5MHSE 4XH2A 2CDGA 3MBEB 1W72L 3N85L 3CFCL 3ILQD 4LPTA 1BVKA 4KK5D 4V2CB 3KPSA 1OTTC 2ADGB 2OSLA 1F90L 3MOBH 4ZTPL 2ZUWA 4XPGH 2BY3A 4QY8A 5BVJB 3C8KB 1BQHA 4WFEE 1KJ2H 5DSCB 1HILB 3O6FB 5JXAH 4PGCA 5BS0B 4Y2DB 3QIBB 1RV6X 2VL4A 1WF5A 2JTDA 3RY6C 4JFFB 3GSWB 2FO4A 2YSSB 1DVFC 3MJ7B 4KJQC 4Y8AA 4MQ7A 3VRJB 1BZ9B 3PQYB 1BAFH 4PLKC 3MXWH 2ZJSH 1RULH 4YHYB 4CVUA 1MNUH 3NMEA 3A6BH 2IBGA 3QZWA 4NHUB 1N0XH 1EZVX 1KCKA 5D1ZC 4K23H 1J0YA 3HCVA 3RZCD 1T7WA 3IXTB 4S2SB 1TFHA 1X5LA 4G80B 4L5FL 2GT9A 5CP7A 1U0QA 1JF5A 1PYWB 4GMSL 5HI4C 4KK5C 1PZ5A 1A3LH 4FTVB 4MX7A 3DECA 2F19L 4R96B 5HBBA 3WXWL 3B9KD 3RWHA 3SE8H 4AIZB 3NIGF 2VXUH 3JTSB 4Q0XL 4QT5A 4ZAKD 1X5AA 2VR9A 3GRWL 1D5XA 4HHAA 4NO5B 4W4NA 4M7KH 4HEPG 4NN5C 3I9GL 4OCWH 5BW7A 1X5KA 1NFIA 5LWYH 2XACC 2UWEA 3WIFB 3DX8A 1WAAF 1I1AC 1FFOA 4Z78B 4HS6B 4IIQB 4L29B 4R9HA 1RZIB 1PLGL 4AENB 1MJJB 2Z91B 2ENSA 3JTTA 2NY0B 2PW2B 5FOBA 2B1HL 5CAYB 4G6MH 3BPOB 1OP3H 1T03L 1H3UA 5DHYA 4HIEA 4G9FA 2YA0A 3BDXA 5IFAH 3VGGA 5E1HB 4MNHB 4UILL 1QHOA 3QDMA 3MV8D 4UIMA 1IT9L 3WXVH 4EOWL 4J3SA 2B5IC 5C0JA 1WCQA 2EYSA 3QEQD 5EU5A 3MRFA 5I1JH 4BUHA 2QADB 1KTLB 3KLHD 1CS6A 2FX9H 2VC2H 1NDMB 2OR9L 1QLFB 4N0CC 3VFGH 4MB3A 1A3LL 2DLIA 2DWDA 1J5OH 2F74A 2AW2A 1S9VB 3UO1L 5F6HJ 4MZ3A 5BVPH 2NXZD 1PX3A 6FABL 43C9B 1L7IH 2AABH 4OI7A 2AEIT 5GRXG 4TYUA 2UWEB 4HK3J 4JLRA 1UA6L 1EAPB 4M5YL 2VZ1A 3T4YA 3JV6B 4HT1H 1Q38A 4R2GC 1NDGA 4RQQA 4WFHD 4L3EE 2YZ8A 1F00I 2ADFL 2F54D 4CU7A 1BREA 4BQ9A 3SO3B 3WO4B 4R4NC 3QISA 5F1OB 1RZGB 4M02A 5DJ0A 4IHOB 1NGZB 4R96A 2EDLA 2XTJD 4U1GB 3MRGB 5C0GB 3WXWH 2VLRD 4K3EL 2YRPA 5FUOH 3S35H 1S78C 2YA1A 3LZFL 4Z7WE 3AAZB 4XBGB 1Q9KB 2JCCB 3GMOA 4XPHH 4Z7WF 4U0RC 1HHKA 1FYTA 4GQ9H 2NY3B 3GBNL 3T0WA 3QUYA 5DT1L 3KWWB 5E56A 3HMWH 1OTSC 2CR6A 1UWEL 1OTUC 2A6JA 1AIFA 3DUHA 3QXUA 4PJCE 5BS0A 1WZLA 1H3TA 2EIBA 2QQLH 2LVCA 4PREA 4RDQF 4XXCA 3KLAB 4EVNA 4JO3H 1ONQB 2Q6WA 3PDOA 3UTSE 5J3HD 2E7LA 1B88A 1J1PH 1NBQA 1D9KC 1KLUB 1PJ9A 2WBJD 1OPGL 1MF2H 1U95B 5ILTL 5IMOB 3DIFB 2OL3L 2LU4A 5IVXA 4HXAL 4O51B 5IIEB 5FV2A 3GI8L 1Q1JL 3R06A 4XC3L 3L7FA 2JB5H 2A2QT 2BY1A 4PRHD 4RGNC 3WFBL 4TQEH 3LY6A 1AO7B 4MXWH 1AQDA 2YBRA 4IDJH 2D7QA 2FWOA 1K5NB 3ZKND 5I17B 3LQZB 2EC9U 3HPLB 1HEZB 4M1CD 3MLVL 3D3VD 4HIIA 4EIZC 5I30H 3V4PH 2VDQL 4HDIA 1WFNA 1K8DB 2PN5A 1E6OH 1ZEAL 4QTIH 4ZFGL 4YGVA 4OLYH 1J86A 1FG9C 3X3FL 4ZUUA 2LFGA 5D8JH 3H9SA 5TE4H 2DI8A 3O6LH 4NUGH 1CVRA 5F1SA 2AJYL 5IWLC 3O3EB 5D5MA 3BOVA 4OF5A 4LLYA 4U7KA 3C87A 5IUSA 5D1ZA 2BNRD 5EOCJ 1G7JB 1QBAA 4R8WH 1UACL 5F88B 1F2XK 1YEEL 3BUYB 4TSAL 3E0GA 4R7DB 1EJ6A 3EUUA 1G6RB 4GS7C 4FNLH 4PLOB 1NLDL 1WISA 4D0CA 1WICA 4QXWA 4ORGB 5DFVD 3MX0A 5FA4A 5K33A 4BSVB 1VEOA 1NFIB 1LO0H 3GGWA 1QFHA 4ZFOA 3GIVA 2R1WB 4MJIA 1CFTB 4OCRL 4WW2F 4YBHA 3RGVB 1RJLA 4W6YB 1F6FB 3BEWA 4RAHA 1UZ8B 2H26B 2VNCA 4XNMB 3NIDE 4XMLH 4OF7A 4N8CH 1KJMB 1Q94B 4NQDA 4K3DL 1JUFB 4C56A 4F33A 4OZHA 4Y19A 5B8CA 4XXDA 1F90H 1TNNA 1L6XA 1A4KA 1DFBL 3O8XD 4UTBL 1T0MB 4WWKD 1L0YA 4LEXL 4MXVF 3MACL 1S7WA 3VFSA 4C56D 1YQVL 1CXIA 2UWEF 5JHDE 1QZ1A 3PL6D 4FFVC 2AK4E 4G6JH 2J88L 4ODHL 4H88L 4RFNB 4DQOH 1J88A 3QUXB 3IB4A 2F5BL 2WINB 3MGAA 3KPMA 4GAGH 3C09C 1S7VB 2AI0H 2AK4A 1G7IB 4P3CH 4OLXH 1JGEB 1UVQA 3N9GL 1KC5L 1V3KA 1ZA3A 3F6IA 4WWKA 2DQUL 4F15B 5C08E 5ACLA 2FJFB 1WLHA 4QRPD 3L3KB 3MRMB 1BD2B 2C3HA 1GGBH 1OAQL 2QKIA 1OP5K 3AS0A 2Q76A 1FPTH 3KPSB 1WWAX 3WO3B 2HFEB 5GZOD 1KT2B 2DDQL 5D1XC 1WBZA 4NQDB 5BOZG 2MPAL 3CFEB 4KI5D 1INQB 5I1DA 4QOKA 4XCFH 5E1AB 4Z7UB 4EN3C 1CICD 1QFWH 2GJJA 4FXLA 4BZ1H 5F1NB 1OTSD 4TQEL 5IJKC 1MAJA 2WZPD 3MV9E 4DUWA 1NPUA 5JIIA 8FABA 1PBYA 4R4FL 3SDYL 4UOJA 5T3XH 1JPFB 1J1XH 1A6ZB 1T1WA 4KKAD 3T2NL 1ZSDA 2ZUSA 3O3AB 3G5ZB 1CGUA 1I7UB 4O5LL 4X0KB 2IC2A 3JV4A 5GS1B 4JQXC 5LGHH 5IVZA 1S7RB 2JK5A 1W0WA 4WI5A 5IKCA 4NZUH 2EDTA 4BSWA 2WLZA 2GQHA 4QXUH 5CSBA 1C08B 5JXEA 4G6FD 4MAYD 5EU6E 3RWGB 4M8QA 2X2YA 3N50A 5C09E 3ZL4H 4PB9L 2VDMH 2HFEA 2W60A 3NACL 3G5VA 5I1KL 2ATKB 4ZNCD 3WN5B 1U3YA 1CG9A 2Q76B 3PV7A 2A38A 3D0VB 4UOW0 1CTOA 5FF6B 3QYCA 1IBGL 4PJ8B 3HC3H 5DJ2A 3LRSA 5M7QA 3IDIB 3QI9A 5E0QA 4KGLA 5F7FA 3CFIC 5D1QD 4JPIA 4K3EH 3TBWA 5KBNC 3F5WA 3G6JB 3QIWA 5GRZA 1P2CB 2D0FA 1BX2A 5AWNH 4X80H 2P24B 4WDIA 2KBGA 5KVFL 4C59B 4P57B 3FB8B 2N56A 1KELH 4S1DC 3OTTA 1JIBA 3QXAB 1ZHNA 2MHAB 3SPVA 4PJ9D 2NNAA 2CO6B 1E27B 2VE6B 1T66D 3D87B 1A1NA 3PGDA 2PTVA 1LILA 3ZE0F 3DPBA 3KXFD 5CZXC 2WV3A 1E6JL 3PJSA 1HH6A 3V95A 1MWAH 3IKKA 4U1NB 5ELIA 5IROA 1KEMH 1Q0XH 4I0KA 1UXSA 2MKLC 4ZFFA 4QHKI 1OAUL 2YD7A 2H9GB 2IFGA 2F53E 2HVJA 4APQC 5F7MC 4FTVE 5FDWA 2R1WA 3MRBA 5ISZE 2IPUG 5J12C 1Z0MA 2P5WE 3HC3L 5D5MF 1UKTA 4NN7B 3FAWA 3LEXA 2ICWI 3MREB 4ZUVA 3UPCA 3V0VA 3KAAA 4KRNA 1FFQA 4RISH 1X9QA 5I6XC 2R8SH 3AAZA 3SE9H 2XG4A 3OKDA 2BY0A 4V2BA 4K8RL 5J1SC 3A6CH 4PP2B 4XC1L 3B9AA 1ZVSB 3H7BA 2J5LB 4CVZB 1CR9L 3EJYD 4P2YA 4HKXA 5ACZA 4IRSA 2O93L 4JM2A 3V4VL 3U4AA 2BK8A 2NW3B 1A1OB 5BQ7B 5FK9A 3HLAA 3IFOB 3VMOA 4H25A 2BDNH 4OZFA 1P1ZA 1QNZH 1VERA 3OX8B 4H1LG 1R3JA 1LO2H 2HJLB 1OT2A 5EOQH 2P8MA 4X80L 4KJPC 2NX5E 4EUPA 1KPRA 2B7DT 3WKNA 3EFDH 3CGTA 3EDJA 3LV3B 4TOYH 3PWVA 4WV1B 2K9UA 2YK1H 1RHHB 3HR5A 1OSZA 3BP5B 2DIJA 4FFZL 2P44B 1SY6A 5KTEH 5GGSY 5D7SH 3DVNB 3O6MH 1UM6H 2H2SD 3P4LA 3SGKA 5TDNB 3OXSA 3U9PH 3ECBB 5DD1H 4F9PA 3IU4H 4ACPA 5IVXB 3OF6D 4IJ3B 1JBJA 2XZAH 2FGWH 1LO3L 4UB0H 2HT3D 1T66C 4QLRA 3RWIA 4KKLC 1E4KC 4WNQA 2PYED 3HRZA 1GYAA 4GRMB 4YHLH 5FO8A 1S9YB 1GIGL 3OB8A 5DD0L 3EYSL 3TBYA 5KJRH 1OP5H 2ZOKA 4XNZC 4HS6A 3IS1X 4IIQA 3LKOB 3C6LB 5DRWB 1WBYB 1R3JB 1NBZB 4K7PL 4GG6F 4F2MB 5TQ0L 3BZFA 1JF1A 4GLRH 1MCWW 4R90L 3LEVH 3BDYH 5EA0L 2NY4C 2P5EA 4XX1G 3EFFA 4JQIH 4Y1AD 3TBTA 3U1SH 5DC4B 5I71B 1SEBA 3C9NA 2GI7A 4AIZA 4Y16D 2C1OB 2C3WA 2W0FB 1L7TL 1P9MC 4OV6F 1NDMA 1RIHL 2DKMA 1MQKH 2NZ9C 5K59E 5EU5B 4U1MA 4PLNC 3OKYA 4GAJH 1DUZB 3DX9A 4ONFH 1EJOL 3VFOB 5I8OL 5CGYD 2ZOLA 3MGTA 5D7KD 1ZS8B 2C1PA 3PDOB 4RMRA 5C09D 4PB0H 4Z95L 1SJEA 3ZDYE 3QDHA 5GGRY 2ICWB 5FOBB 3HUJF 3ZKNC 1KN2H 3M17B 3QAZC 4P23A 5GS1C 1UEMA 3O6LL 3VH8A 1P6AB 3VFNA 2X1PA 4OCSL 3TIDA 2H41A 4PJ5B 3VFVB 3RZCA 3JWDC 2BVQB 3VG9C 2DWDB 1CLCA 2OQJB 3WS3A 4KUZL 1BMGA 5IEKA 4O02L 1IC7H 3WXVL 4EOWH 2EYSB 1R5IB 1QVOA 2X1XR 3FT3B 1DLFL 4P49A 3OJVC 2FBOJ 1LK2B 3DSFH 4WEMB 3C2SA 3OKDB 2B1HH 1H3PL 5KVMC 1KPUB 1XIWB 1NAML 3QULA 2BVOA 3L1OH 4JAMB 1RHHA 1U41A 1YC8A 4X6BB 1ULVA 1LNUB 1J10A 1M71A 4RISL 1LP9E 3GFUA 2IG2H 4NHUA 5JHLH 3ZMRA 2J8UB 3PNWB 3TIDB 1MIEL 3S37X 1K8IB 5LGHL 3HZVB 3BJLA 1KXVC 1IGFL 4I3SH 2AJ3B 4WO4B 3RVTD 2VLMD 1MHEB 2CJUH 4O5LH 4DJMA 2IAND 1Q0YL 5I76A 4WEUD 4UT9H 5CIPB 5CD3B 1FCCA 1HHJA 3GMNA 3EO0A 4P9HH 1DQLL 4M4PA 4PGCB 5C1MB 2YKLH 2V5SA 3BMWA 4DZBB 2JCCA 5CIPH 1OM3H 1J8HE 4IMKA 2W9DH 4PP1D 2H32B 5IHZB 4FQ1L 1GL4B 1IC5H 4FQPA 3TBVA 1HH6B 2DWEB 3QQ3B 2NR6C 3H9HB 5AAWA 3NA4A 3IFNH 5HDQH 1GGYA 5HHNA 1IGCH 5I1CL 4P46C 3NZ8B 3BGMA 1NGWA 2PR4L 2OL3B 3IDXL 3MJ9A 4MD5A 1KIRB 35C8H 3KPRE 3MREA 3QZWB 5EZIH 3CPLB 1S7XA 1BD2E 15C8L 4PJDF 1D6EA 1OGTB 5ALCL 5EO1B 4P2RA 4PRNA 1ZSDB 2NW2A 4DKDC 1XF1A 4GRWH 2IMMA 1ITCA 1U3HB 1TJIL 1KCRH 1GGTA 3QJHA 4XT1C 2K3TA 5EDXA 2AEWA 3DYMA 3P40A 3NFSL 3S6CA 1ZANH 4XMPH 1HXMB 2GTWA 4OT1H 4YHYC 3ZLQC 4EJ1C 2YR3A 4H20H 4JRXE 4EI5A 3CFCH 4C83A 4YHNB 3L7EB 4HZLA 1SY6H 3U83A 3H3BC 3TO4D 4JG1L 2Y9RT 2W60B 1DZBA 4N0FA 1DP0A 2VDKH 3BP4B 1F11A 1ZGLB 2VZUA 4M43L 1K2DB 1HH9B 3SDYH 3T2QA 4AMKH 4BA8A 3P9MA 3ARVA 1DDHA 2ZCKH 4HMEA 5FYLD 4NNPH 5ERWB 1GGUA 3JTTB 3MBEC 1W0WB 2EDOA 5FGSA 1WV7T 2X4TB 1BPVA 3LV3A 2H6PA 1B6DA 4HAFA 3RVVC 3T8XB 2I9TB 3K7UA 2ICEB 4DUVA 5DVKA 1TQBB 1T22B 5D7IF 3OKLA 1JZ8A 4KDVA 4FQJL 4UU9A 1TITA 5CJ5A 3MLZL 3H42H 1ZGLP 3CSPA 1T7VA 3IDJB 5IGXL 4L4VA 3BP7B 4ELMA 4U1IB 3PJSB 1A3QA 1S7SA 3H3PH 1CG9B 3GSOB 4G8IB 5GGQL 1NAKL 2V2WA 3U30B 1FO0H 5EUOE 4XXDB 1JTOA 2BHZA 3BESR 2V9QA 5J6GB 4OM0L 4FNLL 1NCDL 4ZSOE 5EUOF 1I3RA 4ZXBC 4MD4B 1RURH 1CU4H 3QCUH 1DE4A 1T83A 2AV1A 1JGDB 4XNUH 1C5DA 5DMYA 1T1XA 4LLWA 4CVWA 3BEVA 1H3PH 4NKIL 5HHPA 2VWEC 2PYFA 5J06A 1NC4B 3VG9B 4L5FH 3GBNH 4M3KB 5D6CB 1KN2L 4X6DA 3DV4A 3VD3A 3O2DA 3OMZA 3SJVB 4OUUB 2BXYA 2W0KA 4R0LB 5D5ME 5EORL 5CEZL 1E28A 3EDKA 3EHBD 3MLRH 4JDVB 3TJHC 2J12B 1IC4L 5EU4A 5D70L 4LCUB 4YPJA 3CLFL 2A6DA 3ARDA 3VA2C 1VPOL 5E7FA 2FSEB 1NKOA 4Q9RL 1AJ7H 1S7WB 3VFSB 4M8QB 4JY4B 3ARRA 4JREB 2LTQC 4FMKA 1FL3A 4FFWC 1HDMA 3EYFB 4I5BA 5KSAB 4DGIL 1AI1H 2VZSA 1G0YR 2V7NA 4IMLB 4XMLL 3G5XA 1GGIL 4TUJB 1Q0YH 2NTSP 1T22A 2OS7A 1MH5A 3JV5A 3RQ3A 4PTUA 4OZ4B 1KJVB 2DQCH 2VLME 3CXDH 1PG7X 2FL5A 3BFOA 3G6JA 4P2CG 4AEIL 4S1DD 2JIXA 1HQRB 3VCLB 3ULUC 12E8H 3Q3GA 5AZ2L 1FPTL 1BJ1H 1CD1A 3MO1A 4GSDH 4OF0A 4JR9L 4P5KA 4M6OL 3TZVD 4N9OB 1LDSA 5DUPH 3D0VA 3KPQB 3BKCL 1U8PA 1FL3B 3QDGE 4POUB 5FF6A 1RZJC 1EFXD 2E27L 4UT7L 2XI9A 1FJ1B 1C5BL 2CRMA 2CK0L 1WFUA 3GB7A 3LZFH 4OGXH 1VDGA 4YLQT 4PJDB 1FFPA 1BZ7B 3UROR 4KHTL 3P9WB 3EJYC 4KTEL 4OB5H 1OT1A 2VZTA 4Z7OE 3HUJB 3ARWA 5KANI 3BPOC 1CIUA 4LGSB 3EJZD 4Y4HB 1C12B 2DOCA 1JHLL 3GIVB 2VISB 4GUPA 4C58B 5CBAA 3QH3B 1EPFA 2F5AH 2AJ3A 3MFGB 4WO4A 3C60B 4OSUH 1FNEB 3TYGH 5IK3A 1ZT4B 5KS9F 1U36A 3MYJA 3K3QA 1MIML 4M1GL 2YPKB 5I1LB 3ME0A 1IAKA 2DQGL 1GPOH 5T3ZH 1U8NB 4X9GA 1QUNA 3PP4L 4PJHE 1QKZL 4XNQA 1NGWB 2R0WL 4XPBH 2KZWA 4DK6A 1L4IA 3AY4C 3VDBA 5K9KB 3B2VL 5CP3A 5D1XB 5F72S 3H3PL 1AGDA 4H1LA 5D1ZD 5I1GL 3OGOE 4FA8A 1NGQH 4NJ9L 3C6SB 2G9HA 4P9HL 2HVKB 3U6RA 5E8OB 3CH1B 1OCWH 3BQUB 1RPQA 1JRHI 1Q9OA 4DZ8A 4ELKB 4JCLA 1B0GA 4ESKA 4U6VL 4NOBA 2F53D 4F58L 4PJ5A 1G7PB 3AVEA 1RZJH 3C09B 3HUJE 2NY5C 3LQAH 1ZTXL 1QSFA 3JSSA 1CLOL 4N1CA 5I1AB 2X4SB 1CLYH 1AO7A 5D7JB 4MDJB 1UJTA 1GC1L 1DDHB 3CDYA 4W6WB 4DGYL 5HGGS 4ZQKB 2VLKE 5E03A 1HCVA 1FDLH 1QVOB 3DVFA 1IILE 4NKIH 5GHWL 2VR5A 1U92A 4N0FB 3HMXA 5FECA 1MCOH 2BFVH 5MENA 4KZDL 4ZD3L 5L0QB 1CDYA 3T0DA 5INDB 4RMTA 5LXGL 5BV7L 2R1YA 3QUML 2XG5A 3ELAT 2P48B 5C2BH 3TYFB 4FQ2H 1H8NA 3VGHA 1MCNA 4A2LA 3ZZ1A 3QUKA 1C1EL 1IFHL 5C0AE 2W38A 2P5WB 2AGJH 1YPZB 4P3WA 2O5ZL 1IL1A 1YN6A 2ARJB 3MUGA 4G8FB 3HZKB 5F7LB 3O4LD 1MLBB 4Z76A 1BF2A 4YDJB 1A9EB 4IJ3C 5BS0E 4Z0BL 5JZ7D 3UX9B 1MFNA 1G7HA 3C5ZC 3HE6A 1FH5L 1MSPA 1MRDH 3Q5TA 2JELH 2DWEA 1VESA 5E9DE 4RX4D 3LKPA 5GS0H 3BDBA 3R8BB 4TUKH 4UOW1 4ZTPH 2GT9B 1IQDA 4HUVA 4P9HC 5D5MB 2CK0H 4WV1C 1X5IA 3FT4B 1J9CT 3WFCL 1QLRB 1XF3B 2DQDL 5IEKB 3BKYH 2OJEA 4JFQA 1G1CA 5CD3A 2RFXB 2R2HA 3FZUD 2RR3A 2PW2A 4YDKL 3BT2L 1UQSA 2M2DA 4KJWC 4YXLL 3QWOB 5JW4N 5TPWH 5DQDL 1T0NB 1EO8H 1O0VA 3RBSA 5L8LB 3LEYH 2HTKC 5GGRA 1OSPL 3CK0H 3SQOH 1XIWC 5GGSB 1KTLA 1RZ7H 5EU6A 1UYWH 2IBBA 5HHQA 2H2PD 3GRWH 5IHUL 5GXBB 4RZCA 3V6ZA 4N5ED 2P7TB 4C55A 3G08A 4NC1C 4POZC 1PY4A 1V7NL 3RTQC 4CRPA 3ZHLA 1KG0B 1MHCA 4ZXBA 4QYOB 4RDQG 4S1RL 3PHOB 4ZS7H 4OD1L 1ZKAA 3CD4A 3WL9B 4FFZH 4P4KA 5MERA 5FO9B 4XGZB 1CL7L 3P3YA 3QXDB 3EJZC 4JFED 4I8DA 3SDXF 4I0PA 5I1HH 1FFNB 2EDHA 3CUPA 2H32H 5DD5H 4CKVX 4WUUA 2J4WL 3KLAA 4EVNB 4XP5H 4ZUWB 5CGMA 2XWBA 2J7LA 3MV7B 1XGUA 3TT1L 3QZWG 4LHQB 3CDFA 4QOKE 4J12A 3VW3H 3MLUL 1SMOA 2YUXA 4AT6B 3KWWA 3THML 2YMXH 2A6JB 4P46D 3RTQA 1W72H 1FYTB 2FH8A 3N85H 5J89A 4LSTL 3AS1A 3V5KB 5INDA 4BYHA 1P7HL 5HDOA 2E9WA 1HHKB 1YEHL 3FOMB 4H1LB 1AGDB 2BSSA 2CDEB 3LS5H 4PP2A 5FGBC 1PZUB 1YNKL 4DWHA 1H8SA 1A6TB 4XCNB 4TVPL 2V5MA 4U1HA 4NQDD 5C0CD 2CH8A 5MERB 5J9PA 4RIRA 2GJ6D 5DJAB 3IXTA 4Y5VB 2FCBA 3SGDI 2XFXA 3SPVB 4YDKH 4D8PA 1MFCH 4L29A 2PXYC 4YDLC 4M7LT 4LOUD 1I8IB 1FQ9C 1PG7W 3PHQA 1ZT4A 2Y36H 1OCWL 5GRJL 1XEDA 4YDJA 4GAYB 2AXFB 5IGXH 1YEDB 1NFDE 1JYWA 2BOCB 2CKBH 4LHUB 4KK6D 3F12A 3DO7B 2W92A 1G7PA 4G8GE 2RAMA 5E2JA 2H9GA 4PJHF 4GRWE 3WFEL 2WWKT 4YHZH 4M6NL 4LVEA 5M95B 4LVHB 3QPQD 1A0QL 3MRRB 3MSPA 1S9VA 4YUEH 1GHFL 1I8KB 1JJUA 4TOYL 1DBJH 4YDIL 3C08L 1QLFA 2QADC 3O41A 1HSBB 1FNSH 1HQ4A 3MV01 1ND0A 4XPAH 2QQKL 4LSDA 4Z8FH 3IFPA 1N0XL 3VFWA 2NR6D 5E8OA 3QFJB 4ZQKA 2C3GA 3WS6C 2NY6D 3GSRB 2WWMC 2QR0B 2AJSH 4AIXA 1MRFH 1ZMYA 1N4XL 3E3QC 5DRZA 4U1LA 5J1TC 3IDMA 2C3XA 1MCRA 3EIFA 2YPVH 2DQFA 3LSOB 1OSZB 1FAIH 5C3TA 4NQSA 5IVZB 1X6NA 5BV7H 1QSFB 1BBDH 3K8LA 4UI2A 4X9IA 3AM8C 2ZUQB 5I1AA 2WWMD 2AEQH 1T0PB 2VAJA 1AFVH 2IWGA 3JWOL 2ARWA 4D9RD 4Z76B 2E7BA 4I2XA 4YH6A 4PRAA 3WNNA 4FP8L 2JJSA 3OAYH 4WU7B 4KRPC 3T1FB 2BVEA 3CFKB 4YFLI 2ESVD 5F9AC 3O4LB 4HFUH 3CX5J 3ZTJH 5KSAA 3ZT6A 2KDGA 3L3OB 3QB7C 3EYVA 3FONA 1I9RH 3JZ7A 5I1EL 1YY9C 1Q1JH 3U48A 3BKJL 4YXLH 1FJ1A 1ED3B 3QNYB 3GB7B 4MLIA 5KSUA 5FO7B 2PKDA 4L4VE 3R0NA 2VXSL 4OLWL 4R0LA 1JVKA 3BW9A 3PDGA 3QPXL 4XNXL 1Y0LB 4Y2OA 3DMMA 5IF0A 2GTZB 4ZUVB 5A43C 3HG1E 1EHAA 2FD6H 3I3EA 5DEZA 4HJGA 3VGAB 2AS5M 3ZE1F 4PRPE 1RY7B 3LN9A 4X6EA 4HIXH 1OGAE 4CNIA 4OLUH 1HYSD 4NT6A 1XCQB 1Z9OA 3T4AA 5F1KC 3VXSB 4Y2DA 4GAFB 4PJHB 5GGTH 4PGEB 3RPKA 3PHSA 4H20L 4JFFA 5DSCA 1A4JA 1CL7H 4IMLA 4LF3B 3T0EE 5C09B 4YXHH 1FGVH 3W0WB 2VLLA 3VXME 1BZ7A 5DO2C 4P5TD 2G2RA 4IDLA 4OJFH 5DF0A 1B0WA 4X7DC 5DRXB 1H9VA 3DV6A 1QACA 2EDDA 5IQ7L 2OTUB 4X4MA 1VSCA 2DM2A 4HWEL 3G04A 4WCYH 2R23B 5BRZD 1KJ2A 3O3BB 3QIWD 4PJDE 5C08A 5C0FA 5IKCB 1RJYB 4Y1AB 4X4ME 1TCRB 1P7QD 5K9OA 3EZ8A 3MCKB 1WJ3A 4ONHA 4ORZC 1HKLH 5IT2L 1AC0A 2NLJA 4XP5L 5AD0B 3FN9A 2WINA 2FEDD 1EEZB 1HIMH 3SDAB 4I4WB 3WFHA 4X6EB 1YQVH 3OGCA 4NCDA 4D9RE 1K9TA 5GGUA 5GJSH 3ARZA 2A73A 3QDJA 1C5DB 3O6FC 4M03A 4K3DH 4Z7WB 2NY5H 3CFDA 4JY6B 2ERJB 3LS5L 1I1AD 1RUAL 4JDTH 4X7SH 5DRXA 1HE7A 4XNXH 2ZKHH 4LLUB 4U6VH 1Y6KR 2VDNL 1NH6A 2Q7NA 3BEWB 1ACZA 2BSTA 3WFEH 1EO7A 1LEGB 5B3JE 5J7CC 2DLGA 3GZKA 4P23D 1AR1C 4WW2C 3TJEH 5C6WH 2ORBH 5DFWH 3TT3H 1SVCP 3BD4A 3P4OA 2VLKA 3RUGF 1I1AA 5KOMC 5SWQA 1P7KA 4ZDHB 1DQDH 3FRPG 1KBGL 4MAYA 5EIIA 4DGVL 4XCFL 3VA6A 2NXZB 4J7RA 1P5VA 4XPHL 4FHBD 1HNGA 2VZVA 4U6XB 1ZLWH 4UTAL 1EXUA 1XH3B 2FLBT 4FXKB 1OGAB 4TUJA 5ESQB 5IBUB 4HWNA 1DBAL 4JHAH 4C54A 1FAIL 3V6OA 5JIPA 5FYKD 3IXAA 2RIKA 1KEGH 4WCYL 4OCSH 3REVA 2FZ3B 2QQQA 2D0HA 4NKMA 3REWA 4LBEA 3SKOA 2HWZL 3I3BA 1I8MA 4E41B 4LK4A 4F7MA 1CK0H 2GTWB 4G8EA 3QJHB 3ZL4L 3HAEB 2VDRL 4URTB 5M94B 4FRWA 5K93A 3WFHB 4LAQH 5L6YL 5IFHL 1ZHLB 4BQ8A 3BXNA 1TQCB 1MCKA 3OKLB 2VERN 4YX2L 1AR2A 3W82A 3AMLA 5K9JL 4E42A 2P5WD 3MZTA 3GGWB 3WLBB 5TQ2L 3MOAH 4MXWL 4DVRL 2QEJA 2EDEA 3SJVD 3MJ8B 4K8RC 2WQRA 2KQMA 1TPXB 1N5AB 5D2NB 4H5SA 4LNRA 3IGAB 5EZLB 2HLAA 3I02A 1MF2L 5SWZD 1KFAH 4LLWB 3T77A 1QSFE 4JHWL 5FO7A 1INEL 4I18A 1REIA 3U7AA 5IQ9B 1Z3GL 3SGEH 2WUBH 2D31A 3L3IB 3CSYA 5FYKH 5DDHA 5F3BA 4PD4K 3RZCB 1YEIH 4HIHB 1X7QA 2X4NB 1WEJL 1HHJB 3GMNB 1U8OB 3QEGL 1CD9B 2UV3A 3MRDB 3B2UC 3X17A 2Q86B 1S7SB 5LGJA 1G9NH 3C5ZD 4P2QE 3FCTA 3HE6D 3KHOA 2V5TA 5BW7C 5T3XE 1YNLH 1O7SA 2JLLA 4U31A 3I84A 1J05A 3K1KC 5F1IA 5IM7A 2A1WL 2XT1B 4HDIB 4Q9RH 4JFFD 3U7YH 4HIIB 3ESUF 4YFDB 4NQCA 4ODSH 2J8UA 3PNWA 3NFSH 4K8RD 3HPLA 5KG9A 4JFHE 3T8XA 3TGXA 4K3JH 1LNUA 4ORGA 5CS7A 1CDGA 5DMIH 1MCWM 4Y5VA 4PGJA 3NIFF 1TCMA 5FO9A 5J9PB 5EN2A 3DX6A 3O45B 3UTSB 1CQKA 3SY0B 4ODUA 1S3KH 2GITB 4U1HB 3WHE0 1TVBA 3QDMB 5EO0A 4M7ZB 3MLUH 1HHGA 2DLFL 3O3EA 3BZFB 5HHQB 3C6LD 1XF2A 4RAVB 1I9EA 2ZNWA 5DJZB 4N8CL 2H2PC 3BAEL 2Z0BA 4HWBH 2XV6B 3QWOA 3KS0H 1Z9SA 4GKSB 1EGJH 4UUJA 3RFZC 1RAMA 3P11L 3C60D 3WHXB 5DQ9B 4NO3B 5FIEA 2XTLA 4PRPD 3FO2B 5FO8B 4OFPA 4M6ML 3QUYB 5CWSB 1LE5A 1A1MB 2A6IA 4PV8A 5ADPH 4LPUA 3F58H 1UWXH 3GMPB 1U8IA 5CEZE 5LVEA 3MLYL 1XGQA 5JW5B 5EIQA 2LAGB 3KPSE 4ODUB 5KVEL 3BPNB 2QQNL 3BKCH 4D8PB 1T83C 2VXSH 4GG6A 3QFJA 2W1NA 3SY0A 3OB0K 5HHOD 2C1OA 5FHAH 1J18A 1RZGA 1MFDL 4I0CC 5T1KB 3W0WD 4QGYA 3LKSA 4XVTH 3TZVC 1KJ3H 4G3YH 3C5ZB 3C9NB 1KEML 3GSUA 3QA3B 1CE1H 3AREC 1A7PL 1D5MB 4QHMA 3CMOH 5J11C 1E0OB 3SCMD 1FRGH 4MLSA 1KEGL 4DW2H 5CEYA 3UTPD 1I7ZA 3JTSA 1NBZA 2NTFB 3QIBA 4WI4A 5I15L 1D6EB 1OGTA 4YNYA 1ADQH 2RFXA 1N0LA 2HT4C 1UM6L 5IJVB 2XA3A 4IOIA 4Q58C 2EDYA 4WO4D 5E6IA 4QF1B 4QRTA 2XPGB 2R2CA 2E9JA 4MX7B 1WIPA 1JGLL 4ZO8A 5C0GA 1ZHKB 4PD4J 2R0WH 1YEKL 4GT7A 3ILQC 2W0FA 1A6VH 3W2DH 5EZJB 3BZDA 5BRZE 5C86A 3HPJA 2OR9H 4U4BA 5GPRA 4U33A 4ZOEA 2VXTL 4OGYL 2D3VA 5I1JL 4JFZL 1W0VB 1MIMH 2EDBA 4M1GH 4F3FB 3GSXA 1PY9A 3MQIA 1HWGB 1JRHH 4XVUC 5MEPB 3D3VA 3SKJL 5T5FH 5CIPA 1KNOB 4ODVL 4V1DD 3CXDL 1L7IL 4L9LB 3X12A 4S1SL 4NYLA 3BP6A 2NXZC 2VDNH 3OPZH 3B43A 4CU8A 4NO3A 4GKOA 3SGKC 5MEQA 2X1WL 4IRJD 1PKQB 3DVGB 3ZO0A 2E7LC 3WEXA 2HKHH 1RUQL 3VFMB 2FX9L 5B39A 1HINH 2F74B 1OAKL 3NFNA 2HKFL 3JV0A 4OLZH 1NC4D 1RZJL 4LLMA 3CLEH 1FZMB 1OGAD 4U1GC 1UKQA 2ERJC 4PJEF 4JZJC 1DLHB 1EIBA 2HFFA 4MA3B 2F54E 1DANT 2EIZB 1KLFA 4W68A 4YC2B 3NPSC 1QPXA 1YMME 2YRZA 1CGVA 3OG4B 4HQQL 5K9KA 3ET9F 2XXMB 1A02N 1DANU 3QG7H 4OTXH 1NLBH 4ZXBD 4EN3B 3CAFA 4LVHC 5IVXE 4PUBH 4GRWB 5D6DC 3I50L 5TJWK 3ILPA 1A6ZA 3HHRB 1YYMH 1YMHA 4J3WA 1MLBA 5D9SB 5CEYB 3U9PL 3N1QC 3BGFC 5ANMB 3O81A 2F9BT 3RAJL 2WNGA 2APVA 2HJFA 1MLCA 3VXUA 4MCZB 3QEUB 1PVHA 4H0HB 1U6AL 2IANA 5FYJL 5LAXA 2EKSB 2X4QA 4OFDA 1OW0C 5KVFH 2NY7L 4LLDB 2E8ZA 3U46A 3PWJA 3X11A 4PJDA 1K3ZA 2X4NA 3C60C 1TENA 3PGCB 3PP3H 2DYPA 3DYPA 2D31B 3GNML 2WW8A 2ADGA 1G6RH 1T7XA 5EULV 1IM3B 1HI6A 3PL6C 5IQ9A 2Q8BH 4KVNH 3AU1B 5C07E 2CKNA 2MHAA 1D9KD 5ENWB 3HAEH 3MO1B 1NGPH 4GXVL 2R2EB 4JFDB 2VKWA 3GSNA 4NQCB 3U1SL 3V0VB 4RX4A 2R0ZH 1OPGH 2OMBA 3SKNB 4X4YB 4NFCA 1E4XL 4MQ7B 4LSRL 3MRKB 1A14H 4LNVA 2HN7A 4XC1H 3QIWB 4G6ML 3U9UA 4ZFGH 4I48A 4HG4J 4KRLB 3QG6B 1WT5A 5DZLA 2Q8AH 5TPWL 2LV4A 5HI3C 3IDXH 1UA6H 1YJDH 3W39A 5FYJE 2MCG1 3S88H 3MLVH 3NCFB 3MODH 1JK8A 3ZYJA 2IAMC 1WUNT 1Z6JT 3O2VL 3WFCH 4AQ1B 4XHQA 3BKYL 4LOUC 4F7MB 1A6WH 3MJGX 1CIDA 1D3CA 1BVKB 3B8SA 1U2CA 2D7TH 1LEGA 2XTJB 3SKOB 3BE1L 2QSVA 4LCWB 5D7LE 1B6UA 5E6IC 3P4MA 5E8DL 1J8HD 1ETZB 4QHLB 1MREH 4FQLL 4Z77B 5JPMA 5H37G 4J6RL 1RZKC 4JREC 3VI3E 4KZEH 2R56H 4WEBH 3ZE0E 4FFYL 2VR4A 3QUXD 2PW1A 3Q6GH 2IANE 2FJHB 1J0JA 4HJ0D 2UVEA 3C8HA 2PF6A 5GIRB 1JRHL 4PYHA 1YUHA 2OZ4H 3ZTJG 3A67L 4BM7A 5HTSA 4U1KB 1UZ6E 3KPTA 3BEVB 2B4CC 3VXRE 3U2SA 3QI9B 2VISA 4GUPB 1S5IH 4IOFD 4E41A 2J8UE 1MRCL 3DSFL 2AJZB 3RIAK 1Y0LA 4FQ2L 1I1YA 3QEQB 3REWB 4K9EC 3NABL 4OIIL 3CSYB 3DHJA 1KJ2B 3N9GH 4OGZA 25C8H 4JFYB 4JG0H 1K4CB 4MA7L 2CKBB 1JFQL 5KANG 1NEZA 3OJ2C 3TO2A 1X4XA 5T33H 4G6JL 1JHTB 1OVZA 1E27A 3D0LB 4OM0H 3QEUA 2ICES 3FB6B 4LRIC 3PWUA 3QO0A 3NBNA 3ARFD 1FC2D 3P4OB 2APBA 3O3AA 1EAJA 1RIUH 1MUJA 1YJDL 4NBZB 3GMMB 3H42L 1CU4L 5FDWB 2OL3H 4IM8A 4M6MH 4PJ5E 3HNTL 3D69B 2NY6B 4NO0D 5I16B 3O9WA 4LCIL 3P0VH 3P77B 2R29L 2GAZB 1NMAL 3O3BA 3P2TA 5C0FB 3IDMB 2EKJA 4JM4L 2FATL 1VENA 1G7MA 1L7TH 3RRQA 1J1XL 1NBVH 2X1OA 1ZVYA 4QHLA 3TV3H 2B20A 2COQA 1IGTB 2MCPH 5AYUH 1HXMA 1CE6B 2CLVA 4Y19B 5B8CB 3KPQA 1NUNB 2NNAB 1T7YA 3QDGA 2G75A 4ODBD 5CFHA 4O2EA 2Q3AA 4I4WA 3N1PC 3W39B 4P2QA 4B41A 4PJIB 5E2TH 5B39B 1A7NH 4NGHH 43CAB 1T2QL 3IT8D 5A2LH 3O4LA 1OLLA 4DFIA 3S36X 2YUZA 4G6FB 4MAYB 1P2CA 3VI4E 4PRNB 4L1DA 2AJXH 5ANMA 1I8IA 1T20B 4PFEA 1NCBH 2AXFA 1N2RB 1X5HA 2PYEE 4WJ5B 5JDSA 4UNUA 3RX7A 3ZKMC 3BRGC 3VGBA 1XGYH 5HHMD 5IEHB 4JFYA 3TCXA 2FBJL 2BRQA 5D1ZB 5KSUB 3B9DA 3BPLC 1I8LC 5E5MB 3RWDA 3L5JA 4XCEB 1S5HB 5F88A 2F5BH 3MA7B 4GAGL 5F9JA 5DQJB 4K7FB 3WDHA 2X4PA 5FAAA 3VFWB 2AXGB 2B39A 3PWNB 2V2WB 2FYYB 3OKKB 3V5KA 3ULVE 1YDPA 5C9JA 4DUXA 2X4QB 3I6GA 4W6XB 4NWTH 5HVHC 3PWPD 3IS0X 3O2WL 3PP3K 4LEXH 4OAWB 3QO1A 1B4RA 2HJFB 3NACH 5KN5B 5DJ6B 3DUUA 3QEHA 3RUGA 3DWTA 1OQOA 4MA8H 4JPWL 3C5JA 2XNAB 3HZVA 1M71B 4X6BA 4PTTB 3Q0HA 1QBLL 1T04B 4JAMA 1TZGL 2ILLA 2QSCL 5HHPB 4M7ZC 4JFOA 3D48R 4JANA 3LRGA 4O4YH 4XI5C 3TH2T 4IIQC 1OM3L 5T1KA 3KPOB 1G9EA 2R23A 5C0JB 4KKAC 4Z77A 2JB6B 3KGRA 2CUHA 1IZJA 5HVFB 3KPPB 3M1BA 4Z6AT 2VUYA 4C56B 3HAEG 4M62L 2EDJA 4X83A 2EE9A 3QWQB 3SKUD 3MCG1 1EAPA 1RZIA 2BSSB 2CDEA 4GKNA 4JJ5A 1HSBA 1NBYA 2A0LC 3FQRB 4LF3A 2ED9A 3NFNB 2VXQL 3WEXB 4LPCA 3QG6A 1EVTC 1DCLA 1H3GA 1LP9F 1T1YA 4Y4KA 1CK0L 2ZG2A 4HLZG 1QFUH 1QO3A 4ODWA 4YXKH 3RGVD 5CZXD 1SYSA 3DBXA 4LSUL 3V6OE 4JZOA 2R9HD 4F3FA 2EYRB 4JQVC 3GO1L 1AXTL 2VLJE 4UDUA 1H15A 2ZJSL 1KLUA 3UTTE 4H8WC 1LMKA 5J4MA 4U1MB 2IEPA 5FKPB 3T3MF 3ARBC 1I4FA 3BKMH 3HB3D 4FQCL 4NQEA 5IMMA 3VRIB 1EV2E 3VXNA 5D1QC 3DVGA 1WIUA 1JNLH 3MROB 3CFKA 4QWWD 4X98A 1LE5B 2ORBL 2EIEA 4U3CA 1BAFL 5IVXF 3SO5A 4KV5E 4G6AC 1YMHB 2D4DA 4NNYB 1BWWA 4XPTL 3NGBC 4JQVA 4HUMB 5KAQG 3QPXH 2R4SH 5HYEA 1FC1A 1FFNA 2VXVL 3CUPB 3JWNC 3GMOB 4FQXC 2DQFB 3LSOA 1A7QH 4P2RD 4HQQH 1WZ1H 2E9IA 1GAFL 1T89C 2HYMA 2AQ2A 1TXKA 2RQ8A 3D9AH 4LFHG 5LWYL 3GEWB 3LEVL 1UWEH 3PQYD 3B83A 1YMMA 2OTPA 5KZCB 4BFGA 4KI1A 4Q0XH 3F7VB 4LLMB 4BH7B 3FRUA 2BHYA 2FEEI 4LLVA 5EU6B 1XAUA 2ZZUT 5T3ZD 1K6QL 3ISWA 2AXJA 3WLWC 1TZIA 2Y07L 5GS0L 3X14B 1F4WH 2FX7H 5IB1B 1JGVH 3BQUD 5IBLD 4MCYA 4I13B 3V4PL 4XVSL 2SEBB 2DJUA 3D18B 1W0YT 1KPVB 4MDIB 3DUUB 1HYRC 4Q7DA 4HWEH 3BZEA 4I0PB 1R3IH 1TQBC 5MP6L 4HS3A 3I75B 5EO9B 2A6KB 4MNQE 3NCBB 2YBRB 3NIDF 5T3ZL 3GKWL 4F7EA 2ZCHH 5GS2H 5IV2A 4NWUH 4UIMB 1VEPA 2NW3A 3RWHB 3BSZL 3UZEA 4LKCA 1LK2A 4HUUB 3TO4B 1VCAA 1SJHB 5C0BE 1X3DA 3ECBA 4BZ2H 5E5MA 5F9OL 1B90A 2IGFL 1NKRA 1IC5L 1EXUB 2ESVE 4RAUB 2LE9A 1F4YL 5JPNB 3RGHA 3BIBX 1OAXL 5C0BA 4WUKH 4IRJA 4KZDH 1I9JL 2Z91A 2Q7YA 1N5AA 2E9BA 3GMRA 3SDDA 1LHZA 2G60H 2YSSA 3KG5A 5C07B 4RMWA 1RZKH 4XBEH 5IOPA 1IAOB 1MHPL 2YC1B 3MRBB 1GGCL 1T6WA 5DA4A 4OM1H 1AKJD 4N90E 1EFXB 2VABB 2VN4A 1N6VA 1I4FB 1AHWC 5SX4H 4E5XB 5BVJA 2J8UF 5ICXA 4AJ0A 5DZNA 1QSZA 1BGXL 2D7OA 4QRUA 5IB5B 1JP5A 2YPLB 1ORQA 3GM8A 5FEBA 1ZT1A 5D93C 1CD1B 5T5FL 3D85D 2QADD 4YXKL 2A73B 3UJIL 5ESAA 4OCRH 1A6AB 1MVFA 2NX5A 1BFOB 1BP3B 1DQQB 5GJTH 1JHKH 1CD0A 3JV6A 1RUQH 4HJJL 5DQ9A 5HHVL 3WO4C 1FH5H 1MRDL 4YHIA 3MLWL 1OAXH 3WIIH 2BOBA 4HJ0C 5HDQL 4X6DE 1MY5A 1BEYH 3MCLH 2NXYB 1FO0B 2UUDK 4X6DF 1ZA6B 4QRSA 2Q20A 3NA9H 3QUYC 3ALPA 4X5WB 5L2KE 3C8KA 4XPFH 2ZG3A 3HG1D 3MMEB 4RAVA 1XF2B 2RBLA 3MJ6A 3T0BA 4X99B 4PJBA 3TNMA 5CINL 1CFNA 1HZHL 2UY7A 3CFJB 2CJUL 5T1DL 3AROA 5IB2A 4OZIE 1ZVSA 4CVZA 1CXKA 4LPVA 5FGCB 5F9DC 4MJIE 4OLYL 4GW1B 4HV8A 3G6AB 4NJAL 4P2OA 4OF6A 3T3PF 1IAMA 2DL2A 4JO2L 4TPRL 4G80A 1SYVA 4NFBA 4NQXA 2CKBL 3CCHA 1AGCA 3L3GA 4LLAA 3UAJD 1T1WB 2DQJH 3DTXB 2E7MA 8FABB 2CLZB 3BISA 3EDFA 5I1LA 3V0WL 1JTPA 1JPFA 5DT1H 4KMTH 5IVNA 4M62H 2H8PB 5D96B 1CE1L 3QXTA 4Y4KC 1R24A 1HHHA 3OSKA 5HHMB 3WD5L 5E2WL 3J8F7 1NUFA 4OZ4A 1ZVHA 1E4WL 5DTFB 1X7QB 2VSDA 3V7AG 5F1NA