25C8L

Catalytic antibody 5c8, fab-hapten complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPAIMSASLGERVTMTCTASSSVSSSNLHWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCHQYHRSPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Catalytic antibody
molecule keywords IGG 5C8
publication title Structural basis for antibody catalysis of a disfavored ring closure reaction.
pubmed doi rcsb
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 25c8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 25c8L01
1PGRB 1FIGL 1UA6H 5C0DB 4IMLA 2GK2A 4G7YH 4U4BA 5F1IB 3MRIA 5KVFL 4X98A 5J56B 4L3EB 3O2DA 3QPXH 4ONHA 5I8KL 3PQYA 4QTHA 2UY6A 3BT2H 3CVIL 4APQD 4F15B 4RAVB 2CDEB 1N59A 1QA9A 4KGJA 5HDLA 1JNLL 2E6QA 2YD5A 4PRAA 4BKLA 4EEEA 1J11A 3DX8B 3JV6B 4IDLA 5BVJA 2EDNA 5GIRA 5CZXC 1CFTA 3BUTA 2UV3A 4JDVB 2AXHA 5L2KA 4PTTB 2MWCA 3K46A 3VFOA 5BVPH 5DRWA 1UWGL 2P5WE 2FSEA 3OKLB 3BO8A 3SGKA 3WJJA 4ODWA 4HWBH 2R23B 3UPRA 1FLRH 4JQIH 1UZ6E 4WI8A 3MOAH 2ADGB 4TNVK 5SWSA 4K94C 5TFSL 5IBUB 3HE6A 5I17A 4CNIA 3F6IA 2H8PB 1BFSA 2Y9RT 2NY0B 1HCVA 4EDWL 3QEGL 4KPHL 1S7RB 5ICZB 2Z8SA 4KKNA 3UTQB 4FTVE 1C5BL 1CXFA 1KIQB 3LB6C 4JO1H 4PJIE 1D6EB 4W4OC 1E4XH 2FEEI 2WBJD 4TQEH 1OM3L 5EA0L 1RZKL 3TBTA 4PJ9B 4PJGF 1BQUA 1NAKL 5DJCB 4L8CA 3LKPA 1GIGL 5GZNC 1P5VA 1A7RH 2XIDA 5E00A 5CLWA 2AJ3A 2EYSA 2D31A 1EHLH 4XI5C 4MA3A 3V52L 4URTB 3F62A 4XPBL 4M93B 4OI8A 2AVGA 4YFEA 2CIKA 1O7SA 4LDLB 4BA8A 2OR9H 4I4WB 3ZT6A 1YC7A 3C08L 1QFPA 2BFVH 3QUZA 4P9HC 4WFED 4MWFA 5JDSA 2EXYD 5BO1L 4LCWA 4J4PD 3IJYA 4S2SA 1RJLB 5JR1L 3LIZH 2VDKH 3OPZL 4NIKB 4JPVL 4AL8H 1JRHH 4AK1A 2VLLB 5EULV 2Y5EA 4DGYH 2EDTA 3HPJA 1BFVL 4HWEL 3MV8A 3L9RA 3OMZA 4QTIH 3SDAB 2YPLE 4P5MA 2OL3B 2YBRB 1AP2A 2DQUL 3BEWB 4NQDB 5ACZA 3IKCA 1XMWA 3OKDA 4K7PL 4PJCA 1VEMA 1U8PA 3PXJA 1N0XL 5F96L 5DFVD 4N90E 4X5WB 4D9LH 1XIWD 3DI2B 2FJFB 3V6FB 3IJHA 1W72H 3HCVB 4G6JL 4FQ1L 5EPMB 4LAJH 1PY9A 3TBWA 4LCYA 4NFDA 4I1NB 3VMOA 1NDMA 4JPWH 1OAZL 4O2FA 1QBLH 3F5WB 4HX1A 2Z8VC 2VLKD 3RWEB 3BWAB 5HYEA 3IDNA 3P0VL 2OCFD 3V79C 5EORL 2J8OA 3WXWL 4CMMB 2PNDA 1PG7L 3DYMA 2VZUA 3DXAD 5DEGB 5EBMA 5GHWL 2VXQL 1HINH 4OF8A 4RMTA 4P5TB 3EYOA 4X8JB 5I76A 1IGMH 5HGAB 5ESQA 2XFXB 3O6FD 1OAKH 4PTUA 3T0WA 1CGUA 5IIEB 4XPHH 5BW7C 3T2QA 1LNUB 3PP3K 1QZ1A 3QUMA 3WUWA 2HT3C 2ORBH 5EUKA 3OKOB 3IRZA 2NX5D 5GRJH 5ID1A 4ZYKA 1P2CA 4PJAF 2CKBH 1WF5A 5I1IL 2R2CA 3SGDI 3W0WE 4PJ8C 2CR3A 4WNQB 4MX7A 1ZWIA 1K2DA 5J1TC 3NN8A 4MA1C 5CJXA 2XTJB 3QO1B 1ZLUH 2Y6SD 4XT1C 4D2NA 3T2PA 1N4XH 5JHDD 4MNQB 3DVGA 3AREB 1HKFA 4OLUH 4OLYH 3V2AR 1S7SA 2HLAA 4XNXH 4P59L 5GS0H 5KVEH 4JRYE 1FH5H 1BGXL 4YC2C 3RKDC 1RZJH 3D85D 3S96B 2ADFL 2LQRA 1OWWA 1SJEA 3V4PH 3EFDL 6CGTA 4DQOH 5F6HJ 5L9DL 1R5VB 3TO4D 5AWNH 3DX9A 4PP2A 3K8MA 1UKTA 2CMRL 4KKAC 3BYTA 3I50L 2XNAB 3BGMB 4P3CL 4M8QB 4W4OA 1B0GB 1NFKA 5EOCH 3MLVH 1T03H 4I0PA 3QFDB 4HGMA 3MLWL 3STBA 2PUQT 4C83B 1DFBH 3BKCL 1I1FA 3S5LG 1LEIA 5CP7A 1F11B 2LVCA 1U3JA 1ZHKB 4MD0B 1MJJA 3B2VL 3NFSH 5TF0A 2GJ6E 3QWRD 4HH8A 3KLHD 3D3VE 3V8CA 2DTSA 4E42A 1YJDL 1JP5A 5L8LB 1FAIL 3TYGH 5C0RL 2HT2C 1I4FB 4LGPB 1TVBB 1WBXA 1BLNA 5DHVA 5HY9A 3H3BC 2GTZB 4EXKA 2XQBL 4U1LA 4H25A 1OPGH 2HN7B 3WCYA 1I9JH 1AD0A 1GJIA 3F7QA 5HTSA 3MOBH 3OXSA 3SE3C 5I1HH 3L3JA 2B0SL 2ARWA 2DLHA 4FZEL 2KKQA 5IW6B 1MEXL 4R4BA 2QQKL 2EDHA 4KC3B 5F3HB 3AU1B 4MNGB 4D0DA 1IAII 2APTA 3OQ3B 4NNXA 2RJMA 1KPVB 3T65A 3TA3B 4YK4C 2CJUH 3VFTA 3ILPB 4ELMF 4U49A 1EA9C 2UWEA 5IEHA 2BSED 3FTGA 1V3LA 2XZAL 3QZWB 4PRBA 1HI6A 2C3WA 1MRDL 5ESAB 2VKXA 4MS8C 3KDMB 1FL5A 4X9GA 3RNKB 3U9PL 5ENWB 4LBEA 4NZTL 4N0UE 4CU7A 1I7RB 3BPOB 5T1KA 4K8RD 2VLJE 1A1NB 4OM1H 3PV6A 1AGDB 3TN0D 5D1XB 4WU5B 5ADOH 4GXVL 2HAZA 4XXCC 1T1XB 5HI5C 3VFRB 4YBQC 2DI8A 3G6DL 1R3JB 5JZ7C 2BSTA 3KPNB 4D9RE 4HH9A 1P5UA 3TP4A 1KIQA 4QXGL 5DJXA 4NDMB 4TUKH 1YEKL 4XH2A 3E6HB 4QNPF 1Z3GH 2ZJSH 3FB7B 1JZ6A 4L4JA 3SKUD 3TC9A 5BW7A 1T6WA 5F7EH 1MIEH 1VFBA 4PG9A 1JGEA 5CGYC 1IM9A 5LGKA 2X6MA 4QHMB 5D4QA 1YYLL 3OAYH 3PHSA 5B39A 3DMMB 1R3KB 1H15A 4LFHD 1QVOA 3MLUH 3PDDA 4KK8C 3QUYD 4LSDA 1AY1L 2WIMA 4I18C 4PJ8A 1J05A 4HMDA 4MCYA 1ORQB 1WTLA 1MFNA 3VWKC 4PJHB 2EE9A 5B8CB 3VD7A 8FABB 1DBJL 3VFVA 3GO1H 4I2XE 3WNKA 4IRJD 1AGCB 1NGQL 1FN4B 2BMKB 4DZBA 1RUKL 5E6ZA 4FQ2H 4OFIA 2XZZA 2EE3A 2CK2A 4YHYB 1MELA 4JJ5A 1UB6A 3UTSD 2H9GA 4PBXA 2X10A 5DD0L 2VO5A 4JFFA 2XA3A 5SX5H 4P46D 2XZQH 2BVUA 2EIBA 3IT8D 1MCQA 4HEPG 4MAYD 4X6EA 4ODBD 2F19L 1CD9B 2ZSVB 3QHTC 1QKZL 4MXVE 3RQ3A 1IGTA 2OQJA 3FONB 1BWWA 3F8UB 1QFWI 3JUZA 4X9IA 3T0VA 5IMMA 3WO4B 2IAMD 3DOSA 4G9FD 5FA4B 1INQA 3QCUH 1CDIA 4RAUA 2JF1A 3BPOC 3BWAA 2O26U 4G7VH 3BP5B 3PGFH 2F54E 3QXVA 4UINH 5C0AA 3HAEH 4LKCA 1KN4H 2B8OT 2FYYB 5J4MA 2WINB 5BV7C 4CJ0A 3OG4B 3CFKB 4P2RE 4JN2B 3AROA 3QRGL 4MXWL 1OARL 5AZEH 1OGAB 1EJOH 5HGAA 4N0CD 4JO4L 3B9VA 3SE3A 2ADJB 4DVRL 1HCFX 2XY2A 2NW3B 1FV1A 4QRSA 2XPGB 2EEBA 4ALAH 5CS7A 3O9WD 2V9QA 3CSYA 4S1RL 2I26N 4ZUWA 2FWOA 4DTGH 1WQVT 5FGCE 1OSPL 2BVYA 5TPWH 3MRBB 1WWWX 3MV7E 2OZ4L 5IT2L 1HNGA 3FFCD 1G7HA 3CH1A 3TYFB 1IC7H 2CIIA 4WI5A 5I1AA 1T1YB 3GNMH 5ABDE 3MA9H 3DBXB 3GSNB 4NYLA 3UC0L 3WMSA 4L3AA 4HF5H 3PG2A 4PJBB 3GMPA 1CFNA 4YHIB 5D8JL 1HHHB 1KTRL 1MRFH 4XXCA 1MHEB 1MAMH 5C09E 5EUOF 3BRGC 3FHAA 3QXWA 1R5VA 3EYFA 5L7XL 1G9MC 3JSSA 2XNAA 4RX4A 4XHJD 4XRCA 3S35H 2IFFL 4E5XA 2IBBA 4ZXBD 1EEUA 1ND0A 4R2GB 3QIWB 4LQFL 1N5AA 3LEYL 1AKJD 1YN6A 4CDHA 3HKFA 3O8XD 4G8GB 5D7SL 1NCBH 1YNTB 2G5BA 4S10A 4Z77B 1KGCD 4N0FA 3JV4B 4EVNA 4TPRH 1KC5H 1QHPA 3BHBA 3IDXL 1NSNH 4NQCB 1YEHL 1Z0NA 1EBPA 5IB2A 3VWJD 5IB5A 1C5DA 1WIUA 2H2SC 1QFUL 3MRFB 1JTTA 3KPSE 4NNPH 4QHNA 5HVGB 1WWBX 5D2NC 3VE0B 4I18A 5KSBA 1C16B 1P9MC 3RWDA 3VWKA 2E3VA 1RIVL 4ZDHB 2GTZA 3STZA 4R7NA 1AO7D 2GW5A 3TBSB 3RWGA 4GRWB 3FQTA 2C26A 3D69A 1DQML 2XWBB 4ZPTA 1YDPA 5SWZD 4BYHA 1IGJA 3R06A 4LCIL 1G7QA 4Y5XB 5IM7A 3O41B 3VXNA 4FHBD 1JPGB 3O4LA 3ZSTA 4PJ7B 1DUYB 1TQCC 3HN3A 1HSBA 1OTTD 4NO2B 3CMOL 1RZFL 3HR5B 1JHLL 3VXPB 4UB0L 4XP5L 3ZKNC 4RIRA 4OBRA 4CRPA 3VI4F 3OB8A 5JTWA 4AG4H 4PJFA 3HUJA 1T21B 3S34H 4DKAA 5C71A 3DX7B 4LLYA 4JQVC 4X6CA 3BZFB 4YDIL 4NRZA 4WTWA 5IB1A 4ZS6C 3VXSE 1S3KL 5ENWA 1BM3L 1CXLA 1N6QL 3G08A 3QHZH 1RD6A 1X4ZA 4PJDE 1NGZA 3V4VL 5J6HB 5E24E 3BP4A 3MRLB 2UZIL 4UUJB 5F7UA 5JW5A 4P3DA 2V2TB 2HKHH 1VFMA 3CLEL 4FQQB 3U4AA 4PJGB 4JFEE 4LU5H 1R3JA 3GK8H 5GRUH 2B4CL 4ZAKD 2YK1L 4MCZA 1RZ8A 3KPRB 3QG7H 3ARYA 3MJ9H 3ZDYE 5E2TL 5GS1C 1BP3B 2X4RB 1I7TB 3H8NA 3C8HA 2ATPB 4ZSOB 2AKRB 1HH9A 1I7ZB 5D7LE 2FHCA 4HWUA 4MQSB 3GMMA 1OAYH 3P9MB 4XB8A 2RBLA 5JORA 4JFDB 3UYOD 4YUEL 3LN5A 5CJQL 5DD1L 4GKZB 4U6HA 5D1QB 5DWUL 1U58A 4FQJL 4OCSH 4K3GA 1T66D 1MCFA 4DK6A 4PG2C 4WW2F 4ERSL 2DQEL 4NCC2 1B88A 5MP6L 4QT5B 4BSVB 2B39A 4Y2DB 5HHOB 4H0IA 4FFWD 3IDGB 2P8PA 2X44D 5DMKA 3F58L 4TYUA 1HNFA 3QCTL 3L3HB 1QSZA 4H88L 1CGTA 4ORGB 1ULVA 2X7LA 5DO2D 3SKNB 1G7JA 4QRRD 5TE6H 4DKEL 5C6TL 4KVCH 4AYFA 1CLYL 4GLRI 2UVFA 2NY7L 4KTEL 3LDBB 1E6JH 2X9YA 1HE7A 1I75A 3EOBA 2BCKA 3VMNA 3OAZH 3DVFA 5IB4A 4UT9L 2ZPKL 5JW4Q 5EH1A 4HPYH 3Q6GH 5IV2A 2FBJL 2OR7A 5TE7H 4XVTL 1PLGL 3IDUA 1T1WB 3LKRB 3ULUL 1M05B 1B90A 1NFDF 2AABL 4N1EA 4G43A 1LO5A 4HAFA 4HS3A 2VC2L 4WCYH 3BPNB 5B21A 5T3XH 3FB8A 4LAQH 1CIUA 3QEQA 1ZHNB 3QDJA 4GSDL 3GM8A 4KJYA 1ZTXL 3CFEB 2H32A 4U6YB 2VE6A 2NPLX 3QDMD 2NTFA 2VQTA 1FVDA 4G5ZL 2BSRA 5D2NA 1P9MA 4PRIB 1MCOL 2OJEB 1I7UB 4HBCL 2Q76B 5BQ7A 3NFPB 1EEYB 5FM5O 4UQ2B 2XZCH 5HHQA 2YRLA 3HZMA 3CU1A 3BPCA 4WHDA 4B0MM 1IVLA 4AT6A 4NRXA 2W65B 3BXNB 3NFNB 4F7CA 4E0RA 3ARPA 4TTDC 1YMMD 4QXUL 3RA7H 2R2EA 4AMKH 5KTEL 1MQ8A 3I02A 3QNXA 1MF2H 3B9KA 4MGXA 3E8UH 1T5XB 3PF2A 4LMQE 2IQ9L 3REVA 3QCVL 3B8YA 5IVXE 5D1QC 1KENH 4HGWA 5TDPB 5FKAB 4NWTH 2BNRA 1FL3A 4PJXE 5HHVL 4HG4K 2HFEB 4TOYH 1XZ0B 4Z7VF 1F2XK 5LQBL 4JQVA 3C5SA 1I8MB 4M48L 4DUXA 1CYGA 3HC4H 5FAAA 3AMKA 3TWCH 4F9PC 3PQYE 3EYUL 1A1OB 5CLTA 3FRPA 3ARDD 3B2UC 1BOYA 3H2WA 4APQB 1OVZA 4HWBA 1ZKAA 5B3JF 3PWVA 4YXHL 3C6SA 2FZ3B 2MOVA 5IOPA 3ULUE 1ZGLM 1ZLSH 3LDBC 5GS0C 2QBWA 2QQNH 3IETB 4DGVH 4XVJL 1JUFB 3KAAA 3VXRD 1A1MA 1RZJC 4GKSB 3NH7H 4XX1E 1DUZB 5L2KE 4HJJL 2AJYH 1WEJL 2EIDA 3O45A 3HA0A 4FG6C 3HRPA 3B9AA 3H9SD 3FO0H 1MCCA 5IWLC 3RL1A 3OAUH 2BNQB 1BOGB 5K59F 3ELAT 3BPNC 4Y5VC 1JYVA 5GS1A 3IYLW 1YNTA 4R97C 1KG0A 4KK9C 5SWSE 4OGAC 1KJVB 2X1OA 1OCWL 4O2EA 4DJMA 4K71B 4P23D 5L0QB 3BZDA 4WI3A 1RJYA 3ETBF 3G5XB 1ZEAH 3OSKA 1T22B 4POYA 4UT7L 1NJ9B 2MQCA 3ZSSA 4PG2A 4Z7OE 2H3NB 5TF1H 5LBSH 1FFPA 5BCAA 2WBJB 3VGAC 2LU4A 5E6IC 2RIKA 3QBTB 4H1LG 5K9JH 1XGQB 5DZOA 1A6TB 4ELMB 3VFWA 5A2KH 3BIKB 5I15L 1MLCB 5ADPH 5D6CA 4HK0B 1FFNA 4YLQT 3TBVB 1H8NA 4XMKL 1X6LA 4HJGA 4XC3L 4WI4A 3E6FA 3KPLA 3U7AA 1KIPB 3QUML 3PL6D 4JFQA 1PZ5B 2JKXA 1EUUA 1OAUL 4LCWE 1QRNA 3GJEA 2FDBP 3IF1B 5KAQG 1WLHA 1NLBL 4OIAA 3T2NL 3MV8E 7FABH 1UWEL 2ZKHH 2ITCB 4RRPG 3FT3B 3LV3B 3PJSA 5L6YH 1WJ3A 1W72A 2IPUK 4KHXH 4N8PA 2CUHA 2NY6C 2C9AA 1GPOL 1L7IH 1MAJA 5AYUL 3RP1A 4HWZA 3M07A 4POZC 5I1KH 1JZ2A 1Q8MA 3GSUB 5TE4L 1OAQH 1R3HB 4NKMB 3L5XH 3UROR 2OXHA 1AH1A 2ZUQC 4PJCE 3ZDXE 4K94L 1NLDL 3GHEH 1WWAX 5E8DL 2IALA 1RHHA 2AGJH 1XIWB 1IRAY 2DQGH 3D39D 4M6MH 4K3DH 4XNZC 1XR9A 1GGIH 4KRPD 2D03L 4Y4FD 3CUPB 1UJ3B 1CICC 2X4OB 2DKMA 1CU4H 3I75A 2LAAA 3SDCD 2P5WD 5FHAL 3CSPA 4ZSOA 1RU9H 4OSUL 1R0AH 4MDJB 3GSWB 5BZDA 5MEOB 1NUGA 3UJJL 4JFPB 5KS9F 4U1KB 4V2BA 12E8L 1IM3B 3ARFC 3KLAB 4NM8L 4QRTB 3DXAB 3MGTB 2CKBA 3LCYA 5CD3B 2JJUA 5ALBH 3ZTNL 5E9DA 4Q97A 2PETA 3IRPX 4JY6B 2HT4D 4WI9A 1A7PL 4FTVD 3SJVB 4ZFGH 1HSAA 4NGHH 3U36A 2Y07H 3O6FB 3WE6B 4BSVA 4DFIA 3GMOA 4M5ZH 4P9HL 4GAJH 4F9PA 3EO9L 5GGVL 4CN4A 3LPFA 3P0GB 1P84J 1IKFH 1QLFA 4LPCA 5FOJA 1A0QL 3X14B 5C0IB 2YWYA 1SY6H 4K3JL 2GUOA 4JZJC 3N85L 2ZOKA 1II4E 1MFDL 1Q94B 2VERN 4KJPC 1Q1JL 4UILH 5C8JA 5KVDH 1H3PH 1QR4A 4WO4D 2WUCH 1FE8L 3W11D 2D9QB 3VFGL 5JHDB 5IWLA 2ESVB 2DQTL 1MRCL 3L1OL 3RWFB 1FYTA 1RJZB 4Y5VA 4HFUH 5KSVA 5MENA 1QACA 1YN7A 3G5VB 4WW1A 3CFEA 3OKEA 1TZIB 2Z4QA 1NCCH 3D85B 1GGBH 4JDTL 3UTZB 2GTWB 2YPLD 1FNSH 3GHBL 4Z0XA 1S7UB 3DSFL 3SO5A 5DA0B 1A7BA 3RWJB 3GUTA 5I19H 5FDWB 4KZEH 5F89A 3TO4B 3B4NA 1IAOB 4F7TB 2AAVA 4BK4A 5E4IA 1A14L 4ZO7A 3X3GL 4H0HB 5E6IA 2R2BB 3KWWA 1AFVH 4N90D 4ZUSA 4MQXC 4KZDL 5K33A 5C0GA 4DVBB 4PJAA 1DBML 3MRMA 1Q0YH 3CH8A 2X89A 3DJ9A 3UCRA 3G6AB 4OCRL 4ODVL 1A9BA 5IK3A 1ONQA 4HXBH 5I73B 1K6QH 3KNBB 3T1FB 4KUZL 1MUJA 1T0NA 1MNUH 3NOIA 1HHIA 1F02I 3D25A 3B5TA 1J5OH 4YHNA 3GMQB 2J8HA 4LNRB 1IZKA 5FKAA 1YA5A 4U7MA 3G9VA 5IFHH 4DZ8A 4OLWH 1NCDL 4GW1B 4M7KH 2HLFC 1Q9LA 1K3ZA 4TUJA 1A1OA 3BH9B 3VGHA 1IT9L 3MRDA 4X99B 4OFKA 2AJSL 3EUUA 3LVEA 5EZJA 3KPPA 5ICXB 4NZUL 1U95A 3RJDA 3T04D 3GBML 4LLQB 5C0EB 2V17L 5GGRB 1JF5A 3SO3B 3L3GB 3KPOA 4TTGA 4K2UH 5F1SA 1AQKH 1CF8H 1NGPH 3DIFB 1IZJA 4R4FL 3MLSL 3W0WD 3E1F1 4R0LB 1BWMA 2A6JA 1E27A 1F4WL 2QEJA 5DJAB 3QWOB 3BVNA 1OP5K 1J18A 3EDKA 3EBAA 4U6XA 4EBQL 1CICA 3HE7C 4QWWD 4ZTOL 1C5CL 3UBXA 4CVWA 3IVKA 4Z7QF 4MD4A 3FJTA 3KR3H 4MAUH 4YDJB 4HXAH 4ZTPL 4QY8A 5D2LF 4LEOA 2FH6A 3TN0B 1IQWH 1P4IL 4JRYD 2KDGA 3DI3B 1TCRA 3MRRA 2EIZB 3ARFA 5DRZB 1MI5A 4ENED 1RUAL 1C08B 2EDJA 4NRYB 4LSPL 2OI9C 4GKNA 3LS5L 4F7PA 3OJMB 4R7DA 1EO5A 3O11B 4YXLL 4XP6L 3BIKA 4FFZL 3SE9H 3T77B 2BC4B 3WKML 4XPAL 5E8EB 1C1EL 5SX5K 2OMBA 3KPQB 2EYTA 4PJ5A 3IKKA 1J0IA 2ICWJ 4JZJA 3WHXA 1KTLB 3QUYB 4M5YH 3L7EA 3O3DA 2FR4A 2PO6C 3C5ZB 4OCWH 2GJ6D 5HYSA 3V5KB 3D3VD 1LE5B 4YEEA 1S7VA 4P4RB 4U33A 1SBSH 2I25N 4MJ2A 3SQOL 2PXYC 1G6RA 3H3PL 4XTRD 1QLRB 4IRJB 4OUUA 3NABL 4Y89A 2X40A 2FX8L 1F8TL 3D0LA 4IOIB 5B38B 4PPTA 1NC4A 3U6RB 2R56H 1CGYA 4J3OC 4X6DA 4M43H 1H3UA 3MYJB 4E41A 2Y5TA 3D9AL 1EO8L 1U8QA 5HDQH 3UTSB 3MUGA 5DD3H 2C1OA 4JFFE 2ZZUT 5C0JA 3UTPE 3PGCA 2GITB 4GBXD 1I3GL 2W92A 3UEZA 4AEEA 1ZLWH 2GJZA 1PQZB 4P46B 4UIKL 1EJ6A 1I1YB 5LGHH 4ZG1A 4MAYB 3HAEA 3OHXB 2JIXD 3SDYH 4X7SH 4PV8A 1ZANL 1WCQA 5TGBB 4OM0H 2FJGB 2X4PB 5E2UL 3NACL 4XAWH 2EDOA 4LDEB 1JMXA 4ZFZB 4G9FB 1N2RA 2FD6L 5IFAL 4O58L 1I1RA 4C56A 1Y0LB 2EH7H 5C0AE 5GGRY 4ODSH 2VLJD 2C3VA 5HPMB 4LK4A 3KLAA 4OJFH 2HKFL 4QHKJ 4LPUA 2NMSA 2OS7A 3MGTA 1QNZH 1I8KA 2FB4H 1EHNA 2VXVH 3TBYB 5JUEH 3X13A 1A6ZB 2GI7A 3BKYL 1NBVH 4D9RD 5KN5A 1KPRA 1XCQB 3ESUF 5FUCC 5JW4R 3BPLC 2A6KB 3MV9A 1T7WA 4HT1L 4L4VA 4V1DA 1RFDL 4X4XB 4Y4KC 5CEZE 3O9WB 5C0IA 4KROC 3V7AE 4MHHI 5EOTA 3EDFA 1EXUB 4ODTH 3VGBA 4IJ3B 4OZFG 5T5FL 1HHJB 3C5ZC 5ID0A 2XTJE 4XC1H 4FQXD 4X80L 3C60D 4HC1A 4UMGA 3MODL 2XTLA 1S7WA 2BVQA 4CW1A 5JOFA 1LEGB 4KJQC 2HMIC 1G7PA 4EUPH 3GJFB 4PV9B 2PTTB 5F6IB 3HE7A 3WJLC 2HRPL 5C3TA 4O9HH 3EOAA 3MOQA 4FRWA 4P4KC 1NMBH 1DLHA 1X5IA 2P8LA 3ROLA 2PCPB 4XCEA 4KQ4H 2AJVH 1JWSA 3MGOB 2E5EA 3RL2A 3KYKL 4XMPH 5JPMB 3D18B 4LPYA 4YHPA 3CK0L 1LDPH 4E9LA 2ZOLA 5FDWA 4J8RA 5I66A 5DQDH 1UENA 3ECBB 2CDGB 4LRNL 4DUWA 3WHE0 4BM7A 1BBDL 4ZFFA 4XNMA 4Q9QL 3P0YL 5E8NB 2R0ZH 5BV7L 1JNLH 2CO6B 1E28A 1F4YL 1MIML 4R4NC 2DMBA 3TM6A 5DD5H 4H26A 4LSSH 4L9LB 1AKJB 3O8XB 5FDYA 1Y6MR 1RZ7L 3C8DA 3L3KB 3THML 3VH8G 3ORJA 1FZMB 2WK2A 4WW2C 4YR6B 5J1AB 4MD5B 5EOQH 5DK2B 3VWJB 4G6FD 5KSBE 4Z7VB 3QJHA 2F54D 2PO6A 5LCVH 5JW4M 4XVUD 3FRUA 1AO7B 2B1AL 5EU6B 4P2RD 2EEAA 2CRYA 1K5NB 1XFPA 2DD8H 2PXYA 3TZVC 1LD9B 3DROB 4G80A 1FPTL 3LSOA 1U8JA 2O5YH 4HS8H 5DVMA 3P3YA 1P7QB 2IH1B 5SWZB 3QEGH 3E2HC 1JHTB 4N68A 2GFBA 5EUOA 1C5BH 2NYYD 3O4LE 4KQ3L 4FA8A 4H20L 4LASL 3V0AC 1OM3H 4LVHB 3NPZB 5EFIB 5FYLH 1Z9LA 5C08B 1RZGA 4G8IA 1NAKH 1ZT1A 4PJFE 4QRUA 4YHKL 4OAWB 3HUJE 3JWOH 5AYQA 5DT1L 4ZFOA 1UACH 2NLJA 3AS3A 4F2MA 1IGYB 4IRSD 3MV7D 4X6CE 3V52H 1KPUA 4XPBH 2CO7B 3PIQA 4OLXH 4UNUA 2AK4B 3C8KB 3TIEA 1G9ML 4W70A 2UUDH 1ACYL 4JHBA 3PP4L 3MRPB 1INEH 2VAAA 4Q2ZB 3UO1L 1NC2D 3MREA 3KYMB 1U42A 3O4OC 1EAPA 4QXTA 5GS3A 1CLOH 4HWEH 4WWID 4X4ZA 2MFNA 3BE1H 5IHUL 3Q5YA 3S8WA 5JPNB 4R8WL 4BH7B 5LAXA 4NHUB 1PD6A 5C09D 2P42B 1FCGA 4L8DB 4U1MA 2F74A 3QYCA 5D72L 2J88L 5A2FA 2APWA 4ZAKB 1TLKA 1CK0L 5F7DA 3TT3L 4P3WA 3BAEL 2GAZA 2I9TB 4K7PH 4XMLL 1N0XH 4WI2A 4U0RC 3U9UA 4Y4KA 2C3HA 3OAZK 3TNNA 2AERT 3LPWA 1NGYB 2DQDL 1UA6L 3QG6A 1U0QA 4G7YL 1CDGA 3C5ZA 3P77B 3V5KA 3QFJA 1F90H 4P4RA 3KPSD 1IE5A 1SJHB 3RDTC 4NN7C 5HI4C 3DRTA 3BT2L 3GDBA 2NY5H 4YBLB 1QLRA 5EORH 2J2ZA 2X4SB 3T4AB 3ARZA 3WJLA 2CD0A 4OGXH 3O3AB 1PYWB 4P4KA 3C09B 3F12A 3U4BH 1J7VR 4H5SB 4JHAH 2CLVB 1H0DA 5BVPL 1WVZA 1IBGL 1U8MA 2BXYA 1K8DB 1AR1C 3BKMH 4HWBL 4HCRA 4TSCH 1FLRL 2YEZA 1GGTA 1BD2A 1UVQA 2W0KA 3MOAL 5J8OA 4K55A 5I1IH 2ZCLL 2JTDA 4LCUA 43CAB 4NZDA 4KUCF 1DN0B 1HQRB 4WWKD 4ODUA 3QDJE 3VXSD 1FL6A 5IMLA 3G5ZB 4L3CA 1JV5B 3UDWC 5HJ3B 4XAKE 5E5RB 1VACB 3S5LB 4WW2A 4DOHB 2EDLA 7CGTA 5D2NE 2PF6A 4TQEL 1LQSR 2P1YA 5FCUH 2VXUH 1FFRA 3STLA 4GAYB 4UOW0 3B8SA 4JFED 1Z5LA 1HYRC 2OX5A 3TZVA 5AG8A 5D70H 1EHLL 4UTAH 2A6KA 3MUY1 3DVNA 4MZ3A 1BVKA 3P9LB 1YMMB 2YZ8A 2OR9L 4NUJA 2CMRH 4NWUL 2V7NA 3I50H 5ETUB 1WCBA 2BFVL 1ZLVH 3T0EC 3GJFK 4F3FB 4KJWD 4M7LH 5D7LD 3LIZL 2VDKL 5K9OB 3U30B 2VR4A 4AL8L 4NNYB 1JRHL 2YZ1A 3I3BA 1NFDA 3BKCH 3DYPA 4GAGL 2V9TA 4ZUVA 2BNRE 1X5ZA 4DGYL 2C4FT 5AAMA 3CVHA 3A67L 2BERA 3RUGA 1IL1B 3B2VH 4QTIL 1FRGL 4YBLC 1IQDB 5KJRH 3P4LA 4S1DD 3CU7A 3VFPA 4O51A 2VIRA 1BQLH 3WO3B 3QIBC 5E0QA 3ARDB 1P6FA 2XQBH 2ZSWA 1S7QA 5KAQF 5B39G 2DAVA 5CIPB 4D9LL 3QPQD 2XACC 1EFXB 1MEXH 3DX6B 4XPFH 2R9HC 3PWNB 1W72L 5FO7A 3VXRB 2ID5A 1UXWA 3MZTA 2E9JA 3CIQA 4JPWL 3QIUC 1QBLL 3HZVB 5J3HC 3SY0B 5IUSA 3H9SB 3OR6B 3WEXB 2VABB 2ZUYA 5F8QC 1LEKA 3K1DA 3JBG7 2XWJB 4XCNB 3SCMD 1YEIL 2XZAH 4ONGL 2VZ3A 2CGRL 4FQHB 3RY4A 1FG9C 1KNOB 3FOMA 2VXTL 5FM8A 4OZGB 5L88H 3DHMA 3EO1B 4UU9A 4X7EC 4P48A 5J1AA 2A2QT 2L4OA 4OZHA 5DK2A 3RRQA 3MLPA 4P23B 3D2UA 1I3RA 2IADB 2WWMC 2XQYK 2Q7NA 1OAKL 2GY5A 2VR9A 3B3IA 1A2YB 4XPHL 3RDTA 5EU6A 3V6OE 3KS0J 4WENB 3V95A 1QQDA 4H1LH 5A2JH 1DBAH 5CBEA 1R5IB 5E5MA 3O6MH 5GRJL 3IFPA 3FT4B 3CD4A 1G7IB 2NW2A 4JY4A 1A6PA 2CKBL 1QTYT 2FIRT 4QXGH 3HRZB 1NQBA 3CZJA 1SJXA 4D0CB 1S9KC 2FJHA 1S8DB 4RQQA 5EDXA 3SGEH 1RK0A 1LO0L 1N4XL 3GRWH 4HFWB 1TFHA 1VB9A 1QRNE 4KY1H 2VWEC 2ZUXA 2WBKA 1IC5H 1YYLH 5T5NG 2EDDA 4XNXL 4UTBL 5GS0L 4JZOB 4CAGA 1S7XA 3QH3A 5GRVL 2ED8A 2AK4A 4HIEA 1RZJL 5DD6A 3TPUA 1INDH 3TEUA 3V4PL 2DICA 4DQOL 1WFOA 2AEIT 2QLVB 3PQYD 3UDWA 4IS6B 5AWNL 5TQ0H 2X05A 4NCC1 1TVHB 5KOVC 5DFWH 4U1HB 4XBPB 1RUKH 3MLVL 1T03L 2DLIA 4PJGE 4PY7A 3LD8B 1S9VB 3AB0C 2F53A 3ULUD 4UAOC 4RGMB 1JWMA 3WIFB 5DJZB 1DFBL 1JYXA 5A16A 3RNQA 2AXFB 3D39B 4GG6A 5L2KD 2VDRH 3QQ4B 4KRPB 2A1WH 4Y4FB 1SYVA 1KT2B 3NFSL 4HD9A 2VNCA 1HDMB 4PGDB 4X5XA 4ZSOE 2P5WB 1UH3A 2DQJH 2F19H 3TYGL 1DN2A 4JQXC 2A83A 1QKZH 5SWSD 3T0EA 1BECA 1PBYA 4JY5L 4WHTA 4FZ8H 1OPGL 3HE6D 1I9JL 3KPMB 4PLKD 3MOBL 2HTKD 5GGTH 5I1HL 1J1XH 3QRFM 5E9DE 4QRQB 3HZYB 4G9DA 1QSFA 3RVVD 5B4MC 4KH2A 1KCUL 1T2QL 2O61A 4FTVB 4ELKB 3PWJA 3CMGA 4JG1H 5E94A 2CJUL 1KEML 1T89C 3QXAA 1LE9A 3QIBA 1WV7T 4HV8B 3S35X 2J12B 2R1XB 2XT1B 1N8ZB 3NCYS 2BVOA 2LU7A 4ZOEA 4JPIB 4DVRH 4F7MB 4ZUUA 1SMOA 3EGSA 5HHPB 5AEAA 3QUZD 4RFNB 3QIUA 4S1RH 2XI9A 1I9EA 1DQLH 1VKXB 4LCWD 3RWHA 4YHZH 1YEGH 5TDNA 4OM1L 3M1BA 2APXA 3RTQC 3S4SB 5C1MB 3W9EB 1LP9A 5KS9A 4OGYL 2DLGA 4RMUA 1J9CT 1JPFB 5MENE 4GS7C 5ADOL 1ZSDA 5IT2H 3MR9B 3MV8D 3P4OB 1ETZB 3S37H 4B7IA 1GZPB 3GZKA 1FHGA 2YPLB 2Z92B 4JKPL 1FZOB 1Y18B 5DURD 5FO9B 5DQJB 3LD8C 2B7DT 2X4TB 3EJZC 5SWQA 2ZJSL 3KYOA 4M8VA 1PX3A 3VU2A 4Y2OA 2V5YA 2YUZA 3A0OA 5F7EL 2ENSA 1U91B 2WLYA 5D8JH 1DL7H 1F2QA 1YPZF 4PJAE 4J1UA 4F33B 1FNLA 1CE6A 2YA0A 4WJ5B 5I8EA 1RPQA 3MLUL 4MA7H 3P9LA 5C6WH 1UB5B 4YPJA 3ZE1F 2R0LH 4DEPC 1FBIL 1I85C 5KSUA 3ES6A 3GO1L 5IQ9B 4UV4H 3NCCB 5GRWA 5DUPH 3VCLB 3MUHL 3TO2B 5H94A 2FLRT 4U1IA 3MRKA 1HHGA 2WP3T 3HNVH 4Y19A 5GISH 1H8SA 2DJ4A 3MNWA 4AEIH 1I1AB 4FS0A 3I6GB 3QQ3B 5CMAB 3GKZA 5I9QC 5DFTA 4OTXL 1HEZB 4MQ7B 2QR0A 5DHYA 1G6RL 1PSKH 2XZQL 3EFFA 4JLRA 5CILH 1GOFA 3Q2CA 1DQMH 1ZAGA 1X5JA 4LLMA 2DQFB 5DJDB 3GSXA 4QOKB 4P2CG 3W0WB 3N0PB 3HZVA 1IGCL 4F58H 3BP7B 1FAKT 2BNQE 4UIMA 4G7VL 5I1LA 5BS0B 1LO2H 4XP5H 2GJJA 3ZKXB 3PGFL 2XWJA 2ITDB 2Q3AA 3CX5J 4P2OB 1YEFL 3FQXB 3HI5H 4CKVX 1D5BB 1CVSC 1T04B 4JQXA 3RVXC 3EO1A 4PGEB 4YDIH 2F5BL 2P49B 5AZEL 4HIHB 4JRYB 1OGTA 3MJ8B 3FO9B 1EJOL 3O6LH 1MI5E 4XP4H 1N6QH 3BUYA 4YGAB 3TPKA 2OR8A 1MCBA 4PRHA 2YD3A 2JK5A 4ALAL 5DJ0A 5DS8B 5J11B 4AH2A 3LB6D 4HUVA 3VFNA 3V0VA 5E2VL 4ELME 4NKQB 3ULUF 2DF3A 1AXSB 1T89A 4DTGL 3TCLA 3PXHA 1QHOA 3CNKA 5GZND 5M7QA 5TPWL 5EU3B 4NOBA 4PJ5E 5JO5A 4XI5D 2G75B 2AV7A 5A40E 4KHTL 1IC7L 4WFEE 2V2WB 5JLZA 1OB1A 2GJ6B 1BREA 3D3VB 4NKDA 2W60B 3GBNH 3CXDL 3S97C 2ICES 4HF5L 5D2LA 4YXKH 3PUCA 3RTQA 1I1AC 3JWOC 4LPTA 3W9DA 1FG2A 4X6DE 1M71A 2WLZA 4YDKH 4E41E 5IHBA 3U46A 1LO4H 1MHPL 3BGFB 3S35L 4K07A 4QNPE 4EI6A 4YDVB 3X12A 1KLGA 4GBXB 2AS5M 3F58H 4DN3H 2WWKO 4H88H 5DJZA 3PDOA 2JIXB 1NCBL 1CLYH 2CRMA 2AV1B 2NY7H 4WUUA 1IAMA 4LARH 5EBLA 4AM0B 2OBGA 3O2DH 3WIIH 3DV4B 4BQ8A 1KC5L 3WN5C 2HH0H 1HDMA 5HGDA 3F65A 2KUTA 4NNPL 3EHBC 1S5IH 5E1HB 1K4DB 1UM6H 1J0KA 3BIBX 5DMYA 5T1KD 2OSLA 1PLGH 4ZOBA 3ULUH 2BY0A 4N0UB 5IJVA 1I85A 5C70A 2AABH 2VLJB 2PW2B 1U3YA 5DK0A 3IXTA 3FO2A 2YC1B 1RIHL 5FUZH 2EECA 2CPCA 3SKJL 1F00I 2J6EA 4HUWA 4JKMA 1QRKA 3SJVE 2ICWB 5F9AC 4X5LA 1BEYH 2EICA 3KS0H 3MV9E 3MNVB 2IEPA 5C86A 1OLLA 1YNLH 2NY5C 4V1DE 3FCTA 3MO1B 4NO5B 3ARGC 5MERA 4PJCF 4M7LT 1ED3B 1RURH 4EUPA 5KG9B 1CVRA 4PLJC 2HT3D 3QNYB 2AJZA 4MVBC 1QLEH 3LRSB 2IMMA 4AG4L 4K7PY 1IM9D 1FZJA 2DM7A 4OZFH 4XBGB 2BK8A 4Z95H 2DJUA 3S34L 4RMRA 2V7HB 4K7FB 5IEKB 2FRGP 4QXUH 4PJ8D 5ERWB 4TVSa 1EERB 1MCSA 5KTEH 4ZPVB 3BKJH 3QDAA 3QHZL 4LIQH 2PN5A 5F7WC 2ESVE 4KI5F 2AEQH 5L2JB 3QCVH 4I2XB 3ULSB 4M7JH 3MRCB 4ZFOL 2V2XA 2HKHL 3FB6B 4WHYG 5IB3B 4NJ9L 4X6BA 2L7JA 3D0VB 3L6FA 5CD5C 1QFWM 1XF5A 1L0XA 4LU5L 3VXMA 3V6BR 3GK8L 3RKDD 3BGFC 2G2RB 2RHEA 5GRUL 4LHUA 4XVSH 3MXWH 1FFOA 2Q86A 4JFFD 3UTPD 4OQTH 3QG7L 5DUMH 2QHRH 1XF3A 4XPGH 2R1YB 5EU5B 1RUPH 3LZFH 4KKAD 2FLBT 4NJAL 1N6VA 4LCCA 5HYJA 1U8IB 4JG0H 1OAYL 1IC1A 4OF5A 1P84K 4Z9KB 4M9OA 1K4CB 4H1LB 3O2VH 1MLBB 1DQTA 3PV7A 2X1XR 1T0MB 4Z7UF 5SX4H 5A2IH 2VITA 3BW9B 4OCSL 1M7XA 3IDJB 1A4KA 4JKLA 4G6FB 1BQHG 5C0AD 2HVKB 2F54B 3EJYC 4GQ9L 2EDKA 1NDGA 3T8XA 1NPUA 3LKSA 2MQ0A 4R26L 2HT2D 3QEHA 1F3JA 1HHKB 2IH3A 4P2RB 3DURB 4U7KA 5TE6L 3L7FB 3VFMA 3U0TA 1CDBA 1NBZB 4JCMA 5EUOE 3WHE1 1E6JL 1OSZB 5BOZG 4PD4J 4OZ4B 2J8UF 3UZVB 3GMLA 1DZBA 2EDEA 1N0LA 1FZKB 4UDTB 4NCDA 5KANI 4Y0GA 4Q9BA 4FOMA 4YBHA 4YIQB 4JZNA 4EDXA 5I15H 1MVFA 5IKCB 1YY9C 4QHLA 3GSQA 5JXAH 5BOPA 4WCYL 5FGCB 3V5HA 2YWZA 4GJTB 5T3XL 2DWEA 4LAQL 3MV7B 2XTJD 4XMKH 3VRJA 1J0YA 1GVIA 3WN5A 4MS8D 3WL9A 3OKMA 3U0PB 2GK0B 4HCRL 4I3GA 5CSZB 4NPYA 4RWYH 4TNWF 4PLNC 5HBBA 4BFIA 5MEPB 2MHAB 5GSVA 1NC2B 2DWDB 2XZCL 3OKKB 4L4TA 2E7HA 2Q20A 3U4EB 4HKZA 1FFQA 5HHME 1P7KB 3L95B 1XGUA 2NXYC 4LHQB 4AENA 1JNHA 5HI5D 5DYOB 2DL9A 4YBQD 2D7PA 2WANA 2YD2A 5JZ7D 3RA7L 4RX4D 5FUCE 2MKLC 1XGRB 3X11B 4X4YA 2NY1C 3O0RH 4I77H 2UWEF 3E8UL 1FJ1A 3HMWH 4OFYA 4DCQB 5FO8A 3ARGA 4KDVA 4RCAA 4NP4H 3C9NB 2K1MA 1KENL 5CGYD 4HDIB 2DM4A 3UJIH 4Y1AA 1V7NL 3TESA 4RMQA 4TOYL 3LKNA 3HZKB 2ERJB 1AGEB 2VQUA 3CFJA 1ZHBA 1HYSC 4KK8D 3QFJE 3P2TA 5FHAH 1TTUA 3HC4L 3FQWA 3IFNL 3EOTH 1NBYB 3KPSB 3TWCL 3VWKD 1UQSA 1U8LA 4I0KA 3IFLH 4WFGE 3H7BB 1TJGH 1GSMA 4PGCB 1S7TB 4NM8H 1TTFA 3CVHL 4NQVB 2QQNL 1G7LB 3U0WH 4DGVL 5INDB 3CPLB 4L1DA 3CSGA 1U3HC 3NH7L 1HH6A 1A7PH 5T3XE 2AJYL 5C9JB 1BJ8A 5HGBA 3DUSA 3O4LD 4Z0BH 1RULL 1ZA3B 3EO9H 4YX2H 2D0HA 3OAUL 5DVKA 5I75C 5JIPA 5I2IB 4YFDB 1BD2E 4I5BA 5F3BB 2P8MA 4LVOC 1T5WB 1FNGA 4KRLB 2W1NA 3MLTB 1MFDH 4N9GA 5J12C 1R5WB 1TJIL 4KDTC 3VG9B 4DAGL 4WWKB 2SEBA 1E4WH 1ZEAL 3VXSB 1T20A 4NO0B 3D48R 5HGHB 2FX9H 4UQ3B 2C4FU 1H3GA 4PJDB 43C9B 5TF1L 4I9WE 2QV2A 1Q9OB 5H2BB 4LVEA 3L1OH 3H9HA 5FGRA 2VLKA 3U83A 3W5MA 1AXTH 1XEDA 4M00A 4GW5B 5F9WB 1VADA 2V6HA 2W0LA 4JFEB 4LP4A 1U8HB 3ARBC 5ADPL 1GGCL 4GRMB 4XCYA 1KB5H 3WNMA 3PHQB 4ZO8A 4Z78A 3L5IA 3UBXG 4LGRB 3LMJH 2VDOL 3N1QC 1M7IB 2P24B 3IS0X 4OI7A 3MRHA 5IVZA 4L8BA 1JGDB 2I9LA 1UM4L 3N9GL 3ROOA 3X3GH 5DZLA 3L5JA 4BQBA 4EI5C 5D7LB 1NFDE 1WC7A 2DKUA 4ETQA 4JB9H 3O3EB 4CU8A 4GW4B 2D2OA 3LS4H 7FABL 1J10A 1CDHA 3SKOA 3RUGE 1G9NH 3WUZA 2NNAB 3EZ8A 3R8BB 4KHXL 4M6AA 2X4NA 2AEWA 1UT9A 3MRCA 1FO0H 5I1KL 2W0FA 1OAQL 3SKMB 3L5XL 3L5WA 4K9EC 3GHEL 5EBWA 2B1HH 5T5NF 4M9PA 4OLEA 5IFJA 4P49A 3HI1A 4U3HA 2AGJL 1KEGL 2G2RA 1RK1B 2DQGL 4M6ML 2NY2C 5IVOA 5CEYB 5F1KC 4L1HA 3HLAB 1GGIL 3MRQB 3WDJA 5HYSG 1IT9H 4U1NB 2BVTA 2BNUA 1YEDA 4C57C 3U82B 1AGFA 2P45B 2V17H 2X41A 1KTDB 1R0AL 4M62L 2DI7A 5D7KE 3JWDH 3ZT5A 3SCMB 3VG9C 3DUUB 5FECB 5I74B 5HVHC 1N6UA 5C3LD 2R1WB 1T0MA 1RHFA 1B3JA 3W2DH 5GRXG 1QEWA 4OZHE 3QDJD 1HQ4A 5ALBL 2XA8L 5H35B 2XN9A 1NMCB 1XGPA 2C7UB 1XR8A 4XAKD 5KBNC 1AGBB 2H2SD 4NGHL 5TDOB 2Y07L 3WV0A 5EU6E 3HAEG 4M5ZL 1U93A 4CADA 3JV5A 5IMKB 5AG9A 4GAJL 1C12B 1LILA 4Y16C 3GRWA 2IBZX 4P99A 4XPTL 1F6FB 1IKFL 1CFVH 1BZ9A 4ODXA 3FFDA 1PKQA 3ARQA 1T1ZA 2H1PH 5I18H 3VXUA 5IHZB 1SYSB 3WS3A 2VQ1A 2CH8A 5GGUB 2D7NA 3RPIA 1U3HA 4HKXB 5FHBL 5GGSB 3VW3H 5KVDL 1D5XB 1MJUL 3P4NA 5HHXL 3WFBH 1H3PL 5C08E 2WUCL 3VRLF 3AVEA 4WU7B 3L3IB 2WQRA 2IQAA 5K59E 5IW1A 3ZKND 3NPSC 5D5MF 2AK1H 3OKNA 1WT5C 3KJ6H 3GB7A 4XPAH 3WKMH 5DDHA 3IU4L 4NO3A 2BNRD 4OF3A 2AK4E 1JIBA 1OTUC 15C8H 1GGBL 4IMLB 2CRIA 4NHCH 2EZ0C 1FNSL 4KDTA 4ZS6D 3MRIB 4PFEA 4RGOH 4X98B 2J5LC 3WYRA 3B5GA 4ONHB 4U05A 3SQOH 4QTHB 5I19L 4KZEL 3H3PH 5FOBA 3LEXA 4IHOA 4L29A 1N59B 3G6JA 4LPVA 1OW0C 4EZMA 1QA9B 3ZE0E 1MCEA 2AW2A 2DIJA 1AFVL 3NGBC 4PRAB 3OG6B 4BKLB 4BSWA 1KF9B 3RGVC 3NBNA 3LH2L 5BVJB 1Q0YL 2YSSA 3KYAA 4N0RA 5GIRB 3D9AH 1EO8H 4GG6E 1CFTB 1W0VA 3ARUA 3ARBA 5GGTA 5L2KB 4OLVH 4HKBA 4HXBL 2W9DL 1K6QL 3Q1SL 5DRWB 2VKWA 1D3CA 5C07A 2FSEB 4J3VA 4A2MA 3BO8B 3ULVF 1CTOA 4ODWB 1WBYA 5TH2B 3UPRB 3P11H 1Q38A 3FOLA 3HUJF 3T0EE 4GUPA 3TVMC 5SWSB 2H26A 3BZ4A 4EI5A 3OXRA 3ZL4H 2A77L 3NACH 1D5IH 1YUHA 3HE6B 4OFPA 4OLWL 5I17B 3Q5OA 4CNIB 2ZUSA 1NAMH 3BDYH 2A9NL 4FFYL 3EKCA 3O2WH 1FC2D 3RPKA 1QSFE 5IFAH 5JOPE 4OCYH 2HG5A 1FYHB 4M6NH 5EC2A 3DTXA 5CP3H 4P9ML 1J86A 3TJEH 3TBTB 3MPCA 4KKBC 4K2UL 4L8CB 1NGPL 1KTKE 4GMTL 3SN6N 1EZVX 4RISH 5E00B 2AJ3B 2EYSB 1KLUA 4G8FA 1LK2A 2D31B 2Y7QA 2DQIH 2CIKB 1SBBA 1RFDH 4HUUA 4KK5C 1QRND 3QUZB 5JDSB 4MWFB 4MAUL 3KR3L 3HB3C 4HXAL 4LCWB 3IJYB 4S2SB 1LP9E 5KS9E 5DF0A 2YPVH 5GZOC 4XCCH 1IQWL 1MCWW 2I27N 2BY1A 2XOTA 3VFSA 2WSKA 1L9NA 3HPJB 4X80H 3MV8B 3L9RB 4NO0A 4YZFF 5GGSY 4XCFH 1Q0XL 4DOHE 1SEQL 4ONFH 2GSGA 4P5MB 1RZIA 2IAMA 5DURB 3ULVH 1AP2B 1X7QA 2HRPH 5J13B 5ACZB 3IKCB 5DK3A 1Z9MA 3OKDB 4Y16A 2DI9A 2QHLA 4KXZI 3SE9L 1T4KA 4PJCB 4JKWA 1U8PB 1IEBA 3M17A 4X0KA 3R1GH 3NZ8A 3GMRA 2FX7L 1JI2A 3IJHB 2OTWA 3RHWK 4DKFH 1U9KA 1QSVA 2HFTA 3SGKC 3KYNA 3TBWB 4LCYB 3W5NA 1NDMB 2HFGH 4KTYA 4LRNH 4TTDD 4KAQH 4O2FB 5IR1A 1KELL 4HX1B 4KI1A 5I1EH 3CGTA 1SBSL 5F1NA 1MIMH 3I9GL 3IDNB 4JFOA 3GM0A 5ITBL 4GO6B 5E4EC 1HKLH 5GJSL 4GW4A 1EV2E 2VWEE 1RZ7H 1WT5A 5D1QD 3H9YA 4Y19E 3MCKA 3QWQB 2MSPA 1ES0A 4M43L 3QQNA 1NCWH 1XCTA 5E9DD 4RBPK 2BSSA 2R0KH 2DB8A 3EYOB 5I1GL 2DBJA 5I76B 5C7XH 4K23H 1M1SA 3AFLA 5DD3L 1TMCB 4PTUB 1CXIA 4ESKA 1BVLA 5F70A 3NCFB 3BZEA 3TF7C 2VDML 2IG2L 3QUMB 3WUWB 3B2UD 3BQUC 5EUKB 2QL1A 5LGHL 4LSRL 3VXTA 3SDYL 2FGWH 5ID1B 2OP4L 4ZYKB 1OW0A 3S36H 1P2CB 1D9KC 1YPZA 4J3XA 3QO0A 4OM0L 5GS0D 5JHLH 3RGVA 4XAWL 4MX7B 3GSVA 1EGJA 4ZQKA 1K2DB 2R2HA 1QBML 4LASH 3NN8B 2RFXA 3OR7A 4FG6D 2O5XH 5A3IC 3QT2A 3DVGB 1NANH 2OYPA 4YHKH 4OF7A 2X1PA 3EDDA 3ARVA 5DSCA 4D0BA 4KMQA 2X09A 1E0OB 1O5DT 4KK9D 4ZXBA 4OGAD 5MEND 1S7SB 2HLAB 3TVMA 1QNZL 5EWIH 2FB4L 1JFQH 2VXVL 5JUEL 3H3KA 1RQ5A 4NUGH 3RVWC 1SJEB 4Q6YA 1P7HL 1HILA 2Z93A 4PRHE 1UWXH 3K3QA 3DX9B 2HVJA 2C1PA 4MJ5A 3OJVC 4PP2B 2IPKA 2F5AH 3IJSA 2IBGA 5E6ID 4I0PB 3MCG1 1F58L 3A6BH 4ODTL 1A7QL 2H32H 4Z76A 3CLFH 1KYOK 3VDCA 2X89D 4HKXA 4QXWA 1I1FB 1G0YR 3RIFK 4NQEA 4LQ1A 4XC1L 1LEIB 2J88H 5CP7B 5FV1L 1CK0H 2DTML 3TT3H 4KI5C 4KKCC 1MJJB 2VTFA 4Z7QE 4E42B 4O9HL 5HVFB 5HY9B 1WBXB 5DHVB 5D2LE 4U1LB 1NMBL 2YMXL 4H25B 2C4XA 4AEFA 2DQDH 2X9WA 4TUOA 2X4UA 1AD0B 4KQ4L 2AJVL 1IAIL 1KB9K 1FVEA 4XMPL 3FQNA 3OXSB 3BD4A 3F7VA 3L3JB 2EO9A 4R4BB 1LDPL 2P5EA 4OIIH 1NUFA 1UEYA 1OP3K 5DQDL 4D0DB 1A6WH 2NY6D 5MHSE 2W9EL 1D5MB 4NNXB 1CE1L 2R0ZL 3BP6A 4N8VA 3T65B 1UYWH 3VFTB 4POZD 5FM5M 3EYVA 5DEZA 2UWEB 1XF2A 1LGVA 2IPTH 2WWKT 5DD5L 5IEHB 4LSSL 4KTDL 3FTGB 4WUUE 3D39E 1UZ8A 1KJ2H 3NVQA 4LSQH 4PRBB 2IF7A 1KJMA 5CJXC 1HI6B 5FYKL 3UYRH 1Z9OA 4KK6C 1IBGH 5EOQL 2Z9TA 1FL5B 4PR5A 2BNQD 1CFQA 1CICD 2VYRE 1X5XA 4PRDA 1TNMA 4U31A 3MROA 4LBEB 5TH2A 1MFCL 1CWVA 1VSCA 5LCVL 2XY1A 1JMZA 5T1KB 3OB0K 2ZCLH 2DBLH 2DD8L 3PV6B 5F7YC 2E27H 5EG6C 3RKPA 2O5YL 4HS8L 1FNEA 3QUKA 1YNKH 4OZFA 1A6UL 1MCNA 1MI5D 3DUHA 2BSTB 4HH9B 1CD8A 2IANA 5DJXB 3WSQH 4XH2B 4I0PC 3REWA 5FYLL 3OX8A 2A6IA 5CHNA 1VFBB 3BQUA 3V6ZA 4PG9B 1JGEB 1B4RA 3JWOL 1UACL 1IM9B 4QHUA 5B39B 4PJ5D 2PR4H 1D9KA 1H15B 1YECH 1QVOB 5AD0A 4OLXL 3TNMA 1XAUA 4CN6A 4C58B 4NWUH 1RUMH 5FKPA 4QRRA 4PJ8B 1J05B 4KJPD 4MCYB 4YPGA 2XKNA 5JW4N 1ERNA 4G8EA 4MA1B 3VFVB 3ARXA 4OQTA 3MXVH 1INEL 4WHYH 1GOGA 1NL0L 4GAGH 4DZBB 2X1QA 1CLOL 3BE1L 1NC4D 4A6YA 3MFGB 5DTFB 3A67H 1HOCA 4FQLH 3VXME 1FRGH 4E41D 4JJ5B 3VH8A 5F7NC 2NXZC 4YC2B 1UB6B 2XXMB 3HPLA 2H9GB 3FL7A 3DRQA 4WY7H 5E70A 3PWUA 4WI7A 1U8KA 5CCKL 3RY6C 4JFFB 2EC9T 1WZ1L 3SDXA 4CN1A 4X6EB 5HYJE 5GGVY 3I2CH 4U1GC 5DLMH 2W9LA 1IGTB 2OQJB 1LMKA 5E5UB 5DMIH 4BH8A 4MZ2A 5IMMB 1E4XI 5LWYH 2BOBA 1INQB 4PJEF 4RAUB 1YY8A 5CSGA 1F90L 3I6KA 1M6OA 1WIPA 4RA3A 1C7SA 4LL9A 2NY5L 4OQ1A 1YEIH 5C0AB 4ONGH 4LKCB 2CGRH 5FYLE 1R24B 1VENA 1F6LL 5KVGH 2VXTH 5DRXA 4LOUC 4JFYA 4OGXL 4LPWA 3M8OH 1A02N 4I48A 2YD8A 3U4BL 4JHAL 3SJVD 1G9NC 5EC1A 5DZNA 2HLFD 1AR2A 1FORL 2OM5A 3MV9D 4DFHA 2GT9A 1FV1B 4QRSB 1JRHI 2VXSH 4X7TA 4V1DD 3BKML 3L3DA 1QBAA 2QKIB 5FGBC 4TSCL 2DN7A 3CSYB 4ZUWB 4YK4B 2FWOB 4QOKE 3RBGA 5IF0A 5D7IF 4JGJA 2OMNA 2Q8BH 5HXMA 1MVUA 3UJTH 3S3SA 2P7TA 5BS0E 4MSWB 4Z7UA 2G60H 1G7HB 2EDXA 3CFIC 1LO0H 3CH1B 1TZHA 4X7DC 4MJIA 2ESVD 3AMLA 2CIIB 3KPTA 3HE7D 2F58H 5I1AB 5FCUL 4NYLB 2VXUL 1YEJH 3JWDC 1T7XA 1F6AA 2OLDA 4UTBH 3Q3GA 5JNYA 3QDHA 4L4TE 5BXFA 3GMPB 1CFNB 1ZE3C 5LGJA 5C9KA 1WZLA 3PDGA 1JGLH 4LSVH 3VJ6B 1TJHH 5D70L 1U92A 1ITBB 4UTAL 5IGXH 3EYFB 2J8UA 3NIDF 1BFOA 4XRCB 5JMOC 3BD5A 4OKVA 4E5XB 4W6WB 1DJSA 1ND0B 4M7LL 1FLTX 2BHZA 1ORSA 1N5AB 1IAKA 1YN6B 2G5BB 3MUZ1 3WLWC 2KZWA 4LKXA 4HIXL 4N0FB 4NT6A 1DLFL 4GRLC 4Y1AE 4QRPA 4EVNB 5BMFH 3BI9X 2K7QA 3BHBB 3NTCL 1JBJA 4MXQC 5IB2B 3QEUA 3G5YA 5IB5B 1C5DB 5I0ZA 5KJRL 2HJLA 2EDYA 4QHNB 5D7JC 5D9SA 2PO6D 4I18B 5KSBB 3RWDB 1BQLL 3S37X 4CL7A 3VWKB 4RZCA 4FQPA 3IDMA 3STZB 4R7NB 2IFGA 5GGQL 4JY5H 4JM2C 3PL6A 2PXYD 3RWGB 3JTTA 1A64A 3UTOA 5DJYA 3FQTB 5EO1A 3BMWA 3LRHA 3D69B 3RIAK 4ZPTB 1YDPB 2ZCHH 1BHGA 4XPFL 1O7VA 4CMHC 3BWUC 1VGKA 1ZVSA 1KCUH 1IGJB 1T2QH 2VL5A 3RX8A 3R06B 5IM7B 1G7QB 3WIHA 1WICA 3VXNB 3WFZA 5FEBA 3O4LB 1D5MA 3MFFA 5HD8C 5F9JA 3RU8L 4Y4HC 2UZYB 1XGTA 1HSBB 1KEMH 3R4DA 4TNVF 3RY6A 4RIRB 4FMKA 1Q72L 1ZT7A 3IDIA 4JHWH 4PY8J 3O81A 3PNWA 4PJFB 2KZ1B 4Y7MA 4X8XA 3QHFH 3HUJB 4G6AC 3FB5A 3QULA 5L88L 1S78C 4LLYB 5KSAB 1JHKH 4X6CB 4NRZB 5IB1B 5FA3A 1QUNA 3WLBA 1KB5A 3G08B 2WIIA 3GIZH 1NGZB 3CZFA 3HMXH 4NC2B 3BP4B 4OGYH 3SDCA 5E8OB 1DBAL 5JW5B 4P3DB 3O6ML 5BV7B 5ALCH 1TETH 4X6DF 2R69H 4PUBL 5HHMD 3SPVA 2LAGB 3IS1X 1VFAA 1T7ZA 4JKPH 1U2HA 5I8CA 3PWPA 1BX2A 5BZWA 4MCZB 2JELL 1RZ8B 3TH4T 2WBWB 3GRWL 2R15A 4X83A 4U1SA 4LEXH 1K85A 4N8CH 4KY1L 2KH2B 2DYPA 4PJIA 4DWHA 4Y4KD 1FO0A 1HH9B 2R29H 5FGBA 4TRPH 4EKXA 1IC5L 4KROD 3GMMB 4JFXB 5EBGA 1QR1A 3NIGF 3EO0A 5JORB 3EIFA 1A7OL 3LN5B 4YFLF 1T3FA 3C5ZD 2YXMA 1INDL 1H5BC 4U6HB 3QFJD 3T4YA 1U58B 2V5RA 3MRGA 3QDGA 2CXGA 1FBIH 1UXSA 1RSFA 3L3OA 4BSJA 2EYRA 3GI9H 3I6LE 5TQ0L 2HMID 4WFGD 5D1ZC 1CDJA 5EO0A 3BD3A 4FFVC 2P8PB 1A22B 5DTFA 5DMKB 1I3VA 4NN6C 1QFOA 3MRJA 4HZLA 4P4KD 2P4AB 1QSEA 2X7LB 35C8L 4U0QB 5CWSA 1DQQA 1G7JB 3SDDC 3CJJA 3TJHC 1PW3A 1CG9A 2VDRL 5T3XD 4OTXH 4JDZB 2YD9A 2A1WL 2OJZH 1G6RH 2BCKB 1WISA 3EOBB 4AIZA 2N7BA 3ULVC 2MCPH 1S5HA 3N06B 5IB4B 2GCYA 2DQJL 4CUCA 4PRPA 3DECA 1BD2D 1GZQB 5IV2B 1CT8A 2ZG1A 5KSAC 1EHXA 2GYSA 3MBXH 2Z91B 4ZUTA 4R4ND 3X17A 1MCRA 4FZ8L 5MI0C 5JA8B 4G43B 1LO5B 4JFHE 4G42A 4HS3B 1X3DA 2A6DA 2DLFH 5GGTL 1IGCH 1JWUB 1J1XL 3FB8B 2N1KA 2XN9E 3QDJB 3QEQB 4GRLA 4KJYB 1OT1A 2H32B 1WBZA 5FB8A 1YEFH 2VE6B 2NTFB 1R24A 5D7JA 4I9WD 1FVDB 1RMFH 1KACB 2BSRB 5D2NB 4JG1L 4L5FH 2VOTA 3MJGX 2FO4A 1PKQE 1JGUH 3LQAH 2F5BH 1KCSH 4JM2A 5CSBA 5BQ7B 1SMAA 5HHQB 3TZVD 3VXUE 4HPOH 3HZMB 3BPCB 3MTRA 1ADQH 4FXLA 3VXOA 3QJFA 1DEEA 4AT6B 4NRXB 5T1MA 4F7CB 4E0RB 1CR9H 3MJ6A 2AQ1A 3BIAX 5JIIA 3VGDA 2QKIA 2R2EB 2Z31C 5FXCH 5I30H 5E2VH 3I02B 1DQLL 3QNXB 3B9KB 1TQCB 2WQ8A 4Y4HA 4YHZL 2R8SL 1YEGL 4ISVA 4UDUA 5TJWK 5F9OH 3EYQC 4NFBA 4K9EL 1N5YH 1QFHA 3REVB 4J7RA 2HJFA 4LLWA 2VDQH 4HGWB 4OD1H 5E8PA 4MSWA 2BNRB 5LJYH 1BVZA 1FL3B 1JK8A 3S37L 3PHOA 4KHTH 3C5SB 4PGBA 2Q87A 3C60C 1TITA 1OHQA 4EUPG 3CXDH 4R3SA 2YUXA 3QB7C 4JRXA 4LLDA 3ARSA 4M1DH 3VFUA 2PYEA 3G6JE 5FF6A 1A3RL 4WGVB 3PWVB 1U36A 3C6SB 1ODAA 5IOPB 1DL7L 2A73A 3VJ6A 1DBBH 5J6GA 4HC1H 3K2UH 1MSPA 4K3HA 4TSAH 1A1MB 1DQJA 4MA7L 2E7LC 2YD1A 1FDLH 1NAMA 2DQHL 1SEBA 3S7GA 3O45B 3MLYH 2AP2A 1MHPH 3PP3H 4JAMA 5HYIA 2R0LL 5C07E 1P53A 2Q7YA 3RL1B 1JF1A 5E99H 4UV4L 5D7KD 5CP3A 5CEXA 5GS1B 1KG0B 5D5MA 5DUPL 4JM4L 3RWIA 1QO3A 4JO3H 1F4HA 4NQSA 2E9WA 1SHMA 4LHUG 3HNVL 4O2EB 5GISL 5EU4A 1UGNA 4S1QL 2OTUA 3D2UD 5DJ8A 3LN4A 4U7SA 1RJYB 4AEIL 1GAFH 3A6CH 4J23A 2BRRH 1K3IA 1XH3A 2D4FA 2D7MA 1H5BA 4LLUA 3RDTD 5EU6D 2YOCA 5EZIH 1NMAH 5HI4D 1PSKL 5K9QG 1FFPB 4A2LA 5CILL 5I1DA 4XVUC 1P6AB 5D1ZA 3IDYC 1P7QD 1RIHH 3SKJH 3VFWB 4XNQA 1GCFA 1DDHA 5D6CB 2RAMA 1FFNB 5ITFA 1OD7A 3O6KH 4X7FC 3SDDA 2KL6A 1G7MA 4F58L 3B9KC 4EQ2A 1MWAH 4HJGB 5C08D 1LO2L 4HUXA 3E6FB 3KPLB 2BP3A 4JFQB 2AEPH 3HI5L 3QUXC 3IXAA 1AR1D 1QRNB 3GJEB 4YEFA 3SOBH 1K9TA 5KSAA 4U6VH 4WFFE 2FECL 2AK4D 2PW1A 1EGJL 1EFQA 3O6LL 4UNTA 5IBTH 4XP4L 4HJ0C 1WFTA 3PJSB 3C6LC 4PS4L 5F7MC 2Q3ZA 3U2SA 1W72B 1U8NA 1JF6A 5E8OA 4P57A 4F37K 4HWZB 2CLRA 3LPGA 4NJ9H 1UKQA 3FO1A 3B5HA 2IALB 2K9UA 1RHHB 4N5UA 1XR9B 5HYFA 2WUBL 2HWZH 3I75B 1CFSA 5BJTA 2FL5A 4NJAH 1VESA 3GBNL 2Z31A 3CDFA 4HKJA 1CS6A 4R96A 5BZDB 1V5JA 1OTSC 4JFXA 5FV2A 3T0ED 1MQKH 4X6FA 5T1LA 3VD3A 3MQIA 4YXKL 2I5YL 1EEZA 3MZGB 3G04A 5H37H 3NMEA 2Q8AH 3NCYP 2CKBB 4YDKL 1QSFD 3OGOE 1CZ8H 5E9DB 3VXQA 5JOPD 1AE6H 2GSIA 4EOWL 3WNNA 1LO4L 1HSAB 4FQXA 4GQ9H 4HMEA 3C60A 3U36B 1TCMA 3GMOB 4R26H 3CXHK 4M1GH 4DN3L 3T08A 3TV3H 1QLFB 4IRZL 4RGNC 25C8L 3AC0A 5IG7A 1YPZE 2HA1A 4LARL 4QCIA 3WIIL 3O2DL 4JDZA 5F88A 2GUOB 2VISA 3X3FH 2ZOKB 2HH0L 3DGGA 2R9HD 1BIIA 2E7LA 5C8JB 3QR2A 1ZGLP 3ZE1E 1AIFA 3QIUD 1S5IL 5J3HD 1GZQA 1UM6L 1YMHA 5F6HI 2Z91A 1F4XH 5C0FA 2FH8A 5F8RC 1FYTB 32C2A 4Y5VB 3BN9C 4RFEA 5KSVB 1JWUA 4R97B 5MENB 5A2LH 3RUGF 4ZD3H 1YN7B 4WW1B 5FUZL 1D5ZA 1MJ7H 1NGWA 3OKEB 5DMGC 4RNRA 4HG4J 3AXLA 2Z4QB 5T3ZL 2OL3H 1ZK9A 1BEYL 4Z0XB 4HCRH 5GXBB 2V9RA 4YHOL 2WWMD 1YNLL 3F7YA 3T3PE 3GUTB 4NM4L 4EXPX 4FQIH 5J9PA 5F93C 5F89B 1RURL 5FYJU 4OZIA 4QGTA 1QLEL 3VGAB 5E6IB 3KWWB 4ZUSB 4Z95L 3VG0L 5C0GB 1EHAA 1JN6A 2FIKA 5T33L 4PJAB 3MRMB 1Y6KR 1WZKA 4NQEE 3S88H 2R39A 4YGVA 3P4MA 1A9BB 2EDFA 2J4WH 3BKJL 1ONQB 4LIQL 5IK3B 2D7OA 4OIBA 1Q9KA 2AEQL 1OWRM 1MUJB 1T0NB 1S9WA 2W59A 1HHIB 3D25B 4OUOA 5F7HA 2VZSA 4YHNB 3QUXA 4M7JL 3EJJX 5IMOA 4HHAA 4OZHF 1V7NH 5D93C 2B20A 2JJVA 4Y19D 1L4IA 2Y06H 5DGRA 4DZ8B 2LABA 1KJ2A 1WAAA 4F57H 1Q9LB 3IU3A 4XVSL 3IFNH 3JTSA 2P5EE 3GSOA 3MXWL 4IRSA 4TUJB 4KMTH 1UCBL 3C6LA 3MRDB 1NEUA 4OQTL 5DUML 2QHRL 5EZJB 4XPGL 2HJKA 3KPPB 4MNHA 1RUPL 1U95B 2NY6B 3LZFL 5DEFA 4ZOAA 3SQBA 2NR6C 1R3LA 4XB7A 3CVHH 3VRIA 4B7LA 1EFXD 3KPOB 4JG0L 4N1HB 4A6YL 2HFFA 3PWLA 2ZUQB 2EH8H 3H0TA 4DUVA 3O2VL 3QPQC 1W0WA 5ACLA 3BJLA 4P2QA 3RGHA 1RULH 2A6JB 3P30H 1E27B 3RI5K 4XNZB 1FGVH 5T3ZE 3BVNB 3GGWA 5C09A 4U6XB 3D6GA 1CICB 5I0DA 2YD7A 2I07A 3UBXB 1SVZA 3UTTA 3IVKB 4MD4B 4IM8A 4JN1H 4F7EA 5JXEC 3S98A 4QY8B 2VLME 4LEOB 1TJIH 4DAGH 3OGCA 3MRRB 1TCRB 4L9DA 3ARFB 5ICYA 1MI5B 3WNOA 2D9CA 2IANE 2XWTA 2QSTA 4PRHD 3HTLX 5B4MD 4LIQE 4GKNB 4F7PB 3ZE0F 4R7DB 4LGSB 1KLFA 2BXZA 5EIIA 1SQ2N 2EC9U 1GGCH 3KXFA 5JXAL 4GG6F 2ZUUA 4QF1A 3Q6FA 3HNSH 1OQXA 2EYTB 4PJ5B 3DARA 4PREA 2VDOH 4G3YH 4JZJB 3FZUC 3WHXB 2QADC 3L7EB 3O3DB 2FR4B 5HYSB 1H8OA 1UM4H 3N9GH 1S7VB 4RWYL 4WRLA 5CINL 2JE8A 4NOFA 1G6RB 4OUUB 3RTQD 1PAMA 4RMWA 5BRZA 3D0LB 1A6AA 3V0WL 1KFAH 1NC4B 5K9KA 1U6AH 3HNTH 4X6DB 1K8IA 3GIVA 5D96B 4ZS7H 4NKOA 3AAZA 3PABB 2Y5TB 4E41B 1MHHA 3UPCA 1U8QB 2VZTA 4PJHF 3MUGB 2C1OB 5C0JB 1KSRA 3PGCB 3QNZA 2VUOA 5MHSD 4ZNEA 1ZT4A 3O0RL 1BQHA 3EJZD 4I77L 1ZGLA 3HMWL 2GJZB 4H0GA 3HAEB 4KVNH 4Z7NF 4NP4L 1CL7I 4YNYA 1KEGH 4WEUD 4WUUD 5DJ2A 1EUTA 3I85A 4PV8B 4Z5RA 4YWGH 3UJIL 1J8HA 4U1JA 1N2RB 4Y5YC 3EOTL 4M62H 4KI5E 1A6VH 1ROWA 2H2PC 4C56B 5IQ7H 2JLLA 3IFLL 1LP9F 2C3VB 4YHLH 4PB0H 4YE4L 3QQ9C 1TJGL 1ZLUK 3R0MA 1MFEH 1AC6A 4OCXH 1WFNA 1BIHA 3MX0A 3U0WL 1I8KB 2XA8H 2BY3A 4WFHE 3X13B 1S9XA 3W39A 3CC5A 2X4QA 1UKSA 5KN5B 1KPRB 4HIIA 4Z0BL 2UYLA 1NGXA 5GRVK 5FYJL 3MV9B 1J1PH 4YX2L 4L4VB 4XPTH 5CUSH 4V1DB 1TPXC 4Q6IC 1ZHLA 3BDBA 5EOTB 4PYGA 1NKOA 4GXUM 5EO9A 5JMRA 4WV1C 1G6VK 2I24N 1I9IH 1VDGA 5HHNA 4LFHG 5FHBH 1FGNL 4J3UA 3WIHL 3MMEA 5ID0B 5HHXH 1MJUH 1E4WL 4NC1C 5AUMA 4Z7UE 1P4BH 2NQCA 2GEEA 4PJEA 1S7WB 2BVQB 2FX9L 4MJIE 4C4KO 4CW1B 5JOFB 1RVFH 1H3XA 1G7PB 1X4YA 3K8KA 3HE7B 3KLDA 3EOAB 3IU4H 1AXTL 2X9XA 5JXEA 5D96C 1DLHB 2A74A 3RVXD 4CVZA 3ZTJG 2P8LB 3NCBB 3ROLB 4XCEB 3VXMD 2ICCA 1EK3A 1FP5A 1JWSB 3H9ZA 3RL2B 3PGDA 4LHUD 4XZUA 1KB5L 3GFUA 5FYKD 2Y36H 4NQTA 3UYPA 4YHPB 4LSTH 4M61A 2R4SH 3LMJL 2J8UE 2ZOLB 3P73B 1IILE 4J8RB 5I66B 4R90H 1NEZA 4I8DA 3OZ9H 1JNNH 4ZFFB 4XNMB 5HYJD 2OI9B 1KUMA 4Y8AA 1E28B 4HULB 2FO1A 1RI8A 3LQAC 2B5IC 3V5DA 3LH2H 4PJBF 4H26B 4JB9L 1I9RH 1BMGA 1P4LA 3LS4L 1KIRA 2YA2A 4QRPE 5D7IA 3AM8C 4MDIA 1A9EA 3DO7A 4XGZA 3CAFA 1G9NL 2YPKA 1N64L 2W9DH 1MCHA 1Q9WA 3Q1SH 3RFZC 4ZMAT 5D71L 4CVXA 4X4MA 1DANT 1WIOA 4M6OH 3QJHB 5FYJE 2PO6B 4EN3C 1TNNA 2ADIA 3LQZA 1FO0L 5FYLD 3FRUB 2WP3O 5FUOL 4U6TA 2A77H 2PXYB 2B1HL 3MRNB 2JJWA 4G80B 4MB3A 3LSOB 2A9NH 2ARJA 1U8JB 4FFYH 1I1AD 1MOEA 3QA3A 5IVXA 2ICEA 4D9QE 3NA9H 1A4JA 1KJ3H 5D6DC 3LEVH 2GFBB 3EW3B 5EUOB 4PJXA 5ESVA 1NFIA 1DVFB 1BZ7A 4P9MH 4RDQG 1X6NA 4CVUA 3BX7C 1F13A 1MCJA 4OCLC 2UWEE 1VERA 1U8OA 1U41A 1RZGB 4G8IB 2Q6WA 3WXVH 3JWDL 1B0RA 3HMXA 4GMTH 3LKQA 3B6SA 4GRWF 1ZT1B 4QRUB 1PEWA 4QOKD 4ZFOB 3RZCC 2NLJB 2CLZB 4F2MB 3RWCA 3W2DL 4AEHH 2RCSL 1KPUB 3TIDA 4Z7WF 4JR9L 3PIQB 1QBBA 5GJTL 5BS0D 3WDHA 1EVTC 4NBYB 3OAYK 2DDQH 4NN5C 4P2OD 3TIEB 4PJ7F 3KJ4B 1YYMH 2BOCA 3GSNH 4N0YH 5DRNA 3EHBD 4Y5YA 3UZEA 1P1ZA 2VAAB 4OD2A 3WNPA 4LLVA 3RAJL 3P40A 4LVNC 3MNZA 3MREB 1CFVL 1YQ2A 5J89A 2N7AA 4L4TD 5C0CA 1EAPB 4QXTB 3VMPA 2H1PL 3MLXH 5I18L 5F72S 2ATKA 1Q0XH 5HHMB 2GKIA 1SEQH 5ISZA 5LAXB 5HYQA 3HG1A 1TQBB 3S36X 4U1MB 3PWPE 2F74B 1OF2A 5EZLB 3VW3L 4JREB 2QQLH 3WFBL 4F8TA 3FQUA 1CLZH 5F7DB 2CDFB 3BPLB 3MBEC 2GAZB 5IESH 5EN2A 1H3VA 4OFYD 4JEGB 3I84A 1IGIH 4TULL 3ARGD 4HAGA 3W81A 2AK1L 4Z8FH 1DE4A 3U9UB 3KJ6L 4PLJD 4Q6IA 4Y4KB 1J1OH 1IEAA 2YR3A 4MVBD 3T3MF 3TNNB 2FX7H 3OF6D 3CFBA 1AD9A 4KROB 2NY3C 3UXFA 1MCPH 4Y1AD 4WV1A 15C8L 5FK9A 2DRUA 4IOSD 2D3VA 3QG6B 4NHCL 3QI9C 1FVCA 3HC3H 3QDGE 1KELH 3QFJB 4RGOL 4FMFA 2ZP0T 3GSRA 3DRTB 3I9GH 5FIEA 4JANA 3NAAL 5ITBH 1FCCA 5GJSH 2FEDC 3O3BA 4GRWH 3OWEA 4JPKH 1QSEE 2XG5A 3UAJC 4C55A 5CD5D 4P4KB 3KGRA 1DVFC 1AJ7H 3F12B 3PABA 5I1GH 2XQYG 3CDGA 3IFOB 1H0DB 4OLVL 2VDMH 1U8MB 1KCLA 3IGAB 2IG2H 4F15C 1BJMA 5F1OB 4PRPE 4RMSA 3SGDH 1JZ7A 3HHRB 4LSRH 4PYHA 4FXGA 3P11L 4XNYH 2OP4H 2YEZB 1BD2B 1UVQB 4WDIA 3NZHH 3MJ7A 2G9HA 1CLCA 4LCUB 3ZL4L 1D5IL 2EKSB 4UI2A 5CGTA 1NAML 3BDYL 1JL8A 3KJ4C 3FQRA 4UV7H 5GPRA 4ODUB 1QBMH 3O2WL 3AM8A 2APBA 4UBDC 1ADQA 1FL6B 2UY7A 5IMLB 4L3CB 4OCYL 3CDCA 4M6NL 4BUHA 3CFDA 4N8VG 5I1JH 4WW2B 5I6XB 3ET9F 4U2ZA 3TJEL 3EJYD 4EN3A 4C59B 3STLB 1TQBC 3ZMRA 3CCHA 3LKOA 1Z5LB 4RISL 3TZVB 4JREC 4OB5H 3WFHA 3GI8H 2NY0C 3AY4C 4FABH 5HDBE 3QXUA 1GRWA 4OCMC 1GC1H 5H8DA 2B2XH 1CQKA 2DQIL 1A3LL 1B4JL 3DVNB 3E2HB 4EIGB 1BVKB 5D6DA 4NUJB 1CD1B 2V7NB 4YO0A 1WCBB 4PJ9C 4AQOA 2EE6A 2PYFA 1F58H 3S9DB 1GHFL 1A7QH 2J6EH 2WNGA 4S11A 2YPVL 1BBJB 4XCCL 1NFDB 4HS6A 4KUCD 3DSNA 1F3DJ 1YY9D 4ZUVB 1JGVH 1KIUA 4P5KA 5DJ6A 4U3XA 5IVNA 3CVHB 3RZCA 5LG1A 3VI3F 2DTMH 4M93C 4XCFL 3RUGB 5ANMA 2H41A 4ONFL 1BFTA 3OJ2C 3ULVL 3VFPB 3I6LD 4O51B 3C5JA 4JRXE 2VIRB 4XNUL 5MEQA 3F6LA 1ZXQA 2PTUA 4XXDB 3BH8B 2PYEE 2ZSWB 1KN2H 1S7QB 2YMXH 4PLOB 2BRQA 1IAIH 3R1GL 3O4OB 5INCB 3SDAC 1CDCA 2NXYD 5CJOL 4RFOH 5FO7B 4DKFL 3P73A 2CRZA 1UXWB 1MFBH 3H42L 5E1AA 2HFGL 5JQ6L 4ORZC 4KAQL 2W9EH 2I60H 4OV5A 4BFBD 1CE1H 3VRLE 5I1EL 2Z35A 2NY1D 1LEKB 3F7PC 3MBEA 4KTDH 5L8JB 5D5ME 1HKLL 5EZOH 3FOMB 3F7RA 1FNHA 1QYGL 4JFHD 1R6VA 4JVPA 4U0RB 5FYKH 2ZG2A 3MA7A 4UU9B 2Z8WC 3N1PC 3MCLH 1NCWL 4GH7B 2VLRA 2XN9D 4OZHB 4GG8B 5TQ2H 5I6XC 2R0KL 3VD5A 3D2UB 1I3RB 2J7LA 2NZ9C 3HC0A 1MFCH 4K23L 1ZVHA 3QI9A 5C7XL 1HYSD 4D8PA 1NKRA 1MWAA 4O2CA 3B3IB 1SJVA 3NIFE 1AQDA 5C0BA 3RDTB 4NN7B 5KW9L 1I8IA 2BVPA 1QQDB 1HWHB 3MRNA 5HDOA 5CBEB 2JCCA 4W6YB 5E5MB 2FGWL 3IFPB 2M26A 3VXUD 1AC0A 3S36L 1A6UH 4PRNA 2NW2B 4JY4B 4P5TC 5JHLL 5C0DA 1U3HD 1DVFA 2FJHB 5F1IA 4RQQB 4L3EA 2KPNA 2O5XL 1RK0B 3ULVE 1CGWA 4RAVA 2CDEA 2NTSP 5E08H 2CLZA 3E0GA 4MYWB 3DX8A 5EWIL 3JV6A 4CU6A 1S7XB 1JFQL 3QH3B 3MV11 4HIEB 4KDWA 3WDIA 4AIOA 5DD6B 3TPUB 2IGFH 1KOAA 4JDVA 2XTJC 4NUGL 1H3WM 4PTTA 2ZUWA 2H6PB 2ARJQ 3ARWA 1OL0A 3OKLA 3AREC 5LKNA 5SV4A 1JTOA 1NL0H 2F5AL 2D7TH 2R23A 5A43C 1BAFH 2ADGA 4PY7B 2F53B 3ISWA 1RV6X 3A6BL 1JWMB 3CLFL 2H8PA 5A16B 5EZLA 3RNQB 1GH7A 3ARBD 4GG6B 2XKSA 4KRMB 2OK0H 3AY4A 5K9QI 5CCKH 2CDFA 1S7RA 4B50A 5ICZA 2QSVA 3UTQA 1DBKH 1SYVB 5C07D 1WZ1H 1QFWH 4X5XB 1D6EA 4PP1D 2A83B 1TZGH 1NCAH 4NZJA 2L7UA 4PJ9A 2MKWA 3T0EB 5DJCA 4EI5D 4WHTB 1JPTH 3CSBA 4BZ2L 4XBEH 1OP5H 1TTGA 4YZFE 3LRGA 2VN4A 4G9DB 1QSFB 5ACMA 4OIIL 2E6JA 3CFCH 2PKDA 2O61B 4I4WA 1A6WL 5E2WH 3ZHKA 3OKYA 2CK0L 3PWJB 1UYWL 4YQXH 5E94B 1RJLA 3QXAB 1LE9B 3QIBB 2IPTL 2VLLA 4ODHL 1KJ2L 2DJSA 3JV0A 4LSQL 3IFOA 2BVOB 4B5EA 1B9ZA 3UYRL 1FORH 2NY2D 4ZUUB 1KCVH 3SDAA 5FGSA 3EGSB 2FBOJ 3IGAA 4MHHG 3SE4C 5CKAA 2OL3A 2YBRA 1MPAH 1E4KC 1GGYA 3TA3C 3QIUB 3BEWA 4NQDA 4DGIH 4MMXC 3RWHB 5TDNB 1MH5B 3M1BB 3NA4A 1REIA 2DBLL 1LP9B 2EKSA 5KS9B 3SE8H 2E27L 1TENA 4WFFD 4X5WA 1DSFH 1ZSDB 3QEQE 2DM3A 2FJFA 1YNKL 3V6FA 4NO0D 3DYOA 3HCVA 5EPMA 5C0NC 2MCG1 2LVEA 3F5WA 3WSQL 3RWEA 5SWQB 4JVUA 3KYOB 4Y16D 3RJQB 3LAFA 4OZIE 5D1XC 2ZCKL 4CMMA 1DTUA 4J1UB 5DEGA 3K4DA 2PR4L 1CE6B 5I8EB 1YECL 4W4NA 4P5TA 1N26A 2A0LC 1RUML 1CD1A 2VH5H 4X8JA 1CGXA 4LSUH 3TFKC 2XFXA 2IMNA 2AI0L 5IIEA 5KSUB 3ES6B 4HZAA 3MXVL 1LNUA 2W91A 1SVCP 5IBLD 1BBJA 1U3ZA 3OKOA 4I3RH 4HIXH 1D7FA