5EO9A

Crystal structure of the complex of dpr6 domain 1 bound to dip-alpha domain 1+2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
MEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Control of Synaptic Connectivity by a Network of Drosophila IgSF Cell Surface Proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell adhesion
molecule keywords Dpr6, isoform C
total genus 28
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2015-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eo9A00
1JZ2A 3G5VB 3K2UH 3KPOA 1VFBB 3STLB 4HG4K 3NTCH 2C5DC 1KXVC 4OTXL 3GSUB 1VFAA 3IXAB 3EDEA 2FD6L 3GSQA 3ARSA 3QIBD 1T03L 4ZS6D 5E70A 2FLBT 5KVFH 4BSVA 2RCSH 4FA8A 3MV8D 4MD4A 4ZNEA 4M7JL 1I9JL 3TZVC 4ZUTB 2BOCA 3T0XA 1I3RB 1UADC 1XF2A 4QRPD 4PREB 1G7IA 3RWFA 2NXZC 2W07A 3DXAA 1QACA 3PWJB 1N7MH 1JMZA 3O4OC 5ID0B 1KUMA 3O45B 1H15A 1DCLA 1LEGB 1ZANH 2NY3B 1P4LB 1J1XL 1F5WA 3AGVA 3DVNA 3PDOB 2E9BA 2CKNA 5HHVH 3RAJL 4UT9L 3UBXG 2MCPH 5CJOL 5C6PB 3P4LA 4X5WB 4YDJA 2R0LL 3RUGF 4DUXA 3MRBB 2Q86B 5FK9B 3PHQB 2ICES 4FQPA 1UB5A 3GFUA 1EVTC 1NFKA 3W11C 1GC1C 3RUGA 3B9EA 3RTQB 4OQTH 2EXWD 3MACH 4JPWH 3SBWC 3MRJA 5DRWB 1DVFA 1NBVL 2PN5A 3PL6B 4H88L 2G2RA 3A67L 4FQXD 3KXFA 1MWAB 1JUFB 3OR6B 4U1HB 5CWSA 3O6KL 2B2XL 3PGCA 1AKJA 1YY8B 1CGTA 2IGFH 3WN5B 2B4CH 3PP4H 4LSUL 5K9QG 3H9SE 1HWGB 2BCKB 5IG7A 5IFAL 4IRSB 4NJAL 2GHWB 3N1MC 1NEZB 4YHOH 4XGZA 1K8IB 4ZYKB 3TN0B 4O51B 1TZIA 3P4MB 2B0SL 5TQ2L 3P30H 3C9NA 4LSPL 1EUUA 5LAXB 1ZLVH 2Y36H 5E2VH 4YX2H 3HZMB 3IU3A 3EOAB 1YYMH 1G9MC 2YD4A 5IESH 2VIRA 5E4EC 3DO7A 1N5YH 4N9GA 1JGVL 2HH0H 1IGJB 4X6BA 4XMLL 1AO7B 3C6LD 2CXGA 2UZIH 1AGBB 1T1ZA 4MAYC 1MCOH 2VXTH 2FJHA 3IDJB 4D9LL 5C0CD 3P0YL 4L8SC 5C7XH 3RHWK 2JLLA 1LGVA 1WC7A 5F1KC 3UMTA 3HC3H 3MUY1 3VD9A 3TO4B 1HXMA 3VGHA 1N5YL 2GK2A 4M1DL 2H1PL 4ELKA 3FRPA 5TGBB 4W6YB 2HJLB 1NCCL 3NGBB 1NLDH 2NPLX 2AKRB 4JFDB 4BH8A 4AENA 4HPOL 4BUHA 2R1XA 1ZHKA 4U3HA 4U7KA 1MEXH 3QQ3A 4NRXB 4Y5XC 3ZE0F 1W72H 1HOCB 1XCTB 5TF1H 5CD3A 1A6WL 2P24A 4OFPA 3GI8H 3EYOB 2P46B 5E9DB 2C4FU 3HAEG 1G1CA 2I24N 5B39A 2Y72A 3RBGA 5D7KD 4JG0L 4NQVB 1VKXA 1FVDB 4O2CA 4PTUB 2PNDA 3BP7B 2ICCA 4OF0A 5BW7C 2V2WB 4MB5A 5FM8A 3VFWA 4MDJB 1QFHA 3ULUF 1DQJB 5CGYD 3GRWA 4L8SA 1C5DB 2PTTB 3M07A 4OUUA 3QNZB 3FO9A 4NZUH 5DD5L 3ZLQC 1HH6A 3TPUB 5A40E 5IIEA 3LRSA 1I4FB 1CDHA 2PW1A 4L4VA 1U2HA 3OG4B 5DK0B 4LCUB 4AM0A 3L5WA 4WI9A 4XXDB 1IKFL 4XRCA 3K1DA 4QF1B 1RIUL 5J1AB 4WI7A 4HKZA 4G43A 4HGKC 4JVPA 4QEGA 2VDNH 5CCKL 3OKNB 1EDQA 2FRGP 5I1JL 4HS8L 4B7IA 3STZB 1AD9B 5HI5C 2B1HH 2CK2A 3RVWC 1FSKC 2A2QT 1IGIL 4KMLB 4KJQC 4NN6B 3MPCA 1QNZH 4LDOB 3OR6A 3HNSL 1A6UL 1RIVL 3UTPE 4MA3B 4RGND 2W60B 4U6XB 1RUAL 1AJ7L 4LRNL 4K7PH 3PHOB 2AEQH 1Q1JH 2CIKA 1XAUA 3IFPB 3C08H 4HPOH 3NPSB 4HF5H 1HDMB 4M1GH 3QUXC 4HLZH 5E08H 1WCBA 1O5DT 1F8TL 3TCLA 4GQPH 4X4XB 3NPZB 5KAQF 5D6DA 2GTZB 1AR2A 3BPNC 2CK0L 3LKRB 4OBRA 1H5BC 1AIFB 1RSFA 3T2NH 5J12B 4JFQB 4EJ1C 3DJ9A 4DVBA 4L3EB 1DZBA 4L9LC 5CIPB 4TSBH 4HEME 5C08D 4P2QE 1ZT1B 2VLRE 3LMJH 2OR7A 2J8UB 4G6KH 4LQFH 4UBDD 2XG4A 3BPNB 3G9VA 1S7RB 3QI9B 1AIFA 3IDIA 3LKRA 4MJ2A 4JO2H 4CNIA 5FYLE 3L6FB 4KJYA 4IRZL 4XPHH 1PD6A 2QQLL 3FQUA 2J6EH 3UZEA 3WSQH 1I3RA 1XF2B 3TBVB 3MR9A 5BQ7A 3TBVA 2AEPH 3QI9C 3PHOA 5KSVB 5ESVA 1IGCL 4PJGF 4P49A 1X5IA 4Q9QL 1I9RH 3OPZL 4NNXB 1FYTB 4IOIB 4IMLB 3VWJC 2DBLH 3PNWB 2L7UA 3SDAD 3X11A 4OF6A 4I9WE 3WFCH 1BX2A 2Z93A 1VFBA 4C59B 3SGDH 2BVOA 2GJ6A 3DURA 4RFOL 3MJGX 2DKMA 5EIQA 3HMXL 4N0UE 4YHOL 2FIKB 1FZJB 4E41E 4QXUL 5FYKE 2XWTA 4R26H 2YSSB 4J8RB 3GGWA 4NCC2 4MSWA 4DEPC 3QWRD 1TVDA 4O2FB 4UILH 4XCEB 5AG8A 4LARH 3PQYE 4Q9QH 4GAJL 3P2TA 5DQJA 1PKQB 3GMOA 3V0WL 3MLXL 4FFZH 2VWEC 3SQOL 1N8ZA 3VXPB 4GSDH 4EBQL 3HI5H 3PWNB 1KYOJ 2PTTA 4Z7UB 1FNGA 2BVYA 4WWKD 1G7PB 4XZUA 4YXKL 5I17B 4YE4L 1A4JA 1JPFA 5T3ZH 4ZPTA 3CZFB 4GO6B 4JY6A 2VL5B 1R3LA 5D96B 4M5YL 2DF3A 3BP7A 1IAOB 3OKOA 3HE7D 3LN5B 3P9MA 3RDTA 1I7ZA 3GKWL 2EEDA 1L6ZA 6FABH 3E0GA 1ZA3A 3RGVB 1A14H 3ZDYF 4YXKH 3DMMD 1AGDB 4V1DA 2NW3A 3UX9B 2C1PA 1VCAA 3S98A 3K8MA 3EOYG 2E7LC 1HXYA 1EJ6A 2NZIA 2ADFH 4KZDH 3AU1A 4J3SA 5DUML 4Y5VB 2P24B 1DN2A 1UVQA 1XCTA 5F1NA 5C0CE 3I9GH 1NAKH 4HUWB 3BUYB 4GOSA 1MOEA 1BQLL 5JORA 1CBVH 3FOMA 1UT9A 4FQHB 2B5IB 3B3IA 4KRMB 4FXGA 1CGWA 4N1EA 5E6IC 5JHDA 4BH7B 2C3VB 1VGKB 3HZVA 4M6OH 1HH6B 4CN6A 5EIVA 2FYYA 5SWQA 5F89B 2PO6B 2NLJA 4KKBC 2AV7B 1GVIA 2DBLL 5TDNA 1FBIH 1CE1L 3GIZH 5DFTA 4Z76A 4QOKE 4MAUL 1A1MB 1CLYH 4JREC 3X13B 4AYFA 3WV0A 4R6UA 4M8QA 1AD0B 2C1OA 1ZGLB 4ETQA 5CJOH 2X7LB 3T8XA 4YHYC 2NLJB 3UO1H 5GZNC 1KV3A 3ALPA 4P5MB 3TEUA 1RHHA 5IHZB 1CF8L 4OI8A 3CDCA 5F7WC 3MTRA 4Y5YB 2FNBA 4XCEA 1XF4B 1NGWA 5L2KB 2A0LD 2JJUA 3WEXA 4MHHI 4EI5A 2MPAH 5E2UL 4HWNA 1U6AH 2BNRE 2F9BT 4WI3A 4ISVA 1ACYH 4IRSA 3FB6A 4G7YL 4U6TA 1K9TA 3O41B 4LVHC 4X7SL 2R0KL 2GSGB 1N2RA 3GSWA 4XNQB 1YMMD 2MPAL 3QUMH 3OX8A 2YS4A 4DW2H 3U9PL 4HV8A 4PRIE 4Y5XB 2F54B 3DSFH 3HAEH 4L4VD 2Z4QB 3G6JF 2X42A 3B4NA 3FHQA 4JO4L 4MD0A 43CAA 3ULVL 5SV3A 3MRNA 4MDIA 4ZAKA 1E4KA 1NBYB 3C5SA 5EDXA 4K3EL 3LB6D 1GGCH 4XZUB 2VL4A 1DANT 3RL2A 3TM6A 1DFBH 4OLVH 4FXLA 4LHUB 5IMOA 5FHBH 5DO2D 5JTWA 2Q1EA 3MFGB 4ZUSA 2H32H 3NFSL 4Z78A 3GJFA 2K9UA 4KJWC 5T1LD 1E4WL 4JPKL 4NUGH 5ISZE 3MOAH 1DL7L 3OZ9H 1A6AA 4UNUA 4WHCA 4UU9B 4ZUUA 4PJEB 5F1IB 5DMKA 3JV4A 1IBGL 3C6LC 5CIPH 3RY5A 2WINB 3LRGA 4CRPA 3H9SA 1SVZA 1N59A 4JO1H 3WIIH 4MQ7A 2DAVA 3WN5A 5CIPA 3WHE0 3X11B 2ZSWB 5EU6D 2CKBL 5HGBB 2BC4A 3RPIB 1I85A 2XQBH 3TCXA 4ZQKB 4NKDA 3NCMA 4LK4A 4PV8B 4WHDA 3V4UH 4PJ8D 3WDJA 1CLOH 3I02A 5LCVH 1A6TB 5DVNA 5ESVB 5FKAA 3GO1H 2VC2L 3HUJF 4U0QB 2DQIL 4YHZL 4UT7L 3Q6FB 5F7LB 1UB5B 4XXCA 5T3XL 4XB7A 4U6XA 3MREB 4PRHA 3TVMD 1XGPA 1T4KB 1U93A 2P1YA 1P7QA 4QXWA 4XP1L 4XVSH 1T1WA 1YEHH 2J4WL 4F7EA 1B4JH 4PLJC 4LSTL 4EN3B 3ROLB 3CXHJ 5HHOE 2K7PA 2JJSC 5CJ8A 1SBBA 5HPMB 5H35B 3QA3B 2FL5B 4LIQL 2DQJL 1U3YA 2E9WA 1S5IH 2XFXB 1NDGB 4L3EA 1Q9KA 3K7UA 4TRPH 1MCEA 1JHKL 3ES6A 2BHYA 4QF1A 4QXUH 4ZUSB 3BI9X 4X6CB 3VXSE 2BRRH 4MNGA 1RJZA 2N56A 2YD7A 3MACL 4JPWL 1HQ4B 1H3WM 4DFHA 4NYLB 5F6HI 5ICXA 3MV11 3ESUF 3VXUD 4DK3A 2YD3A 3MLZL 3NIGE 3DUUA 2F5AH 4JM2F 4JDTL 2P42B 1HSAB 4RFEA 4EEEA 5L8JB 4OFVA 1RUQL 2IBZY 3TYFB 3UC0L 4WFHE 5DJ2A 1XR9B 4D0CA 3G08A 4XBGB 5JXAL 3OPZH 5LXGH 1MQ8A 4MXWL 4PTUA 4D8PA 5CBAB 4NM4L 3RHWF 2F5BL 1IQWL 2KDGA 4WFEE 1IILE 4ODXB 2DKUA 4DKEL 2ZUSA 3TP4A 4G6JL 1FLTX 2XIDA 1UM4L 4YUEL 5CD3B 1XF4A 4AIZB 5IW6A 4WUUE 2YUWA 5CFHA 3WNLA 1REIA 3QISA 3ZE2E 1S78D 3OXSA 4HHAA 2DM3A 4FZEH 3WDHA 4CVZB 3G5YB 1UH3A 2R0ZH 1NGQH 1MRCH 4Z18A 5D1QB 4F80A 5SWSE 1II4E 3I3EA 5I15L 1S3KL 1KJ3L 5HVHC 1H8OA 2NMSA 2DIAA 5CKGA 4EXKA 2EO9A 5I66A 1P6FA 5DR5H 4XC3H 3UYRL 2F19L 2X9XA 1OGTA 1RAMA 3N9GH 2PO6D 1HCVA 5CJQL 5FYLL 2P45B 1JPST 3ARGD 1YPZE 3BPCB 4OLEA 3WXVL 1AHWC 1YEIH 1U3HB 2FJHB 4LIQE 1KELL 3QG7H 5D6CB 1JCKA 4PJGA 43C9A 1YEJH 3CXDH 4Y4KC 4LBEB 4LEOB 5BS0A 3CXHK 4HZLA 4JGUA 1AXSB 1UEYA 4OF5A 4P5TD 3MRLA 3O81A 5GSRB 4Z77B 2DWDA 1CDIA 3EYOA 2VB5A 4XNXL 3LKQA 4JFFB 1NCNA 2WBJA 3QXWA 3SDAB 5AD0B 4Z7NF 4WWID 3RAJH 1U6AL 4PRHE 1KB5A 2W59A 3DXAD 1JWSA 4Q6IA 3D87B 1AXTH 4EUPB 5FDWA 1AGCB 1W0WA 4U6VH 5FM5O 3B43A 5C9JB 4FQ1H 1EGJA 3OKDB 5KG9B 4Z7UF 3MV9A 4HPYL 7FABH 1QQDA 3EO9H 5AZEL 3WXWH 1JZ6A 2ZJSH 4JG1L 1DBMH 3NH7L 3VXOA 3FFDB 1MWAA 3PGFH 5FGBA 3VCLB 1T1ZB 4NFCA 5JPNA 1S8DA 3ULUH 1FZOB 2R2HB 2J5LC 2F54D 3W5NA 4JRXD 4WWKB 1YPZF 4L8BB 2AJ3B 1DE4A 4GXUM 1YMMA 4IRSD 5JZ7D 4X6FA 4PGBA 2ZKHL 2VTFA 2A74B 4NC1E 1A6VL 1IGTB 4RIRA 4ZD3H 4O51A 2ICEA 1JK8A 3QIUA 1GCFA 3FCTB 4UTAL 4MXVF 3QA3A 4PJDE 1NCBL 2HT3C 2XNAA 4M93C 1MJJA 3ET9F 2QADD 1VB9A 4G8IA 5HHQB 2V5SA 2EICA 1KCRL 2XWJA 1J88A 3ZDZF 4K9EC 1IC4H 3DMMC 3ARBC 4OLYH 3HNVH 4BQCA 4TNWK 3PL6A 5CGTA 1DVFB 1DQDL 1C5CH 2IF7A 5KSBE 1EH9A 1C08A 4TULL 1U8MA 1J1OH 3R0NA 3ZHKA 3VXMA 4PB9L 3V0VA 4N0CC 1IM3A 2HWZH 4JRXE 5D7IE 3PUCA 2GTWA 3MRQA 2L4OA 4R4ND 2F5BH 2ADIB 3BD3A 1OAZL 3O2WH 2X09A 4X5WA 2EXYD 3IT8D 2IAMB 2YKLH 3CH1A 5DLMH 5H37H 4ZXBC 5DRXA 2W9EH 3QPXL 3HE7C 1MRDL 4ACPA 5JDJA 2X4QA 5EBWA 1RUMH 5H37G 5LGHH 5JW3L 4P2OB 5E24E 3IDYC 3BYYA 1CXLA 2VLJD 4LMQE 4QHKI 1KGCD 1YNKL 1J1PH 3BQUB 1NC2A 1NANI 1YEIL 1T22A 1NSNH 2ITDB 1N5AA 2ZCLL 1XGYL 3I9GL 2R0WL 4L9LA 5EC2A 4YR6A 5TDPB 5FGCE 2FR4B 5DR5L 4GXUN 1XF5B 4XCCH 5E0QA 5I1KL 1BQHA 3PWPA 1TPXB 1YMMB 4LLDA 4MA3A 4F58L 2OTWB 1WWBX 2DM7A 2D7TL 4ODWA 1B9ZA 2GSIB 3N85H 1A22B 1HKLL 1HN1A 3K4AA 3HPJA 4WO4C 3CK0L 3MXVH 2R2HA 1VFAB 1BGXH 3NN8B 1GPOL 4YWGL 5J13B 1OARL 5K9KB 2A38A 2K3TA 2A6KB 3MJ7B 4HC1A 3Q3GA 5DJ8B 3CSBA 4NWUL 2EDDA 5SWSD 5C0GA 1WEJL 3GB7A 3O0RL 4HIEB 4JM2C 3HC3L 5CBEB 2HLAA 1I7RA 3LEVL 4K3DH 3LPFA 5DDHA 1S7SA 4GH7B 3HZKA 4HKBB 5IW1A 3RDTC 1CGXA 1SEBB 3ROOB 1M71B 3FN0L 3ARBB 1EZVY 2YUZA 2C3HA 4OCXL 5SX4I 3SKMA 1JZ7A 1G84A 1I4FA 4IS6B 5TDOA 3WNOA 2OR9L 3DV4A 1E27B 3QQ9D 4L8SB 3D2UD 4JO1L 4YFLF 5EULV 2DWEB 4ZO7A 2XY2A 4KHXH 4ZPVA 5C0JA 5D1QD 4NHCH 4G42A 4NKOB 4NO2B 3U0PB 3H9ZA 4XPAH 3QEHB 5LGKA 3L3DA 2OS7A 5J9PA 1OTSD 2DLFL 2ZUQC 4N5ED 1MY7A 4M62L 5F7KC 5EZLB 1WAAA 2WWMD 4PP2B 3MLSH 2SEBB 2QQNH 4YO0B 3WHE1 1VGKA 2B1HL 3T3PE 5DJCB 4QTHA 3ZYJA 4GRLA 1SJHB 4Y8AA 3CMOL 3PIQB 5FO8A 2W9LA 4K3GA 4WTZA 4JJHA 4R0LB 3HMWL 5C0EB 4LLUB 1ZK9A 4GRWH 3S3JA 1DR9A 1B0WA 1IEBB 3OGCB 5GS0L 3QHFH 3BH8A 3DSFL 4J7RA 3KPSB 2D4DA 4HIJA 3SGDI 3WIHL 5GJSL 3OKEA 3S97C 4QXTB 1KTDB 1H3TA 2FH6A 5FGSA 1CDGA 3ULVC 4YPGB 2F58L 4YXLL 5E6ZA 3EYVA 3PP3H 1A0QH 3MUGB 1R3IL 5JNYA 1TMCB 3BPLB 4S0SD 1DBML 5IJVA 4I0CC 4KK5D 3WL9A 4BZYA 5HXMA 3RNKB 3VXUB 4D9RD 4L4JA 3B9KA 3WIIL 4UTAH 1RMFL 4J4PA 2DI9A 4YHIA 4M61A 4E41A 2PYEA 4JZJA 3U0TA 3U4EB 2Q8BH 1K6QL 5F9DC 4U3CA 4WHTA 3CVHH 3AY4C 2OXGA 4N0YH 2ILLA 3OTTA 3PJSA 4XGZB 2BVQA 3RX7A 5MENE 4A6YA 2OQJA 3V7AE 1OAQH 1XIWA 4JY4B 2AI0H 4OSUL 5C2BH 5GHWL 3J7HA 4IIQC 5DA0B 4GW1A 1RPQA 3OAUH 3FHAA 1EEYA 5C9KA 1TNMA 1Q38A 1T2JA 3BIKA 1ONQA 3P77B 1GOGA 1WCQA 1J9CT 3ULUC 4ERSL 4OZFH 4MNQB 4G8GB 4FFVC 1S7XB 1GGCL 1C16A 4Q6IC 3MJ9H 2AXHA 5C0BA 5KANI 4FQ1L 4FZ8L 2C26A 4QY8B 4H8WL 4TVPD 1WZ1L 2UV3A 3EGSB 4PLOB 4LKXB 4RQQA 3W2DL 4PJ5B 5GGQH 5DQ9A 2I5YL 3RUGB 4OB5L 5E8DL 1T2QH 1LHZA 1HYSC 4HK3N 4K07A 3SDXE 2NY4C 2AJSH 1H3PH 5L9DL 3JBG7 1U0QA 4CMHB 5DI8B 1Z0NA 4ZMAT 1KLFA 2WSKA 1JGVH 3HNTH 5I8EB 3RVTC 3QP3A 1A6TA 4E0RB 3FTGB 2HA1A 5B4MD 5D7JC 1GYAA 2PW2A 2AXJA 5KVDL 3RQ3A 1KEGL 1LEIA 3AB0B 5E94B 1GZPA 1DLHA 1YJDL 2NY2B 5CS7A 4W4NA 5T1LA 3RY6A 4BQ9A 1IGFH 4FABH 3FT2A 3RWGA 1G9ML 2X4UA 3ILQD 1D5XB 2OTUA 1XIWB 4Z7WE 4HKJB 2V2TB 2AXFB 2D9CA 3D85D 1L0QA 2BHUA 4WCYH 1DEEA 3A0OA 4QYOB 3C87A 5D1ZA 5J11B 4WHTB 4KKCC 1BZQK 2M2DA 3VGGA 2WLZA 3O6FA 1VACA 1WTLA 2AK4B 4HBCL 4Q6YA 3BMWA 1RZ8A 1KEML 3R1GL 1NC4A 5J89A 3V2AR 4B5EA 5DMYA 3C60C 1FFOB 3UPRA 3RNKA 1BIHA 3JSSA 5L2KD 1OLZA 4TRPL 5C07A 4XBEH 2Q76B 1DBBL 5JOPD 4NQSB 5GZOC 1HEZA 1N6QL 2AJXH 4BELD 1G9MH 5HYSB 4XVJL 2ADFL 1CVSC 1MRCL 3H7BB 4ODUA 5JXAH 2E7HA 3GMPA 3NCBB 5D1ZC 3C60B 1NDMA 2OJZH 3QIBC 1ZWIA 4P48A 2X44D 3D85A 1A14L 1WFUA 2NY0C 3QAZB 1XMWA 1KBGL 5C8JA 3FB8B 1I3GL 1Y6KR 2WUCL 1LDSA 3I50H 3ARBD 4YHZH 1K2DA 1J8HB 4YFLI 2OYPA 3TBSB 5KW9H 3BPOC 1MCPL 5IBUG 5ACLA 1EEQA 1KTLA 3QDJD 4UAOC 1GJIA 5HDQL 3RWHB 4PJ9A 4R9HA 2VDMH 1GGYA 1TPXC 1MF2L 4N8CH 3K4DA 3OKKB 2Q87A 5F8RC 3GMQA 3N0PB 2B4CL 3PP4L 3PWLB 4Z0BL 3VXUA 3L3OB 3BGFB 4YHLL 1CDYA 5EO9B 2X9WA 4N8PA 4ONGH 5MEND 3KR3L 4I18B 3ELAT 4DEPB 1E4XI 1F2XK 4EDWL 5EU5A 1D5ZA 1UWGH 4XXCC 5ERWB 4UUJB 3THML 2YPVL 3LKPB 4U6HA 3QDGE 5F9JB 2LTQC 5HJ3B 5FO7B 4PRNB 3S96A 1S7UB 1RULH 2IC2A 1WAAF 5E8OB 5EU6B 5JHDB 1PYWA 3CCHA 2JJTC 3M1BB 1XR8B 4L4TB 2EXWC 1BAFL 3D9AH 2HTKC 1VSCA 3BDBA 2V7NB 2NY1B 4WTXA 5BVJA 3RGVC 1FN4B 1KT2B 1NH6A 2XN9A 3QDGA 4OFKA 2ZOKB 2VDPH 4X7TB 5D7LA 4U1IA 5DD0H 5KJRL 1HXMB 5C0IB 1WC7B 3GRWL 1I7TA 1KC5L 3NACH 1I8IA 5EUOF 4IJ3C 2ZCKL 1G6RB 3E3QE 4GQ9H 5HHOA 3FN9A 1UENA 2FBJH 3VMNA 4MA8L 3C2AH 1Z9SA 1PSKH 1I7ZB 4Q58C 1DQML 2CO7B 3KLDA 4M7KL 4KK6D 3CDFA 4RMWA 5IHUL 3MODL 1MFNA 2OL3H 4S2SA 1TIUA 4S1SH 3HZMA 1LP9A 2VZUA 5LAXA 4N0CD 1T03H 5JOEA 1KCSL 5IBUB 1OGAE 3WFBL 4K94C 4JM2D 5AUMA 2Y6SC 2Q7NA 3HA0A 1OGAD 1A4KB 5HYIA 4AZ8A 4Q9CA 4QRSA 3MCKB 2FSEA 3PHSA 1LVEA 2IPUK 4LLWA 1G7LA 2BZDA 3C60A 1MCBA 4LRNH 3P73A 5E2TH 3ARDB 4J4PD 3F7YA 1TZGL 4RRPG 2GQHA 5B22A 3EIFA 1IGYA 3QZWA 4KK9C 3QO0A 1ZGLP 1LNUB 4N5UA 5K9QI 4WW2B 5GHWH 5HYSG 2FJGB 1AC0A 1Q9WB 5IFJB 1Y18B 2DN7A 4YFDB 1UH2A 1RU9L 1K8DA 4ODWB 3MLUH 4XPAL 4M7ZC 3D69A 4FQXC 3MBEA 4NNXA 4OQ1A 2F53E 3JTSB 1MCSA 2V5YA 1Q0XL 2XTJD 5FK9A 4NJ9L 4YR6B 5IEKA 3QUKA 2G5RA 2Q6WA 1C5BH 2XWBB 3ARFB 2QHRH 1OCWH 2X4OB 2CLVB 2YXFA 3CFIC 3WE6B 4WFFE 4JREB 2HKFH 3U82B 2EYSB 1MAKA 2ZG3A 1JGUH 4GRWB 1BJ1H 3T0EC 4LVNB 2YUXA 5DEFB 2Z8VC 5L88L 1FVCB 1KCVH 3U36A 1BJMA 5L7XH 1UYWL 1IZKA 1MJJB 5KVEL 2VLKA 3ARFC 1C12B 4LCCA 5FUCE 1J8KA 5E94A 5MEPA 1FGNL 4NCC1 1X7QA 1CQYA 1MFBL 4DVBB 2VQTA 2IPTL 2FECI 5GS0H 2YEZA 2W65A 3P30L 1CD8A 3HMWH 2D0GA 3N9GL 1FFRA 5FYKL 2ENYA 5C0BE 1FFPB 3T4AB 5ECJE 4FFWC 1QFWI 1OTTD 4EDXA 2E8ZA 1RD6A 5B21A 1EO7A 2P49B 4QHNB 3QQNA 3TWCL 4JCMA 4P9HC 1BD2A 4EI6B 1U3ZA 3WO3B 3LV3B 5FHAH 2P8PB 4YDIH 1CE6A 2XZCL 3WNNA 3UDWA 4KROB 1LMKA 2C9AA 4RGNC 4LPWA 3BIKB 4HJGA 3BD5A 5D7IF 2VAAB 3C2SA 4OD1L 4G80B 3EZ8A 3ZE1F 4Z0BH 1D9KB 3ARFA 4HK0A 2J12B 3UYOD 1F6FB 1F4YH 5I1CH 1YMME 1IKNA 4S2SB 5EA0L 3P0VH 2OMBA 4HH9A 3TO2B 3BN9C 2AV1A 3T3ME 5EUOB 1U8KB 5D2NC 3S5LB 5BS0B 1QPXA 3O0RH 3DUSA 5I8KL 1CFSB 3KYKH 2HT3D 1JTTA 3OKYA 5EPMB 4JZJC 2FJGA 2YRPA 4BQ6A 1BD2D 4S10A 5JQ6L 2ESVA 1LD9A 4GUPB 4PY7B 1Q9LA 2HG5B 3M8OH 4O00A 5KAQG 2CDFA 4OIIL 3F7YB 3RVTD 3QQ4B 4G6KL 3GMRA 1MHEA 4HMEA 3OXRA 2QBWA 1VKXB 5FA3A 5DHYA 4X6DE 3TBTA 1MHHA 4KPHH 4LF3B 2RCSL 4WIQA 4Q6IB 4JPIA 3M1BA 2B2XH 3SO3B 5B39B 2H3NB 3VFVB 2HTLD 3CSPA 3BN3B 2PKDA 4X9BA 1A5FL 3SDAA 3DYPA 3OR7A 1O0VA 1RZIA 1JHLH 4R97B 1YPZA 5I1GH 4JRXA 5D7IA 3BHBB 5TQ0H 4FTVA 4OQTL 3JWNC 3LD8C 4U6HB 4IRZH 3L5XH 1ZHNB 1B0GA 1ZAGA 1PLGH 2GUOA 1AXSA 5KSBB 3QIUD 5ANMA 5I16B 4PJIE 2NY1D 1FFNA 2NXYD 1AQDA 3DX7A 5SWZA 4ZUVA 2IADA 3HI6H 4LLVA 1BECA 5IFHH 3IJYB 3T08A 2XA8L 1F90L 1KIQB 5DGRA 2EIEA 4PJDB 1C5BL 5EUOA 5GRXG 4PJIA 5GGQL 4WI5A 1SY6L 3H3KA 3IS1X 1D5BB 1UACL 4WO4A 4HX1B 5J7CC 2NZ9D 3FOLA 1RUKL 4YBLC 3VG0L 4QRQA 3IDGA 5I6XB 2VLJB 3BHBA 1PYWB 4PJHF 4JFXB 3TF7C 2A9MH 4HK0B 1JGDB 1UH4A 3G6DL 3IFLL 4NNPH 3FKUS 3BQUD 4X6CA 1CZ8H 4KGLA 2VO5A 4NHUA 5J3HD 1TQCB 4J1UB 4Y2OA 1JV5A 3HTLX 3MV01 4ODXA 5E1AA 3C60D 3CFCH 4U1JA 5H35A 1OAQL 1I3VA 2Y7QB 4LGPB 2YUVA 3VDCA 1OPGL 3LV3A 1UM5L 2XT1B 1V5JA 4W70A 4P3CH 4F7EB 3EOTH 4JPVL 3L3JB 3WHXB 5HHNB 3ARDC 4O2EB 4OGAD 3KXFB 1J8HD 4K23H 4G6ML 2AEWA 4KKAD 3MV8E 1U8KA 2DYPD 3Q6FA 4CMMB 3UTOA 4N90E 4YDVB 4ENED 4JM4H 4KHTH 3DO3A 4CVXB 7CGTA 4G6AC 3OAYH 3I02B 1W72B 5F7EL 2YEZB 5CEXB 4GW4B 1R5VA 4MCYA 3MRBA 2PYEE 4GG6E 5CINH 3OAZH 1UWEH 5E8NB 3TJEH 4F33A 2VLKB 5EOCJ 2AJUH 1X6LA 4G7VL 5B3JF 4I13B 4E42B 3RWJB 3WLWC 4JKLA 1TFHA 5C08B 4S1RH 4RGMC 2IG2L 3QUMA 4PB0H 5F6HJ 1JHTB 4Y2DD 4UU9A 1X6NA 4FP8H 1IQWH 3N1PC 4TSAL 4DCQB 2ED8A 4ZXBA 5I8EA 4U1NA 3V4PL 5LKNA 1NAMB 4CBPA 1HI6A 1P1ZA 1CLYL 1EO8L 2AK4A 3TV3H 3GI8L 3MRQB 4D0DA 3K81A 3WMSA 1KB9J 3VXMD 1SHMA 5HHOD 3ZKSD 4S11A 4QCIA 5K59F 3RIAF 5HBBA 1WBZB 2CJUH 3FT3A 3TBYB 2D03H 4NN7B 2H8PB 3F7VA 3RWJA 4MNQA 5KS9E 3LS4L 4AQ1B 1IT9L 3O3BA 1KJ2B 4YHLH 4KQ3L 5D93C 4XPTL 4G8IB 4P4KB 1GZPB 5HGGS 1F2QA 2E7CA 5HHQA 2QQQA 1GC1H 3OGOE 1YEDB 4WJ5B 1OW0A 2VXTL 5INCA 4JDZB 1BQHG 1CLCA 1NCWL 1GGTA 2GY5A 1JNNH 2AEIT 5CEXA 4HSQA 4XP5H 1KPUA 3PJSB 4TVPE 3IAGC 4LNVA 4P5KB 4TVPL 4PGEA 5IEKB 3GSNL 3Q5OA 1ZOXA 4H20H 3ILPA 5EU6E 2IPTH 5IHZA 2B4CC 4HS6B 1A7NH 1CLZL 3QFDB 1SJEA 2ZCHH 3OKMA 4Z7OE 2W0KA 4PJ7A 1B3JA 1QLEH 4WU7A 5B3JE 5JLZA 3GKZA 3MLXH 3DIFB 4HC1H 2IBZX 5IFAH 2J8HA 5D8JL 4QO1A 5HHPA 5IM7B 1DVFC 2AQ1A 3IAPA 4JAMB 5IB3B 1OSZA 1HHHB 3IDXH 3TN0D 1IEAB 3KPMA 3MZTA 4XMPH 2MWCA 4J3UA 3DMMB 5GIRA 4KVNL 2E6PA 2IAND 4LLMA 3KWWA 3W82A 1JGDA 4M4PA 4NC2B 1OAXL 4L5FL 2JF1A 4E41D 1KB5B 5IB1A 4U33A 3WFCL 4PJXB 2VXUH 2XPGA 1P7QD 5EOTB 2BRRL 3TJHD 5FO7A 4U1GB 2GAZB 4M7JH 2D7MA 5K59E 2N1KA 4NZJA 5I71B 3VFUB 3SJVB 5I8CA 4PP2A 5DD3L 4I2XA 5FHBL 1K5NB 3ARTA 3BO8B 2WIIA 1PQZA 5I1JH 2CDEA 1E28A 1LDPH 2O5XL 1MPAH 2X4NB 4LSTH 4MNQE 2BNRD 3MCLH 5I16A 3NA9L 1T6WA 2VL5A 1L7TL 1EZVX 5C0BD 1K5NA 4X5LA 4JO3L 3U9PH 1IAIM 1S9WB 2XRAL 1OVZA 1D7FA 2BRQA 5GRVK 5CLWA 1JPGB 3RPKA 5FYLD 2DDQH 4OKDA 2VDKH 1MAML 1FJ1A 5IVNA 1PX4A 4CJ1A 1UC6A 3VMPA 3GEWB 3ROOA 1NUFA 3BH9A 3H3PL 3SE9H 4ONOA 3D85B 4XVUC 4YDLC 2XI9A 2IPUG 4AIZA 2WZPD 4O5LH 4WW1B 5C0GB 5C08E 1LO5A 5TH2A 4UUJA 3ZHLA 1F8TH 3V7AG 3QDMA 2V9RA 4HF5L 2W0LA 5CEZL 3L3GA 2AK4D 2C1PB 2P7TA 2ZKHH 5KSAB 1JJUA 3QEHA 4K3JL 4ZTOL 3O11A 4UBDC 4RA3A 3HPJB 3HUJE 5MENA 4JRYB 1GGBH 4FQIH 4IMLA 3RIAK 3GMQB 2NY0D 3TYFA 3SJVA 2EYTB 5I8CB 3KPSE 4P4RB 5HVFB 1BQHB 2K1MA 5HGAA 3TBSA 2PETA 3TGXA 4D94A 4LEXL 5T3ZD 5E2TL 4B7LA 1MIEH 1U42A 4QYOA 4IS6A 3RU8L 2JCCA 1CFQB 4Z9KB 2YK1H 5IMKA 4RISL 5IB1B 5HD8D 3VXRB 1T04A 4PBXA 3REWA 4CNIB 3FT2B 3RGHA 4H0IA 3CX5K 4HXBL 3DMMA 2X89D 1MJUL 4P4KA 1PG7W 3ARYA 2MMXA 1C5CL 3IFOA 4U4BA 5TE7L 1MCOL 2I9TB 3V4VH 3LD8B 4XWGL 4TUKH 3QDJB 1BOGB 3TH2T 1SM3H 2BSRB 2M8XA 3LSOB 4EN3A 3NN8A 2ADJB 5HHMB 4EDXB 4N8VA 5HDBF 1FFPA 5BO1L 4LPXA 3SY0B 1ES0A 1IM3B 3ULSA 2FWOB 4S1DC 2JB6B 2VJXA 4KKNA 3O4LD 5KS9A 1A6VH 4JGJA 1K4DB 5F7UA 5GSVB 1NAMA 1I7UB 2W65B 4JQIL 4EDWH 4OAWA 4PY8I 5FKAB 5KVGL 1KPUB 3PGDB 1CCZA 1I9IL 1EMTL 2AXFA 4R3SB 3TZVB 1YY9D 4XNXH 5JHDD 3INUH 3CLEH 4ZQKA 5FYJE 3TVMB 8FABB 4UILL 1YEDA 4O9HL 4WJ5A 1DN0A 4AT6B 3GSRA 3K2MC 4NM8L 3T04D 5EBWB 2EKJA 2P5EB 1CT8A 3UCRA 3JV5A 3R1GH 3I6GB 1DDHB 3QUZB 3DXAE 2ZJSL 4JG1H 2EEBA 3MJ9A 4JR9H 1FC2D 3I75A 2XKUA 2Q6WB 1TDQA 4Y88A 4JJ5A 5CZXD 3UZVB 3L5WB 4LPUA 5CMAA 4WW2F 1KJ3H 5MEOB 2GT9A 5ICYA 1QSFA 2VDML 1NGQL 4YHIB 2AERT 3U46B 4C57C 2CGRL 1C08B 1Z2KA 5E5UB 1FZOA 4FHBD 3UJIH 3LEVH 4K3DL 4H5SB 4LKXA 3SE4C 5IJVB 2EDBA 4QWWD 3OMZA 3BGMA 5H8DA 3ZHDA 1KN2H 2O61B 4PPTA 3MV9B 5DRNB 3L7EB 2DYPB 4DVRL 5T3ZE 4YPGA 2XICA 3CIQA 1KELH 4XX1E 4PV9B 1QYGL 5F88B 4QRSB 3MYJA 1V7MH 5BS0E 5FDYA 2GW5A 3OKNA 5TFSL 3BEVA 1JWSB 1KN4H 4ZFOA 2V7HA 1Z3GH 3ARDD 1LK2A 5GRZA 4CJ0A 1QFPA 4A6YB 5D2LA 2QLVB 5B38G 2YRZA 4GRMB 3G5ZB 3HE6D 4U2YA 5B39G 3W9DB 5I75B 5EN2A 3FOLB 4CVXA 4MA7L 3MLRH 2QJDA 4KQ3H 1FORL 3I84A 4DZBB 4Z77A 3U30B 5D2NB 3MMEB 4R4NC 3FQTA 1MCFA 2ITCA 2OM5A 3IXTB 2SEBA 3BWAB 4Y19D 3TYGL 4OUUB 3IYLW 4F7TB 1IKNC 4K9EH 1NFDF 3CDYA 1CDJA 1TJGL 2VLMD 3LKOB 5F3HB 4PGZA 1GL4B 1MRDH 4K7PL 4NKQB 3ARFD 3SDCA 1OGTB 1FFNB 4HIXL 2BHZA 1FG9C 3OKDA 3KNBB 3B83A 5IWLC 1GZQB 5TDNB 5FOBA 3UPAA 2MTPA 5L88H 2VLRB 1OAZH 3O2WL 3CFKA 4Z7OF 1CLOL 5JXEA 2V7NA 1FAIH 4X9HA 1BBJB 4FNLL 4GG6F 4RAVA 4I77L 4L3EE 5MP6H 4BYHA 1P4BH 3V6FA 1MCWW 4GLRI 2CKBH 3DLQR 1T89A 5DJYA 3V5HA 3EO0A 2QADC 5JW4R 4IOSD 2DLGA 3O2DH 2F5AL 3H42H 3HZKB 3CLFH 5HYEA 1S9XB 1SJHA 3CFKB 3IJHB 2UWEE 1IAIL 5K9OA 1Q94A 2AJZB 2Y1VA 5C09D 2FDBP 2BX5A 3P3YA 3N1QC 5D7LD 1X4XA 1J0IA 2OCFD 3TO4A 1ZA3B 3RGVA 4PGCA 1HNGA 1XR9A 5HY9A 1WZLA 4WUUD 1G9NL 2O5ZH 1H9VA 4KRPB 4OZIA 5GGRY 3Q6GL 3FQTB 4PP1D 3RDTD 5EFIB 3DNKA 1NEZG 2FX8L 1T5WA 2V9QA 2BOBB 4HIIB 5A1AA 5D1QA 1KIRA 4ERSH 4F7PA 1IC5H 3LOWA 4JRXB 4L9LB 3MGOA 3FB8A 5D7IB 5EC2B 1RQ5A 1N0XH 5D2LB 4JFFE 3ZKND 3F7QA 1FZMA 4BQ8A 5GGTA 3X3FL 5IW6B 4MSWB 4CADB 1TCMA 3QZWG 4R4BA 3B5GA 3MODH 3TN0A 4ZYKA 1S7SB 2OMNA 5DK2A 3QUXB 1FE8L 3QIWA 5F88A 2DTMH 3V4PH 5HYSA 1MHEB 5CKAA 3MRKA 4JQXC 5DURD 3BGMB 2QHRL 3QUYD 4JHAH 4J3WA 1P4LA 2FBOJ 4MVBC 3T1WA 4P2YA 3BXNA 3HFMH 4AG4L 4YHKL 5I19H 1N3NA 2OL3B 3RZCD 2NY4B 1P7QB 4M1DH 3X14A 1IVLA 4KVCL 1FSKB 1XF3B 3GMMA 3QDME 4TQEL 3O6FB 1MJ8H 3FONA 4UT6L 4OF3A 1NL0L 1ACYL 5H94B 4D9RE 3GBLA 3Q1SL 4P57A 1FLRL 2BC4B 3MLVH 5DVKA 3U4BL 3WS6C 1FNSL 3MA9H 1GAFH 3SKJL 1O7VA 4NKIH 2YOCA 3KS0H 1S7RA 5T3XD 5HPMA 1AI1H 4Q2ZA 4KK5C 5CD5C 2R29H 8FABA 4KK8C 1MSPA 4LFHD 4M7LT 2F19H 3QIUB 1X5JA 5I76A 2NXYB 3DPBA 3O45A 2RB8A 4L4TE 4S1SL 2XXCB 2VXVH 4PRHB 4LU5H 3VFGH 3S3PA 1ZHLB 4XP6H 3ULSB 3K3QA 1BD2E 4PREA 2VISB 1MJ7H 2GTWB 1DEDA 3HG1E 3F12B 4EIGB 1WCBB 2EH8L 5IMMA 2NQCA 4Y2DA 5J8OA 5TE4L 4AMKL 1R0AL 1U8NA 3ZYOA 4N8VB 3F6IA 5KSAD 4QY8A 2HFFB 2BJMH 3LKSB 4NFDA 2JELH 3LN9A 1KN2L 2F54A 4QOKD 5JMOC 2AVGA 2R0LH 2RIKA 3H9SB 2A6JA 4LDEB 3VD4A 4Z8FH 4NDMA 1ZLWK 1T2XA 2LU4A 2XOTA 1A7NL 1CLZH 2ICWJ 3DBXA 3PP3K 2DI8A 5FYJD 2YA1A 4CADA 2YBRA 1HHIB 3ULVD 2EDFA 4PRID 3DROB 3AAZB 1R0AH 4WEBL 2E5EA 2APWA 2NY7H 3OAYK 5IF0B 4P5MA 2OJEA 1NMAH 4R2GB 1S9KC 1OAKL 4HFUH 1MI5A 4GSDL 4I4WA 1FAKT 3RI5K 3KLAA 3B9KB 4JRYA 4LBEA 5F9OH 5DWUH 2UYLB 4LARL 4KC3B 5LQBH 4QTIH 3O4OB 1DQJA 1RHFA 3MRHA 2DQJH 1XGYH 2IMNA 1EVUA 1XGUA 1MI5E 1NGPH 3GSWB 2ENSA 4WENB 2CH8A 4DAGH 1FVDA 4YZFF 5BVJB 3BJ91 2NY6D 2IFFH 4U7SA 1YEFH 4DKDC 5D2LF 4NIKB 1FNEA 5ANME 2XA3A 1DUZB 3VXQA 1NGWB 5L2KA 5LGJB 1Q72L 1U92B 3SE8H 2CUHA 4S1DD 1RURH 5T33L 1UA6L 1G7MA 3VFTA 3D0VA 1E6OL 3PG2A 2FCBA 1HIMH 4LLQB 1W2KT 1U3HD 4I9WD 1OF2B 2WANA 2F54E 4OD1H 4UZGA 5GZOD 2HJLA 3B5TA 1P84J 5EO9A 2CIIA 3UPCA 5HHOB 1CYGA 4WVRA 3MBXL 3QWQB 5C09B 4K71B 5E6YA 3ZDXE 1RZFH 5D7LB 5I18L 1BF8A 4PBWD 2XN9B 3V6OE 1G7PA 4C4KO 1QA9B 4KRPD 5ELIA 3QH3A 5BZDB 2Z8RA 1ZSDA 1UWXK 4N9GB 3T4YB 1M1SA 2A1WL 4JKPL 1KACB 4KUZL 3FOMB 4UQ2B 3L9RA 4CVZA 1RJZB 2VE6A 1EJOL 3HCVB 4HJJH 2CD0A 4LRIA 3MBXH 2G75B 4ZSOE 1DBJL 3GMPB 2FO4B 2VUOA 5C0FB 1CGSL 1V7NL 5ERWA 2DQUH 1I9EA 12E8L 3MV8A 4Y4FC 3G9AB 3K2UL 1RZKH 2R2EA 4KMTH 1FL5A 5IGXL 1A7RH 3TNMB 1GOFA 5D5ME 2M26A 3ZZ1A 1K3IA 3GZKA 1UYWH 4PJEE 2UZYB 3SKOA 4MNQD 4W4OC 5E5MA 2CLRA 5CZKA 2G2RB 4LSRH 5GRVL 1TTUA 1MJUH 1DQMH 2E27L 5TDPA 5INDB 5HYQA 1N5AB 1AO7D 1U8JB 4FQQA 1T7ZA 3W2DH 1XGTB 3UDWC 5HYJD 1MUJA 3HE6C 3C8KB 5MEOA 5C0CB 3X12A 4FG6C 3NABH 5HGDA 1RVFH 1OP5H 2X10A 3D3VB 1L0YA 5HDLA 3LEXA 4ZS7L 4FXKA 5IFHL 1MCWM 2FIKA 5LXGL 2IANE 4ODUB 3O3BB 5B8CB 3BD4A 4O4YH 1Y0LB 2O93L 1Y6NR 4WFED 1G6RL 2GJZA 3U0WL 5I1AA 1HYRC 1EXUB 3BPOB 3OJDB 3PDOA 4F15C 2Q76A 1CE1H 3GIVB 4MLSA 2DL2A 4QCIB 4AT6A 4QT5B 4ZNCD 3SDDC 1PVHA 4PGJA 4R8WL 2J2ZA 1TTFA 2J6EA 4KI1A 3UTSD 3WIFA 3ME0A 3PWJA 4X4XA 1OP3H 1UM4H 5F7DA 1XGTA 4NT6B 1CXHA 3FQWB 5KSVA 4X83A 4F15B 3EJYC 1TQBB 5IMLB 1EHLH 3PL6C 1WT5C 1DEEB 5DUMH 1XGQA 5F8QC 1JP5A 3SY0A 1Z0MA 3QEUA 1MAJA 1URLA 1JHTA 1EFXD 1FDLH 3SKOB 5ESQB 1P2CA 3SE8L 2LVCA 1OB1B 3QNYB 4AEHL 1S7XA 3QI9A 1ETZA 2JK5A 4GMTL 1ITBB 1AD9A 4QOKB 3BXNB 2R2EB 1N59B 5DO2C 1OM3H 3U6RA 4M43H 4KTDL 4EVNA 3QNXB 5IVZB 1VFMA 5IHBA 1TVBA 3MFFB 4HCRA 4G43B 5I8KH 1IJ9A 3IFOB 1FL6B 5DJZB 3S35H 1EHAA 5EU4B 1JRHI 2MKWA 3AREC 5F1OB 4GMTH 1A9BA 2VDLL 4XPFH 3D3VA 1ZVSB 2GTZA 2NTFA 3QUXD 1QBBA 4LHJB 4NRZB 2FHFA 2ESVD 1RHHB 1VDGA 4WWKA 3GMNB 1U8JA 2AS5M 5INDA 4N0UA 4HWEL 1ZS8B 4MAYB 5DWUL 3T1FA 3EO1B 1YEEH 5AWNH 3VI4E 1GHFH 1AY1L 1RIHL 2AXGB 5KZCB 1WBXB 3D3VE 4XMKL 4LSPH 5CUSL 5E5MB 2Y07H 4HXAL 2NY4D 1UQSA 2MNUA 3ESVF 1V3MA 3KYMB 3QXUA 1IQDA 2J88L 3CAFA 1MQKH 3NIGF 1UXSB 4XNQA 2A6IA 1AY1H 1RIHH 3ARUA 3MRGA 4EXPX 5GS1C 1C1EH 4O9HH 4HC1L 5JO5B 4JFXA 4PJBE 1EBPA 3Q48A 2R4RH 5DS8B 2Z92A 5GGSA 5JA9A 1P9MA 4YEFA 4KDVA 4L8DA 4FQLL 2CRZA 3PQYB 2X6MA 3G04A 2V17L 3HPLA 1N64H 2JIXB 2AABL 5JR1H 2AKRA 2PTVA 2BY0A 5EZLA 3SPVB 1PZUB 2BSTB 4NN6C 3V8OA 4HDIA 5CP7B 4OI9A 1SVCP 3V5DA 3DYMA 3DX9B 1U3HA 1P4IH 4LAJH 1AGDA 4XP5L 1XGUB 3IETA 2E7BA 4L4VE 2CGRH 3U0PA 4PG9B 5HYJA 1A6PA 1LQSR 1U8QB 3ARQA 3MOBH 1ZHNA 2HRLA 3TFKD 3X3FH 1NLBL 1FZKB 1T21A 1TVHB 5ICZA 4P3DA 4PR5A 1E27A 3EO1A 3SPVA 1AXIB 1B2WH 1CK0L 1A7OL 1ZS8A 1RZKL 3BWAA 3WD5L 1UZ6E 4EZMA 4BH7A 4I3SL 2EDHA 4BK4A 2VDQH 4OCRL 3C9NB 3T65A 4HJJL 4MNHA 1H0DA 2Z9TA 5AZ2H 4RGOH 5IVXA 4X0KB 4WGVB 3RVVD 1N4XH 3AROA 4XPGH 4AEFA 3GSXA 3EYQD 1VADA 1AGFA 4NO0B 4DFIA 1BX2B 5C70A 4WI6A 1I9IH 1JGLH 5EIIA 3OJ2C 5HDBE 3PGCB 3RTQC 4Y4HB 4PJFE 5BJTA 1CICB 2OZ4A 5ESQA 4NKOA 4NO2A 1K6QH 1HSAA 4RFEB 3OSKA 5DC4B 3S5LA 4PJ7F 1A2YB 3ECBB 4WI4A 4ZPTB 3MV9D 5TE6H 4AG4H 1A3QA 4GG8A 5E9DE 1RUKH 3VG0H 2AQ2A 3DO7B 3SDAC 3RKPA 2QV2A 4ODHL 2JJVA 4H1LG 3T0WA 5J1TC 4MS8C 2R8SL 4PJFA 3AAZA 4P5KA 2XTJB 4JQVC 1F42A 1LILA 2F58H 4XB8A 5FUZH 2RFXB 3B9AA 2EIBA 4JJ5B 2X05A 4JFDE 2FL5A 1BZ9A 1BLNA 1XH3B 4U7MA 3GB7B 2APXA 3DVFA 1OAUH 1BFOA 1OY3B 3T77B 4GKSB 2BVOB 3KS0J 2IFFL 5DTFA 3SOBH 3WBDA 3VWKC 4M4RA 1V7NH 1GGIH 1JRHL 1YN7A 4TUJA 4YK4B 5DQDL 2ADIA 1JUFA 1F3JB 5IROC 4LSQL 3KG5A 5D1ZD 4FXKB 4RBPK 2EC9T 1I1AD 3WFBH 3L7FB 2DJ4A 1ERNA 5HGHB 4KI5E 4W81A 1A6WH 3BKJL 2KQNA 2V5MA 3DX6B 1MUJB 1E4XH 1XGQB 5C6WH 1OT1A 5C1MB 2VLRD 5J13C 5SX5K 3MLWL 3MUJA 2VXUL 2JB5L 3LEYL 4OCRH 4GAYB 3IXAA 5EWIH 5J3HC 3ARGA 2DMCA 3KJ6H 1OAXH 3GSUA 5SX4H 5CEZH 1NMCB 2ZUUA 3WD5H 1FCCA 4ODTL 4WFGD 5H2BA 1AXTL 3OBAA 4P2OA 5DTFB 3R8BB 1U3HC 3KYKL 1T0PB 4IDJL 3KGRA 3BZFA 1EXUA 3DHJA 4P46A 3EFDL 5DZOA 5IB5B 2EE9A 1A6AB 1I1YA 2OZ4L 3IFNL 2G60H 3ZE2F 5EOQL 3MNZB 3GBML 5J06A 4HUVA 2IANA 4LPVA 3QEGL 4KROD 5CJ5A 4P57B 1DP0A 1CG9A 1T1YB 4R7NB 4J4PC 1HK6A 5E2JA 2IQ9L 3GHEH 4MD4B 3QHFL 3KJ6L 3LRSB 3QIBA 4R7DA 3HS0B 4NFBA 1Y18A 3UXFA 2FEDD 3DETC 1YQ2A 4DUVA 3L1OL 2VZTA 3QWOB 4ESKA 4Y16A 4O2EA 2CLRB 1KJMB 5I2IB 1A7QH 5DA4A 4MZ2A 3OX8B 1LO3H 1T7XA 2D31B 4FG6D 3DVIA 3QEQD 5GPRA 1AGCA 1W0WB 1FL5B 2I60H 3QCTH 1KB9K 1NMAL 3QHTC 3QDMB 2W91A 3VRIA 1S9XA 1TENA 3IJHA 1YJDH 2J3SA 4EI5D 1WICA 3IDUA 4Y5YA 2A77L 1J12A 3CFEA 4M1CC 4BSWB 3IRPX 1RUAH 2BSED 5DYOB 3RZCB 2XYCA 3L9RB 3VXSB 5DJ0A 2EKSB 2Z31C 3O6FC 4KXZI 1X5FA 4QRQB 4L8BA 4EOWL 1INEH 2XZQH 3RY6C 2X7LA 4XAKD 5EFIA 1QP1A 3AS3A 3K0WA 2C1OB 1ZA6A 4YLQT 1U8QA 1S8DB 1P5VA 3ORJA 4QRRE 4YGVB 3CSYB 1G6RA 3RA7L 3NZHH 3UTPD 4CU6A 5DVMA 1JPSL 5DUBA 2AV7A 3OV6A 4ODTH 5E7FA 3VGDA 1R5IB 4H8WH 3DX7B 4KK9D 4P9HL 5EO0B 4TNVF 1HSBA 2DL9A 3S7GA 1RUPL 4ALAH 4RZCB 4E5XB 3JWDH 4IJ3B 2CKBA 1N7ML 4I4WB 4MWFA 4LSRL 4NUGL 3RWCA 3D0VB 2DKSA 5ADPH 3RZCA 3EOAA 4L4TD 4HW6A 2Q8AH 3G5ZA 3KPTA 2HLFC 4PJDF 3GDBA 3V6ZB 3OL2A 1DUZA 3ARWA 4RGOL 4KHTL 5FGRA 4I0PB 2EZ0D 2H3NA 4NZRL 4OZIE 3ZSTA 2DQGH 1GOHA 4P2RE 4AENB 2CQVA 2CKBB 2Y5TA 1DSFL 1ORQA 3MYJB 1KB5L 1B4JL 4KDTC 1MIMH 5L2JA 1GIGH 2A6JB 3OXRB 1IQDB 4EKXA 3VH8B 4L8CA 1CXKA 1G6VK 3FO1B 3L3OA 3GMRB 2NY5C 3CMGA 3BSZL 5FCUH 1NCDL 2X5PA 2NY5L 4NP4H 3MLVL 3RBSA 5ISZB 3LKSA 4PY7A 2DQIH 5FUZL 4NRYA 5I66B 5E6IA 2ESVB 5CAYB 4LMQI 2VERN 2ZG1A 2G5BA 4G7YH 4WU7B 1JGUL 4K7PX 1MAMH 3H9SD 1ZVHA 5ICYB 3S37H 1U8IB 4DKFL 2XKNA 4ODHH 5A16A 5JPMB 3OJVC 1E4JA 5KZCD 4W4OA 4UNVA 4HS8H 3DVGA 3MOQA 1J05A 3TJHC 2VSDA 3NFNA 4FQJH 3GGWB 2W0PA 5EN2B 3CFEB 5GJSH 1CDUA 4UIMA 3DGCR 2YN5A 3WFHB 1RIUH 2X1XR 4RAUA 4PRIB 4JKMA 2VAAA 5HI3D 3SGJC 1OAYL 5JUEH 2ZUVA 1BPVA 2PO6C 2XA8H 2Z93B 4R2GD 3MOAL 2JK5B 1UM6H 1ZT7A 1QSZA 1I75A 3B9KD 3HB3C 3O9WB 2PXYC 4HGWA 4PYHA 4ZAKD 5EZJB 3ETBF 1LO0H 3NIFF 3P0GB 4NQDE 2XZQL 4C55A 3BRDA 5ID0A 5KVMC 2QSTA 3Q2CA 3QEUB 2H9GB 3BP5B 3MREA 1AKJD 1RZJH 2UY6A 3U46A 5D1ZB 3C5JB 3DWTA 4Z7QF 1IZJA 4HULB 4CU7A 3DUUB 2JB6A 4UMGA 1YEKL 2R9HC 4OCSL 2PTUA 3T4AA 3IF1B 4PJFF 4RMVA 25C8L 5D71H 2X4TB 5EUKB 4G8FB 1GSMA 1INQA 1YYLL 1CG9B 1T1YA 3CSGA 1E6JL 1HINL 2PR4L 4XHJC 3SE9L 4Y5VC 1NFIB 1RZGB 2A1WH 3VRJA 4DCQA 5KOMC 4MNGE 4A2LA 2A6DA 4NN5B 1ZT1A 5E00A 3QUMB 2YR3A 1CT8B 4V1DE 1QPPA 2YA0A 3QXAA 4MXQC 3LQAH 1NCAL 3VW3H 1OQOA 4D9QD 4G8EB 1PY9A 1A9EB 4R3SA 5EZIL 1OM3L 1QKZL 3NCFB 1T4KA 1U93B 3DXAB 3RFZC 3UAJD 3LPWA 4GW4A 5GGVH 3UO1L 3HI5L 4QNPE 4S0TD 1P5UA 1MRFL 3RWDA 1WIOA 2MCPL 1PJ9A 4BKLA 4HBQA 4RDQF 5E03A 1YEGL 3RL1A 5DSCA 1C1EL 3O6ML 4KKAC 3E6HB 3T0EB 1WF5A 3GSQB 3W39A 3CVHA 5MEQA 4P5TC 1YYML 2JE8A 3KDMA 4MS8D 3ZO0A 3BIAX 1CIDA 2NXZD 4IMKA 1Q94B 4LRIC 1PDKA 1A6ZA 3EAKA 1XH3A 4XC1L 4XRCB 2CLZB 4Y4HC 1HKFA 4HG4J 2WP3T 4PRDB 2OLDA 1TZHB 2VXQL 5FO9A 4AEIH 2YWYA 3TPUA 4E41B 4PJCA 4OJFH 4HUXA 2QR0A 1JF1B 2Y5EA 4F7PB 3KYNA 5IT2L 6FABL 1TVHA 1D5MB 1BBJA 2MKLC 1QSFD 2C3XA 1RJYA 4NSKB 4RAHA 2IH1A 5HYJB 1R24B 3TT1L 1FH5L 5GRWA 4HV8B 2X70B 3D3VD 1NC2D 3V5DB 3S88L 5C2UB 1JYNA 3CX5J 1CN4A 3O41A 3KPLB 4AEIL 1JMXA 1Q9OA 1D6VL 3V52H 2AJSL 1M7DB 2VYRE 3EHBD 4MNHB 4YZFE 5JQHC 2HRPL 3BUYA 4FZ8H 4I1NB 4G9FA 2BMKA 1KCUH 4JPVH 3OF6D 3FQXB 3VXTA 5EZOL 2WW8A 3WO4C 3B2UD 3M45A 3MRGB 4MJIE 2H45A 4LF3A 5I75C 5J9PB 4UV4H 4DGYL 3TBTB 4BA8A 4RWHA 2EIDA 4U1LB 3K8LA 4P2QB 4X6CF 1CIUA 3LN5A 3MRHB 3X13A 1T3FA 1QRNE 1HINH 3CLEL 3WLWD 2O61A 1M7XA 1QRKA 2CO6B 4OLUH 1JBJA 3SGEH 2YZ8A 1H8SA 2YD9A 3WXWL 4GKZB 1OAYH 1UEMA 3KYNB 5JUEL 1MI5B 1TCRB 4NKIL 5GGTL 5FYJL 1ODAA 2Q8BL 3N50A 3GMNA 3QEQE 2YA2A 3VFUA 4KAQH 2AV1B 2GAZA 3O2VH 4FQHA 1IFHH 3GNMH 5BO1H 1W8NA 2YSSA 4J8RA 1A9BB 3S4SB 2Z0BA 4U05A 4EUPH 5DJ6A 4Z95L 1RZKC 4V2BA 4YXLH 2HT2D 5T1DH 4NZUL 5DD5H 2V7HB 3SJVE 4XBPB 1JYVA 2DRUA 1T80A 3QUZA 4Y19E 1RJLB 4HS3A 2I5YH 3T2NL 5K9KA 3QT2A 5C92A 1ETZB 3C2AL 3MSPA 3AMLA 3P9MB 3SE3A 4NQSA 4KAQL 3BISA 1ADQA 1GIGL 2X4SA 2E9JA 5ALCL 1TLKA 3VXSD 1W0YT 2FX8H 2EC8A 5D5MF 3MXWH 5I17A 2J7LA 2Q7YA 3MLUL 4E9LA 2PYFB 2O5ZL 3QYCA 2M1KA 1FC1A 3OJMB 3KPRE 3DRQB 1DQQB 2A9NL 1YDPA 3PHQA 2AI0L 4OSUH 3RWEA 4KJYB 4O2FA 1OD9A 1FBIL 3GIZL 4LDLB 4MCZA 3WLBB 4ZFGH 4FQIL 5I9QB 4JANA 5EBMA 1TJHL 2X1WL 3BKCH 4BJLA 5EU4A 2ADJA 5DUPH 2A9ML 2X4UB 3OKLA 2VDQL 3HG1B 2NNAB 4BZ1H 3BT2L 1BOGA 1CVRA 4C56A 1JF6A 3U6RB 4XCFL 4QOKA 1EHNA 2LV4A 3F7PC 4RGNE 4X80H 4XC3L 3UYRH 5I73C 4JFED 1VGEH 2HKHH 4PRPA 4RMQA 2WWKT 1JWUA 2AK1H 1BVKB 2R0KH 5EA0H 1LP9F 1R5VB 1G7IB 1OT2A 4U0RC 5EC1A 2IALA 3SGKC 3ZT5A 3AREB 3VXMB 3O3EA 1I7UA 2NX5B 1F11B 1ND0A 5I73B 3TLRA 1MFAL 5K9JH 1WIUA 2YPLD 5GGSY 5F7DB 4P4RA 3WUWA 1OWRM 1S9VB 5EOCL 3RRQA 1T1XA 3RVUC 2F8XC 4PJAB 3TYGH 5I1LA 1NGZA 1L4IA 3BW9B 3STLA 5ISZD 4QT5A 4Q0XL 3LY6A 2BSRA 3UTTD 1QRNA 4MVBD 4Z7QE 4MLIA 1WBYA 1AO7E 4O02H 5E1AB 4F3FA 1JNHA 2GKIA 4GAJH 32C2B 4PRIA 4LIQH 4R0LC 1QVOB 4K94L 4XC1H 2ARJA 4NO0D 5CGYC 3FZUD 4UOW0 2W92A 4GS7B 3WFEL 3UROR 5DJ6B 3MRPA 1KEMH 5T1MB 1QYGH 3TCLB 4HBCH 2PXYD 5I0DA 1A47A 4U31A 1U8IA 5T5FH 4GKOA 4I0PC 1U8OA 4WO4B 4XAWL 2XZZA 1LP9B 4YDVA 3NCYP 2JJSA 4OGXH 2YPLE 4MB4A 2QQKL 2PYEB 2W60A 5ISZA 5B38A 3VFWB 3VFRB 3GO1L 4UT6H 3L3JA 1FNFA 2IADB 4KTEH 2DQFA 1ZLUH 5CD5D 1H5BB 3REVA 4QRPA 2XQBL 1QBMH 3O6LL 4TPRH 1I7TB 1YEHL 1F4WH 4U1LA 4PB0L 3MV8B 3MA7B 1LO5B 3IDYB 1I3GH 2ZUYA 3ULUE 2ZZUT 1QLFA 4MJ6B 4KTDH 5DJDB 4UT7H 3CK0H 3MXVL 3GSNH 3OR7B 5BVPH 1TITA 4XP6L 4XP4L 2QSVA 4CVWA 1LO2L 1KG0B 2UWEB 4LCYA 4MWFB 2XTLA 2VR4A 1K85A 1FV1A 3LKNB 1KPRA 1JI2A 1MFDH 5FUOH 1OWWA 3X3GH 3U7WH 5FA3B 4WFGE 2NW2A 5FGBC 1QFWH 1YNLH 5HI3C 3D1MC 4X7DC 2J8OA 3ZE1E 2RHEA 2DQUL 5CSBA 3VMOA 3WO4B 1YNKH 1Q9LB 5FKPB 1CD9B 1XIWC 1DLFH 4K8RC 3OWEA 4Q7DA 3FQRA 2JB5H 3LEYH 5JW3H 4WWKC 4U2ZA 5FB8A 3FMGL 1CD1A 4PY8J 2P48B 1KCSH 3DUSB 3JTTB 5B4MC 4NSKA 4Y4FA 3OB0K 1LO0L 3JV6A 4JCLA 1WITA 1F58L 4TOYL 5DHVB 3S9DB 3DV4B 1MI5D 1EO8H 3DROA 2EE6A 1MFCL 2EIZB 4PJCB 3UAJC 1RZIB 2CMRH 2OI9B 1P7HL 4XVTL 4HJ0D 5T1KB 5BXFB 1EAPB 3CVHL 1NEZA 1EK3A 3C6SB 4OZFB 2VDNL 5CCKH 4MJ4A 1RVFL 3S8WA 1JWMA 4I2XE 2D7NA 1SY6H 5HTSA 5KOVC 4KI5C 4X98A 2BXYA 1IBGH 3VWJB 4I48A 4LOUD 2NY0B 4P46D 4GKNB 4F37F 3MGTB 4DKFH 2ICWB 5DVOA 5JMRA 3QUYB 3VJ6A 2DDQL 4EI5C 4G5ZH 2H32B 1N4XL 5D93B 4GT7A 3H9HA 4N90D 1WWAX 4ZO9A 1IGML 3CVHB 4TSBL 3I85A 1NGXA 1MHCA 4RGMB 5F72S 5IK3A 3OKMB 4Y16D 3MV9E 2VIRB 4D0DB 3O6FD 3MV7E 5E8EB 3PWPB 1T0NB 1IAMA 4TN9A 4JO4H 4P3CL 4U1NB 1YUHB 1T20A 4NZRH 2XFXA 1NC2B 1PG7H 3EUUA 1CR9H 1ZVYA 1IL1A 1D5XA 2WQRA 4P23D 3RWGB 5C08A 4YBQC 2YD8A 4TSCH 4TVSa 3GK8L 3AS0A 3HG1D 3U9UB 2ED9A 2R0ZL 2BDNL 2ZG2A 4F9LA 1DLHB 1MCKA 3DV6A 5E8NA 5CSGA 5CWSB 4C54A 1KJ2L 2EH7H 3TBYA 2VR5A 1ED3A 4OIIH 1WBZA 2NY7L 5JW4N 1ZLSL 4P9HH 2L7JA 2P5EE 3D25A 4CUCA 3ZKQD 1D6EB 3BP6B 4N1CA 2C3GA 3NACL 5L8KB 1A1OA 1UACH 1CFNB 3BUTA 4NC0B 4P99A 3C5ZB 2DMKA 5IK3B 4RMRA 3BIBX 4P59H 1XF3A 2P8LB 4MQSB 4XNYL 4YDJB 5HHNA 1BFVH 3BFOA 1UA6H 4OIAA 4Y4KD 4OCWL 1F58H 4RCAA 1FP5A 1IAKA 1UZ8A 4OT1H 3EGSA 1EGJL 4CMHC 5FXCH 4R26L 1NUDA 5IB2A 1J7VR 1J11A 3U9UA 3OAZK 4RSVA 1XCQB 2VN7A 4JFYB 2J88H 1PLGL 3G5XA 2DLHA 3HE6A 4LKCA 3QUXA 2D7PA 4MX7A 1N6VA 1F45A 5T3ZL 4ZFFB 4N0FA 2HTKD 2EDTA 1S7TB 1NGPL 3QCTL 5BXFA 1XF1A 1IGTA 4RIRB 4ZO8A 4PGDB 2OQJB 3QUYC 1WQVT 1GC1L 4OFYD 5DD3H 4NWTH 4O58L 4RDQG 4YHPA 5JW4Q 1RV6X 1ORSB 1S5IL 4GRWE 4GMSH 4Y4FB 3BQUC 4ETYA 2R29L 1YNTB 4D0BB 4LVEA 5F7HA 5GRJL 1NFDE 4KK6C 4LSDA 4UINH 5FF6A 2NR6D 3VWKA 3QUZC 3QZWB 1C7TA 3WL9B 3EJZC 2D3VA 3VWJA 4H20L 2BNUB 1QQDB 2Y7QA 5JHLL 1G9EA 1JGEA 3CPLB 5KG9A 2NW2B 3TVMC 4JRYE 4ISVB 5DLML 3QIWB 4GBXB 4U1KA 5D1XB 5T5NF 2D2OA 3WJJA 1F4YL 1SYSB 1IGCH 1QLRA 4OGAC 3MYZA 3UYPA 1A1NB 5GGVL 4XBEL 1FZMB 2V2XB 5TF0A 4R4FH 4FS0A 1M05A 4IRJA 2CPCA 5GGUA 2D9QB 1QKZH 3CGTA 2X4RA 2KH2B 4X6DA 4PJGE 4LVHB 3T8XB 3B2VL 1T66D 2IMMA 4ETQB 1I8MB 3A6BH 1ZLSH 4F9PC 5FOBB 3H0TA 4JFEB 2EDRA 2B0SH 4YO0A 3BZEA 4G3YL 1FNLA 3WFEH 5FB8B 2DLTA 4PJGB 1MHPH 4QRPB 3FQRB 3WJJC 2YC1A 5D6CA 2R69H 4GS7C 1IC4L 4PGCB 3SDDB 3Q0HA 4HD9A 4FFYH 1SYVA 4Q9RH 2ORBH 2YN3A 3L3DB 1CFTA 1SJXA 1E6JH 2NY5H 2ITCB 3IXTA 3H0TB 4BSJA 4M6NH 1UM6L 1KT2A 1G0YR 2Z8WC 2DWEA 4ZPVB 3MRFA 4P23A 5EO1A 3LH2H 2NY2C 4R8WH 2AJYL 2E6QA 3EO0B 1CL7I 4Y5VA 5DYOA 1CFVH 1LK2B 1V05A 1NGYA 2W9DH 3KPNA 3KYOB 3FZUC 5DJDA 1JNJA 2K7QA 3ZKMC 1CXFA 1UXWA 4CKVX 2AGJH 4I3RL 2OL3L 3EKCA 3VRIB 1AH1A 4UNTA 1RY7B 4WFFD 4YFEA 1J18A 3BDXA 3P4OA 5JHDE 3K80A 5ID1B 4CGTA 3GNML 4HWZA 4OKVB 2DD8H 4PRPE 3PL6D 4TTDD 4YC2B 5TPWL 1A4JB 1KLGA 1NC4B 4JVUA 5SV4A 1M6OB 3H7LA 1HNFA 1KTLB 1PKQA 2HTLC 3GMOB 4Y1AD 3MRRA 1Q0XH 5DD0L 2VDRH 4OF7A 4CW1A 3O3EB 2BNQD 5D5MA 3EFFB 3RIFK 2V2TA 1FL6A 1T83A 3SE3C 4JFPA 2E7LA 1TZGH 1NUGA 1X7QB 1D5IL 5A2JH 3RNQA 2H41A 5MEPB 4GRWF 5IROA 4DOHB 1UWXH 2P5EA 1A7PL 3P11H 4MX7B 5CLTA 4OLZH 1I1YB 1CGSH 1FNAA 1ADQL 1OGAA 3U36B 1NBZA 5TQ0L 3HG1A 1MCHA 2LU3A 1KB5H 2DBJA 2IH3A 1U8PA 1HQRA 5DRXB 3CH1B 3QUML 3UPRB 1WSST 4GG6A 1NLBH 4E0RA 5E2WH 4X7FC 4U49A 1C7SA 4JQVA 2C4FT 3GUTB 4YIQB 1KOAA 1K4DA 2ARWA 5IB4B 5KS9B 2UZIL 3FAXA 5I8OL 4U1GC 4L3CB 4XTRC 3WIFB 1F4AA 2Q7YB 1EFQA 1FO0H 1K8DB 1UG9A 3AREA 4NQCB 1BOYA 3AB0C 3JZ7A 1UB6B 1U8MB 2VQUA 5F7NC 1H3VA 3UTQA 4RQQB 1U91A 4PD4J 1KTKE 2FBJL 1N64L 3L3HA 4NGHL 3WYRA 2AK4E 3QO0B 3RPIA 5FIEA 3LH2L 5IT2H 1YN7B 2UVFA 4TUJB 3NZHL 3PWUA 2D7TH 1JZ3A 3V0WH 3PWPE 1XIWD 2WP3O 5J57B 1HHGA 4KQ4H 4PRHD 3TVMA 5BV7H 5C0NC 3ZKXB 3REWB 1FG2B 1HWHB 3LRHA 3LS5L 4M6AA 3RVXD 1G0XA 3BX7C 1RUQH 4Q9RL 1IEHA 1LO4H 4JZOB 5IQ7H 4KKLC 2GFBA 4YHYB 2VQ1B 5I18H 2VLKE 2A74A 2QEJA 3LQMA 1X5YA 4UAOB 4XCYB 3J8F7 3UTZB 4JZJB 4K9EL 3U0TB 3CC5B 5IB4A 4A6YL 3QJFA 5BZWA 5EU3A 4HJ0C 1MELA 4HUUA 2VABA 35C8H 3CFBB 1PY4A 2OI9C 3MRMA 5J4MA 2AP2A 4ELMA 3WKMH 1FRGL 2FX9L 3QDJA 4I48B 3EYFB 4M5ZL 1P84K 4DTGL 1LO2H 2I9LB 1UXWB 4X7TA 2DQTH 1NBVH 2LQRA 1GGIL 1JRHH 4NHUB 4XP9H 4PJ5E 3T0BA 1FCGA 3KVQA 3NGBC 4PJ8A 3STBA 1ZKAA 4XVSL 4OZFA 1J0YA 4KRPC 2ID5A 4G7VH 2IQ9H 1QRND 3CCHB 3NZ8A 5JW5A 4U6YA 4G8GE 5JXEC 1CICC 3A6OA 4F37K 5I8OH 1F4XL 3V5KA 3KPRD 3QXTA 2XZAL 1T0MB 3WKML 1FDLL 4GKZA 4UTBH 2ICWI 3SQBA 5DGQA 4L1DA 5MENB 1YQVL 1TQCC 2YD2A 3LZFL 3B5HA 3BDYL 3SCMB 1BVZA 2Y25A 3VDBA 4DN3H 2VWEE 1T3FB 4NNYA 1A1MA 3A67H 4H88H 3HMXH 4BFEA 4ZD3L 5JIHA 3IETB 2WIIB 5E08L 5EH1A 4L3ED 1HE7A 3UP1A 3V5KB 1RZJL 2FO1A 4LCWD 1FN4A 1AQKH 3H8NA 5DMIL 3VXUE 5GS0C 3ZL4L 1OTUD 3PABB 2H2PC 4NRXA 1RK1A 1FNEB 3HNSH 2EE3A 3PIQA 4TNWF 5FO8B 4PUBH 4JFDA 5DS8A 1IGFL 1PKOA 1PEZA 3ARED 4QHUB 3SEPA 2I9LA 4MA1C 4JAMA 5SWZD 1UGNA 2ED7A 1F13A 5D72L 4OLWH 5I19L 5C07E 2A6IB 1DANU 2CXKA 1SYVB 2DD8L 4PLKD 3BZDA 1LD9B 3MRMB 1LK3H 3W5MA 2UYLA 5TPWH 2Y9RT 1WJ3A 5IOPA 2HMID 3TIEB 4JFEA 2VDOL 3MROA 1NL0H 1YN6B 2BDNH 3NCJH 2VXVL 2EDXA 3ILPB 2OK0H 4JM2B 3ARXA 3EJZD 1VPOL 1IARB 3VFMA 5FO9B 5JW5B 3O3AA 5C8JB 1AHWB 3HN3A 4HJGB 4H1LH 5EUOE 4LAQH 5D72H 4K2UH 2COQA 1BMGA 2P8MB 4LLMB 4ZFFA 4JY5H 1XT5A 4QGYA 3JVGC 4YQXL 1MFEH 1QFWM 4Y1AA 1Q0YL 4WO4D 1A6ZB 5LWYH 3QIWD 2P8PA 3QFJB 1YY8A 1JTPA 5DK3A 5IM7A 3C09B 5IB2B 3BWUC 4JZNA 1KIUA 5ESAA 1HEZB 5IEHA 3SKNA 4X99A 2FH8A 1RULL 5KN5A 4GLRH 1IGIH 3X17A 4NPYA 2ZP0T 1P2CB 1J87A 5I1LB 4OM1H 1MQKL 2GSIA 3NH7H 1IC5L 1ZT4A 2NYYC 1MJ8L 3C5ZA 5T5NG 3QB7C 3DYOA 2N7AA 4LVOB 1YMHB 3T2PA 3T09A 1I1AB 5DEGA 3QPQC 3V0VB 3A6BL 4YAQA 1HH9A 1DTUA 4LGRB 4JQXA 4YHPB 2Y06L 2AABH 3CD4A 4U6VL 1S7WB 1F11A 1ND0B 5IV2B 2FR4A 3GUTA 1R3HA 3D25B 3R06B 4PGEB 4WEUD 1NKOA 3GRWH 3FQWA 1L0XA 1DUYB 4XPBH 2P5WA 4BQBA 1FNHA 5C0AA 3DV6B 4HQQL 5C0BB 1R3JB 1HHGB 4HGWB 1B6DA 3T0DA 1O7SA 3HC0A 1F4XH 5DEFA 3QXAB 2YD6A 1LEGA 2QQKH 1KJ2A 2HH0L 1UKTA 4MJ5A 5KANG 4LLAA 1KYOK 4GW5A 4JO3H 2CUIA 1N0XL 1LEIB 1QFOA 1DUYA 1HHKB 4F57L 5AG9A 3RWFB 3WUWG 2MSPA 1X5ZA 3IU4H 2P8LA 2OJZL 5EBMB 2CRIA 4I5BB 3IGAB 3FONB 4I77H 3IDMB 4G8FA 1FAIL 1JHKH 2AJ3A 2VXQH 4Z7VB 5TF1L 2IEPA 1Q9WA 3E3QC 2OL3A 5JW4M 4NRYB 5LG1A 3SKNB 3F8UB 3FRPG 4XAWH 4K3HA 4MD0B 5J12C 5GRYA 3CFDA 5KW9L 3N1GC 1XGRB 3MRKB 1NBZB 1H3XA 1WK0A 3CLFL 3FB7A 3VH8A 4Y1AB 3EYVB 1JWMB 4RMUA 1AR1C 4J2XA 3U48A 3QG6B 4M3JA 4MA7H 1T7YA 2IQAB 3KYOA 3FCTA 4BFBD 3U0WH 4WU5A 3KPSA 4HIJB 4JHWL 3VXRD 1YQVH 4RAUB 4HKZB 4YC2C 4RWYH 4EQ3A 5AD0A 5IW3A 5BV7L 1MF2H 4EI5B 2HKFL 4Y0GA 1FIEA 4R0LA 3GJEB 2AK1L 3DVGB 2YMXH 4RNRA 2E6JA 2R2BB 3O8XB 3JTTA 3MO1A 5GGRA 2LAAA 4NN5C 1CD1B 1BVLB 1YY9C 4X7CC 5C86A 2EDQA 4JFHE 1F3DJ 4M43L 5HHMD 3DI2B 4LLVB 3MGTA 4JE4B 3VXOB 1P7KB 3N85L 5ID1A 1DL7H 3P4OB 4PRAA 2GK0A 2A83A 4NO3A 3DRTA 4G42B 4XT1C 3CUPB 4QKXB 1U58A 1JV5B 3V6BR 2X4RB 1OOAA 1CR9L 1KTDA 5ADOH 3L5IA 2R1YA 3L3KA 3V8CA 1AGEA 3O2DA 5KVGH 4YJZL 3NOIA 4YQXH 1AGEB 2IAMD 3OXSB 4YH6A 1F02I 3A6CH 2EIZA 3AS1A 2JIXD 5F9AC 3B3IB 1A1NA 1M71A 4QRRD 5ALCH 5F9JA 4M1GL 4I0KA 1M7IA 1NAML 5EORL 4CL7A 1FGNH 1UVQB 2EDEA 1KIQA 4RZCA 4E5XA 5B8CC 2OK0L 5L7XL 1CFTB 3C5ZD 3ARPA 3W11D 5E8PB 3MC0A 4M48H 5SWZB 1CXIA 4IMKC 5IJKA 3E8UH 2MCG1 3RWHA 4D0BA 4LPYA 3O4LA 1R24A 2B1AL 1EEZA 1ZLUK 3BMVA 4ONFH 2GUOB 4CDGC 5ITBL 4JY6B 4XHJD 4HPYH 3QO1A 4RNRB 3TO2A 3IRZA 4BZ2L 1ORSA 3HZYB 1KPVB 4PB9H 4U6YB 3T3PF 1SQ2N 2YK1L 1YPZB 2ATKB 4PFEA 2EH7L 4NYLA 5IF0A 1V8HA 1D9KA 4HHAB 1I85C 3FQNB 2RR3A 3H3BC 1ZWIB 2VZ3A 1NDMB 3S37L 1TZIB 4HKBA 1FE8H 4JKPH 5SWSB 4F3FB 4TOYH 3T0EE 3AS2A 4MGXA 5E8DH 1JGEB 3CPLA 1A02N 3BZFB 4OGYL 4IOFC 4EI6A 5ITFA 4EQ2A 4D8PB 2IPKB 5CBAA 2WBWB 1UWGL 4DZ8A 2BVEA 4KGJA 4LP5A 1BQUA 3BN9D 4HUUB 4M3KB 1MIEL 3LQZB 1WFTA 1CK0H 4ZOCA 4TUOA 1A5FH 1MCDA 4O5LL 1JNLL 4YHNA 2DQEL 3BDYH 3Q6GH 3X3GL 4PIRF 4KUZH 1QFWL 5LBSH 1J0ZA 5HDOA 3QIBB 2GFBB 1BZ7A 1RZJC 4Y8DC 1PFCA 5F9OL 1F3RB 5T1MA 5T1DL 2R8SH 2D4FA 4MNGB 1JWUB 3ALXA 3WFDH 4BFIB 4EIZC 3F62A 4V2CB 1F3JA 4FZEL 1S7TA 3S36X 5J1SC 3AM8A 4ELME 3FN3A 2Q20A 3DHMA 3IDNB 4M5YH 4C56B 5IB5A 2FATH 3MV7B 2MQCA 3O6LH 5A2FA 4PRBB 1F4WL 5D7JA 4MA1B 3R0MA 5MP6L 2A73A 2O5XH 4XVTH 1QBML 4TPRL 5EU7C 3UTSE 4PP1C 1SEQH 3E8UL 2OX5A 2QSCL 3K74B 3ARGB 1SY6A 3QUKB 2R1WB 4NQEE 1HILB 4JFOB 4KKBD 4QHMB 2BVPB 3SHSA 4ZFZA 1ES0B 1QTYT 2A0LC 1TJGH 1X5HA 5ENWB 5GS3A 4GG8B 1NBYA 3C5SB 3MRNB 3BE1H 4M6OL 3QUYA 4PV8A 3BOVA 5JPNB 2ICWA 4JFFD 3SDXA 1DQLH 2KQMA 4JZNB 4H25B 4OGZA 2XTJC 5CEYB 3LZFH 4PJBF 4FQXB 4X98B 3MUHL 5DRZA 1EIBA 1WWCA 3GJFH 3RUGE 5C9JA 2EDOA 1VADB 5DHXB 1A64A 4Z6AT 1CQKA 3O4LE 3MCKA 4UDTB 5I15H 1JYWA 1W72L 2ZUTA 4PJEA 5F1IA 3UBXI 4HFUL 5DK2B 5AAWA 1H0DB 5HI4D 3ARZA 1XEDA 4LCIH 5HI5D 4TYUA 4OF8A 3LVEA 4WEBH 4U1SB 4WDIB 4JM2A 4XXDA 3L95B 3ZYZA 4DK6A 1YDPB 3NFNB 3RL2B 2VKWA 4M93B 1KNOB 4R4FL 4Z7WA 5AYUL 1LDPL 4WV1C 2FB4L 1C5DA 1YJDC 4K55A 1H3PL 1QO3B 1J0KA 5JIPA 2EYRA 2QKIA 1CICA 2P7TB 3UC0H 5I1CL 3QCUH 1V3LA 5CZVL 3DTXB 4XCCL 5I1KH 5D70L 4KVCH 3ZKNC 3P9LB 2FATL 2HYMA 1T6VN 3NPSC 4X4YB 5DEZA 2VRAA 2Y06H 3TA3B 1N6UA 2GCYA 3D48R 4POZC 3QHZH 3IJSA 4PJHB 2DICA 1IM9B 1G7JB 2VLME 5F97E 2V5RA 3T65B 5EO1B 3FT4A 4YNYA 1JN6B 2JCCE 4MXQD 1FHGA 1WV7T 3I2CH 1MCQA 4LP4A 5DJYB 3LS5H 5DHVA 4KMQA 5C0RH 2DWDB 3RZCC 4Y2DC 3FFCB 5L6YL 2BNRB 5E9DD 3HE7A 2ZNXA 1NJ9A 43C9B 4G6FD 1ZGLA 1MFEL 2DM4A 4TQEH 5L2KE 3I6LD 1E28B 2A83B 4NO3B 3GI9H 3MJ8A 4NGHH 1PGRB 5EOCH 3HB3D 4OZGF 5DUBB 3SDCB 4F8QA 5KSBF 4HFWA 5I1EL 4OCYL 4F57H 4FOMA 1U2CA 1DBKL 5CJBA 1S7VB 2YD5A 4NOBA 1L7IH 3OF6A 4TVPH 1X44A 3VD3A 3QR2A 4KU1A 1BJ1J 1J8HA 2FYYB 3KPRA 4LQFL 3EYUH 4ORGA 3HZVB 4X7SH 5L9DH 4LCYB 4G9DA 3FO0H 5LCVL 5HVHB 3VG9B 3ARBA 4L8DB 4TUKL 3EJYD 2D7QA 4APQD 4HUWA 4PRNA 2XWTB 4HXBH 3RX8A 1Q9KB 1QVOA 1I1FA 1NCTA 1NDGA 1D5ZB 2IQAA 4K7FB 3BEVB 1VFUA 1YEKH 4OCSH 1UWEL 2N7BA 1QSEA 5FF6B 1MCLA 1PW3A 4F8TA 3ROLA 1FO0B 2GJ6E 5JLZB 1H5BA 3KYAA 1D5IH 1JPTH 4DKAA 1FFOA 3CFBA 4ONHA 4WTWA 4R96A 3RL1B 2OTWA 1WBXA 1ZTXL 3KHQA 3WCYA 1XF5A 5C3LD 3PWNA 2ZPKH 4RGNB 4PLJD 1Z9OA 4FP8L 3B2VH 3EO9L 3HUJA 3NABL 2NTFB 1IE5A 1ZE3C 3WXVH 5E99H 2GJ6D 1FG2A 1BF2A 4CN1A 4DW2L 3MLRL 1IKFH 1WUNT 3G5XB 5ITBH 2VR9A 2ZSWA 3ES6B 3U7WL 4N9OB 5FGCB 1TVBB 3Q5TA 3H7BA 1VERA 1ROWA 2H26A 4FNLH 3I6GA 4XMLH 2NNAA 2PF6A 5F7EH 3JWOH 1BREA 4I3RH 5DMKB 2ZNWA 2IAMA 2XRAH