5EO9A

Crystal structure of the complex of dpr6 domain 1 bound to dip-alpha domain 1+2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
MEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dpr6, isoform C
publication title Control of Synaptic Connectivity by a Network of Drosophila IgSF Cell Surface Proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell adhesion
total genus 28
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2015-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eo9A00
1CE6B 1KENL 3TNMA 4D0DB 4PRPE 1AGFB 5DO2D 2VXVL 4KJYB 1RU9L 4R4NC 4LSRH 1RJZB 5IMLA 1UENA 2W38A 3B9KB 3QHZL 4P4KB 1JTPA 3VXRE 3PG2A 1DBKL 4WUUB 5I9QB 1H5BA 1L6XA 4M93C 4TVPD 3MROA 3O9WC 3ARRA 1MFAL 2FGZA 4F57L 1A7RL 4N9GB 4EUPG 1J0ZA 3WIHA 4HAGA 2DLGA 2XOTA 5MEOB 3FQNB 4PJGF 1X5KA 2OM5A 5FO9A 6FABH 5HI4C 2Q76A 5JQ6L 3GJFB 4LCYA 1T3FA 3WS3A 4XX1G 1WF5A 2OJZL 3I6KB 2QTEA 1LE5A 2CPCA 2HTKC 2D7OA 1X4YA 3S88L 4HK3J 4JFOA 1CICD 1D5ZA 4K23H 1UYWL 1NEZA 2CXGA 3IJHB 2HKHH 3OKYA 3O3DA 1F45A 4NO3B 5LGHL 2PO6C 3EOAA 4PS4L 3P11L 4EUPH 1KPUA 4PTUA 1FO0A 1JNNL 2KDGA 2PYEA 4KI5D 4HCRL 1PEZA 3AMKA 4P0DA 2D9QB 2ESVD 3S35X 1FH5L 4DN4H 5B21A 2VDKL 4E5XA 3SDDC 5EOQL 1HEZA 3QNZB 4M43L 4CVZB 3MRGB 2YD7A 4YHZH 3OAUH 4XAKE 1KNOA 4XMLL 3MNWB 1J0IA 3MGTB 4ZFZA 4GH7B 3MNZB 1RZGA 2ZPKH 2W9DL 4M1CD 2GY5A 4UDUB 1E4WL 2EDWA 1YPZA 3BP7A 2W0FB 4JFEE 3CH1A 3HMWH 1A6VL 2C7UB 2DQUL 2YD3A 3FMGL 3GMOA 4QF1A 4CU6A 5L6YL 1ZA3A 1P7QD 3KLHD 5DLMH 4U1JB 3W2DL 1NC2D 3UBXI 5BZDA 5ERWA 5HYJD 4RAUB 3BHBB 3MQIA 4XB7A 5HHOE 4PPTA 2X4RA 3PIQA 2RR3A 3GZKA 4G7VH 4LNRB 4HXBL 3VXSA 1SBSL 1AD0B 4NUJB 3DGGA 4H1LG 5ALCH 3VGDA 4X7TB 2HRLA 5KS9B 4WHDA 1UC6A 2AQ2A 2BVPA 3WL9B 1QZ1A 1FNLA 2AI0L 2P8PA 4I0PB 4JKPL 3SY0A 3N0PB 4RWHA 1MAML 2F58L 3MUJA 2VLRD 1BQHG 4XNYL 4RNRA 5LG1A 5IEKA 1MLBB 4GRMA 1UM4H 3TWCL 1CLCA 4K9EC 5GS1B 4Q58C 4Y16A 5EU4B 1S3KH 4FQJH 3RWFB 1HYSC 3U0TB 4JGUA 4NWTH 3V9FA 3VI4E 2Y07H 3MRRB 2VZSA 2CDEB 3G5YA 2H9GA 1NBZA 2JF1A 4TPRL 5CWSA 2DLHA 4PB0L 1X3DA 3NIFE 4Q9QH 3JTSB 2WWMC 3LPFA 4ZO8A 4TUJA 4QGYA 1BOGA 2UYLB 4PJIB 4U05A 3H3BC 3KPRB 1RUML 2VZUA 2YD1A 2PXYA 1P4LB 3OKNA 4M62H 3ZDZE 3VA2C 4WI2A 3HUJE 3H9SB 2H6PB 3HNVH 5EC1A 1HNGA 1DQQA 1HINL 4LARL 1HSAA 3T2QA 4TSAL 5TQ0H 4XP9H 3UTQA 2E7HA 4P9HH 3DO7A 5FA3A 5MEND 3C09B 3BP5B 2VLME 3AC0A 3NCJL 1P4BH 3L6FB 3HB3C 5J9PB 1MLCA 1DQTA 1H3WM 3PP3K 4DAGH 2VMFA 3BKYL 2QQNL 5F96L 3TYFA 4NYLB 1Z0MA 2IAMD 1LEKA 5C07E 4Z7WE 5C71A 3IVKB 4TOYH 4MWFA 2Z93A 2A9NL 4W4NA 4IS6B 1MJ7L 2MNUA 4P4KC 4G6MH 5C0EB 3WNNA 3JTTB 4FQXB 5DR5H 3SQOH 5DUBA 1T83C 3C9NB 2V5TA 3CVIL 2WANA 1A22B 1X6LA 2GJZB 4PGBA 3W9EA 1HIMH 2WSKA 4NN5B 4OI7A 2LVEA 3IKKA 4PUBH 1M7XA 2DQTL 2IH1A 3DX6A 3NH7L 1NDGB 2IPKB 4PLOB 3OSKA 4C56A 1J9CT 4IDJH 5DRXA 5ICYB 1JNLL 3UYPA 1AKJD 2P7TA 2UWEE 1CGTA 4K7FB 4OKVA 5ENWA 5J6GA 3VWJD 5I30H 1CU4L 2XFXB 4HDIA 4QT5B 4MNGB 2V9RA 3KPQA 1PKQE 4C57C 1DL7H 1T1ZA 4HV8A 3L3DB 4Y19A 1QUNA 5CCKH 1ES0B 4K71C 2IMNA 1H3VA 3EFDL 3JV5A 5DVLA 2AK4D 2AXJA 3KYKH 4H8WH 3U4EA 1EXUA 2OTWB 4HIHB 4JZNB 4XPBH 2XTJE 1U3HB 2CO7B 1MCJA 2A6IB 1TQBB 2PTUA 1M05B 3TP4A 4FTVA 2Z0BA 3NFPB 5TDPA 1TQCC 2H26B 2EDJA 4JFQB 2W59A 3IFPB 2GTWB 4AIXA 3RY6C 1JUFB 5E70A 3NZHH 4PJDB 5C7XL 3J7HA 1EBAA 3DUHA 1ACYH 4UB0H 4YJZL 3MZGB 3P30L 4Y4KD 4NBXB 5JXAH 4S1DC 3ZDYF 1IC7H 5FO7A 4WHYG 4YO0B 5HHQA 5ITBL 2NXZB 2EO1A 4FQPA 1KXTB 1U8KB 4HQQL 5T5FL 5D1XB 2AJZA 4P2YA 3U0PB 1TNMA 2GKIA 3IFNL 2Q7YB 3TPUA 2YRZA 4F7PA 2GTZA 1NCBH 3W5MA 2EDBA 4RAHA 1OTUD 5HYSG 2AXFA 2F19H 4ERSH 2XT1B 3HPLB 1YEFH 2A77H 3C6LD 1DBBL 3DV4B 3BW9B 4L3EE 5T3ZD 2Q20A 2EDLA 2EIDA 3GRWL 4KUZL 3K7UA 1S7VB 2I25N 3QWRA 5EA0L 1T7WA 5JHDD 1INQA 3TA3D 4ORZC 3QDGE 3MBED 4LKXA 1T6WA 1G7QA 4E41E 4E0RA 3CVHA 5EIIB 2FX7H 3RIAF 3IDIA 3C60D 2ZNXA 5EZJB 4MAUH 3U30C 3FQWA 1S7WB 1Q8MA 3FQTA 4I0PC 4LSUL 2YXMA 3N1PC 3ULVD 2HMIC 5FYJU 4BK5A 3T0EB 5H94B 4PJ7E 3WEXB 4GG6F 5GS1C 5FAAA 3L9RB 1LHZA 2GUOA 2DM3A 3LEYL 1R24B 4PG2A 1S5IL 3V5KB 1U8PA 3T4YA 3CDFA 4NRZA 1BVLB 3CK0H 1YMMD 3IKCA 4P5TA 3ME0A 3O3AA 3FN9A 3VGGA 4HG4K 5JIHA 1XF5A 4OGAC 3VFGH 3TIEA 1KPRA 2MKWA 5J3HC 1S9WB 1JWSB 4NJ9H 4TNVF 1QNZH 4Q0XH 3HS0B 3CU1A 4JY6B 1N6QL 2DKUA 2VQ1A 2IH3B 4XRCB 1VKXB 2FBJH 2MOVA 3H9HB 1C5DA 2R2EB 4WU5B 3RDTB 1YN6B 3I02B 4LCWB 3GMPA 2VYRE 3RA7L 1SYSA 1UA6H 2X7LA 4OZGE 4RFEB 4ZFGH 2Y06H 3CZFA 3C09C 4GRWB 2AK1H 43C9A 4KZDL 1MFDL 5JXED 3RWJB 5KVGH 1T4KA 3O8XD 2XZCH 3BPLC 3FFCA 3NCFB 1AQDB 1JF1B 4LLWA 1TDQA 5E4EB 3UXFA 1I1AB 2I9TA 2GW5A 3KPMB 3BKJL 1KIRA 1YJDH 2VOTA 3QEHB 2CLRA 4DFIA 1JPTL 4TVPH 1ZMYA 3H3PH 2DTMH 2YPKA 3I6LD 2F5BH 4FQXC 4HW6A 1EPFA 1RZKH 1QBML 3FFDB 4KKAC 5DJ0B 2AJXL 3WHXA 1EEQA 2J8OA 2DQHL 2E9IA 4G9FB 3T1WA 3X13A 1MI5B 1IC4L 3SDXF 4NN5C 1WFNA 2EDEA 1FDLL 3ALXA 4UOW1 1GIGL 4KV5F 1SY6A 5CJXA 4FQHA 4G6AC 3FOMB 5I1CH 4G43B 2FX9H 1EEYB 4PJCA 4JHAL 1XR9B 1EVTC 1F2QA 2BNUA 4PRPB 1FCCA 2C3HA 2VDNH 1EMTL 5C0RH 2WUCH 5I74B 3WD5L 4X80L 3ZT6A 5CEXA 2VAAB 3IRZA 1GGIH 4EI5C 3NAAH 2EYTA 4L29B 4P4RA 4XVJL 3VXRB 4JRYD 4PREB 1M7IB 5C70A 2QJDA 5BJTB 1T20B 4HS3B 5IJVB 3GSRA 2NY5C 1RMFH 2ZUSA 3D87B 5DJ8A 3QRFM 2EE3A 2CMRH 2VR4A 4Z77B 1J8HE 1CFSB 4HKBA 5IUSA 3FZUD 2EKSB 3OR6B 1EHAA 3C5JB 5GZND 4MDJA 1F11B 3PABA 4LSDA 2WUBL 2P24A 5HPMA 2MHAA 1IEAA 3B6SA 1U3HC 3ZKQD 2AV1A 1TQBC 4CW1B 2HJLB 3MO1A 4HC1H 3QQ9C 1C16A 1CDUA 2XN9D 1IGFH 2AJYL 4L8SB 4G6JH 3ZSSA 4NDMB 4OLEA 3ZO0A 1BLNB 1T66D 2VABA 4WFED 1GGUA 4N5EC 2Y6SC 2R4RH 2NZ9C 1R5IB 4W70A 3MA7B 1CL7I 4NRYA 2FR4B 1D3CA 4NO5A 2PTTA 5FGCE 1EEZA 4XMKL 1UCBH 1UH3A 4Y5YB 2FHBA 3VD5A 4TUKL 3D39A 1UH4A 2J88H 3STLA 5DTFA 4JO2L 4K94L 5EBMA 3CFDB 5ECJE 3MRPA 3WIIL 5D71H 4N5UA 4POYA 1NAKL 3EHBC 1AXSA 4XCFL 4JAMB 2CDFB 2DIBA 2A6DB 2BSSA 1CG9A 4QRRE 4HJ0C 5DJ6A 3VH8A 1B6DA 5TFSL 4GW5B 1B0GB 1ITBB 3MFFA 4WRLA 1BVKB 4GFTB 3WSQL 5C2BL 2Y7QB 3BGMB 3IT8D 4JFEB 3RUGA 4PV8A 1KLGA 3VXSE 5D4QA 3WN5B 5F8QC 1PSKH 1Z3GH 3O2WL 3BDYH 3T0EC 3TVMB 2V2TB 2Q3ZA 4GRLD 1XIWA 2X1WL 2O26U 4L4VA 5IQ9A 3HZYA 1RZJC 1I9RL 3L1OL 4KK9D 3VFWA 4EXKA 1T0NB 3HPJA 4JN2A 2QSVA 4NBZB 3K8KA 5F88A 3D3VE 2F8XC 4Y2DA 1DQJB 4N0CC 1TCRB 3QYCA 3ZHLA 4BA8A 5DWUL 3W0WD 3RWGB 1HH6B 3RVXC 4JPWL 4BKLA 3GSUA 2OK0H 2XPGB 4OTXH 5EO0A 4WIQA 4XTRD 5I66A 3WFDH 4LASH 3RDTC 4QCIA 4TSCL 4XP5L 5DK0B 3BWAA 1VFAA 3WUZA 5K93A 1MY7A 1FVDA 1K8DB 2VE6A 1CXIA 3B4NA 3H9YA 2QQLL 1BX2B 3R06A 1NCCL 3KXFD 4XMPH 2JB5H 5CGTA 4PG9B 1IGIL 3MLRH 3RKDD 3WFEH 3NACH 3OV6A 5BW7A 1X5YA 4QRPD 2HA1A 5E4EC 1I1AC 2ESVA 2NX5E 3B83A 3HN3A 3U46A 1E6OL 3LCYA 4LLMA 4JFYB 1HHHA 3P0VL 1U8NA 5I1DB 4G8GD 1HN1A 4G9DB 4ZS7H 4Y1AE 1M6OB 5IT2L 1IMHC 4J3XA 4F9LA 4LVNB 3VJ6A 1NDMA 3BH9B 4HC1A 4QRTA 3MYJB 4OB5H 3N1GC 5GRZA 1S8DA 1DQDH 2Y4SA 5DT1L 1SEQH 5CEZL 4HIJA 4OCSH 2AJVH 1MIMH 4EN3B 3KPSA 1X9QA 4I77L 3O4LE 3PL6D 5JPNA 2XZAL 4OZ4B 2XKNA 1ZV5A 3U2SA 3LS5H 3WE6A 2P5ED 4L9DA 4PD4K 1R3LA 2UY7A 4XAWL 2PETA 4OF8A 1ERNA 5I74C 1A4KB 1JL8A 5KJRH 5AAMA 4L3CA 1FFPB 1MUJB 1NC2A 3EZ8A 2FYYA 4IEFB 5ISZA 3IAQA 4LVOB 4XH2B 5IFJA 3OBAA 3MV9A 4KKLC 2DLFL 4M1GH 4CJ1A 5HI5D 1LNUA 4ZODA 1MVUA 1XH3B 2DRUA 4ZDHA 2DM4A 3KPLA 2DI9A 2HH0L 5IHUL 2FJFB 4ODVL 4IOIB 4LMQE 4P3DA 5HGHA 2GSGA 4FMKA 1PY9A 2Z4QA 1VADA 5F3HB 5DRWB 1OGTB 2VLRA 5LJYH 1MQ8A 4H26A 4TVSa 4OZHB 4CU7A 4PJ8B 1T5WA 4N0UE 5TJWK 3AM8A 4JFFB 4L8SC 4OT1L 4DZBA 1N3NB 5SWZD 1HQRA 4G5ZH 3TO4A 3OXSB 4KTDL 1ZGLP 3UTSD 2VH5L 4M6NL 3QUKA 3K2MC 2P8LB 4EDXB 1J18A 2V17H 1P2CB 3MUHL 3EFFA 1X6NA 4ZFOA 4NSKB 5C08E 3RWHB 5F9JA 4G6KH 2X4QB 1A6WH 4HT1L 4OCYH 5BXFB 3TESA 1HHGA 4WI5A 2XTJB 1DLHB 1H15B 2Z8SA 2EDRA 4Y5YC 1NCDL 2Z91B 3IF1B 4OQTH 4WFHD 1O7VA 5T3ZH 1KT2B 1QFWH 4O4YH 3TT1L 4MJ4A 4PJGE 4UTBL 5HI3C 1TJGL 5DJXA 3JVGA 1AY1H 1BD2A 4LVHB 4MJ5A 3V7AE 2V5SA 3MGAA 1QPPA 4H88L 3VD7A 4BH8A 5I1LA 3QJHB 3D85A 1I8KB 2D7QA 3GKWH 4BSVA 1JZ7A 2FGWL 3Q5OA 3GB7B 1U8MA 1UKQA 2XQYG 1DSFH 5MENA 3ULVH 1F8TH 1DBAH 3CSPA 1NFDF 2D4DA 3FB7A 3FRPG 3U7WL 3N06B 4LPYA 1YYLH 2E7LC 4LU5L 1MHEA 1Y0LA 3UAJD 1QA9B 3BQUA 2IAMA 4I13B 3TVMC 1BBJB 1OY3B 1PZ5A 1OAQH 5GGVL 3BRGC 4AENB 1NGPH 5ITFA 5E2WH 2GCYB 2JK5A 4X98B 1IAIH 5FHBL 3S3SA 2KL6A 1AO7B 3QDGB 5JOPD 4PJAA 4E41B 3RZCD 5JW4M 1LO3H 2ICWA 1CGSH 2VAJA 3SE3A 5C0IB 4KVCL 5BV7B 2YEZA 5SV4A 1JF6A 3HKFA 1IGCH 5KSBF 3U7YH 2X1OA 2Y1VA 3GMRA 3MLVL 3IJYA 5KAQG 3BZEB 1NPUA 3SKJL 2XY1A 4M6AA 5DD1L 1ED3A 1K4DB 3BVNA 5CEYB 5EFIB 1JPFA 4KQ3L 1C5CL 3D69B 4CNIB 4PR5A 5MP6H 1JPGB 5IK3A 3HAEB 1FSKB 3KYAA 3U0WL 1YEIH 3PDDA 4X5XB 3GMNB 3S9DB 4TTGA 4X8JB 3OHXA 3VCLB 2DDQH 4HPYH 4FFYL 1KYOJ 3VGHA 3SKOB 3LKPB 5EU5B 5TE7L 4I48A 3VRLF 3MRMB 2WBJD 4Z7UA 3BISA 4OGXL 4TQEH 4OLZL 3WJLC 3ZKNC 3HZVA 8CGTA 3UJJH 3KWWB 4X4YA 3TIDB 3ARFB 5KN5B 3P9WB 1J1OL 4PJHA 1KN2H 2E6JA 1VESA 2YSSA 4MQXD 4LVNC 4N0FA 1VGEH 5DHVA 2FLBT 3BP6B 4EIGB 2MWCA 1MCLA 1RULH 2MQ3A 4MD5A 4J3OC 1ZSDA 1JHKH 3I75A 1NQBA 4EN3C 2DQEH 3O0RL 4WW1A 1QR4A 1U93A 1G7HA 3O45B 2DS4A 4R90L 4S10A 3Q3GA 4PJXF 5EOCJ 3X3FL 1F4AA 1VFBA 4LPVA 3S37X 3FO2A 1QSED 1FYTA 1BIIB 2R1WB 1XCQB 3QIUB 1H0DA 1T5XB 4WFFE 3MREB 5HHNA 2J12B 3S98A 5CGYC 4LFHD 3LMJH 2Y5EA 4KGJA 4LVOC 3RVUC 1OGAE 2OCFD 4YHMH 1F3JB 3ELAT 3WXWH 4M02A 1A1MA 4ETQA 3AMLA 3MBEA 4XBPB 5IBTL 3KJ6L 3LKNA 1NGQL 1BM3L 4J7RA 2ATPA 2NY0B 3QPQD 5H8DA 2HWZH 3RVWD 4MZ2A 5HDQH 2F74B 4FG6C 5KVDL 2G9HB 1ZTXH 2FEDD 2EC9U 3UO1L 5JA8B 1FN4A 2PW1B 1UQSA 3LSOB 4PJ8C 1PEWA 3PWVA 4KDTA 4ONFL 1P9MA 1KBGH 4JFHE 1NCWL 2F5AH 3F7QA 5F7FA 2R0LH 3FT4B 4PY8I 5DFVC 3L5XH 3B2UD 3HI1A 1J8HB 2DIAA 5DA4A 1AJ7L 1DN0A 3ZZ1A 5IJKC 4U3HA 2ZKHL 3WV0A 3SKMB 1YY8B 4K8RL 4OCXL 4ZTOL 2FHFA 2NY2B 2QHRL 1TVHA 3BMWA 1RURH 2I27N 1S9YB 1EFXB 4YPGA 5EOTB 5C9KA 1MQKH 4R97B 4M1DH 4U6VL 2LQRA 4G7YL 1JHTA 2BY3A 3TT3L 3FT2B 4C4KO 1CZ8H 2VLKB 1JK8B 3C5SB 2HT3C 3I3BA 3FO9A 3PWUA 1I85C 4Z0XA 4A6YL 3I3EA 4X9FA 3D18B 3IDYB 1R6VA 5FEBA 3K4AA 4LKCA 4L8CB 4ODSH 4PLNC 1PVHA 3EYQC 5C09A 2BVUA 3V0WL 1D6EB 4LQ1A 3P4NB 5DXWA 3CFEA 3O2VH 5ILTH 5AWNH 5JXEA 3IJSA 4J8RA 1MJ8H 1G0XA 4JZJB 5C3TA 4X99B 3DRTB 4FQIL 4L3AA 4YHKH 5D6CB 2F54A 4U1KB 1FZKA 4JO4H 2BJML 1F6AA 1S9VB 3T0VA 4QRRB 3ZDYE 4PRNB 4BZ2L 2CRIA 4L4VE 2WINB 5J11C 3H0TA 4MMXC 3KPTA 5IW1B 4MNHB 4Z7VB 1OAZH 1JFQL 1B0WA 3L95B 4S1SH 5EN2A 4LCUA 4HAFA 4ONGH 1MNUH 4JDZB 1T22B 3MRDB 4QHLA 4BSJA 1INDH 1Q0XL 5FB8A 1S7SB 25C8H 1FSKC 2YPLA 4X6CF 1NFDA 4NQXA 1TZHA 2B2XH 3D3VB 4OF5A 4LGRB 3CJJA 4FP8H 3UCRA 1RK0B 3PV6B 3ZE1F 2PCPB 5JDSA 3N85L 3FQRA 4NO2A 3RL2B 4AH2B 2IF7A 1WBXB 2DQJH 2J8UA 3DX9A 4QXUL 5J6HA 1I1CA 4AEHH 1L6ZA 3L3HA 4WY7H 5JNYB 3QNYA 2CLZB 2V7NA 4GG6E 3IAGC 5I1IL 4LSQH 2YD6A 3ARFC 2FX8H 4I3SH 3AS3A 4AM0B 4C83A 1VGKA 4HGWB 5L9DH 2XYCA 5FV1L 2OZ4L 1CXEA 3L5WB 5C0CB 3BPOC 3L3JA 2NLJA 3STBA 3N9GL 1WICA 5KSBA 3H7BB 3SE4C 1FAKT 3JWOL 1T1XB 2AP2A 4MDIA 5BCAA 2C3GA 4GKSB 2DD8H 1CDGA 5CD3A 1IAKA 4ZSOB 1DTUA 4KZEL 4P3WA 1ZLSH 4ZUTA 2NX5B 3RTQB 4YE4L 4OFYD 1UZ8B 5CLWA 1Q72H 1C08A 1QLFA 3RY4A 1QBLH 1WTLA 4G8EA 1DLFL 4Y1AB 3TJHD 3SOBL 2BRRL 3N1MC 4XC3L 1A1OB 4O51B 4HZAA 5AUMB 1V7MH 4LP5A 4UQ3B 1OWRM 1BECA 5LGKA 3G5VA 1RK1A 1R5WA 3DI2B 5DSCA 2EE9A 1G7IB 5HGAA 1WBZA 5ISZE 1X7QB 1T7ZA 2HTLD 2NY0C 1G84A 3PQYE 4K07A 4KH2A 2X9YA 5D1QD 3MV9E 1HSBA 5CZVH 1KTLB 4WTXA 2XWTB 3WO4B 3CFCL 5E5MA 2ICEA 2C3VA 5D7LD 5TH2B 2XICA 3HHRB 3EO1A 4EVNB 2GAZB 2Q3AA 4R26L 2YKLH 3MXWH 2FSEB 3EOBB 2BSRB 4PJ5D 4KKNA 3W39A 2WQ8A 5F3BA 4YH6A 4XCEB 3MRBB 4QXWA 1HDMA 3B2VL 4PJXA 4JFPA 3BEWA 3ULUL 1UB5A 3UJIL 5ID1B 3TZVD 3TO2B 3SDXE 2RCSL 3OKLB 5D2NB 3S4SG 5IVNA 1D5IH 4KV5E 3EJZD 1NBYB 2OTUA 2NY2C 4L1HA 1IBGL 2V6HA 5DMIL 3MOBH 4HJJL 1OM3L 5IG7A 2I60L 1JGUL 2VITA 4N0UB 4AEFA 1B3JA 5EORH 5EU3A 5T1KB 4R97C 4K7PH 5CIPB 1HXYA 3PWPB 3KR3L 2X40A 4HUWA 4XNXL 4AY0A 3EYOB 4NC2B 3N1FC 5GRUL 5LKNA 5GISL 3KLDA 4KHXL 1OPGL 2BNQE 4LQFL 2Y9RT 2ZP0T 3PE9A 1BD2E 1DEDA 3QO1A 5IF0B 3IDYC 4NC1C 3LS4L 3WNPA 2A6KB 4HMCA 5EIVA 3TBTA 4OZFA 3G6DL 4NJAH 4MCZB 5GGQL 1NSNL 3KXFA 1EFQA 1FHGA 4XNUL 4TNWF 3SO3B 3O6FA 4LIQH 4N90D 1UB6A 2FH6A 1DE4A 2X4UA 4GG8B 5EOCL 4BFIA 4QRPA 1WZMA 4JZJC 4DN3L 3ZTJH 4OLYL 1ZHBB 4HKXA 5DJZB 2BRQA 5LBSL 1JRHH 2BXZA 4XWGH 3SE8H 1RZ8B 4G8GA 1A14H 4NZTL 1JMZA 4XCYA 2OYPA 5GXBB 4AMKL 2R1XA 1QYGH 1CS6A 3VGEA 4APQA 3T04D 2ICCA 2KZWA 4YIQA 4CGTA 2OJEB 3S35L 1NBQA 4OLXH 2FEEI 2VL5B 2BFVH 2CXKA 3PL6A 4W68A 5MEPB 5DFWH 4OUUB 4NZJA 4HK0A 1XGQB 4QKXB 5C0DB 4H5SA 2VDOH 4K3DL 5TE6H 1I9EA 5LXGL 4FNLL 4QWWC 4PRIB 1E4KA 1UWXK 3JWDH 4CVXB 1U91A 3B9KD 3ULSA 5DQDL 1G7PB 1GGBH 2DICA 3FOLB 4U1MA 2DN7A 2ZCHL 4JJ5A 1QSFE 5T3XL 3PV7A 2EH7L 5GGSA 1CYGA 3F5WA 1ZWIA 5A3IC 2BXYA 4EJ1C 3GIVA 1UVQA 4YXHL 2KPNA 4LCCB 5C0JB 5EU7E 3DHJA 1XGPA 2W92A 1DN2A 1T2XA 4IOFC 1OVZA 1QBAA 3QFJD 3F12A 5T1DH 1NBVH 5ACMA 5JO5A 3NIGF 5E9DD 5BOPA 3T2NH 3WJJA 5DEFB 5SWZA 5JOFA 5F93C 1CFTB 5F1SA 4R0LB 1OOAA 5CKGA 1IFHH 2HVJB 1GAFL 1Z9MA 3OKDB 5J1AB 5F1IB 2FZ3A 4GXUM 2ZCKL 1N59B 4LGPB 3RWEB 2A73A 4NZDA 5IV2A 5FYKE 3V5DA 3F6LA 1A8JH 1N0LA 3LRSB 4LSRL 3RTQC 4X6CA 1B4JH 1QO3A 2JB6B 4TULH 2AGJH 1T21B 2E8ZA 4WDIA 1OT1A 3DBXA 5CBAA 2P5WB 1NGXB 2AJSL 4K7PX 4JY5H 4CMMB 3QEUB 4MHHI 3VFSA 3PWLA 2E3VA 4P99A 3T0AA 1RUAL 5F7WC 2VXSH 4EZMA 1SJEA 1UXWB 4YDVA 3I2CL 2Q6WB 1YEDB 6FABL 3MUGA 1B4RA 3LHPL 2E27H 2IQAB 3QH3A 4Z76A 2NCMA 3HRZB 2AKRA 1MFBH 5DVOA 3NTCH 4MSWA 3FO1A 1G0DA 4FXKA 5BRZD 9CGTA 3DTXB 1OGAB 1RHHA 2ZUVA 3BPCB 1YNTB 4YHPB 4ZUWA 4BFEA 4K23L 1QKZH 5EU6E 5FO8A 2HKHL 3SDCA 3HLAB 2Q7NA 2CKBL 1ND0B 5F7LB 1ODAA 1WEJL 3GSVB 5D2NC 1ORQA 1NCAH 3CSYA 5C0BB 4P2RD 2A6JA 3LH2H 2NTFB 3QQ3A 2ID5A 4R3SA 3BO8A 1S78C 4FFVC 4LP4A 4WTZG 3MV8E 3JV4B 1JGDB 4RISH 3JWNC 1SYVA 4R9HA 1FNSL 4Q7DA 4YR6A 4Y88A 5D1ZB 1S9XA 3QUYA 2EZ0C 4PJEF 3MRNB 3FO0H 1K4CA 3G04B 4L5FL 4YHZL 5FF6A 4UDTB 4XB8A 3F7YB 3W5NA 1AGDB 5TDNB 2KUTA 1G6RH 1KIPB 3FHQA 1BQHA 2OL3L 3T8XB 1UKTA 2VLJB 3MJ6A 3OJDB 5B38B 1AHWA 1MRCL 3HMWL 4X8XA 4MVBC 3KPRD 2F8VA 3SO3C 1TVBB 5CJQH 2EICA 5GGTL 5DLML 5IEHB 5C09E 4MQ7B 2P46B 4O2FA 3V6ZB 3RL1A 1P6FA 4YWGH 5CUSL 5A16B 4YXLH 5GHWH 1ZKAA 4MNQA 3KPOB 1XAUA 3OZ9H 5KG9A 4MA1B 1A7QH 4ZOCA 2KBGA 5JW3H 4G7VL 5EUOB 3I84A 4OLUH 4AT6B 4JKKA 1P7KB 1AGCB 4ZNCD 4HUUA 5ALCL 3WNLA 5I1AA 2VDPL 5K9KB 4HWBH 3WUWA 4EKXA 4YDIH 3SBWC 4HULB 1FGNH 4HEPG 4LHUB 4F8QA 4LAQH 5B3JE 3KYOB 5I8KH 4PJBF 5E6IC 4LBEA 4JM2D 5D8JL 4KVNH 1UM4L 2J7LA 3MR9A 3GSOB 4JKMA 1UEYA 2HKFL 1K2DA 3RVVD 4NWTL 3PGDA 4GUPB 5IWLA 1KN4H 4FQQB 1MCWW 4XBGA 5IB1B 5EPMA 1QBBA 2FD6H 1RUKH 1LVEA 5B39G 5B3NA 2DAVA 1A6ZB 1EIBA 1WWWX 4DGVH 4P2QE 1QFHA 3RU8L 1X44A 4G8FB 1CFQB 4M48H 3INUL 2RFXB 1NFDE 4LCCC 3RX5A 2R0WL 1X5FA 5HY9B 1OARH 4PP2B 4M62L 1KJ2H 5L88H 3DGCR 4WCYH 2Q86A 1QR1B 5IB5A 3WBDA 5C6TH 2VWEC 5D72L 3HNVL 3UPRB 3BE1H 1FFNB 3D0VA 1L7IH 5E99H 4ZXBC 1FRGH 3SCMA 2VKWA 1JNHB 5BVPH 1BBDH 1RSFA 4XP9L 2HT4C 4D0CA 5KSAA 4HS6A 4PV9A 3QXVA 3ULUE 4P9HL 2D03L 3DI3B 4R0LC 1P84J 4GQ9H 4WNQB 4XXDB 4D8PA 1OTSD 1SJHA 4HKZB 4ZD3L 1MFEH 1RVFL 4ELMF 4DAGL 4V1DD 5E8EB 1SVZA 2OSLA 1NEUA 1TLKA 4QXGH 3IDGA 5KSBE 1Z0NA 1JN6B 4YUEH 1HCVA 3HG1D 4BH7B 4JFDB 3T0DA 4Y4FA 3EYVB 1DEEA 1JPSL 4TOYL 5HJ3B 1MIEH 1XR8B 2Y36L 1YEGL 5EZIH 1ZXQA 1VACA 3B3IB 4IRJA 4KROB 5DQJA 4UOJA 4NQCD 4ZG1A 1MJJB 1ZHKB 1CXKA 1HILB 5EWIH 3PNWA 1CK0H 2DMBA 2AERT 3PJSB 4L8DA 4RWYH 5E8PB 2NNAA 3QEGH 2NXZD 2XI9A 4MXQC 4P9MH 2YA2A 3I85A 2H2PD 4IDJL 2GFBA 5D1XD 2BCKB 5L2KD 2C1OA 1G6RA 4X7DC 3VRLE 2O5ZH 1MVFA 4K94C 3M8OL 1CIUA 5CJOH 1A1NA 3TJEH 3DV6B 4S1QL 1IC5H 4J1UA 5T5NG 1PY4A 3UBXG 4I3RL 2HT2C 3PP3H 1IILE 3P73A 2FJGA 3DMMC 3DXAA 1T1YA 2GSIB 2Z31C 3BUYB 5F71A 4M9OA 1H8NA 5CCKL 3KVQA 2X05A 3VG9B 1ADQL 5D70L 3TFKC 1AFVH 3KYKL 4HF5L 4H8WL 1KTKE 1S5HB 1DBMH 3QG7H 4JN1H 5J13C 3QUML 3SKNB 4PJXE 3E6FA 5F7EL 2EH8L 1WBYA 4WVRA 1AD9A 3TBWB 3NZHL 2RJMA 5ESAB 4UB0L 3V4VL 5T3XE 1KJMA 1IC7L 3BD4A 4NQUA 2Y5TB 1C12A 1F2XK 3P77B 2F53D 3ZTNH 4NO0B 5FDWB 2GJ6B 5SX5H 3VXOB 3DNKA 3SDXB 5K9OA 3O9WA 4NQDB 1AGEB 2V2WA 5MI0B 4LEOA 4OD2B 5ADPL 1ULVA 1C5BH 5DGQA 4NQEA 1RFDH 2ADJA 1PQZB 2P8MA 5GS0D 5FUZH 5DK2B 2DI7A 3OJMB 3VMNA 1CGYA 2FIKA 4HIIB 2F19L 3B9VA 4A2LA 1JHLL 3ROOB 1YEFL 4RGND 4UIKH 2A77L 1FNEB 3VXUE 3AY4C 1JWUA 1N4XH 4MX7A 1UXSB 5MEQB 1ZA6A 1SQ2N 1XCTA 2BX5A 1OB1B 2R1YA 5KSUA 1NFKA 4D9RE 4MA1C 5SWSA 2OR9L 1BFVH 3EW3B 4I18C 3HE7B 3I6GA 3VFRB 1ZVSA 1JYWA 2NYYD 4R7DA 4MAUL 3ROLB 3D5OF 2PO6A 2G2RA 5DMGC 2AXHA 3AREB 2X44D 5KS9F 3VFUA 1FBIH 4L8BB 1MHHB 4OIAA 2VZVA 4KAQH 4MYWB 3ARXA 4UU9A 2FB4L 5CBEB 3QI9D 1SEBA 3SDDA 1IT9H 4GAYB 4XPHL 2I07A 3WLWD 5LWYL 3ARDB 1A3RH 1CT8A 5I19H 4G9FD 4NZUH 3DJ9A 4QRSA 4MD4B 1J11A 3ZKXB 4HLZH 4K3JH 2FWOA 2IG2L 2ORBH 4JGJA 3QT2A 2AQ1A 1JWMB 4IRSB 5J8OA 1YEJH 1N26A 1LP9A 5E94B 4NQVA 3QIWB 1QNZL 3S36X 5D7LA 4JQIH 3U1SL 1KUMA 2NXYB 2L0DA 4PJIF 1I3RB 3VXMB 3VXRD 4R7NA 3DUUB 1KTDB 2FBJL 1AIFB 2JJSC 1CVRA 1LO0H 4LDLB 4TUOB 5M7QA 3VWKB 3VDBA 3CX5J 2DL2A 3FRUB 3MACH 3NZ8A 1UA6L 4XPGH 3MNVA 1TZIB 4QRQB 3TZVA 1FZMB 1QRNE 5BS0A 4WHTB 2AK1L 1DDHA 1FFQA 5HHPA 3LIZL 5E00A 5D7IB 4BUHA 2XZCL 3RKPA 1FV1A 3CFJB 1ZLWH 2R2HB 3GNMH 1YJDL 1I8LC 1U8QB 4XX1E 3WFCL 3GEWB 3QNXA 4DVRL 5KZCB 4KROC 3H3PL 2MSPA 4N8VA 4W6XB 3VFMA 2V2XA 1LD9A 1BZ7A 5CHNA 5EDXA 4M61B 4J6RH 4N9OB 3QDMD 4X6CE 1DQMH 1U8OA 2FATH 5INCA 5I1KH 4TYUA 3K4ZA 4YFLI 1I3UA 4JFZH 3FQUB 3GHBL 3LN5B 1K8IB 4FABL 3ZE1E 5FCUH 3DVGB 4NKIH 4Q6IC 3VD9A 5GSRA 1IM9B 3FTGA 5A2KH 3GMQB 2WUCL 3T0XA 3OB8A 2ED7A 5DJCA 1GGIL 5IVZA 3NAAL 3DX7A 1U58A 3SGKA 4XAKD 3KNBA 4A6YB 1JGEB 2EEBA 1CF8H 2VQTA 1CXHA 2CMRL 5CSGA 5F6IB 2FRGP 3UROR 3VG9C 5KBNC 4MLIA 1LDSA 1Z5LB 1NC4B 3ILPB 1L7TL 5D96B 1KEML 4KJPC 3LKQB 2R29L 5IMMB 3SGJA 5K9QI 1EGJL 4JRXE 5IOPB 2QKIA 2GT9A 3W11D 5KAQF 1UJ3A 3LKSB 3KDMA 3OMZA 4PY7A 5IB4B 1HH9A 3RZWA 1CE6A 3RIAK 2AEQH 4D0DA 5BV7L 4LVEA 4KJYA 1IGFL 1JTOA 4G6JL 5I1JL 1R0AH 1RJZA 5DZLA 4POZC 5HHOD 5HSFA 2H1PH 3B9KA 4MJIB 4P4KA 5IFAH 5IMOB 3FN3A 2I5YH 4WUUA 1T83A 5EU6B 5GGUB 2R4RL 1YN7A 3E0GA 3MFGB 3MRQB 1JYNA 5B8CB 4PJDF 4DZ8B 3MJ7A 2EXWD 4XVUC 5MI0C 3ARVA 4N9GA 5AYUL 2ATKB 5F1KC 3MMEB 3O81A 5MEOA 5DK3A 3MV8B 3FQNA 4ISVB 2HG5A 2PUQT 4O2CB 1J0JA 4M4RA 3C8DA 2B4CH 3MA9L 5F1OB 3BZDA 3I6KA 1PG7W 1W72H 3QWOB 3HE7C 2ICWI 3ZKMD 2BOBB 1X4ZA 2NMSA 1UACL 1YA5A 1NCTA 1A6UH 4MNQE 1KLUA 3AROA 2IPUK 4JKLA 2APTA 1EX0A 4NO3A 3WIFA 2EDFA 3AREC 2BNRE 1PSKL 4OLVL 3DVFA 1Z3GL 3CLFL 1NGYA 5K59F 3OPZH 4PB9H 3MV11 1JI2A 4YDKH 2JIXB 3EOTL 4KJWD 3GIZL 4NKOA 3QUZC 4XNZB 2X4SB 4U4BA 4PLJC 3HC3L 3QNZA 3MRGA 1CWVA 4F9PA 2D7MA 3K0WA 1PX4A 4OD3H 3BKMH 3MGTA 3ARGD 1BWWA 1EAJA 3BI9X 3EYSL 3OR7B 3MNZA 4YXKL 1HE7A 2EYRB 4CDGC 4UDUA 3ZKXC 2W0FA 4IRSC 4I8DA 2C7UA 1VFMA 3UTTE 5HHVH 5FV2A 5C07D 1JPST 1MCWM 4X7EC 4AYFA 2OK0L 4HKJA 2R9HD 4U1JA 3NCBB 4OTXL 2NXYC 2HN7B 3VG0H 3ISWA 4G3YH 3WFDL 4RAUA 3BHBA 4JG0L 2RIKA 5HHME 3CUPB 4LASL 5BRZA 1GYAA 4XVSH 1G9MH 4LNRA 5T1LB 2BOCB 4LF3B 2ZCLH 4WO4B 1AD0A 5DHYB 4NHCH 3G9VA 3Q6FA 4NUJA 1BQSA 3QIBB 5KS9A 4P2QB 4X7TA 5DYOB 1BP3B 2R4SH 4MS8D 2VC2H 1XZ0B 3U4BH 3RVTD 5HYIA 3WL9A 5EU7C 3BIAX 4P2RA 3U83A 1QRKA 3MLRL 4I0PA 4OUOA 3D2UB 5E8OB 1MWAH 4PGEB 3OXRB 1U8IB 3IDNB 4GRWF 1CDCA 1DANU 1FL6B 1Q9OB 1MLBA 5B38G 1QFWI 5GS1A 1HHKA 5EU4A 3R4DA 3E8UH 4Z7OF 1P7HL 2SEBB 5I8CB 4OB5L 4Z0BH 2X2YA 3MRRA 4J3SA 4K8RC 2CDEA 4OCSL 5IMLB 1OAYL 3JTSA 1S7UA 1FNGA 4P46C 2XTJD 4Y7MA 5FA4B 3IETB 4JM4L 3LS5L 3EZJB 2UYLA 3MLYL 4PJIA 3L3OA 3KPRA 5TPWH 1N0XH 1L4IA 5F6HJ 3U9UB 5TF0A 2YD4A 3H9SA 4JRWA 2Z35B 2H6PA 2HJKA 2WLYA 5B22A 3NIGE 1KB9J 3NPZB 2YWYA 4X5LA 4NQTA 4LHUG 3CZJA 1RPQA 1RUPL 1I7TB 4ONOA 5F6IC 4M1GL 1OL0A 2Q76B 2WIMA 4H20H 5FKAB 4LCYB 5D96C 1H9VA 3DXAE 5IBLD 3BP5A 1AR2A 1CL7H 4JEGB 3L6FA 5J9PA 1UG9A 3AU1A 3G5XB 3O3UN 3L5JA 3HZKB 4NYLA 4XI5D 5E4IA 1WGOA 1J10A 3EOAB 4L3ED 4QHUB 1KPUB 4G5ZL 3GBML 5C0NC 2Z92B 3MZTA 2BVEA 1P4IH 1QG3A 4IS6A 2PYEB 5C0EA 15C8L 3JTTA 2DQGH 1ZHLB 3NCCB 1KIUA 2VISB 1QP1A 3C9NA 4PBVC 4XC1L 4ZAKD 2V17L 5E0QA 3S37L 2J5LB 4E5XB 2ZUQB 5GS0H 3MJGX 2GJZA 4Q2ZB 1A6WL 1WITA 3EUUA 4NNPH 4Y4HB 1NDGA 2IPKA 5FKPB 3JV6A 2R8SH 1VB9A 5ICYA 4PJ9D 3CDYA 4OQTL 3HMXH 3NIDE 5T3ZL 1QFWL 3LRGA 4O4YL 3V6BR 3BN9C 4KUCF 1FVCA 1RZGB 4FZEL 3H6JA 5H37G 2R0KL 1YPZB 4NNXA 4YGAB 3QB7C 2XFXA 3TBSB 4QT5A 4MNGA 4U0RB 3GMOB 5CKAA 2IJ0C 3L3DA 5JZ7D 1ES0A 4GSDH 2OP4H 1IEBB 3TV3H 5H35B 2R69L 1F8TL 3HRPA 2XV6B 4BSWB 4KPHH 4DUVA 1EBPA 1WC7B 1U3HA 2A6IA 1YYLL 1F58H 1M05A 4GOSA 4IRZH 2GITB 3NFPA 2CUHA 5CS7A 2H26A 4JFQA 3EO0B 3IFPA 3BGFB 3UJTL 2GTWA 3ARFD 1SMAA 4ZO9A 1T2JA 1JUFA 4PJEE 3CPLA 3EOYG 4AEIH 5L8LB 1NGPL 1T7YA 5E2WL 2IBBA 1IAIL 1TIUA 4O2EB 5F7UA 5DMKA 4RNRB 1MREL 3P4LA 1UZ6F 5E24E 3OAZK 4YO0A 3IS0X 1LO3L 1CGSL 3ARUA 4D3CH 4K3EH 1IKFH 1VEMA 2B1HL 3GSNL 1U8KA 4ALAL 5BVJB 5F72S 4WENB 5DDHA 1TENA 5D1XA 2AABH 5ALBH 5L2KA 4P2OD 3U0PA 3O3EB 4OKDA 2MFNA 4LSTH 5CWSB 4EDWL 3CXDH 4WI4A 3RGVB 4AJ0A 3BAEH 1ETZB 3QIUD 5AEAA 4EQ3A 3HPLA 4TUJB 1BOGB 4ZFFB 4KK6D 3DV4A 5FUCC 1ZHNB 3BW9A 3F65A 2XG5A 2APWA 3V79C 4O58L 1F6LL 3OKNB 3QEQE 1S7VA 2DYPB 3HR6A 3TLRA 4YDLB 4N0YL 3PWJA 4LLUA 4HPYL 3QIBC 5EIIA 1EO8H 4M5YH 2OMBA 4JHWH 2QR0B 3V6OC 5EZJA 1GC1C 1S7WA 3DO7B 2QSQA 2NY5L 3CH8A 4U33A 3K1DA 4TQEL 3LVEA 4PJBE 5H94A 2W07A 3WEXA 3NFNA 4P23B 1MLCB 2W9LA 1X5IA 3WS6A 3L9RA 3MRLB 4ETYA 4KK5D 4S11A 1R24A 5D2LE 3D25B 2CKBB 4M7LL 3V5KA 3ULUC 1LEKB 5DJDB 5CILL 1RULL 2BDNH 1EO5A 4MWFB 1JHKL 4FFWC 4EUPB 3D9AH 3WYRA 2DQEL 3TCXA 1GHFH 5F9WB 4LSVH 2K9UA 5DUBB 1CD8A 2EXYD 5E5RB 5F8RC 4UIMB 4ZS6D 2UZIH 4WW2A 2J4WH 3CMOH 2IH1B 2NY1D 3PF2A 3MLZL 3PGFH 4OLWL 4C56B 1S9WA 1JWSA 3OG4B 5HD8C 1A02N 1H3PL 4X9GA 3HS0A 5I0ZA 2VDLH 4NKDB 2IH3A 4M9PA 3H9HA 1BHGA 2R2EA 4YHML 2OL3B 4WU5A 4WJ5A 3RDTA 1AR1C 1YN6A 3I02A 5FM5M 3WXWL 5J6GB 2W60A 2FO1A 4RZCB 1V3JA 3RNKA 4RFEA 4HDIB 4WI6A 3BZ4B 5L2JB 1F90H 3OF6A 5HDQL 4ZUUA 1W0WB 4V2BA 4AZ8A 4Z95H 2ADFH 4OFDA 1V7NL 4ELME 1ZTXL 1MH5B 3RWJA 1DUYB 1AQDA 1JF1A 4DW2H 5CD5C 1XFPA 3QCVL 1I1AA 2C9AA 3ILQD 3QEHA 5GZOC 2JJTC 2R0LL 3I9GH 2JELL 1ZT7B 4OZHF 4QRRD 3T09A 1SHMA 5DJ0A 5INDB 2OQJB 5J4MA 1FPTH 2J5LC 4BZ1H 4G9FA 1MI5A 4GW1B 3BUTA 3G9AB 4JRXB 4WUUE 3VXSD 3KLAB 4C4KT 2XWJB 4FQ1L 3KS0H 4KKCD 4CVWA 3FOMA 4G43A 1EEYA 1RURL 4HWZA 3TPKA 3I3DA 2NY4C 3ZSTA 1XR9A 4PRPA 4CKVX 1KG0A 4PRHE 3SGDH 1MQKL 4UILL 4M1DL 2VAAA 2AJZB 1B90A 4L29A 3VXRA 4PREA 5BJTA 1T6VN 1T20A 4HS3A 3O2DL 5IJVA 2AAVA 4H1LB 4QOKB 2AXFB 1IGMH 4Y16D 2BVTA 4Z77A 4QTHB 3ZDXF 1CFSA 4ODSL 5LCVH 4JG1L 3HNSH 1CDHA 2EKSA 4P48A 3OR6A 3SDYH 3C5JA 1F11A 5AAWA 1E0OB 1T0MA 4YAQB 3MRHA 4CW1A 2H45A 3PUCA 1LE9A 3MX0A 2HJLA 4JGMA 4YHKL 3BGFC 1LEIA 1RZ7H 3VMOA 4L8SA 4IBLT 2PXYD 4JO4L 4NDMA 4MXWL 3ZYIA 5HYEA 3IFOB 1A3LH 1BLNA 5IR1B 1NMAH 2QADD 4I0CC 4KDWA 1KEGH 2V7HB 5FGBC 3BJ91 2QL1A 3C5ZB 3QCTH 3ALWA 1XF2A 1R5IA 2GUOB 5HVWA 2FR4A 2N4IA 3HZMB 5HGGS 2IALB 3T4YB 2BY1A 2ZOKB 1GOFA 4JANB 3TN0B 4NRZB 1ITCA 4S1SL 2M8XA 2DF3A 5ANME 1YNLH 3X3GL 35C8L 3RGVC 2NX5D 1MNUL 2XA8L 5E6ZA 4MAYB 3KHQA 3CFDA 1MJUL 4Y1AD 1INDL 3O4OC 1UM5H 1CTNA 1MFNA 4LK4A 4WU7B 1XF5B 4JAMA 25C8L 2CDFA 3QRGH 2A6DA 3VD4A 4WGVB 2B2XL 4KJQC 4YDLC 1CFVH 4FP8L 1QSVA 1B0GA 3GSQB 3MGOB 4GW5A 1DQLH 3PHOB 3O4LD 3W81A 5FYJL 1BVKA 3QUXD 2Y7QA 3BGMA 4JFEA 5D7JD 3UTTB 1GXEA 3WN5A 5KS9E 1MCOH 2E7LA 4WY7L 1EUTA 4RA0C 1MAJA 3TVMA 2VZOA 2V2TA 3QXTA 5JMOC 2FX8L 3BRDA 5HHMB 3SJVB 1DVFD 3VA6A 1KCRH 1NAMH 1QFUH 3FFCB 4Z7QF 3M17B 3G08B 1A7NH 1KCVL 1I9IH 1T0NA 5DUPH 2CLRB 5I75B 1D9KB 3QFDB 3QUMB 1DQJA 3GI8H 5F9WC 1TCRA 4Y19D 4XWOD 3S34H 2YPKB 5T3ZE 1WLHA 3HE6B 1ZVYA 2DD8L 2MCPH 2DQIH 5BZWB 3F58H 3RWGA 3X13B 1HH6A 1ZLSL 4DK3A 1QFOA 1WIPA 4ZNEA 1MF2H 1QBLL 5GIRB 2XPGA 3V7MA 2B8OT 3SGEH 4PJIE 1V7ML 2BNUB 2OR8A 2CD0A 3HFMH 5ICZB 1JRHI 1DUZB 5DVKA 5C08D 2EYTB 4P4RB 1MCFA 3KHOA 4IIQB 1K8DA 1NKRA 1BX2A 2CK0L 1NGWB 5SWQB 5CZVL 4FQCL 1I3GL 5KVFH 2NY7H 4HKBB 4PG9A 1N2RB 2HLFC 5ID0A 2CO6B 4ODTL 4R2GD 5CZXC 4F2MB 2ARJB 3HUJA 1YMME 4OCRH 3U6RA 4UBDC 4BUGA 3B9AA 1M6OA 5BV7H 4KTEH 4K3GA 3Q1SL 1AXTH 1KENH 2WNGA 4Y5XB 5K9JH 3BH9A 1MHCB 3QA3A 1C16B 4X6EB 1JCKA 1RU9H 3VFVB 3DUSB 4M7ZB 1JGLL 3ARGA 4U6XA 4EN3A 3QWRD 3EJYD 1QSZA 4QHKJ 3RAJH 4LLDB 2VXUL 1GL4B 1QHOA 1DBKH 4OZ4A 3MOBL 5JPMA 3V52L 1CDYA 3HAEH 2PW2B 4NRYB 5C07A 1MFAH 5EORL 1A4KA 1EEZB 4K7PL 3VXNA 3IU3A 1FFPA 1MUJA 4LNVA 3NGBB 1Q38A 4KI1A 3IGAA 5E08L 5E7FA 4XH2A 4P5KB 3QQ4B 3A67L 3K81A 5CP7B 3WXVH 1XH3A 4DCQB 5JQ6H 1AXSB 5I2IB 4NJAL 2ZUUA 2FJFA 1A5FL 4WI7A 3UTPE 4BM7A 5C9JB 4PLKD 4IOIA 5I71B 4LIQL 1I1RA 5F3HA 5DRWA 4P5TD 1UYWH 2UWEA 3MFFB 4X0KB 1OGTA 5SV3A 2R2BB 1N64H 2A83A 2HRPH 4MA8L 4OZHA 5BMFL 1WWCA 4PV8B 1A14L 4OZIB 4PS4H 3P11H 4P9HC 4HIXH 1QYGL 4GXVH 1TTFA 2P8LA 4EDXA 1FH5H 2K3TA 4HS8H 1P2CA 2VDKH 4PJDE 5IQ9B 1R3JB 3P40A 4NSKA 4OLXL 3RWHA 5EOQH 3HI6L 2X4QA 4PG2C 4JRYE 4M43H 4WHCA 5BXFA 1DLHA 4XMLH 2Z91A 3IF1A 3TN0C 4Z6AT 1F3DH 5F88B 2VDOL 5TE6L 3R8BB 1A6AB 3BIKA 4OFVA 3JWDL 1JP5A 4Z7VF 1E4WH 4PJEB 4W81A 5DEGB 2KZ1B 4M7LT 1A6VH 4Y2OA 3FMGH 2VXTL 1BREA 2J6EL 1LK3L 1A2YA 1I8KA 5D6DA 5K33A 5L6YH 3GSUB 5ETUB 3GB7A 1G7JA 3W2DH 3P4OB 3NBNA 2G5BA 3EKCA 5EO0B 5FM5O 2XN9E 4X6DB 3EO9L 5DRNB 3ARSA 1WAAF 4X9BA 4U3XA 1W2KT 1C1EH 1MRDH 1CICB 1VHPA 2MQ0A 1SBSH 4RRPA 4WTWA 5K59E 5F9DC 2ZJSH 4LSPH 3AXLB 3R06B 1GGCL 5DURD 1QA9A 4WFFD 1S7QA 5DQ9B 1V8HA 3T2NL 4C55A 2YRPA 3P9LB 1CIDA 2KQNA 4KMTH 4B5EA 2AI0H 4JKPH 4AENA 3QEQB 1TETL 2DWEA 2F58H 2BHUA 4H8WC 3MV7E 3GO1H 5HDBF 3T0EE 3CDCA 1AO7A 3QDGA 1IFHL 2ESVB 4XNYH 2UUDH 4E41A 4QO1A 4W6YB 2HFEA 3TWCH 1F02I 5I75C 1D9KC 4RIRB 4IMKC 3C2AH 1FO0H 5E1AB 5HYFA 4B0MM 3BZEA 2C1PB 4TPRH 5A2IH 1K4DA 4PB0H 5D1ZD 3MXVL 1TTGA 5CJXC 5CEYA 5EFIA 4JFHD 1FVEA 3D69A 4CNIA 2X4PB 4J3UA 3U2SB 3KPPB 1JPGA 4FZ8H 5D2LB 4NBYB 5E1HB 3HAEA 4NOBA 5DRZB 1P7QB 4X5XA 3CX2A 3T1FB 3A6BL 2M2DA 3DVIA 4WTZA 2FYYB 4X8JA 3QXWA 3LEXB 5HYJB 4IIQC 1HINH 3SKOA 3LKPA 1X5XA 2VXSL 5EU5A 4LCWE 3MRMA 4NGHL 3G6AA 3VMPA 1EAPA 1LNUB 1WISA 1GOGA 3L3KB 4C54A 4GRWE 3KWWA 3NCJH 3D39D 3TIDA 3QG6B 3ARFA 5KN5A 2APFA 4RDQF 2Z4QB 4W4OA 3W0WE 4GAGH 3BKYH 2B0SL 1QKZL 1ZK9A 5F96H 1GGTA 3BP6A 2VKXA 5FYLE 4M7ZC 3SE4A 4X6FB 3S3PA 1NCAL 4KRNA 3LD8C 3B9EA 1MJ7H 2YC1B 1BFOB 3O45A 5AZ2L 4HCRA 2FDBP 3QUKB 1Y6NR 4RISL 1MI5E 3VGBA 1T7VA 1BIIA 5FOJA 5H2BA 1A4JA 1BAFL 1XCQA 2DQTH 5JW4N 1HHGB 3NH7H 3QIUA 4YHNB 1T5XA 3FO0L 1Q9LB 3NGBC 3MREA 1JNLH 5HGDB 1E4XL 2IQ9L 1F3JA 1WCQA 1XIWD 4L4VD 4UINL 5FYJE 3RPIB 4HHAA 5ICXB 2E6PA 3D6GA 4XBPA 5C0AE 5C0FB 1MRFH 4IJ3B 4HUXB 1UT9A 5FYKU 2F74A 2LV4A 3QQNA 2G9HA 2WMPA 5I71C 5CJQL 4HG4J 1NMBH 4Y2DD 4PRHB 3BD5A 3D0LB 3S96B 5MENB 4IHOB 5DVMA 3FB7B 3LSOA 4Y89A 1FNAA 3OZ9L 5DD0L 1A7QL 2GY7B 5EBWB 5JW3L 1RJYB 1J8KA 4UT6L 4ZQKB 3FT4A 2NY6D 4J2XA 2P5EE 1MHEB 5DO2C 8FABA 1J8HA 3V6FB 4HWBL 1GVIA 3UTZB 5C7XH 2GHWB 4NM8L 2JK5B 1QTYT 4YDIL 3P30H 4QEGA 3DRQB 4K71B 5DJYB 4LAQL 3HNTH 4KMQA 5J7CC 4H0GA 1YJDC 1S9YA 5I8KL 1BFSA 1NUGA 2ICWB 3BYTA 5ITBH 4KVNL 4YBQD 1D6VL 5I16B 4OI9A 1ZT1A 4HQQH 1RZKC 3TEUA 3SHSA 3GSWB 5T5FH 3VFNB 1FC1A 3FT3B 1G0YR 1B2WH 1TQCB 1AKJB 3FT2A 3GMRB 2VLKA 1RIHL 3IJYB 1KPVA 1F4XH 4WEBH 4OBRA 2H8PB 3VWJB 1A9BA 3D18A 2DLTA 4LLYB 4OCNC 4DGVL 1ZLUK 1OP5K 1RY7B 1DBBH 4MHHG 4M48L 3LN4B 4X7SH 1D6EA 5TE4H 3F7VB 1IGJA 1KJ2L 1WZ1H 5ANMB 3STZB 3KPSD 1CICC 5HYQB 2AK4B 4RMWA 3JBG7 5C6TL 1VPOH 1Q9KB 3BE1L 4JZJA 1HKLL 4X99A 5D6CA 3LV3A 4Z7UB 3CXHJ 5BVPL 1BBDL 3B8YA 4LSUH 2FL5B 3V4UH 4KI5C 5BW7C 3HZVB 4KRMB 2KQMA 4QRRA 1UZ6E 4PRNA 4EBQL 3Q48A 5ISZD 4GBXD 1F6FB 3BESR 3PQYD 4BFGA 2YSSB 3LEYH 3MV9D 1YECH 1MFEL 4Y4KB 5IW1A 1QQDB 2UZXB 4MNHA 5CIPH 4QXGL 4Z7VA 3GK8H 1RAMA 4UUJB 1OAUL 1G7LB 5IM7B 2VXQL 3UYRH 3JV0A 2HVKB 1FE8H 4M1CC 4WW1B 3RBGA 1MIEL 1U93B 1G7HB 3U30B 5EZIL 4DUXA 1T22A 3MRDA 4N68A 3ZHKA 5AD0B 3K74B 1KIQB 2YBRB 3TBVB 2E7CA 5EWIL 1CVSC 3QXAB 1CK0L 4UT9L 4RWYL 3H8NA 3KLHC 3QEGL 4ZNEE 2VZ1A 3DHMA 3TO4D 3D3VA 4P9ML 3C6LB 3S36L 3SDAD 1N6QH 1RK0A 3PV6A 2PCPA 2ZWLT 2PN5A 3RL2A 5FECB 5JHDB 1WBXA 1ZANH 1GZPB 5CJOL 3TA3B 1A1MB 2HJFA 2CK2A 5ESVA 3RA7H 2ATPB 2B5IB 5JNYA 2ERJB 2CLZA 4JB9H 3C60B 4U6HB 4J4PD 4KZDH 4U6YA 2AEPL 4AM0A 2BNQD 3PGCB 4HGWA 1BD2D 3TCLA 1TVDA 1V3KA 5E2TL 5C0CA 1A6TA 3O3BB 1UQSB 1LEGA 3PWVB 1DP0A 4LLQB 3CVHH 3BKJH 3JXAA 3H7BA 4R96A 4U7MA 4JPKL 1JPTH 4LEXL 1FZOB 1T1XA 3D85D 3QG7L 4X83A 4JN1L 2BY0A 4PBWD 3JZ7A 4GKSA 2YA0A 4GQPH 3HI1B 1C7TA 1X5AA 1DN0B 1I75A 4XNMB 2A0LD 4BK4A 1NGZB 1L0YA 4ZSOA 2DQHH 1FP5A 1YMMB 1IQWL 2NX5A 4WWKD 1UZ8A 4BZYA 5I0DA 2ADGB 4DKAA 3WFZA 3DX8B 4Y1AA 3VGFA 1TVHB 4LPUA 2P4AB 3BPLB 1A1OA 4O51A 1NUFA 5AUMA 5LGJB 4UQ3A 4XHJD 3ARDD 3BQUD 5DJ2B 5KOVC 2YWZA 3ZTNL 3GSNB 5IMKB 1G7IA 1JHTB 1FFOB 3MOAL 3WLBB 1X7QA 1XGUA 1YDPB 1C5BL 4IJ3C 3O4LA 4YK4C 1RFDL 3PWUB 3QUXA 4N8CH 4NT6B 4XCNB 5D7JA 1KTLA 5ESQB 4RMQA 3VFOB 5ABDE 3QIWD 2FCBA 4YBHA 4UIKL 3E1F1 5TH2A 4OIBA 2HFFA 4EVNA 2GAZA 1R5VB 3GRWA 4KFZC 3CFEB 4MZ3A 2FSEA 3EOBA 2BSRA 3KPNA 1BFVL 4J8RB 1DVFA 1QSFD 5IGXL 3VWKD 3O8XB 4XCEA 4OZHE 4EI5B 3MRBA 2IAMC 4RX4D 4JFFE 5SX5K 1MAKA 3TO2A 2AJYH 1BMGA 1YUHA 5EO9B 3OKLA 3MLTA 5EUOF 4F15B 4CN1A 2J8HA 5TQ2L 1BZ9A 1NBYA 1IVLA 1CDBA 1FBIL 1RZIB 3WCYA 3EDFA 4S0TD 3WDJA 3RNQA 4YX2H 3IDJA 4GMSH 4F7EA 3H0TB 3SE3C 3RWDB 4N0UA 1IT9L 4XXCC 5CIPA 5KZCD 3WKNA 3EYOA 4OD1H 4UQ2B 2X70B 1QPXA 1A3RL 2O5XL 4U1SB 5I19L 1OCWH 1ZGLB 4ODXB 1R3KB 3VWJC 5DD6B 4QHLB 5IF0A 5L7XH 3ZDXE 3OQ3B 3WIIH 5C08A 2A6KA 4JRYB 5TF1L 1SY6H 2WIIB 4MCZA 1IRAY 1YEJL 3UPCA 1F4HA 1FGVL 5FYKD 4JR9H 4LOUD 2YOCA 4PJGA 5TFSH 4MGXA 4JQIL 4BYHA 4GG8A 1N5AA 5I1GH 3SE9L 4JPIB 3WSQH 3FQRB 4KU1A 4NO2B 4ODWB 1ZHBA 2YMXH 5C2BH 5DJZA 5JDJA 4LLAA 1GSMA 1RZ8A 1FYTD 1HZHL 3H7LA 1T7XA 2J8UB 1Q1JH 5J6HB 1HWGB 2L4OA 3MACL 4XPGL 3QNYB 3K80A 3I50H 2BMKB 2VDRH 2OJEA 2XN9B 2CGRH 1VERA 4NKQB 4C83B 4M8QB 1J0KA 2B39A 4Y4KC 2VL5A 3SBWA 1AO7E 5MEPA 1KELH 4OUUA 1CBVH 3MLUH 1XGQA 5C0DA 1FORH 43CAB 1GH7A 3H2WA 4P5MA 3MJ9L 3S6CA 4PRIA 2QQQA 3CFIC 2C4XA 4YHOL 5HPOA 4CVXA 4M5ZL 1G7PA 5DWUH 1T0PB 2EYSB 3FOLA 1FIGL 3MV7B 5EU6D 1DQML 4MD0B 4ZUTB 1OF2B 1OTUC 5F9AC 1C08B 3GMLB 1QLFB 4JFZL 4G8EB 2DM2A 3C6LC 4KRPD 2N56A 1RIVL 2XXCB 1ZAGA 5FCUL 4NKIL 4X6BA 4LCCA 5C0JA 4JHBA 4DOHB 3TA3C 4XP5H 3MBEC 1G9NH 4D0BB 1BJ1J 1ZLWK 2B5IC 2DJ4A 2DQDL 2ERJC 1MPAH 3RX8A 2VR9A 3C60C 1HSBB 1JYVA 3DURB 5D5MB 5DEFA 1CF8L 1N5YH 2C3VB 4OFPA 1CFTA 3ULVC 1X5GA 4Z7QE 3EO1B 4ENED 4XPAL 2HVJA 1I3VA 4GRLB 3OKDA 5J1AA 5E8NB 5F1IA 4F37K 5EH1A 2IPTL 2R56L 3GUTB 3QAZB 1N59A 3RWEA 1HDMB 3QXDA 1HHJB 5C09D 1L9NA 1MCPL 5DT1H 4MLSA 1CQYA 3TBYB 3LRSA 1R0AL 3REVB 4YGVA 4I77H 3E3QC 4X7CC 4XNQB 1YQVH 4M7JH 5EUKA 3W0WB 2JB6A 5IG7B 3DETD 4MQTB 2VITB 3O41B 1T21A 4OM0H 4XAWH 2F54D 4HPOH 1UM6H 1PX3A 2P5WA 1NGXA 2Q8BH 1TCMA 2E9BA 4CMMA 4QTIL 1M1SA 4GMTH 1P53A 3R0NA 5GSVB 4GKNB 4O5LL 3GSXB 1UXWA 2QQKL 3QO1B 2G75B 4XT1C 4N1EA 3BT2L 2HH0H 5IHUH 4HBCH 1B6UA 2IQAA 4ODVH 1T03L 1FL5B 3MCKB 1ZEAL 3HRZA 3KXFB 3Q6GL 1WFTA 4PJFF 4U49A 2H3NB 5JXEC 1IL1B 1J1PH 1W72L 3DTXA 1OGAA 5EBLB 4YFDB 3BPCA 3O8XC 1YNTA 4YHPA 5FHAH 3O6KL 4WO4D 1A6UL 4HKXB 5JR1H 3HLAA 5C0AB 1ND0A 4CBPA 2NPLX 2YPLD 3GSVA 4F15C 2V5MA 3RBSA 5IFHL 4E9LA 3D2UD 3GBNH 2IPUG 2VH5H 2CJUL 3OPZL 4M6NH 5F97E 4YDKL 3R1GH 2W1NA 3ZHDA 3JV4A 1JGDA 5DJAB 1QLEL 2EE6A 4U1LB 3MOQA 5D1ZA 3PL6B 4WUKL 3SKUD 3MRNA 1HHIB 4OFIA 2XKSA 4WFGE 3G04A 4YEEA 1NCDH 4GXUN 2P5EB 4UDTA 4FFZH 3TT1H 5I1HH 1AGDA 5TDNA 4UTBH 1CD0A 1TJGH 4X4XB 1KIPA 3BKML 3KYNB 4L1DA 3T8XA 1ONQB 1S9KC 2VLKE 2VLJA 4YFEA 3OJDA 5B38A 5D7KE 3SPVB 5GGSB 3O6LH 3CGTA 2FGWH 1KV3A 1ZWIB 5HHVL 5L8JB 1QOKA 1TVBA 4NC1E 3RP1A 3QSKB 3FZUC 5FOBB 5IEHA 3DARA 4MQ7A 3V6ZA 3THMH 3VG0L 5GZNC 1YC7A 4G3YL 3WKML 3HI5L 3U7WH 5DS8B 1ZVHA 1MFCL 2CR3A 5JIIA 4DGYH 3KPOA 4RGOL 4XVSL 5EUOA 4XHQA 5JTWA 4AT6A 1P7KA 2ZCLL 3F12B 3LZFH 1AGCA 2IFFH 4JKWA 4MJ6B 5GGVH 5K9KA 5SWZB 5GJTL 5K9QG 1Z9LA 4AIOA 2ENYA 1D5MA 1T66C 2J2ZA 3UTSB 1QEWB 1MWAL 4LHUA 2DKMA 3FB5B 5B4MD 3KYOA 2IC2A 2FZ3B 1GPOL 4L9LB 1YMHB 3DLQR 1JIBA 5D7IF 3C08H 3GSOA 1U95B 4Z7VE 4NPYB 3RWCA 2A73B 2LU7A 4JQVC 5IV2B 5ACLA 3HCVB 5CJ5A 3MLVH 1WQVT 4Z0BL 1IQDB 5HTSA 5IB1A 3SKJH 1EHLL 2I9LB 1FNHA 1P5VA 1A6ZA 4Y4HD 2LAAA 4G8FA 1CFQA 2W65B 3Q2CA 1WAAE 4WDIB 1FZJA 2YZ8A 3U0WH 5TPWL 1N0XL 5HY9A 4PP2A 1CD1A 3MSPA 1QR1A 1HKFA 4FFYH 3UPRA 1BQLH 4OIIL 4I5BB 2C3XA 5T3XD 1JNHA 5C8JB 3MODL 3X11B 2W91A 4WNQA 4XXDA 5HDBE 2FJHB 4HKZA 3VXTB 4Z76B 3S4SB 4GRLC 1GJIA 4FXKB 4M7KL 1CL7L 1SVCP 4HD9A 1J1OH 3W9DB 3QZWB 5C0CE 1P1ZB 1PG7H 3VFTB 3QAZC 4KK9C 4S2SA 2W0LA 3RZCB 1IM3A 3VXUD 3EYVA 1J05B 1I8LA 4GG6A 3O0RH 5HJ3A 4LPCA 3O6FD 1P4IL 3B3IA 4PRBB 4R90H 3X3FH 2LAGB 1Y18B 4ZSOE 3L3IA 2DQGL 1MJJA 1SYVB 2LABA 1PD6A 4ORGB 4B7IA 3PJSA 5GS0L 1FNFA 1OAXL 1WT5C 2EECA 3QFJE 5GRVK 5E8PA 2CRMA 1OHQA 4RA3A 3VDCA 3UZEA 1YEKL 5E9DE 1TMCB 4ZUSB 4EXPX 3UZVB 5E95B 3GJEB 4XTRC 4APQD 2R8SL 3HMXL 2BCKA 3L3GB 4KK8D 3S3JA 4JDVB 4OCMC 3ZT7A 3BZFB 3TC9A 1D5XB 2HLAB 4NM4H 5IBTH 3DV6A 2L7UA 1NGQH 2D7TH 1AHWB 1BM3H 1WFUA 4JZOB 4M3KB 4KQ4H 3RHWF 5D9SB 3VRIB 5KVDH 2WBJB 1LO4H 2GSIA 1X5HA 3BUYA 5IB2B 4LRIA 3RKDC 5EC2B 4GSDL 2OP4L 1JV5B 4F7MB 3BKCL 5TDOB 3T2OA 4Z8FL 4GBXA 2W9EH 4KPHL 3PQYA 1S5HA 4GO6B 4NKMB 1KJVB 4KGLA 4HXAL 3X12B 6CGTA 5I1AB 1URLA 1N8ZA 1AJ7H 1IEHA 2BHZA 2ZKHH 5D2NE 3T0BA 4P23D 3ZL4H 3CIQA 3P9MB 3TBWA 1PYWB 3OX8B 3PL6C 4PY8J 4ZTOH 3AAZB 5ESAA 2QHRH 4JY4B 4X4ZA 5DHVH 3ESVF 1QSEB 4P57B 3L7EB 1HI6B 4ZUVB 5IVXF 3P77A 3MRIB 3NCYP 4YZFF 4M00A 5FYKH 1J88A 1EZVY 1E4KC 4K3EL 3PWPE 2GJ6A 5FDWA 1KB9K 1QRND 3VXOA 3SDXA 2NW2A 1H3UA 4U6VH 5EZLB 1K2DB 4G7YH 4NFBA 3KYMB 4OD2A 3SDAA 3TT3H 3G6JE 4DWHA 4XBGB 2AABL 5ALBL 3EDDA 1IZKA 1MHPH 5ACZB 1PQZA 3CXDL 5CMAB 5DK2A 5HI5C 2BHYA 5FIEA 2WP3T 4HIIA 3ROOA 2A1WH 4PRDA 1FNEA 4QNPF 4JDTH 5MEQA 4ESKA 5B3JF 4J4PA 1OB1A 3BJLA 3X17A 2BNQA 3OWEA 3O11A 3VFRA 3BP4B 3NFSH 1RUQH 3D0VB 3WJJC 2ITCB 5D93B 2BJMH 3OAZH 1SJHB 2XG4A 1XGTB 5JIPA 4L8BA 4BZ2H 1FLRL 1N6VA 5JW5B 4PYHA 5CBEA 4L9LC 3DROA 4WWKA 1PG7X 2VSDA 1KC5L 3SGDI 1NJ9B 4GAYA 3FONB 3OKMB 1SJXA 1JFQH 3IDGB 2H32B 4XVTL 1I7RB 2H2SD 3CDGB 2BDNL 3ARDA 4G8IB 1DEEB 4FN0A 4PRIE 4E42A 1GHFL 4MD4A 5I8OL 2DLEA 4HZLB 2JCCE 4IOSD 3ALPA 4N1CA 4JRXD 3ULUF 1Q0XH 2G60H 3SDCD 3PNWB 2UZIL 3B9DA 4IRSA 1JWMA 2J4WL 2NNAB 2OXGA 1BGXL 3CMOL 3LQAH 5J11B 5E94A 1QVOB 4N0RA 4Q9CA 3U48A 1VEOA 3QIWA 4M6OL 4HUNB 2C1OB 1I3RA 3W82A 1OTTD 4H0IA 4TUOA 4R4FH 3ARBD 3P4MB 1QSFA 1XF4B 1MEXL 1YY9D 3QUYD 4J1UB 2VWEE 4TTDD 3UAJC 3VWKA 3FRUA 3MLWL 5IESL 5CSZB 1TZIA 4RX4A 2BK8A 1F90L 1M71B 4QRQA 5I1IH 3AS1A 3BXNB 1FZMA 3EGSA 4CVUA 1ORSB 4WHTA 4Z95L 2ADFL 4XGZB 4CADB 1TJIL 1MCQA 2EDOA 3N9GH 5J12C 5FGSA 5IB3B 5I17B 3RZCC 4I4WA 4KKBD 3CFJA 2R2HA 3QISA 1Q0YH 3JWOH 4YDJB 1U8QA 3I9GL 3E6FB 1CR9H 3VD3A 5LVEA 3K46A 4BZ1L 4KZEH 2EIBA 3C5ZD 4MNQD 1KB5L 4O02L 4YE4H 5CINH 3DVNA 4ODHH 2Q87A 3FQUA 1DLFH 1F5WA 2CLVA 3LN5A 4X5WA 5F9OL 5GGVY 1K8IA 4F3FB 1CGXA 4XC3H 3BPOB 5E7BA 2NY3D 1FG2B 1WZLA 2BNRD 3K8MA 5IQ7H 3DVGA 1RJLB 2CUIA 1QLRA 4PP1D 3ZKSD 2P5WE 4LLVB 3JWDC 3WDHA 3GMQA 4MAYD 4U1HB 4OBSA 1AHWC 4LSSL 3LB6D 2ADJB 2P8MB 2BP3A 4V1DE 2WBJC 3NPSB 4A6YA 1OLZA 1JGEA 1DCLA 3CFCH 5F7KC 2NR6D 1YPZF 2AEIT 4U3CA 3RPKA 1Z5LA 5JUEH 3HNSL 4AL8H 5C6PB 1NC4A 3ILPA 5JLZA 1EO7A 3PXHA 2R1YB 1KJ2B 3LKQA 3VDAA 4MQXC 3UTTD 4PGDB 3LKSA 4Q9RH 3BX7C 3HC4H 3PDOB 4ZPTB 4XPTL 1RZ7L 4L4TE 4LPWA 1BZQK 4S0SD 3L7FB 1IGTB 5C0BE 5HHMD 1II4E 5DZNA 3VFUB 1A3LL 4MJIA 1PLGH 5IMOA 1IBGH 5DMIH 1KEGL 2MPAH 5JIKA 1OM3H 5B39B 3SGEI 5EU6A 5IW6B 1E4JA 5E8DL 1LO2L 2X1PA 3QCTL 3MRQA 1JGUH 1W0VB 5B8CA 3SCMD 5C3LD 4DZ8A 4FXGB 1LK2B 5M95B 4XNXH 5KSAD 3FB6B 1F3RB 2JKXA 5IWLC 5GRUH 3HE6D 4R4BA 2ATKA 5GISH 2A2QT 3QPXL 3MMEA 4LRNH 3NN8A 1YNLL 4FQ2H 3VRJB 2WW8A 3MV8A 4QRSB 4ISVA 3LS4H 4FMFA 4O2CA 2VLJE 4M4PA 3G6DH 3QPQC 3QHTC 3RVWC 1K5NB 5D1QB 5GGQH 3H42L 3U4AA 5CSBA 4AK1A 4G42A 2VRAA 4Y4FD 4NQVB 2FEDC 4UT7L 2X4NB 3QWOA 2PYFB 2BOBA 2V5RA 4IRJD 3MC0A 5EOCH 1DQLL 1I1YA 3EYUL 4R7NB 5A2LH 3RGHA 3GM0A 1WUNT 1U92B 1DBJL 1I7ZB 2H41A 5JW4Q 1P5UA 4PJ5B 5D93C 1AC6A 5EUOE 4QXTB 2QSTA 2Q8AH 3B2UC 1MCOL 2F53E 2K1MA 2YD9A 1JVKA 2JIXA 1I8IB 1U8HB 3S35H 5HHPB 2AJUL 5I18H 4OGYL 2X4SA 5IHLB 1T89C 3OB0H 4XBEH 1NAML 1QFUL 2GK0B 2XZZA 3PXJA 3QCUL 3EBAA 5GGRY 1A7NL 2XNAB 4K3DH 5GJSL 4OZFG 3DXAD 4FNLH 4RGNE 1H8SA 5JHLH 1T2QL 3GI8L 4N8VB 4U0QB 5DQDH 2EYRA 4OF7A 1BZ7B 5CEZE 5CZKA 4PRAB 4TSBL 5T3XH 2EH7H 3UBXB 3DPBA 2D4FA 2WQRA 1UCTA 1U8LA 4KTYA 3RIFK 4YXHH 4OM1L 4M8VA 5GSRB 1U2HA 5F44A 1R3IL 2DTSA 5DC9B 4R4ND 2V5YA 2APBA 4YHLH 5T1LA 3NA9H 4LF3A 1NMCB 4WO4A 3DX7B 3QIBA 4OZFH 4P2QA 4DKFL 5DYOA 2OBGA 1XZ0A 4QY8B 1LO5B 5KVFL 1HXMB 2IBZY 5DI8B 2NY7L 3O9WD 4JHZA 5E8OA 3D2UA 1A7PH 3ET9F 3OXRA 4LPTA 1GAFH 1U8IA 3IDNA 1F4WH 5IIEB 4JQXA 3QBTB 2I26N 4NQED 3VXQB 1Q9OA 4U1NB 2GT9B 2PR4H 1BFTA 3IAPA 3PP4L 1HOCA 4PY7B 4KTEL 4HWEL 3KAAA 1AXTL 3ARTA 5HI4D 4KWUA 5K9JL 2SEBA 5I8CA 4JFDE 2WAHA 1S7RB 3ARWA 5SWSD 2P42B 5IBUG 2HTKD 4BQBA 3DWTA 2IADB 2OS7A 3RAJL 2DWDB 4YQXH 5FA4A 2VO5A 3TH4T 5CP3H 1YN7B 3IETA 1R3HB 2FNBA 1DZBA 2DM7A 1KGCE 1CLZH 4F8TA 3J8F7 3MJ7B 3C8KA 2AJSH 4HUVB 5F70A 2EE2A 3U9UA 2PO6D 2D0FA 2Z35A 1RUAH 4DTGH 3RQ3A 3I2CH 3NPSC 1V3LA 1I7TA 2BZDA 2HG5B 1IAOB 4G6FB 3QFJB 1YEEL 3OJ2C 1TZGL 3SDDD 2AS5M 3WXVL 5FKAA 3LHPH 1AE6H 2FO4B 5E9DB 3JSSA 1OSZB 4GLRH 3SEPA 5IVOA 4RAVB 1JF5A 3FB8A 3QDME 1N64L 3G5XA 2CKBH 2HRPL 1KLUB 4H25A 4MXVF 3HZKA 1PKOA 1KJ3H 1WEJH 3G5ZB 3SQBA 4XP1L 3WIFB 4OCWH 4QHUA 4HUKB 2JJTA 4HIXL 2Z92A 1NGYB 3QEQD 1GC1L 4GXVL 5DFTA 3TYGH 5F7YC 1ZHLA 4NKOB 2VISA 1DFBH 1YEHH 1Q94B 1FNSH 4HS8L 4MJ2A 4Q2ZA 4PFEA 4NRXA 3TJHC 4Y4HA 1T80A 4L5FH 4HJGB 5FKPA 1VENA 1KCKA 2J3SA 3Q5YA 2IBGA 2B1AH 3BN3B 4YHYB 1ACZA 2GJ6E 5BS0D 2R0ZH 4NQDE 2OL3H 5KTEL 4HFUL 2VDML 4XP4L 2HTLC 4QYOB 4GKZB 1MRCH 5D1QC 3QZWG 3TBSA 4PJFE 1YQ2A 2JJVA 3JUYA 5KVMC 3ZTJG 5GGTH 4HKJB 3VXPB 4EEEA 5CJBA 2OR7A 3HR5B 3OKEB 1IEBA 1HYSD 3GHEH 5H35A 2DIJA 3GKZA 5CUSH 1OP9A 3WIHL 2VIRB 2HP4A 3G6JB 4FHBD 4BSWA 5BRZB 2N7AA 3GI9L 3QDAA 5FUOL 1BWMA 1C1EL 1WC7A 1MRDL 4RQQB 3Q6FB 2ZJSL 2GITA 2WWMD 4LSPL 3TZVC 3EO0A 4LPXA 5BO1H 1ZOXA 2VDPH 3DSFH 3VXUA 4ZOBA 4Z5RB 2HFGL 4Y8AA 4KY1L 4KMTL 4P2RB 3EJZC 4OF3A 4XZUB 3H3KA 5I15H 1NLDL 2D0GA 3GO1L 4O2EA 5HXMA 5FGBA 2WWKT 4X4MA 5D8JH 3MRCB 1MOEA 1HHKB 4OAWB 3LQMA 5FK9B 3C2AL 2FBOJ 3GFUA 1FO0L 2HKFH 5BVJA 5KVEH 1GGYA 2ITDB 3O3EA 4X9IA 4JO3H 1BEYH 3RGVA 3HB3D 3DYMA 2LU3A 4H1LH 1ETZA 1S7UB 1FNGB 3RU8H 1I7UA 3INUH 5F7DB 2ZSWA 4ZFFA 5CP3A 1ZHNA 4FZ8L 2R0WH 3L3OB 1JNJA 1P6AB 2IANE 1U3ZA 5E6IB 4F33B 4ZPVA 4HGMA 2DYPA 1WZKA 1HWHB 1EVUA 2UUDK 5E2VH 2O5YL 1NMCC 2HJKB 4PJCF 5D72H 3VXME 3WUWG 4P4KD 2JCCB 3SGKC 4I2XE 4WUUD 4NWUL 4RFOH 4YBLB 2QR0A 3BSZL 2D03H 1EA9C 4PRHD 4ZD3H 4LCIL 4NP4H 1Q9WB 3IDUA 3P2TA 3SGJC 2ZG2A 4P23A 1W72B 5D7IE 4LFHG 1UJ3C 1RVFH 3MRLA 3MJ8B 4UNUA 1QACA 2DJUA 3AU1B 2VLLB 2CR6A 4GAGL 4N8PA 3D25A 2CKBA 3IFLL 5DJDA 5I1EL 3S5LB 1BJMA 4JM2B 2KH2B 2ZNWA 1JPSH 3LKOA 4ZXBB 4EUPA 2WLZA 2Y36H 1S7XB 1YEGH 1QRNA 2EIZB 2VQUA 7FABL 3B9KC 3S8WA 3TH2T 1O5DT 3UC0L 5I9QC 2ZZUT 4OV5B 1D5BB 2YK1H 4UIMA 2X4OB 4ACPA 3PHQA 3JV6B 2VZTA 4PBXA 12E8H 1JGVL 2ADIB 1SBBA 4WV1B 1XGYH 4NKDA 1FVCB 3M8OH 3FN0H 3OGCB 2OL3A 1IGYB 1JE6A 3P0YH 4S1QH 4NNXB 2LVCA 1MRFL 4I3RH 4RZCA 4NHUB 4LMQI 3BZ4A 5L2JA 4S1DD 3DO3A 5HDLA 3V8OA 1V05A 4M6MH 1W0WA 3RJDA 5GGTA 2FEEL 1NMBL 3LRHA 1ADQH 5D70H 3IXTA 1MH5A 4HF5H 1DUYA 5TGBB 2XY2A 3NIDF 4Z7NF 3V0VB 4V1DB 3QUMH 4NIKB 5HHXH 5F7EH 1ZT7A 2EH8H 2LTQB 3HG1B 5INDA 3RUGF 4UV7H 1NFIA 2OQJA 4OZIF 3DMMB 1JYXA 5AG8A 3CPLB 4U1IB 2Z31B 4GW1A 4K3HA 3V4VH 4MJIE 1MWAB 4NQCB 5BQ7B 5FCSH 3GMMA 4JRXA 5DMKB 1KCUH 3KG5A 2XWJA 3KLAA 3MLSH 4F9PC 3U79A 3HNTL 2PKDA 3TNNB 4YHYC 3X14B 1CE1H 3BEVB 4L4TB 5HGBB 5J13B 2AJ3B 4I0PD 4M03A 2MQCA 5ADPH 5DDHB 1B2WL 5L2KB 3VFPB 2HMID 1J1XH 3T77B 1F4XL 4WEBL 4DN4L 1EUUA 1CLOH 3ARBA 4H1LA 4QOKA 3E6HB 1EK3A 3TGXA 4WEUD 1JHLH 3TM6A 4QTHA 5MHSE 1PBYA 4OGZA 3OAUL 4X7SL 4YHIA 5TE4L 3V5HA 2OR9H 1WZ1L 3K4DA 3BH8A 4YAQA 2ZPKL 2UV3A 3PWJB 4LLUB 4ONHB 4WHYH 4X6DF 5GRWA 1VPOL 2D9CA 2XRAH 1EDQA 2BVOB 5DD5H 3IB4A 1S7TB 5E5UB 1TFHA 4UOW0 4XPFH 5MERB 2X4TA 2BVQA 4OGAD 5T33H 3V4UL 1U8JA 5DHXB 3IFOA 5J3HD 5IR1A 3H9SD 3QDJE 2V7HA 5EG6C 3NFNB 3OGOE 5IVXE 4YZFE 2FB4H 3GGWB 3C5ZA 5F1NB 2ARWA 4ELKB 1YECL 4KI5F 5T1MB 4XPHH 4I18B 3HZMA 3VGAB 2IALA 3KGRA 3GK8L 4AIZB 2ZOKA 2BNRA 4JANA 3EDEA 5LWYH 1H3TA 2F53B 3T0WA 3TN0A 1ZT4B 3LOWA 1OP5H 1ZLUH 3UYRL 4EQ2A 1A6PA 1FE8L 2IEPA 2X1QA 3B8SA 3B5HA 1K6QH 4MAYA 1I4FB 2IG2H 4QNPE 5IKCB 4WU7A 4WW2B 2E7MA 5D7SH 4NN7B 3V0AC 1S3KL 3DYPA 4FQJL 4RGNB 3LEVH 3U1SH 4F7TB 5FUCE 2R15A 3MGOA 3GSQA 5D2LF 5C86A 3PHOA 4FQXD 1WK0A 4KKAD 2Y07L 5LAXB 4WJ5B 4YBLC 4DGIH 1WJ3A 3LQZB 1ZANL 2W60B 1KFAH 5A40E 3UTTA 1GCFA 3DOSA 2B4CC 3RNKB 4Q9QL 32C2B 1AGBA 3NCEB 1OD9A 1LDPH 4EI6B 4XP6H 4JB9L 4G6AD 4ZUUB 3V6OE 5C1MB 1TTUA 3LIZH 1B0RB 3UX9B 1ADQA 3SJVA 4I9WE 2VB5A 2R23B 3FHAA 1RIUH 3M17A 3G08A 4YFLF 4EI5D 3CVHL 4CAGA 4JM2C 1FC2D 1A47A 1G9EA 3QI9B 2M26A 3WFCH 2A9MH 2CUMA 1D9KA 4J12A 5TQ0L 3QFDA 4IMKA 3QUMA 2D31B 4DVRH 3RVVC 3UTPD 3HE6A