5EO9A

Crystal structure of the complex of dpr6 domain 1 bound to dip-alpha domain 1+2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
MEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Control of Synaptic Connectivity by a Network of Drosophila IgSF Cell Surface Proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell adhesion
molecule keywords Dpr6, isoform C
total genus 28
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2015-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eo9A00
3CCHB 1HDMB 1FGNH 3UTPE 4MAYD 4ELKB 3Q48A 4GAJH 2EZ0D 4NHUB 4PTTA 2IQ9H 1XF4A 1CQYA 3BRGC 1DJSA 1AR2A 2BOCA 3QXDA 5AD0B 1I7TB 4G8IA 4J4PD 1TTGA 2BJMH 1VENA 1E4XH 2M26A 3FT3B 5F7EL 4GUPA 5F1NA 1F58L 4PGEB 4ONFL 5BRZB 1MHCB 2ITCA 5KG9A 3G5XA 4BELD 4EVNA 4JM2B 3ILQC 43CAB 3GSVA 3E3QE 3EJZD 1KULA 5D7LA 5E5MA 3GHEH 1M6OA 3MRIB 3QXVA 2AV1B 5IWLA 2HYMA 3IFNH 4EUPA 2NTFA 2VZVA 4G8GD 3HI1A 1I7UB 1I4FB 5JORB 4U33A 3QIBC 5C8JA 3MRCB 3R1GL 4WI5A 1H0DB 1NCAL 2MCPH 3DHMA 4WO4C 3MV01 4XRCB 5CUSH 5DC0A 1WBXA 4CN4A 3M8OH 1ZGLP 4X4YA 1KFAH 4MB3A 4EBQH 3RVUD 4BQ6A 8FABA 1JZ4A 3BPLB 1DLHA 1I1AC 4NRXB 3BZ4A 2OX5A 4K3DL 4H0GA 3VXSD 4ZO9A 2MPAL 3I02B 1KFAL 2P45B 1AJ7H 3LRSB 2JJTA 4JPKH 4XNXH 4QYOB 1NBZB 4UINH 2DF3A 1KIQB 3GSNL 3O3UN 1U3ZA 1KCVL 1UWEL 3ET9F 2A6JA 1UJ3B 4KAQL 2EKSA 4Y88A 5EC2B 2DJUA 2Z91B 4H20H 2XYCA 3T8XB 1AGEB 3WN5C 1SY6H 4AT6A 1U42A 4LPTA 3O45A 3HG1A 3REWB 2DQCH 2ICCA 4U1JB 3SE3C 1F4WL 2F5AH 2E7LC 4FHBD 3HPJA 4R2GC 4DGIH 3SKJH 1U2CA 2VABA 3ABZA 1GGYA 2H26B 4OD3H 1KCUL 3R8BB 1Y18A 3DIFB 1OTSC 2PXYD 1CE1L 4G6AC 2WANA 5CJ8A 1XCTB 2ICES 5HGGS 4WENB 5KSBA 5LXGL 4E0RA 1H15A 4F7MA 1X7QB 2LQRA 2D7OA 4LSQH 1A7NH 4EQ3A 1FLRL 4R4ND 2Y1VA 4ZTPH 3MXWH 1Q0YL 3SDDD 1MCIA 1OAXH 3F7YA 2W9EH 1P84J 2FSEB 3H6JA 5HHVH 2O5ZH 3IAGC 4CMMA 3O8XD 1BOGB 5INCA 5C09A 3D85B 4CMMB 3DX6A 1ZHLB 2EH8H 2DWDA 2B2XL 1MCFA 3K81A 4ZUWA 4Q2ZA 5I19H 4M48L 1R5IB 3BVNB 4HPYL 1CLOH 1FL3B 3RUGB 43CAA 1E4KC 3JUZA 4TTDC 1AO7E 1F4AA 5C6WH 1IC7H 3BKCL 1DANT 4WFGE 1BBJA 4KROC 4YDKH 1JPGB 1CLZL 1KXQE 5JQHC 1C08B 3NIGF 4WU5A 1CZ8H 4QRSA 4ZOBA 4ZFFA 4OV6F 3OR6B 1WAAA 4JZJB 1FLTX 4M1GH 4XVUC 4ZSOA 3MJ9A 4EIGB 3ARPA 4XRCA 1MRCH 1CGUA 5F44A 4XX1E 2IG2L 4PJ5E 2X9YA 3UDWC 4OT1L 3CFBB 3UC0H 4KXZI 2RR3A 3QIWD 1EO5A 2UWEB 4DGVL 2YK1H 4KK6D 4NCC1 3EDJA 4P0DA 1FJ1A 4FQXD 3X12B 2Q8AH 1QO3B 4YPGA 1J8KA 1G1CA 1OTUD 3ZE0F 4JM2C 5F8QC 3WNNA 1VACB 2DBLL 3RWFB 3LDBB 4CNIB 3VFMB 3BDYL 4P9ML 4PRHE 5DK2A 4DKEH 2RCSL 4U1GC 3ROOB 4XCYB 2ZG1A 3HZMB 5DK2B 5IHBA 3S3PA 4XCYA 3QZWB 3ZYJA 2R2BB 1S5IH 2ITDB 3UTZB 1MFDH 3MLRL 4QHMA 1AGDB 5AZEL 4XNZC 1ZVSA 3PF2A 3EJJX 4M7LH 4P23B 2R2HA 1PYWA 4PRBB 1RJZB 2I9LB 3G6JA 3T65A 2LAGB 3Q6GL 5CP3H 4DKFH 1QKZH 1OOAA 1RFDH 3RWEA 4XNQB 4I0PC 1MFDL 4LPYA 1I9JL 1HCVA 4FFWC 4DW2H 5D7JD 2IEPA 2OTWB 2XRAL 3MREA 4EOWH 2F8OA 4PJXA 4QHNA 3SY0A 4CUCA 2OR9L 3TJHD 5DS8B 3QWRA 3FFDA 5CGTA 5J11C 4KDTC 1CVRA 4QKXB 4NQUA 3MRIA 4X6FB 4UTBH 1C8PA 1CDYA 3TA3D 4GRLC 2XG4A 3EOAA 2F5BL 5F96H 1NGXB 2ITCB 3WO3B 4OCWH 2VIRA 4G6FD 5E4IA 1WZMA 4YO0B 2BVPB 1HINH 2VQ1A 4YAQB 4EDXA 1T3FA 2J6EA 1MHEA 2VDML 3NFSH 5IBUG 4OCRH 3PWVA 2N7AA 1MUJB 3NOIA 4FQIL 4N5ED 1OB1A 1EBPA 3IETA 2V5YA 1WFOA 4JLRB 3EYFB 2QQKH 3RPIA 1QSFE 3EOBB 1YECH 3FN3A 2X09A 3VFOB 3C5JB 1CDGA 5A1AA 3IFOA 4X6EB 4JM4L 3HI5L 2H6PB 5DQ9B 4M93B 5LBSH 3MNZA 3WHE0 2P8MA 3KPNB 2R39A 5GGUB 3OGCB 2EYTA 2IMNA 3S3SA 2HWZL 5T3XL 1NSNL 3GM0A 5MENE 4OZHE 2EYTB 4KUZH 5SWSA 3TM6A 1RQ5A 1WIOA 4D0BB 5JPNA 3RWEB 4KKAD 2P48B 4WFEE 3TO4D 4X99B 4D2NA 3HC4H 4JG1H 4NC1E 1G1YA 1WEJH 1VERA 4KRNA 4Z0XA 1I9EA 5FM8A 3OAUH 2DYPD 4AH2B 1ZKAA 5JIIA 4OLYH 3S4SG 3BIKA 3TNNA 3K3QA 2PO6D 4R3SA 5J6HA 1JF6A 1I8KA 1RULH 2NY2B 1HOCA 1VEMA 4NBZB 4U7SA 2R29H 1X5KA 1TMCB 3F5WA 1Q9LA 3MBED 2I5YL 3T77A 3MFFA 2QKIB 1H3TA 3RTQB 1JHKL 1TZGL 5C0GA 3RY6A 4ZDHB 4OB5H 4RISH 5TQ2L 1XGTB 1CXHA 5D7SL 3T0EB 2OM5A 3DUUB 5C7XL 4WHYG 4IRJA 4TTDD 5IR1B 4G3YH 1MAKA 5JHLH 5JOFA 3T4YB 3OWEA 4KDVA 3KGRA 1KB5H 2GT9B 3ARBA 3GSOA 1ZOXA 1EGJH 3AREC 4XPFH 4X7SL 4G9FD 2OXGA 5INDB 4ZSOB 2R0ZL 1NMBH 1UWEH 2WIIA 3QFJA 4LL9A 3P9LB 4RAVB 3H7BB 2OK0L 1T7VA 3QUZA 5D7LD 4XPTL 4QRUB 1JRHL 1NFDB 3S37H 5IHLB 3ESVF 1IRAY 3KYKH 2BSRA 4GOSA 1NFDA 5IFAH 2NY3D 2H41A 4U1SB 5T1DL 5J12C 4YXHL 1OSPH 1F4YL 1WTLA 4BZ1L 2KH2B 4PBWD 5IFJA 3ZLQC 3DX7B 4HFUL 2XWJB 3RIFK 1CFQA 5IW1A 1FNGB 1D5BB 3GI8H 4UUJB 4NBXB 1YN6A 3GJFH 5C2BL 4LCWD 4AK1A 3X3GL 2XG5A 3OTTA 5GS2H 3UTOA 1JPTL 1S7XA 4TNWF 3ARBD 2B5IB 2E9WA 2OR9H 1BVLB 4ALAL 5DJ8A 4ZDHA 3IRPX 1WC7B 2IBZY 1FGVH 3B6SB 2YR3A 2YKLL 3QB7C 3BHBB 3C5ZA 2X05A 5CKAA 4PG9B 5F3BB 1EGJA 4OZFB 4LARH 4K07A 5TDNB 4L8BA 4UOW0 4PV8A 4BH7A 1I9RL 3PGDA 5E7FA 1A0QH 3AU1A 1I7UA 5IMMB 5CJXA 3GMMB 3KPRE 3DXAD 3L3HA 5FB8B 2UWEE 5FYJE 1WJ3A 1I3RB 1A6UL 1CLCA 4PJ5B 4HXBL 3FFCA 2H2PC 4HUUB 1DQDH 3TPUB 1ZHLA 4C4KO 2Z8SA 5B39B 1FVCA 1BZ9B 4PJ9D 4N0RA 2IADA 1EX0A 2DM2A 5DSCB 1IKNC 4KKCC 5E7BA 1YQVL 2Q87A 4QHNB 3ZHKA 5C92A 2C4XA 5BZDB 4JE4B 5K59E 5LGHH 1BBJB 3V0VA 4LHJB 4M1GL 2FZ3A 3CU1A 1QBLL 2HG5A 4WO4D 5B8CA 2BHYA 5HJ3B 3L1OH 4YFLI 3RVTC 4RX4A 3D25A 1G7QB 3OKKB 3KLHC 1WZ1L 3WYRA 4RGNE 3FMGH 2EXYC 4YAQA 2NY7H 3GMPB 2BY0A 4L4VE 1QRNE 4NQEE 3P9WB 1OAKL 5I9QB 2EDYA 2DBLH 1YEGL 4JM2D 5C0DB 4MB4A 4CN6A 5TFSL 4TTGA 1KPVA 3RWFA 5DC9B 2APVA 1KN2L 4H5SA 4XAKE 4N0YL 1IJ9A 1SBSH 3FT3A 3W2DL 4MZ2A 5FGBC 5GISH 4EI6A 2UYLB 4OZFG 1CFSA 1UJ3A 5I15H 1MQKH 5KZCB 1Q0XH 4JJHA 3MRGA 4I2XE 4KPHL 5I75B 5IEHB 4KY1L 2WQ8A 1T6WA 5HDOA 1KXVC 1LEGB 4WY7H 2PUQT 3FQXA 3MXWL 4OGAD 3D9AL 3I84A 2ORBH 3GSOB 1QYGH 2DLEA 3TZVC 4MCZB 3MNVB 1U41A 2QV2A 4KHTL 4KK6C 3W81A 1RUMH 4PJCF 4MVBD 4ZO7A 2V2XA 1FNEB 3LQMA 3DV6B 3MGOB 1UWGH 4JHWH 5DRWB 3QDAA 3LKRA 1RAMA 2I60H 1UKTA 1M7DB 4OF0A 5BMFH 4WNQB 2PETA 1H3UA 5FHBH 4XPGL 4IJ3B 5DJ6A 3LMJL 1B6DA 5EOCL 2APXA 4P4RA 5GJSL 4OQTL 4ELMF 4XP6H 2EDTA 3CLFL 2LE9A 3OGOE 5KVGH 3EYOB 1AC0A 1FFOB 4HKXA 1VADA 4JRWA 4TULL 5DR5L 5EIQA 5F1IA 4FMFA 2FJHB 4Y5XB 5KBNC 4JHAL 3F62A 1UWXK 2XZQL 3CFBA 3C5SB 2CLRB 1IEAB 4Q9RH 4L8CA 3TBWA 3QEQE 1IILE 6CGTA 5HBBA 2IH1B 3BXNA 1FVDA 1FCGA 1H0DA 4RBPH 2WP3O 4F3FB 2LTQB 2XQYK 4NT6A 4BFIA 3NA4A 3LRSA 3AM8A 1WEJL 1IQWL 4EXKA 1BQHB 3NIGE 3QZWG 4XPAH 2VZ1A 3PHQA 3ARBC 1JUFA 2BNQA 2RCSH 1F00I 3VH8G 5KSAD 1HH9A 4M02A 3VGBA 3QXAB 3QCVL 1LDPH 4JRYA 2A6IB 2NY1B 4QRPD 2J7LA 3O8XB 4DOHE 1EXUA 4YHOL 5D72L 4X6CE 5FHAL 4H1LH 3S35H 3FFCD 1QUNA 1NJ9A 3EDFA 1ZLVH 4JFOA 1GIGH 3SDDA 5LCVL 4J3VA 1JPST 3A6OA 4XBPB 2Z0BA 2EIZA 1U8KA 4NN5C 5JDSB 5E99H 4IOIA 2XWTB 3MV7D 2H9GB 4ZUTA 3G5VB 1FFNB 3I9GL 4BSVB 2EH7H 3MLTB 3PGFH 5D2LB 3ARFA 5LCVH 4P57A 4JFXB 2XZAH 1B0WA 3BQUD 2I27N 4I48B 3VXUD 1ZA3B 5DQJA 2YUZA 3SDAB 3ARSA 4QCIB 5IBUB 1H3GA 2AXFA 3MODL 4X7SH 3IJYB 1BLNA 2VWEE 4U7MA 5HHXH 3ARDD 2FO4A 4HK3J 4PYHA 2YC1B 5D8JH 2OL3A 2A73B 3L3HB 1A8JH 2DQIH 3ARRA 1IZKA 3OV6A 3AREA 5C08D 5ERWB 3D1MC 1UXSB 4M43L 2JJWA 3RRQA 3NACL 2X4TA 4L3EB 2Y36H 3V6OA 3W39B 3K1KC 5J1AA 4GW1B 5FUZL 1VACA 5KSBE 1KIRB 5DZNA 4EI5A 5JDJA 3LHPH 3UTTE 4NCDA 3DYOA 1XCQA 4C55A 4IRZH 3H9SE 5EU4A 4QOKE 4UILL 3H0TB 5DR5H 4ZUVB 4F33A 1D5ZB 5C0JA 2BJML 4JRXA 3QHZH 3DHJA 3L3IA 1YPZA 1F2QA 1T7XA 4E5XB 4ZQKB 4G6JL 2ERJB 5IVNA 4JCLA 3CMOH 1WCBB 4OD3L 3U36A 1I7ZA 3EOTL 1G9MH 1QFPA 1CGYA 3MYJB 4N0FA 2CDEB 3X13B 3HTLX 4PJFA 5ICYB 2HTKD 1RHFA 1CXFA 5I8OH 5J06A 1XIWA 4WUKH 5E2UH 1DN0A 3EIFA 4RMWA 3RBSA 5DGQA 1G84A 4UQ2A 3TYGL 1GGBL 5EU6D 35C8H 1BIIA 2VKWA 3H3PL 1J8HD 1X5ZA 2H45A 5A2LH 1CXEA 4Y0GA 4XNUH 4LKXB 3IB4A 3U30B 4ELKA 4F57L 2NZ9D 3O2WH 2GJJA 1E4WH 2PF6A 4LP5A 3TO2A 1TCMA 1A02N 2WWMD 1I7RA 3W5NA 1VHPA 5ETUB 3D5OF 2AEPH 2AJSL 3KPRA 2HKFH 3GMRA 1CFBA 4MAUL 4GXVL 5F6IC 1YN7A 3KNBB 1S9XB 2UZIH 3EFDH 3TA3C 1JRHI 2HFTA 1OARH 2FWOA 1S8DB 5D1ZC 2NY7L 2VLKB 4HS3A 4LMQE 3T1WA 4ODXB 4LLMA 3UAJC 4HS3B 3SDAA 3SDXB 1RIVH 1WBZB 1MJ7L 1A4KB 4R97B 5EU4B 4DGYH 1KF9B 1IEAA 5JW3L 4D9LL 1CF8H 1N3NA 2BK8A 3FAWA 5I6XB 2QQQA 1A3QA 5DYOA 3RDTD 1Q8MA 3Q6FA 4A6YH 3HB3C 5E2TH 1RVFL 1G7LB 3C2AH 4JLRA 3UYRL 5IVXE 5DUBA 1K2DA 5GGSB 3O9WC 2F19H 1F45A 2ED8A 2J8UF 3BGAA 1BQSA 1UXSA 4Z8FL 5D7IE 4NO0D 4ZPVB 5ITBL 3VFNB 3EDKA 2P47B 1YNTB 3H9SD 1A7OL 5FO7B 4WI8A 4LHQB 4MQXC 4ERSL 2WBJD 3C9NB 4UQ2B 3PWJB 1M05A 4UNUA 1VCAA 1T5WB 2R23A 4PV9B 5E6IC 1MH5B 4NGHH 1P69B 3CU7A 4LLQB 3P4LA 4L8SA 5GRJL 1CL7H 3CZFB 4YC2B 3MV9D 2XWJA 1OT2A 4RBPK 1F4XL 3U7WL 3ES6B 4LSSH 2JB6B 2ADJB 2ZOLB 4Y4FA 1FNFA 3OKOA 2YXMA 4DUVA 1R6VA 5IB2A 2Y5TB 1FFQA 4CDHA 4ZOEA 4LAQL 4FS0A 4OGZA 1HNGA 2EDJA 5F9AC 2NXZD 1DBAH 2PW1A 2NY3B 1DQML 1KJVB 3VGGA 4RFEB 3D69A 3ULVD 4DFHA 5ISZE 4NKQB 5C2UB 4J4PA 4K3HA 3BN9D 2W38A 4RGOH 1PZUB 2VXVL 3W0WB 5JNYA 3NZ8A 5FYKL 4YDVB 2FECL 1TVHA 1QPXA 4MQ7A 1GCFA 1J0HA 1JV5A 4WI7A 4DGVH 1ZK9A 5GGQL 3V4UL 3D25B 3NVQA 3TP4A 1EAJA 1PKQB 5J7CC 3C8HA 4LVNC 1LO5B 3IDYB 3D0LB 2CR3A 3B8YA 5T5NF 3TWCL 3HB3D 1BIHA 4XGZA 5TPWH 4MMXC 4XPTH 1S7RA 4N90D 2VE6A 3RVXD 3ZL4L 4UIKH 4Q9QH 3BQUA 4OLUH 1NCBL 2FGZA 4R97C 1S7SB 1J87A 4AG4L 2V5SA 3JXAA 4F37F 4B7IA 2BY1A 5I19L 4U0QB 3JV6A 3T3PF 2XY1A 3BKYH 4WU5B 5K9QG 4N0YH 3WNOA 3IDMB 1I1CA 1YEHL 3GSQB 3QA3A 1CFVL 5DYOB 5HHOA 5JMRA 3DMMB 4ISVA 4OGYH 4LCUA 2BSTA 4TVPD 1BECA 1I1FA 4UBDD 3CFCH 4GG6E 3PGDB 4U0RB 4J3OC 4OIAA 1RV6X 2Y5TA 5IMMA 1E27B 1XF3B 4N0FB 4MNQE 1S9KC 3IKCA 1MCOL 3REVB 1WICA 4G7YL 5HHVL 4LCIH 5DS8A 2PKDA 3MV9A 5LWYH 1DSFH 1JGDB 4K3DH 1BMGA 3GMRB 1LDSA 3VFGH 5B21A 4BSVA 5D7JC 3JWNC 4CBPA 1OAYH 1KGCE 2AK4B 1PSKH 4Z7UF 4WGWB 3ARGD 3EJYC 4DAGH 4KJWD 3SBWA 4K71B 5ICZA 4MA1B 1GL4B 2Q76A 3KDMB 1U8IA 9CGTA 3RWDB 4LLDA 3KYKL 3RX5A 4D94A 4U6HB 4NNYA 1W72H 1DVFD 1YEFH 1UWXH 3HZKB 3CUPA 5K9KB 1A1OA 1N5YH 5AEAA 5ADOH 1I85A 4MDIB 3HZVB 2X4SB 1U6AL 4FFYH 1S5HA 4W6WB 3RZCC 4P2RA 1UFUA 2BVQA 3G04A 1KJVA 5DFVD 2R15A 5JIHA 1KXTB 3TBYB 5E8EA 1A14H 4QY8A 3MRKA 4IDJL 1VEPA 3GMPA 3K0WA 5ADPH 4ZO8A 4AL8H 4M8QB 1IBGH 2BVEA 1LK2B 4BZYA 1T1ZB 1N59A 5DD1L 2ZCHL 4N9GA 5EU7C 1F4HA 4KVNL 5FFLA 15C8H 1ZS8B 1HQRB 2JKXA 3B4NA 1EUUA 3O6LH 4N0CC 1ZT7B 3VXNB 3RVTD 3BUTA 3EJZC 1KJMB 3TN0B 2D0HA 1MCEA 4ZS6D 2FL5B 3OG6B 1XCQB 3LEVH 4DN3L 3TT3H 3KPRD 3MCG1 5CCKH 5CZKA 2IAMA 1S7VA 5HGAA 4L4TB 4EN3D 3MV9B 2V7HB 1U8KB 5DO2C 1S7XB 5DA4A 2NY1D 2Q7YB 5CCKL 3O4OC 3PQYD 4ZAKB 3T77B 1YPZE 1PG7W 1J8HA 4X8XA 4ZAKA 1TIUA 2R29L 1LGVA 2YMXH 4WVRA 1WWBX 4DUWA 5FYKH 5IVZA 2Q1EA 1IT9L 2ZNWA 5EO9B 5E5MB 1HZHL 3QFJE 1IGMH 5JHDA 3MLWH 2UUDH 1BLNB 3FHAA 5LBSL 3E2HB 4DZ8B 5F70A 4PJXF 3GHBL 1KIPB 3KXFE 3MV8D 2IANE 3I6GB 3WDJA 4Z77B 2EXWC 4N8PA 1RZGA 5MI0B 4KHTH 2FD6H 2X4QA 3OG4B 4LSVL 5C0CD 5IG7A 4PJAA 4O2CA 4JPVH 3O3DA 4HD9A 3O8XC 1IM3B 2GW5A 4H26B 5LQBL 4UBDC 2GYSA 1GZPA 5I66B 2JB5H 2BSED 1T83A 1FPTH 4KRPB 5JOPE 4CVWA 5JHDE 1P2CA 3OKEB 3EBAA 5B4MC 5T3ZH 5EN2B 5CD3B 4XVJH 3MX0A 4ZPTB 4LDLB 4HGKC 2GJZB 3W9DA 1JYVA 4NP4L 2P24B 1JWUB 4D0CA 5TDPB 4P5KB 3VWJA 4KC3B 4XTRC 1HINL 4A2LA 2DS4A 4CW1B 5GGSA 2YD3A 4NQVB 3FOLB 5BQ7B 4ZO6A 1NC2A 4NO2B 3ULVL 2XY2A 1AO7D 3CFKB 5KSUA 4HEPG 3VRIB 5KSBF 3S36L 4TSCL 3U4EB 4IMLA 5HI5C 3RVWD 4PRHB 1MIMH 1MLBB 3JWDH 2IPKB 4IJ3C 2ZUXA 1A5FL 1MCJA 4L3CA 2EDEA 4LLQA 3UDWA 5C0AA 1CWVA 3QEQA 2NX5E 4LPUA 3IAPA 1I3RA 5C0BA 3PWNA 4WFED 4XNUL 3UTTA 5HVHB 5D2NA 1A6AA 4WFHE 5D93C 1F6FB 4XBEH 3MRPA 5C09D 2FLRT 3IXTA 1YEIL 3F5WB 5DHYB 3S5LG 1MEXH 1E6OH 4F7EA 3VFSA 1FZOA 4APQD 4OCYH 1U91B 3F7PC 2V2XB 4Y4HB 5EN2A 3ULVC 4O2FA 3NFPA 1FVEB 3KLAB 4X8JA 1FV1B 3MRJA 4U2ZA 3ZDZF 1IL1A 3O2DL 2IGFL 4XXCC 1RZ8B 2QEJA 4MAYC 3CFDB 5F71A 4J3SA 1NBQA 2YPLB 3MLVL 5BOPA 4W4OC 5C8JB 4FP8H 5CZXD 2DWEB 3PWLA 4N0CD 4PRIA 5KS9A 1Q94B 4PRNB 4WEBL 4PRIB 4HPOH 3DX7A 3O3BA 4ODSL 4UV7L 5E8EB 3FQUA 4RGMB 3F6LA 4PRPA 3RA7H 5B39A 1QACA 1S3KH 3K8LA 4JRXB 4K71C 4RQQA 2NW2B 2QJDA 3TBSB 2G9HB 2DYPB 2ZCLH 4HCRL 3WNMA 2BDNL 5E8PA 4JY4B 3RY5A 3KJ4B 4CVUA 3KR3H 5GZOC 3TH4T 2BSRB 3MRBB 1FL3A 3W9EA 4MNGA 4NZDA 4X5LA 2J5LB 4KK5C 4OLXL 5DD3H 2O26U 2DN7A 5E4EB 4JFEB 1EMTL 1A4JA 4HC1H 1EK3A 5FGCE 3U4AA 5D6DC 2M1KA 3V4VL 4YXLL 4DK6A 4NKIL 4XXDB 5EFIB 5HYSG 3QXAA 4YHKL 5EWIH 3F6IA 1L6XA 4OZFA 2LU3A 3QHZL 1W0WA 2R1WA 1RK0A 4F15C 4Y89A 5F7DB 4LSPH 2ADGB 1MWAH 4O2EA 1RJYA 1R5VB 5T1LA 2XN9D 2ZCKH 4PGCB 1KCSL 4JGJA 3U83A 1F11A 4DGIL 2AABH 4QRTA 5L9DH 4R4FH 4ZQKA 2X4OB 1N5AB 3PGFL 1Q1JH 1PJ9A 1SHMA 4YXKH 1TLKA 3S35X 1KBGH 4PJ9C 1DLFH 1KIPA 1H3VA 3U1SH 3GSNH 3OB0H 3FZUD 3GSUB 2BNUA 1AGDA 3PE9A 2CO7B 5I9QC 1DUYB 5C0IB 4KUCF 3KPPA 2HN7B 4QT5A 1V7NH 4OJFL 5TQ0H 4HLZH 3V5DA 2Y6SD 3D39A 3P0GB 3QJHB 4NNYB 2AEPL 2AJSH 5L2JA 2NCMA 4IOFD 1XZ0B 3TT3L 1L7TL 3PL6B 3H8NA 3QFJB 4MJ4A 1T66D 2ADIB 2MPAH 5BVJB 3KYMA 1DLHB 4R8WH 5D71L 4N0UB 4KTYA 3RBGA 4DN4H 1XT5A 3BAEH 3G08A 3VWKA 1FL5B 4G5ZL 1X4YA 5GZOD 3VWKB 1D5IH 4IEFB 2NY3C 1P4BL 3CX2A 4PRHD 1BFSA 5ADPL 3V6FA 5GRVK 5IHUH 2GK0A 1GGUA 1N8ZA 5DD1H 1AD0B 4H8WH 2WIMA 4LF3A 2GJ6A 4HH9A 4YBLB 1CICC 4ZUVA 1KG0B 2IH1A 2J6EL 4Y2DC 4C83B 3CMOL 3OJVC 5E03A 1VFOA 3TNMA 2ZKHL 4R3SB 5T33L 1X5IA 4PGDB 4W6YB 1AFVH 3OJMB 4MWFB 4Y19B 3MLYH 4WEUD 4LGSB 5EU5A 2XZZA 5DJXA 5ELIA 4PGEA 1X4ZA 3ZDXF 3IJHA 3LIZH 5K9JL 3VCLA 5E94A 3UO1H 4EKXA 1I9IH 3RU8H 3C5ZD 1JHLH 3PP4H 1TZIA 1VEOA 4NOBA 4PG9A 4X9HA 5IK3B 3LY6A 3AB0B 4YDLC 3B6SA 4IDLA 4UOW1 4NO5B 4P2QA 4JVUA 2VRAA 4JG0L 4P2OB 5GRWA 4WFHD 2EKJA 1QR1A 3ECBA 4NZRL 1R3JA 1R5VA 1TENA 5DC4B 3MNVA 1XZ0A 2PYEE 2VLJA 5E6ID 4PY7B 3CDCA 4FMKA 1JP5A 2EDRA 3P4NA 3QWOB 1X4XA 3BMWA 4QRPB 2PYED 3B9EA 3CXHJ 3VXSE 4U1HA 3O2DH 4MA3A 5E2VL 5FV2A 2A83B 4ONHA 5I1HL 3ULVH 3MJ8A 3W9EB 4AQOA 4PJCA 5I76B 2QHRL 4FQCL 1V7MH 2VDKL 1IVLA 3FT4B 3JV6B 3RWCA 5FA3A 4KZEL 4P5KA 2YXFA 4NJAL 1A1OB 4JHAH 2X4NA 2F15A 3V2AR 1CBVH 4B53A 4JZJA 4NQDB 2WIIB 1NANI 1WCBA 1RUPH 2CXGA 3WS3A 2FHFA 1KCSH 1K6QL 2CDGA 3SJVA 3TN0D 4TOYH 3ARZA 2NY0C 5IGXH 4O2EB 4N5UA 3VFOA 5D93B 2AVGA 1QRNA 4BUGA 4XVSH 2AQ1A 4X6CA 1FZJA 3SO5A 2PW2A 1TJGL 1QSZA 5D6CA 4PLNC 5IGXL 4KDWA 1O7VA 3H3BC 4OF5A 4OCWL 5C08B 4JKPL 1G9NH 3I6GA 3C6SA 3K1DA 3QRGL 4O58H 3VG9B 4NKOA 1A3RL 3QDJA 3GNML 3EFDL 2DLFH 3PJSA 5EBWA 1WTGT 1GOFA 2GCYB 3DWTA 4U1JA 4HUUA 4PGDA 2H8PA 4HMDA 2NXYD 4OF6A 1LE9B 3PWPD 3MLSH 2JJSA 4ZOCA 3NIFF 5J3HC 1YEJH 2DI7A 3F58L 3GIVA 5D7IB 4POUB 5FYLE 4C58B 1NFKA 1YYLH 3HCVB 1DBKH 3BPOB 3R0NA 4P3DA 2ADFH 4YHPA 4RMVA 1MY5A 4I0PB 3GGWA 4G8EB 5AAMA 4U6YB 3VE0B 1N6UA 1G7MB 4Q6IB 2C3WA 3RNQA 3ZTJH 4AEIL 5J12B 3D39E 3QIUC 4XWOD 4NKMA 3WE6B 2VDMH 4PJ8A 1LD9B 5T1LD 1L0YA 4DKEL 2BVOA 4Y5XA 5E8OA 1AXTH 3VG9C 2WUBL 4JFFD 1C5BL 1HHKA 3UP1A 2XKUA 5AUMA 3N06B 2JJSC 1ZHNA 2HRPL 5C3LD 3E3QC 1RVFH 3PWVB 2Q8AL 1WUNT 2R0LH 4RZCA 5T3XD 4ZPVA 1FE8H 3THMH 4NHCH 4RNRB 3DO7B 2RFXA 1C5BH 2MTPA 1BF2A 3V5HB 1JNHB 5HGBA 2VTFA 4XCNB 3KHQA 4B0MM 2R2EA 1OCWH 5BV7B 2WMPA 3V79C 1P84K 2DD8L 3O3AB 2NPLX 1YUHB 2MMXA 4FOMA 2BMKA 5T1MA 2WNGA 4X98A 1XMWA 5IUSA 1JWSB 3QWRD 4ZS7L 4HJJL 3QEGH 5DRZA 5C0CB 2P8MB 4FQHA 5D70H 3WFDH 1RZFL 4LFHD 5D7JA 3ME0A 4M6NL 1NDGA 1UM4H 4NO2A 4PRDB 1R3JB 1HDMA 4Y1AD 1CBVL 4DVBB 5CGYD 1YNLL 4KKLC 4PJ8C 4WDIB 3IF1A 5C0ND 3RWJA 3AFLA 3LQZA 1KPVB 4L4TD 4KRPC 3S37L 1OW0A 5DHVB 1QBBA 4MQSB 5ACZB 1YZZA 5DUMH 4GUPB 2YPVH 3LQAC 3TN0C 3LKPA 1N7ML 1B0RB 2D03H 2CDFA 4G8IB 2RGSA 1UZ8A 3FOMB 3HZMA 4WUKL 4M7LT 1ACYH 4S11A 1JPSL 3PNWB 2H3NB 5I1IH 3RNKA 4OI8A 1P2CB 3H9SB 3OKEA 4H25B 4MNQD 4JJ5B 4Y4HD 3RUGF 1JI1A 3UTTB 2AV7B 1ONQA 1I1AA 2ZZUT 5HDBF 2W0FB 5ENWB 1MHPL 2X9XA 4D9QE 4P23D 5A16A 3MUGA 5D5MF 3AB0C 5C0AD 2OL3H 1CD8A 1RZGB 4JR9H 4QLRA 4HKBB 5DD0L 1S7SA 3GRWA 1IEBA 3RL2A 4LLMB 3NAAH 4ELME 4TUKH 3VFTA 1BP3B 4UB0L 5CJQH 4MA1C 3BZEA 1JYXA 4BQCA 1VFBA 4PJ7B 4GG6A 1T1WB 2AJYL 3HE6A 5DMKA 5DTFB 4URTB 3RIAK 2BNRA 3SDXF 5MP6H 3T04D 4HXAL 4YQXH 4M9PA 3P11H 1EUTA 2YBRA 4N8CH 3DUSA 4D0DA 1FIEA 5AWNL 3UZVB 3QPXH 5DXWA 2GJZA 4NNPL 4MSWA 5CILL 5JHLL 1MUJA 4BFEA 1RULL 3BIKB 4ODBD 1HQ4A 2G2RA 4LFHG 4BM7A 4WWKC 2APBA 4ZFOA 3QUZC 1W8NA 3DGGA 1T2QH 1A7BA 1ZXQA 3FB8A 4XBGA 4FQQA 1HHHA 2BCKB 1FYHB 4J2XA 4PJIB 1OHQA 1ZANL 4QXUL 4FXLA 4X6CB 4WHDA 4ZXBB 4MJ5B 4PJFB 3SQOL 7CGTA 4F7TA 1E0OB 3IJSB 5HYSB 2CKNA 2Y72A 2NZIA 1DR9A 4MYWB 3OB0K 5I1JL 3BN9C 4K3JL 3X3FH 4XVTH 3MLVH 3MCKB 5HVFB 1JN6A 4U1IA 5J1SC 3BPCA 2YPLA 4OGYL 3VXQB 5IIEB 2GIYA 4R26H 3LPWA 1H3WM 2AEQL 4HS6A 3RGVA 1ED3A 3HE7A 4HIJB 5CP7B 3GMLA 3N9GH 4JHBA 3TBTA 2DKSA 4XBPA 4FQPA 2CUHA 4P4KB 3HC3L 4LIQL 3QUZB 2N4IA 3QQ9D 3UBXG 3PDGA 2B1HH 5EBMA 3HC0A 2GUOA 2ERJC 2VLLA 2X2YA 2BSSA 1YECL 5EBMB 5EU6B 3WIFB 2DIBA 4TUJA 4U1LA 4OGXH 3VFWA 3CVHA 1NEZG 5JO5B 2JCCB 2VIRB 5ECJE 3WN5A 2NTSP 2EYSB 2CUMA 2L0DA 5D70L 2E5EA 3WFDL 1A7PH 3G6DH 3HE7C 1KJ2L 3FQUB 4HUNB 3HZYA 3G6JF 4LEOB 1N3NB 5JIKA 1HNFA 2YC1A 3EYVA 3L9RB 3PQYE 4PREB 4TOYL 4NRYA 4I3GA 1T22A 1RZKC 2HTLD 4NT6B 4LLWB 1NCWL 1QSEB 3OAYK 1IGCH 1XGPB 4GRLA 5F89A 5KTEL 1CLOL 4BQ9A 4RGNB 1IAMA 4K23L 5E9DE 2R69H 4LHUA 3T0WA 5F7UA 3MJ6A 3VWKC 5D9SB 1KIRA 4EI5B 3SE8L 4YGVB 5B38G 2VOTA 4O51A 4Y19D 1OF2B 4ONOA 5FOBA 4MD4A 4HFWA 1EEZB 3JVGC 4N8VB 2EKSB 4NKOB 5IWLC 1K85A 1OAQH 1P4IL 3UJJH 2E7MA 4BFBD 2O5XL 4ZFGH 2APTA 4PY7A 1A6AB 5DUPL 5IOPA 1LP9A 5BOZG 3OKOB 1NCCH 5HVGB 2VH5L 2YD4A 3WJLA 3ARTA 4J3XA 4MCZA 1J12A 4NN7B 4LKCB 3MPCA 1KN4H 2FJFB 1U8JB 4RMTA 2J88H 3GIZH 3QUXB 1IEHA 4CN1A 2NY5C 3M17A 1U92B 3ZYOA 4DCQB 3DVGB 3TLRA 4QWWC 4I0PA 5DQJB 2VITA 4PLKD 4XP1H 4HCRH 1HYSD 2NY1C 3LKSB 4HWBH 3CIQA 5EO0B 5J89A 3MTRA 3KPSE 4EUPB 3D39B 3QJHA 5F7LB 4QRQB 3X11A 4OFVA 3BESR 1ADQH 2ARWA 5TH2B 4MGXA 4K3JH 5K9OB 4OFDA 3QJFB 4P2RB 4QGTA 4WJ5A 5GQBA 1ETZB 4XPBL 4I2XB 2J6EH 5INCB 3EYUH 2GTWB 4FQJH 4U1HB 1JNHA 1UZ6F 1FYTE 4NM4H 3FB7A 4RNRA 3QIBA 1ZT4B 3CXDL 1A1NB 1I85C 4E41E 1G0YR 4DW2L 1DP0A 5FYJH 3QI9C 4HXAH 3T4AA 2H6PA 5DQ9A 3V0VB 2MHAA 2YA1A 4V1DD 1HCFX 2A1WH 4FTVD 1QP1A 5AWNH 4EN3B 4N8VG 5IVXA 1OGTB 4B50A 4O58L 4WUUA 1RK0B 3EDDA 3WS3B 3BX7C 5BZWA 3IDIA 2YSSA 1IC4L 1EO7A 1G7IA 3MNWA 1A6UH 3BP7A 5DFWH 1Z0NA 4HLJA 3UC0L 3ULSB 1X5LA 1EHNA 1DQDL 3P73B 4PLJC 4FQ2H 2IAMC 1CD9B 2YRPA 3QQ4A 3SPVA 4YX2L 2DQGH 1TETL 4P4KA 1T0MB 4H5SB 4TSCH 1WAAE 2OL3L 3L95A 4P4RB 5C7XH 1UM6H 4L3CB 3EGSB 3AU1B 1NCUA 2APWA 5GSVA 1QBML 3L6FB 3ELAT 1J1PH 3BW9B 2D31B 4Y5VA 3OHXA 1Q9WA 3DGCR 3QP3A 4RFNB 2EO9A 4YHIA 1DTUA 3U2SB 3C60B 4NC2B 5ID1A 4KZEH 2V9RA 4TSAH 1P4BH 4WUUD 3FQRA 1MSPA 5KSVB 3LKNB 3KPRB 1VFAA 2GSGB 3UTSE 2XTLA 4FTVA 3BKML 4QHKI 2HT3C 3VXSB 1NAML 3D2UA 4OLWL 2RJMA 4Q2ZB 5DRXA 2VXTL 3HC4L 4AIXA 4XPAL 4HBQA 1U3YA 1FVEA 1UVQA 4J7RA 4M5YH 5LVEA 1INDL 4I77L 1NLDL 3WFEL 2ZSVA 2WBKA 3EW3B 1JZ8A 35C8L 4L3EA 5E99L 4HX1A 1WIPA 2BRRH 2WBJB 1YYMH 1S9VA 3U9UA 2YBRB 3SE9L 2DI9A 3BPLC 1S9VB 2N56A 3MQIA 3GKWL 2HJKA 4Q0XH 5FYLH 5DEFB 4LQFH 4AT6B 5IESL 2HT2C 1YQ2A 4TN9A 5I1JH 1AHWA 4HHAB 2D4FA 4K3EL 5E24E 3WFHA 4X0KB 4F3FA 1UB6B 1UYWH 1QLFA 4UT7H 3NCBB 5BS0A 1N64L 4ESKA 1G9MC 1U8HA 3ALPA 4JHWL 2HMID 4Q7DA 4X6EA 2Q8BH 3AC0A 4M9OA 1EZVY 4IRJD 3O2VL 4BH8B 4XNZB 4XPGH 3VH8B 3I6LD 1UCTA 2Z9TA 3I3BA 1G6RL 4M1CD 3U2SA 3K4ZA 5FGBA 3HUJB 2H1PL 3V4UH 2VDRL 4NO3B 3MRPB 5JORA 4JFDD 3PV6A 2UY7A 1F3JB 1Q72L 4ZXBC 1U58A 1NGQL 4HIIB 2AW2A 4ETQA 2FX9H 4Y5YC 4FQIH 2VXUH 4OLYL 15C8L 1NFDF 3NACH 4LNRB 1OAUH 3T0EE 2ADFL 1JRHH 2HWZH 5T3XH 1DBAL 3TBSA 4ZNEA 3I6KA 4KTEL 2YN3A 3AAZB 3TYFA 5IMOA 4Z6AT 4RGNC 5GHWL 4AM0A 4P3DB 1VPOL 2HVJB 3CFEA 5IVOA 4KTDL 3QDJE 1L4IA 2Q76B 3F8UB 5LGKA 2EICA 3O9WD 2HVJA 3CFEB 3S36X 3V7AE 3TF7C 1FNAA 5E56A 5LKNA 4QHKJ 4JRXD 1PG7H 4CW1A 1HIML 3IFLH 5SV4A 2X44D 4GT7A 1AHWC 2VUYA 5FCUL 4G9DB 4JREB 3KWWA 1DEEB 4JRXE 4LLYA 4I1NB 3E8UH 5BW7C 3LH2H 1X44A 5A2FA 1KPRB 1RJCA 3LS5L 3DTXB 4U1SA 5BRZD 2VQUA 1H3XA 5D6CB 1PSKL 5DK3A 3V4PL 3ALXA 4LIQE 1OF2A 4LVNB 1P1ZB 3TCLA 4IRJC 2FHBA 3QISA 2E6QA 4GRWE 5C0BD 3GMMA 5C0AB 3ULSA 2X4QB 2IALA 3T2OA 4HAGA 2Q6WB 2A77H 1QBLH 4NUJA 4TRPH 4ZG1A 3P4OA 4X4ZA 4I13B 2VABB 3NBNA 1RHHB 2WUBH 3VXUA 3VI4F 2CQVA 5KS9F 4BJLA 2ZSWA 1MI5B 5GIRB 1JHTA 2VXQL 2AI0H 4TRPL 3NCMA 1XGTA 2ATKA 1HYRC 4XB7A 1HWGB 3JV0A 2AV7A 2YD6A 3P0VH 3WFCH 2Y23A 3G6AB 2IF7A 3GM8A 2R1XB 3JWOH 4ERSH 2XZQH 4NO3A 2VXQH 5TDPA 3UTQB 4N90E 5DFTA 4XVSL 3D85D 2DB8A 2CR6A 1TTFA 2K3TA 4YR6A 3KWWB 4TQEH 2VXSH 4IS6B 1RUML 5EIIA 3DBXB 4GAGL 5FXCH 1HHGA 1F4XH 4GRWB 3CVHH 3WDIA 3D0LA 2C1OA 5HYJA 4NZUH 1XGRB 4K55A 1BFVH 5H8DA 5JR1H 3LPFA 1DE4B 2G9HA 4JVPA 4MJIA 4S2SA 4APQC 4C56A 1QLFB 1ZS8A 2VLKA 1UEMA 3C6LD 1A6ZB 3DSFL 4MXQC 4AJ0A 2UYLA 3O9WB 4KKBD 1WZLA 1GGCH 1OQOA 2ZCHH 2EE3A 2D0FA 3GO1H 1CD1B 2BMKB 4FQLH 5T1MB 4KQ4H 4OZIA 5IROA 1UM5H 3HPLA 3TC9A 2VDNH 1ZHBA 4WHTA 4Y2OA 5IQ7H 5SX5H 3FCTA 4R0LB 2FX9L 1N0XL 4WHYH 4P5MA 1NBVL 3C60C 4DFIA 3TFKD 2JF1A 2F53B 2DQDL 3O41A 2MKLC 4NUGL 1MRFL 5HI5D 3BSZL 4JFED 3S96B 5JW5A 1IM9D 1BAFH 3WFZA 3RL1B 1JK8A 3CDGA 3EFFB 5HYEA 4Z7QF 1BHGA 1KT2B 5CJBA 1X7QA 1JHLL 1WZ1H 2J12B 3PP4L 4JO4L 4LCCB 1FN4B 4XTRD 1IFHL 5ISZA 1I8LA 3DUUA 3FRUA 1JNLH 1EO8H 4PR5A 5DJYA 1OP5H 3IJYA 4V2BA 3X14B 3VD4A 2XA8H 2AJYH 4RDQG 4WGVB 3HI1B 2D7TH 5T33H 4EBQL 1R5WA 4XNQA 5GXBB 1XGRA 5E95B 3H42H 3VXPA 5A3ID 1JWMB 3R0MA 3EYVB 5C6PB 3S34L 5EOTA 3WS6A 1MI5D 3QNXB 1T5XB 4QWWD 4ONHB 1T7YA 2QQNH 1NH6A 3WKMH 4HBCL 4HJJH 3V5KA 1QLRA 4V1DE 3QNYB 4PJIE 2W65A 4DQOL 2F8XC 1KTKE 4LHUD 4HX1B 3GHEL 2PO6B 5BO1H 2W59A 2IANB 3DLQR 2ICWJ 3EO1B 4TUOB 2VSDA 3HNVL 3Q1SL 1C5DB 4XAKD 4I77H 3SGJA 2V17H 1HHKB 1P9MA 4OTXL 5HDLA 5I17A 1AY1L 1MJJA 3RWHB 3ILPB 2BVTA 2YD5A 3QIWB 5EZIH 1J88A 4HKZB 3GUTB 4K7PH 4K3EH 4PB9H 3HNVH 5BXFA 2CK0L 2OQJB 1FZJB 5D1ZA 4I8DA 2VDQH 4PD4K 4MNGE 3RVVD 4S1RL 1PVHA 5HDQH 2CH8A 1EHLL 4S1QL 3NTCL 4L9LA 1HE7A 4ORZC 3WEXA 2AS5M 4DTGL 1CLYH 1A6ZA 2BVUA 1AXSB 2DQUH 3LKQA 3WSQL 2ZOKB 4GO6B 2WZPD 5L8JB 1M4KA 1BD2D 4ELMB 3MFFB 4JFEA 2DQJL 3I6LE 1G6RH 5CJXC 2NXZB 3G5YA 1UM6L 1X9QA 2BXZA 2FGWL 5DJDB 2DM4A 3VI3E 1DN0B 3AS0A 4LSUL 2DTMH 4O51B 5IP4A 4GKZA 5L7XL 4HQQH 2FRGP 4WWKA 3UX9B 4FQLL 4FP8L 4U1IB 5BV7C 4F15B 3HLAB 1SYSB 4M5ZL 4XC1H 3BIBX 5D72H 5KZCD 3VGAC 4NSKA 1F3JA 5HGDA 1XF5B 3DOSA 5D7KE 5DD5L 1F2XK 4AIZB 4PTTB 2PN5A 3MR9B 4LDOB 4QOKD 5T1KA 4JPWL 5D7IF 3AS2A 5KVEL 4U3HA 3CAFA 4GG6B 3KNBA 1HILA 4F9PA 2X9WA 5EU3A 1QOKA 1ZMYA 1NPUA 4CGTA 4OZGB 1KBGL 1X5GA 4RISL 5HY9A 5FYJD 3X17A 5AG8A 1L0XA 1B0GB 3O4OB 5D1XB 2EECA 5DF0A 2X6MA 2XQBH 3QPQD 2IMMA 3U6RB 3ALWA 1S7TA 1KTLA 2V5MA 2FEDD 4JANA 3Q6FB 1CGWA 3DXAA 1OP9A 3O0RL 5KW9H 4NN7C 3UTSD 3QG6A 2XFXA 4WJ5B 5F6IB 5DWUH 5FM5M 5L8LB 1G7HB 2Y7QB 1QG3A 1U8OA 4K23H 5IB5A 1DSFL 5F89B 3BGFB 4Q97A 1U8NB 3MYZA 1CTOA 2HP4A 1CIUA 1VKXA 3QUZD 1JGVL 1FRGH 5CEZL 3NCEB 1ZAGA 3MUHL 3QQ3B 5TDNA 4OLXH 1C7SA 1QVOA 2CJUL 1WITA 4XP5H 5L8KB 4LCCA 3TBVB 2VLJD 4Q9CA 4G80B 1SQ2N 3MV7E 3QNZB 3U7AA 3ZT5A 3W0WE 1OTTD 4F33B 3WO4B 2EIZB 1JPFB 1LEGA 3CGTA 3LEYH 4PUBH 1T21B 2J4WL 3FN9A 4K7FA 3N1QC 1QSFA 4DJMA 4Z7NE 5ALCH 2JIXA 1ZLWK 4YBHA 3SCMC 3DX6B 2VLLB 3GIZL 1CL7I 3OF6A 2PXYC 3R06B 4IIQB 2AI0L 2OR7A 4HUWA 1RZKL 2QQKL 3FB5B 2G5RA 3NFNA 4W4OA 1JBJA 5CWSA 2OTPA 4M3JA 3O6FA 3QEUB 5D7LB 2AQ2A 3T2NH 1IARB 1B3JA 1BREA 3U7YL 1QLRB 4MJ6B 4YK4B 1P6FA 3MLXL 2OTUA 4ODHL 1CXLA 4QF1B 3RU8L 1CE1H 2NW3B 4G42B 4WWKB 5CHNB 1MRDL 3DMMC 5AZ2H 3ULVF 2XPGB 1KEMH 2DQTL 4ODSH 4GJTB 3LN5A 4Y1AA 5I1LB 2DWEA 2J8UB 1EVTC 5F7FA 1LEKB 1QYGL 2E7HA 5E4EC 1DQTA 3MJ9L 1QSEA 1WIUA 2VL5B 3BISA 5AUMB 3P4NB 2YKLH 5D1QB 5IVXF 3LS4L 4HZLB 2VZUA 3MROA 1YN7B 2X1XR 5IB4A 3SQBA 1LO0H 4GBXB 4GXVH 5KVMC 1HXYB 1FL5A 2HKHH 1ORQB 1HXYA 4UNTA 3L5JA 3QDMA 2IPUK 3LH2L 4XC3L 4KRPD 2X4UA 2R2EB 3NCFB 4PPTA 4XP6L 2M8XA 3VMNA 1A6WH 4LLVB 1YMME 2FHCA 1U0QA 4WU7B 3SKNA 4PJHE 1N6VA 1T1XB 3DURA 1EEYB 4OLZH 4D0DB 1UM5L 1OGAE 4JG0H 3FTGB 3WNPA 2XNAB 4NQDE 2W60A 1ZT1B 2VLKE 4N8CL 1QSVA 2J88L 4HWBA 1G7LA 2H8PB 3DXAB 3BZDA 4OD1L 4HMCA 5GS0H 2DQFA 4LSVH 3L3JA 4LOUC 3W11C 1XIWD 3BPCB 1IGYB 2CDEA 2PW1B 3O6FB 3U79A 1G9ML 3FFDB 3O6KH 4P5TB 2PCPA 3INUL 4QRRA 3LKSA 2FGWH 3EUUA 5HHME 5C0FB 5T5FH 2FH6A 1DDHB 3SQOH 2V2WA 1KLUA 3UYRH 4OCSL 5MEPB 3VA6A 3QUYD 3CZFA 1DQLL 1QHPA 3ZZ1A 3UTPD 1UB5A 4LLAA 4XMKH 2VDLL 1I7RB 2DAVA 4JJ5A 4GMSL 1GJIA 4G6ML 3DBXA 2CRMA 2FR4B 4ZS6C 5F9DC 5ID1B 5HHQA 1NBYB 1IFHH 4Y5VC 1K8IA 3SDYH 1DVFC 3V52L 2RFXB 4F7EB 4PTUA 4R8WL 5D71H 4P2QE 5ILTL 5GS1A 2I5YH 4MA7H 3KYOA 4PGBA 1R0AL 4M7JH 2VMFA 4RFEA 4J12A 3D6GA 4I4WB 3LKRB 3QG7L 2ATKB 4J3TA 1EVUA 2ARJB 4XMPH 3ZKQD 4C54A 4QRUA 4G7YH 1AC6A 3CVIH 3V5KB 5L2KD 1KOAA 5CFHA 1VFBB 4L8DB 3K2MC 4WI2A 4NRZA 4DN3H 5ABDE 1BM3L 3MRQB 1EIBA 1KB9J 4NQDA 5D8JL 4PJFF 3U0PB 5JXED 1QSED 1ZT7A 2AJUH 5I73C 2VL5A 4U1MB 3ZT6A 5E00B 2NY2C 3VRJB 4YHML 1HEZB 1T1YB 3VRLE 4HJ0C 1VSCA 1AHWB 4NKDB 3CFKA 1CFNA 5KSUB 2KUTA 3E6FB 3T09A 3QO1A 1Q1JL 4W68A 5K9JH 3L7EB 2O61B 3HNTL 5FM5O 5I1CL 4X7FC 1ZGLB 4FQ2L 3ZL4H 1M71A 1JFQH 5M7QA 1MHCA 3MLWL 1ZTXL 1D5MA 2ZUTA 4X7CC 4LVEA 1MVFA 5F9WC 3FQTB 5SX4I 4Z76A 3VCLB 5HYQA 2E6JA 2D3VA 1IM9B 1NEZB 4WFGD 4PJEA 1M7IA 5CBAB 3KDMA 3JWOL 4OLWH 4YHZH 3F7RA 4R0LA 2GFBA 3RZCA 2F54B 3DMMD 3BO8A 4OUUB 3LRHA 1C12A 4TSBH 3QUYA 4GXUM 1UM4L 2HTLC 1NL0H 4ZAKC 3JV5A 1PGRB 4POZC 4P5TD 3AXLB 1YPZF 4FZ8H 4DOHB 1DBKL 3RGHA 2WP3T 3AAZA 3P11L 4YDVA 4YXHH 3GK8L 3DETC 4DQOH 5GSVB 5C9JB 1N6QH 1OAYL 1SEBA 4JDZB 4OV5B 5B8CC 1I75A 1DFBL 3U9UB 1Z6JT 2D03L 4OFPA 3FO0L 3C5SA 4G6KH 1A6VH 2FJHA 3Q5YA 3QXUA 3BKJL 1I1AD 4IRJB 4XWGH 4PJCB 5A40E 2PTTB 3B2UC 3GKZA 3VXRB 3OXSB 1OTTC 3T8XA 1C1EH 5I16B 3VXPB 3N1MC 5FKAA 3DX8A 4HZAA 2LV4A 4G7VH 3O81A 3T1FB 3QDGD 3D2UB 4M4RA 1N0XH 3OKMA 5TF1L 1I1RA 2GJ6E 3B2VH 5E6ZA 4NRXA 5F7NC 3ARDC 5IMKB 3L3GB 2KQNA 4OLZL 5LGHL 5FF6A 1T1WA 2X1OA 3MRDA 3GFUA 5DI8B 4TPRL 1P5UA 4WW2F 2ZNXA 1X5AA 5AAWA 3MGTB 4D0BA 5CJOL 4NQCA 1VFMA 4HULB 3SCMB 3QUMA 1XF3A 4NQCB 5BS0D 4X4XB 3S8WA 2LU4A 4WV1B 3H0TA 4Z77A 3OKDB 4PGZA 4GQPH 1YY8B 1CIDA 4XI5D 3VGDA 2C3HA 4PGJA 1S9YA 4XNMA 1VESA 3HAEA 4OCRL 4WWKD 3MJGX 4PJEF 3S88L 3CSGA 5ETUA 1MFNA 4Y1AE 1FIGL 2E8YA 2A2QT 5TFSH 1JK8B 3WFBL 5BRZA 5J11B 5CEYB 5I18L 4TNVK 5DHYA 1CCZA 4G8GE 1TITA 3KYOB 4PGBB 2F5BH 1W0VB 2H3NA 4ZAKD 1FIGH 2Q7NA 4LLDB 4V2CB 1P7QD 4GG6F 2JIXD 2X4RB 5DT1H 4HWUA 1QR1B 5FK9A 4P48A 4GMTH 1QSFD 3NFSL 1LVEA 1MFCL 5HXMA 5MEPA 1B6UA 1CFTB 3ZKMD 2GY5A 1J9CT 3P9MA 2H1PH 5EC1B 4IS6A 5EIIB 3R8QA 3OKMB 3V0WH 1J5OH 4YR6B 2OJEA 1SBBA 5KS9B 3MUJA 3OMZA 1IM3A 4G8GA 3I2CL 4X7TB 3FRPG 3MLUL 3PWUA 3SHSA 1FVCB 1U8NA 3CMGA 3NABL 1JGEB 4S1DD 4S2SB 1MCNA 2Z8RA 2IWGA 1Y6MR 4D9RE 3IT8D 5F9OL 3WFHB 4B7LA 3NCYS 3RUGA 3PWPA 5CZVL 2C3VB 3MA7B 1WQVT 1YUHA 4OQ1A 5I8EA 3D18B 3V6ZB 1CD1A 3HE7D 4WY7L 2ITDA 1QFOA 3UTZA 3O45B 4LRIC 1Z3GL 1S7TB 3O6MH 2C26A 2NR6D 2DLTA 5DMGD 3MRLA 3GKWH 1A7PL 4NUJB 2ESVA 1G7QA 1MPAL 3K4AA 3IAQA 1L7IH 1IAKA 1NAKH 2P1YA 43C9A 1U8JA 3OR7A 2OYPA 1ZGLM 4DVBA 1OGAA 4HWZA 2NY4B 1JMZA 1FJ1B 3X12A 5GIRA 3U9PL 4FZ8L 2R0WL 3BJLA 3T0AA 4HH8A 3K46A 1HI6B 3FO9B 4D9LH 1AI1L 3KLAA 5E08L 3LAFA 4JFYA 3EAKA 1XCTA 2UVFA 4QXUH 3RL1A 3LS5H 3TIDA 1EEZA 3MOAH 3UTQA 1LWRA 5CP3A 5IHZB 4XMKL 4YHZL 1MFBL 1RUQL 4M62L 1JGUH 1DUYA 3GSUA 4NP4H 5DFVC 2FR4A 3L3KB 4HMEA 4KROD 4IMKC 2BNRD 1PG7L 5IW6A 4KQ3L 5J57B 5EA0H 2X4SA 3NFNB 4TUKL 5KG9B 1WV7T 4YUEH 2FX7L 5CSZB 4PTUB 3WKML 4Z7OE 2BZDA 4L9DA 2JB5L 4M48H 2DL2A 1MCWW 1NUNB 3TVMD 4R0LC 4U1GB 2AABL 2YUWA 1LDPL 5EIVA 5HDQL 3NA9H 3W5MA 1J1XL 3CNKA 1HH9B 1YMMD 1KB5L 5B38A 2O5ZL 3HRZA 4HFUH 3IYLW 1MVUA 2X42A 4JQVA 3BYYA 3EYQC 3QT2A 1WBXB 4P9HH 4XT1C 5EZIL 4I0CC 2Y06H 1DUZA 3SGDH 1NGQH 4HIXH 3ZMRA 2ZUWA 2JELH 3VFNA 2HT2D 3ZSTA 3MJ7B 4MNQA 3SGJC 2B1AH 3ZTNH 5LGJB 2C1PA 3BXNB 3SDDC 4MSWB 3QULA 3LV3A 3CPLA 3EO9H 4HIXL 1F97A 2LAAA 3JWDC 5BS0E 5J13B 3PXHA 3VD9A 3HR5B 2YHGA 4ZSOE 3RVWC 4XZUB 2B1AL 3ZTNL 4XNXL 3VDAA 2AXJA 1XR8A 3D18A 1JUFB 2BNQB 3EO9L 4N0UE 4P23C 4LRIA 5DJDA 2SEBA 4G6AD 3H42L 3LKOA 4XPFL 3V7MA 2DQCL 1U9KA 5SWSB 5GS0D 4KQ4L 1T2JA 5CINL 1CE6B 1RPQA 1KJ2A 1J5OL 2JTDA 4KUZL 2P5WA 5SWZA 1ZVHA 5C1MB 3MV8A 4V1DA 4NZTL 4NQXA 4R2GD 3B3IA 3NZHH 2WLYA 1TPXC 5FUOH 4P49A 1IQDB 1MAMH 5JHDD 3FHQA 3TIEA 5D1QA 2NX5D 3VFUB 5JOPD 5DEZA 2XTJD 5L88H 1FL6B 4OI7A 2OSLA 2R1XA 3HA0A 5DA0B 5GRXG 4HUWB 4XX1G 3WIFA 4KJPD 3G5ZA 4NWTL 1PKOA 1EMTH 1A6WL 1OAQL 1P4IH 4ZNCD 4MD0B 3MJ8B 2VLJE 1II4E 3ISWA 1H5BC 2P44B 4MVBC 5ANMA 3Q5TA 3MLPA 5HI3C 4B5EA 4HUXB 4BZ2L 4YZFE 4FTVB 1B9ZA 4ODWB 2V2TB 3TNMB 4TSAL 4HPOL 4UV7H 2CRZA 3BEWA 5DJ0B 1T6VN 4BSWB 3U36B 5BS0B 4PIRF 1HSBB 3U9PH 1CGXA 4C4KT 4QGYA 4NYLB 4TVSa 4HKJB 4S0TD 4YDJB 2DM3A 4GS7B 5C0EA 2ATPB 4MJID 3ILQD 3HRZB 1ZTXH 3LMJH 4HIEA 5J9PA 1RJZA 3LB6C 3SOBL 4DVRH 3B2VL 4F8QA 1FYTA 1U8MA 3TVMC 4OGAC 4YWGL 2E27L 1MJJB 1A2YB 3RWHA 3Q1SH 4S0SD 3V6BR 4LKXA 3QUKB 4K9EL 5H94A 4LEXH 1NDMA 1RIHH 5IOPB 5CBEB 4ODHH 1PKQE 3F7YB 2R0KL 2QSTA 4GAJL 3HI5H 3RWJB 4MD5A 1XGUB 1Q9LB 2NY5L 2B1HL 3H2WA 1QSFB 4M6OL 3GMNB 1AI1H 1QNZL 4U05A 1R24A 1AGBB 2ZSWB 1HILB 2ZPKH 2V2WB 5DMYA 3V0WL 4DZBA 3VD3A 4JZOA 5I15L 5GJSH 2NY5H 5LXGH 3LD8B 2AXFB 3MLUH 3GRWL 4RGMC 3SDCD 1K4CB 1D6VL 2VITB 4Z7OF 4GMTL 1UGNA 1F6AB 4QHUA 2R69L 2HLAB 5DK0A 3MCLH 4HUXA 2Z31B 2GT9A 1CFTA 4NRZB 5CAYB 3M45A 4ONGH 2J8UA 4AIOA 4LSRH 3QRFM 4PREA 4MXWL 1AGCB 2VSCA 3V52H 1YEIH 4MAYB 4PJDF 4X5XB 1JGVH 5D1QC 2QADB 4L5FL 2DQEH 4LQ1A 5DJ6B 5DUPH 3OKLB 1GSMA 3VI4E 2VL4A 1A9BB 4BK5A 3U30C 4QRRE 2NMSA 4PRAA 2Z92A 1T83C 2A9NL 2EC8A 5ESQA 3MLSL 3D3VA 2OI9B 2APFA 5D1XC 4RWHA 1FYTB 1YJDH 1T3FB 2DJ4A 4LPCA 4Y5XC 4HGWB 2X1QA 5C0RH 3CK0L 2MHAB 5F72S 1ZHBB 1G7PB 3RTQC 3RUGE 2V7NB 3CLEH 4DGYL 4YDIH 1T22B 5L6YL 4JFPA 1RUPL 4GW4B 3BD5A 5EZLB 2EDDA 4KK5D 3HG1E 1ZVYA 4PGCA 4NQDD 2HLFD 3MOQA 2J8OA 2X10A 2NY6B 5IMKA 2EE2A 1J0ZA 1JF1B 2GI7A 4G43A 3N1GC 1RUAL 3QIUB 1AO7A 4PLOB 5IB3A 5JOFB 4Z8FH 1EHAA 1T5WA 4PV9A 4P4KD 4C56E 4MDJB 3U46A 5JW4R 3SGEH 1IT9H 1SYVA 2YA0A 3BP5B 1N6QL 4K94H 5C0GB 1RK1B 5F3HB 5C07B 5MEQA 1Y6NR 1T0NB 4I3SL 2FLBT 4JFZL 4Z95L 4BKLB 1T7WA 1NLBL 1FLRH 3C09B 3DARA 5ESAB 4Y16C 1AIFA 4YEFA 4M7KL 2VDRH 3S36H 5CIPA 4OFYD 2FSEA 4Y4FD 5D1XA 4ACPA 3QO0A 4HXBH 2EIBA 4UOJA 4ZYKB 1PG7X 2X7LA 1FNLA 4JREC 2NW2A 3L7FB 1VFAB 2GSIA 1LK3H 4M43H 1H9VA 2HT4D 2CMRL 1A0QL 1ZLUH 1Q9KA 1PW3A 1A4KA 1G6RB 3B9KB 1X5HA 5DJAA 1N2RA 5DJAB 5EBLA 3RWCB 3MNZB 5HHXL 3QEGL 4EUPG 5DRZB 4Y2DA 3DMMA 1F4YH 1OSPL 4Z9KB 4BZ1H 2R56L 3L5XH 4M6NH 4ZFZA 3K4DA 3MV9E 2BXYA 5DHXB 3KJ6H 5HDBE 4WI4A 1RUKH 4Z0BH 2R56H 3L5XL 3QULB 1E4XL 4IDJH 3W0WD 3C5ZB 1MHPH 2F74B 2Q8BL 3ROLB 3BAEL 4U6TA 3CVHL 3A67L 2IAND 3JTTA 3OJ2C 5C6TL 1F8TL 3HS0A 2JIXB 1EO8L 2R9HD 4O5LH 4TSBL 2WWKT 1G9NC 3UBXI 4ZXBA 3S97C 3RI5F 4XP9L 2R0LL 5FYJU 1JNJA 4UUJA 3TZVB 2EEDA 4ETYA 3GBNL 3GI8L 4H20L 5DJCB 4F7MB 1XF1A 1L6ZA 4KKAC 3MUY1 4JN1L 1CS6A 1MQ8A 1DFBH 3Q2CA 1KJ3L 3LN9A 4KH2A 5DSCA 1UT9A 3SGKA 4YDIL 2RHEA 5CSZA 4X5WA 1HH6A 5KSAC 4M6AA 2VZ3A 1NCNA 3BD4A 4NFDA 3V4VH 4NNPH 3ULUE 3S4SB 3QNYA 4HV8A 1MRFH 5I1DA 2D7MA 4MDJA 4EI5C 4M7LL 2FCBA 1JNNH 2YD1A 3ULUH 2NY2D 3QHFL 3BH8B 1U93B 2HFFB 1CDUA 4PRAB 1I8LC 3V6FB 1OL0A 3P4MB 1Q94A 3VXTB 5J6GA 3VFGL 2A6KA 4GSDL 5L88L 4NN6B 4OM1H 5C0BE 3HRPA 4LLVA 3NGBC 1K4CA 4PRID 4ZS7H 2Q86B 5E8DL 1DN2A 2J8HA 1LO4L 3MJ7A 4MNQB 5D7KD 1D5ZA 1J8HE 4OD2B 2C1OB 5BRZE 5I1KH 4KKLD 4PJ8D 3VGEA 2YA2A 4MX7A 1EZVX 4XHJC 4NPYA 5FO9A 5A2KH 1PX3A 1AQDB 3HS0B 4I5BB 3H9HB 4MNHA 4NNXB 1R3KB 4PJ7E 5E0QA 5H2BA 3DYPA 1BEYH 3WUWB 4OM0H 8FABB 4OLVL 4NOFA 5JR1L 4P46A 2O93L 5DVNA 2FEEL 2DQGL 1PEWA 4JB9L 1LEIB 2UY6A 1UXWB 3SJVE 5FOJA 4PJ9A 3IU3A 3QUXC 2K1MA 4UU9A 4HAFA 3UJTH 1AE6H 3SEPA 1BIIB 4KKNA 1YEDB 1B4RA 4LSTL 1N0LA 2K7PA 2D0GA 2HJKB 4JY6A 3MZGB 3QEQB 1J0JA 2QR0A 3T0EC 4E42B 3NMEA 2Z91A 1TDQA 3PV6B 4R7DA 2R1YB 5EUOB 2YPLD 4X5WB 1KG0A 4EEEA 3LS4H 5I0DA 5CBEA 4UT9L 3ZE2E 1FBIH 3OAUL 4Z7WF 3OAZK 1X5FA 3LKPB 2Z31D 2Q6WA 4UDUA 1RUAH 2XKNA 2X70B 5IBLC 2MNUA 3I50H 1GGIH 2LABA 4TVPE 5F93C 3T0ED 3ULUD 1GHFH 3QAZB 3QUXA 1UEYA 1U92A 4DCQA 5J1TC 4DK3A 2QADD 3OZ9H 4JZOB 3GGWB 4G8EA 4GG8A 3TEUA 2FB4L 1RZ8A 3OPZL 2X4RA 4P59L 2I9LA 1AIFB 3G6JB 3P3YA 3C60A 3FT2A 4P2OA 3JWOC 3STLA 3S9DB 4K94C 4WWID 1U8PA 5DWUL 1RU9L 5EBGA 4GAGH 3U0TB 1IZJA 4YO0A 1ZHKB 1QFWM 5HGDB 4M1CC 3GMLB 1P5VA 4G7VL 1MIML 4R4FL 3HE6D 2G60L 4X6CF 5IROC 2GAZA 2R2CA 5MERA 4XCNA 3SKUD 5IB4B 4KJPC 3PWPB 4KJYB 5SWSE 5H35B 3BH9B 2PXYB 3UPAA 2DQJH 3BOVA 2OZ4L 3ZHLA 1T1XA 3DURB 4P46D 4Z7UB 4LMQI 4P5TC 2BP3A 2P8PA 1Z5LA 1GC1L 3IKKA 1RURH 3L1OL 4Z18A 3HC3H 4ZFFB 1OD9A 4HGWA 3WFBH 5C08E 1YMMB 2XZCL 2UWEF 4XGZB 3MSPA 4AQ1B 4ZFOB 3TZVA 1NMAL 2CIKB 1ZLUK 2ICEB 3GDBA 1MCPH 2XRAH 1EERB 4XNYH 4R26L 1IAKB 1TQBC 3KLSA 3EOBA 4K7PL 43C9B 2UV3A 2DDQH 1FG9C 1QLEH 5IJVB 5GGTL 4JFOB 5GGVL 5CWSB 1KENH 3SGEI 5KW9L 2C1PB 2NYYC 1A7NL 4JQIH 3CSYB 4X9GA 1A7QL 1NGYA 3MBEA 1OAXL 1NGPL 4JRYB 1KB9K 1FL6A 5GSRA 2FJGA 1U8MB 5T5NG 1JHKH 1TZGH 3ZDZE 1V3MA 2CXKA 5CMAA 5TE7L 3T0XA 5CJOH 2CO6B 1JN6B 3LSOB 1SJHB 3VXQA 4X6DF 3MV8B 3HAEB 1CICB 2DQHH 2C7UB 3IFLL 5FUOL 3CX5J 3ARFB 1A22B 3JBG7 3GMQB 4X80L 2I07B 2CK2A 1OP5K 1CLZH 1R3IH 4QRPE 4MJIB 2AEIT 4Y5YA 3DRTB 3M17B 3AY4C 3KS0J 4JHZA 3EYQD 3UYPA 4JPWH 1IKFL 1J18A 1FV1A 1PY4A 1VGEL 3QI9B 4O4YH 5DJ2B 4HGMA 3DECA 3GK8H 4JZNB 3NGBB 3T0VA 1DL7H 4PJBE 1DQQB 1J1OL 2EE6A 3ULUC 4JQXA 5EORL 1GRWA 4Q0XL 5FYLL 4G6KL 3GSNA 1K9TA 2JK5A 1DVFA 1K5NB 1MCSA 3CK0H 4QTIL 3T08A 3MOBH 5T3ZD 2YSSB 2KZWA 4XCFL 1FYTD 2DQDH 2E7LA 1R3KA 3WUWA 3D48R 4JY6B 4F58H 3O41B 2Y07H 3DUHA 2HJFB 5EZOL 1X6LA 1CLYL 3E6FA 3TZVD 3BZ4B 3V7AG 1G7JA 1LNUB 4JN1H 1CFNB 4M5YL 4Y2DD 2HVKB 4GBXC 5I71C 3SDCB 4BH7B 1NFDE 1U8HB 4R96B 4POZD 3O6LL 4L9LB 4KI1A 4R96A 4EQ2A 1IC5L 4LBEB 5FKPA 1D9KB 5E94B 4RMSA 4TPRH 1WC7A 5FUCE 3LQAL 4RGND 4OJFH 1I8IA 1LILA 4X4MA 5HGHA 4KQ3H 1QPPA 3IU4L 4GKZB 1NLBH 2R2HB 3RZCD 4MQXD 1L7TH 3MRRB 1ZEAL 4M61B 1UACL 3OX8A 1FFPB 2GTZA 2DWDB 3VRLF 5KOMC 5L0QB 1H8NA 1HH6B 3C09C 1BVKB 1CI5A 1NDMB 1ZHKA 2NR6C 1FSKC 4OD1H 4DKFL 3WL9A 1SJEB 5I8CA 1WWAX 1NQBA 2OCFD 2XIDA 5DHVA 4EXPX 1P7QB 1TVDA 4ENED 3WLWC 4CADA 3BD3A 3FT2B 3S37X 5I1DB 4F9LA 4LCIL 1A7QH 2VO5A 1CTNA 5B8CB 5BVPL 7FABL 1N26A 3KLDA 4Y19E 2L7JA 1BPVA 2P5WD 5SWZD 2BNRB 1B88A 1IGJB 3HKFA 3SDXA 1OPGH 1NEUA 5HPOA 5FECB 3WIHH 6FABH 4WW2B 3IXAB 2ICWB 2COQA 1XF2B 1U2HA 3GJEB 1S9XA 2QL1A 1DEDA 2IADB 1G7PA 2VNCA 1FCCA 1AGFA 1XGYH 1V05A 2VLRA 1L7IL 5I1EH 3FQWA 3VW3L 3EYFA 4OLUL 4YUEL 3IDXL 4I18B 5DDHB 1XAUA 3WHE1 4LCYB 1FDLL 1MFEL 1YEEL 1OY3B 1UXWA 3O4LD 3O6FD 4BK4A 1IAIL 1CDBA 3UJTL 1DCLA 3HUJF 5E5RB 4Q9RL 1A9BA 4XCCL 5EO1B 2JB6A 3G6DL 1T20A 3DO3A 1OWWA 4WTWA 3SCMA 3BGMB 1G7IB 3GNMH 5DUBB 1JNLL 5FGCB 3IDIB 3DUSB 3FL7A 4OIIL 1A2YA 5IIEA 1KLGA 3MLZL 5IBTH 2YD9A 1HKLH 4Q74A 5T1LB 4V1DB 2IAMB 4LSSL 1N4XH 3B3IB 2UZXB 1YMMA 5BV7L 1IMHC 1CN4A 1KTDA 4J3UA 1FPTL 1CU4L 4Z7WA 4P2OC 3DVIA 3QCTH 3QO0B 3L5IA 5H37H 5LG1A 4JKMA 4CU7A 4KDTA 1BZ9A 1XR9A 2R0WH 2I07A 3A6BH 3BKJH 4XWGL 5C0FA 3OZ9L 1IAOB 3C5ZC 2NY6D 1T0NA 4AEHL 4ODVL 4RGOL 1HHJA 4P23A 1GGIL 2LVEA 4H8WC 1HSAB 1M6OB 4G42A 5CHNA 2NW3A 3HMWL 4KROB 1AKJA 4YE4L 3VGFA 3SKMA 2FNBA 2BFVH 4MLSA 2W0FA 1PEZA 3SKMB 5BCAA 5IT2H 3F7VA 1Q9OA 3CH8A 5TH2A 4J3WA 5E2WL 2JK5B 4JZJC 1ORSA 3V6OC 1ZANH 1H3PL 2LFGA 4PRNA 4WV1C 4RAVA 4JFHE 1KCRH 2C3GA 3C60D 3TVMB 3OKLA 3QI9A 4K8RD 4UTAL 4S1QH 4E9LA 1P9MC 2YEZA 3L3OA 3RHWK 2A77L 2A74B 5FA4B 5KANI 4EZMA 5B38B 3DRTA 3NN8B 4OV5A 2P49B 3DX9B 4PYGA 4LCCC 2YD2A 4OCLC 1ZSDB 2MQ3A 1WK0A 2LU7A 4OKVA 1FP5A 4NQEB 2EDHA 2ICWA 4L4VB 1OP3H 5JA8B 3IKCB 5F7YC 1Z5LB 1QNZH 1FZKB 3UPRA 2V2TA 4PJDB 1OM3L 3WXWH 5IKCA 5B4MD 3U4BL 1Q72H 4NQVA 4P4KC 3QG6B 4U31A 4IRSB 3DGGB 4AENA 5IEKA 2CKBA 2DLHA 3G5XB 1OM3H 1PFCA 4QXGH 3X13A 4ELMA 1IAOA 5I1EL 4RDQF 3FZUC 3I50L 1AO7B 5FYKD 1A1MB 1D7FA 1MAML 3TA3A 4LPXA 3WL9B 4PJ9B 2HFGH 1EDQA 1QEWA 1INQA 2A9MH 3QEHA 2IPKA 5F3BA 1EBAA 4KK8D 3ZKNC 3B5GA 1E4WL 3MFGB 4W6XB 1FGVL 2Y6SC 4XC3H 3LN4A 1LD9A 5ICZB 2P5WB 5SWZB 1UG9A 4G8FB 1K4DA 1I1AB 3QUMH 4MLIA 1LO4H 5JUEH 5CIPB 3PIQB 4O02L 3GMQA 4K8RH 5D1XD 3IETB 1RJLA 1JL8A 2FIKB 3RFZC 2YN5A 3BH8A 5DJ0A 4BSWA 4HEME 3AREB 1FO0H 3TJHC 1GH7A 3D69B 2CRIA 5DJ2A 2AK1H 3V6ZA 4Z7QE 1HXMB 3Q0HA 3DI3B 4KVNH 5F88A 1AGEA 4EJ1C 2P42B 3O6KL 2VDNL 1K3ZA 4PJDA 3M1BA 4M1DL 4RWYL 4PP1D 4R9HA 1AGCA 2C5DC 4OZHA 3RWGB 4NZRH 4DUXA 5F7KC 2CD0A 4ZD3H 4NQCD 5EUKB 1QFUL 2AEQH 4WTZG 4CMHB 2QTEA 1NMBL 4U1MA 2AXGB 2P4AB 1YPZB 2R0KH 2BC4A 4YJZL 5FDWB 3ZDXE 4G6MH 3NAAL 3BRDA 2OQJA 3MMEA 4KI5F 3BWAA 5FA4A 1BFVL 3DXAE 1WVZA 2CSPA 3NN8A 3BEVB 4IOIB 2HVKA 5TF1H 4FQXB 5JHDB 4NPYB 1ZLSL 3QUXD 1QTYT 3VXNA 4FQQB 3ZE1F 3PWJA 3RAJH 1T20B 2X70A 3V95A 5D7SH 3BMVA 4R90H 4OKDA 1YYML 5KOVC 3QDGA 1B2WH 1IGIL 1P7KB 1FQ9C 2EZ0C 5E1AA 4PJBB 1VFUA 2R2BA 4JEGB 3FQNB 3K7UA 25C8H 2DMKA 3A6CL 4LQFL 2GKIA 1QFWH 1X5JA 2HN7A 1BJ1H 3TFKC 1NBYA 3TGXA 3C8KA 3UZQA 3CC5A 5HI3D 3S98A 1IC4H 1MY7A 2AKRA 2EE9A 1OLZA 1I1YA 3KLHD 1UKSA 1XF4B 4JDTL 2CK0H 4NC1C 1N2RB 4OSUL 1R3HB 1BQLL 1YNLH 5HD8D 4PV8B 4NN6C 2ENYA 2MFNA 5I71B 2E9BA 2HG5B 5TJWK 1BVZA 5HPMB 3I75B 3ARGC 4P57B 3HUJE 1RUKL 1HKFA 2XPGA 1GGCL 4YXKL 1W72B 2IPTL 3GSWA 2AJUL 4HWNA 2I9TA 3O6ML 2NY0D 4KK8C 1ONQB 4LRNH 3IDJA 5ADOL 4MS8C 3VXMB 3CLFH 1KC5L 3U4BH 1BZ7A 4RFNC 1WSST 5FIEA 3KXFA 1T03H 3VGAB 5FKAB 5ALBL 5GGRB 3WMSA 1FNGA 2NYYD 5GRUH 2NLJA 2XTJE 3U0TA 3UPCA 5GS0L 3GI9H 4L29A 3KS0H 1MLCA 3S34H 4X7EC 4HJGB 4PJBF 5I76A 2VXTH 3TH2T 4AENB 3NABH 5GGQH 3CJJA 1A7OH 2A9ML 3QHTC 1R3LB 3QDGE 1J0IA 2VR9A 1KLFA 1B4JH 4OZIB 1P6AB 3IU3B 3KPTA 3DYMA 3BUYB 1NDGB 1RUQH 1SJXA 4IOSD 5C0RL 3SE9H 3BUYA 1CE6A 4JFPB 1N8ZB 3KPMB 1OTSD 1I3GH 2WW8A 1E4XI 1QRKA 4FZEH 3LSOA 3T0BA 3DIFA 3QUYB 2X4OA 1I9JH 4XPBH 1WBYA 1K4DB 1LQSR 1F11B 3QSKB 3PABA 1MCOH 2JELL 2NNAA 4JPIB 3GMNA 5IT2L 5L2KA 1IL1B 3SN6N 2AK4E 4Q58C 3D3VD 4M7JL 1RZIA 2Z35B 5F1NB 1UZ8B 3FOMA 5JMOC 1IKNA 2D31A 3RVUC 1ITBB 1MRDH 5EPMA 3NA9L 2MCG1 2HH0L 3KPPB 2ILLA 5HD8C 3SO3C 1A7RL 5C0IA 5FGRA 2Z93B 4LGPB 2H32B 2J5LC 3HE6C 4CU6A 1OWRM 4QRQA 3X11B 1J05B 5EOTB 2YOCA 2FO4B 4Y2DB 2OL3B 3OAZH 3RGVD 1UH3A 4YZFF 1WFUA 4OT1H 4U49A 4XP4L 5IG7B 4NYLA 4PJGA 5I30H 3P9LA 5JTWA 2C7UA 4MXQD 1IEBB 3RL2B 4OZIF 1P4LB 4UIMB 4GKNB 1OSZA 5FYKU 2CIIA 3QDHA 4QRSB 4OLVH 1T04B 2GAZB 1N59B 1CZ8L 1U93A 2HFFA 2ESVE 4JO3H 4ZODA 1ZSDA 3MOAL 1QFHA 2HAZA 4LCUB 2R23B 3DX9A 4MD0A 1JZ6A 3RI5K 3MA7A 4R7NB 3QI9D 2QR0B 4E42A 1HXMA 4YHKH 5EWIL 4XH2A 2ED9A 4FQCH 2CKBH 3MLZH 5IBTL 4HWEH 1HOCB 4G5ZH 4IBLT 1AXSA 2P8LB 5IFHH 4P5MB 3TESA 2RAMA 2O5YH 4MNGB 4WW2C 4PP1C 3FO1A 5CKGA 3AMKA 3HNSH 2Z35A 5KJRL 4GLRH 5DJ8B 3STZB 4LDEB 1KELL 1D5XB 3EJYD 4LARL 3ARGB 3HMXL 1TJIL 4HIHB 4XHJD 4UMGA 3TPKA 3KYNB 1M05B 3NPSC 4Q6YA 1DDHA 5EO0A 1NCTA 4ALAH 2PCPB 3F12A 5I8OL 2AJXL 2Z31A 5DZLA 4B41A 4WW1A 1NFIB 1NCDH 4HS8H 3BW9A 4PG2C 5D96B 2UZIL 3BO8B 5J6GB 3KG5A 2G60H 1OD7A 5EA0L 4X83A 1I9RH 4P3CL 5EBWB 1FHGA 2Q20A 5GRUL 1QHOA 1RI8A 1I9IL 1RIHL 4Q9BA 1RZJH 2NY0B 3EYSH 4JFFE 3QR2A 3MLTA 1C16A 3HZKA 3L3KA 3FONB 1IGTA 4JDTH 1LO2H 4OQTA 4F57H 4ZYKA 3O4LB 5HHNB 4IIQA 1CR9H 3VFSB 5HGBB 3PDDA 2YWZA 2YD8A 2IFFL 4JDVB 4GS7C 1W0VA 2EH7L 3G9AB 3GSXB 4ORGA 7FABH 1NBZA 2XN9E 3WHXA 1ERNA 4F37K 5I1HH 3NPZB 1K8DA 1CK0L 4JPKL 1EFXA 4LCYA 2YWYA 4J23A 2HTKC 1EJ6A 3VXMA 4I0PD 1S7VB 3KJ4C 5J56B 4L4TA 2D4DA 4NKMB 4KTDH 5IVXB 1DBBL 4GSDH 4OD2A 4ZFZB 1F6LL 3QAZC 1GGTA 3ARDA 4XVTL 1AGFB 1OGAD 4X4YB 4JQXC 5DVMA 3GUTA 5C2BH 3JWDL 1MWAA 4XI5C 4LVHC 1IQWH 4LP4A 1FNSL 4YDJA 4DN4L 2V9QA 1U3JA 3NCJL 4Z7VA 4H1LA 1MF2L 5JIPA 1I8KB 1T0MA 2MSPA 3FB8B 3EYUL 1NGWA 1BWWA 1IC5H 5I1IL 2C3VA 5MP6L 2EDNA 2E3VA 1NKRA 4IRSD 4KMQA 3UO1L 4PP2B 3L5HA 3MJ9H 2FX8H 1ES0B 1CXIA 2B8OT 2P5EE 2V17L 2YUXA 3A6CH 3C6SB 1FZKA 1O5DT 4C83A 3UPRB 2NXZC 1IC1A 1WT5C 4RA3A 1VB9A 2GJ6D 1WWCA 3NCYP 5HYQB 3FQNA 1PQZB 4OQTH 2ZKHH 4NZTH 1FH5H 3UEZA 3MXVH 4L3EE 4OCXH 1UC6A 3KPSA 5E1HB 2MCPL 4JFFA 1VGEH 4RIRB 5C09E 1F4WH 1C12B 2F5AL 3DVGA 4N1EA 3JTSA 4YNYA 3DV6A 3MGOA 2MQCA 1FZMA 1P7HL 4U1NA 1KTDB 5LQBH 2IQAA 4H26A 1BX2B 3TVMA 4X8JB 3NIDF 4Z5RA 1GZPB 5I66A 4QRRB 4Q6IA 4PJHF 3RNQB 1P7QA 4EUPH 4LGRB 3AXLA 5B22A 2E7CA 3B9VA 3HMXH 4KI5D 5C07E 1TVHB 1MNUL 2QKIA 4JO4H 4WEMB 5EH1A 3P0YL 2VQ1B 3CDFA 5HHPB 2PO6C 1LEKA 5BQ7A 1YEJL 3FFCB 1ACYL 2PTVA 2B5IC 4CRPA 1MNUH 4R4NC 3STBA 1W2KT 2IH3B 3FONA 3V5HA 5MHSD 5DD3L 1XGQB 4PRPB 3VDBA 5SV3A 4TQEL 3REWA 3MRHA 3HR5A 1T66C 2DJSA 4KJQD 1I7ZB 1PLGL 3WEXB 4Z7VE 4XP9H 5DMIH 2Q7YA 3KR3L 5C3TA 3ROOA 3C6LA 5HVWA 2NX5A 2X4PB 3O3EB 3G08B 4EN3A 1RFDL 1OGTA 3PWNB 4HUVB 2D7TL 3I3DA 3KPQA 5FDYA 4HUVA 4MCYB 2OJZH 1EJOH 3KPQB 4PJAF 2VJXA 2Q3AA 3FOLA 4PJDE 5L9DL 3GO1L 4Y4KA 3BGMA 1S9WB 4ODVH 4HJ0D 1FZOB 1QKZL 2A6DB 5E6YA 1Y18B 1RZJL 3FJTA 1XF5A 1DQJB 4IMLB 4HUKB 1OT1A 2OBGA 5J6HB 2W9DL 5SWQB 1D9KD 4ZOAA 1A1MA 3TA3B 3MRFB 3B43A 1WISA 4YGVA 4YHOH 4Y19A 1RZIB 1AR1D 1AKJD 4IRSA 3VJ6B 3L95B 1YMHA 5J13C 5C9JA 1A47A 5TE6H 4Y7MA 3RNKB 3ZKSD 4NZJA 2MWCA 3X14A 3GB7A 5FECA 2ZOLA 3O3BB 4WFFD 3U6RA 4YEEA 3HZYB 4HK0A 2F19L 3QFJD 3QQNA 2GSIB 1UQSA 1S7RB 1M7XA 1MJUL 3ARDB 4WEBH 3DRQB 2VLJB 4I5BA 1LP9E 4NC0B 2IFFH 4HW6A 5D4QA 2ADIA 4K2UH 4J4PC 1ZLWH 4U6VL 2OI9C 3G9VA 4P2QD 1DBJH 4HUMB 3X3GH 1DQMH 4N9GB 5K9QI 4OAWB 12E8H 3EO1A 5FO7A 4M8QA 3RJQB 1IC7L 3DTXA