5EO9A

Crystal structure of the complex of dpr6 domain 1 bound to dip-alpha domain 1+2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
b'MEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dpr6, isoform C
publication title Control of Synaptic Connectivity by a Network of Drosophila IgSF Cell Surface Proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell adhesion
total genus 28
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2015-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eo9A00
2X7LA 2VQTA 2IJ0C 3SJVD 3VFNA 5JO5B 4K7PY 4YHIA 5DC4B 3WLBA 4HCRL 3ULVD 4JJHA 4UB0L 4XXDA 2R2HB 5TGBA 4QOKE 2AGJL 4U6YA 5I8EA 1KJ3H 5D5MB 5D71L 3QYCA 3VI3F 1RK0B 3SJVA 4JFPA 4M5YL 4YHLH 2W0FA 5IVZB 5I9QB 4NRXB 4NBZB 4QXUH 2AXFB 5EZOH 1MCEA 4K8RH 1N6UA 1IRAY 2GJ6D 3E6HA 3FAWA 2DB8A 4QWWD 3ORJA 4G9FE 3WJLA 1INQA 3TZVD 4L4JA 3GIVA 3G6AA 1I85C 4OKVB 5IB2B 4OLYH 4KC3B 1PQZB 2C1PA 5ICZA 1CGTA 4WHCA 4ODBD 2FB4H 1UH2A 5IW6A 1A6UL 3HS0A 5M94B 5IMOA 5DTFB 1MFBH 3BE1L 4QRRE 3W9EA 2Y23A 3RPIB 1ZS8B 3QEHA 2A1WH 5GGUA 3OZ9L 1R3HB 1FFQA 5BVJB 3KVQA 4NCDA 4MD4B 5EUKB 1OTUC 2OK0H 4JQVC 4PY8J 3QUXD 3SKMA 3FONB 3MRRA 4CADA 3OG4B 1J8HB 1QQDB 3WKMH 3VJ6A 5BO1L 1I3GH 2ICES 2H45A 2X70B 5KSBA 1JWUA 1GVIA 3I6GA 3VCLA 3QUXA 4R90L 4HBQA 4OLZL 4R7DB 3IU4L 2EC9T 2IANB 5EC2B 3OKEA 3GSUA 4UTBL 2R69L 1XGRB 4OUUB 1U42A 4AQ1B 4OCSH 3LH2H 4MJ2A 1A0QL 2B1HL 4XPTL 4X4ME 4Z7UA 4CMHB 3UJJL 4NCC2 4ZXBC 3BJ91 2MFNA 4NQEB 4XVUC 1U8IB 3RHWF 4X8XA 3WDJA 1V5JA 4YO0A 3LIZH 1Z3GL 1XR9A 2HLFC 3OR7B 2VDQL 4L4TA 5L88L 1EEZB 5JA8B 3CIQA 3EZJB 4JFDD 1YQVH 3BIBX 3KXFD 5F9OH 1WIPA 3NABH 4WFGD 3PDGA 1KCSL 3AUVA 4R97C 1T1ZA 2DL2A 4WI5A 3GJFH 2VXUL 4UQ3A 2IALA 4U3HA 5I1KL 3B9KD 1QA9A 2FJHB 4S1SH 4RGOL 1F90L 3MLWH 4BSVB 4D9RD 3F12B 1JRHH 1QLFA 5GGVH 4RGNC 2ICEB 4M7JL 1JGDA 1Q72H 3QPQD 3TJEL 5ACZA 4PJXE 4OGAC 2OL3H 3LB6C 4HT1H 1YNLL 3MV7D 3EDDA 4BKLA 3MRPA 4NFBA 1X6NA 3ILPB 2C3GA 2FYYB 3O8XD 1A7RH 2JIXA 1C7TA 2Z4QB 1KJ2H 4LP5A 3T2PA 3P4MB 2WQ8A 3MV7A 3THML 5LXGH 4F2MA 4QRQA 2FX8L 1JTTA 1LK2A 2H32H 1TXKA 4HF5H 5KVGH 3GK8H 3H3PH 5C71A 4PGCA 4GAGH 1UB5A 5IT2L 3MUGB 3S34H 2HT4D 1EEYA 4PTUB 4QHLA 4BFGA 3FO2B 3D0VB 1J5OL 1UZ6E 1WWWX 3SE4A 3ZT5A 4QTIL 4U7MA 4GXVL 1RV6X 5CUSL 4UV4L 1QG3A 3BPOC 4LVEA 2FBJH 1HH6A 5DD0H 1OARL 4JRXB 2DQUH 1T83C 1PVHA 4NO3A 5JIKA 3WNNA 4ZO9A 5BZWA 4IRZH 3SDYH 2VE6B 4KRMB 3B8SA 5F1IA 1VERA 2ZJSL 5ADOL 3UX9B 1JHTA 1NEZA 4EUPB 4X80H 1DE4A 2HFGH 4HC1H 1GPOL 4KKLC 3UDWC 4LPXA 3EYVB 4L3EB 3V0WH 5EU6E 3VWKC 3QQ9D 3P9MB 2RGSA 1RJLA 1HXMB 3QQ3A 1CG9A 3SY0B 3LOWA 4HV8A 1RIUL 5AUMA 3H9SB 3QH3A 1DQDL 5FB8B 4X9BA 2CIKB 4J3UA 4C59B 1RZIB 3IVKB 3HE6A 1QOKA 5EC1B 5D2NC 3FZUC 4Y19B 3QDJD 4HHAB 4QHKI 3WFDH 4GG6F 1LNUB 1Q9KB 5C0GA 3BPLC 2WUBH 5I1IL 4MAYC 4XI5C 2ZPKL 2ZP0T 3O4OC 1QD0A 3AROA 3M17A 3T09A 3UEZA 3AGVA 4BFBD 5FOBA 5CJOH 5HGHB 2R39A 5IQ7H 7FABL 2GIYA 2YMXH 4Z7QE 1YJDL 2Z31C 1MLCB 1MWAH 1FN4B 1KIPA 1N6VA 3DHMA 4M5ZL 1D5ZB 5AYQA 4MS8D 4YEFA 1R5VB 5D7KD 3RUGE 3KPLB 3BGMA 4LLYB 4PJBE 1JYNA 3KHQA 3QIBC 1B4RA 1QLRA 3ESUF 3SEPA 4OZ4A 1U8KA 4N0UA 1FPTL 4DUVA 3ALWA 2BRRH 4GRWH 3B2VL 4P3DB 4QY8B 4KK6C 3PWUB 3WHE0 4HH9B 4B50A 4BZ2H 4KRNA 5JHDA 2MKWA 3QCUH 4LSSH 3S96A 1MQKH 3K8MA 1CXEA 5J89A 1B90A 2X4QB 2E6JA 5I76A 3CD4A 4PR5B 3VFPA 3U36A 3HRPA 1MCSA 4G7YL 3LV3A 1PW3A 3CVHB 4JAMA 2F54E 5DJCA 1Z0NA 4JJ5B 3WIHA 1TETH 1WEJH 3BEWA 1RD6A 2AVGA 4JCLA 3N85H 4UT7H 5DT1H 5INCB 5SWSB 3GIZH 3L3OB 3VW3H 4U31A 4YJZL 2L4OA 1FZMB 2IFFH 3MRCB 4OTXH 1SBBA 3VFWB 2JK5B 3QG6A 1J11A 4XRCB 4YIQB 3SGEI 3MBXL 4R8WL 1KPRA 3KDMA 3QCVL 1YDPB 1AD9A 5FXCH 4PJAB 1MIML 3NA9L 5FF6A 2R23B 2YOCA 2A6KB 1GJIA 1N0LA 2CUHA 1OAXL 4S0SD 3G5YA 1I1FA 3FHAA 5C08D 3SE3C 1NBYB 3X11A 2QL1A 1P6AB 1I8IA 1P84K 1GGIL 5SWZE 1DEEA 3U2SA 5JPMA 4XPFL 4LU5H 5C08A 1LD9B 3KWWB 1J0JA 1CDHA 5IF0A 3AFLA 4PJEE 3U4EB 2DQTH 2P5EA 5MP6L 5DVNA 4P3WA 5HY9A 1IGFL 4RMWA 1A64A 5DVMA 3AS1A 1E6OL 3RAJL 4GKNB 3LCYA 1QSED 4CVXB 4UIKL 1E27B 4QCIB 1X7QB 1C8PA 3BDXA 1NC4D 1CDIA 3VG0H 1VFAB 2YRZA 5ICYB 2FATL 5D1ZA 1P4LB 5D8JL 1MI5E 1TJHL 2NX5B 4AQOA 1UB6B 3UPRA 1AGDB 2Y5EA 1RAMA 3V6OE 5IR1B 3KNBB 1IGCL 4JFED 2GSGB 3MXVH 3MXWH 4Q9QL 1P9MC 5EO1A 4YHZH 3W39B 1NJ9B 2FIRT 1MVFA 4PJDE 5JQ6H 4P23A 4UBDD 4A6YA 4JFXA 2E7LC 2R8SH 4KWUA 1J87A 3LS4L 2EDQA 1HSAA 5ETUA 1GGCH 3RA7H 1F8TH 1X4ZA 1X5XA 1YC7A 3MV8B 1LE9B 5E6IC 2WLYA 2XZCL 1TMCB 4RAVB 1F6AB 4AENA 5J11C 1J0KA 4HUNB 5BRZD 5EO9A 5ITBH 1KIRB 1EO5A 1RK1A 2D7TH 3LRGA 2OZ4H 3U9UB 3X13A 1W0WA 2BXYA 1I1YA 2C5DC 5J9PB 5F9JA 1A1NB 2EYSB 3MLRL 5BRZA 5TDNA 3SDXA 1CU4L 5EOCJ 4KMLB 1FFOA 4GBXD 2FHBA 1HXYA 2X4RA 4RWYH 2LVCA 1DEDA 4JN2A 1QLEH 4DVBA 1H3GA 4YQXH 5F1SA 4GBXA 4AJ0A 2LTQB 2J3SA 1XFPA 3QIWD 2VL5B 5F7NC 1AC0A 4N9GB 2IFGA 1CTOA 4I0PA 4Q6IA 3LN4B 4BH7B 2Y25A 1FRGL 1RU9H 1MUJB 4HGMA 3E2HC 3CC5A 4M61A 4YXLL 3EYUL 4V2CB 3CVHL 4D3CL 4E41B 1MRDH 1LILA 1HQRA 5EBMB 3BYYA 4TULH 2CDFB 1F4HA 2H8PA 3MJ9A 3CFDB 4EZMA 3L7FA 5I1LA 2V6HA 1MLBB 3FMGH 4GS7C 3BEVA 5FCUL 1BOGA 1P69B 3DTXA 3TYGL 2BY1A 2CKNA 3U6RA 2RR3A 5T33L 4JR9H 2JF1A 3MLUH 1OAQL 3U1SH 5I30L 3CVIL 4HGWA 1H0DA 5D7JA 2WMPA 5DJAA 3VFRB 2OR9H 3RNKB 1GGUA 2IH1B 3VXSE 3T77B 2W60B 2NYYD 1NMCC 1TVBA 4MNQD 4M6OL 2MPAL 4LGRB 2DBLH 3QNXB 2QSQA 4APQC 3V7AG 1YUHA 3W82A 1UWXH 3MLZH 3U46B 5C0DB 1GC1C 4MNQA 1BX2B 3SDDD 1ZGLM 3RTQC 1TZGL 1VEOA 3AB0B 1R0AH 2K1MA 4ELMA 3EOAA 3QDMB 4XBGB 3BH9A 3ZDZF 3SDDA 2GTZB 4AK1A 2CK0H 1I8KA 4KK9D 1B2WL 4FG6D 4YE4H 2MOVA 1WAAA 5HHPA 1WLHA 2OR7A 2YBRA 1RJYA 5C8JA 3TN0D 3O81A 4LQ1A 1DBBH 4NZRL 1EXUA 3IAGC 5DFTA 4PRPD 3SE8L 5B3NA 4PRBB 2DQJL 4W4OC 4TNVK 4XCFL 2GK2A 5CJBA 5ESVA 4ZO7A 1FVCB 3HPLA 3VFUB 1LO0L 3ROLA 4PRPA 4KQ4H 2DYPA 5GZOC 4FHBD 2MHAB 3FQRB 1MCNA 3WFEL 3RX7A 5E1AB 4DZ8B 3VXUB 4F9PA 4LLVA 4ZO6A 1IC5H 1LVEA 2D31A 5CBEB 2XTJB 4JO4H 2PKDA 2EDHA 1TLKA 2HTKC 4GMSH 1C5DB 1OSZA 5HHNB 4XAKD 3TVMD 1XT5A 2ADIA 5D5MF 3MROA 1ZTXH 5FECA 2EZ0C 5D2LA 3PWPE 3W2DL 2ITCB 3ECBA 3TVMA 5FKPB 3S88H 1FZJA 4MMZC 5D7LA 4XMPH 5GQBA 4RGNE 1MCKA 2HRPH 1FVDB 5E0QA 3IXAA 4MX7A 2XI9A 1GHFL 1HI6A 4YNYB 1YMHB 1RHFA 2ATPA 2A9MH 2VLRE 4GSDL 2ZOKA 1I1RA 5FGSA 1I7TB 4IOIA 4XP9H 2WWKT 12E8H 3QA3B 4JPWH 4JRYA 3S4SA 2VDRL 4NM8L 4UQ2B 3O45A 4EIGB 4Y0GA 4KHXL 3RZCA 1F58H 5FYJE 1F3DH 4LF3A 2OL3A 1IEBB 4G9FB 2HT3D 3C60D 3T4YA 2FL5A 4OCRH 1MJUH 1EAPA 1GZQB 4OFYD 4RISH 1IQWH 1F02I 3VWJC 3E0GA 5DUPH 2EKJA 1P7QB 2X4TA 1KJ2A 3EFFA 4XP1H 5GGSY 1ZHLA 1U8NB 3JVGC 2H32A 4NBYB 4EI5B 4JZJA 4QRRB 3OWEA 4Y5YA 4YPGA 3GRWH 1A1OB 2AXJA 3ULUC 4PJ9B 5D7IE 4FZEH 4N8VG 2BSED 4PJ7A 1KJVA 4J4PA 5CGYC 2NCMA 1BFSA 1N6QH 1JMZA 3ZTNH 4MXWL 2H9GB 5A40E 3NFPA 1CLOL 1OGAA 1UZ8A 1H3UA 4X98B 5DMKB 1OLLA 4W4NA 1OW0C 2QADC 5DRXA 3U9PH 3O11A 2UZIH 1JYVA 5JQHC 2D2OA 3ZDXE 2W1NA 4OLUH 4YDJA 4Y2DC 2VIRB 1XCTB 2HN7B 4HC1A 1WC7A 2LVEA 3W81A 4P5MB 1JGUH 1E6JL 4TVPE 5AWNH 1C5BL 3G5ZB 2PO6A 2YA0A 5GISL 2YZ8A 1CI5A 5TDPA 2VR4A 5FO8B 3WN5A 5DD3L 4WUUB 2DIAA 2I9TA 5I17A 4NN5B 4JO2L 3DX7A 1PJ9A 2A2QT 4FXKB 3W9DA 6CGTA 3P0GB 4GQ9L 4X6CA 1OTSC 4LLUB 3BPCA 5J1SC 5I0DA 4KMTH 4KK5C 3SCMC 3I02A 4NSKB 2OI9B 3ME0A 3DV4B 3B5HA 1U8MA 4R4FH 4RDQG 5C70A 1S7UB 1S7VA 2Y36H 4OCLC 4P2OB 1J0IA 4R6UA 2V9TA 3MA7B 3KYKH 4PG2A 4NRZB 4TUJB 1ZEAL 2V2XB 2GSIA 3ZDYF 3GHEL 2YD5A 4PJXB 5IW3A 3OB8A 5IG7A 3FCTA 5IROC 4K3GA 5KSBE 3P0YL 1E28A 3HRZA 1TQBC 3WSQL 1U91A 5F93C 3ARGA 4PJ5D 3IFPA 5JNYB 3CZFB 3IT8D 2NY2B 4HK0A 4MB5A 3WD5L 2FX9L 4EDWL 3BT2L 5E2WH 4PJHA 4GAJH 4PV9B 5CP3H 1FL6A 3ALPA 4QNPE 4TN9A 1RVFH 2VZVA 1QTYT 4IRJB 3T1FA 4X7DC 4FFZL 2ORBH 4PJ8D 4LSPH 4QRPB 3FN0H 3R4DA 1U95B 3HFML 2Z93B 5HPOA 1GOFA 2XKNA 3SOBL 3N1QC 1VGEH 1JZ7A 4OV5B 1HHJB 4B7IA 2J5LC 4HKJB 4R3SB 5ACMA 3DRTA 1ZHBB 1LO3H 4L4TE 1WUNT 2YA1A 1VPOL 3QFJE 1CD1B 3PWNB 1S5IH 1IJ9A 2NNAB 4N8CL 5ISZA 1Q8MA 2W38A 3GHBH 1J10A 4WU5B 2VZ1A 3IDIB 3RWIA 3ARBD 5DI8A 2VOTA 4ZUVB 5EU6B 5GJSL 4ZYKA 5ID1B 4J6RL 4Y5VC 1KCUH 1LEGA 1YEFL 3K1DA 3ZSSA 3WIFB 3V4VL 5I1CH 1NGZA 2O61A 3BN9C 4Y4KC 1A8JH 1WGOA 1NH6A 3V95A 4RMUA 3PDOB 1WIUA 3QNZB 4OQTL 3B9EA 5E5MA 5IBLC 4YR6A 1IBGH 1MJJB 4ZAKC 1PZ5A 1DR9A 4QGYA 4ALAH 3JV4B 5DO2D 1G0XA 3DMMD 3O4LE 4JO1H 4NNXB 4DGVL 4RBPH 5IQ9A 4Y5XB 3RIAF 4XPAH 5TF1H 5CGTA 1DUZA 1I7UA 4DZBB 1NC2D 1TJGH 4QXTA 3UYOD 1IL1B 1PKQE 1KLGB 4O5LL 4IHOB 5AD0B 4PJBB 3LD8C 4HXBL 2RCSL 1HCFX 3QQ4A 3REVA 3ARFD 5FUOL 4DTGL 1BHGA 2D7PA 3FL7A 3RVWC 2KPNA 3KR3L 4OGYL 1HSBB 3OB0K 5E24E 3RIFF 4AEFA 4MXQC 1WFUA 4JDZA 5JMRA 1FH5L 1KCRL 3L3HA 2QEJA 2R4RH 1CXLA 2J4WH 1D6EA 3SGDI 3U79A 5IGXH 3T0EC 3LQAH 2DJ4A 5TH2B 2VDLH 3V2AR 1T66C 3BQUB 2JELH 2EE2A 2F54B 5E8NB 2N7BA 5HDQL 1TDQA 2OTWB 3NBNA 5B8CA 3PP4L 1YEKH 2E7MA 4IRSA 5DS8A 3HTLX 3QDHA 1YEGL 1RHHB 2OZ4A 4G9DB 1DANT 3EYFA 4HSQA 5EWIL 3HAEB 3IFNL 3EHBC 3RDTB 2R29H 4KKCC 4XGZA 4UDTA 2AJUH 4DGIL 1S9XB 5LG1A 1GXEA 3UROR 4ODXB 4EJ1C 4MCZB 3HMXH 3MRDA 2A73B 4WHDA 2A6IB 1T04A 2XWJB 2RIKA 2GY7B 4X7SL 1CGSH 1NMBL 4MCYA 3EJZD 1MH5B 1I85A 2HTLC 5SWZB 2ESVD 1WBZA 3ELAT 2VQ1A 1KENL 5EPMB 5B4MC 2A9NL 1NCBL 5T3ZL 1HKLL 3GMQB 4PJEB 3MODL 4AT6B 4ZD3H 3TIDA 3L3GB 2NY6C 5I1AB 3O41A 2M1KA 4C54A 3PGDA 3LZFH 4KHTH 4O02H 4HJJH 5AAWA 3O3AB 1BQLL 1RZKH 5DUBB 2HVKB 2Z91A 2X9YA 5FHAL 1B4JH 5IB5B 2IG2L 1CF8L 4NT6B 1NFIA 3V5DA 5GGRB 5BW7A 4OI7A 5F7YC 1I7RA 1MHCA 4YFLF 2A6JA 5C7XL 1CE6A 4BYHA 4M43L 5FOJA 1BECA 1CFNA 2CDGB 1MI5B 1IKFH 3U30B 4PRID 1AH1A 4LNVA 5L2JA 5I1HH 4N5EC 3MRKB 5GS0H 1RURL 5DJ6A 5HI3C 1XF4A 1JJUA 2HLFD 5F21B 1A9BB 4HBCH 4PJDB 4ONOA 1EFXB 3BZFA 2EIBA 2X2YA 4FFVD 2NY1B 2JJWA 3FO9B 3OKKB 2BOBB 4JHWH 2HJKA 4X4XB 4FFYL 2PYED 3QEQB 4P5TC 1VB9A 1M71B 1U8JA 3GI8H 4GRLD 3ULSB 3BO8A 1R5WB 5JR1L 15C8L 3EFDH 2PYEA 3SE9H 4K9EH 4R0LB 4JM2A 4GRLA 1N5AA 3ZE1F 2P5EE 3WNLA 4CNIA 3BP7A 3BX7C 4OGAD 5C1MB 1XZ0B 3LB6D 2HA1A 1CFTB 4KJYB 1T80A 5HBBA 3KLHC 4LIQL 2ADGA 2EH7L 1S3KH 3WIIH 1EERB 4S2SB 2GJZB 1LO2H 5DJ8B 4LLMA 4XCCH 4J8RB 1I9IH 3DXAA 5A16B 3WYRA 2FO1A 1URLA 4M7KL 1RI8A 5FYJD 5FKAB 3VXPA 3C9NB 4G8FA 4HKXB 2DLTA 4U1KA 1KC5H 3D87B 3RZWA 3MA9L 4AL8L 1T4KA 5DFVD 1KN2L 4O9HH 2VJXA 2OS7A 2GFBA 3BKMH 2PW2B 2A38A 5JPNB 1UVQB 3FFCA 1T2QH 3QCTH 1ZLSH 3IFLH 2YA2A 1ADQH 1MHHA 1ZSDA 2IBZY 4QHMB 1H8SA 3STZA 1I8LA 1FNSL 3JXAA 4K7PH 1CL7L 4JFZH 1IC4H 2BSSA 4IOFC 4KKLD 5D4QA 1KT2A 1CXHA 2V5TA 4WWKC 4W6WB 2IMMA 3VXSB 1H8NA 1Z2KA 1AD0A 1I3VA 4XCEB 3E6FA 2RFXB 3UDWA 2EKSB 4Q0XL 1XR8A 5IMKA 1O0VA 4HUUB 1XF3A 3A67L 4QRSA 4FXGA 3QRGH 3X17A 3SKNA 4TVPD 4DQOL 3MLYH 3ULUE 3QISA 2E9IA 1EHLL 2F53D 3UBXB 5KS9A 4Q6YA 5EOTA 5C6PB 3FZUD 1FV1A 1F3JB 2DICA 2YUWA 5BQ7B 1YYLL 3LRSA 2BFVH 1JPSH 3CX5K 1CXFA 2IQ9L 3VA6A 3DJ9A 1R3KB 5JA9A 5DQDH 4UTAH 1FZKB 1OY3B 4MAYD 1L7IH 1WT5C 3GRWA 4MA1B 4XI5D 4KXZH 4LLWA 4QTHB 1DQJB 2QQQA 3H6JA 1KTLB 3INUL 4WTZA 5FUZL 5FYKD 4NOBA 3P0VL 1ZA3A 1VESA 4HMCA 4NQUA 2Z31D 1CE1H 3DPBA 1XGYH 3G6JA 1R5IA 2LAGB 5DGQA 4X0KB 3CUPA 5BOZG 3QIBD 4G6FD 5B21A 3RWFB 1Q94B 1A3RH 1VACB 2Z31A 4XNMA 4QRUA 3T0XA 2J8UB 4KI5C 5I2IB 1YMMD 2FGWH 3VGAC 1P7HL 2VYRE 4RFNC 1DBKH 1M7DA 5H8DA 3PNWB 4L8DB 1A47A 3TV3L 2PXYB 4YH6A 4QT5A 5SX4I 3WXWH 4W81A 3B8YA 2WNGA 2JB6A 5MERA 4UU9A 4KAQL 4GKOA 2D9CA 3PWPB 4AIXA 5ITFB 2WUCL 4HIHA 3IRPX 4RX4A 4LVHC 4LCWB 5E2TH 5CEYA 1PEWA 3BFOA 4RGNB 4NQCD 4ELME 4L8CB 1IAKA 2EEDA 43CAB 1NLDL 5GGQL 3IB4A 3IKCA 4M7LH 3CZJA 1TTFA 2HFTA 4Q2ZB 3DVNB 1GRWA 2VLRB 2B2XL 5E8DL 1MAMH 1B0GB 3G5XB 4X9HA 1PD6A 4LQFL 4LSUH 3N0PB 3QFJD 4DVRL 1YPZE 4LSTH 8FABA 4GT7A 3G5VA 4BQ9A 5HJ3A 1JGVH 4UIMB 4D9LH 3T1WA 3QEGH 4UUJB 4NPYA 4TPRL 1C16B 4ELKB 2ZUSA 4AEHL 5DYOA 2FSEA 3LDBC 5DD1H 3I9GL 4NKOB 5E5RB 1NGYA 2BMKB 1O7VA 2Q8BH 1A7BA 1FJ1B 2H6PB 2VXVL 5CP3A 1I3RA 3D18B 3R1GH 2AERT 5D7IB 4KRPC 2D4DA 3LEVL 3EYOB 1QFPA 3RHWK 4YHPA 1OPGL 3UTTA 4WY7H 4N0FB 3KLAB 3MRGA 3K2MC 3HZYB 2WIIA 3MYJA 1D9KB 3DI3B 3F6LA 5D2LE 3I75B 1BOYA 3RWGB 4LLQB 4LOUC 5IP4A 3O4LD 4HAFA 4I18B 1U3HB 2CPCA 1KNOA 1SM3L 1DQMH 3A0OA 3PABA 4R4BB 2R1WB 4NC0B 2MCPL 4IMLA 1MNUH 1S7SB 2JCCA 2UYLB 3MRBB 2OYPA 2X7LB 1NAKL 1IEHA 4Q9BA 1T5WB 4W6YB 1MREH 3KJ4B 4FOMA 3VFNB 1JZ3A 2P8MA 1UWGL 4YHIB 5DZNA 2VLMD 3WLBB 5IFHH 1T7VA 1JNNL 1MPAL 5F3HA 4XXDB 5TGBB 4U6YB 1S5HA 2R0WH 4KU1A 3KGRA 2FJGA 4JFPB 3ZT6A 4QF1A 2W0FB 3PQYD 4FP8L 1QFHA 3AREA 2Q1EA 4XCYB 3RBGA 5F7EL 4CU7A 2EYTA 3V8OA 3ZE0E 3E6HB 3QUML 5E6ID 5TPWL 2FDBP 1NMAL 2NR6C 3C5ZC 4PJXF 1INQB 3G6AB 3LPWA 4RMTA 1AI1L 3L3JA 3D0LA 5ICZB 3HI1B 5F7KC 2VUYA 3JWOH 5IW6B 2N7AA 1QVOA 1QBLH 5ALCH 1ZLUH 3HCVB 3W9EB 5TE4L 3ARWA 4XVTL 3QEHB 4O00A 5GGUB 3NFSL 4Y4HD 4WO4C 5I66A 3HNTH 3MRRB 4CADB 1TJIL 2OQJA 3AXLA 2QQNL 5I16A 4Y4HA 1BD2D 1F4XH 4K3DL 4I5BA 3ZYZA 5KSBB 1OGAE 4DFHA 2WBJC 1JWUB 3C8DA 4YXKH 5J13B 4WHTB 2G5RA 1H5BA 3OKEB 3GSUB 4OZIA 5BJTA 1UFUA 1T5XB 4G6JL 5L8JB 2DLFL 5TE6H 2WK2A 3D39D 3OXSA 5B22A 5EIIA 2CLVA 3MJGX 1OAKL 3HZVA 2X9WA 4OJFH 1AY1H 4X6DE 3MOAH 3OF6D 2XA8L 5IWLA 1FORH 3UAJC 3D39A 1W72L 4WHYH 1KLUA 1DLFH 4GKSA 1KYOJ 1E4WL 1JUFA 3OF6A 2HG5B 2VDNH 2EICA 1DUYA 1T0NA 4L4TB 3O2WH 1EGJL 4OSUL 2EDRA 2NY5L 5H94A 1AO7D 1UADC 4LARL 3ES6A 4PJCA 2QSTA 1T1ZB 4FQXC 3CJJA 2ED9A 2FH8A 4UQ3B 3B3IA 1AO7A 1CYGA 1RIVL 4HWBL 1H9VA 1QLFB 5JHLH 2VDKH 1LK3H 3HMXA 1BVKA 3QIUA 2JJSC 3MLTB 2WV3A 5EZLA 3SO5A 3NZHH 5L2KD 4BKLB 1U93A 3F62A 3BDYH 2VC2L 1SJHA 2GAZA 2V9RA 2O5ZL 2IF7A 3PV7A 4OM1H 1Q1JH 1G7JB 3TO4A 3MLPA 4JG1L 1T6WA 2W9DL 2CGRL 2JIXB 5C0ND 5L2KA 4PJBF 3GMMA 5DJ0A 2CSPA 4F2MB 5DWUH 5L6YL 1LK2B 5C07E 3P30H 2BSTA 2YUXA 2GI7A 4PGCB 4HFWA 4BQ8A 1UB5B 1KEML 4IDLA 5CP7A 5AZEL 3I6LD 2LABA 2E7CA 4JFQA 5GZOD 5EU4A 5DMYA 5JZ7C 3P4OA 3S35H 4WI9A 3DUHA 2GTWA 3RJDA 2EDDA 1HH6B 4JQIH 4OKDA 4WUKL 2P42B 4LPVA 4NFCA 4NO3B 1P1ZA 2HYMA 4OZFG 4Z7OE 5F1IB 1BM3L 1R3JA 1JHTB 4KRLB 1NEZB 2HTKD 3W0WD 2RQ8A 1DE4B 4U4BA 5ISZE 3RGHA 5BS0D 1G9MH 4ODHH 5E70A 2EXYC 5EO0B 3BMVA 4XWGL 3QHTC 3W0WA 1RJLB 3ZKXB 2RBLA 1CG9B 4Z7WA 3GBML 4OD3H 5BS0A 5ESAA 3S37H 2D7OA 3L5XH 3OAZK 4F57H 3L5HA 4S0TD 4OFIA 5CJXC 3MCKA 1BFVL 4HIXL 4RBPK 3O2VL 1BF8A 3L6FB 3HE6B 4KKAC 3TNNA 4NQTA 1HYSD 5BVPL 1AP2A 1RFDL 1J1PH 2WQRA 2I26N 1CGVA 1MEXL 4LLAA 1KCVL 4IIQC 4MJID 3GMNB 1JF5A 4P3CL 3HZMA 1A22B 3GSQB 5E8EA 4MJIA 3M17B 3S36H 4GMTH 3D69A 4MAUH 5FOBB 4Z7VA 1CQKA 4PUBH 5J12C 4LAQH 3K3QA 3VWJD 4OF8A 3NH7H 3WE6B 3WFCH 2HLAA 1BQSA 4Z0BH 3VXTB 1ZVSA 1KIPB 4KUZH 3T2NH 5JXAL 4X7TA 4EOWL 1OTTC 3BGMB 3RY6A 1QLRB 3D6GA 2DM3A 2C4FU 2XN9A 6FABL 4OZ4B 3G9VA 1U8KB 2WSKA 4N0UB 1NUNB 4O51A 5BZDB 4RAHA 3QJHB 5CGYD 4MNHB 2XZAH 2VZ3A 3TFKC 1JNLL 3TPUA 1FYTE 4FQHA 5JHDB 2EECA 1F4WH 3HR5A 3S96B 3VRJA 3NIFF 4ONFL 1ADQA 3G08A 4NBXB 2QADD 5F6IC 5C0BD 1J12A 5I76B 3HE7C 1QFWL 3U36B 5DD6B 2JB5H 4XZUA 4Y2DD 2DQIL 3MJ8A 2BNQE 4HD9A 4JAMB 2LV4A 2NW2A 2NY0C 4X4ZA 3BEWB 4MLIA 1MCPH 3LMJL 2QSVA 3RTQB 4GQPH 2Q3AA 4I8DA 4Y2DA 1F3DJ 3DX9A 3P9LB 2OBGA 4YUEL 3QG6B 4ONHB 4U2YA 2QHRL 3J8F7 4X7CC 1X5LA 1KPRB 2X4SB 3KDMB 3ARYA 4FMFA 2A0LC 5EUOE 1EHXA 2R2CA 1AD9B 1OTSD 2N4IA 5KW9L 1ZOXA 2AV7A 3C6LD 1AKJA 3Q5TA 5D1QD 3SCMD 1KB9K 2OP4L 1CZ8L 1Q0YL 4Z5RA 1I1FB 4K3HA 2MTPA 3RWDA 4DGYL 1UH3A 3X11B 3C6LA 3EYQC 2HP4A 1CLCA 2VH5L 5D1QA 1DEEB 3U2SB 3KPOA 5C08B 3C5JB 4PJIA 4FTVD 5DDHA 4WEMB 1OCWL 3OAYK 4EXPX 3L5JA 5IVNA 1ORSA 1MCHA 5IF0B 3K46A 5IK3A 2P5EB 3NPZB 4FTVA 4CBPA 3GUTA 2EDTA 1WBYA 1I3UA 3A6CH 3WUWB 1FAIL 5BMFL 5GPRA 1JP5A 4P2RA 3CCHA 3SGEH 3BZ4A 1CLZL 1FNEA 4ZDHB 4IS6A 1M7XA 3VD9A 4J3SA 2IAMC 2G60L 1T21A 1KELL 4KY1H 5D1ZB 5CCKL 1XMWA 2W59A 2WINA 1WV7T 4PLJC 1CWVA 5TDOB 3UPRB 1E4KA 5LJYH 4HWEL 1F97A 1HIML 1OSPH 1FIGH 1F4YH 3M1BA 2QR0A 3QR2A 1A5FH 2QJDA 1FSKC 4RGMC 4JHAL 2KBGA 1ZA6A 5EO1B 5CBAA 5GJTL 1NPUA 4HKZA 1PLGH 5GSRB 1J18A 4P23B 5LAXA 4A6YB 4JFXB 5M7QA 3C2AH 2AJZA 5F89B 4LHUD 1VADA 1HSAB 1WWCA 1AFVH 3VI3E 1HHGA 3H8NA 4J3OC 1UXWA 4H0HB 1IC7L 3CXDH 4AENB 3DBXA 1KPUA 3DOSA 5EO9B 1NCWH 3MFGB 1RK1B 4U1LB 1DBJL 2ZUUA 2AI0L 1W0WB 1I1YB 1MFNA 3MRHA 5F9JB 1JHLL 5TDNB 5I8CA 4U1NA 4ZFZA 5CLWA 3EBAA 1FFOB 5SV3A 1ZLVK 1HINH 3BN9D 4M1DH 3DX6B 4Y4KD 3LSOA 4JREB 1AGEB 1CLYL 1HXYB 1G6VK 4JN2B 2DTMH 1KGCE 5KSAA 3S5LB 5IBLD 3DXAE 4H20H 3ESVF 2HH0L 1MVUA 3QDAA 4TQEH 4I0PB 1YNTA 5HHXL 2J8UF 1JF1A 3OR6A 4PP2A 1PG7L 1BZ9B 3CC5B 4M61B 4X4YB 4HPOH 2E6PA 2J8OA 3WIHL 3BZDA 43C9A 1GGTA 3WNMA 1WITA 1XCQA 4MWFB 1HQRB 1OT1A 4MQSB 3FFCE 4XNUL 5GZND 2DL9A 3L7FB 2AJXH 3LN5A 1RJZB 4OIIH 4CAGA 1BOGB 2VKXA 3L9RA 5IBTL 3DTXB 4LGPB 4NNPH 3U6RB 4D94A 3KS0H 2I60L 2YD3A 3A6BH 2KL6A 5ALBH 4NO0A 3RVWD 4C56D 1PEZA 1T20B 1M05B 2YK1L 1H0DB 3P11H 4XMKL 5D7JB 5D6CA 5DJAB 4MXQD 3SGJA 4YHNB 3OXRA 1I9RL 2VDPH 1B6DA 1JGLH 4KPHH 5JMOC 4OCXH 3MX0A 1TVBB 4C56A 1OD9A 4HK3N 3T0ED 1ACZA 1KBGH 4Z95L 1RZJH 1T66D 1FDLH 3BOVA 1K4DA 2R1XA 4MNQB 5HYJD 5DEZA 3PUCA 1MFCL 5ILTL 5C2UB 1GOHA 1KTDA 1SY6H 3QULA 5F6HJ 5I9QC 2FLRT 2VABA 3D3VE 2PW1A 4QGTA 3EOAB 1ND0A 4ELMB 3V4PH 3HC0A 3H42H 1ZWIA 3MNWB 1JPTH 1I8KB 2E3VA 4UT6L 4OZHA 4RMSA 4QYOA 1RJYB 1N8ZB 4C55A 5C8JB 4CL7A 2F5BL 5FYLH 2FECL 5HHOD 3LKRA 4JPVH 5D7IF 1HHHB 1CN4A 1YNKH 4HWNA 5ESVB 3EO1B 1FGVH 4KJPD 5HHOA 1HQ4A 5KVEL 3ROLB 2DYPB 1PG7W 5MEOB 2YXMA 2X5PA 3RVVC 1WZ1H 5B4MD 1MJ8H 2VXQL 4WCYL 4KROC 4UILL 4LLVB 2EDLA 2EH8L 3GNML 4JLRA 3K74B 2D31B 1V3KA 3DHJA 3AVEA 2NY6D 4XPBH 4A6YL 4OM0H 3MGTB 2BK8A 3LEXA 3PHQB 3GMRA 5T1MB 1YJDC 2IGFL 1IM9A 2ADIB 3D2UD 3I2CL 1N2RA 3MROB 3FT4A 2X4UA 2L0DA 4CMHC 1RIHH 4KZDL 5D2LB 1EK3A 1J05A 3ECBB 1AGFA 1EPFA 3CLFH 5D7LB 5EU5B 3FQUA 1MCIA 3FFDA 1BJ8A 3BUYA 3PG2A 3IXAB 3B43A 5CJQL 4MX7B 4O4YH 1I9EA 3CDGA 3RL1A 1HI6B 4N5ED 2A77L 5D9SA 3WNOA 5HI3D 2UV3A 2ATPB 4N5UA 4NC2B 4OLWL 4N8VA 1IT9L 2ZOKB 3EW3B 4IOIB 2ZUQC 2X05A 4M6NH 2NTSP 1KFAH 4JRYB 3S4SB 1QRND 3GSWB 3X14A 3O45B 1FZOA 4PD4K 3RZCB 4LF3B 4GG6E 4DKEL 5CEZH 3MBEC 4P2CG 4UDUA 3T4YB 2FL5B 5KSBF 5GRUH 4AG4H 4KDTA 3EFFB 4WFEE 2OM5A 4WGVB 2H32B 4LMQI 4JZJB 3MJ9L 1MJ7L 5KZCD 2WLZA 4Y5YB 3KYNB 2CJUL 4NUJA 4YPGB 3L3KB 1OM3H 2VISB 2Y06L 1OWRM 1BIIA 1FAKT 2D0GA 4QNPF 3IJHA 2HKHH 1KJVB 3VXMD 5I1DA 4Z7UF 4N9OB 3GM0A 3KJ6L 2VDOH 2J1KA 3ARPA 3VFTA 5LGJA 1BQHA 1OGAB 2XV6B 2YUVA 4UT9H 1KPVA 4ZFOA 3TBVA 4ZOCA 3MR9B 5DRXB 3DURA 5KANI 1KJ3L 1EJOH 1Q9WA 2VN4A 3O11B 1L9MA 2P24A 1DDHB 4WRLA 1MOEA 3S3JA 4YHLL 3SDCA 3DVFA 3UTPE 2PTTA 5E6YA 1IGTA 4P9HH 4H0IA 1WC7B 4QXUL 4V1DD 5E99H 5EZOL 4K8RL 1IMHC 1I9JH 5FO9A 4X6DB 4MGXA 2AQ1A 2PO6B 4JN1H 3RWCA 2Z92B 1I1AA 4OLYL 4V1DA 4NQVA 4PGDA 4WW2A 5T3XH 3WN5B 2FB4L 2X6MA 3GMLB 4JFFA 1ZLUK 2PTVA 2I9TB 2DWDA 4JG0H 1MFBL 2C4XA 3DX7B 4IOFD 1LO5A 3W9DB 2A1WL 4HZLA 4WWKD 3NCYP 2R9HD 2OK0L 3I02B 4NQDD 2Y1VA 3MV9D 4RZCB 4XPHL 3WKML 4WWKA 2X09A 1I3GL 1F11A 4L29A 1S7VB 2BNQD 4JFHE 4GKZB 4NQSA 3NCMA 4C4KO 1V05A 3MV9A 1F00I 3RIAK 4YLQT 2PF6A 4HG4K 4I0KA 4FQIH 4ZPVA 3GB7A 5D6DC 2GSIB 4OCSL 3LH2L 3MO1A 3UJIH 3QWRD 1M7IB 3FCTB 3QPXH 3D9AH 4G8EA 4ZUSA 1E28B 3HRZB 2D7MA 3QHFH 3ARGB 3CH1A 4POYA 5DZOA 1I75A 3X3FL 4OZIE 3QWRA 4HCRH 3U7WH 4R4NC 3LIZL 5C07B 2QV2A 1FL6B 1KB5H 1VFBB 4MDIB 1NGWA 1L7TH 4M7ZC 4HMEA 1YQVL 1OP3H 1D5MA 2DM4A 3T8XA 1NDGA 5F9OL 4PRNA 4XP4H 3NABL 2EC8A 3NACH 3OBAA 4PGJA 3OX8A 2EXWC 1LHZA 1IKNA 4KI5D 8CGTA 3BXNA 3MLWL 1KOAA 1A6UH 3RWHA 1JRHL 5GGVL 2AAVA 3BE1H 5KOVC 4F7PA 3OG6B 2YN3A 4RA3A 1Q72L 1CGWA 5ISZB 1NUGA 4ACPA 2OL3L 4HT1L 3RWIB 5IJKA 1JIBA 5DI8B 4LDEB 3FQWA 4M93B 4P5TB 5C0CD 4ZYKB 3EGSA 5TFSH 2FRGP 1A7RL 1LEGB 1KJ2L 1W8OA 4ODSH 5GS3A 2HFEA 5C0CA 4HGKC 5T1KD 4HF5L 1G9NH 4L3CA 1T0MB 1NGZB 3S97C 5KVGL 3H3PL 4GAGL 2O61B 4OF6A 1CTNA 3S34L 2HAZA 3MPCA 2XG4A 3NFNB 3I50H 5HDLA 1I7ZA 3Q5YA 2X89D 1G1CA 4MJ5A 4YR6B 5E5MB 4EDXA 2FBJL 3VE0A 5DD0L 4V2BA 3JWNC 2VZOA 4BH8B 4IRZL 3SDYL 5CZVH 4PG9A 2XXMB 4KJWD 1LE5A 1RPQA 4X80L 1DUZB 2HFGL 4HC1L 1J8KA 1I7UB 4R96A 4TNWF 4QXTB 3GFUA 2V5RA 5IB3A 2BVOB 2OSLA 3DGCR 5MEQB 1CFQA 3V0WL 3RP1A 2A74A 4D0CA 1ACYH 4N90E 1DQLL 2E9WA 4KRPD 4PP1C 3REVB 2H3NA 1INDH 4F58H 5AYUH 2UWEA 4FABH 2BC4B 5H35B 2P5WE 1KEGH 4RMRA 3ZYIA 1D6EB 2NY4D 3KPQA 4LOUD 1PSKH 5E9DA 4FRWA 5MHSE 1A9EA 2VZUA 3PJSA 3WFDL 5C3LD 4XBPA 2V7HB 2WUBL 1F3RB 3O6LH 5B8CB 1SJXA 4IRSB 5CJOL 3VU2A 5E2JA 1R3LA 4DAGH 4E0RB 5IQ7L 1IM3A 5HGDA 2XWBA 2YMXL 4J1UB 3EYFB 2CDEA 1MWAL 4H8WH 4L4VD 4LCYA 4NHUA 1CK0H 2L7UA 5C0AD 3ZDZE 5CD3A 4G6MH 3DVIA 4XGZB 5E00A 2NR6D 3PL6A 5GGSA 3C5ZD 4M9PA 2YPLD 4H88H 1EJ6A 2HRLA 3B9DA 4Z7VE 3HZKA 1HKFA 3MRDB 3UTSA 2EE3A 4L4VA 5C0AA 1YEIH 3FQXA 1T04B 4M6AA 4BZ2L 3CFBA 5KG9B 3C5ZA 1IE5A 1QFWM 2YPLA 3QCUL 4OZFH 3BI9X 3IU3A 4LSSL 1GZPB 3ZYJA 3IDXH 3GKZA 1MQKL 1VFMA 2GK0B 3FRUB 1WBZB 2VWEE 2XN9E 4PRDA 1ZHNA 1QFOA 2LTQC 3JSSA 4WW1B 1BBJA 3D3VD 1AR1C 1T7ZA 1NBVH 3VGAB 1TETL 1WEJL 3N85L 5DT1L 3O6FA 3O41B 3HUJA 3CSBA 2WBJD 3PGDB 3P9WB 3VW3L 3RY5A 2P7TB 2IFFL 3K80A 4OTXL 2Z91B 5CD5C 1P7KA 4X9IA 3QO0A 1T89C 5GSVA 1NFIB 3V5DB 3WNPA 4OFDA 4NO2A 1I7RB 1MHCB 2XKUA 2A6JB 1CE6B 1CFNB 1G6RB 1GCFA 3UAJD 5SV4A 2ZPKH 1XIWC 3MOQA 2CK2A 2DKSA 3KPPA 3HLAA 5GS2D 5DJ6B 4YXHH 1XF4B 4Y1AE 1MCWW 4CVUA 4OLXH 3SDXF 2QSCH 4LU5L 3U83A 1SY6A 1JE6A 3EOBA 5FM8A 2H41A 1B3JA 2E8ZA 3I84A 2ZOLA 3TBSB 3FRPG 5J3HC 5FYLD 2DQTL 2HJKB 3MC0A 5GXBB 1MCQA 3AB0C 5KSUB 5IHZA 1WWBX 3HKFA 4RRPG 1HNFA 1X5HA 2ZCKH 1K8DB 4KFZC 1X5YA 4XNYH 4DCQA 3AAZA 4NKQB 1MIEH 4PJIE 3OKMA 1OQOA 2ZCLH 1QSFD 5DJZA 4JM2B 4BUHA 3VG0L 2Q6WA 4U3XA 4CNIB 3WBDA 3MACH 3GSVB 5EOCH 2ADGB 1BIHA 3L5WA 3TO2A 2GYSA 1QNZH 2VERN 3VMOA 3BMWA 1AHWA 1V7NH 3DXAB 3DV6A 3MXVL 3MXWL 4YHZL 2XY2A 4NQEE 3VXPB 3VXOA 4G8FB 5JQ6L 5T1LA 4LHJB 3DIFA 4GRMA 4U1KB 1K5NA 2R8SL 2CQVA 1GGCL 1SYSA 1T4KB 4P46C 3RA7L 5JZ7D 1F8TL 2XTJC 1DLHA 5F6HI 3FFCB 2WBKA 5IVXA 3QWOA 4NO5A 5FV2A 3EZ8A 3QUKB 5JLZB 5ITBL 3T0WA 1J86A 2D7TL 2OZ4L 1UCBH 5DJ2A 4NHCH 2AK4A 5EOQH 1A6TA 4TUOB 3ARUA 1BLNA 1WCBA 4ELMF 1KT2B 2WZPD 5FM5M 3ZMRA 5DA4A 2EXYD 1AD0B 3OJDB 5CJ5A 3AM8A 4RWYL 1WAAF 3E6FB 4P2YA 4M8VA 1QLEL 2DS4A 35C8H 2B1AH 4EUPH 3RAJH 4XP5H 4QRSB 4FXGB 2ITDA 3Q5OA 2YR3A 4DN3H 1RU9L 4WO4B 4I2XA 3MRJA 1U8PA 1FV1B 1EVTC 3AMLA 2OR8A 2MQ0A 3RWEA 3LRSB 2IWGA 3WO4B 3DWTA 1MRDL 2E9BA 3BP5B 4OI8A 4ODUA 4TULL 3ZDYE 5LWYH 2ZCHH 3FMGL 5IBUB 2X42A 4I3SH 3RVTC 1RZ8A 4LLWB 1UKSA 3H7BA 3LS5H 2DN7A 3VXNA 2R0KH 4FQ1H 4JR9L 2WW8A 1XH3A 5EULV 1ZA3B 3MLUL 4ZFFA 3U1SL 1SHMA 4PJ9C 3RKPA 3G6JB 3UZEA 1R5IB 3T3ME 2OR9L 5I6XB 2YWZA 4LPCA 1CDGA 3OJVC 5T5NG 3CUPB 1OTTD 2BNRD 5D2LF 4YFDB 2LFGA 3VA2C 4M9OA 4XNMB 4QRUB 2DBLL 3FB5A 4DW2H 3BRFA 4L3EE 2BJMH 3MLZL 4PREB 4LRNH 1OAUH 9CGTA 4G6FB 3SKUD 1M7DB 2OJEA 4PB9H 2LE9A 3PWJA 3U0WH 1R0AL 1D5XB 4TRPH 1HK6A 5I15H 1JL8A 1RUMH 2AXHA 2YSSA 1D6VH 4JE4B 1CICA 1Q0XH 1G7IB 1AE6L 3TA3A 2JB6B 5MERB 2CK0L 4UU9B 4M3KB 4CU8A 4YE4L 1BQUA 1EBPA 2NY0D 4HIHB 5HHMD 4WFFD 4PBXA 3ZE0F 5CEYB 1DBBL 4M1CC 1BGXH 2DKMA 4JPIB 4NN5C 1V3JA 1AQDB 7CGTA 2DRUA 2YWYA 5HI5C 1V3MA 1AIFA 3WXVH 1IAKB 2DBJA 5JDJA 2DQGH 3L5IA 4KQ4L 3BAEH 3DUSA 5GGTH 2XNAB 1U8QA 2VZSA 2OI9C 2P8LA 5MEND 3HC3H 1E4XI 3PP3K 2IEPA 5I8OH 1UJ3C 4PJ7F 1EEQA 5HJ3B 1IC5L 2B5IB 4P2OC 5FCUH 4GG6B 1AGCA 4NPYB 2XICA 1EIBA 1K2DB 4JO4L 5EZJA 1Z9OA 4Y4FD 5SX4H 2YC1A 2X44D 2R56H 2FSEB 4HLZG 5I30H 3NZ8A 4GMSL 1J0ZA 3CVIH 4YGVA 1NGYB 4B5EA 4QHKJ 3VDAA 4Y4FA 1ZTXL 4LCCA 1GGBH 4GW4A 3MRFA 4K71B 1KB5A 4U1GB 1I3RB 5KANG 3P77A 4LSRH 2NY2C 3S88L 2ARJA 2C26A 1MHEA 4XMPL 3TBTB 2K7QA 4NNYA 2HRPL 5IJVB 1ZGLB 3UTTB 4RNRA 4IRJC 2WIIB 4CDHA 5IV2A 3MYJB 4FQQB 3GSNH 4IDJH 1MCOH 2A9ML 4OI9A 4ZOEA 2VLLA 2CKBH 4GAFB 1QYGH 1HDMA 1KNOB 3CAFA 4XP9L 4ERSH 4PLJD 4X6CF 4JPWL 1CD0A 1AXSA 1ZHKA 4GOSA 5T1DH 2JCCB 4JGUA 5KVFH 1F58L 3BKJH 2P47B 3T04D 3JV6A 1X44A 5F3HB 4OCRL 1MJUL 4O2FB 3TH3T 4RISL 1S5HB 1UEMA 1IQWL 4NQXB 5ACLA 4X7EC 5DUPL 2FJGB 4AY0A 4IIQB 4XP1L 5TQ2H 3AREB 5LBSH 2Z8SA 4F33A 2EYTB 1HOCA 2P5WD 3GRWL 3WFEH 3S6CA 4FZEL 4JANA 3L3JB 3D0LB 2K7PA 2W65A 3T4AA 1N6QL 1A7PH 4ISVA 3ZTNL 2BX5A 3KPMA 4RMVA 4OLVH 3MCLH 4PJHF 4MA7H 4GRWF 5IM7B 3U9PL 1LDPL 2UZIL 5I66B 1XGUA 4OLUL 5C0JA 1U8HA 4P2QD 1EH9A 2R2BA 2OQJB 3AXLB 1NFDA 4L9LA 3MLVH 5I16B 1JGUL 4Y4HB 3Q48A 3CGTA 4LLDA 4I5BB 2K3TA 4Y5XC 5AWNL 2NX5E 4P2QA 1A7QH 1H5BB 1KTRL 3RGVD 1BVZA 4OZIB 5BJTB 5HSFA 4L3AA 5DEFA 4Z7OF 2W07A 3OXSB 1RUKH 3DI2B 3RGVA 5EIIB 2CLVB 1DBAH 4KMTL 5C0RH 4KXZI 4X5WA 4EI6B 1DN0A 3D39B 5HTSA 1KLUB 4UV7H 1S9YB 4GW1A 4JFFE 4GKSB 1QR4A 1GH7A 2G5BA 2Y36L 4XP6H 3V52H 1EEUA 1DUYB 1T0NB 4OZGA 3BHBA 5FUCC 3SBWC 3KYKL 2GJJA 3HG1A 3BQUC 4WDIA 4WV1C 5H94B 2KDGA 4CRPA 3ES6B 4U1HA 4PJCB 2Z35A 3FN3A 1B0RA 4DKDC 2XQYG 3B3IB 1AO7B 2KQNA 2OTPA 4U1MA 5JO5A 3WEXA 1HH9A 3REWB 1T1YB 4U7KA 2I24N 1G7HA 1BVKB 3QIUB 2CR3A 1QPXA 4D9QE 2QBWA 5E2WL 4GAJL 5EZLB 3RDTC 1YN7A 1X5FA 1RVFL 1U93B 5IVZA 4OZFA 1SJHB 2GAZB 1OGTB 1SYVA 1OP3K 1TPXB 4NRXA 3ZE1E 1QR1A 2ORBL 2AXFA 5IB4A 4LSPL 5IMLA 3FN0L 4JY6A 3TO4B 4U0RB 5DJXA 3T2OA 3GMMB 3HN3A 4HX1A 1ZT7B 1VGEL 4OKVA 5IB2A 2E9JA 2IAMB 2YD8A 1LO3L 3CLEH 4HFWB 2FR4B 1FIEA 3VFGH 2MMXA 3H9HA 4ORZC 2X4NA 3NAAH 2R2EA 4OCMC 1SMOA 1P2CA 5F1OB 4ODVH 3FTGA 4KJQD 1S5IL 1J8HD 3K4AA 3UP1A 1KLFA 1IGIH 3KPRA 1MRFH 3RVVD 1R3HA 2UUDK 3GHBL 4WWID 2GTWB 4EQ3A 2FWOB 3KPTA 3MV01 4ZNCD 1PGRB 1PG7X 3FONA 2IPKB 2DQFA 3MLSH 4NN7B 1QQDA 1EZVY 2IAND 4LCUB 2X70A 1KCUL 3FB8A 5E5UB 4NZTH 1NCCH 2YEZB 5I1CL 4UNUA 1RZ7H 5EC2A 1C1EH 1RUQH 2VITA 3U30C 3V6OC 4NQED 3RVUC 2B8OT 3V6BR 1CCZA 5BS0B 5ESAB 2BXZA 5E4IA 1IBGL 4M4RA 4POZC 3K8KA 3QUYA 4FN0A 4MQXC 2VLJA 4ALAL 1U8IA 3MCKB 2K9UA 3QDGD 4JO1L 3J7HA 4PLNC 1FGNH 4JEGB 3V4UH 2NY1C 3TNNB 3DNKA 3BH8A 4XPAL 5TF1L 3LKQA 2P48B 4LCIH 3DO3A 3QDGA 4KGJA 2XZQH 1TJGL 4FFZH 2CIIA 2R1YA 1JZ8A 4M00A 3HZMB 3HI6H 2Y5TA 5E8EB 2DLEA 4NJ9H 1ZT4A 3D69B 1BZ7A 4Z7VB 3OMZA 5F96H 3X12B 2VAJA 1K3ZA 3FT3B 4BK5A 4BSVA 3QRFM 3F12A 2XTJE 3BGAA 2FEEI 5JXED 1ZVSB 1B0WA 1FNGA 4MLSA 4H1LG 2R4RL 2J4WL 1F45A 5IGXL 2C7UB 4EKXA 3LQAL 2XN9B 4R2GD 2VDLL 5JXEA 1YEJL 3ILPA 4DWHA 2FYYA 2JELL 4YEEA 3TPUB 4PV8A 3D85A 1DVFA 3HR5B 3VRJB 1YYMH 2PYFB 1YEKL 3QI9B 1JPFA 3G08B 5KTEH 5HGBB 5E9DE 3C8HA 1G7QB 4LKXA 3MUGA 4HJGA 5FA3B 4XZUB 4JRXD 3MJ8B 1TFHA 4PTUA 2NW2B 3TGXA 2R29L 2AJUL 2ZKHH 3SKOA 3OPZH 3HMXL 3DX9B 5IFAL 5JOEA 2VE6A 1CGSL 1OWWA 4ZODA 1SJEA 4YBHA 4L3ED 4EUPA 4Y1AB 4JM2F 2GJ6A 3VXRE 3VGGA 1S9KC 2AV7B 1AC6A 1JN6B 2EDXA 3H9SD 3NOIA 1AKJB 3TZVA 3UTSE 5DK2A 1S9VA 4QO1A 2P43B 2J6EH 4Z5RB 3A6OA 5DR5H 4ZD3L 3RWDB 2AK1H 5JW5A 2WWKO 5D93B 4LSQH 3LZFL 4KHTL 4O02L 4Y19D 4HJJL 1ITBB 5KSVA 4YX2H 5K9QI 1RZKL 3MUJA 4X6EA 4PJIB 1BREA 5DDHB 2H1PL 3IVKA 1RZIA 3L7EB 5EC1A 5TF0A 4KROB 4Q97A 5IK3B 4G6KH 4MA1C 3R06B 4M4PA 2I07A 3VH8B 4HHAA 4NYLA 2F58H 5C09E 3GUTB 1WBYB 5I8KH 1LNUA 1Q9KA 3HUJE 3F7VA 4JVPA 1IKFL 3Q3GA 3IYLW 4KH2A 3CCHB 4P2RB 5JW4R 3HPJA 3BZ4B 1MQ8A 3F6IA 5I1HL 1CFSB 4N68A 4R4ND 5GS0L 5A2KH 1T21B 5D1XD 2AJYH 5H37H 3N50A 2XXCB 4HBCL 4WUUE 1MLCA 1FN4A 3IFNH 1R3IH 2CO6B 5J4MA 4YC2B 3WO3B 4CN4A 3M1BB 1CD8A 5D1XA 3WDIA 1L9NA 5F1NB 2I25N 4JHWL 4KMQA 4MNGA 4X99B 2BY3A 2EXWD 3ZL4H 1ZA6B 5I1EH 2PXYC 4QY8A 5CJ8A 5LGKA 3GI8L 2FZ3B 5CBAB 4HH9A 4HKZB 3ALXA 4YPJA 3EFDL 3HMWH 2ZUQB 3SGKA 2AJZB 5ID0A 3SE9L 4E9LA 4JFDA 4K9EL 1VADB 5C9JB 3MMEA 5KS9F 2X4QA 3KXFA 1DCLA 2APXA 3SO3B 4S1RH 1UXWB 5SWSD 2A9NH 3MBEB 2ZG2A 1UYWH 3DBXB 1KPUB 5GGTA 1S3KL 3WIIL 3B9KA 2LU3A 1FFRA 2FD6H 4G8GE 1LO2L 5HGAA 1R24A 4XCCL 3MRHB 1I9IL 4G6AC 3H0TA 1JCKA 5I8CB 4GH7B 4U1NB 4YIQA 2NY5C 2P4AB 3LSOB 1KC5L 3G6JF 2VLKE 1IAMA 5A3IC 2DQDH 3OKLA 4U6VH 3O8XA 4O9HL 3O3BB 4PJAA 2V5MA 5KSAB 3KYOA 3MV11 3BKML 1BPVA 3EYSH 1INEH 2BCKA 3MNZA 1T2QL 3QCTL 1ZLSL 3IFLL 1ADQL 4QRPE 1YNTB 1JF1B 3OR6B 2D0HA 2JJTC 1RMFH 4R9HA 1JWMA 1U92A 3DETD 4K7PL 3BD3A 4JFZL 4O2EB 1IC4L 5T3ZE 4Z78A 2JTDA 3LHPH 3NN8A 2YPKB 2BVPB 43C9B 3IDUA 3NIGF 4P59H 2E5EA 3GSNA 5TQ0H 1HCVA 2ZUXA 1Y18A 1OF2A 4M7LT 3LN5B 4WIQA 2CKBA 2A83A 3OL2A 4XPGH 4PP1D 1D9KC 2AK4E 3QUZD 1DP0A 4NO0B 3UJTL 1CGXA 4I18C 1U3HC 3QRGL 5D6CB 3OXRB 3MLYL 3QUZA 1JHKH 4QCIA 1UWEH 1X7QA 4C83A 4X83A 4O58H 4RSVA 4OFVA 3KJ4C 4YDVA 1EUTA 4G3YH 5BV7H 5CAYB 2IQAA 4BELD 2FHFA 3T3PF 2FLBT 1V7MH 1JPSL 1FCGA 1K4DB 2B0SH 5DJYA 2R1XB 1WIOA 4JGMA 3KNBA 5DQDL 5B38G 1RULH 4UTAL 3PGFH 1L7IL 3CFEB 3MZTA 4F7EB 5CEZE 3QULB 2FHCA 1PX3A 1SBSH 3GDBA 2VABB 2NPLX 1ND0B 3AS0A 3W39A 1NJ9A 3MV8D 3HC0B 3WLWC 5HYFA 3QDJA 1CE1L 1ZWIB 4PRHE 1XGYL 4OZHB 4L8SA 3RL2B 4QYOB 3IDGA 4LL9A 5AEAA 1XF1A 4QLRA 2EIEA 2DQHH 4ZFGH 1A3RL 4ETQA 1TITA 5I74B 1KIRA 2FGWL 3LEYH 4MSWA 1A6AB 3KPSE 1DBKL 1MCCA 4LIQE 1HQ4B 3MGOA 1A6VH 2P45B 4M7ZB 5EIQA 3WXWL 1FE8H 2Q20A 2ADJA 3EJYC 3KYAA 4HEPG 1AR1D 5J13C 3QUXC 3QZWG 3F7YA 3IJSA 5JORA 2JCCF 4KV5F 5E2TL 5FUCE 1EFQA 3P73A 1V8HA 1S78D 4DKAA 4E41D 1FO0H 3LN4A 1IM9B 2V5SA 5CD5D 5HVWA 1N2RB 2VDMH 4M7LL 3FT4B 2X4UB 1OP5K 1MUJA 3D25A 5E7FA 4PJFA 1J05B 1AGFB 1MAML 5INDA 4HS8H 4LSUL 2CRMA 2W0PA 3EDJA 1JBJA 4LSTL 4GXUM 3FFDB 1IAII 3BUYB 1MLBA 5HYQA 1JGVL 4D9LL 3BP6A 4RMQA 3QEGL 5D9SB 5ICXA 5I1GL 5FUZH 2P49B 4N8VB 4BJLA 5DD1L 1LEIA 4AYFA 3VFRA 2Q8BL 2FO4A 3BESR 2IH1A 3RI5K 1FZOB 4QHUB 3VRIA 3NTCH 25C8H 4JKPH 5J3HD 5D72H 2J2ZA 3R1GL 1EMTH 4UDUB 1IQDA 5F9DC 4M3JA 3CFCH 2VB5A 5F88B 5C0DA 3QDMD 2CD0A 1BX2A 1LEKB 4ZTOH 4WY7L 1FLRH 3V6ZA 2BVQA 5CGMA 4KQ3L 4OZIF 3STLB 4WU7A 3M45A 5HHQA 2NTFA 3HA0A 4OLEA 4NUJB 1BIIB 1XF2B 3QFDB 1DQML 3IJHB 1T1XA 5I1DB 1MNUL 5CKAA 4EIZC 3LVEA 1QSEA 1MREL 1UQSA 3VFTB 4ZNEE 5LGJB 1NKRA 3WDHA 5IFHL 4ZS7L 4J23A 1KPVB 4ZFOB 3TBVB 1NC4A 3DURB 2R0WL 3SE4C 3GKWH 3CH8A 3VXUD 3NIFE 3SDCB 1IGTB 1SEQH 3QG7H 4BZYA 2MHAA 3MUY1 1LO4H 2APWA 4LQFH 5DD5H 4YDLB 2XTJD 4MZ2A 5FO9B 4XNXH 5E1AA 4YHOH 5IEKA 4PJCF 3VXUA 4JFEA 3RWCB 1I1AB 5J8OA 4YHKH 4NQVB 4PGDB 4WW2B 2IC2A 5CBEA 3JWOL 4JFFB 3QEQE 2F74A 3ZTJG 1NSNH 5ALCL 1QBLL 3EDFA 1K3IA 1C5DA 4ZQKA 5HHNA 2IADA 1K8IA 3AY4A 3ZKXC 4HZLB 4OCWH 4HLZH 1JF6A 5CHNA 3IDYC 3HNTL 4EQ2A 2YD6A 3JBG7 4LEOA 4CDGC 2GW5A 2X9XA 1A14H 2VRAA 4JKLA 1F4XL 2D03H 3GO1H 1F11B 3HE6C 3UC0H 2NXYB 5HDBE 3JTTB 3H2WA 1W0YT 4YXKL 2AABH 4QOKD 1G7MB 4B53A 4YNYA 1YMHA 5CLTA 2H2SD 4ZPVB 4EVNA 4TNWK 4QOKA 5EU7C 2G2RA 3CSPA 5TE6L 3MO1B 1V3LA 3KPNA 3NCYS 4G9FD 4LHUG 4X5LA 4QRTB 4G8EB 4OJFL 4ZUSB 3QIWA 1FORL 3CMOH 3RVTD 5A2JH 1DLFL 2HJLB 4N0CC 3MCG1 4EI5D 2N1KA 4QRRD 1KG0A 3G04B 1NCDH 3O2WL 4PJ9D 3WS6A 5I18H 1RZFH 4EI5A 5AAMA 1D5MB 4QRRA 3T8XB 1NDGB 4MB3A 2XFXA 1JNJA 1XIWB 3OX8B 4Z7WF 5EDXA 3MUHL 2YUZA 4NFDA 5DHYB 5CMAB 4FMKA 4NUGH 2H9GA 4X6FB 1KN4H 2VUOA 3RWHB 3SQOH 5JHLL 4K55A 2VDKL 1LK3L 4ZSOA 5DMKA 5C6TH 4F7PB 3BPNB 3LKOB 1I8MA 3NZHL 4N0YH 1DBMH 3BDYL 3FQWB 5DRWA 1M6OA 2VIRA 2HN7A 1QUNA 4WFHE 3EGSB 4OM1L 5GRJH 1Q1JL 3ARDB 1TIUA 4P4KD 4M1CD 2IH3B 5DWUL 2NXZB 3IS1X 4Z7VF 5HI5D 5DURB 2J6EA 3P30L 5FO8A 4L3CB 2JLLA 3GI9H 5EN2B 1ONQB 4FQ2H 3E8UH 4P4KA 2GCYB 1MRCH 1I7ZB 3NGBB 2C4FT 3MZGB 5C2BL 4D8PA 1DSFH 2ZG3A 3S35L 3TN0A 2X4PA 4MJ5B 4TYUA 4NGHH 3WFHA 2BVYA 4JQIL 4ZFOL 4P2OD 3DV4A 3V8CA 5I0ZA 4PG9B 3TT1H 1LE5B 1QKZH 1F42A 2J8UE 4Q9RH 4CN1A 5FYJU 4M62H 1WZMA 4R96B 4P46B 3KPRE 4NM4H 1J88A 1REIA 3MA7A 4NRZA 1ED3A 5IB3B 1G9ML 2KKQA 2OSLB 4ODHL 3B6SB 1CFQB 4JKWA 2R4SH 2V2XA 4MMXC 5LVEA 4FQLH 2A74B 1CVRA 5FYJH 4HS3A 2ARWA 2NY2D 5GS1A 4OD3L 4HUVA 3S37L 3L5XL 2UWEB 4F57L 2Y6SC 3CZFA 5D1ZC 4LCWE 4IRJD 2YPVH 4LDLB 32C2A 4PV9A 4QRPD 3MRQA 1J1PL 3TPKA 1W0VA 1KXQE 5E9DB 1Y0LA 4F8TA 4LRIA 3PJSB 5IEHA 1QACA 3GJFA 1CXKA 2NY4B 2ICWB 4JDTL 4LEXH 5HD8C 4HLJA 2Z93A 4GXUN 2DI7A 1N3NA 4P23C 4H0GA 4L1HA 2AJSH 4K94C 3S36L 4GMTL 2F8OA 3F7RA 4MAUL 2WIMA 4R3SA 2BP3A 1R3LB 4PUBL 4WHYG 1ZHBA 2MNUA 4LAQL 2MJWA 3RX8A 5HGDB 2XWBB 5J06A 4EBQH 3NH7L 3CFKA 5AZEH 1T03H 1D5BA 3WFCL 2CDEB 1CD1A 2B4CL 4PJIF 4Z0BL 5EU6D 4KUZL 4CKVX 2GT9A 3PWNA 4NHUB 1PY4A 3T2NL 3RX5A 4TSCH 3QBTB 2YRPA 3WS3A 1KF9B 3CSYA 2ZSWA 4Q74A 3PL6B 1FNAA 5K9QG 4TVPH 3VXRB 4WUKH 3C60A 5EU6A 3UTSB 1DFBH 5ID1A 3FQXB 4OFYA 2XZAL 1U8LA 3CFJA 2XG5A 2YPLB 3IU3B 5JOPE 1F4WL 4JREC 4LBEA 5FYKU 1T22A 3MNVA 1H8OA 5GRWA 4OD2A 1HHIB 2JB5L 1MCBA 4I0PC 5FYKH 4DJMA 2YKLH 1MCPL 5C09B 4NKDA 1OB1B 3O6FB 3HUJB 4I9WE 4NNXA 3TWCH 3QO0B 3FRPA 3O9WD 1EO8H 4F3FA 4L5FH 4GLRI 4LKCA 1IC1A 4RRPA 3DYMA 2J7LA 4XWOD 1QZ1A 2FH6A 2IPUK 3FO0H 3SJVE 5E6ZA 3O9WA 2HT2D 2FJFB 3OTTA 3ULVE 2X10A 3QXUA 2GUOB 4IHOA 3RUGA 4BZ1H 1UACH 5D7JC 2NLJA 4JFYB 5JW3H 1BQHG 5EZIH 3HLAB 4ZUWA 1M4KA 1UJTA 4Z76B 3ET9F 4N1HB 2GJ6E 3CK0H 4F7TB 3EOBB 1HYRC 1UJ3B 3BQUD 4Z77A 2NYYC 3UO1H 1N64H 4EOWH 2F54D 4UAOB 4K8RC 1HEZA 1Q9OA 3FQTA 4H1LH 5TH2A 4YWGL 1FBIH 3VG9B 4S1DC 3L1OH 3A6CL 3BQUA 4HFUH 2BVTA 2F54A 5E8NA 3KG5A 3DVGB 3U0PA 4DCQB 3AAZB 3SDDC 1SQ2N 3WJJA 3OKMB 4G8GB 2B20A 4WEBH 5B39G 1MWAA 4JCMA 4JB9H 4QXWA 4R7NA 1ZVHA 5DJZB 1NLBH 3IF1A 3RDTD 4LHQB 2Q6WB 1RHHA 4JQXA 3HNVH 4M8QB 1RZGA 3K1KC 4KY1L 1TVDA 2CMRH 1A1MA 2VLKB 3L5WB 3T3MF 3TO2B 4OB5H 1DQQA 1OSPL 1FIGL 1F4YL 4PJ5A 1FNLA 3JWDC 5KVDH 1S9XA 3BWAB 5H2BB 1A5FL 4ODXA 4Z7UE 3DV6B 3GJEA 5SWZD 1JFQH 2A6IA 3BKCH 4YAQA 4QXGH 2QHRH 2R15A 2C1OB 3VXOB 1PLGL 2PETA 5T1LB 1MH5A 3LPGA 3C2AL 3GJFK 1K5NB 4F9PC 5E94A 3PWLB 4PJ8A 1SYSB 1FO0A 1PYWA 1DLHB 5FEBA 5EPMA 2APFA 3P3YA 4H26A 3ZHDA 4PJGA 4U0QB 3CXDL 4NO5B 3GMQA 4PJEA 1KULA 1NCWL 4WI3A 3L3GA 5I1AA 5DJ2B 1CS6A 2H26A 3K81A 2AK4B 4XXCA 1A6TB 3WMSA 5KN5B 1GOGA 3KXFE 3TVMC 1N7MH 2HVKA 2BDNH 4WFGE 1HINL 1MI5D 4EN3B 5IB5A 2AEQH 3ARBA 1YECH 4KKBC 3RVUD 4TSAH 4OZHF 3R8BB 4D9RE 3IGAA 2DTML 5HYSB 3FQNA 5BMFH 5I73B 1MI5A 4H20L 4MQXD 2Q8AH 3V6OA 4TQEL 2ITDB 1EFXD 3MRKA 4AEIH 2OCFD 3TM6A 1G7LA 4UINH 3MV7E 2NY1D 2XRAH 1U8PB 1UENA 2F9BT 3BP4A 4HPOL 3RZCC 3FB6A 2F15A 3QXVA 1A9BA 3RWEB 4PJDA 1EFXA 1FQ9C 3BKYH 1C5CL 4PRHB 4ODUB 1JYXA 4I48A 3OKKA 2BOBA 1EV2E 2AJXL 3WHXA 1NCAL 4I77H 1CT8B 5LKNA 3JUYA 3DMMA 1RZ8B 1IGMH 4OIIL 5FA4A 4H5SB 3H7BB 4F9LA 4MJ6A 4NNPL 4HIJA 4JZJC 4G42A 4K23H 3A6BL 4RQQA 1RUPH 1QFUH 4Y5YC 5ALBL 3ULSA 2NY3D 4ZFFB 4UI2A 3Q6GH 3KPSB 3P11L 1S7XA 1NC2A 4R0LA 2VDPL 1ZXQA 1JGLL 3EOTH 4J4PC 4JRWA 4OCXL 3MRMA 3ETBF 4NN6C 3GM8A 1H15A 4DK6A 4RAUA 1A3LH 1KBGL 4KJYA 1RZJL 1IC7H 1C7SA 1Z0MA 2RB8A 3FB5B 3MOBH 3ARFA 1FDLL 2CRYA 3TCXA 3GSOA 4HIIA 3BIKB 2GJZA 3C8KB 3P4LA 1JZ2A 2EDBA 2OJEB 5GHWH 1SY6L 3QJFA 1DL7H 2HVJB 4WV1B 2V7NB 1OVZA 2DM7A 2YSSB 4UOJA 5FKAA 3V4PL 5F8QC 3F7QA 1CICB 2IPTH 1WQVT 3C9NA 3H42L 3K8LA 3TA3B 1JPTL 2PO6C 4KVCH 2DIJA 3VFVA 3WN5C 2Y72A 5FYLL 5JPNA 4PGZA 4BK4A 4JPVL 1AIFB 5EU7E 1M1SA 1YNKL 1W2KT 3QDJE 2O93L 1FGVL 3M07A 3VXSD 1ERNA 4KTEH 1UXSA 5IW1A 4N1CA 1U8QB 1GC1H 1JWSB 1U3ZA 2P8LB 5C86A 5ERWA 3QHZH 1WZ1L 1A3QA 1MJ8L 3VXSA 3SN6N 1J7VR 3VFSA 3IDNA 3LKPA 1YN6B 4J3TA 1S7QB 5K9JH 4JM4H 5IBTH 1AGCB 1Y6NR 1JZ4A 4PG2C 5EZJB 4XPBL 4N0UE 4OM0L 1OTUD 1QBMH 2LAAA 5TJWK 4XBEH 5I1JH 2ESVA 2MKLC 5D7KE 4YGVB 4XMKH 3BIAX 2YHGA 5JHDE 3OJ2C 4K07A 1O7SA 4Y4FB 4LCCB 4JQVA 4GW4B 3MRFB 1RIHL 3ARGC 1Z5LA 1KB5B 3S98A 4RDQF 2M2DA 3P77B 4NC1E 1TTGA 3EO0A 5CSZA 3CLFL 2ARJB 2D9QB 1OAYH 2MWCA 4NNYB 2DDQH 3TLRA 3WFBL 1MFCH 4Y8AA 2XOTA 1I1CA 4O4YL 2VXSH 4WW2F 1VGKA 5IV2B 5I75B 1GIGL 4PJFE 1E4XH 1H3XA 4ZXBD 1U3YA 3NCBB 1FFPB 2VLLB 5F8RC 4NCC1 2RHEA 4OV6F 4XVUD 1HDMB 4M6NL 4CN6A 1G0YR 1KFAL 1FL5A 1ZHKB 4X0KA 4PRIA 4ZXBA 5A1AA 1JPGB 1Q94A 5BXFB 5CEZL 3C5SB 3JV6B 4XCNB 3V5HA 2PXYD 2OLDA 1MFDH 5ESQB 4P4RA 5GRUL 4E42A 1LP9A 4AG4L 5F44A 4WJ5A 2HWZH 4TUKH 5KVEH 4I4WA 1FFNA 4M93C 4F33B 3PWPD 3T08A 5GIRB 5F7WC 5C08E 1OM3L 5K59E 3K2UH 4JANB 4BQ6A 4RGND 2HKHL 4WGWB 3PWPA 5CIPH 2W65B 5FHBH 1ZK9A 4XX1G 3MRNA 4ISVB 1N4XH 1YEHH 1A4KB 2BOCA 2VDOL 3KPMB 4K94H 5E2VH 3N9GH 2VLRD 4UT9L 4ZUUA 2QTEA 5K9OA 1EJOL 1XGUB 3IAPA 5C0JB 1U8HB 4JHZA 3IKKA 2XTLA 3H9ZA 4Q2ZA 1DN2A 1UA6H 5A3ID 3DGGA 3OGOE 4P9HL 3C08L 1NFDB 3QP3A 3G5XA 5E99L 1QSEE 1VHPA 3HR6A 1I9JL 4B0MM 4LLDB 4Q9CA 4OBSA 4JN1L 4HMDA 4OAWA 5EA0H 4NWTH 4Y16B 3GSRA 5T3XL 4GG8A 2D0FA 1GAFH 3ULUH 2XZZA 4L8BA 2MQ3A 5DEFB 1N0XH 1JYWA 3WCYA 1KYOK 1MF2H 1RUAH 2DJUA 2VTFA 4JG0L 1KV3A 3Q0HA 4L9DA 5DJDA 4U1SA 2BMKA 4JDVB 3RGVB 1ZANH 4R26L 1FJ1A 4AEEA 4JFEE 2OJZH 1FVEA 4X5WB 3IRZA 3CFIC 1DN0B 2ERJB 1T83A 3HI5H 1MHPH 1KJMB 4GW1B 5CILH 2SEBA 1D9KD 2DMCA 2G5BB 3H3KA 1ES0B 3EYOA 3VWKD 4LSVH 1K85A 5C0FB 1J0HA 1U3HD 3BHBB 3IJYA 3KLAA 4OZGB 1T6VN 3HZYA 1Z9LA 2A6DA 3HG1B 4WDIB 4YZFF 1D5IH 4FQIL 1IGJA 3DYPA 3VWKA 5BRZE 4F7CA 3SDXE 4J7RA 3MTRA 4F37F 2Z35B 3UJIL 4WTXA 5B8CC 1B0RB 3QPXL 3D9AL 2DJSA 2R1WA 4IRSC 3GBNH 3L3IB 1S7SA 2UYLA 3QHFL 3FHQA 4U1MB 1T5WA 1VSCA 4OD1H 3WEXB 1MCJA 1D3CA 1HH9B 1NQBA 4U6XA 2AXGA 4W68A 3U7WL 3O3DA 1G7HB 2F53A 5D2NA 1YN7B 3TNMB 1ODAA 1KB5L 3QUMB 3O2DH 3WLWD 4FQCH 3RU8H 4OZFB 3SDAB 1L7TL 1SYVB 4XCYA 1QR1B 5IB4B 5IMLB 4JY6B 4XP4L 4MAYA 3EAKA 1H3PH 5DJXB 3NACL 4HX1B 3UPAA 3FOLA 3HI1A 4LVNB 2UWEF 3C87A 5DMIH 3EJZC 3H9HB 1YY8A 3WL9B 2X4NB 1UWXK 5F97E 3HCVA 2R2EB 4PTTB 5FDYA 3L3DA 1P2CB 3FTGB 2BHUA 3ZTJH 4KK6D 1RY7B 1JNHA 2DAVA 3KPRB 5J6GA 3EJYD 3QIBA 3QO1B 4GW5A 2DI8A 5C0EA 3FT2A 1L6XA 2Z8RA 2DQFB 4K7PX 1YMMA 1HZHH 4XPHH 1EVUA 5TFSL 4HUWA 4LVOB 3JWDH 1FG2B 1TCRA 3FB8B 4ODSL 4HQQH 4HUXA 4ZSOE 4WHTA 5BW7C 4MNQE 1S9WB 5E08H 1G9NL 3U4BH 4ZPTA 4LPWA 3QNYA 1T5XA 2C3XA 2DD8H 2VITB 4PB0H 5MEPB 4ETYA 4LPYA 4FQJH 3I50L 1F13A 1W72B 3BISA 1IEAA 3VRLF 2NW3B 3U7YH 3U0TA 2VXTH 1K6QH 3QUYB 2VLJB 4NQCA 1WAAE 5C0IA 3GGWA 4H1LA 4L4TD 5DHVH 3X3FH 3SQBA 5D7SH 5CZVL 1PAMA 2HG5A 4S1QH 3BH8B 1WISA 3ZO0A 3LKQB 4G43B 1B88A 3QDGB 4AZ8A 3QFJA 2CIIB 4FFVC 2R1YB 5FGRA 5E1HB 4PRPE 1HHKA 1KCLA 5DVKA 4AMKH 2Y5TB 5J57B 3SE3A 5D70H 1ACYL 1ZT4B 1BZ7B 4MZ3A 1B9ZA 2VSCA 4JM2C 3HUJF 5IMMA 1INDL 4GRLC 2XQYK 3RBSA 2G75A 5AYUL 3S3SA 4F58L 2FIKA 2PTUA 3O0RH 4FABL 1G84A 4B7LA 3S3PA 2BZDA 2UVEA 1KEGL 5HVHC 1FNGB 3MLTA 4YBQC 4U7SA 4ONGH 1NGQH 1PSKL 2JIXD 4OIAA 2I9LB 1XGTA 2E8YA 3JZ7A 3OKDB 1XF5A 1G7JA 4PV8B 4XAKE 4I13B 3O6LL 3D85B 4YFLI 5D7LE 4R2GB 1DVFB 5L7XH 4PBWD 1JPFB 3MRIA 5J1AA 5LGHH 4DAGL 4DKFL 3O4LA 4LKXB 4HJGB 4O2CA 3SKJH 3W5NA 4H8WL 5KVMC 2QQKH 1CK0L 5DFVC 5E8OA 5I8EB 4RFOH 2Q3ZA 3B4NA 4G6ML 3SJVB 1I8LC 4MVBC 1PKQA 1IFHH 4H88L 4JRYE 3SKOB 1P9MA 2X1QA 1YEIL 3ARQA 3OHXA 5ENWA 4U2ZA 2F19H 5LCVH 3MQIA 1SJEB 2E7LA 4HUMB 3GIVB 3AS2A 3PQYA 4KVNH 3IDXL 2YD4A 1K4CA 2C1PB 2GJ6B 5E6IA 5F7DA 1S7TA 3EKCA 3HS0B 3TZVB 5EO0A 5IMOB 4K3EH 1NBVL 1S9VB 5DK2B 5IHUH 3AU1A 2DQCH 1DQLH 5JW5B 3HE6D 4PJ7E 5DQJA 3X3GH 3SKMB 3WO4C 5KSVB 4X6EB 3OB0H 3VJ6B 1SVZA 3L6FA 3ARRA 3I6GB 3VCLB 3QUXB 2LQRA 4M48H 2DWEA 2I07B 3TT3H 5FO7A 4NYLB 3GMNA 5MI0B 2X1PA 1AGBA 1BD2A 3F7VB 4F15B 5JIHA 3Q3GB 4X6BA 3BGFB 3HPJB 3GSQA 5IVXF 5KOMC 4KUCF 4A2MA 5I6XC 4Z7UB 4N0CD 4YXHL 4XNZB 4OLXL 3WE6A 2QSCL 3VXTA 4YO0B 3EO9H 2KH2B 3QSKB 1XR9B 2BNUA 5D1XB 1LWRA 4HPYH 5JHDD 2J8HA 1AXTH 3ILQC 4X6CE 1IAIM 4Z9KB 4MNGB 1ZT1A 1S7WA 2MQCA 5BZDA 4TOYH 4JKMA 3QJHA 4MNHA 2ZCKL 2X4OA 1Y6MR 3BD4A 4XNYL 5EBWA 2Y07H 1MIEL 3MLXH 1BAFH 5ID0B 4APQD 2ZCLL 4JFDB 3MMEB 2IALB 1QA9B 3KXFB 3MACL 3LPFA 5DRZA 5DD6A 3RTQD 3R0NA 4APQA 3P40A 5EOCL 2EDNA 3V5KA 3T0DA 1JGDB 4Z0XA 3B9KB 3T0BA 5ACZB 1QNZL 5DF0A 5HGAB 1R24B 3RTQA 3MRPB 1V7NL 3P9LA 1NL0H 3H0TB 4ONHA 3MV7B 2OXGA 4QRQB 2X4SA 4PJHE 4GRWE 2J88H 3DO7A 3OKLB 2B5IC 3O8XB 3LY6A 4PJ5E 3Q6FA 4X9FA 1CGUA 1VEMA 3KYOB 5AZ2H 3E1F1 3WV0A 1EEYB 1NBZA 2BCKB 3MNZB 1QHPA 4JPKH 4QHLB 4W4OA 2EIZA 4Z8FH 5E4EC 1UCBL 1JWMB 1U92B 4NHCL 5EOQL 4Z78B 4K71C 1BZQK 2R0LH 4U1GC 1TNNA 2P5ED 3NN8B 3C5JA 5BZWB 5B38A 4PS4H 4KZEL 3GSNB 4PJGE 1Y18B 1OF2B 3ULVL 4GAYA 1W8NA 2AEPL 2CKBB 4G7VH 2A83B 2ICWI 3EOYG 3HHRB 3WUWA 3IETA 4Y2OA 3QQNA 35C8L 2PR4H 2B1AL 3WKNA 2EZ0D 4XP5L 2Y6SD 2GITA 4NZDA 5D1ZD 5LQBH 3QQ3B 4ZDHA 4DN3L 4HV8B 4OT1H 3QUZB 3LQZA 1PBYA 3IDYB 5AUMB 4C83B 2I5YH 4IOSD 4KGLA 3QH3B 1SEBA 3TESA 4YDVB 1E0OB 2IQAB 1KUMA 1A6WL 4YK4C 3I3EA 3ROOA 5TDOA 4BA8A 2EDYA 5DJYB 5HD8D 1UM6H 5LWYL 2ZCHL 1JGEA 4P23D 4I3SL 4QHNA 1U36A 2CXKA 3AREC 3LS5L 5C0GB 2DI9A 2R0KL 4FQ1L 3VH8G 5CIPA 4YFEA 3GSXA 5GSRA 3QZWA 3QDJB 5F89A 1BVLA 1A6PA 4WI4A 1FNHA 4L8SB 5DA0B 5F70A 3IDGB 4BSWA 2Y9RT 4MD0A 4ETQB 4AM0A 2WBWB 1FC2D 1PY9A 4DW2L 1UKQA 2BJML 4PFEA 2YXFA 4LRNL 1TZHA 1OAUL 3VWJA 4U1LA 4MSWB 3ULUD 2ZZUT 4XAWH 4PB9L 4AIOA 2YD7A 3U0WL 3MGOB 3JVGA 3S35X 4TRPL 2ZG1A 5I19H 3IXTA 4C58B 3S9DB 5I15L 1RUML 1D6VL 2ADJB 4Y4HC 1Q0XL 5E8PA 4OFKA 5D96C 3DX6A 1BMGA 1AGEA 3F7YB 3IJSB 1G1YA 2DF3A 4I0PD 5JORB 1NANI 1BFOA 1H5BC 4P9MH 4HJ0C 1G0DA 2PNDA 1H3TA 3S5LA 3VFPB 3V0VA 1BGXL 3P73B 2R0ZH 3LV3B 5DJCB 4GO6B 3WXVL 1OW0A 1P4BH 4LMQE 5C0BA 1BZ9A 4OGXH 2VN7A 3D25B 5IWLC 2DQGL 1P4IH 4X4YA 4PJFB 5GGTL 3BAEL 5DXWA 3LQAC 4YDIH 1J9CT 3S37X 3HC3L 5INDB 4URTB 4MWFA 2W9LA 1KIQA 5I8OL 2XT1B 2Z0BA 3F58H 3Q1SH 2Q87A 5HYQB 1RJZA 5D7JD 3BP6B 3KHOA 5FF6B 5ICXB 2LU4A 1Z9MA 2R56L 4KK5D 1T20A 3NIDE 5HDBF 1M05A 2AJ3A 5EORH 4ZTPH 3G5YB 4JZNA 2AQ2A 1LEIB 4HWZA 3C2SA 4YHNA 2FO4B 3M8OL 1G6RH 3TC9A 4KDVA 1I8IB 1GGBL 3VRIB 4YHMH 4K8RD 3S36X 3SCMA 5JPMB 3O2DA 1NFDF 4LSRL 4MA8H 1IQDB 4S1DD 3QIUC 3PIQA 1L0QA 1EUUA 2ESVE 2C3VA 3MUZ1 4GUPA 2C3WA 4OQ1A 3V6ZB 2BVQB 2YD1A 3O6ML 4M02A 5HY9B 4EUPG 2FGZA 4Z18A 3ZSTA 1KXTB 1TPXC 3GSNL 4WU7B 4NJAH 3TIEA 4IDJL 5HHQB 2NTFB 2QQLL 1MCOL 3TO4C 2YZ1A 4U0RC 1AE6H 1IAIH 2CKBL 1QYGL 3MNWA 4ERSL 5IROA 5ABDE 1T1XB 2O5YH 4CMMA 5T1DL 1N8ZA 5E2UH 3OJMB 3V6FA 1QSEB 3HC4H 5C0NC