5EO9A

Crystal structure of the complex of dpr6 domain 1 bound to dip-alpha domain 1+2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
MEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dpr6, isoform C
publication title Control of Synaptic Connectivity by a Network of Drosophila IgSF Cell Surface Proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell adhesion
total genus 28
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2015-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eo9A00
2IH1A 3BAEL 3BO8B 1I7TA 2CKBB 5HPMB 1WFOA 1OPGH 1YYLH 5IJVB 3SEPA 2V2XB 3QQ4B 2DF3A 2NR6C 4OIAA 1AO7D 1RJYA 2NY0D 3VFOB 1UB5A 5DVNA 4JRXA 3TJHD 2F15A 4XPAL 4AEIL 2JJSC 4RISH 1T20B 4HKXB 4R4NC 4UQ2A 4Y1AB 4M7JH 3CK0L 1U8LA 1TJGL 4Z8FH 3NVQA 3O6MH 3DBXA 2PR4L 3MFFA 3MV7E 2JJTA 3BKJH 4QXWA 2X41A 2IPKA 2OR9L 2Q3ZA 5TQ2L 3IS0X 1OQXA 5JORB 1U58A 3EFFB 4OCYH 5C0CD 5E8DH 1N8ZB 4DUWA 4JGMA 1C5BL 5EU6A 2LU3A 2QR0B 2ERJB 4YGAB 1RV6X 4XBPA 1MRFL 3SOBL 4U1IB 1A5FL 3L3KA 3N1QC 1YPZA 1XR8B 1P7QA 3BRFA 1PFCA 3U7WL 5ACMA 1KPUB 4JJ5A 1YYML 2FBJH 3OSKA 5DJXB 2D0HA 3DRQA 2EDRA 4GRMB 3UTPD 3QT2A 5T5FL 2VXTH 3S5LA 1S9WB 2EYSB 1BD2A 3D69B 1ZT7B 4YR6A 3G08A 3VXUE 1YC7A 3B2VH 1FNSH 2YEZB 2P1YA 2YPVL 2Z31D 3OB0K 3X13B 4YAQA 4C56A 3EFDH 1CLYL 2RJMA 2Y5EA 3EO0A 3MBEA 5EPMB 3RZCB 2HJKB 3FMGL 4JHWH 1Y0LB 1RIUL 1NC4B 5C6TH 2MCG1 1KIPA 3V6ZA 2ZCHL 5C0NC 4JFOB 1MSPA 3KPTA 5DQDH 3B3IA 3HE7B 3MRKB 4G7YL 4HWEL 4JPWL 3QDGD 3S35H 3EYVB 5IBLD 1MF2H 4DW2H 5KSBB 1KIRA 3C9NA 3ZDYE 5CLWA 2AEWA 5F88B 2AGJH 3VGAC 4ELKB 4QRPE 5JHLL 4Q9QH 5DJAB 3IAGC 4YBLC 1YMME 1JNJA 1AQDA 1UWEH 3SDYH 3OF6D 5T1LD 3WFZA 4WO4C 3M8OL 1MAJA 1S5HB 1B0GB 4JHBA 5BMFH 3V6OC 4CVZB 4KI5E 4L4TD 5D72L 2BY3A 3ZTNL 4P57A 2AJVL 5JXED 3IXTB 1OGAD 4LLVB 3WKMH 2UWEB 4FQJH 4QHLA 2Y7QB 1II4E 4PG2C 1EJOH 2HKFH 4GW1B 5TGBA 4M8VA 2X4SB 3IETB 3S88H 3KHQA 5C0GB 4XGZA 4JQVA 4WU5B 1I7RB 1MJJA 4GUPA 4BH7B 5KN5B 2GYSA 6FABL 1CGWA 1NGXA 1NFIB 4QRRE 3IJHA 1NMBL 2IANE 4ODXA 3OAYK 3DRTA 5AAWA 3QO0B 1DQJB 2XN9E 2VR5A 4LGSB 5GZOC 1K4DA 1LO2L 2VQ1A 4P2OA 4YHIA 5SWSE 1EVTC 3BVNB 2NY6B 1MCOH 1UENA 5E2JA 2ZCLL 3K80A 3O2DL 3HUJB 4U0RC 5IFJB 3GHBL 3EOAB 1SBBA 2OSLB 1PDKA 3U4EB 4R90H 4WTZG 1XMWA 4XP9H 4M3JA 3BH8A 3GIZL 5D93C 1QBLH 2WNGA 1AFVL 3IAPA 5F89A 1H8OA 3LD8C 2GTWB 1ACZA 3O3BA 2VLRB 2F54E 4PJBE 4WV1C 4GT7A 4RMRA 5I2IA 2ESVB 3WJLC 2DDQH 2DWDB 2WAHA 4FXLA 4WUUD 5J9PB 3RIAK 5IFHL 4PJ8C 4PLJD 2RFXB 4LPCA 2XTJE 5DFTA 4QXUH 1WBZA 5INDB 3MJGX 1IFHH 1INEH 4RAHA 1WBXA 4IRJB 2YBRA 4R7NB 4YFDB 3W39A 3BE1H 4XCNA 1FC1A 2B4CC 3LS5L 1MH5B 5CEXB 5I8KH 3ZYIA 4JGUA 3GBML 3RNQB 5B3NA 4L5FH 2A0LC 1HH9A 5DUPH 2YD9A 2H32H 3W9DB 3WD5H 4ODUB 1RK0B 2VITA 3L3DA 3RVXC 4WI5A 1MRCL 3H2WA 5I19L 2EIZB 3IGAA 3QHTC 4R97C 2AJUL 4OSUH 4NRXB 4RMVA 2UZXB 2V5MA 3THML 3LCYA 4NC1C 1QLFA 1IAIM 3UO1H 2J3SA 3KPRD 5DJ0B 1OTSC 3IU4H 4LNVA 5TFSL 4HK0B 4DKDC 5MEPA 4N8VA 3TO2B 4JQXC 1AO7A 3LKQA 1GSMA 1QFWH 4K3JL 4ZG1A 3BT2H 2HWZL 3DVIA 1HN1A 1KNOA 3B6SB 1NDGB 5E5UB 3GMPA 3JWDH 2ZG1A 4NNYA 4WFHD 1M7IA 1IEBB 3DIFB 5I66B 2CO6B 1RJCA 1QSVA 5JW3L 2HG5A 1REIA 3ZKMC 5A2IH 4Z0XA 2Y5TB 1NAMB 1LO4H 3VWKD 1JPSL 2PTUA 1KLGB 1P4IH 4J1UA 3U9UB 4LSRL 3WLBA 1MHEA 2BNUB 3B9KB 1VACA 3W2DL 1S7QA 1IKNC 2VABA 4WGWB 3MV8B 3MGTB 1E28B 1FRGL 5C0CA 4LARL 2F19H 4R2GC 4ZDHB 1U9KA 4XVSL 1KJ2L 5ITBL 3O41A 4G8EA 1YQVH 4W81A 3DPBA 1XGYH 5KSAD 1J11A 4HIXL 1ZVYA 1UEMA 4ZUWB 3PGFH 1JTOA 4I9WD 2LAAA 3QSKB 4FQQA 4P5TD 4ERSL 5D1XB 3PWJB 2OJZH 2AKRA 5JHDD 3T4AB 5LG1A 3FT2B 4KKAC 4MNQE 3V95A 1J10A 4RX4D 1RHFA 1T5WB 2H32A 5KAQG 3MJ8B 3GSXA 1KENH 4R8WL 3QEQD 3OKLA 2OTPA 5GS3A 3BPOC 3RPKA 5IWLA 4HJ0C 2A73A 2PO6D 1NCWH 2VISB 4FQCH 5BS0D 3LDBC 4FQ1H 3W11D 4NFCA 1U0QA 1FAKT 3OGCB 2Z31A 2AK4B 5EOTA 5LGKA 3BD5A 3UAJC 4U1LA 2GK2A 3TH3T 4OGAD 1CFTB 3VFPA 2W0FA 5ESVA 3BGAA 2A74B 2X4RB 4PRHE 5JPNB 4PGJA 3TBTA 1EDQA 5HI4C 3WHXB 4D8PB 1AGEB 1P7KA 5FFLA 3QDGA 4JRXE 1ACYH 4HMEA 5F7LB 3WNLA 5D1ZC 4G5ZH 3MR9B 5JOFA 4AT6B 4Y19B 4JKPH 5E8OB 2CH8A 3D0LA 3U4BH 2XWTA 5IV2B 4KZEH 1F11B 1PSKL 3RWCA 1JPTH 5DD1H 4O2EA 4OD2A 1E4KA 4H0IA 3OF6A 1AE6L 5T1LA 3OR7A 4G6KH 2H6PB 1AD9A 1V05A 3C5ZC 1OB1A 4L4TA 4ZUUB 3PP4H 3LAFA 4ETQB 1R3KA 5JXEA 2PUQT 3FRUA 4M6OH 1OGAA 4DK6A 4NCC2 1NLBL 1ZTXL 5B38G 4KHXH 4YPGB 2R23B 3F12A 2OLDA 1DVFD 1JHKL 4XMLL 4MHHG 3I2CL 3UCRA 1PEZA 2G9HA 5IW6B 4I8DA 5DD6B 1YPZE 3AROA 3T0DA 4RSVA 4BZYA 3RTQC 3L5IA 2EZ0C 5JW5A 1UM5H 1I8IA 1GPOL 1YDPB 1S5IL 3CSYA 2JJWA 3LN5B 2D0FA 3PL6D 4XPHH 1PY9A 3MMEA 4O5LH 1T1YB 2EEBA 3AAZB 4HDIB 4PFEA 5FHBH 3VDBA 5H37G 2LFGA 3CH1B 3QXUA 2DLGA 2Z92B 2DQUH 4YHML 3VE0A 1QFUL 5FUCC 5E2VL 5B4MD 5IM7A 1WBYA 4XXCC 1IGCL 2PW1B 3UYPA 2YD5A 3DMMB 4HWZB 1PVHA 1KULA 4IIQC 3RVTC 1ES0A 3BQUB 3V6FB 1FE8H 3MGOA 4JFPB 4RBPH 3SY0B 4YFEA 2FGWL 4GXUM 5ENWA 1Z5LB 3BD4A 2DQJH 4HMCA 2VNCA 4N5UA 4X4ZA 1EH9A 5C08E 1CDJA 4LCWB 3N1GC 5MHSD 2R4RH 1HILB 1BQSA 4WUUA 3VDCA 1RZ7H 2XZCL 4OD3L 1YNLH 2VDML 3GKZA 3MX0A 3TBYB 5EU5B 3H9SE 1QHPA 3IU3B 4LLQA 3BP5A 2Z91A 1IKFL 1UGNA 3K81A 1KJMB 5A16A 5F96L 3RVVC 3STLB 4FQLH 5LKNA 1NFDB 3DARA 3C08L 3K46A 4BQ6A 1WC7A 3CMGA 4AM0B 3QIUC 4NJAH 1EO8L 5GGUB 4FG6C 3JXAA 5DRWB 1DUZA 1T83C 4PJ9B 1L7TH 2E7BA 4QCIB 2AJXL 4HJJL 1VKXA 4H8WC 3MRGA 4P49A 4RMSA 2H2PD 1FL5A 1YY9C 3QFJD 1KBGH 3KPRA 3AB0C 3ARDB 3UBXI 3PNWB 3VD3A 1EA9C 1R5WB 3QWQB 4MA8L 3V5DB 2BC4B 1G9NC 4JFEE 1UACL 4J6RH 1CLZL 5DA4A 3PE9A 2OZ4L 5T1DH 3UBXA 2H9GA 2W9EL 3MRPB 3B4NA 3PQYE 5D5MF 1M6OA 4P23B 5DVOA 3X11B 3R8QA 3FQWA 1HWHB 2E8YA 5E99H 4JHAL 3Q5TA 5DRXB 4I0PD 1WEJH 5CEYA 5J06A 4Y8DC 3ZHKA 3CFCL 3VWKA 1HHKB 1LO5B 5CINH 4HUVA 5AAMA 3ARGB 3FN0H 3NCFB 3NA9L 4Z5RB 3GJEA 4HPOL 3GMOB 1A3LL 1CR9L 2I60H 4PUBH 4CBPA 1M71B 4HK3J 1HXYB 5TH2B 4RFEA 4KY1H 4XMPL 4PRNB 1HKFA 1J8HE 1NQBA 3EYOB 3S4SB 3VXQA 2JE8A 4EOWH 5KSAA 1OHQA 5FYKE 1YEJL 2Q7NA 3MRBB 2IMNA 3RY6A 4LLMB 5JW4N 3OKOA 4QF1B 4H26A 4P5TA 5CUSH 5GJTL 2YPLB 3VFVA 3BP4B 3KLHC 4IDLA 4X7SH 5JHDA 4OF3A 3V0WH 1DBJL 3L3GA 4RX4A 4MA3A 4NKMB 1EBPA 3MNZA 4B50A 3QEQA 2ZKHL 1AGCB 2SEBA 4ELMF 4YHPA 5JPMA 5E1AB 5EZIL 4QXGL 3MLRL 5GGRA 2PO6A 2IWGA 4KVNL 5BS0A 4V2CB 3CMOH 5EU4B 5C7XL 1RUQL 4L4VE 2XIDA 1YEHH 1U3YA 5IG7A 1EFXD 4M9OA 1Q1JH 2CGRH 1K8IA 3SO3B 1RI8A 5C1MB 2MQCA 5D5MA 1GGIL 1JGVL 5CS7A 2GAZA 2DIAA 2R1WA 5DJYB 2G2RB 3FQRA 1N5AB 4PG9A 4XPTH 5CBEA 3ZHLA 1UXSA 4PGCB 3ZDXF 2NR6D 2NNAB 4LLWA 4PJDF 2E9JA 4BFGA 4WCYH 4UTBH 4F33B 4H8WL 3NAAH 4EIGB 3BZ4B 4LFHD 5GRUL 3KLAB 3BW9A 3LKOB 2FD6H 2HP4A 3DYOA 3VXTB 4JFZL 3HC0A 5ELIA 4XC3H 2CLZA 1G9NL 3V8CA 2DI9A 2R69L 4KKLC 5DJ6A 1NMAL 1A3RL 3IDUA 3WIFA 1VADB 3BI9X 4Y4KC 2WUBL 3CFJA 5SWQA 3RNKA 3BAEH 2APWA 3R06B 5E8NA 4O00A 1T0MA 2HN7B 4RNRA 1D7FA 4QRTA 1FH5L 4ZUVA 5IQ9B 5T5NG 1DVFA 1AGFA 4MWFA 5CJOL 4ELMA 3KPNB 2AQ1A 3LPGA 3IFPA 1M1SA 4HH9A 2FR4A 4AEIH 2DWEA 1P53A 3SDCD 4N0YL 4OZHF 4PV9B 1D6EA 2J12B 3G6JE 2C5DC 3BJLA 5HGHA 3PDOA 2CDFA 3DYPA 3P11L 3PL6A 2QSTA 3WDHA 1NGYA 3DLQR 2JCCF 1LDPL 1MLBA 4OLVH 1RUAL 2PR4H 1VCAA 5DMKA 3ECBA 5I71B 2ENSA 4I48A 2AXJA 4TRPL 3E3QC 3VFWA 2DLEA 4LDEB 1GOHA 2JB5L 1IGML 1U8HB 2KPNA 4PJDA 2F53E 3MGAA 4P4KB 4Y1AD 1V5JA 1Y18B 3D87B 4G6FD 1J05A 3WUWA 2IAMB 2Z8RA 5GRVL 3CVHL 1MRFH 3SOBH 5J12B 1EXUA 5C0ND 5E24E 2R0KL 2I25N 4R7DA 4O2CB 3ESVF 3LRSB 2A6JB 4FTVD 5ACZB 3U7WH 3ARWA 2LU4A 4JFQB 1HCFX 1YYMH 5E6IB 5I8OL 5CJBA 2HFEB 3S9DB 1CTOA 3JSSA 3BOVA 1ORQA 1IT9L 1QHOA 4U6TA 3MLUL 5GS0C 2EXYC 4WI3A 1LK3L 3DETC 4HC1H 1ZHNB 2FL5B 5T1MB 5I74B 2XXCB 4HLZH 5F7FA 3GSQA 5DHYA 1VFAB 3QZWA 1VPOL 4WO4D 1MQ8A 4L4TE 2YPVH 1A4KB 3B43A 1CLYH 5DFVD 5DQ9B 1JZ4A 3FMGH 5I76B 1RIUH 1OGAE 4NZUL 4OZHA 1ZVHA 3DVNA 3TH4T 1MY7A 3JVGA 2Q3AA 2BVUA 3FO1A 1D9KB 1ZHLA 2FB4H 2JCCA 3QCTL 3AS2A 2DM3A 4G7YH 4MX7A 3TBSB 1KELL 4JPWH 1CGVA 4F9PA 4R0LB 2APXA 1BFOA 1BGXL 3QFJA 4TSAH 5IKCB 4ZO8A 1CD0A 2VKXA 2XZQH 3KJ4B 3VA6A 2BOBB 1NC4D 1HZHL 4NN6B 4XB8A 3CD4A 4RIRB 5EO1A 3STBA 1FFRA 1MCKA 3M8OH 8FABB 1RVFL 2C26A 4Z7OF 5D72H 3HTLX 4GG6F 3ZTNH 3I75A 2A83A 1BJ8A 5GZOD 2VXQL 1DE4B 2X1PA 4I0PA 3FOMA 5L2KD 1QNZL 4OAWA 4NKDA 3H9HA 3JV6A 4F58H 4LKXB 1RUKH 1R6VA 3QEHB 1D5BA 3TN0C 1A6ZB 3ELAT 2WUCL 4YZFF 2BNRB 4YNYA 2O61A 4LHJB 3C60C 3IJSA 3SDXF 1G9MC 4IMKA 1IZJA 4KDVA 3LVEA 4X7TA 4WUUE 1CE6A 4FS0A 1U8JB 4HC1A 1CXFA 4PJ8D 2AEQL 2JB6B 4I0CC 2R0ZH 5DHVH 4YHNB 1J1OL 3OKEB 2EC8A 4URTB 1K4CA 4ODWB 2DQTL 4HZLB 2P5ED 4MDIA 1FL6A 5LCVL 3V5KB 1DR9A 4Z77B 4I4WA 3MUHL 3IDIB 4RRPA 3FB8A 3OMZA 2ZCLH 1R3HA 1B4JL 3O2DH 2GSGB 3DURA 5M7QA 3H9YA 4FNLL 2VUOA 2CKBH 2HFTA 5GS0L 1EHLL 3C09B 3GIZH 1VERA 2F74A 1MAMH 4GKNB 3O4LB 3RVXD 3V0VB 5IHZB 1WSST 3TYGH 1EFXA 4EI5C 4QHNB 5IB5B 3VH8A 3ARPA 4P4RB 4RFOL 2XQBH 4F7MA 3SGKA 5IFHH 4JFFE 2Q6WA 1ND0B 1JJUA 1WAAF 4Z76A 3BKYL 3KWWA 1U8PA 2VZSA 4FFZL 4OCSL 4Z7WB 3GK8L 1BPVA 4UU9B 4WFHE 4LPUA 1Q0YL 1NGZA 2VLRD 3B9VA 2JJSA 4D2NA 3LS5H 3SDXA 1J5OH 2ITDA 3GBMH 2F5AL 1KSRA 4JJHA 3FO9A 1YNTB 2QSVA 1YA5A 3DUUB 4WUKL 3QCVH 4WW1B 3H8NA 4FA8A 5I19H 3RX5A 2ED8A 3W0WB 2AJUH 4IRJD 5B8CB 1LEGA 1GC1C 1H3UA 1UM4L 4RWYH 2BFVL 4G8IA 4R2GD 2X10A 2KZWA 1NJ9B 4HUUB 5TFSH 1I3RA 5J1AA 4MJ5A 5DHVA 4OFYD 4HJGA 2O93L 2CIIA 1WIOA 1FFNA 3SDDB 1NGWB 2HWZH 4ONHB 4PJXA 4PJFB 2DQDL 4OZFA 1D5IL 3VMOA 5KJRH 4LU5L 1CT8A 3SDCA 3VG0L 4UDUB 2F58L 3QUXC 2P7TB 5JW3H 2ADJB 3O2DA 1G9ML 4OCXH 2FECI 5EA0L 4KKAD 1BEYL 3D39E 3AC0A 5D7IE 3H3KA 25C8L 3RQ3A 3IRZA 2V2XA 3QQ4A 4RBPK 1G7LB 3C87A 1SYVB 5AYQA 4LDLB 4HJ0D 3W2DH 4LSPL 3FZUD 4MXVF 1WAAA 1PAMA 4MAUL 5CD3B 1FRGH 4A6YB 4LARH 4X6CB 2Z8WC 3T2OA 1T20A 2V7NB 4ENEC 3L95B 1BWWA 3AS3A 3UAJD 4HS3A 4Y1AA 5D5ME 5E6ZA 3RL1B 4XVSH 3FAWA 5ITBH 5KG9A 1CN4A 4S1SL 1UM6L 1H3VA 1F02I 2WLZA 1WWAX 1KCKA 1DQML 4HIXH 1F8TL 2CXGA 3LKRA 4YXLL 4UIMA 1Q9KB 1S7SB 4FTVA 4J23A 1DBML 3BPCB 5JDSB 3QG6B 1RUML 3CH8A 2BCKB 2OL3B 1N8ZA 2DJSA 3UC0L 5JA9A 1FPTL 4HS8H 3K4DA 1H5BB 4RMTA 4R8WH 1LD9B 3N85L 1TLKA 1RURL 2QR0A 3NCJH 5A2FA 3EDKA 1UXWB 4U1IA 1AY1H 2VLKE 5ABDE 4WO4A 5CP7A 1ZLSH 5C8JB 3C5ZD 2OR7A 2PYFA 4WFED 2B1AL 5D1XD 1Q9OB 1KPUA 5D70L 1U3HC 2UWEF 5TE7L 1S9VB 1C8PA 3R1GH 3CZJA 1D5XB 4GW4A 1LE9B 1IGIL 1H8NA 2NY2B 5FAAA 3CFEB 4PR5B 3SKJL 1S9WA 2EYSA 3D69A 1ZT7A 1TCRB 1HINL 2M1KA 4PG2A 4ELME 4Y16C 1FYTD 4PRPD 5I15H 3S36L 3WXWL 2FX7L 5L2JB 2YEZA 2AK4D 3X14A 5I6XC 5K9KB 4LVEA 3HN3A 4MAYB 5EPMA 5JLZA 2HJKA 3ROLB 1GC1L 2HT4C 1NC4A 4HHAB 5DD0L 2YSSB 1CGXA 1PX3A 3WCYA 5D6CB 3VXSE 1UQSB 3MRKA 3PABB 5FA4A 4BA8A 5IB4A 4KRLB 3HUJF 3OAZH 3ZDXE 1I1YA 3UPRA 3NACL 5IBUG 5L2KA 3VGGA 4JR9L 3IDNA 2FJHB 3WXVL 1NLBH 3N06B 4AG4L 1P5UA 4LEXH 1JHKH 3T0EB 3I2CH 5CWSB 1B0GA 3FTGB 2K3TA 4ORZC 5MHSE 2P8PB 3HRZB 3S7GA 4DVBB 1GPOH 4WV1A 5H2BB 4OLWL 1U8OA 1S5IH 3LQZA 4G43A 5H94A 3Q3GA 4RGOH 3BRGC 1RJZA 4PJ8A 5E95B 1MIML 4X8JA 2UWEA 3DO7B 4P3CL 7CGTA 2Z9TA 2Y7QA 2BSSB 3AM8C 1QFUH 1U8KB 4U1HB 2AQ2A 4NC0B 4WW2C 5E2VH 5ESAA 1TQBB 3LZFL 4GW1A 2P5EA 4XRCB 1N5YL 1QEWB 2NY1C 3RVVD 1IGCH 3IETA 3OKMA 3WE6A 5C0GA 4ZTPH 4NFDA 4WU5A 4MAYC 1I7RA 4QGYA 2EC9T 1QR1B 3QIUD 1GXEA 4FG6D 3BWAB 1NFIA 5KTEL 1C5CL 2FGWH 1OAUL 5ANMB 4ALAL 4Z0BL 2YPKB 1VFBB 2JCCE 3F7RA 5J6GB 2XWBB 3QO0A 1QFWM 3FT3B 1DLFL 1PBYA 3ZDZE 5CFHA 3QFJE 2BRRL 2AABL 1E27B 3DMMD 2XZCH 5DUBB 1KT2B 4OD3H 1KCRH 3HUJA 4OGZA 4EQ3A 3EOAA 3BQUD 2OSLA 5KOMC 3W81A 3H9ZA 3U4EA 1NAMH 3GMQA 4FQXC 5F7DB 1IKFH 4OF7A 2H3NB 4MMXC 4NCC1 3SGEH 5FECB 2D4FA 1GGBL 2VLRA 3WIIH 3KG5A 4LCWD 4EUPG 1EHXA 3ZT6A 1EO8H 4OLZL 2DWDA 5GPRA 5J9PA 4HXAH 2V7HA 3QHZL 2GTZB 3I50L 1CD1B 2AJ3A 1I9JL 3MBXL 1QSEE 1ZK9A 5ETUA 1I3UA 4KRMB 2IF7A 2IFGA 4IRJA 3ALXA 1OGTB 3RWHB 1MFCL 4PGZA 3BIKB 3LEVL 4Y5XC 3JTTA 1FGNL 3NFPA 3QIWC 3K1KC 1OP3H 4OFYA 3RNQA 1KXVC 2VERN 3V7AG 3EYQD 3S97C 1UACH 2I9LB 1CLZH 2WP3O 3W9EB 4EDWL 4PJIB 4LSTL 2OZ4H 3ARYA 2W9EH 3GKWH 5HDOA 3HI5H 4M6NH 4NQVB 1RMFL 4YWGL 4JHAH 3W5NA 3MRIA 1C7TA 1VB9A 3MLZL 1QRND 2CK2A 1F6AB 2NYYC 2GY5A 2RB8A 2ADIB 5CJQH 2GJ6D 3D1MC 3WSQL 5FYJU 4X99B 5D1QB 4J3VA 3ZKXB 1NDGA 5IMOA 5J6HB 1CR9H 2H8PA 3PWLB 3P9MA 3SGEI 5M95B 4XMPH 3WS3B 5J1TC 3D85B 2K7QA 5GHWL 1QKZL 4GG6E 2V9TA 1NAMA 1DANT 3EKCA 1KLGA 2XWJA 3O11A 1X5FA 1MWAB 1K5NB 1XIWC 4S1RL 5DJCB 4YZFE 4X5XA 3U46B 4D9QE 2GK0B 3BP6B 4ZDHA 3SDXE 1A8JH 3HZKA 4ZS6C 4RAVA 5EZIH 4QXGH 3MLRH 2MJWA 2BNQD 4MXQC 5DRNB 2NZ9C 4KVNH 4BYHA 4ZUWA 5C7XH 1T6VN 3RL2B 1RUQH 3C5ZA 2YPLD 4KKLD 5D1XA 3GBNL 5C09B 5JXAH 3MRRB 3T2NH 2DIJA 3T4AA 3L5HA 2B5IB 5EBLB 5C86A 1GGIH 1JGVH 4BQ9A 1T21B 1T3FA 2LU7A 3MJ8A 4DTGH 3G9AB 3SKNB 2WIIB 2C7UA 5GGVL 2OZ4A 3U6RA 1FYTA 4PRPA 5J1SC 4GS7C 2E27L 2DIBA 3GSOB 5F70A 2Y4SA 2YUZA 1DLHA 4KK6D 4EI6B 4H8WH 1JBJA 2AK4A 4ZOBA 3V52L 4Q9BA 5D7SL 5GRUH 1CFTA 4FP8L 1IGJB 3A6BL 4XZUB 2X4RA 5JPNA 1JV5A 1OSPL 3WHXA 4D8PA 2R69H 4GRWB 1X44A 3DGCR 4DUXA 3G5XB 2YRZA 1WAAE 1A3RH 4I3SH 2ZSWB 4LPXA 5DHXB 5ID1B 2WUBH 3VFNB 2XXMB 5I30L 3MRDB 3GMMB 5IV2A 1WZ1L 1HSAB 4IIQA 5DJ8A 5HXMA 1TJHH 2KQNA 1UH2A 4PJHF 4D0BA 2ENYA 5I1DA 5GGRY 3GJFB 4JFXB 4RFNC 3AXLB 4IRSB 4N0YH 1FV1B 1A7OL 4S0TD 1I8MA 4Q74A 3KPSB 3F5WB 4MJID 5DDHB 3BH9B 4RGNC 1LDPH 4F37F 1TXKA 2WBJB 2VMFA 5GS0D 4YPGA 1J1PH 1ZS8A 2R23A 2H2SD 1B2WL 3HC3L 4TRPH 1PZ5B 1OF2B 1Y6KR 5DRZA 2WINB 1JYWA 4UBDD 3FT4A 4GMTH 1JHLH 2FO4B 3V6OE 2JB5H 1IGMH 2IC2A 5C0AB 4N8PA 1MCHA 2PTTB 1MVUB 3QIUA 4MJ2A 3DVFA 4QTIL 4PP2B 1T83A 2VDQL 4NSKB 3ZL4L 4NQTA 1ZA6B 2Z92A 2R0KH 1JWSA 1S7XA 4DJMA 4D0CB 3DSNA 3DMMA 1FZMB 2A38A 1TZHB 1MELA 4MXVE 2VAAA 2XNAB 3T0VA 3MLUH 1UEYA 7FABH 1LK3H 5LGHL 3BQUA 4M4RA 3TZVB 3V6FA 4JFPA 3B2UD 1KEML 3ZSTA 2IAMD 2H45A 1G6VK 1NBQA 1JZ5A 1AH1A 1Z5LA 3IDMB 4X6BA 4BSWA 5D7LB 4HGWA 4PJHA 1VPOH 4KAQL 3Q6GH 1DBAH 4LBEB 2C3GA 3T09A 4LCWA 5D4QA 3AS0A 1L4IA 1OAZL 1N3NB 4XVTL 1HILA 5L2KE 1U36A 2ZCKH 5EIVA 2CLVA 5EU5A 3HG1E 3IU3A 3QCTH 3TN0D 3T1FA 3QXAA 4YK4B 2XTLA 2ZOLB 1KELH 1KJMA 4YIQB 4NN7C 1MWAL 2E6JA 1PKQB 1ED3B 1BGXH 1BM3L 1ZT1B 3N1MC 3EYUL 3QWOB 5DRWA 4L9LC 1A7PL 1HZHH 4QCIA 1E4WL 4X0KB 5GS1C 4UT6H 4PJCE 2I07B 1BX2A 1LEIB 2R8SL 3QG7H 1RVFH 3FQTB 5GSVB 5HDQH 2UYLB 1T2QL 2P5EE 4D9RD 4Z7QF 1A1MB 2P4AB 5F1OB 4KUZH 1QNZH 3PNWA 4Y4HC 1R5WA 5HHQB 4FXKA 1QRNA 3TZVC 3V5DA 2BC4A 2WUCH 2GJ6A 1INQB 3IDYC 5EC2B 1HEZB 3UTSD 1WZKA 3MCG1 2IBGA 3H3BC 3TESA 3DJ9A 5HI5C 3HAEH 5LGJA 3N1FC 2C3VA 3X11A 4IOFC 4LIQE 5CLTA 3FB5A 1EJ6A 4P9ML 5DRXA 2NXZB 5M94B 4HT1L 4NC1E 5EC1A 1VA9A 1Q9LB 3KYOB 1LO5A 2AEQH 1ZLVH 3O6LL 4WFGD 5J56B 2GFBA 4CMHC 3OV6A 4XVJL 2BNRD 3WDJA 5CILL 4Z5RA 3BJ91 4HXBL 4W4OC 1HXYA 5LCVH 4EN3C 3JUYA 3IJYB 5H35B 2DTML 2Q87A 1B4JH 3EYOA 3S4SA 3UYRL 1OCWL 4L8DA 3BPLB 4W6YB 2BNQA 3HFML 2R2EA 5GS0H 4LLMA 1JPFB 2CKNA 2VAJA 3BD3A 1DQTA 2IADA 2NY5C 1KCLA 3MRJA 2BY1A 2YPLA 4YDIL 4UILL 3AMLA 3E8UL 2BERA 1A1OB 1CL7L 3VWJC 3CDCA 2NXYC 2R2CA 4NKMA 4H5SB 1AGCA 2YR3A 2YMXH 5E1AA 1CDCA 3BKYH 4U6YA 4KC3B 3GUTA 3DV4B 3O9WC 4OCSH 3F6LA 3GK8H 3OPZL 3EIFA 3GMLB 2D7PA 3GM8A 4YO0B 3ULSB 2MMXA 1KPVB 2LABA 4U1KB 4YDKL 3OAZK 3QUXD 1CLOH 5FF6B 4QRUB 3FRPA 1A21A 2F5AH 4GKOA 5CAYB 1BFTA 4QHKJ 2EDXA 5DJYA 5HGBA 1TTUA 1VFOA 4WUKH 2DLFL 4PGCA 3HAEA 3V4VL 4DEPC 2YZ8A 1YUHB 4LVNC 1TVBB 3V5HB 2AQ3A 2IBZX 1G6RB 4X5WB 3KLAA 3LKOA 5BRZB 4ENED 2GQHA 3VXTA 3RWJB 4KJYA 1JWUB 1URLA 1FFOB 4HS6B 4R6UA 5C2UB 4WI8A 5HDLA 4NNPL 2DQDH 1PJ9A 4LU5H 3VG0H 2CRIA 2F58H 3OBAA 4Q0XL 3AU1A 3NGBB 5FGCB 5EA0H 4MJIA 2AK1H 3R06A 1KEGH 3P73B 3MZTA 4PJ5B 5F9JB 5IQ9A 1R5IB 4HWUA 5GRWA 3RX8A 3MRMA 5LBSH 2ICEB 4DFHA 2DMCA 4XCFL 4MAUH 4WHDA 4M6AA 1FP5A 4PV9A 2PNDA 2EDLA 2DKMA 3MRCB 4QYOA 2YUVA 1U3HD 3CFIC 5E70A 1A4JB 1S9KC 4S1SH 2X05A 3EDDA 1K8DB 1DQMH 5AD0A 1I3GL 4YXLH 4AH2B 2YZ1A 1BFSA 1FYTE 4PRPE 1RZGA 1DBMH 4Y16D 2NY5L 3I6GA 1RK1B 1RUMH 4LLAA 1SY6L 3L3OB 2FIRT 1CVRA 4I77L 4OF6A 3UC0H 4OUUA 2DI7A 2GEEA 3NPSC 1FPTH 3BHBB 3UZEA 2WANA 3FFCD 3N85H 4M7LL 3GRWH 2HT4D 2IAMA 4UIKH 2FCBA 1JK8B 1OAYH 3GGWA 2W60B 5EOCJ 4O2CA 2XFXB 4Y4FB 3IS1X 5FUCE 1GZQB 2B1AH 2DMBA 2VZTA 5D8JL 4FFVC 5TQ0L 5D70H 4JFQA 4MYWB 2BXYA 4LCYA 4TNVF 3UJIL 1KGCE 5E1HB 1IGIH 1QSFE 1OP3K 4X5LA 1X5JA 4OLXH 1XGUB 3SKJH 3TN0A 1ZHNA 1KYOK 5I9QB 2VDNL 1AXTL 1HINH 1XH3A 3S5LG 3VXMD 1D3CA 3S36H 1VFAA 3WXWH 4OIIL 2FX7H 5DA0B 4PLOB 4JPIB 3EOTL 3NIFF 5JNYB 3DHMA 4OFKA 5DQ9A 1MCEA 3QHFL 2J8UB 5I76A 1GC1H 3D25A 4HCRL 3CC5B 1DN2A 2NY2D 1JGEB 2CDEB 4UV4L 4MNHB 2CRZA 1Q72L 4R0LA 1SEQH 5F6IB 3CFBB 4G8FB 1MLCB 3NACH 4JR9H 2DOCA 4V1DB 4DGIL 5D7JB 3NABH 1X7QA 3HE6C 1JVKA 2JIXB 4G8GB 4MAYD 4U1JB 4AG4H 3ZMRA 3MUGB 3VGBA 4MDJB 1T0NB 3UTSA 5KSUB 1BAFL 3MYJB 3QP3A 1W2KT 2YN5A 1NMCB 2CLRA 1DE4A 1E4XL 5I17A 3E2HB 4PJAF 5MEQB 1ZAGA 3MV9E 2HFGH 2EE2A 4Z7WF 3MNVB 4ODTL 1MIMH 3MOBL 3QEHA 2A77L 1A6ZA 2COQA 4P3CH 2V2TA 2ZG2A 2BNRA 3H3PL 4P3DA 4EKXA 3LZFH 1UCTA 1N5YH 2ZJSL 3JV4A 2Q8BL 4PJHE 1JYXA 3SJVB 5ADPH 1FORL 1G6RL 3R0NA 5I0DA 2VIRA 5I1HL 1U8JA 3RKDC 1OAUH 2JB6A 5ERWB 3EO9H 4Z0BH 2ARJQ 5E9DE 4LPWA 1I7ZB 4EXPX 4NRYB 1A0QH 4Q9RL 1A3QA 2AXFB 4ODWA 1DLFH 2W9LA 1AHWC 3U0TB 5B38B 1NUGA 3LS4H 3PWUB 5J13C 1AC0A 2OTWA 4HIJB 3QIWD 4YQXL 4PJFF 3WO3B 4YHKL 3LKNB 3UEZA 4I13B 3OJDB 3A6OA 4CVWA 3CUPB 5T5NF 3ULVC 1CK0H 1XF3A 3PDGA 4KDTC 3QUXA 5ITFB 5IB5A 4OLZH 4P4RA 1CE1L 4ZFFA 3QHZH 3QUYB 3I50H 4AYFA 3MCKB 2A1WH 3GO1L 1IRAY 1QRNE 1B90A 4PJAA 3K8LA 5T3XH 1KPRB 3MBXH 2VO5A 2GJ6E 5KVEL 2NYYD 4Z7WA 2MCPL 2VWEC 1X5ZA 4UU9A 5IMMB 5C71A 4F37K 1IAOB 3LEVH 1I9EA 4YBHA 3TNMA 1YMHB 1FGNH 4UT7H 2GW5A 5FOBA 2Z4QA 2CIKA 1CGUA 2FDBP 3ESUF 2N56A 1MFEL 5CSZA 3UTTD 5F7EL 3HHRB 1W72L 1G7JA 4RQQA 1YEFH 4X80L 4NZTL 1MIEL 2XZAL 12E8H 4JM2B 4LSTH 5DD5L 5C0JB 2AJSL 2NW2B 2NQCA 2ATPB 2UZYB 1FNLA 4YWGH 3IFOB 2G5RA 4QHKI 3BZFB 4HUUA 3MLZH 1R3JB 4NN5C 4JY6B 3WFDH 5MEND 4Y2DB 2BNQE 5HJ3B 4ZS6D 5GRVK 4BM7A 4N8VG 5DS8B 3WSQH 2NZ9D 4HV8B 3ZKNC 3VXPA 4PJFA 5HHNA 1XGQB 4LSSH 5TDNA 1FQ9C 1T0PB 2DQEL 2ZP0T 3BDYL 1U3HA 4WIQA 5GHWH 5EBMA 4P2RB 4QXTB 3QJFB 5JW4M 4Z7QE 1CGSL 2BVQB 4R96B 3OXRB 4WW2F 2MHAA 3EGSA 2EEDA 5JQ6L 1SYVA 4GAJL 2G5BB 1UJ3C 1U42A 2WM0A 3GMRA 2ATKA 4Y16A 3TT1H 2VB5A 5DEGB 2VKWA 4X9FA 5B39B 4X6CA 3QDAA 4XCCL 3L95A 2Y07L 4N0UA 3FFCA 3RL1A 3TBVB 1F00I 4F7PB 4UNTA 4GJTB 1PG7L 1PX4A 3L5WB 5HHVL 1M7DA 4Y5YC 1HH6A 3QDJB 5CMAB 1GJIA 1QZ1A 3KYNA 3E3QE 4FQHB 3BPCA 2RR3A 3QG6A 5JDSA 2P5WD 1WTLA 5CGYC 5HYSA 2OTUA 2DD8H 1H5BA 5C3LD 3HZMA 2RAMA 3KXFB 5GGVH 2FGZA 3GSNL 3VXMA 2HJLB 4LVHC 2E27H 3R4DA 2D7TL 1PQZB 1UVQA 2GJZA 2X1QA 3KGRA 3U1SL 3V52H 3AMKA 3PGDA 5D7SH 1MPAL 2YD3A 1F45A 4J12A 5C09D 4KRPB 4MJIE 1S9VA 4FP8H 3A6BH 1LE9A 1UC6A 1T5XB 4UTAL 4PR5A 2E9WA 2R2BB 1OSPH 3L5XH 5EU3A 1H3GA 3PV6B 3AM8A 5BV7C 2DQGH 4WW2A 3U9PL 1FZJA 1MOEA 2IFFL 3DX6A 4GXVH 3V79C 3T65A 1MVFA 5K9KA 1KB9J 4MAYA 4TVPE 1RZ8A 3ROLA 4Z78B 5KANG 4F7CB 3U36B 4HHAA 2YSSA 4PRID 1ZLVK 1ULVA 5D6CA 1UQSA 1WZMA 5IB1A 3G6DH 4RGMB 1G84A 5CZKA 3F7QA 1A7OH 3NOIA 4XWGL 2IGFL 3ARUA 4KGJA 3ZE1F 2NLJA 4J7RA 5F1NB 1LHZA 4LCCB 1B2WH 3ARFB 4HEME 1KTRL 2EH7L 5I1EL 1MRDL 2W0PA 4QY8A 5CWSA 3AREC 4N68A 4OGYL 2EE6A 4JO4L 4R4FL 5KS9B 3FTGA 5HSFA 2P8PA 3HRZA 5FHAL 5TPWL 1CQKA 2D9QB 4G6ML 1HI6B 2MQ3A 3V6BR 2XPGB 3RAJL 1IGTA 3HPLA 4CKVX 2K1MA 4FABL 2VDQH 4CL7A 1CBVL 2YA1A 3DO7A 2D7OA 1EIBA 1WWWX 3H0TB 3J7HA 4F8TA 4U1HA 1U8KA 1XF5B 1V7NL 4DGVH 4WI9A 2H1PL 2PYEB 1QBBA 3MBEC 4JHZA 3BGFB 4Y5XA 4X7FC 4OLYL 5C0AD 1QR1A 4KQ3L 3BWAA 3QIWA 1UKTA 4LAJH 5LGHH 1KEMH 4LLYB 4CDGC 4H20H 5ANMA 4OFPA 3S96B 2YPKA 1VFBA 2E5EA 5J6GA 1BQHB 4WGVB 2XWBA 4AZ8A 1BJ1H 4D9RE 1J0IA 1U3JA 1OAZH 4XVTH 1NGQH 3C6SB 3DX8B 2BVPB 2N7BA 1E27A 1KT2A 2ZOKB 1XGTB 1FG2A 4X6FA 4JG0H 1EAPB 3TZVD 3LEXB 3F62A 4GQPH 4X83A 5LXGL 4JFYB 3UTSE 1T2JA 4DAGL 1MWAH 1X9QA 3HMXH 5HI5D 3RY5A 4ZUSA 1KUMA 3CXHJ 5BV7L 2NX5D 8CGTA 1BM3H 4L4JA 3EYUH 4CMMB 1P2CB 1F3JB 3MLTB 4YH6A 1VSCA 3EJZC 5L0QC 5D7KD 3C6LB 3UTTA 1FVDA 1A7PH 1R3LB 1W0VA 1LNUB 1E4WH 4MSWA 1CD1A 4PV8A 1N6VA 4U7SA 2EDBA 1T1WB 4BFBD 4BFIA 2R8SH 3P77A 5E8PA 5E56A 1S7RB 3QISA 3P9WB 3T08A 1U8QB 2LVEA 1T2QH 1GL4B 3RWHA 4JKMA 5FUZL 5DK2B 2D0GA 2W65B 2XV6B 4EN3D 1ZVSA 4HBQA 1DSFL 2PW2A 3QNYB 4C83B 2AI0L 1FAIL 5MENA 5GS2D 3NIFE 1C08B 1TIUA 4ZNEE 3D3VB 3GIVB 4IOIB 4I1NB 2I9LA 5E4EC 3W9EA 1PEWA 3O3EB 2B2XH 1VEMA 1ZEAL 2O5YH 3QFDA 4HFUL 1JGDA 3UBXG 2Y25A 4NQVA 1I4FB 3PWPD 5L7XL 3HC4L 2H26A 4P9MH 1NUDA 2FIKB 4HT1H 4PBWD 3VWJD 4L3EB 2WBWB 2X4NA 2F8VA 4K3GA 3O6LH 5MERB 4U1GB 2Q86A 1ONQA 2VZ3A 1F6AA 1Q9WB 3NFSL 3BKCH 2AEIT 4X99A 1FN4B 5CILH 1CFBA 3G6AA 4HXBH 4GRWH 3CSBA 3BISA 2EDDA 1YEEL 4YC2C 1HSBB 4J3UA 4PRBB 3WS3A 2AS5M 2EIEA 2NXZD 3UYRH 1OCWH 4ODHL 2EIDA 4OCMC 3MZGB 1UWXH 4PJAE 5JIKA 3BEWB 4I18C 1K5NA 1MWAA 1GRWA 2X4PA 2EKSB 2QQNL 2MTPA 5DJCA 5J11C 3GJFH 1RSFA 2MPAL 4OKVB 4UILH 3VMPA 3WLWC 2P5WA 3U46A 3E8UH 3UPCA 3IDXL 4OZ4B 5E2UL 3P40A 1CL7H 3DXAB 2FYYA 5AZ2L 5FB8A 4XNMB 1H3XA 4Z8FL 5L8JB 1C16B 3VXOA 3BEVA 3GI9L 4UQ3B 5SV4A 5DRNA 1XEDA 4E0RB 1NLDH 4CJ1A 3AFLA 2ZUQC 3BUYA 3LV3B 3QPQD 3KDMB 5T33H 1GGYA 1L9NA 4MLSA 3B9AA 5C09A 4YDKH 3MRRA 1A14L 1CFVL 3U0PB 2ZUUA 2GY7B 4S11A 1GH7A 4XAKD 3QDMB 5GXBB 2NY0C 3IAQA 1AXSA 3QUZB 1T21A 5C0BB 3TJHC 1WITA 3LHPL 2DLFH 3SKNA 4U6VL 3V4VH 1FVEA 1JGLL 3OQ3B 5DLMH 3GSOA 2OBGA 4EI6A 3WEXB 2YS4A 4F2MA 5EZJB 5BJTB 4M61B 3IDJB 1QLEH 5IIEB 2YRPA 1HHJA 2HT2C 2VXTL 2HLAA 1BOYA 2HVKA 2KBGA 4PRIA 4XZUA 2MNUA 1TNMA 4NNPH 4X6DB 5BW7A 1T22B 5C0EB 5I75B 1HDMB 3R8BB 1BVLB 1UZ6F 3EFDL 5ID1A 3STZB 5JZ7C 1JNHB 2JK5A 4AEEA 4QOKB 3GMMA 5C6TL 4TUOB 4N0UE 4MNGA 3FFCE 3TPUB 1CL7I 4H1LB 1Q94B 3VI3E 3QIBB 1A9EB 3QQ3B 5C07B 4UAOC 4MXWH 2XICA 5DQDL 2Y1VA 5HYJD 1P4BL 3GJFA 4HF5L 3IYLW 1MF2L 3AXLA 4XCFH 5EULV 4DW2L 1F4HA 5D2NB 5DT1L 1S7WB 3UX9B 4M93B 4FFVD 2VZ1A 3IT8D 4Q9QL 3KVQA 5TF0A 4P2QB 1F4WL 3SDYL 5DK3A 3SQBA 4JRYB 4PJ5D 5DD3H 1I3GH 4YHYC 2Z35A 4K2UL 1PZ5A 3VXME 5BMFL 1OF2A 3C8KB 2FSEA 5DTFA 4PJEB 2A6IB 1QA9B 2FO4A 1BQLL 1SY6H 5C0AA 4I77H 1ZSDB 4KQ4L 2PTTA 4GKSB 3FFDA 2X1OA 2OCFD 3CX2A 4M7LH 5CSGA 4FQJL 3SBWC 3JWDC 5IB3B 2W0LA 5GS1A 1BIIB 4NSKA 1ZA6A 3WUWG 5C0DB 4M7ZC 4BJLA 4DZ8B 1YN7A 3MO1A 5D8JH 2IH3A 3SKOB 1KG0B 3UJIH 1NSNL 4ZFZB 1FZMA 3CAFA 4XP4L 3RGVB 2XNAA 3HE6D 2X4QB 4BKLB 2YRLA 3GFUA 1JPGB 1W0WA 3TZVA 1R5VB 1T66C 5HI3C 2Z93B 1A7RH 4NQSA 2R1XB 1NANI 2LAGB 2WWKO 3IDMA 2RBLA 3DO3A 1X3DA 4OIIH 4LBEA 1F4AA 4Y4FD 2NX5A 4AEHH 3EOTH 4PPTA 3QZWG 1N3NA 5E94A 3QHFH 2AAVA 1FO0B 3Q2CA 4UUJA 1A1NB 4HCRH 1UG9A 3P0GB 4JO2H 4XBGB 3EBAA 2GSIA 3TM6A 3VA2C 4UV4H 3DX7B 1MJ7H 2ZOLA 4KKNA 4ZFOB 1Q72H 4CNIA 3LKPB 4J3TA 1CQYA 3SCMB 5KZCD 1PKQA 4ZYKB 5J7CC 2DDQL 5EWIL 1P4LB 4EN3A 5DJDA 2VDRH 1TPXB 4DGIH 1ZT1A 2X4OB 3FONA 3X12A 1L7IL 1DN0B 4E41B 4LVOC 4QXUL 4YDVA 3OKDB 4X0KA 3RKDD 1INEL 4K94L 2I07A 1HOCB 1MI5B 1LEIA 1NH6A 1BAFH 4S1QL 1U95A 3UTQB 3ZKSD 1SY6A 5GSVA 3BE1L 3PWPA 4XNZC 4NQCB 2WLYA 2HYMA 1RZKH 1A1MA 5I8KL 5BCAA 1ZGLB 3VRJB 3VWJA 3KPPB 1CXLA 4PTTB 5DUPL 4ODTH 4FRWA 1KTLA 1Q0XH 3LOWA 2FZ3B 3JWOH 3MOBH 2A77H 2WBKA 5IB2B 2UY6A 5JO5A 3H3PH 5CD5D 4OZIF 5EC2A 1HEZA 2YD6A 5D2LF 1ETZB 2ZJSH 2Q8BH 2R29L 4C54A 2P24A 1JZ6A 1Z0NA 2IALA 4PLJC 1OAKL 1FORH 1G6RH 3RWDA 4Q6IB 3E6HB 2JELH 2O5ZH 4K55A 4Y5VC 1AGDB 4GRLC 4OZGF 1F4XH 1IGYA 1DQQB 4LNRA 4OQ1A 3ZE1E 4U6HA 3FB6B 3JWDL 4JLRB 1B9ZA 4HLZG 4Q9RH 4EVNB 4N9GB 1MFAH 2UUDH 3HNTL 5H8DA 3SJVD 4M8QB 4HCRA 3T8XA 1DBBL 5IP4A 5H35A 5ISZB 1LO4L 1BVKA 3UTTE 2WQRA 4RRPG 3IXAB 2PCPA 4L8SB 1ZT4B 2R56L 4LMQE 2X4TB 4MB5A 2OYPA 4Z18A 3A0OA 3KS0J 4XAWH 4KRNA 2W9DL 5ID0A 1A1OA 3JTSA 5DMGC 1CE1H 4I2XB 1ZHBA 3BPNC 3GO1H 3VH8G 1FFQA 2QADC 4MCYB 5MENE 2EDWA 5KVEH 4Q6YA 1XZ0B 4K7PX 1I85C 3GMLA 4NRZB 3CPLB 5DEFB 4YO0A 3ULSA 4R3SA 4HG4J 4OZIA 3KLDA 4TN9A 4DZBB 5D2LA 5FF6A 2BP3A 1IZKA 3CDGB 5EUKB 4LFHG 5F7EH 5EOQL 1VESA 3QUYD 5IGXH 2VLJD 4NZTH 1MIEH 2XZAH 4X80H 4FQCL 4JFDE 5F1KC 1TVDA 3FQXB 3PJSA 5DD5H 3WFBL 1CDGA 3EUUA 4OZGA 4FXGB 1RULH 1ZWIA 4OCRL 1MUJB 3MODL 1F3DH 2F5BL 3V5HA 1G6RA 4APQB 1FZOA 1U91A 1XAUA 3N9GL 5JA8B 2HMID 5KSAC 1TVHB 5GZNC 3RWJA 3S6CA 2R4SL 1JWUA 1L0QA 5BZWB 3FL7A 4P5TC 4X9IA 1XCQB 5HYJA 4HS6A 4NQDD 4Q7DA 1ACYL 4TUJB 4XX1E 4G5ZL 4EUPB 3I6KB 4OZFG 4F7EB 1LK2B 2P5WE 2DQEH 3BDYH 4KZEL 5E6YA 1KJVB 4JDVB 2YC1A 5CGYD 4Z7UF 5ESQB 5DD1L 2PO6C 1CGSH 4PJ5A 1FO0L 3K7UA 4G6KL 1N64L 1IEAA 4Y2DD 4CUCA 4NUJA 5JQ6H 4UI2A 4L29A 3N50A 3PP4L 1RZFL 2E7HA 2ICEA 3MRFA 4OGAC 4P59L 4W4NA 4M6OL 4XCCH 4MA1B 4KK8C 4HFWB 4M1CD 3ZLQC 4YDLB 1T7WA 15C8L 4U1SB 4RGNE 4KHXL 1PG7H 4P2RD 3BP7A 5BZDB 4HH8A 5HHVH 4AH2A 3D2UD 3QXVA 1T4KB 3RRQA 4JREC 1UM5L 4EDXB 2X9YA 3L3OA 2OQJB 4ZO7A 1BLNB 4XPHL 1JZ3A 4ODVL 1SYSB 2JLLA 3BHBA 3HE6A 5DYOB 1LP9E 5I1AB 4P5MB 4BQBA 4PRIE 2CDGA 2DQUL 3GSNH 2DYPB 1H15B 2D7TH 3FQNB 4J8RB 1LE5B 3RDTB 3QDJD 2XFXA 3U1SH 4Y4FA 5C3TA 3WHE1 1MPAH 3NCMA 5FYJL 1HHIA 3QDHA 5EO0A 3VXRE 1LDSA 2GI7A 1FE8L 1DVFC 4MNGE 5IR1B 4UTAH 1XGPB 3FB7B 3RBGA 2DQJL 5DZOA 4Z7UA 5EBGA 4S1DD 5ICYB 1O7VA 4KJPC 1EFQA 3TGXA 2UY7A 3U9PH 2IFFH 3ARED 4OCLC 4NO0B 1UT9A 4KI1A 1RZ7L 4KRPD 1QUNA 4NPYB 5F21B 1TQCC 4AIZA 5FKPB 4QWWC 4YXHL 3DV6B 4GMSL 3CVIH 5B4MC 2CDEA 2ZUSA 3MFGB 2VDPL 1XF4B 2WV3A 3P4NB 4G6AC 5DJZA 1J86A 3C5JB 4MNHA 5JW4Q 1QFHA 2HFFA 3CFBA 3OXSA 4G8FA 1AHWA 4NJAL 2OI9C 4XP5H 3WFHB 2CMRL 3OWEA 4U1JA 5MEOB 3DUSA 3MV7B 4WWKB 4X7DC 1UWXK 4R4BB 3VD4A 3IVKB 1BBJB 1T0NA 4ONGH 3U30B 1MRDH 5I1EH 5KSUA 4NQXB 1YEIL 4PTUA 4QT5B 4R4FH 3GJFK 5FHAH 4X4XB 4KDTA 4GAYA 5CZVL 1I1FA 5HHOD 1QQDA 1K6QL 1RQ5A 3MNVA 3KS0H 1K3IA 3GSNA 4J6RL 4Y7MA 3ARFD 1B6UA 3LKSB 1V7NH 2H1PH 4RMWA 1KLUB 1MFBL 3D0VB 3SJVA 3WDIA 4EEEA 2NX5E 3P30H 4OLYH 3OGOE 4WI7A 5EG6C 4KQ3H 1JUFA 2NY3C 1HQRB 4ZXBB 5CINL 3EJZD 4HUXB 1AC6A 1FIGL 5ERWA 1S8DB 4F9PC 3FN0L 4L3CB 2VJXA 3VXUB 1T7YA 4JFHD 2XZZA 5HDBF 1I7ZA 3ABZA 4DOHE 4PUBL 4NRYA 2LTQB 2AXFA 4MHHI 1CD9B 2UV3A 4Y0GA 4KY1L 4TNWF 1FG9C 3FOLA 4JEGB 3PWUA 2A2QT 2ICWB 4UB0H 2DQFB 3RWGB 1S7TB 3KPMB 5LXGH 5CUSL 2D4DA 4G3YH 3U30C 5J4MA 3L7EB 4MD0B 3WN5B 5KVDL 3HS0B 2C1PA 2PKDA 3ZO0A 5BV7H 1Q38A 2XKNA 3PWPE 4PLKC 4HZAA 2M8XA 4POZD 3V7AE 4QRPB 3QUYA 3DI2B 4YX2L 2VLJA 1HHHB 1J18A 1YMMB 4O2FA 1F90L 4HGMA 1KPRA 2MWCA 4O51B 5GGVY 1DUYB 3MRQB 2EYTB 3S35X 1XGRA 5IMMA 4HIEB 5IVZA 1IAOA 1Q1JL 2CGRL 3G5YA 5FUZH 2IG2L 1JN6B 4IOSD 1YMHA 4XCYB 1DSFH 3MA9H 2AI0H 1FAIH 4ZXBC 2YUXA 3C6LD 2PXYB 3ILQC 5EUOF 1QSZA 1INDL 3ZYJA 3WO4B 4NQDA 3ZTJH 5BQ7B 4NNXB 4Y5YA 5CBAB 1KCUH 1ZEAH 3MLXH 4UTBL 5C0JA 3KYMB 3X3FL 1J9CT 3MNWA 4HFUH 3NAAL 1OAXH 1I8KB 1BVZA 2Y36L 3HC4H 3IFOA 2FD6L 4ZUTB 4K71B 1IVLA 3ULUC 1RIVL 5CEZL 3BZFA 2WQ8A 3I84A 4QRRB 4JY6A 2IANB 4Y2DA 5HJ3A 3D18B 3NFSH 5T3ZL 1OAQL 3CXHK 5DS8A 3D3VD 1U8NB 2EYRA 4GBXB 2DQCL 1U8MB 2FRGP 2XN9B 4CJ0A 1J8KA 1TJIL 1IJ9A 5FYLH 3VI4F 4OBSA 1QACA 3TT3L 2BY2A 1DL7H 1PYWB 1AD0B 1HWGB 1YEEH 1YEDB 5SWSB 3SGKC 3TA3B 1SJEB 4XAKE 1QTYT 43CAA 2FEDD 3SDAB 5C9JB 4ODHH 4QXTA 1GCFA 3QJFA 3CX5J 3D2UA 5IBTL 3MROA 5I1LB 2QQNH 2G5BA 4HIHB 2ORBL 2F54B 2MPAH 4PJBB 3TEUA 4OZIE 2X1XR 3IDXH 5E2UH 5FM5M 1NCAL 4LKCB 5AZ2H 5D2LE 3IF1B 4OLVL 2BMKB 1QPPA 3ILPB 5HGDB 1NC2D 4F7PA 3RWEB 3GI9H 2QQKH 1Z0MA 2HT2D 4UOW1 2XTJB 2JJUA 4YHOL 3T77B 1U2CA 4Y2OA 1EZVX 2VLMD 1XF2B 1R0AL 3KAAA 3QDJA 5CGTA 5CMAA 5EUOA 4OZGE 2BSTA 4ZTOL 4FQHA 1A14H 1CFVH 5JZ7D 3DXAD 4N1HB 4OF8A 4ZPVB 2FEEL 3LHPH 4U6VH 5KS9F 2A6KB 5HYJE 4PD4J 1JGLH 3SDCC 1PQZA 3AREA 5HYEA 1NUFA 3VJ6A 4HUMB 5TDOB 4WTXA 2ZZUT 1BZQK 1I8LC 1RU9H 1IBGH 3O6KL 4HC1L 1T5XA 3QUZD 1KXTB 2X70B 4JY5L 3IDGA 5AEAA 5IHUL 5C0BD 3NH7H 5FO8A 3WFCH 3RJDA 2AXGB 2Y6SC 2FX8L 3NMEA 1IQDB 1X5LA 1AI1L 2ZWLT 1NBVL 3Q5OA 1SJHB 3G5ZA 4Z78A 4F7CA 1YZZA 2AJZB 2FB4L 4WHTA 3U2SB 2XTJC 5IMKB 3ULUL 4BSVA 1VGKB 1P4BH 1FZKB 1UYWH 1WISA 3ARTA 1KIQB 4HF5H 5DQJB 4L8CA 1IE5A 4TSAL 2M2DA 5DT1H 3A67H 1IM9B 2UUDK 4S10A 1HXMB 4OI7A 4MCZB 4K3EH 2W0KA 2XZQL 5EIQA 5HHOA 4I0KA 5FUOL 4QOKD 4ZAKB 1RZJH 4MJ6A 1F4WH 2ERJC 2EC9U 4U1MB 3QEUA 5F1NA 1T66D 3QI9B 3MPCA 4LCCA 1U93B 3ARFA 5HI3D 5K9OB 5C07D 3F7VB 2FWOA 4K2UH 2XG5A 4BH8A 3EDFA 5E2WL 5DFVC 3MA7B 3BESR 5KS9A 1BQLH 1H0DB 1QBAA 1T1ZA 4MNQB 4Q2ZA 1FL3B 4KQ4H 2XY1A 1HI6A 4F58L 3BGMB 3BYYA 1RUKL 1OP9A 3PHQA 5IVXF 3GSUB 4MVBC 5IW1B 4P2QD 2GT9B 2I9TB 2AVGA 5BVJA 4JRYD 1OT2A 3H0TA 4Z7UE 4JO3H 4HW6A 1XF5A 1L9MA 5DGRA 4H25B 3RZCC 5CP3H 1NCDL 5F1IB 1NSNH 4XP4H 1KCVL 4L8BA 1H3PL 3UTZB 3VGFA 4KMLB 4PRHB 2R0ZL 5IEHA 4AMKL 2AW2A 3EDEA 4C59B 2QKIB 1FLRL 3HE7C 3S96A 1IMHC 4JRXB 3TLRA 1BQHA 1IC1A 4U7MA 1WCBA 4NQEE 5F8QC 5AG8A 1P84J 3V4PH 3MUZ1 5FM5O 2OP4L 3NZ8B 3MACH 2ZOKA 1U8LB 1XGTA 4OT1H 4D0DB 1EAPA 2CKBL 3OKNB 2ICES 4XCEA 3MFFB 2WP3T 3BWUC 1MAML 4LSQL 4JFYA 2DQHH 2FECL 3TYGL 5DVLA 5CIPH 2P47B 2XRAL 3ULVE 1G1CA 4KZDL 3ISWA 5EWIH 2XQBL 1ZLWH 2KH2B 1F3JA 3MLTA 3C6LA 5ICXB 1L7IH 3TPKA 4ONOA 4N90E 5A2LH 1R3LA 2PF6A 3TYFA 1LNUA 3UROR 2X6MA 2J5LB 4GRLD 4ZPTA 4K94H 4XBPB 5IVXA 3VW3L 3DECA 2VC2H 4I18A 4S1QH 3L3KB 4F9LC 4K9EL 3SPVB 2VWEE 1U8QA 1YPZB 1P7QB 3IFLH 1N0LA 3TIEB 5ILTH 1J5OL 5DK2A 4JJ5B 2W65A 3DNKA 1QOKA 3DRQB 4ONFL 3QNYA 2ARJA 2EDJA 4E41D 3QCVL 1C08A 3D3VA 3GIVA 4YJZL 4K8RH 1DANU 1A6AB 1MI5D 3GDBA 4ZSOE 2ED7A 3CFDA 2R29H 5CP3A 1IC5L 3MRNA 4RWYL 3MLVH 2NY6C 1I4FA 4LLUA 4NQCD 4YAQB 1OAKH 4BQCA 5DMGD 2VR9A 4K7FB 1U2HA 2C1OA 4OQTL 2QADD 2HH0L 5HVGB 4WDIB 1MHPL 5HD8C 2X40A 5KJRL 3B3IB 1FN4A 2EO1A 5C08B 5DC0A 1IM3A 1CDUA 4K7PL 3HNTH 5FYJD 4Z7VF 4OCXL 3UZQA 2CR6A 2R0WL 1DBBH 5BXFB 1NC2A 4HWBH 4OIBA 5KW9L 2Y06L 2VLJE 2R56H 1DEEA 3H9SB 1GHFH 3S4SG 1AQDB 4H1LH 4X98B 1NEZB 4IRJC 3SKUD 3BDXA 5CIPA 2EKSA 5JOPD 3VFSB 2FX9L 2HT3C 4F15B 2W9DH 4OZ4A 4P57B 3DXAA 1E6JL 4XNMA 4WTWA 3K4AA 5ISZD 5GZND 3CSGA 4RZCA 2X44D 4UQ3A 4XNUH 4QHLB 4NQDE 4M1GH 4E0RA 3LV3A 3KDMA 4HK3N 2YD1A 1X5HA 4DQOL 5HVHB 4XGZB 5HDBE 5FA3A 3U0PA 4HS8L 4HKJB 4GUPB 4MA7H 2ADGB 3QUZA 5EOQH 2NCMA 1NGXB 1MCJA 3NCJL 3IJHB 3FRPG 4JFEB 5C0BA 1ORSA 3FZUC 4DKEH 4EZMA 4ODXB 1AY1L 3DRTB 3GSVA 5DK0B 3WFBH 2E9BA 3ZE0F 4BK5A 1ZLSL 4TUKL 3PQYB 4WU7B 4OCRH 3MODH 1PY4A 3HAEG 2F5BH 1K4DB 4P2OB 4YHIB 5EZJA 5BJTA 3N9GH 3R1GL 4M61A 5DVMA 3F8UB 1I9IL 4KK8D 4KROB 4Z7VA 2R4SH 3KNBA 1S9XA 4CADA 3SBWA 2CD0A 3UDWC 3B9KC 1U3ZA 1CXEA 1S7VA 2Q76A 4U33A 5I15L 1P5VA 3BH8B 5E5MA 3KHOA 1T22A 3O3BB 1HDMA 1BVLA 3STZA 1JNHA 3KYKL 4MB3A 5I2IB 4QOKA 1J8HB 3OJ2C 2FHBA 4JVWA 5GRZA 3RBSA 3U7YL 4F7TB 1FO0H 3EW3B 1N64H 3I9GL 2R39A 2VDOL 4HG4K 5C07A 4BQ8A 4TNWK 3OR6A 5D1XC 1WBXB 3A6CH 1RZFH 3RHWF 5EUOE 3RWIB 1JNNH 4P59H 1FNEB 5D2NA 1FCGA 4KK9C 5FCSH 1S7WA 5T1KB 1MFDH 15C8H 5EU6E 4P2QA 1HH9B 3NPZB 4LEXL 4JRYA 3MJ9H 3T0WA 1U92B 5DJ2B 4L4VB 4KJPD 3VMNA 4P5KB 4GAGL 4NWTH 4RGOL 1ZSDA 3WIHL 4ODVH 1QLFB 5L88L 5HGAB 4PIRF 5CZXD 4PGBA 2X4UA 5IB3A 2CR3A 4QWWD 1BD2E 3MLYL 3FN3A 3O45B 3LKQB 4LGRB 1X6LA 1VHPA 5FGRA 3HB3D 1B0RA 3S34H 5C0DA 2EH8L 5MP6L 3GMPB 4G6AD 4IRZH 4NNYB 5CKGA 1X4ZA 4ZTPL 1M7IB 2BVOA 4C56E 3SKOA 5FYJH 1KG0A 5JQHC 1JI2A 2HG5B 2Q7YA 1P9MA 2YHGA 4CN4A 4Z0XB 2E7LC 4N5EC 2X4QA 3P4MB 4MQ7A 1R5VA 3S98A 4KJWC 2Z93A 3PGCB 2VSCA 1VACB 1ITCA 3NCCB 2YXFA 1JRHH 3U4AA 4MQXD 2FHCA 5CEZD 1KCRL 3DYMA 4NGHL 5HHOE 2HVJA 1FO0A 2EDQA 4DKFH 4Y5VA 3HPJB 4YXHH 4E9LA 3O41B 1IL1A 1KCSL 4GMSH 5T3ZD 4GRLA 1NAML 2EDKA 4G8EB 4LOUD 2VZVA 2APBA 1XCTA 1ZHKA 2VDPH 3DX7A 1QD0A 4LPTA 4FQQB 3WIIL 5EIIB 2VYRE 3LKPA 1DDHA 3EOYG 4KK5C 3G6JB 2N7AA 4ZYKA 2AKRB 3LMJL 4HXAL 2CMRH 1FVCA 1AR2A 2X4OA 1JMZA 2H32B 2HLFD 3GSXB 4E41A 1MHCB 2HJFA 2NY3D 3MJ9A 1ZA3B 4NC2B 1PZUB 4KMTL 2A73B 1MI5A 3S3JA 4JFHE 1YEIH 5FK9A 3QNXA 1IAIH 1EERB 3NTCH 3WL9A 3DMMC 2Z31B 5IMLB 4NQCA 5EOTB 2F53B 4U1LB 3KPOB 1ZGLA 3VRJA 3M45A 1I1CA 3GI8H 5CZVH 3BQUC 5DC9B 2W0FB 3D5OF 3VFPB 5ESVB 1K6QH 5IB2A 4WWKD 4G9FD 3V2AR 1NGPH 1B6DA 1P7KB 3GKWL 2BZDA 3HI5L 1I85A 4M6NL 1MFBH 1ETZA 5HHME 1T6WA 3VXNB 2ICWJ 5HYQA 3CFKB 4R26L 2ZUXA 3D0LB 2XWTB 4PLKD 3TNNB 3LN4A 1JRHI 5KSVB 4IMLA 1XR9B 5CJQL 3RWCB 1IGFH 5EB9A 1FIGH 1KN2H 4OD2B 4HUWB 3EDJA 3OR7B 3T3MF 1RZIA 4LPVA 3FB6A 4JLRA 3O3AA 1AD9B 3SO5A 4PGEB 4LLDB 5LAXA 4EVNA 1OB1B 4L4TB 1AGBA 1NBZB 5K59F 4L3AA 4LSDA 1KFAL 3KPLB 1R3KB 1G7HB 4M8QA 3FRUB 4PJ9C 5AUMA 3OL2A 3TO4B 4N0FA 1OGAB 3EYQC 1OL0A 2FATH 5ISZA 3HZYA 1U6AL 1A7QH 4ZXBD 3IXAA 4PY7A 3ILQD 4XNQB 5FYKL 3F12B 2NW3A 3TCLA 2X4TA 2ZPKL 3CZFA 5IVXE 2J8HA 4XBEL 3VXUD 2G9HB 4OM0L 5J3HD 5KVDH 1QO3B 3MJ7B 3ARDC 5JW5B 4LAQL 1I8IB 2Z8SA 3HR6A 4QNPF 1IAII 5IK3A 4X9BA 4I2XA 2DBLL 1RY7B 2A9NL 4HSQA 1QLRA 3GZKA 4YX2H 3ULUD 1H3TA 1NEUA 2XACC 1F90H 4MCYA 5I1JL 2F8XC 3RUGF 5SWZD 3TC9A 2OJEA 4UV7L 3RVUC 4P23C 3VE0B 4FQ2L 5JXAL 3CPLA 5DEFA 2XQYK 3T2NL 5IM7B 4NZRL 1WBYB 4KU1A 2IG2H 2IPUK 3VFMB 4PJ7F 3CDGA 5BVPL 2K7PA 4AY0A 4DTGL 1BOGB 1ZGLP 4QRPD 3ARGC 1ES0B 2MKWA 1AO7E 1INDH 1YMMD 1BZ7A 3FQXA 5ENWB 3X3FH 4JQIH 2OR8A 4FXGA 2OMNA 4KI5D 5K9QI 2Y36H 4UNUA 5E7BA 4WUUB 1RIVH 3L1OH 5CEZH 3VFTB 3D48R 3EOBA 5IF0B 4X6EA 1WVZA 5T3ZH 4IHOB 1XCQA 1OAQH 3QNZA 4H0HB 4TUJA 2DQCH 4I3SL 3I6KA 1TJIH 1AP2A 3TT3H 2P8MB 5C0CE 2D03H 4KTEL 2D3VA 4NCDA 1TJHL 1DUZB 2FHFA 3Q48A 2DS4A 2IAND 5IBTH 1DJSA 4KK6C 3FQUB 1VKXB 2ORBH 1PGRB 4PB0L 5HHXL 3RUGA 3MRGB 4GQ9H 4XWOC 3QA3A 2DQIL 2XN9D 1FL5B 3SO3C 5A2KH 1NCAH 5FXCH 3UTPE 5SWSD 2B8OT 1WTGT 2WWMD 4HFWA 4JFFB 3HLAB 1U8IB 3F58L 4U1SA 3SDAD 1J1PL 4G42B 4PJ7A 4YHOH 5BZDA 5F3HA 1R0AH 4GMTL 1JHLL 4XTRC 4ZTOH 5F7YC 1JF1A 5GGQL 2Y6SD 2F54D 3FQWB 2A6DB 3OB0H 4EDXA 1ZLWK 2OQJA 2CK0L 3MCLL 1RJLA 5DYOA 2VL4A 1JYNA 2EKJA 2WMPA 3HZVB 3SHSA 3BUTA 3VWKB 5HYSG 4P5MA 5I1AA 4HUVB 2XTJD 2W07A 4LK4A 4XH2B 1I3VA 3MREB 3QDGE 2VUYA 2EXWC 1H15A 4WJ5B 1KACB 3GJEB 1NUNB 3T2PA 3TIDB 4OI9A 4RFEB 1K2DA 1MCRA 5AWNL 3U48A 3QAZB 7FABL 2H2SC 3O6KH 5L8KB 5IR1A 5JIPA 4JY5H 5IHUH 4Q58C 4UBDC 3OKOB 5D9SA 3QBTB 2DM2A 3HCVB 3Q6GL 1DBAL 1KLFA 3VFVB 2FX8H 4CVXA 4FOMA 1WZLA 1CYGA 4HIIB 1AI1H 4P0DA 3UXFA 3L3GB 1NBVH 2ZCKL 4MA3B 3D39B 5D7IB 5I71C 4NPYA 5FKPA 2SEBB 4KVCL 5JPMB 3DV6A 3ULUH 2GHWB 4MVBD 4XT1C 5GGRB 4OD1L 1EEZA 1QVOA 4FQIH 1UH4A 1YEGL 1N7ML 3C5JA 3ALPA 4U4BA 3ULUF 1CDYA 3ZZ1A 1E6OL 3ZE0E 4P4KC 3RZCD 2QHLA 5D5MB 5FUOH 4OJFH 3B2UC 2IAMC 1D6VH 2GAZB 4UT6L 3PHSA 5MEOA 3FQRB 4PBVC 2XY2A 3CIQA 4WWKA 5J12C 4G9FA 3QG7L 4NM8L 1UXSB 4R4BA 1BBJA 1M7XA 3WKNA 3HE7D 2FEEI 3ZDYF 5HDQL 5E2WH 5GGTH 4QT5A 5E6IC 2J8OA 2V5RA 3S3SA 3T2QA 4KUZL 1Z9LA 5JR1H 1IM9D 3BW9B 2ZSVA 4HAFA 1J0JA 4JN2B 43C9A 3QAZC 1ZE3C 3REWB 1X4XA 1LGVA 5I74C 4CVUA 5D96B 3P9LB 2EDNA 2VLKB 3LKSA 5DJ6B 5HBBA 2GJJA 4PJGF 3GHEL 3WIFB 4XXDB 1NCDH 3CFJB 1KCVH 1BREA 2FO1A 5SWQB 1UB6A 2CUMA 3L9RA 3RNKB 1H3PH 1D9KC 1HQRA 4ZXBA 5DF0A 2HTKC 4AMKH 3F65A 1T0MB 5JMRA 1K3ZA 4HUXA 5FO9B 4HEPG 1FLRH 4QRTB 4RNRB 4ZUVB 1AGFB 4MWFB 4R0LC 3VXUA 5I1KL 4ELMB 2QQLL 5I1GH 1UZ8B 5FDWB 2FR4B 2RQ8A 1MREL 2OP4H 5A3ID 2IBZY 4JAMA 3KJ4C 5ICZB 5HGHB 2CDFB 3PL6B 2J6EL 1NGYB 4PJXF 4NN6C 4KWUA 2XA3A 1CD8A 1MLBB 1YNKH 1J12A 4XB7A 5SWZA 2DQFA 4FZ8L 4PRHD 2DB8A 3RWGA 3LRGA 3VXSB 4OTXL 3DVGB 5GGSB 3CLFL 4LSQH 4QHUA 32C2B 5MI0B 2XRAH 4KZDH 4YXKL 3KPRE 3NZHH 2NY6D 2VE6A 3EJJX 4N1CA 4NP4L 1BJMA 1XF1A 4QRPA 2YMXL 3RHWK 5IHBA 4WVRA 1NDMB 1HHHA 1YMMA 5KBNC 4O51A 3VW3H 5HD8D 4K9EH 3UJTL 2AV1A 4LEOB 4HIEA 3FCTA 5FYJE 1CLOL 1J1XH 2ESVD 3ARRA 1IAKB 1HNFA 4ONFH 5C0FA 4PJGA 4DWHA 1ORQB 1JIBA 4UOW0 3LPWA 4JM4L 1WT5C 3MOAL 5BQ7A 4PGDA 4XMKH 4U1NB 5CBAA 3GSQB 5DHYB 4XC1L 5JOPE 1IC5H 5DMIL 4NHUB 2OK0L 2HT3D 1I8KA 4ZUTA 4JG1H 1VDGA 4JKLA 3VGDA 3C5SB 4OQTH 1HNGA 2IANA 2HH0H 3C09C 3FO1B 1NCTA 3D18A 1MHPH 4I9WE 2JCCB 3BZEB 2V17L 4MX7B 2RHEA 1N2RA 1U8MA 4K7PH 2XN9A 5JHDE 1PYWA 2AK1L 1BFOB 2ICCA 3KLSA 3QFJB 5IEKB 4G7VL 1YEDA 5SWSA 2R0WH 3BO8A 2CKBA 3DX9B 4HKBB 5HPMA 3DWTA 1KEGL 1A6TB 1I8LA 1A7BA 3QEQE 3SDAA 3CNKA 5C9JA 5IJVA 5KW9H 1V3KA 2Y06H 3I02B 3VFOA 5BS0E 5J0BA 5LBSL 2NY4B 5EO1B 2VZUA 2MKLC 1I1AB 4MD5B 5I1LA 2FX9H 1IC7H 2F54A 4XX1G 1CF8H 4HKXA 5C08D 3REVB 3TFKC 3VD9A 3I75B 2A83B 4HAGA 4HULB 4I0PB 1E6JH 3FOMB 1L6ZA 3ILPA 2VR4A 5HGDA 3S8WA 1FCCA 4LSUH 1D5BB 5IUSA 5KSBF 4LSVH 1QSEB 4YNYB 3H9SD 3B9KD 4M02A 1JPST 2GIYA 5B8CC 2E8ZA 5JORA 3MV8D 3EFFA 3U83A 4DQOH 3T3ME 3SE4C 1UA6L 3HMWL 4OLUL 3GRWL 3SDDC 1PD6A 4UIKL 1OAYL 1VENA 1DQDL 1GGTA 3QRGL 4LCUB 1XR8A 4TUKH 1DEDA 3GSRB 5FGBA 1BZ9B 4KK9D 5CHNB 5DJXA 4GRMA 4I4WB 1I9IH 4OQTA 2V5SA 1GIGL 3JUZA 4OLXL 5C2BL 2CJUL 3O3DB 3VG9B 4QNPE 4JFED 3BIBX 4X9GA 1RPQA 3RUGE 3PQYD 3X13A 4IJ3B 3RZCA 4HUKB 3KYKH 1Y0LA 5F72S 1X6NA 4GG6B 3U7YH 1JZ8A 1NAKL 1SJHA 4XI5C 4OUOA 2C3XA 2Q6WB 2M26A 1F58L 4JFOA 4G80B 3I9GH 2VLLB 4PJ7E 2VDOH 3HE7A 3KWWB 1JE6A 1U8PB 4C4KO 1VGKA 2R2HB 1FZKA 1SEQL 1KIQA 3EYVA 3QRFM 3RGHA 5KSBA 4NZJA 4Y19D 1NGZB 1GOGA 5F88A 4PJDE 1IM9A 5I1IH 2N4IA 4YPJA 3NABL 4ELKA 3SDXB 1H5BC 5GISL 4P9HH 2ITDB 4RA0C 5DJAA 5K33A 5JTWA 1J8HD 4QHMB 3FO9B 3BFOA 4N5ED 5FYKD 2OS7A 1U93A 2LVCA 4KJWD 2VL5B 5K9OA 1S5HA 3F7VA 4CVZA 2L7JA 5F9OL 4TOYL 3PV7A 4GAGH 2L7UA 3IXTA 3X3GL 1UKSA 3WIHH 2HFGL 1FNHA 5T1KD 5L88H 4G8IB 4NFBA 2NY2C 4LLVA 1N4XL 3CXDL 3ETBF 1ADQH 1I3RB 4F80A 2APTA 3GSUA 4MJ5B 5DHVB 5J1AB 4HJGB 1DBKL 2GT9A 2A9ML 2CIIB 1A6WL 3MLYH 1FFNB 2I9TA 1WJ3A 1WCQA 2YUWA 2BVEA 2EH8H 5MP6H 4OZFB 4F9LA 2X4SA 1CT8B 5ADPL 4L4VD 5E08L 5I18L 1OLZA 4H25A 4BH7A 4YEFA 5KN5A 4LGPB 4KK5D 4OZHE 3MRLB 1A2YB 3BYTA 5E03A 1Z9MA 2LV4A 3UTZA 4JANB 4PRHA 4QO1A 3EO9L 2QKIA 1JHTB 4M4PA 1SBSL 1A0QL 2VXVL 1DQJA 4NKOB 3IB4A 4MJ4A 3BVNA 3LS4L 3NZ8A 5IFJA 4NGHH 4HS3B 4G6FB 5KG9B 3RY4A 4D0DA 1KCSH 2QJDA 4D9LL 3OKNA 3TBWB 5I1CL 3T0EC 4G9FE 1F97A 3LKRB 4HUNB 4UIMB 2DN7A 2D7MA 2GTWA 1CK0L 4IBLT 4FTVB 3LIZL 4JGJA 2ESVA 4WHYG 3LMJH 4A6YL 1V3MA 5DR5L 4AENB 2A1WL 2GKIA 2RFXA 2XT1B 3O2VL 5ICXA 3VGAB 5T3XL 5INDA 4LASL 2X9XA 4YBLB 3WS6C 4MZ3A 2FJFB 4KMTH 5TDPB 1TQBC 1DP0A 4R7NA 2BRQA 4WO4B 3SPVA 4AJ0A 3RU8H 5CP7B 3WIHA 3TIEA 1YEKL 1MH5A 2PYFB 1Y6MR 4UT7L 5CEXA 3MV01 1ADQA 2OL3L 3QQ9C 4PJ9D 4GW4B 1YEFL 1Z9OA 4ZOAA 4ODUA 5FV2A 3W9DA 1RK0A 4ZMAT 12E8L 2EIZA 1A6AA 1LMKA 4NRXA 4I5BB 5SX5H 4N1EA 4R26H 3X14B 3ARDD 5DJ0A 2F53D 3KYAA 4HK0A 5JLZB 1NCBH 1HKLL 4K7FA 3TO2A 2DJUA 3WFDL 2IBBA 3ULUE 4IS6B 4F57L 1MCPL 2B20A 5SWZE 3HA0A 3B6SA 4WDIA 5AZEL 5EDXA 3ZYZA 5FA4B 3DIFA 1IEBA 3EZJB 4LSSL 4HX1B 5C08A 4P23D 3RVUD 4E42B 5I66A 1GGUA 5GSRB 5IB4B 1KFAH 3UPRB 1I1YB 3UYOD 4Z7OE 5L2KB 2J2ZA 1KJ2B 3IDNB 5EOCL 2Y5TA 5BXFA 1U6AH 5K9JL 4ZQKB 4U0RB 2DI8A 3U9UA 3ARGD 3UDWA 2BNUA 3H9SA 3HG1B 3B9KA 1OM3H 5FYKH 4X98A 3LQAH 2ZPKH 4UNVA 1NEZA 4XBEH 3TT1L 4OM0H 5D93B 3VFSA 3MV8A 3MGTA 1E28A 3SGDH 3K3QA 3LD8B 4LAQH 2UVEA 4WV1B 1U8OB 3E1F1 3V8OA 2DBLH 3LQZB 2A9NH 4G43B 3TO4D 5H94B 3Q3GB 4PJGE 3LN9A 2BVYA 4RDQF 5F7UA 1RJZB 4PJ8B 5I1JH 4X8JB 4PJCB 3SQOL 4KUCD 4UV7H 5FO7B 1SMAA 4FQ2H 3PWJA 5ESAB 2IQ9H 2P5EB 3P0VH 4NZRH 3FT2A 1NCCL 3OKMB 3WE6B 1HCVA 2ZUVA 1T5WA 2DD8L 4HKJA 5BVPH 2ADGA 3QXDB 1P69B 4AL8L 4JFEA 2VISA 1CU4L 5D1QC 3ZKXC 2DRUA 4PJXE 5I16B 1ZGLM 1ZANH 2E9IA 4OV5B 5DK0A 3OGCA 1EHAA 3L3IB 3PQYA 1QYGH 4WU7A 1F2XK 3U7AA 4R97B 1M4KA 2QEJA 4XWOD 1XFPA 1V7ML 1MJ8L 3OAUH 2A74A 5F7MC 1CICB 4ODBD 3L5XL 1AGEA 1CDHA 3GMQB 2DQGL 4DVRL 3HNVH 3MR9A 2NTSP 4AT6A 4M43H 4Y19A 4GXVL 4XTRD 4QGTA 5E8OA 5A2JH 4U3HA 3G04B 2DL2A 3M17B 3PHOB 1SVCP 4HQQL 1F11A 4KTEH 4Y1AE 3SGDI 2QSQA 1J8HA 2V7HB 5KOVC 3IKKA 1LWRA 4HGKC 2E7LA 4F7TA 2AJ3B 1WF5A 1NBYB 2H6PA 3RWFB 2CO7B 3G6DL 3FO2B 4FTVE 5ETUB 4ZUUA 1PG7W 3NFNB 3HNSL 4PB0H 4QRQB 5HHXH 1WQVT 3RWIA 2DQIH 2EXWD 4ETQA 1FNEA 2B5IC 5T1KA 4R2GB 3GSWB 3JTTB 4ZD3H 3I6LD 3NFPB 3F58H 1RHHB 1CXIA 3EAKA 3NCBB 1UH3A 4LHUB 4E5XB 1NFDF 1T7VA 2WWKT 1S3KL 5IW6A 2VN4A 5DD6A 3G6JF 4DN4H 1U92A 5L6YL 1QBML 5DJ2A 4OM1L 4L4VA 5GGQH 3WNPA 4P5KA 1YDPA 3PXHA 4YBQD 3MRIB 2EDTA 3LN5A 5DSCB 2CK0H 3MCLH 2NMSA 1VGEL 2VRAA 1CICC 3P4LA 4O58L 1BF2A 5HGAA 1T1YA 3AAZA 4HDIA 4JFFD 5HVFB 2KL6A 1MCCA 3CH1A 3F6IA 5BW7C 5A43C 4LQ1A 3BPOB 3O45A 2YOCA 4DGVL 1QPXA 5IMOB 4RMQA 3LDBB 1L0YA 2PW1A 4RA3A 4V2BA 2H8PB 3JZ7A 4HWZA 5IW3A 3P9MB 5AWNH 4P4KD 3P4OB 4HLJA 4YHLL 3SY0A 4H20L 3P4MA 2XWJB 3O11B 4IRSC 3KJ6L 3PGCA 3FHAA 3UP1A 2QV2A 3WNMA 5KSBE 5D1ZB 4X5XB 3SE8L 1NGQL 5E6ID 3WJJC 4JB9L 1WWCA 3PWVB 4JG0L 2WBJC 2FLRT 3H7BB 3I3BA 1TETL 3TBYA 3HZKB 3HPJA 3LEYL 4KVCH 3B8SA 4RAVB 2X42A 4J4PD 1BP3B 4OD1H 1YEGH 1N7MH 3STLA 3HMXL 1R24B 1NFDA 2B39A 3C5ZB 2J88L 4XPBH 3UJJL 5EIIA 4ODSL 1E6OH 4AM0A 3OHXB 3LB6C 5GGUA 3G6JA 2VH5H 5GIRB 4PJ9A 4KUCF 4G6JL 3MC0A 3D39D 3MTRA 1EO5A 1T3FB 2UWEE 1MHCA 5SV3A 1D9KD 2HTKD 1ZA3A 2W59A 4NM8H 1ZMYA 2C7UB 3QULB 4UDTB 3U6RB 1FYTB 1H8SA 4PRPB 1B4RA 1QFWI 1DLHB 4W6XB 1CCZA 5IMLA 3RTQB 1SHMA 4M5YL 3ARDA 2F53A 3KPOA 3VRLF 4ISVB 3NA4A 4LPYA 1MCFA 1OARL 3VDAA 2B4CL 4OFDA 2NY7H 5KANI 1JV5B 3U82B 1JGUL 1WIUA 2B2XL 2O5YL 3MRPA 4P23A 4BZ1H 3CJJA 3GHEH 3VXNA 3CFKA 4LIQL 2X7LB 3CLEH 1JFQL 4N0CC 1HHKA 3HUJE 3TNNA 4DUVA 1QSFB 4DFIA 4IIQB 4XHJC 5DJ8B 3M07A 1NCUA 5KSVA 1XR9A 3ARGA 4S2SB 4YK4C 3BKCL 4D0BB 4P46B 4HUWA 1GOFA 1TTGA 4AIOA 5I1DB 5I1KH 2QQLH 1EEYB 4JDZB 1OTUC 3GMOA 2VLKD 1M71A 3FO0L 2VLRE 4LLDA 4OLEA 5TH2A 4PGEA 1NBZA 1ZLUH 3RA7L 1MREH 3KPQB 2ESVE 3KPLA 1MCWM 4PRNA 1I8MB 1G7HA 3CCHB 3TO4A 3IRPX 2J6EH 2Y9RT 3MRBA 2VTFA 4FZ8H 5TE4L 1G7IB 4QF1A 3K2UL 4EJ1C 1ZS8B 4XNQA 4OTXH 4ZO9A 3CLFH 1R3IL 3VFGL 3BP4A 3S36X 5DRZB 1BFVH 4O02L 3FT4B 4TSCL 1QO3A 2IEPA 4PYGA 2R9HC