4KROD

Nanobody/vhh domain ega1 in complex with the extracellular region of egfr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
213
Chain Sequence
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epidermal growth factor receptor
publication title Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
total genus 36
structure length 213
sequence length 218
ec nomenclature
pdb deposition date 2013-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kroD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kroD01
3GHBH 5C0FB 1CG9B 4ELMF 3VGAC 4KMLB 2F5AH 3QI9A 3RIAF 4G9FA 2YN3A 5E5MB 1OB1A 4WFED 5ICYB 2WUCH 3QR2A 4JN1H 2XZAH 4ZNEA 3MRMB 5AAMA 3HZKB 1DN0A 4U2ZA 4DTGL 4NOBA 1KBGH 2PYEA 3G08B 2YD3A 1A1MB 2CJUH 5L2JB 5C0AD 3L95B 2WBJD 1VDGA 5EUOE 1EHLL 1J0JA 4C56E 4ZSOE 4EI6B 4JFYA 4OFYA 2EKSB 4XZUA 5FGSA 4QRRA 2NY7H 3D3VA 2YUVA 1RZGB 5A2IH 5LVEA 4OZ4A 1OGAD 4IJ3B 4M1DH 2R23B 2BX5A 3HMWL 4G80B 3FO1A 1KIPA 4ZOAA 2IALA 1O5DT 1Q94A 5BOZG 4D0BB 4Q97A 1CE1H 4P3CL 2P5WB 5FYJL 3DV4A 3SE4C 1I9RH 1J05B 2PCPA 3D9AH 2Q86A 1CU4H 4YNYA 4MAYC 2PO6D 5DK0A 5JOFB 3D85B 5HDQL 4OLYH 2EXWC 2V17H 3VWKC 1MFAH 5E2JA 5MERB 4Q58C 3UTTE 2UY7A 2XTLA 1FE8L 3O6FD 3MV9E 4Z7NE 4DOHB 1N6VA 4M9PA 5AWNL 5EUKB 3O8XB 5F3BA 2CK0L 4I4WB 2JJTA 35C8H 3HI1A 2IH3A 1T5WA 2XTJD 2QL1A 4EJ1C 1MF2L 4HLZG 1UXSB 3ZKMD 2J3SA 3ZT7A 4QT5A 2VDLL 5FGCE 1ZS8A 4GRMB 4CAGA 2CR6A 3VXSE 4H26B 5AG9A 3QCUH 4B7IA 2A0LC 4LSVL 1JF1B 4X7FC 1FGVH 1WSST 1A2YB 1BFVL 2E8YA 2DYPB 3QT2A 1AD9B 4U1HB 1JPSH 4KROD 3PNWB 3G6DH 4R9HA 4X6DF 1YEEH 5KVGL 1YUHB 2DQFA 2ATPB 3L3KA 3LIZL 2W60A 3ARFC 4K71C 1A4JB 2AV7A 3OJ2C 5ISZB 5J6GA 1JMZA 2V2XB 2PF6A 5I2IA 3REWB 4NQXB 4PB0H 2IPKA 5JW4M 1DQMH 2Z8WC 4JO2H 5IBUG 1RZIA 3WHXB 1NGYA 3KYNA 1A14L 5FYLH 2DD8H 3CMOH 3WCYA 1ZGLP 2MQCA 3F58H 1V7NH 1E27B 1FV1A 1H8SA 4QO1A 4Z7UB 1F4WH 2D3VA 3B6SA 2GCYA 4QRQB 2X6MA 4LSRL 4ZTPL 1VB9A 4XVUC 1N6QH 4JRYB 1RUQH 1BX2B 3SJVD 4RAHA 3REVA 3MFGB 3FQRB 2D0HA 1KNOA 2NW3B 3M17A 4GAYB 3QWOB 4KVCH 2IADB 4XC3L 1CGYA 1Q38A 2OJEB 1XIWC 1HINL 5KSUA 2EIDA 4G3YH 4J3SA 5KSBE 5MEOB 1QLFA 1TJGL 4KJYB 3KS0H 2OSLA 2YD4A 4QTIH 2W65B 1D6VH 1FC2D 4J6RL 4JM2D 5SV4A 1KCSH 2OMBA 3EYVA 5TDPA 2ZCHH 2E9BA 5ALCL 4NZDA 2DQEL 5F89B 3GJFK 2XKSA 5CCKL 1E4JA 3UTPE 5J06A 4LSQH 4Z5RA 4AEHH 3OKMA 3MRQA 1T0MB 3QIBD 1E6OL 3Q5YA 4H0IA 2M2DA 2ZUUA 3U2SA 5J56B 2H26B 5GSRB 4PJEE 3NFSH 1LO3H 3MRPA 1NFIB 3B9EA 3ETBF 3KPSA 3B9VA 3V4VH 3BH9B 4L3ED 1JL8A 5KSVA 5F70A 4XXCC 4N9GB 1EXUB 3OAUL 2BNUB 2VC2L 5GQBA 5I6XC 2AJXH 4X7CC 1VGEL 3GI9L 2GJ6A 3R06B 4HUNB 2ZG3A 3TZVA 4YJZL 3GSOA 5D71H 1EEYA 2A6JA 5DRZB 4DAGH 3DV6A 3FB5B 5EOCJ 4HV8A 1GCFA 1QPPA 3TBYB 5CGYC 2FWOA 3BPOC 4JZJB 3AM8A 5F9DC 3O11A 3SOBL 4F3FA 3GRWA 4OZHA 5HHNA 3O4OB 5EU7E 3CFCH 3GMNB 1G9MH 3QFJA 4DWHA 5TE6L 3RI5F 1F6AA 4ZPTA 1FO0L 4HJ0C 3ZE1E 2XFXA 2YXFA 4R2GC 4WFEE 2J5LB 1TNMA 3RWJA 4I3RH 4I0PB 2OR9L 1WWBX 2UV3A 4LNRA 4PJAB 3IDNB 1JZ5A 5IB3B 4OCMC 3EYQD 3HNTL 1SYSA 5HYJB 1MHCB 1HZHL 4YFLI 4PIRF 1NKRA 1R0AL 4PP2B 4PRDA 3TH4T 3LH2H 1U36A 3UBXB 1I7UB 4PLKC 2ICWJ 3BD4A 4ODUB 5C07E 4FZEL 3S5LG 3MRLB 3BHBA 4TSCH 4ZXBA 2R4SH 5IW6B 3IDJA 3NCEB 5C0JA 3T77B 3TM6A 2EXYD 1FL3A 4OIIH 5HYSG 3D85D 3MLTB 4GQ9L 1LHZA 1IAIM 4U1JA 5HHVH 4JVPA 5KVFL 1RHFA 3DYOA 1Q0XH 4U4BA 1FAIH 4HIJA 1I3VA 4GKSA 1IM3A 4R96A 3OWEA 3TN0C 1NCBL 2GUOB 2VUYA 5IEKB 4U6HB 2QQKH 1MCPL 4MWFA 3QIUB 1GHFH 2HN7B 3QFDB 5F7EL 3FO9B 4EDXB 2XTJE 2ZCLL 3EDEA 2P8MA 3KPRD 4U31A 2XZZA 3FJTA 1AQDA 4RMTA 4Y16C 3CFJA 2FLBT 1CFNA 4S1DD 3FQTB 4HCRH 2D9QB 5FYLD 4M7LT 4NQDE 3WHE0 4LOUD 2ZWLT 3FFCA 5D7JA 2DYPD 1GL4B 3BKYH 3IFLL 3QNZB 1OARL 4JG0H 4ZO6A 1YYLH 3ARVA 5EU4B 4KKBC 1NEUA 2BSRB 1ZGLB 2KQNA 3FN9A 4WV1B 1A64A 5ISZD 1IGJA 3C5JA 1DBMH 3RWFB 3GK8H 1EBAA 3QAZB 5F1KC 3FOMA 4WRLA 4B7LA 5LGHL 4NO5A 3BZEB 3DHMA 4DVRH 2VLRB 2AJ3B 3S34L 4PGDA 1BOGA 3EGSA 3CSPA 4L4VA 3AU1A 5DFWH 1U8QA 4M62L 1MFEL 2EC9T 5L9DL 1GGIH 2XQYG 3QDGE 3RWDB 5BS0B 2AS5M 1U2CA 2EIBA 4XMKL 5EFIA 4JRYD 4YC2B 1U92A 4KI5F 2KPNA 4OF6A 4YO0B 5LWYH 4UNTA 4YBQC 2HVJA 2F54A 3SJVE 3L5XH 1UVQB 5SX5H 2VDRL 4PRHB 5CGMA 1S9YB 5JUEH 1IM9B 1FBIH 5BMFH 1T1WA 4O2FB 4QRUA 1JNJA 2XV6B 4G43A 5DFVC 4FQHA 1G9NC 2D7PA 5ALBH 1MCIA 5HDOA 5KJRH 2Z92B 4JO1L 2QQNH 1PY9A 1Q72L 1WITA 2VDMH 4OFIA 4ISVB 3I02A 4EBQH 1L0XA 1VSCA 3OXSA 5KZCB 3BOVA 2Z31D 2PTUA 2R69H 1EFXD 1ZLSH 4E5XA 4F58H 1I3RB 3EDDA 3IDUA 4DVBA 1Z3GH 1KB5B 3C09C 1NGXB 5A16B 1T6WA 2LFGA 4G6JL 1P1ZA 1XAUA 4IRJC 5E2TL 4LCIL 4OM1H 5MEQB 2JB6A 3SCMA 2UUDK 5LAXB 3IJYB 3LQZB 3IJHB 5KVEL 3X3FL 4U6VL 4LLQB 3FB7A 4TULH 2CPCA 1L0QA 4U1GC 1KG0A 1QR4A 3VMPA 4ZFOL 1H3WM 1EZVX 2C3VA 3RVWD 4BH8A 4OCWH 1R3LA 2RIKA 3WD5L 3M8OH 3O4LE 4XX1E 2Q8BL 4JO4H 1TVDA 4Z95L 3TNMB 3ZSTA 4KK9D 3RNQA 3U9PH 2HJKA 3ROLB 1CXEA 1RHHB 2BNQB 2CO7B 3DVGB 3ES6B 3Q6GH 2D7QA 5EBLB 2X9WA 3ARDC 4WHYG 5HGDA 4PJIF 4YE4H 1CQYA 4XCFH 2R4RL 4EDWL 3ME0A 5C0EA 4RDQF 1WJ3A 4HPOH 3SGJA 1IKFH 3R0NA 3HE7C 4I0PD 1GOFA 5DRNB 3D18A 1WWAX 5BJTA 4KKAD 4R97B 5HYJD 5E00A 3VW3H 1JYNA 2BVOA 1F42A 5C0GB 1DQJB 1S7VA 3BT2L 1JWSB 3U1SL 1UM6L 3VFRB 5C0CB 4WDIB 4YXHL 5DVNA 1DR9A 1N7ML 4BELD 1BFOB 2CR3A 4R6UA 4PGJA 5L8LB 4TNWK 4OCSL 2P5WE 3KLAB 5MENA 2DQTH 3RA7H 3T1FA 1NDGB 3C6LB 3O9WB 5JXAL 4Q9QL 1L7IH 4NJAL 5CJBA 3MNVA 3OXRA 3O6KL 1EEQA 4IS6A 1KLUB 4KMQA 3KNBA 2NY6C 5BW7C 4P23C 3ARBC 4TSBL 2IBZY 2ICWA 4DOHE 3N9GL 3OJVC 2X4PA 2NY5H 4LEXH 3QIUD 1BF8A 3PQYA 2X4RB 3HUJE 5F3HA 4G9FB 1WCBB 4M1GL 4ZFZB 1OB1B 1UWGL 4KGLA 4OCYL 4JFDA 1HXMA 1DN0B 2VITA 3PDGA 2PYEB 2VISA 1SY6L 5DEZA 1EJOH 5FYLE 2XQYK 1G9NL 3KR3L 4B41A 1YNLH 4IDJL 1FZKB 4JFYB 4KRPC 1PFCA 1MFBH 1YQVH 3T0AA 4CU7A 1WWCA 4XZUB 4QRRB 3RTQA 3HNSH 2VLKE 3D3VB 1CIDA 3KPPA 3S37X 4OZ4B 2IPUG 1T0NA 3GSQA 4XWOD 2Y06H 4UILH 1AR1C 2VLRD 3B8YA 5DWUL 2XA8L 4XPGH 2PCPB 3MLZL 2Q86B 4POZC 1Y0LB 4NP4L 1HIML 3LHPH 2EEAA 3ARWA 3CXHK 3QDHA 5F7WC 1N3NA 5GGQL 5I76A 5BS0D 5B21A 3VFSA 5F3BB 4GLRI 5EZIH 3MODL 2IH3B 4JRYE 1S7WB 1T5WB 4PGZA 1AXTL 1U8MA 3G5XA 5IGXL 1OT2A 2DS4A 1X6NA 5IMKA 1CZ8H 1IM9D 3RI5K 3QUXC 1FGNL 5EORL 4QT5B 1RZJH 5C6WH 5C0ND 5GGSB 3T2QA 1IRAY 1ZS8B 3Q6FA 1MRCL 1GZPB 3INUH 1PLGH 3DVFA 1IEAB 2R8SL 4ODVL 1CFTA 1M6OB 4YZFF 1B90A 4IOIA 1MCKA 1DCLA 4RGMC 2AK4A 2DQFB 2YMXH 4H1LG 4R26L 4KK8D 4WU7A 1IAOA 1FORL 2W60B 2Y36H 3FB6A 2AV7B 2E6QA 5J6GB 2E6PA 5JOPD 3WFCH 4XPHL 5GS2D 1C5CH 1VHPA 1JNLL 5I2IB 2IPKB 2HT2C 3S4SG 3W5MA 1RZIB 1C1EH 2EIEA 5CD3A 4MQTB 3KYNB 4HFWA 5FKPB 2KQMA 5KVDH 3NN8A 3JWDL 1FV1B 1S9WA 5IFAL 1D5XA 3NCJL 1VFUA 1BM3H 3OAYK 1GGCL 3B6SB 1CI5A 2GCYB 1TZIA 4KHTH 4UV4L 1QBAA 1T2QH 2Q76A 1XMWA 4PJFE 1CWVA 2BNQD 2CMRH 3REVB 1OT1A 3C2AL 5D2NE 5FCUH 1KNOB 4LGRB 3OAZK 3O45A 1ZLWH 3OX8A 1BWMA 4L9LC 4D9LH 2VDOL 3M17B 4GFTB 1HCFX 2P44B 3C5SA 2P5EA 4X6CA 5KSUB 1WF5A 5JLZA 5A3ID 3FT2A 2OSLB 1NGQH 5HGAA 1TITA 5B3NA 4F7TB 1ZEAH 5TDPB 3BH8A 4R3SA 5C8JB 4OKDA 2X7LA 3CH1A 4PJAE 5ITFA 1KSRA 4LPYA 4MNQD 4Z5RB 3SDXA 5HYJE 3OKMB 3MRQB 2KBGA 4NIKB 5CUSH 4HC1L 1AXIB 5ABDE 5HHQB 1T89C 3U2SB 5C0CD 5HYEA 5IB2A 1I1RA 2EDQA 3KPSB 1F2QA 1X44A 2EIZB 2NY4B 3CFBB 4PJ7F 5KSVB 2EDXA 1KJMB 2WUBH 3QNXA 3UTSD 4AYFA 1DTUA 5AG8A 2GJ6B 3TZVB 3H9SA 5T3ZH 3SO5A 3O9WD 3GSOB 3LKPA 4JY6B 1EEYB 4Z7VF 2A6JB 1PY4A 1ED3B 5LCVH 1R3IH 3KJ4B 2X9XA 5FUCE 1RVFH 4JHZA 1D5MA 5TDNA 4DEPC 2FX9H 2FWOB 2EZ0C 1UJ3C 3O11B 4MXQC 4F3FB 3SQBA 3LEVL 2M8XA 2IPUK 4OZHB 4WW2C 5HHNB 4G9FD 1ES0B 1KEGL 1F6AB 1A3LL 2XFXB 3BSZL 4DUVA 2PYED 3RWJB 2FO1A 3HFMH 5E2VL 3EBAA 5DUMH 5H2BA 4M43H 1I1AC 3RVVD 4LNRB 3RDTA 1NSNH 5CS7A 3W11D 1KLFA 1SYSB 3CX5K 4G8GE 5F6HI 2XZCL 4PRDB 4QRRD 3GRWH 1OY3B 4RQQA 3C5ZB 3BHBB 5HPOA 4ZXBB 1MJJB 1JHTB 3W0WE 5DHYA 3VFVA 2OM5A 5C0JB 3MXVL 1A7OH 5GXBB 5D96C 4ZUWA 2BSED 1FL3B 5EU7C 3DMMD 4HDIA 3NCBB 4U1JB 1P6AB 2E8ZA 4EN3C 4XTRD 1YEGL 4KK5D 5CD5C 1OAKL 4HIJB 3KAAA 4X9FA 3VWJA 4R96B 1IM3B 5ESQA 4MJID 1Z9MA 4RISH 5LKNA 1T6VN 5BS0E 1JHKL 4F80A 1PSKH 3DUUB 1IJ9A 4HT1L 1IGMH 3LCYA 4MWFB 5CKGA 4YGVB 2B0SH 1MIEL 2P8MB 2H1PL 1AQDB 1FNFA 3CFJB 4PJHF 4PRHE 1CFNB 1OP9A 3PWNA 3TLRA 3WFZA 4LHUB 4UTBL 1ZANH 2J8HA 1DVFA 3ALWA 1NC2A 5D72L 3ZKQD 1IC7L 1V3JA 3FFCB 3ARTA 5D7JB 4HQQH 5DK2A 4TRPL 2NY1B 3ZYZA 4OGAD 2VKWA 3MOBH 4P2QA 4H8WL 4L4TA 2B2XL 1SBSH 5DVOA 4KKLC 1CDCA 1IGJB 3C5JB 3QDJE 5K9JH 2NXYB 3FOMB 3I9GL 2ADJB 2X10A 5I1JH 4WGVB 2GY5A 1QQDB 4PGDB 1BOGB 3EGSB 1MVUA 4UIKH 3R8QA 2VLJD 4OCRL 4ZOCA 3V8OA 2DLEA 3AU1B 3DPBA 1U8QB 5HHMB 5CHNA 2XTJC 2BVYA 4D9QD 3CX2A 3X13A 1MJ8H 2HLAA 4ONGH 3TIEA 1MPAH 1NBYB 4RWHA 5EFIB 1U92B 5EOQL 3RX8A 5FB8A 1H3PH 1LK3L 3H7LA 2Y5TB 3TBTA 1A6UH 3V6OA 4CKVX 4Q9BA 2BNQE 3L5HA 4P2RA 2VDNL 4HZLB 5E7FA 2B4CH 3T2NL 4M5YH 4YHYB 3ZKXB 1T1WB 3B3IA 4YQXH 5IIEA 1D9KA 4G43B 4FQHB 4C54A 4I18B 1J8KA 1RULL 3RJQB 2FB4H 3K4DA 4L5FL 4NDMA 3V5HA 4NUGH 1T03L 5B38A 5IVXA 1CT8A 4Y19A 1FN4A 4KU1A 5T3ZD 3OXSB 1CGVA 4PJ9A 1MVFA 2FBOJ 1QSZA 3LKSB 4E5XB 1P7HL 4DVBB 1GRWA 4UZGA 1J88A 2D4DA 4UDTA 4LLMA 2OR8A 1LEGA 2NW2B 5E8DL 4WFHD 2JB6B 1YDPB 4PJXB 3SCMB 4AEEA 1CD1A 4HH8A 1KOAA 3KPSD 4MD5B 3FB7B 2NY4D 4TTDC 5BRZA 5C0CE 4CU8A 2C3VB 2RAMA 4BH8B 1R3LB 4LPWA 1DL7H 2GJ6D 3TZVD 2VYRE 3LDBC 3MV8A 1INEH 1BAFH 1ZVHA 2CKNA 4GRLC 4NQCE 1RUPH 2O5ZH 5IT2L 2DQDH 3RNQB 4QKXB 1V7ML 2ADIA 4RNRB 5F1SA 2HJKB 5AD0A 3HZYA 4A2MA 5CJOH 1BQLH 1BJ1H 3IDXH 5HGDB 4WI3A 3L3JA 5L2KD 3FQXA 3OR6A 2Y72A 4NC2B 4J4PD 2AGJL 4G5ZH 4G7VH 2C4XA 5F9WB 4RX4D 1H8NA 3I6KA 2EO9A 4G9FE 2DTMH 1BIIA 4JDZA 4PYHA 2EYTA 1URLA 3SE3C 3CIQA 1IE5A 4ZNEE 3D18B 4R90L 1HEZA 2PYEE 3IVKB 3P11L 3D87B 3CVHL 5BJTB 3W2DL 1CFBA 3PGCA 3UBXG 5E00B 2FH8A 1CICA 3BE1H 2EDYA 5T1KA 1S7VB 5ACLA 3TYGL 3KWWA 4HAGA 4P9HH 4OZIF 4QRRE 5E4IA 3C5ZD 3D3VE 3P0YL 4UV7L 4ZXBD 2QLVB 4R8WL 2HT3C 4YXKH 1QYGH 1EDQA 1PG7H 3MJ9A 4OLUL 3D39A 5DK3A 2QQLH 4MD0A 3T1FB 1WISA 4TVPE 3BFOA 5EOCH 4QHMB 3THML 3RZCA 3OXRB 4O02L 2DIJA 2FX7H 3QEUB 4FQCH 4IS6B 1HDMA 3KNBB 3NACH 2VAAA 3D69A 3C9NA 4PJ5B 1T66D 5DHVA 4P3DA 5ANMB 4G6KH 4K94L 5I19H 2X4PB 3HTLX 3B5TA 2DQGH 4GMSH 3PQYB 1EJ6A 5FYKL 4MDIA 4JJ5A 1KCRH 5C9KA 2MOVA 3MJ6A 1RZ7L 4WIQA 3MXWH 4JFDB 4LHUD 1MCRA 3TBWA 3FO0H 1MCQA 4LSTH 2YK1H 4IJ3C 2DBJA 4FN0A 4XXDA 4P46A 3RGVC 2NY1D 1VADB 5D1XA 1JPFA 3TWCH 1QFWI 2J6EL 1ZA3A 3PWUB 2EXYC 2IWGA 4FP8H 4OV6F 3RTQB 3RZWA 3KPPB 1G6VK 2NYYD 4OIAA 1BF2A 3GSQB 5TE4H 3OKNA 4DKEL 3OZ9H 2BHUA 3QCVH 2IG2H 4X5LA 4OGYH 4NQUA 4EEEA 3O8XC 1K9TA 4U1LA 5HHMD 3KXFA 4G7YL 1JV5B 1CXKA 2JELL 1EZVY 1N3NB 3D25A 1JUFA 1RK1A 1N26A 3I3EA 1AI1L 1S3KL 4GBXD 4HJGA 5J4MA 4L8SA 1CN4A 5I1GL 1YEFL 3QEQA 3TO4A 4JCLA 5H37H 3DRTA 3K80A 1PG7X 1U8MB 2HTKD 5HI3D 3SO3B 5FOBB 3G5XB 4NKOA 1ZOXA 4PV9A 5EWIL 5F7UA 2I9LA 4YHKH 3V4UH 4KMTH 3W81A 3PP4H 2EC9U 4WFGE 2JLLA 3Q6FB 3IDYB 4JFFA 1MRDL 2I24N 2UWEA 1DBBL 4U1IA 5JMOC 4XB8A 1MREL 1CFTB 2VN4A 3QHZL 4G9DB 1QHPA 4IOIB 5T3ZE 3GHBL 5DUPL 4I2XA 3K74B 4WU7B 2F5AL 3B9AA 1NAKH 3A6OA 3M45A 1YA5A 3FB6B 2VL4A 1KUMA 3T4YA 2WUCL 4ZDHA 5TJWK 4WFHE 4XNZB 5I17A 1MWAA 2FBJH 4ZNCD 4ONHB 3EFDH 5CD3B 4KJWC 4EUPA 4HFWB 2CJUL 2VLME 2Y9RT 3E6HA 1KB9K 3NN8B 1S9WB 1OSPH 3MRGB 2GJ6E 3MLRH 4NQVB 4HUWB 4NBZB 3KPLA 4V2CB 2AK1L 1TZIB 4OF5A 2Q76B 1I7ZA 3U9UA 4APQA 3DGGA 4WUUA 2VOTA 4GXVH 4PRBA 3O45B 3OX8B 4NN6B 2FRGP 5I8OH 5HHOA 1JTTA 1E6JL 4OZHE 5DJ0A 2P5EB 5LJYH 4X6CB 3MFFA 3D9AL 5JLZB 3L5IA 3QFJE 1A0QH 3FT2B 3MR9A 5HGAB 1G7IB 1XGRA 1QRNA 2V17L 5JDJA 3NIDE 2D03H 4PY8J 1PW3A 3BH8B 3WFEH 3GFUA 3CH1B 1G9MC 1LO0H 1HCVA 5DMGC 1SEQH 3SDXB 5F6IC 3QG6B 3TH3T 5I0ZA 5JW3H 1BVZA 3QQNA 3QUZA 4HGMA 3SGKA 4JB9H 3MRRA 4NJ9L 5IB2B 2VXSL 4DJMA 5D2NC 4H25A 4BKLB 3R4DA 4RIRB 1NEZA 4ZFFB 1OWRM 3QNXB 5KN5A 4XNYL 1LMKA 5HSFA 3H9SB 3IKCB 4Z77A 3DROA 3LKPB 1DEDA 3TJEH 1RJLA 2FHCA 3VXQA 3G6DL 1YEEL 3EO0A 1AGCA 4FFZH 3ISWA 4P59H 3KLHD 4Q2ZA 5TDNB 1L6ZA 4PJ5D 1MJ7H 2QTEA 3MA7B 3BZ4A 1CDGA 1DQLL 5F7LB 4AK1A 1U3HA 4I0PC 1MCLA 2LU4A 3PQYD 3DX9A 5EUOF 1RU9L 2AEPL 2MCPH 4KKAC 2WLYA 2R0ZH 4Y8AA 3CMOL 3WUZA 3RX7A 3R8BB 5ADOH 1V7NL 3C8KB 2DQJH 3E3QE 2CRMA 1F4WL 5H2BB 1QO3A 5IW1B 1MI5A 2D31A 2NX5A 3IF1A 3RDTB 2HRPL 4N0CD 4P2CG 3LQAH 3V7MA 4U0QB 1P5VA 3FFCE 1IGTA 4M4PA 1TQBB 4XBEH 4YHMH 1P2CA 2BNRA 3RTQD 1DP0A 3BVNA 4RQQB 3SDYL 5FUCC 4PRID 2Q3AA 4H0HB 3T0EA 1NFKA 4Z7NF 4HKXA 4G3YL 4FQ2L 4JY4A 4M7LH 5DHYB 1F6LL 4ZUWB 3SE9H 5HHPA 3LEXB 4HWNA 4HDIB 3I75B 3PABA 4XMLH 4L4VE 5HHME 4O51B 1VEOA 3LRHA 5E56A 3KLDA 2WWKO 5CINH 4PD4K 1JGUH 4LL9A 2MKWA 2QSQA 5ESQB 12E8H 3ZE2E 3HZVA 3NFSL 1LO3L 1HNGA 2DQCH 4Y5YC 5JW5A 2E7MA 3V4VL 3VCLA 4JZNA 4XP5H 2V7NA 2F54E 3QUKA 3N0PB 6FABL 3HC0A 4YXLL 5CIPA 2AJXL 3PWNB 3JWNC 2KKQA 3UJJL 4NM8H 4QXGL 4WV1C 1A7PL 1UA6L 1XGUA 4Z7OF 5KS9F 5HHXH 1UM4L 4DAGL 3E2HB 3O0RH 1JRHI 3P4MA 4HUXB 1U8OB 1JIBA 5DK2B 4Z8FL 4I8DA 4GQPH 4P2QB 3SDDC 1T3FB 3MMEA 1UH2A 2PR4H 4L4TB 5FHAH 3CFCL 5IUSA 1I75A 2A74A 3CC5A 3UJTH 1SMAA 4PUBL 5T3XH 1UQSA 4LIQL 3SDAC 5JQ6H 3EJJX 1DSFH 1P7QD 4NFBA 3WNMA 4U6YB 3TIDA 1GIGL 3EYUH 5EZJB 2FD6L 3X13B 1B6UA 2HLAB 1C7SA 1QEWB 3RVUC 2HA1A 3TJHD 5KSBF 2VXUH 3KGRA 1AJ7H 2B20A 1V5JA 4CMHB 3TPUA 4RGOL 4N8CH 5FB8B 3RKDD 1JGEA 5CWSB 1P4IH 1U3JA 1GGTA 3K46A 4X80H 4HIEA 4TSCL 4YHLH 5C9JB 4YHPA 4PYGA 3QCTH 2AV1A 4EKXA 4NHUA 3S88L 2X2YA 3B3IB 4PRPD 4WW2F 5IIEB 2P5ED 5GGSY 1FO0A 1HSBA 3A6CL 4TTGA 2FJHA 3FOLA 1JPTH 4U0RC 1P9MA 2X40A 5D4QA 4OKVA 2ZSWA 5B38B 4PJEF 5IF0B 5IVXB 1CT8B 4Y19B 1FN4B 2Y23A 4AM0A 4XRCB 3PL6C 1FAIL 3RWEA 4PJ9B 3SHSA 1F4HA 2QQKL 1UENA 1VENA 1ADQH 4UDTB 1FNHA 1GYAA 1FFQA 4JFQA 1M71A 1LEGB 2NZ9C 4BSVA 1GHFL 2DM2A 1E4XL 2NZIA 1R5VB 5JW4Q 4NQEB 1CD1B 5ETUA 4L1DA 3TNNA 4LF3A 2ENYA 5BRZB 3IDMA 3BISA 4HCRL 5IESH 3DX8A 3IB4A 1T1XA 3UPRA 5MI0B 3H9SD 3MV8B 2ILLA 4AEFA 2IBGA 5IROA 4EI5D 4KTEL 1IZJA 5MENE 3OKYA 3CCHB 1LO5A 3GMMA 3FKUS 3PJSA 1CGUA 4JG0L 3DTXA 1QRKA 3EFFA 4OLZL 3GKWL 3VXRD 5GZND 5A3IC 3Q5OA 2RCSH 5AD0B 3E1F1 2B7DT 2QSCL 3MJ8B 2ZKHL 4N8VG 3L3JB 5FKAB 3FQXB 3L5JA 4N5EC 4R97C 1OW0A 3PQYE 1BIIB 3MCG1 4JDZB 1OAZH 4KJQD 2I9TA 4JFDE 2NY5C 4J7RA 1HEZB 7CGTA 2J12B 1NDMA 3VFWA 1U8PA 4NGHL 1JYVA 5E6IA 3BJLA 1AC6A 3SDCA 5T1KB 3C6LC 4M6OH 3O9WC 1C12A 2WWMC 2XWBB 5JUEL 3WNKA 2DB8A 2XXCB 4QGTA 1MEXH 4WVRA 4PS4H 2VSDA 5ALBL 1KPRB 4NNPL 3QXUA 7FABL 5KJRL 3D39B 2QQNL 4D94A 4MD0B 2VDML 4KK6D 1UCBL 2EEBA 4EBQL 3QI9C 5LGKA 4GRWB 5F9JB 5CILH 3DI2B 3MLXL 5IHLB 1Z3GL 1H5BA 3R0MA 5FO7A 2CUIA 4WTZA 1HDMB 2VAAB 5DHVB 3C9NB 2Y5EA 4P3DB 1TVBA 2XQBH 1UC6A 2B39A 2WBWB 2YUWA 5E8EA 3BDYH 4ZQKA 4MDIB 4JJ5B 1XF2B 4YDLC 3QPQD 3L7FA 1TPXB 2VSCA 4LHUG 3NCYP 3RBSA 2I26N 4GW5A 4OCWL 3MJ9H 5FYJU 1IGCH 4DK6A 5T1LD 3O6MH 3PXHA 1FG2A 3TBWB 4NWUH 4JO4L 4KUZH 4W4NA 4OLXL 4GRWH 25C8H 5D7IB 5HJ3A 1KB5L 2DJ4A 2XPGA 3PHOB 1JZ6A 3C87A 1Y18A 5DHVH 5D1XB 5EA0H 1JPFB 3ZDXE 3ULSA 1RZJC 2JIXB 1ZA3B 4OLWH 4DK3A 4JO3H 3LKRA 3OJDA 4L4TD 4TPRH 3Q6GL 2AK4E 2DBLH 1JZ7A 3ORJA 4M6AA 4G8EA 2G5BA 5TF0A 1Z6JT 3LPWA 3OKNB 1OLZA 5T1MB 3U79A 1M7DA 4JE4B 3S37L 5LXGH 4ZFOA 4HPOL 5EG6C 2GAZA 1IKFL 5J13B 3QULB 4U1LB 3WDHA 2JJTC 1JI1A 2B8OT 3KXFB 3MPCA 1NGWA 3D25B 1EEZB 1JUFB 2VXQH 3QO1A 4GG8A 5KW9H 3GJFA 3BRGC 2NY3B 4HJGB 5I1LA 4L8SB 2IPTH 3P9MA 3QEQB 3TO4B 2QQQA 4M5ZH 5E7BA 4V1DE 5SWSA 2GJJA 1RZ8A 1YY8B 2YWYA 1B9ZA 2ADGA 1XEDA 2H45A 4YHOH 4E41A 1DANU 2I9LB 1U58A 5C0DA 1XF1A 2DQTL 4ONFH 1NPUA 1IAKB 3F7QA 2P5EE 4JFFB 4UU9B 4JQXA 1L7IL 4EXPX 2UWEB 2P47B 1NCNA 2IMNA 4XNMA 1I8IB 2W0PA 2DMCA 1QFWM 2YBRA 1MQKL 2BRRH 4DGYL 4LKXA 3CVIL 4RMQA 2EDBA 1CDBA 3OB8A 1NL0H 5D1ZC 3SDXE 5JPMA 4NQED 3T4YB 2XICA 1NAMA 4ZDHB 4J2XA 5BRZD 5I17B 1MWAB 4QGYA 4EUPB 1P84K 3CPLA 2VL5A 4KQ4H 1X3DA 1D5IH 1MELA 3E6HB 5CEXA 3MV8D 5C71A 2X4OA 3AREA 3KPLB 3H9SE 4P5MA 1YNLL 2WAHA 1JTPA 1S7SA 3U9UB 1I7ZB 1YQVL 3NABH 4APQB 4BK5A 3HNSL 4JN2A 4WUUB 1YJDL 4NQSA 3VG9B 5JR1H 5C7XH 1A6VH 2Y06L 4KJPD 1ZSDA 1MWAH 5HHOB 2XA3A 3WKMH 5JDSA 5DJ0B 4XPGL 4EUPH 3MFFB 4G8FA 3B5HA 1K6QL 4Z76A 3LHPL 3MR9B 2QHRH 1XGRB 1PQZB 1QRNB 3ARUA 1SY6A 5GGUB 4OFVA 3GMQA 4PBVC 3ECBB 4NO2A 2V5YA 4W81A 2CUHA 1H8OA 4POUB 3UP1A 2NY4C 4J1UA 4LLAA 1EPFA 3LMJH 3MZGB 2AI0L 1OSZA 5T1KD 1F00I 5EBMA 4RAUA 4WWKD 4W6XB 3QUZB 1WFTA 4LFHD 3MRRB 5D93B 3BWAA 3BQUA 5J3HD 3KJ4C 4HFUL 2WBKA 3EZ8A 3P30L 4BSJA 4H25B 1NEZB 3BKMH 2XNAA 3ABZA 4DTGH 3AM8C 4OLEA 1PLGL 3VD3A 4XCYB 3DROB 1SJVA 4ODSH 1EHLH 3HUJF 1M7XA 5EBWA 1WK0A 4M7JL 4UT9H 3W9EA 3CXHJ 3EO0B 2VXTH 5TF1H 1AGCB 1F4XL 5D70H 3DLQR 4FQXA 2MPAL 2D7OA 2ATKA 4Q2ZB 3WMSA 3QH3A 3SQOL 2Y36L 1UACH 3BZ4B 1U3HB 1BQSA 3P73B 3AVEA 2VDQL 3WFCL 2DI7A 3DX9B 3HMWH 3L5WB 2RQ8A 1C1EL 2YA1A 3CDGB 3GIVA 2GI7A 5KVDL 5T3XE 5HDQH 1FVDA 1KIQA 2N7BA 5BVPL 1BM3L 4NN7C 3WLWD 1QO3B 2D31B 4PGCB 4KHTL 4XP9L 1T2QL 4S1RH 4ORGA 4ZXBC 3MGTA 1DBAL 5C2BH 1IGTB 1U8NB 2CMRL 1BZ9B 2DM3A 2JIXD 2CK0H 5H37G 4E0RA 3VXMA 2BNRB 5DUBA 4P2QE 3VI3E 2V5RA 5FECA 1HHJA 1MF2H 3U48A 4PREB 3I2CL 5D7LA 4HKXB 4JY4B 4D8PB 4FTVA 4ZG1A 5DD1H 2VDLH 4MGXA 3BP7A 5I18L 3TT3H 4U1SA 5HHPB 5KBNC 1LEIA 2APTA 3KXFD 2ZJSL 3L3HA 1OGTA 1XF5A 2ZOLA 3PABB 4LSVH 3QUYA 4N0UB 4KZEH 1BFVH 4ZUSA 2NY3D 3E3QC 5KVGH 3VD9A 4XHJD 3LIZH 4N0FA 3QEQD 3IT8D 1ZLUH 3HZVB 1FDLH 2I60H 5D7JC 5JW5B 5DFTA 3VCLB 3V6OE 4JZNB 4NZJA 5F97E 5D7KE 2V7NB 4JKMA 1YMMD 3U4BL 4LASL 4JDVA 4M3JA 4P2RE 3HC0B 1A14H 2WUBL 3PG2A 4ZS7L 4HS3A 4WI9A 5T3ZL 5GZOC 2GQHA 5DTFB 5IM7A 1XGUB 2OP4L 4TSAH 2A9NH 1A8JH 1ORQA 2NXYC 3P4MB 3ZTNH 1U8LA 4LSRH 5C70A 5IVXE 4Y19E 2A9ML 1DFBH 4YDJA 1QSVA 2J7LA 2PTVA 3MMEB 5D1QA 1PZ5B 3RP1A 1UEMA 2XY2A 1ZHNB 4LPCA 4NZRH 4HC1A 2APVA 5J11B 4UOJA 2JJWA 3FT3A 3CC5B 4XC3H 1OTSD 4G8IB 5CIPH 1UQSB 1HINH 3BPNB 4MXVE 4L8CA 4PJFF 1TJGH 2WMPA 2YD1A 5BRZE 5D6CA 2HLFD 4J6RH 3TIDB 5HYSA 3HC3L 1Q9LA 2X41A 1NSNL 4K7FA 5F21B 5DD3H 2BY0A 2DQEH 4EVNA 4PGBA 4YHYC 5EZOL 1YEKL 4K55A 4X6DA 3RY6A 1JWMA 4PBXA 1R3KB 4APQD 3GRWL 4S1QH 4WUUD 4EIZC 1E6OH 1JGEB 4AT6A 3ARRA 5DD5H 4K7PX 4HIEB 1AHWB 1VPOH 4K8RD 2JJSA 5IOPA 5HHOD 2AV1B 2YPKB 4ORZC 1A7OL 4LCWD 1HSBB 3FOLB 5E8OA 2R2BA 3ZDZE 3GI9H 1EHNA 4OKVB 2ZSWB 4K9EL 3SCMC 4FQIH 4AM0B 3UYPA 4ZOBA 3UO1H 3RWEB 2V5MA 4YGAB 4RISL 2R1WA 5T33L 3BPLC 3WL9B 5HVHC 3IKKA 3SOBH 4HWUA 2B0SL 4JKWA 5JO5A 3TEUA 5IBLC 1PKQB 4PJDB 1LNUB 2I25N 1FO0H 3IDMB 3ZT6A 1XZ0A 4ZS6C 3G04B 3T04D 5EO0A 1TQCB 1ZANL 3NFNA 3UPRB 2OR9H 2ZUVA 3IXTA 1F8TL 3D39E 4HQQL 1KYOK 3VH8A 2YPLA 1FH5H 3HNTH 1LO5B 3GMMB 5F9WC 3MOBL 4N8PA 1B2WH 4BQ6A 4GRWE 1ONQB 1R0AH 3DTXB 3EFFB 3SGJC 1SBSL 3GUTA 1U3HD 3ARGA 3BUYA 1WT5A 3PWJA 4FZEH 4NNXB 5K9JL 3UAJC 5I1JL 4JREB 1HI6A 3RBGA 5F93C 2YUZA 5I1AA 1FNGA 3EDKA 2VQ1B 4R4ND 1NC4A 3ARYA 4ZMAT 4GQ9H 5JHLH 1T04A 4N90D 3UTZB 3IDGA 3T3MF 3AMLA 4XVTL 1EAPA 1MJ8L 3IAQA 2LVCA 4JFOA 4ONGL 5KVFH 2VIRA 1HK6A 3VGHA 4M7ZC 4Y1AA 1NDMB 4RFEA 1NCAL 1NCBH 5AYQA 1WBYB 4LVHC 4LLVA 3KPMA 4XC1H 4I0CC 1MCPH 1QSFA 1IILE 3SDCB 3QA3A 2YS4A 1G7QB 2B4CL 1C12B 2WM0A 2LAAA 2ZCLH 4ZPVB 3QEHA 4YQXL 4UDUA 1LILA 3OHXA 2B1AL 4AIOA 4JHAL 3GSXA 1Q0YL 4NUGL 4FNLL 1RUKH 5JXED 2YUXA 3LN4A 3AFLA 3KXFE 3PHQB 4O9HH 5D9SA 5E2WH 5CLWA 4C58B 4CN4A 2LTQB 3C08L 3L7EA 2O5XH 5I8EA 1X4XA 1T83C 1VERA 5E8EB 3QEQE 2C3WA 3QJHA 2H32A 3L7FB 4HJJL 1CL7I 3HPLA 4GKNB 4GW5B 3U7WL 4CNIA 1DL7L 1FJ1A 4M62H 3WXVL 3KHOA 1UADC 1MFEH 1FG2B 1INEL 3BEVA 3RTQC 3SKNB 2YPVH 5KANI 1RUPL 3O3EB 5L9DH 4JFFE 5TQ2L 5I1EL 1S5HA 1WUNT 3LS4L 2K3TA 1YNTA 2UWEE 3PP3K 4XMKH 4HLJA 2ZUSA 3WE6A 5CJOL 1BQLL 1I3UA 1U8IA 1KEML 3LKRB 5DSCA 1TJIH 1N64H 2HT4C 4I2XE 3T3PE 1QFPA 4G8EB 3CSYB 2VDRH 4G5ZL 3AB0C 4W68A 3ULVF 1U9KA 2COQA 3CD4A 4JGMA 2GYSA 5GISL 2GAZB 3BDBA 4U3XA 5GRVK 4NZTL 1Q72H 3SO3C 4QTHA 1I7RB 3VXUA 1NGWB 3JZ7A 3QO1B 1EVTC 4GG8B 3BE1L 3GJFB 3ZSSA 1HYRC 4HH9B 2Q7YA 4P9HL 1FYTD 3IFNH 4LQ1A 5E2TH 4LCIH 3H3KA 3GKZA 2DI8A 3OKOA 4WUUE 5KVEH 5ILTL 1RZ8B 4U6VH 1BEYL 1R3JB 3WDJA 4E41B 1PG7L 1LEKA 5ICXA 2QQLL 3WD5H 5B38G 3BP5A 5C0DB 5EB9A 5AZEL 5C0AA 3L3IA 1I1FA 2Q8BH 5IBTH 4XNMB 3RVXC 1QRNE 1WAAF 2FX7L 3GJFH 3SBWA 3CVHA 1K2DA 2FLRT 3BZFA 4LKXB 1YN6B 4G6KL 1J0ZA 5I19L 1OGAA 1T21A 3VMOA 4U6XA 1RIHL 2H2PD 3IDIA 4NUJA 5ESAB 5C3TA 2CLZA 4U7KA 1NAMB 5J9PA 2ICWI 2OCFD 2QADB 3ELAT 2R4RH 3TJHC 3MOQA 2SEBA 4XCCH 2BSSB 3SKUD 4G42A 2PO6A 3BIKA 4MS8D 4LSTL 1LWRA 2YK1L 2VL5B 2GTWA 5CEXB 5FYJE 2X4OB 1S8DA 4GS7B 1GJIA 2M26A 3DXAE 1G0YR 4P5MB 3FRPA 3MCKA 3TWCL 1LP9A 1A6AB 5DMIL 1JFQH 1DQQA 4FP8L 3U1SH 4JN2B 4NCDA 1PZUB 1JHLL 2OMNA 2ZSVA 1Q9KA 1NAMH 1QFWL 4FFYL 5TE4L 2MCG1 1YN7A 1Q1JH 1ZSDB 2HKHH 3OZ9L 2DAVA 5CSGA 5ITBH 2PXYB 3P4OA 1SJEA 3MRFA 5IMOA 2H6PB 3TBSA 2FL5A 5JDSB 1DUZA 4QRPA 4DKFL 3L6FA 4WI2A 3GSRB 4OCSH 1HKLH 3LEYH 4Z76B 5JXAH 4NJAH 1N59B 4NO2B 1YPZA 3CUPA 4N90E 4ZO9A 5DZNA 3BO8A 5FEBA 5IG7A 4J1UB 1MI5E 2NX5E 3B2UD 3NPSB 3V7AG 3UPAA 1OSZB 3N9GH 2J6EA 3SDCD 4H1LA 4LFHG 1PG7W 1G0XA 5EBMB 1IARB 1OF2B 4O4YL 4DKAA 1HXYA 2BNRE 4L3CA 4M1GH 3UZVB 3BWAB 4HLZH 1G7HB 3VXNA 1MFCL 1UWGH 4YHKL 3LQAC 3V4UL 4KMTL 3S4SA 1I9JL 3TO2A 4F2MA 5IBUB 3T0EE 5GZNC 4RMSA 4OF8A 4RBPK 1SY6H 3CFDA 3K2MC 1BBJA 2YRZA 5EBWB 5H35A 3EYOB 1ZHBA 2APXA 1X5IA 3W9EB 1U95A 4IDJH 2JCCA 2K1MA 1T1ZA 4FQXB 3EYFA 1FNEA 3P4NA 3QH3B 4GAJH 2MMXA 5F8RC 4ENEC 3LB6C 4NRYA 3W9DA 3JWOL 3RDTC 2PKDA 3L3GA 3O2VH 2ESVD 2P8PA 5DWUH 2FBJL 4LPTA 1KLGA 2XXMB 2XA8H 3EFDL 4PJCB 1BBDH 3GIVB 1TQBC 3LSOA 3MLZH 4JM2A 5K9QG 1FVDB 1OSPL 4U7MA 3BJ91 1ERNA 5GGQH 3K1DA 4ORGB 4MZ3A 4P4RB 3MGTB 3PDOA 3EOTL 2D7NA 3QIBA 4GXVL 4ELMB 3OL2A 2IAMB 2FDBP 3FMGH 1AXTH 4MVBD 3CLEH 5FECB 1NFDF 4GW4B 4L3EA 3O3DB 1DZBA 1HHJB 4W4OC 1FGNH 5EORH 4IIQB 3VWJC 4FTVB 2HMIC 3BP7B 2YHGA 32C2A 3Q5TA 3H6JA 1LEIB 2X4SB 3K4AA 2D03L 3L3HB 3WO3B 3S7GA 1XF5B 2ZOLB 3QUYB 2R8SH 4ODVH 1KB9J 2BOBB 2CDFA 4M93B 1LO0L 2AQ3A 1SEQL 4ZUSB 3VGDA 5IP4A 1MJUH 4F9PA 1RJCA 5C0FA 1CE6A 1GPOL 5IFHL 4GMTH 5JW3L 4CN1A 3NA4A 1DVFC 5E5MA 4IOFC 3LRSB 3OJMB 4OFDA 2DI9A 4ZOEA 3F6IA 1W2KT 3MLYH 4JDVB 4E41D 4Y4HC 2Y25A 5JPNA 1SJXA 5GRVL 1AD0A 4HS3B 3NGBC 3JWDH 5IFAH 5IM7B 4C4KO 1U6AL 3QDAA 1GGCH 1ORQB 1YEJH 1U8LB 4P59L 3LKOA 5IWLC 5JZ7D 4YDJB 1U8KA 5D1QB 4OZGA 3VFPB 4KUCF 1GGYA 4AL8H 4G80A 2DICA 3K4ZA 2UUDH 1PX4A 3FT3B 4JVWA 4X0KA 5I1KL 2W9DH 3VXOB 1S7XA 2R0ZL 4BQ9A 4ZUVA 1J05A 5HXMA 3ZKND 5ADOL 4L8CB 1MHPL 5JOFA 2R0LL 3D85A 4B50A 3LOWA 4BK4A 5D6CB 3V6OC 2XWJA 1Q9LB 4F7PA 4K7FB 4EVNB 4PGBB 5CZKA 1TLKA 4OZHF 4X6DB 1D9KC 2CLVA 5K59E 3T8XB 2FZ3A 2BERA 4HC1H 3HZMA 4AT6B 3NIDF 3KPRA 5E70A 2AVGA 2VZVA 4P2YA 1NBZA 4PJ9C 5IOPB 4M7LL 2PXYD 5DJ2A 5T1DL 1GXEA 2NY2B 4P2OA 4H26A 5F7MC 5E8OB 3TA3A 3HE6D 3T1WA 3BEWB 3UMTA 1A2YA 5B8CB 2DYPA 5CINL 1JGUL 3ARXA 3WIFA 3AXLB 2ICES 1F3DJ 5E94A 1F11A 4JVUA 12E8L 2YKLL 2E7HA 5EO1A 2XN9D 1C5BH 1JYXA 4JPWL 1N8ZB 5DEFA 5ISZA 3LEVH 3I50H 4Y4FB 4JY5H 1AIFA 4NQXA 5JO5B 4NNYA 1A3LH 2YC1B 1FPTH 1OTUD 4CGTA 1F45A 4JRXA 1E27A 3O2WH 1NUGA 5HHXL 2VZUA 5E2VH 5TQ0H 2ITDB 3A0OA 4RFOL 1Q9OB 3IXTB 3O0RL 1X5HA 2ICEB 4QXTA 3VH8B 1A02N 2YPLB 5JHDB 3EYSL 4YWGL 2WNGA 1J1XH 4PD4J 1BX2A 4I77L 1GGUA 3QG7H 4K2UL 2VDKL 2XZCH 3P0GB 3FQRA 2PW1A 2WP3O 1JRHL 2AJYH 2NW3A 3GUTB 1YNKH 1HHKA 3CGTA 3PWJB 4K3HA 1KIUA 4I9WE 5L8KB 4PJ7A 4GKOA 1HI6B 2BCKA 5I1AB 5IVOA 3ZT5A 3UCRA 1FNGB 4KJYA 5D6DA 1CICC 1DSFL 3S97C 5CBAB 2FGWL 2J8UA 5F1IA 2W65A 3WEXB 1NC4B 2O5YH 2OQJA 4XP1L 5FGBA 3V52L 1T04B 1FVCA 3EW3B 3GSNL 4Z7VA 4HAFA 2Z31A 4XCEA 5DO2D 1EAPB 1EFXA 4JFOB 2HH0H 4LQFL 2VIRB 2VXUL 4Y1AB 3WIIL 2EE3A 1AJ7L 4RFEB 4LLYA 1WIPA 4LLVB 4DZBA 1JHKH 4N8CL 2IF7A 1QSFB 4HT1H 2IAMD 1MOEA 4PJ8B 1H0DA 2FHBA 1MIEH 3DO3A 5FYKU 3RZCC 4AEIL 1EEUA 3QCTL 5IVNA 4M1CD 3QEHB 4LEOA 1EXUA 2BNUA 2H1PH 3OHXB 4I1NB 4JFXA 4UTBH 3B43A 3GSXB 4OI8A 3WHE1 4FS0A 1VGKA 4P5TD 5D72H 1IC7H 3QUYD 1FLRL 2R15A 3HB3C 3LN4B 2CKBB 2Q3ZA 3LV3A 1SJHA 1TPXC 3IU3A 1KN4H 5D9SB 1O7VA 1ADQL 4JZJA 4H8WH 4Q9CA 2AP2A 4MMZC 3WO4B 3ZHDA 2KL6A 4HPYH 3HR6A 5I8EB 4MX7A 1FIGH 4HGWA 5KAQF 1FZOA 3D0LB 2C26A 2CQVA 3GSVA 4P46C 3I9GH 3QJHB 5SWSE 5IESL 3HPLB 4D9RD 4WJ5A 5D1XC 4CNIB 4FXLA 1FJ1B 4E41E 1JNNL 1KTRL 2GK0A 5IB3A 2CKBH 1PEWA 4LU5L 2ADFH 2Y07H 3LKNA 4J12A 1S5HB 1MHCA 4LSPH 4RGND 5I75B 4OJFH 1YNTB 4EOWH 5CKAA 1HYSC 2FEDC 2EH8L 2RCSL 5EOQH 5E5RB 4H88L 3WE6B 5DSCB 1MLBA 1S7QB 4Q7DA 3VDCA 4WHYH 3MRLA 2HJLA 4XNQB 2KDGA 3EDJA 3O3AA 4XMPL 5DMKA 3VA2C 4L8SC 1B4JL 1HHGA 3MLTA 5LQBL 3TO4C 15C8L 4PTTB 1T03H 1QKZH 4QTHB 3OAYH 4JLRB 5T5NG 3A6BH 4Z0BL 2HTLD 5D8JH 4GUPA 2R2EA 1HQ4A 4OGXH 2HN7A 3OAZH 3QFDA 4EDXA 1MEXL 4PLJC 4IHOA 4XVJL 1QSEA 2NY2D 4O2CA 3RUGE 5IJVB 5ICXB 3BP5B 5C0AB 3L3IB 3SGEH 1I1FB 4IMLB 5C0BB 1JE6A 5CILL 2D2OA 1NBQA 1H3GA 1K2DB 1A3RL 5DI8A 3BZFB 4BFEA 1OM3H 5EU4A 5CP7B 5E9DA 4D3CL 2ITCA 3KJ6L 3FFDA 2X05A 1T21B 3BDYL 4U6XB 4Y4FD 3STZA 5D2LE 5D5MA 4JR9L 5DRXB 3IDIB 1B0RA 4URTB 3BZEA 2AGJH 2DOCA 4UOW0 5J9PB 3V95A 1IGCL 3S36X 2SEBB 5KOVC 1A9BA 4APQC 4CMMA 3BIKB 4YPGB 1CD0A 5FGRA 4WI5A 2NMSA 2GTWB 4KUZL 2BRQA 3D0VA 4R90H 3ESUF 5E6YA 3RWDA 2YPLD 5JHDD 3W2DH 2HWZH 3MCKB 1LP9B 3MOAL 5EA0L 3MJGX 1DQQB 3QIWA 4OLWL 2IH1B 4YO0A 3MCLH 4UBDC 4X5WA 5B22A 2DBLL 3FHQA 3TYGH 4BUHA 3MACL 1QOKA 3IXAA 1O0VA 3OKEB 4RAVB 5F7FA 2ZSVB 1Q9KB 1YN7B 3P0YH 4UV7H 3IFPA 4L8DA 3P4OB 3MRFB 3TBSB 5IMOB 2FL5B 4QRPB 3DO7A 3L6FB 3ROOA 5B3JE 1CXFA 1P4LA 3QUZC 3THMH 5D93C 3CUPB 2XG5A 2XRAH 3BO8B 1KB5A 1X5AA 4Y1AD 5IG7B 4G6AD 2CIIA 5HYQA 3MNWA 1EA9C 4K94H 5MEQA 4XAKD 4H1LB 4PJ8D 4P4KB 5DHXB 4PJIB 4XI5C 5CZXC 4HF5H 4X4YA 2ED7A 3KYMA 5FYKH 4LLQA 4J3OC 3VXME 1HXYB 5BZDA 4Y7MA 4C57C 4L3CB 3HNVH 3VXNB 3AS0A 4WHDA 5GGVL 3S4SB 1NANH 4F2MB 4ONFL 1KXTB 2ERJB 2R29H 5D7LE 4L1HA 4UQ3A 3KHQA 4FTVE 3MA9L 1YY9D 2MHAB 4FQQB 5CAYB 4KH2A 3CFDB 1BBJB 3FQUA 4TVSa 2BRRL 4WTZG 1ZHBB 3ROLA 2C5DC 1U95B 1JBJA 5KANG 4Z7WF 2H2SC 3IETB 4R4NC 5I74B 3U7YH 1T1ZB 2YD5A 4CL7A 3EYFB 2J6EH 1NL0L 4H1LH 1FNEB 3P4NB 5EBLA 3J8F7 1JGVL 5TGBA 1HN1A 1S78D 4NRYB 1AO7B 3W9DB 4I13B 3L3GB 2P42B 4QHLA 1A6ZB 3EJZD 4PJGF 2N1KA 4M8QA 2P8PB 1TZGL 2HFFA 1KLGB 4P9MH 3ZDXF 4KQ4L 3LSOB 4JM2B 4G7YH 1C16B 1MRFH 2D7TL 5JNYB 3MRHA 1DLFH 1KJVA 2JELH 1CBVH 4FFWC 3BKCH 3MNZA 3MLVH 3T0EC 4MNQA 1AI1H 3PDOB 1S3KH 5C0GA 3NABL 1DQJA 3VFOB 2BVQA 1JWSA 3QIBB 1YEFH 4GXUN 3Q48A 4HXBH 1QR1A 5JR1L 2FX8L 4JANB 4I0KA 3WKML 2OR7A 5EWIH 4ERSH 1U8HA 2E7LA 3UTSA 3KLAA 2XKNB 3EO1A 32C2B 2QHRL 4JM4H 1MRDH 1DBBH 1QBBA 4JPIA 4MQXC 5M7QA 4HK0A 2LABA 3T0VA 2Q7NA 3LMJL 4JKPL 3QHZH 2RB8A 2CDFB 4L3AA 3WJJA 1BVKB 3L3OA 1IKNA 3G5YB 1BP3B 5DUPH 3RAJL 3K8KA 1CE6B 4X6DE 1NCTA 1A7QH 5BXFA 3MZTA 2X4RA 4K8RL 3FL7A 2F53A 5I73B 3AS2A 1WCBA 4ZFZA 3RIFK 2BDNL 1OLLA 4XCNB 4GKZA 4HIIA 2I27N 3BKML 5JORA 5JPNB 1AGFA 1AD0B 1CR9L 4FQPA 1A7NL 5IB1B 5C0BD 4RFNB 4ODSL 3SDXF 2CD0A 5J11C 4UT9L 1ZE3C 1C5DA 2LAGB 2AK1H 2VXTL 1FZKA 1PAMA 5TF1L 3QZWB 4YEEA 3BPNC 5D70L 2V7HA 3LKOB 4M48H 5CP3A 1T7WA 4U6TA 5TFSL 3TBVB 1UACL 4KI5D 2VXVH 1U8KB 1OCWL 1X4ZA 4OZGB 4OF0A 1OQXA 4MJ2A 4X0KB 2AEIT 1E6JH 1S7XB 4YK4B 4ZUVB 4F15B 1Y0LA 4CADA 3DMMA 1I4FA 1S7UA 3TESA 2VQTA 5HYFA 4R7DA 2FECI 2XWJB 2YOCA 4S1RL 1XGTA 4F7PB 4MA1B 3BKJL 3Q3GA 3UX9B 1FQ9C 1DEEA 5C2BL 3QXVA 4MJIA 5FUZH 1PVHA 3DSNA 2CLVB 4F57L 2R2HB 1S7WA 2FZ3B 1X5KA 1P9MC 1MCNA 3RHWF 3OR7A 3HZMB 4JAMA 3KPRB 1HQRA 3J7HA 3OF6D 3DNKA 4NJ9H 5FYKD 2VXSH 1NBZB 1WEJH 5DD1L 5DJ2B 1NCUA 5GGSA 4QRPD 3TT3L 4IRZH 4K7PL 1GZPA 1WZMA 2Y7QA 4P2OB 1FZJA 3DSFL 1KPVB 3TA3B 2WIIA 4XNYH 1VFAB 3NPZB 4KZEL 5F88A 1IEAA 1M6OA 4QHUB 3WIFB 4WGWB 2FATH 5E94B 1F11B 1YECL 5EO1B 4MS8C 1TQCC 1DQLH 3WLBA 5GRUL 1FC1A 5DEFB 4P23A 1FDLL 4P4KD 3UYRH 1BECA 1JP5A 2I60L 2VRAA 1F3JA 1QSFE 5IROC 1RU9H 1WVZA 4XAKE 1AIFB 3VGAB 2G60H 2AEPH 4NWTL 1AP2B 4NNYB 1EV2E 3RL2A 2VLJA 2XYCA 2A2QT 4YBLB 2X44D 5FKPA 8FABA 2YRLA 4JRXB 3QXAA 4NKMA 1RMFH 5FCSH 4TSAL 2A9NL 3G5ZA 3ZTNL 1D6EA 3CLFH 2HRPH 4QXTB 1EAJA 1DFBL 1OW0C 2NNAA 4UUJA 5A2KH 3G6JE 1Z9OA 2FJFB 2PW1B 1S7RA 3F65A 1EMTH 5L7XL 4NZRL 3LN9A 3MRCB 3SDYH 1HHKB 1AO7D 1BJ1J 1HWHB 3RL1A 2DWDB 2YSSA 4PJ7B 4X98A 4Q6IA 4FQ2H 2BCKB 4MZ2A 5BO1H 5F1IB 2J8UB 5E6IC 1FG9C 3I85A 3PF2A 5B4MD 5EIIA 2OQJB 4F7TA 1IZKA 5I0DA 3VI3F 1FVCB 2A83A 3WJLA 5IQ7H 1QZ1A 5DD3L 5C8JA 4MAYB 2OJZH 4Z7VB 2Z31B 1N2RB 2CDGB 4XCEB 4G6FD 1EFXB 1OPGL 2X4TB 5IMLB 3VWKB 4JFZL 4LLYB 2ARWA 4S1QL 4DZBB 4HUMB 2YWZA 5I30L 5HHQA 1KFAH 5DD5L 1QD0A 5FV2A 4FZ8H 1H0DB 5EUOA 1VPOL 4PRAA 5DVKA 3GSWB 2EIZA 1UGNA 3CFBA 5HY9A 4OGZA 4KXZI 2HKFH 1QFHA 4LEOB 1H5BC 6FABH 4YXLH 1KJMA 4X9HA 3K3QA 1U3YA 1NJ9B 5AUMB 3P0VL 3QJFA 4JFXB 3UJJH 2GTZB 2L7JA 3EHBD 4MJ5A 3MV11 4QXGH 4JY6A 1A7PH 1UA6H 1VGKB 2Y6SC 4FQIL 1UM4H 2IC2A 1ED3A 1EHXA 3EJYD 3UO1L 1E4WL 5C08B 5HVWA 3PIQA 3LV3B 1SJHB 4LAJH 3IU3B 4Z8FH 1UWEH 1XGQA 1LE9A 3VXUE 1ODAA 4Z7QF 2AJSL 4YHZL 1I8KA 4MX7B 1N0XH 5L2KA 4HGWB 2YN5A 1FZOB 1ES0A 5E8PA 4J4PA 43C9A 2YD9A 4N8VA 4J8RB 3GSVB 3MV9A 4RX4A 4PUBH 5IVXF 4MQ7A 4LIQH 4WJ5B 5IB5B 1RJZA 2P46B 5GS1C 4LVNB 2Q8AL 1OOAA 1J10A 4FG6D 1GIGH 2GK0B 1JPST 5C0AE 2FD6H 1SMOA 3BYYA 1FH5L 3LKNB 4IRSA 3HI6L 1B2WL 2WQ8A 3V8CA 4PY8I 2FEEI 1J1OL 4RGOH 3B9DA 4YFDB 3BD5A 1MLBB 3C5ZA 5J1AA 1VKXA 4CVZB 3STLB 2HJLB 3D2UB 1MJJA 1JHTA 1OGAE 1CDIA 3I6LD 3S88H 3O3AB 1CGSH 4OD1L 5DMKB 1I85A 3A6CH 1HHGB 5JHLL 2R2CA 5I9QB 5KS9A 5DEGA 1K4DB 5E2UH 1GOGA 3LPFA 1UXWA 4OT1L 5DQ9A 1KENL 1KCUH 2IQ9H 3S3SA 3KPQB 1SHMA 1KYOJ 5JIIA 4HK3J 4XC1L 4JFHD 2GSGA 3WFBL 3DUUA 5JA9A 5E24E 2PN5A 3ZDZF 4FABL 4GUPB 1LP9E 2R2EB 3Q0HA 4YGVA 1HQ4B 4JQXC 1ZTXH 5A2FA 1E4XH 4G6MH 1J5OL 1T89A 4W70A 1X5YA 2ZG2A 4MDJA 4IHOB 3ZZ1A 4OUUB 1QSEB 4LHUA 4O2CB 5FYKE 4P2OD 4TQEH 1RUKL 4U1NA 1V3MA 3TA3D 4QRPE 3BRDA 4KTEH 4O9HL 3NIGE 5E2WL 3JV4A 4JCMA 2QADC 1CXLA 3DURA 2Y1VA 3H3BC 1J0KA 3TFKD 1YPZE 5DI8B 1MCWM 2O5XL 3TC9A 3NFPB 3GKWH 4OLZH 2Q87A 5E9DB 4YEFA 2ITCB 2UVEA 3FFDB 1RZKL 2QSCH 4U7SA 2ZKHH 4BQ8A 3STZB 3AREC 1UJ3A 4GS7C 5D5MB 2ADJA 1B0RB 3MUZ1 1QQDA 5GRWA 4GT7A 4GRWF 5B39B 1FNAA 1CXHA 1A9BB 1X9QA 4CMMB 4JRXD 3JSSA 1ZT7A 4QYOA 2YPVL 4R2GB 3VH8G 3DETC 3V0VB 1KCKA 3D0VB 4YUEL 4WO4C 1NBYA 1QFOA 4GBXA 5IJKA 4AG4L 4NGHH 3P77A 3QIWB 4LP5A 2Y5TA 1Z0NA 5I1HL 1TJIL 2C3HA 4X5WB 3RIAK 2JCCE 5GJTL 1N64L 4P99A 1Y6MR 4HZLA 3VA6A 3IXAB 4KHXL 2OS7A 3QDMB 4FQ1H 5DJ6B 2APWA 3IFPB 4L8DB 1MUJA 4I18A 1IC4H 1JK8B 1J0YA 3NPSC 5HVFB 4NNPH 1J0IA 7FABH 3DO7B 3X17A 2X1XR 1WICA 1NUFA 3ROOB 1NGZA 1ITBB 1UCBH 1P4LB 3L1OL 4ZYKB 5DA0B 4K3JH 4MAYD 1F3DH 4MNHA 3LKSA 1X5ZA 2EXWD 3BQUC 3MLXH 3VWKD 4EQ2A 3HI5L 1JZ4A 5DMJB 2CIIB 2RBLA 2KUTA 2NW2A 2OX5A 4NKQB 5HYQB 1R5WA 3MNWB 3IFNL 3DX7B 2E7BA 5J0BA 1XT5A 1YDPA 4PJXA 4YAQA 4X4YB 4TUKH 3KYMB 4MD5A 5KSAA 2X1OA 4IMKA 4KFZC 5BZDB 3BMVA 4L3EE 4KKCC 4FQXC 3ULUF 3BP4A 5MP6L 1RJYA 4MNGB 1H3VA 2DDQL 1CTNA 4UQ3B 2VR5A 4NFCA 5IBTL 4OLXH 5C08D 1KB5H 3FQUB 2A0LD 1RUMH 1NCWL 1TXKA 4RNRA 3ALPA 3JUZA 1BREA 2ZUXA 3O3BA 1K85A 4JFEA 5GS2H 5TGBB 4OZIB 3ARFD 2VMFA 3EKCA 4QHLB 4TUJA 4M8QB 4X6BB 4XCCL 5EIQA 3S37H 2HFFB 4TUOA 2VO5A 2O61A 2E6JA 1B0GB 4RMUA 1MCFA 3RWHB 5CJ5A 3IVKA 3MRHB 3T3PF 1KJVB 2PW2A 2O93L 1AQKH 3MNZB 3QO0A 1JFQL 4MNQB 4XWGH 1I8LA 2L7UA 1MHEA 2BVQB 4QOKD 2EDOA 4NQDA 4XVUD 1FNSH 2D9CA 1A7RH 3CZFA 1QR1B 1KV3A 1NAML 4NO3B 3QB7C 3JWDC 1DBJH 1A6WL 1Q1JL 2HKHL 3D2UD 4OZGE 4JHWH 5ITBL 3WSQL 4M93C 5DJAB 1WZLA 1U8HB 3UTSB 1K8IA 1XIWD 1HKLL 1ZWIA 3EO1B 3LEYL 3LPGA 4QHMA 4JPIB 4HK0B 1QBMH 1MQKH 1GC1L 3QEUA 1X5GA 4PJ5A 3L3OB 4DGYH 2XWTB 5ANMA 3CVIH 1MQ8A 3H9ZA 3MRKA 4FRWA 4S11A 5BXFB 4H5SB 1A4KA 4XP4H 2BOCB 2F53B 2X1PA 1IGIL 3D6GA 2EDDA 3QDGA 2P48B 4LBEA 5J1TC 3KPRE 4GKZB 4HIIB 1QSED 3V4PH 1J7VR 5JORB 1AGFB 5CSBA 5D1QC 2FYYA 1DUYB 4WWID 5BQ7A 1JGDB 1C5DB 1BZQK 1VADA 1NLDH 2WZPD 2G9HA 2V7HB 3PWUA 4NPYA 1DDHA 4GAJL 4LHJB 1WIOA 1MCJA 5E9DD 4Q9RH 3QQ9C 1YJDH 2BVTA 5CGYD 4PRIA 4AIXA 2X4UA 1L4IA 3O2VL 4LARH 5ISZE 5GRJH 3ARDB 1JWUA 1M1SA 3CFIC 2DQUL 1BBDL 4NKDA 3RY6C 2UZYB 5DZOA 5DF0A 1K6QH 4MXWH 4CADB 4HJ0D 4S2SA 3DMMB 1I4FB 1JV5A 1S7UB 4R2GD 2YA2A 4R7DB 1LK2B 3FRPG 4JRXE 5JW4N 4Z7UE 1XGTB 1QTYT 2JJSC 4Y4KA 2EYRB 3Q3GB 2YD7A 1DEEB 5CP3H 5LGJB 1XGYL 4MJIB 5DJYB 5HVGB 1MCDA 2AI0H 2H9GA 3BAEL 3QIWD 5DR5L 2AJZA 3FMGL 1U0QA 3CLEL 5FOBA 1YMHB 5SWZA 1X5FA 3OR7B 4JAMB 3F7RA 4KWUA 3V9FA 4PLKD 2BC4A 1HQRB 4X7TB 1AGEB 3QDMD 4XT1C 3JVGA 4GLRH 4O00A 1F4YL 3UPCA 2C3XA 1OD7A 3H3PL 4ODXA 4HFUH 3P30H 1UM5H 2F8XC 4PJ7E 2FIKA 4LVOB 3QWRD 2Y7QB 2QKIB 1FZJB 2EDEA 1IL1A 2WIIB 2J8UE 5F88B 2BY3A 1BLNA 3GBLA 3RRQA 4M7JH 4G9DA 2OK0L 3VI4E 4Z7VE 1MJUL 1F4XH 2MPAH 4GMTL 3MBEA 4J23A 5HDBE 3SQOH 3EOYG 4XBPA 3S35X 3TN0D 2JJVA 3WLBB 4P23B 3UC0L 2VDQH 5HTSA 1F3JB 4RDQG 4GXUM 3SKJH 3MLYL 1MCSA 4ONHA 1TCRB 1P7QA 3RL2B 2VLJB 1CD9B 3I84A 5DGQA 5I8CB 1BD2A 2AJUL 1AE6H 4Y16D 4C59B 2O26U 3N85H 3QHFL 8FABB 4NRXB 3DVNB 3QXAB 3ARGC 4LIQE 4NKMB 3MRGA 1J9CT 4NQVA 1WT5C 4HUWA 5BVPH 5I1DA 3G5ZB 1HILA 1YEJL 1D6EB 4XP9H 1Y6KR 1DBAH 1ZAGA 4JFPA 2NNAB 4UUJB 1JZ3A 2VDPL 3FB8A 4O2EA 1ZT1A 1S7RB 5HI4C 5ACZA 4AL8L 4CU6A 4KKBD 5IB4A 4HIHA 2W9DL 1CDHA 3RL1B 4PRPA 3WFDL 5CJQL 2OTWA 2YSSB 3I2CH 4X98B 4Q6IB 3MROA 2X9YA 1W0WA 5I18H 5E8NA 3MGAA 4H8WC 1G7IA 2ED9A 4FQJL 5EIIB 2ZJSH 2A83B 5C6TH 1RAMA 2L4OA 3MUY1 4OD2A 1XR8A 2LU3A 2V2TA 1UFUA 3F62A 4ZUUB 4F8QA 2Z8RA 2CRYA 2FIRT 3QG6A 3GM8A 1AY1L 3GMLA 3JTSA 5EUOB 5HPMA 4PRAB 4C56B 4YBQD 4JPKL 4DZ8B 2YRPA 5HY9B 2CH8A 1CLZL 3U4BH 1UWXH 4BKLA 1G7JA 4LASH 3GMPA 4RIRA 4MA8L 4ZFFA 1U8JB 3PGDB 3QJFB 4ZS7H 1MH5A 5DFVD 4ESKA 3IKCA 5GS0L 4MJ5B 4EI5A 5AYUL 4N5UA 5I1CH 1J87A 2OP4H 2E3VA 2GJZA 2R9HC 1I7TA 3PIQB 2A9MH 5TPWL 3H9HB 3NZHL 1LE9B 1XGQB 3P9LA 3VXRA 3MA7A 1C5BL 1OAXL 1I8KB 3I50L 4JY5L 5C86A 5L2KB 5CFHA 4CDHA 2F53D 5E8PB 3UTTB 43C9B 4N8VB 5I75C 1OL0A 3MV9B 1AXSA 2P4AB 1F90H 1FPTL 4MQ7B 2DKMA 3F12A 1B4RA 4ZAKC 2X09A 1RJZB 3C8KA 4POYA 3M07A 3O2WL 5TQ0L 5IW1A 2OTUA 3RPKA 4FFVC 3K8LA 3HC3H 1INQA 3QZWG 4N1EA 1KCLA 1T4KA 1WLHA 4IRSB 5EZOH 1BHGA 1J1XL 1YEKH 3QG7L 2YD8A 2AJYL 1YNKL 2EDJA 2N56A 3ALXA 5ERWA 3KVQA 3LS5L 5E95B 5E9DE 5J1AB 1VKXB 2EDTA 1L0YA 1QA9A 3ARDD 4QHNA 5F1NA 5F96H 3DJ9A 3OPZH 4L9LB 1GAFL 5D5ME 4RSVA 2APBA 3VD5A 2VLRE 3Q1SH 4I5BA 3LEXA 5K59F 3NOIA 2O5YL 4Y0GA 3DI3B 3I75A 3ESVF 5KS9B 4O51A 2A1WH 4ONOA 5DEGB 4K9EH 3ARSA 2HH0L 3HE7D 5A2JH 1UXWB 5DQ9B 4WUKL 2GSGB 4L8BB 5T33H 4Q0XL 4R4FL 2WBJC 1AGBA 5ADPL 1E4KA 3SBWC 3OG6B 3S8WA 5DC9B 4MDJB 3EDFA 5T1LA 1KXVC 4UNUA 1JYWA 3GDBA 5EPMB 4U1NB 2OBGA 1F8TH 4HUXA 1U8OA 6CGTA 3GSNA 5CGTA 1KN4L 3JV4B 4WEUD 3NBNA 4LSSH 3DURB 2C4FT 1T3FA 1HOCA 4HPYL 2PO6C 1F2XK 1A6PA 1IAIL 4DEPB 1FIGL 3N50A 4PP1D 4P23D 3NAAH 3T0DA 3KPOA 1UJ3B 4BFIA 3BYTA 4NM4L 5FUOH 3O6FC 4HUVB 4PG2A 5JOPE 4WW2B 3DWTA 1BWWA 1J12A 4U6YA 2B1HH 4P57A 1ZT7B 4QYOB 4N1CA 5EZJA 2CKBL 4K94C 2OZ4L 2ADFL 2Y07L 4XVTH 5IMMB 4LSPL 3S36L 3ZKMC 1I9IL 4OJFL 2DN7A 1QEWA 4AMKH 4EOWL 3WKNA 1I1AB 4GBXB 1NCAH 4X9GA 3OKLA 1ADQA 3P77B 1UCTA 4BA8A 5CWSA 4XAWL 2Q6WA 1G6RA 3BD3A 5EU5A 3LVEA 5C9JA 1FAKT 2XKUA 1YYML 4KROC 1MUJB 2B1AH 5TH2A 1AR1D 4JHAH 2AXGA 1A47A 1Q0YH 5E5UB 1QKZL 4FNLH 5IF0A 1NGZB 3VFNA 1W72L 1JVKA 2AEQL 3PWVB 4POZD 4XRCA 1W8NA 1FVEB 4MNHB 3A6BL 4EN3B 4MSWA 3TCLA 3DARA 5ESVA 1KGCD 3C08H 1KCVL 5D8JL 3SGEI 2ERJC 4MNQE 5IHUH 4OGXL 1R5WB 3CH8A 3ARQA 1R5VA 4NQEA 4YAQB 4C56D 4PR5A 2CLRB 5KSAB 43CAA 4HJJH 1J8HA 4Y5YA 4TNVF 1UYWL 5I74C 2DLHA 3QUXD 3U7WH 1QNZL 3BP4B 5C2UB 1BQHG 1RJYB 2BJML 3WXVH 3UTSE 4LPXA 5C07B 2ZUTA 3CCHA 1F4AA 5TQ2H 4DFIA 5I1EH 4KVNL 3LS4H 1LE5B 4EXKA 1OM3L 3QUMA 3ILQD 2X4QA 4HUUA 2Z8VC 3O3BB 1VESA 1LO2L 2EDRA 3MJ8A 4JM2C 4XNXH 1KEMH 3B2VL 1MNUH 4JFEB 5FKAA 3HAEB 1U93A 4D2NA 4FXKB 3MLUL 1M7IB 3T0BA 3UTTD 3MV9D 4J3XA 4TUJB 2F53E 2G75A 1IQWL 4FA8A 5DJCB 1A6TA 5GISH 2HT2D 3QIBC 4TUOB 3EO9H 3U36B 2O61B 2X5PA 1NQBA 2NCMA 1MCEA 4NZTH 5E08L 1CVSC 4KTYA 2PW2B 2Z93A 4JJHA 4IRSD 2HWZL 3GI8H 3WBDA 4PGEA 3QO0B 1FNLA 1ACZA 3MCLL 1MHEB 3S96A 2HRLA 1IBGL 3VXSD 4MAUL 1FL6B 1OAYH 1MCWW 4NQDB 3RNKA 3HAEH 4WWKA 2XWBA 3CZFB 3EJYC 2AXFA 3O6LL 1YQ2A 5ILTH 2W9EL 1BEYH 3FRUA 3ZYJA 1F5WA 3HCVB 1KPRA 4F9PC 1AFVH 1K8IB 5AZEH 1ZWIB 3VE0A 3FCTB 3RY5A 1T2XA 2EYSA 1KTLA 2VZOA 3ZE0F 2WLZA 3KPNB 5F9JA 2XRAL 4PJBF 1F3RB 3BP6A 1UZ8A 2DMBA 4WI4A 4NFDA 3RUGF 3MLWL 3MRKB 5E1AA 1HHHA 4MJIE 5HI5D 1AC0A 4HF5L 4RFNC 1A4KB 1RIHH 1UT9A 1XF2A 4MYWB 1OAUH 3ZDYE 3EYQC 3HNVL 3QDGB 4MCYB 4LBEB 4LCUA 1FHGA 5DLML 2R29L 1LD9A 3MRNA 3K81A 4X4MA 3QPXH 2FYYB 2GITA 3T08A 2A73B 3NIFE 5D7IA 5D2LF 3PHOA 5BQ7B 4R0LA 1U2HA 5DMIH 4YK4C 3U7YL 1MIMH 2G9HB 4F15C 2JIXA 2W0FA 4NPYB 1DDHB 1WGOA 4I3GA 2R1XA 1SQ2N 1TDQA 4KKNA 4MB5A 1HH9A 1JHLH 4PRIB 2AXJA 1QFWH 4MXQD 4FFYH 2BHYA 2X4UB 4MA1C 5T1MA 5B39G 1JWUB 1ZKAA 3UTPD 3TGXA 3RFZC 4P9ML 1KJ2L 4NKDB 3QULA 4DKFH 2DLIA 2BY2A 3G9VA 4S2SB 1MRFL 1BFSA 2VLJE 1DLFL 1CBVL 3BKCL 1LDSA 1EEZA 3MLVL 1WCQA 5F7NC 4D9QE 1WAAA 4Y4KB 3G5VA 1I1AD 4S1DC 2LU7A 1DQTA 4PV8A 1A21A 3VGBA 2H9GB 5CBEA 4P2OC 3LZFL 4HXBL 2AJZB 3O4LB 2F8OA 5B3JF 2M1KA 3TA3C 4LOUC 5MHSD 4GG6F 5SWZB 2WW8A 1YY8A 4O4YH 2BC4B 1YMMA 4HXAL 4ERSL 1NGPL 1MFCH 4ODXB 3MRJA 1I9JH 1IAKA 5DYOB 2FIKB 2HG5A 3V5KB 4UU9A 4JM4L 1IL1B 2DRUA 1N4XL 1TFHA 2DJUA 1I8IA 2PTTB 3BIAX 1BLNB 1DLHA 1E28A 3MYJA 5DVLA 1NMBH 5DA4A 4EN3D 5I8KL 3NA9H 5F7HA 2IFGA 5CD5D 4NYLB 4YBLC 1A7QL 3MBEB 2YZ1A 4XBPB 2HYMA 1DQDL 5FO8B 2DTSA 4HKJA 4U3HA 1EVUA 1KGCE 1ZA6A 4FQLH 4O5LH 3JWOH 5KSAD 1Z5LB 3KPSE 5CJ8A 1P7QB 5IQ9A 1BD2B 2A6DB 5DJXA 1MAML 3H42L 3MREB 1J18A 3VFTB 3U0PA 5C07D 1T80A 4HS6B 5I1DB 4X83A 1HILB 1JPGA 1BVLA 3HPJA 2AQ2A 1I9EA 3IAPA 4M48L 3SPVB 4JFPB 5D6DC 4CVXA 3EOTH 3FB8B 4O2EB 3RGVB 2VXVL 3HA0A 1JMXA 1ZT1B 5ACZB 4JFED 2R0KL 5FGBC 4QNPF 4UQ2A 2BK8A 3FO2A 2Z31C 5IB4B 4HIHB 1CCZA 4KKLD 4PRPB 5L2KE 3V5DA 2OTWB 3OGOE 4LCWA 3CSGA 3MROB 3IFOA 1SBBA 1XH3A 4ELKA 1W0WB 5E8NB 3RQ3A 1PQZA 5GGUA 4KRLB 3ECBA 4IEFB 3HUJB 4OD2B 3AY4A 1XR8B 3PP3H 3RVWC 3CDFA 5FUZL 4NT6B 4D0DB 2V2TB 2FECL 4FHBD 1GPOH 1SEBB 5IFHH 1G7PA 4NQDD 1ZLVH 1I3GL 3GMLB 5KOMC 3JTSB 5HPMB 2GEEA 1WEJL 3HMXL 2RFXA 3GMOB 4KK9C 1G7JB 1CXIA 3GMPB 4IRZL 2C1OA 4X5XB 4JZJC 2F9BT 1MH5B 4XCYA 3RGHA 2VLKB 2X42A 3H7BB 4NOFA 4EI5B 3O4OC 3MLSH 1U6AH 2GJZB 1J11A 5KS9E 4Z7OE 1I7TB 2FATL 2D7MA 1B88A 3P9LB 3VXRB 1H3UA 2J5LC 4LVNC 1NUNB 4WFFD 1VCAA 3GEWB 3P73A 3UYRL 3PGFL 5JTWA 1B0WA 4RCAA 1D5ZB 1NFDA 5FO9A 3FT4A 3L5WA 2G60L 1OP3H 5D1ZA 3SEPA 4TNWF 5GJSL 1EGJL 1NLBL 3QDGD 3DYPA 5BV7L 5I1KH 1AXSB 3CDGA 1OP5K 3F12B 4TTDD 1MHPH 3SE8L 4LLWB 2R0LH 1ROWA 5I71B 1RMFL 3FTGB 5ECJE 4ODBD 3VMNA 2ID5A 2R0WL 2OTUB 4PGCA 1INDL 3CLFL 1INQB 3IRPX 3X11A 3GGWB 4GRLD 1T4KB 3OB0K 4GAGL 4WI8A 1U8NA 4M02A 2ORBL 1U91A 1BZ9A 3K7UA 4QWWD 5DD0H 1EMTL 4U49A 5I9QC 1TJHH 2VWEE 3E0GA 5ERWB 5JIHA 5EC2A 1TETH 4PREA 1VFBA 1QA9B 2GHWB 4D8PA 4QHNB 4TNVK 5F1NB 4NCC1 2LVEA 2VLLA 5BO1L 5T1DH 5J6HA 4I5BB 5FHBL 3QIUC 5JXEA 4N0UA 1GH7A 1F58H 5IQ7L 2OJZL 4KQ3H 4X8XA 3IS0X 4M6NL 4Y4KD 3HLAB 4NCC2 2YKLH 5HD8D 4E9LA 3CK0L 4XPAL 3O4LD 1KFAL 4DUXA 4JPWH 4KI1A 4FZ8L 3C2SA 4QF1A 1L6XA 1EIBA 5SWZD 1L9NA 1AGBB 2OL3L 5F6IB 5MHSE 2HKFL 4LPVA 3SN6N 1X5LA 4A2LA 4YFEA 4AH2A 4PJFB 4JRWA 5T1LB 4X7DC 1WQVT 3Q2CA 4YH6A 5D2NB 5DTFA 2HT3D 5I16A 4NN5B 3BGFB 3QAZC 4RFOH 3WXWL 4BUGA 3SKOA 4XWOC 3GSNB 3EYSH 4LSDA 4YWGH 1UWEL 2FJGA 1RURH 1RUAH 4NRZA 4I77H 4K2UH 2VDKH 3OGCA 1HOCB 2HJFB 3SKMA 3MBED 1JRHH 1PZ5A 4NZUL 5EIVA 1N0XL 1A22B 1ZHNA 3VD7A 5C92A 3OV6A 3KPOB 1PEZA 4BFIB 2EDFA 4G8IA 1RFDH 3ZKSD 2ED8A 1CGTA 2B5IB 4PJXE 4DCQA 3ZHLA 4YC2C 3G6JF 2FGWH 3QIWC 1BD2D 4Y2DA 1CGXA 2GFBA 4JG1H 5H94B 4P57B 1IC1A 4F7EA 4RBPH 4XP1H 3V52H 5DZLA 2J8OA 4MLSA 3GSNH 1N5AA 1HH6A 3MRDA 4LQFH 2IGFL 3WIIH 1R3KA 4RZCA 5C0NC 2DMKA 3RGVD 2AAVA 2CSPA 1TMCB 3OKLB 1FYTA 2P5WD 2Q6WB 2Z9TA 1G6RB 5DVMA 5EU5B 5JA8B 4A6YL 1AHWA 3TV3L 2FEEL 3UBXI 2X89A 4AEIH 2YPKA 4JFEE 2IBBA 2LE9A 1CGSL 3D1MC 4XPTL 5A1AA 2IQAA 4RRPG 1R5IB 5DT1L 4ODWB 2VR9A 5TH2B 3UDWA 4KK8C 2AXGB 1E4XI 4C55A 5E2UL 3O8XD 2Y4SA 3VFNB 4JKKA 1FLRH 4KAQH 1KCUL 1K4CA 2IQ9L 2H3NA 1Z2KA 2X70A 1CFQA 5E6ZA 2JKXA 4MSWB 2W92A 4UAOB 3TCLB 3WL9A 2XZQL 5ESVB 3EOAB 4O58H 1G6RH 4ZTOL 1ZTXL 5GHWL 1I8MA 4G6ML 1H9VA 3PXJA 1PKQA 4F7MA 4PJDA 4PR5B 1LNUA 2HP4A 1UKSA 2P43B 2WINA 1RK0A 5CJXA 2J2ZA 5F9OL 3G04A 43CAB 1J8HB 4Y5YB 3IRZA 2BFVL 2JE8A 3BUTA 4G8GB 4TQEL 5I1IH 4LMQE 2BHZA 4NHCL 5BVJA 2BZDA 1I1YB 2VLKD 1X7QA 1JNNH 1D5BA 3GIZH 4LU5H 3MRIB 3C6SB 3W0WB 1ONQA 5CMAB 3LY6A 4PTUA 3ZE1F 3DECA 4OV5A 4YIQA 3QUMB 2X4QB 3GJEB 4HUUB 2EH8H 1KPUB 4H88H 4PJ5E 1IFHL 5ANME 4NNXA 3WS6A 3SDDB 4WFFE 1H3TA 1U93B 1G1CA 3BX7C 4MHHI 1NMAL 2L0DA 3ZO0A 4XH2A 2VQ1A 1QFUH 2G75B 4XMPH 4HZAA 1JGLH 4ZD3H 1A6TB 3RY4A 1B4JH 5LQBH 3SDAB 3TH2T 1PBYA 4IBLT 4M9OA 3UTZA 15C8H 1ZXQA 4KJWD 3QQ3A 1VACB 2ZOKA 4OM0H 2Z93B 5FA3A 2ZZUT 4PGEB 5IR1A 1CD8A 1WBYA 4Z0BH 3QUMH 2E7LC 1IGFL 3S96B 3RNKB 5DRWA 1G7QA 4WWKB 4V2BA 2E27L 4WI6A 4FQ1L 4ZPVA 2AXFB 2VZ3A 3FRUB 4PRIE 1IC4L 3WN5A 4XVJH 3WJJC 1IKNC 3DBXA 1H3XA 5DMYA 1LP9F 3VE0B 4K3JL 1YJDC 2EYSB 1KTLB 4U0RB 3PHQA 3QDJB 3BP6B 5GRYA 1UZ8B 1A3RH 3PL6B 2CDEA 4FOMA 3DUHA 1N5YL 5FOJA 5HGGS 1NKOA 4D3CH 3KJ6H 5DMGD 5E1AB 1HHHB 4Y5VA 4F9LA 1F6FB 4TUKL 3RVVC 4DGIL 3W11C 1QG3A 4JR9H 2ESVA 3NIGF 5SWZE 4NBXB 3DOSA 4GKNA 4LCUB 1FFPB 1YPZF 2XT1B 3HC4H 4M7KL 1LD9B 3SKNA 5GGRA 3MRNB 1J0HA 3O3EA 3U30B 2GITB 1YC7A 3F5WA 3IU4L 2IFFL 1RUML 2VABA 4H20L