4KROD

Nanobody/vhh domain ega1 in complex with the extracellular region of egfr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
213
Chain Sequence
b'QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epidermal growth factor receptor
publication title Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
total genus 36
structure length 213
sequence length 218
ec nomenclature
pdb deposition date 2013-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kroD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kroD01
4GXVL 4JZOA 4NRYA 1TLKA 3S35X 1UXWB 4HW6A 4WEBH 4PJAF 3FT3B 5EBLB 4PRPE 1J5OL 1N7MH 1VGEH 2VDLL 4QXGH 3VD9A 4GKOA 5B39G 3QAZC 1BMGA 2VNCA 5IHUL 4F57L 4NWTL 3S35L 4AYFA 1GHFL 3BMVA 2SEBB 3FONA 2C4XA 3RVWD 1IVLA 1ZVYA 3OQ3B 3QXVA 2XWBB 4KRPD 4XP6L 4WUUE 4KK8C 3U0PA 1T03H 4P2OA 4ZYKB 3W0WB 1HCVA 5ILTH 3CFKB 4NN6C 1NGZA 5E70A 3FN0H 1MAML 3X3GH 4GBXD 3M45A 1P4IL 2ATKB 1KPUB 3DVNA 5KSBF 1VEOA 5ID0A 5FUCE 5FK9B 5IGXH 4LASH 4WJ5B 3LD8B 2BOBA 3NFPB 3RIAK 4OV6F 4M43H 1L6XA 3WS6C 1A6UL 3NIFF 2VL5A 2DLEA 4X6BB 4KHXL 5IB3B 1ZLSL 2D7TL 1RK1A 4ZAKC 3TVMD 1BJ1J 3NACL 2GY7B 4TVPL 4FQQA 5CP7B 3I9GH 4KKBD 3EHBD 2V2XA 1CGVA 1C08B 1ERNA 4JFYB 3HZVB 1WIOA 1KCUH 1U91A 1P69B 1OQXA 5D7LD 3ARDB 5E8PB 1QTYT 5IESL 2DLFH 3F65A 5EU5B 4LSPL 5D1QB 1EFQA 3OG6B 3SPVA 2UY7A 1OOAA 3BEVB 5CAYB 4GXVH 4IM8A 4X6EB 2EDNA 3VMPA 1TVHA 1BD2A 1S7XB 3LKOB 4X7DC 2HTLC 2AV1B 1GGTA 4S1SL 1UZ8A 3T2QA 4XH2B 3RZCD 1XR8B 4U31A 5EFIA 3RGVD 3IFLH 1OP3H 4M5ZL 2DS4A 5DHVH 4PRHA 3FQNB 2BSTA 1KIUA 4Q58C 2AEQH 2OQJA 1HOCA 2B4CL 1MAMH 3R1GH 1N0XH 4QHLB 1NCBL 5BQ7A 5TF0A 1H3PH 3EYSH 4IRJB 3T08A 1QBLH 3L3DA 4OZIB 4IMLB 3U9UA 2VLJB 2A6KA 1SYVA 5DT1H 2R1WB 3DO7A 3N1QC 5E9DB 2DQEL 1F2XK 4ONOA 4F7PB 1G7IA 4MNHA 4C83A 2X7LA 2GTWB 3E6HA 4DAGL 2L0DA 4K7PH 3UTTA 4PJ8D 5IESH 3L5WB 2ESVB 3UAJC 3VXQA 4LSPH 1NGXB 1FPTL 1U6AL 4R6UA 1B88A 4Y16B 1A6PA 5KVFL 5I76B 1GZQA 4ZDHA 1RZFL 1NCWH 3SJVE 1PKQE 1RJLB 2A6JA 1YPZE 3CFDB 4GW4B 4PRIA 3HR5A 5C0JA 4HCRL 1DR9A 3C5ZC 4E41E 5GGUA 4XNQA 1H0DA 5JHDB 3STLB 4PREA 4ODWA 4PJ5B 4D0DA 1P6AB 3F6LA 1ORSA 3BIAX 3BO8B 2G75B 3HR6A 1U58B 5IVXF 3BIKB 2ED7A 1T1WB 1CFQB 3MODL 3QDGD 3GBMH 3MRHA 5JPMA 4XGZB 1EBPA 4HIEA 3KHQA 4KVCL 2FIRT 2BERA 1T1YB 1RZ8A 3EZ8A 3TO4B 1Y18B 2WZPD 2ID5A 4LCCC 3TPKA 5DUBB 2BVOA 3KXFE 4OQ1A 4OGYH 1SHMA 3WSQL 4PP1C 3TC9A 2JJVA 4UNUA 1A6VL 5ICXA 4UT9L 1JTOA 5CSBA 3G9VA 3B9KB 3BPLB 4KJWD 4Z18A 1JZ8A 2HWZH 1V7NH 1MEXL 1AHWC 4DAGH 4U0QB 4OZGF 1XF2A 2UZXB 1KPRB 4Z95L 1MCFA 1BOGB 1FBIL 3MUGB 1UXWA 2QR0A 2CSPA 1AD9A 1FV1B 4GOSA 5EBLA 3QJHB 4PFEA 1ZGLA 1PLGL 1BFVH 1KB5H 3L3JB 1I1RA 1RU9H 1PY4A 1A4KB 2SEBA 4YBQD 3BN9C 2GEEA 5BV7B 1YYMH 3W0WA 4ZYKA 2FJFB 3FHQA 4H1LG 4G6KL 3CFKA 5I8OL 4ZO8A 3TH3T 3HNVH 5JUEL 5I8CB 5IFAL 1AQDA 3UXFA 2ATKA 5CWSB 3VMOA 2E9BA 4APQA 2D4DA 4GAJL 5FK9A 5J1SC 4WJ5A 3CDYA 4G9FE 4JY5L 4I5BA 4PJAB 4URTB 3NFPA 4AQOA 5C0RH 4YDJB 1UJ3B 2IBZX 2NY4B 4X6BA 4YHNA 3DV4A 2EDXA 3GI8L 5CP7A 4WTZG 3VXTB 3HRZB 4YC2C 3VG0L 12E8L 2UVFA 4PJIF 4JFYA 2K3TA 3VGAB 3MRPB 4UT9H 3EOBB 2DLHA 5FA3A 2EDHA 4P2QE 3MJ9A 5EU5A 3PGFH 3D18B 4KQ4L 3MYJB 2XQBH 4RX4A 3JWNC 5I1AB 4Z95H 3GHBL 2X89D 2VB5A 2E5EA 1F58L 2CKBH 1IE5A 1OAUL 2WLZA 1S7XA 3HE6B 5B3NA 3EJZC 3LKOA 4NM8H 4ODXB 1G9NC 4J4PA 2AV1A 1R5VB 5EO9B 4TTGA 2F19H 4JHWH 3WDIA 3F7VA 2HT3C 4XH2A 5DVNA 4IMKC 2WWMD 1XR8A 2BNUB 2X40A 2R2BA 1PDKA 3DHJA 1PSKL 1UZ6F 4H0HB 5IVZB 2XY2A 3MR9B 1MCCA 3CXHK 2AK4A 2Y6SD 5F7EH 3AM8C 4ODTL 4X4ZA 3LKSB 2ICEB 3EDFA 4IRJA 4KK6D 3IXTA 4U3XA 1Z0MA 4LVOB 4NWUL 4KI1A 3VFGL 2R1WA 3UTZB 5ESQB 5T1KD 3HS0A 2OSLA 5E9DA 4HS6A 1FVEA 4F7PA 5CLWA 4F9PC 1JI2A 2DD8L 3L5WA 1P2CA 1XMWA 4N9OB 1BJMA 4KQ4H 3QP3A 4WHDA 4XBPB 4Z7OE 2MPAL 1ZT4B 4IRSA 5IWLA 2J1KA 3QO1B 5I76A 5I1KL 1FE8L 2XG4A 2BVYA 4UAOB 4W70A 5IJKC 5CD3B 4HBCL 1RJLA 1KB9K 3CFDA 1DSFH 1F58H 2EDTA 2IBZY 3BZEB 4QTIH 3L1OL 2V5YA 3RDTC 3HG1E 4GUPA 3RUGE 2FB4H 5A3IC 2VDKL 5JHDA 4JO2L 4OI9A 4Y4FD 3STLA 2EXWC 5E4EB 4PJ5A 5F6IB 4XNUH 5E4IA 5SWZD 4ALAL 1UB5A 4R7NB 2G75A 5F97E 3RHWK 4RISL 3VFVB 1I7UB 3BIKA 1CFQA 1S9VB 2IADA 4CRPA 5BVJB 5ERWA 3ILQD 2E7LA 1UA6H 3C6LD 2GJ6D 3PQYB 3MV7A 2V5SA 1T1YA 4XVUC 5B8CC 1Y18A 2PNDA 1YMMA 2F9BT 2EIZB 3HAEG 3L9RB 4HC1L 3BZFB 2PN5A 5LGKA 2UUDK 1QFOA 2IQ9H 3I75B 5HYJE 2AERT 3RJQB 3FMGL 3B9KA 1LNUB 2IBBA 3AS2A 1W72L 1OVZA 4DGVL 4IDJH 5IVXB 2XFXA 5IHZA 5I1JL 4CVWA 4P23A 1KPRA 5EUOF 4C56A 1EVUA 3RKDC 4O4YH 1BOGA 3B2VL 1JGDB 3MUGA 2YHGA 1I7RB 2MPAH 4LLMB 1KNOB 4ZFFA 1FV1A 3NFSL 3S3PA 5IBLD 4UIMB 5CJXA 3QIUA 3QJHA 1CF8H 5I66B 2IG2L 1RUML 2ITCB 4DKAA 3EKCA 5T1DL 3S5LB 5L7XH 3L3JA 4HLJA 1A4KA 3OG4B 5H94A 3IDJB 2I07B 3ULVC 1JN6B 4OM1H 3RVXC 4XC3L 5J3HC 3PP4L 1OARH 4P49A 3HUJA 4XNXH 4OZGB 5FYKU 3QEQE 5I8CA 5DC9B 3D2UB 4NQDB 5GGSY 1I1AC 3BUTA 4EJ1C 5J13B 4FA8A 1B4JL 2ZP0T 1OM3L 3SDYL 4P46C 1CD1A 4PJAA 3TCXA 4HWBA 4LVNC 4YDJA 3IDXL 3B5TA 1CE1L 3VXTA 1HYSD 3NA4A 1S7UA 1H8OA 3MZGB 4S11A 1UQSA 4QF1B 3MRPA 5JO5B 3SDAD 3EOBA 3FMGH 2WBJC 4RMRA 4YO0B 4D9QD 1I85A 3D18A 3HZYB 1YJDL 2ZKHH 3VXSD 1H5BB 1MI5D 5FYJL 1JPSH 4QTHB 1HILA 2J8UF 3NFSH 3T0XA 3CZFB 3DX9B 3B9VA 1UM6H 4GS7C 4M7ZB 3GFUA 5AWNL 3VXME 4NQCE 5EO9A 5T1DH 4Q6IA 2Q6WB 3ARPA 2EDBA 2YD5A 5DURD 1LK3L 1B6DA 3T3PE 2VDML 3N0PB 5DJCB 3FAWA 1Q38A 4PJIB 2BNUA 2VMFA 3W2DL 3M1BB 1FNFA 2WWKT 2OJEA 4QHUB 3CSYB 4P2OC 4MS8C 4Z7UF 5J56B 2OTPA 5D1ZB 1JVKA 4Q0XL 5IVZA 2AJXL 4XPGH 1G6RB 1Z6JT 1S7VA 3MXVH 4TSAL 1MVUB 4NC1C 2XTJC 4U1GB 1B4JH 1P6FA 3LKSA 2ICEA 4Y5XB 2GAZA 4P4KD 2YPLD 4QRUA 4TRPL 5AG9A 2HMID 5KANG 1JPTL 3IDXH 2XWTB 4MD0B 2X4SA 5HVWA 3UTZA 4F9LC 1RJYB 5ESQA 4N1CA 4NN5C 4YFLI 5IJVB 1FO0H 5I16A 5KVDH 3S37H 4X8JB 5IFJA 1DLHB 2QEJA 5GSRA 3LQAC 4DKEH 4ODHL 2IANA 1R3JB 3GI9L 1CFBA 3MROB 1HSBB 3QRGH 3MBEA 2CJUH 1IGIH 1FZMB 4FRWA 2R4RL 3IJSB 4XBPA 3QYCA 5GS0L 1ZT4A 1NLBL 2IPUK 3QO1A 4UTAH 1AC6A 5BZWB 5CD3A 4MQSB 1EO8L 5HY9A 3BZEA 5JORB 2FRGP 1JF1B 1N3NB 4MQTB 3SDXE 5C07A 5CIPA 5AWNH 4OZFB 3ZDXE 4I3GA 5I8KH 1R24A 3PXJA 2VDMH 3TCLB 2VIRB 2PCPB 4H20L 5C3TA 3VFVA 1I7UA 1LO0H 3GJFH 1KENL 1AO7D 1S9VA 3T65A 1MCOL 2FNBA 2MHAB 5BVJA 4NQXB 5BJTB 3LN9A 5F7HA 1UM4H 1O0VA 2DAVA 1DQDL 4YDLB 3KPSD 4P9HH 3MRBB 4F58L 3PQYA 4P59L 5MEPA 1SEQL 4H88L 3T1WA 2NY7H 4H26B 3LPFA 4BZYA 1B90A 1MCIA 4M61B 1R5WA 2CUHA 5I1EL 2EIZA 4M3JA 5D70L 3FL7A 1JPTH 3O3DB 3S97C 5CUSH 3GGWA 5A43C 4PLKC 5FUZH 4OCMC 3ARFD 1ZT1A 1LNUA 4UQ2B 4JFED 4ODHH 4L4TB 1V7MH 3EJYC 3QI9B 3BWAB 4OCRL 2CDEB 3T4AB 1VKXB 4M4RA 3EOTL 3ZDYE 4JCMA 4L8CB 1T0NB 1KNOA 1NLDL 1OAKL 4OLYL 4UIMA 1OP5K 1IGFL 1RZ7L 4HAFA 1CT8A 5HD8D 3KPRE 1NAMH 4LRNH 4JPVL 3S5LA 4X98B 2Y4SA 5ABDE 1NGQL 1FL5B 4HUNB 4YLQT 2APXA 3ESVF 3BQUD 3BGFB 1NGPH 2WP3T 3ZYIA 3TIEB 2LVEA 4JFZL 1QFWM 1SJEB 4M6NH 5GJSL 4H20H 3U1SL 1A14H 1KENH 3QFJE 4OZGA 4MJ2A 3C08H 5LGHH 4Z7VF 4OFYA 1F6AA 3D2UA 4NQDA 2BSSB 5EUOB 1U3HB 1YNKH 3KAAA 5GRVL 3L3KB 2NY1C 4X80L 4F58H 1TPXC 4RAVB 5ISZE 5A2LH 5J12C 4LIQL 1SBSH 5E5MB 3Q6FA 3WIHA 4LAJH 5F1KC 2D7PA 4U1KB 4Y8AA 5DSCA 3U0WL 3VXNB 5ID1B 1NUGA 5D70H 1IAMA 2ATPB 5EIVA 5TDNB 2QKIB 1X6LA 5C09D 3BH9B 3HZYA 1NFDE 2R4SL 4MDJB 1FZJA 2XXMB 2DL2A 2PTTB 1H5BA 3DVIA 4FTVE 1ZHBB 4BFEA 3ME0A 2BMKA 1YA5A 5SWSE 4OV5A 4LPUA 3ZT6A 1DBBL 4QTHA 1NLDH 1OAKH 4OCWH 1F45A 3CZFA 3DX9A 1IGFH 4AJ0A 4LCWE 3U48A 4I48B 4B50A 4WDIB 2Q6WA 5KG9B 4XB7A 4OI7A 4D2NA 4EBQH 3K46A 1AP2B 5C08B 1VFBB 1I3UA 1NBZA 3CFJB 5HYEA 1BQSA 3O9WB 1S8DB 4ZFOA 3VH8G 5DJCA 4PJHE 4PJIA 3TT3L 1YECL 3M1BA 3CSYA 1FFNB 4JFZH 3MRFB 4JDTH 1TENA 5D1ZA 2DQUL 5GJSH 1BM3H 3D9AL 3ARTA 4WI2A 4RBPH 4W4OA 1CXIA 1U3YA 1G0XA 3O6MH 3WIFB 1X44A 1X5AA 4MX7B 4APQC 1J11A 4LSTL 1HHJB 1X5XA 2J8UB 4Y5XA 1YEEH 2XPGB 1BF2A 1NCTA 4PJ9B 1FIGL 4LSVL 3VGGA 1R5IA 2CQVA 3FN9A 4MD0A 4ZUUA 1A7PL 2QADD 4HXAH 1K8DA 4N0UB 3C5JB 3F62A 5KSAA 5C0ND 5IJVA 5DJYB 4X8JA 1UWEL 2D4FA 4JRYA 4S2SB 4EVNB 1R3JA 2ERJB 3SQOL 3MROA 4BH7B 1HSBA 4Z7UB 2I5YL 4LHUA 4CVZB 3IJSA 5FOJA 2P5EB 1ZS8B 3MUZ1 3UTPE 1LE9B 5BZWA 4YIQB 1DBBH 4L4JA 1WICA 4KK8D 2IMMA 3MRMB 1N3NA 4ZPTB 5CFHA 5D5MF 3FQRB 1J1XL 1XGRB 1BVLB 2I26N 1MJ8L 4N9GB 3GKZA 4NRZB 3P30H 5L8KB 2GITB 4YGVA 1K4CB 3TCLA 3QCVL 4G8GD 2VIRA 2VUYA 5EZJB 4ZTOL 1ZA6B 3TT3H 4ZFZA 5ALBL 2MHAA 2DQUH 4NQXA 3V8CA 5HI4C 5BJTA 4YDKH 3MRBA 1IGTB 1AR1D 2AI0H 1F8TL 4OCNC 3CX5J 1IEBB 1JV5B 2D7OA 3O45B 2DQTL 3BP4B 3EO1A 4H26A 5CJOH 2ICWB 4NQSA 4PJBB 1VFUA 3DROB 4RRPA 5K9KA 4IRJC 1WBZB 3HZMA 1FIGH 1Q1JL 4XP9L 2VDRH 4LSVH 4DGIL 3TBSB 3ULVE 2Z31D 4YEEA 3LEVL 4PB0L 1U42A 3QUMA 5FCSH 3FAXA 4J3XA 4G7YL 2KUTA 4L4TA 3DVFA 3QI9A 3UYOD 3T4AA 5MEOB 2X44D 1FYTD 1VKXA 1T1XB 2XT1B 2HTLD 1LK2B 1YN7B 1T0NA 4IRSC 5IWLC 4KUCD 6CGTA 1QO3A 4HQQL 4NNXB 2OBGA 5J89A 4FFVD 4QXUL 1J1OL 2VXVH 1FL5A 4EI5B 5HHXL 4S10A 1MREL 2X9YA 1VB9A 3QG6A 1I8IB 1MJ8H 4NN7B 1E6OL 5IQ7L 3CSBA 5JDSB 2A2QT 1SJEA 1S7WB 4Y4HA 1IT9H 1V3KA 2CK2A 2X4PB 1VFMA 4ODUB 5BVPL 3U9PL 3RVTC 5C70A 1UB6B 5ALBH 2AXFA 1KUMA 1U3JA 5GIRB 2C3GA 3GBNL 2E7LC 1TJIL 1U3HA 3FB5B 5JXAH 3CZJA 1AGDB 3L3KA 4NKQB 1F8TH 4WI5A 5L0QC 4K94H 1EXUA 3JUZA 3C2SA 3QRFM 1MY7A 3FRUB 1TZGL 1C5BL 3P3YA 5HHOD 1QG3A 5D8JH 1N6QL 2AGJL 4U1KA 3VXNA 4PJDF 4UU9B 5I75B 3MLVH 3P0VH 3X13B 5TDNA 4DGIH 2QKIA 3O4OB 4BQBA 2LABA 3CVHB 3OKNB 1Q94B 3OJVC 5DJ8A 1JCKA 3BPLC 4L4VB 2GSIB 3WUZA 3PDGA 5CZKA 2AJUL 5I74B 3BH9A 2RR3A 2HH0H 3AMKA 2PTTA 3F7QA 1ZHBA 4N0FA 4P23C 5DJXB 5EC1B 1YEGL 4Z7VB 2HRPL 3IDMB 4M1CC 1RURH 4NC1E 2XTJE 1I9RL 3O4LB 5CJXC 3QIUC 3MCLH 4IS6B 2BVPB 3V4PL 3GJEA 1N5YH 1GCFA 4I48A 4HQQH 5JA8B 4GKSB 4HG4J 1RZGB 1AP2A 4QXUH 5C08A 1VFBA 4S1QL 1RUPH 4R7DA 4XVJL 3G5VB 3BXNB 3PWPB 2HFEA 3L3GB 4KV5F 5HHMB 3SE8L 5BV7C 1OGAD 1E6OH 1VDGA 4O51B 5JOEA 5GGRY 1FFNA 2APVA 3MRFA 3T77B 5I1HL 1NSNL 1A1MA 1WT5A 4OCLC 4HMCA 2LE9A 4MJIB 4WW2A 2AJZA 2GJJA 4WW1B 5CP3A 4S1DD 4CVUA 2F5AH 5C0BB 3MBXL 3LQZB 1H3UA 3U4AA 3EDKA 4JFFD 5DJZB 1DZBA 2AJSL 2HJKB 2R23B 3S9DB 3MNVB 5DTFB 1HHJA 2IFFL 3FT2A 4BSVB 1J0HA 3QDJD 4LSQH 1NFKA 2J8UA 2XPGA 3O2WL 1BD2E 1MLCB 4PJ9A 1SY6L 4OBRA 3QFDB 1CDCA 1C5BH 4AZ8A 4R26H 1JTPA 1UH2A 4LPVA 5DJYA 5ESVB 3H42L 2GHWB 5DMGD 4KK9D 2APTA 1DVFA 2B5IC 1CK0H 1GOFA 2YC1A 4R2GB 4JAMB 4G7VH 5EOCJ 1SJHB 4BH7A 1I85C 5HI5D 4PRHE 2FL5B 4Z7QE 3H3PL 4HK0B 3ZDZF 4MXWL 4QRSB 4ZS6C 3N85L 1ZS8A 1YEGH 1LD9B 1TETL 5E6ZA 4MA7L 1IAII 3BN9D 3MRMA 4ZPTA 5CJ8A 3OPZH 2X5PA 2P8PA 5DJDB 1ZLVH 2DM7A 1XGRA 4MHHG 1Q0YL 1BVLA 3PHQB 4Q6IC 1XGUA 3VD3A 4NRZA 1E4XI 4S1QH 4Y1AB 2GITA 2HLFC 2E6QA 4J12A 5EZJA 5JIIA 4LFHD 3SE8H 1ZA6A 1GGIL 3FT4A 1OF2A 3VI4E 4G42B 2F8XC 5I1HH 1J0ZA 2JCCF 1CU4H 4LP4A 3L7EB 3ZE1E 3MBXH 1IGTA 5TJWK 1S7TB 3O8XD 3IKCB 1YC7A 4M6OL 2EEBA 2ZCHL 1DBAH 1JV5A 4LEOB 4KMTL 1WV7T 4PRIE 2ICWA 4PJBA 3EIFA 3DROA 3OXSB 5KVMC 4OD3L 1WBZA 3O2WH 2BY3A 1SY6H 3ARRA 5D5MB 1ADQL 4G80B 3L6FA 3TBSA 5E6IB 5FGCB 4RSVA 3H42H 2VLME 1B0GB 4XBGB 3TBVB 1WK0A 2BC4A 4MD4A 3MBEC 2VL4A 2NZ9C 1VACB 5MP6L 3H3PH 3MGAA 3VWKB 3SDCA 4JO3L 1AI1L 3N85H 1MFEL 5FYKD 4QWWC 2R0WH 2HT3D 4WV1B 5F88B 3BI9X 2F8OA 4RMSA 2ZCKL 5D6DA 4EI5A 3RY6A 3TWCH 3ESUF 35C8L 4GRLB 4AH2B 3PHSA 4XWOC 1I8IA 5F7LB 1HIML 4ZNEA 5F6IC 1S7WA 3FTGB 2EDOA 4KTEL 2X4PA 2M1KA 1M71B 2W9DL 1UB6A 5DR5H 5C0CD 4H0IA 1D6EB 4AL8L 1KELL 4FNLL 4E0RB 1E0OB 2H41A 3LB6C 2N4IA 1AGDA 3BP6B 3LRSA 1EUUA 3R06B 1KCRH 3F7YA 4WY7L 1S3KL 3PWUB 3ARBB 2XZAL 4WEUD 2Y5TB 2NY5L 3QHFL 2BSRB 3FRUA 3HMXL 3KYNA 4K23L 3AUVA 3MRRB 4OD3H 1PYWB 4NBXB 4LQFH 4UU9A 2XA8L 1BEYL 6FABL 2YXMA 1ADQH 4W68A 5IB5B 3CCHB 3HE7B 4D3CL 3CVHA 3D87B 4EQ3A 3W11C 1Q94A 4KMQA 2NXYD 1WVZA 4L4VA 2EDRA 2VTFA 3QWRA 4JFOB 4ZQKB 4HMDA 5E5UB 5I1DB 1QR1B 4GAYB 1X5YA 4QRPD 5CBEB 5EC1A 5DJXA 2PW1A 3IDMA 5FYKL 5F72S 5MP6H 3IDNB 3JV0A 1SYSA 1AKJA 1AI1H 1GGCH 3VFRA 1CICB 3O4LA 4CU8A 4I0PA 2O5XH 4IS6A 3MLUH 2BVPA 4CDHA 3X14B 4ZD3H 3A67L 4O9HH 4TOYL 5C0GB 2V9RA 1RZGA 3GMMA 3MRLB 1QSED 1CGUA 3VRLE 4PJDB 2HYMA 3WFEH 4KKAD 5FV2A 3L3GA 3IETB 2XOTA 2GFBB 2EE6A 2XG5A 1EERB 4O51A 2FGWL 3V52L 4MJIA 5EU3B 2VC2H 3RX8A 4C4KO 1KPVB 3O2DH 3LQZA 2IPUG 1PJ9A 1A5FH 1N59B 1WWAX 2K9UA 5TGBA 3VGHA 2B2XL 5DJZA 1D5IL 4FNLH 2BHUA 2R23A 1DBKL 3KYKH 5J13C 3KGRA 4WY7H 4UOW1 5EOTB 4RFNB 5EBWB 3VFPB 1MLCA 2K7QA 4AIXA 5DUMH 2P5WB 4GSDH 4BQ6A 1NCCH 2IPKB 1VGKB 4OB5H 3MRKB 2N7BA 1U95B 1SMAA 3FQWA 4OF7A 3I84A 3U0TB 3BRGC 3GRWL 5T5NF 1DBMH 3BVNB 4PS4L 5ESVA 4E42B 1SEBB 4R4ND 1S9XB 4CN1A 3C2AL 4IOFD 3LMJL 1IGJB 1INDH 4BZ1L 2APFA 3DURA 1SJHA 1RULL 5M94B 4K8RD 1M05B 4LNRB 1G9NH 1H5BC 4M62H 4HAGA 5CGYD 3NCJL 1LD9A 1CIDA 2XZQH 4RGND 5DHVB 2AK4E 1CFVL 1EGJH 1FC1A 2W38A 4QCIA 4TNWK 5DJDA 4M1DL 3AS0A 2APWA 4TOYH 3PHQA 4PGCA 3CPLB 3TBYB 3UO1L 5FECB 5E00A 1EPFA 4HX1A 4LMQE 3HLAB 3O3BA 4V1DB 4LAQL 4FQ2L 4GMTL 2G5RA 4QKXB 5E9DE 1M7IB 3GMRB 5C0EB 4YHPB 4YZFF 3IDGA 4POZD 4OLVH 1K8IA 2FGWH 4MLIA 1RUAH 1CDUA 3MV8B 4LARL 1A3RH 1DQQA 4W4OC 2VLRB 2J2ZA 3Q48A 1QNZH 3IKCA 2KQNA 5KAQG 1D5IH 1W0YT 2DYPA 1X9QA 4DEPC 4OBSA 1DBKH 4LEOA 5CD5C 3U6RA 3WFDL 3OXSA 3MYZA 3D85B 1F4XL 4HH9B 3GSXB 3IFOA 5JHDE 2FEEI 4WVRA 5KSAC 2UY6A 3FQXA 3IFNH 4U1JB 15C8L 1MCRA 1QA9B 3ZKNC 3TBVA 4MJ5B 1IC5H 4K8RL 2UVEA 4HHAB 2JCCB 3RX7A 3GSNL 1LP9F 3P9WB 3ORJA 2YKLH 3G5YB 3SGEH 3MV7E 2MWCA 3SGKA 5DC0A 5GRJL 3T1FA 3VI3F 3S88L 4NO0B 2HFGH 3V6OA 4MS8D 4M1DH 4M7LL 1YMME 3HFMH 3MFFB 3MQIA 4GRLA 4AH2A 3UO1H 1NKRA 3BYTA 4N8VA 1IAIL 1AGCB 1H9VA 4LAQH 2H32H 4FQ2H 3WJJA 4LCIH 2VDOL 3FTGA 3TVMB 3HCVB 4U6VH 4CADB 3BDBA 4OUUB 2DBLL 3DMMD 3TT1H 1D5BB 1D6EA 1E4XL 3AVEA 3WV0A 3GM8A 4E0RA 1OAZH 4C56E 4YDLC 3MLTA 5D7LB 2R56H 5B21A 3R06A 2NX5D 1N8ZB 2E27L 2VZUA 3PWUA 2HKHH 1T3FB 2J6EA 5D96C 3BOVA 4A6YL 3VJ6B 1LEIB 3WFDH 2BVTA 1PYWA 3DUHA 4QGYA 3WUWB 2W0FB 3CDCA 4KROD 4OIBA 5IB5A 3HE7A 5F1NB 4LPXA 4I3SL 4PGDB 1QHOA 3SE4A 2LTQB 2W0PA 3QHTC 1I3RB 5EZOH 5FKPA 1KB5B 4JFOA 5I1DA 3ZHDA 4XC1L 2KZ1B 1M7DB 4GAYA 4JM2D 3HUJE 5CBEA 4HKJB 4G6AC 5DFVC 3RGVB 3GSNH 4QRRA 2EIEA 5IK3A 1CICA 1P4LB 4FQXB 4PJAE 3EFFB 3ZE2E 4DOHB 4GO6B 3X14A 3V5DB 5C0GA 1CDBA 1HYRC 5I9QC 3JWOC 2H3NB 3MRLA 3VXRA 3WNNA 2BNRB 3BGMB 4N0CD 1GH7A 3BGFC 4KY1L 3WJLA 3ULUC 2ICES 1CVSC 4JKLA 1IC4H 3HI5L 3MNWA 5J6HA 5K9QG 3MMEB 4Y4HC 4P4RB 5DZNA 5EU3A 4KAQH 3OR7B 1KPVA 3RA7H 2OR9L 4JZNB 4OSUH 1N59A 1KN4L 1U3HC 3W39B 3GKWH 4L29B 4PJ8B 3KLAA 3QXDB 3QIWC 5EBWA 3NOIA 3VFPA 5B3JE 4R4BB 1GPOH 2IPKA 1VGKA 3BP7B 3MRKA 1H15A 1U95A 1N5AA 3NIFE 4XMLH 1P4BH 3BVNA 2CKBB 4PGBB 4N90E 4V2CB 4NQEB 1SEBA 4D9RE 4X5XA 4I3SH 1A21A 3WFBH 3RWHA 3QNXB 3IVKB 1M05A 2DQCH 3A6CH 1WTGT 5FEBA 3QWOB 1JYXA 3KJ4C 2YPKB 2Y7QA 3SE9H 4JG0H 2XNAB 4LLWB 1QP1A 2OMNA 2H2SC 1DQLH 3QDGB 4XPHH 3FHAA 1B3JA 1ZANL 3VFWA 3TBYA 3O6LH 3HLAA 4V1DA 1N2RB 3L7FB 2VKWA 5EU6D 3IKKA 1FFPB 4OM0L 4RMVA 3GMRA 4OLZL 4YHPA 3TA3B 5BS0D 2VAAB 2IANE 5HGAB 5L2KE 4FABH 1WT5C 2KL6A 4O02H 2OXGA 4WW2C 1EAPA 4X6CA 5IMMB 3MV8A 4GG8B 2R1YB 1MFNA 4TSCH 3MGTB 3UJIL 1T7ZA 1FNAA 1DUZB 2NY0D 3D0LB 5IF0B 2YPVL 4YH6A 3LKRB 3LQAH 2AEWA 4PJ9C 5F9DC 1QR4A 5C07E 4HH9A 3IRZA 2OCFD 1QQDB 1HHHB 3FB7B 5JXED 4R90L 4JGUA 1D9KB 4AMKH 4U1JA 1T7XA 3FOLA 1DVFC 4MJ5A 2JB5L 2ERJC 2R15A 3ROLA 3MLZL 4HHAA 2JCCA 1RAMA 4LLQB 1U9KA 2VXQL 4EN3C 2A6DB 4OD1L 4M48L 2EYRB 2HN7A 3PQYE 1UM5L 1EHLL 2VDQH 4NO0A 4GBXA 4I2XB 2UUDH 4I3RL 1NCUA 4AEEA 4F37F 4YDVA 3RY5A 1VFOA 1NL0L 2RFXB 4DQOH 3LHPH 1HDMB 3PWJA 3ARED 5IMKA 5HVHB 1TJGL 4RGMB 4AEFA 5TE6L 4JGJA 4OM0H 1YNLH 1EVTC 3B9AA 3HCVA 5D1XD 3TVMA 1WZMA 2YS4A 4D8PA 4CADA 3QEHB 1YEJH 3GMQB 3D3VB 4N0YH 5DMKA 5DRXB 1LP9B 1YPZF 5D7LA 5EZIL 1N8ZA 3UJIH 1T3FA 3OF6A 3LRHA 1H8SA 1XEDA 3VJ6A 1LEIA 3Q3GB 5C6WH 1UWGH 4KK5C 3WUWA 3WKML 5HYSA 5F1NA 1T4KB 4R90H 2D0FA 1KB5A 2EO9A 1YC8A 1SM3H 4YHYB 3TJEL 2D9CA 3BPOB 2FEEL 4OZGE 3RZCA 4HKJA 2IH1B 3RGVA 5FKAA 1TQCB 3LKQB 4JY4B 4NQDE 2VXQH 1ZV5A 3H9SB 3SDCC 1BIIB 3S5LG 3GSVA 2Y36L 1UM5H 1Y6NR 4X99B 4AENB 1EHLH 3EFFA 4JVWA 4GQPH 3X11B 1JRHL 3RWDA 4OT1H 1FH5H 4KKCC 3V5DA 2XRAL 2MOVA 4I3RH 2H3NA 2DMBA 1IZKA 5D6DC 2ZUSA 2ITDB 1UCBL 3RY6C 5BO1L 3WDHA 1MPAL 1CLCA 4TYUA 2CMRL 5GZND 4KVNL 4P4RA 4LBEB 4X0KB 4G6FD 5DYOA 2CIIA 5T1KB 5L88H 2HTKC 1FGNL 4L29A 4PJ8A 5EZIH 1OAYL 4CN4A 1HXYB 3MUJA 4R4BA 3W82A 3OL2A 1RFDL 3OTTA 3UBXB 3AY4A 4OCXH 1HEZB 3FCTA 5DDHA 5I75C 2A74B 5B39B 1JGLL 5FDWB 4PGBA 5LGJB 2WMPA 3GIZH 4NQEA 1AC0A 2FDBP 1FL3B 1ZE3C 3E1F1 4HT1L 1RZKL 4J3UA 1J88A 1JI1A 3QNXA 3TJEH 3TN0D 3QEGL 1YMHB 5SWZB 5AG8A 2J88H 1CR9H 5EIIB 3RAJL 2YPKA 4RDQF 3MV01 2AJVL 5KN5B 5IFHH 4PRPB 4I0PC 3QDGA 2Q20A 2A77L 1JRHH 4YWGL 2GJ6B 2D2OA 3BD4A 2XRAH 5K93A 1JK8B 2ZJSL 5LBSL 5J11C 1FDLH 2RGSA 1N2RA 3L7FA 4WUUB 1F4YH 3TPUB 1EEQA 1MPAH 4U1NB 5E2JA 2Q8BH 3CXDH 2VAAA 4JG1H 2DQJH 2XQYG 4KVNH 4JRYE 5HGAA 5ICZB 3TF7C 3K2UL 4BUGA 4GG8A 3MRJB 1FO0B 1BQLL 5LCVL 3IU3B 4RMWA 1UZ6E 3MGTA 4F7CB 1G7JB 1H3WM 4KI5D 4AIOA 4Z77B 5JW3H 5DJAA 3D0LA 5IF0A 3EAKA 4JFPA 3LKRA 4QXWA 5T3XD 1OAYH 5IMOA 3REVB 3DTXB 4WU7B 3MREB 2EC9T 3O6FB 3MJ9H 1HHHA 3FB7A 1AGFB 5JW5A 3BISA 2Z91B 1F11A 4Q6YA 2FBJL 4FMFA 4FXKB 2D0HA 4LHUG 5SV4A 5DHXB 4MMXC 2UZIL 4QRTB 3UJTL 4Y4KD 4HT1H 5ANMB 1DANT 4ONGH 1AXTL 3MXWH 4O2EA 4LLQA 2HVKB 2A6DA 1Q9LB 4N1EA 3ZE0F 5T33L 5JNYB 3BT2H 3RAJH 4E5XB 5FM8A 3GJFB 4KGLA 1DDHB 1LEKB 4I2XA 3D48R 1W0WB 3I6LD 4ETQA 3SDDC 3AB0C 5FHAH 1HDMA 3STBA 1BLNA 5D71H 2A0LC 4YAQB 3QUXD 1UACL 4UUJB 1D5XB 2FBOJ 2J4WH 1RUQH 1P5UA 1J0KA 4L4TE 3SO5A 4Z6AT 1OP5H 3D3VA 3SDAB 5LCVH 1LP9A 4PBVC 5KANI 4M5YL 3IJHB 5D93B 1U8NB 4RRPG 3MGOB 5DEFB 3VXSB 4XXDB 3RUGF 1I3GL 1HKLH 2AJYL 2X89A 4HEPG 1CE6B 1R6VA 3BGAA 1UG9A 1OW0A 4X8XA 3W81A 2XZCL 1T4KA 3ULUE 1ZOXA 3MOBL 1NAMB 5F96H 3ZLQC 4X9BA 3RWFB 5FO9A 1G9EA 4ONHB 1HHKB 2FBJH 4JRXD 3NIGE 5DURB 2UZIH 5T5FL 1K4DB 2IH1A 1S78D 4JY4A 5HGHA 5KVGL 4OZ4A 3SJVB 1PKQB 5T33H 4LLUB 1KJMA 1BIIA 2QQKL 2V2TB 4DN3L 4X99A 4AENA 3SGKC 1MHCB 4XCFH 4E41B 2FO1A 5EOCL 4HUVB 5CJQH 2CO6B 5J8OA 5TDPB 3BPCB 5KZCD 4GRLC 1NAKH 4P4KB 1S7RB 2YPLB 4CDGC 4MQXD 3WN5B 5INDB 3UEZA 1UACH 1D5ZB 1NBVL 1EFXD 4X0KA 5T1KA 3I6GB 3VXUD 4FXLA 1JHLL 3VFNB 3HTLX 4M8QB 4D94A 1BGXH 5KSVA 1P53A 3FRPA 3JVGA 4HGKC 4N5EC 1IZJA 1MF2L 3UYRL 1HXYA 5T3XH 4P48A 2OMBA 3CH1A 1FRGL 1I3GH 3UBXA 2AJYH 2NW3B 4NUGH 4QO1A 5L2KD 2A74A 4XAKD 3C6SB 4NFDA 4QXTB 1MCSA 3HE7C 3T0ED 5H35A 3SE4C 1NMAL 1MAJA 4FQLH 1GGUA 4I9WE 4Y4FA 4OGAC 1IGYB 2G60L 1KT2B 1YMHA 3OKMB 5SWZA 4ZO6A 3WIIL 2R2EB 5EIIA 4UDUB 3QXTA 1I4FA 1IAKB 5KVGH 3MRNA 2HG5B 1HNGA 3U30B 1CICC 1PW3A 1A6WH 4XNYL 1UWXK 2J8UE 4MNQD 4BH8B 3C6LA 2BSED 1MJ7L 2GJ6A 4NQTA 3BDYL 4LU5L 2YN3A 2ARJB 1KF9B 3MCG1 1JGVH 2ZG3A 4XPFL 3TPUA 3WJLC 2UV3A 4U1NA 5ICZA 1EEYB 3EBAA 2FX9L 4DZ8A 4DGYH 1A7QL 3OSKA 4AEHL 3I3EA 4PBWD 1DL7H 3QPQD 4G9FB 4Z77A 4ELMF 2X4UB 3H3BC 1MF2H 3WNLA 1JWSB 3DTXA 3QBTB 4WU7A 4JKWA 1G1CA 1F42A 3O6FA 3FQUB 3Q5TA 4X83A 1AGFA 1MCWM 2I9LB 5KTEH 4UT6L 2FD6L 1D6VL 1YEIH 4FXKA 1VA9A 4OKVB 2X4OB 3LKPB 4DKFH 4P2QB 4QRTA 3BQUB 5FGRA 5ICYB 1B0RB 5ANMA 3J8F7 1FP5A 1O7SA 2P45B 2HVKA 3N1PC 3WEXA 4DVRH 1Q9LA 3WIIH 5JNYA 1BFOB 5DK0A 4JM4L 3GJFA 2X09A 3MV9D 1XIWD 3ARGC 5F9WC 1LEKA 5C0AD 4KXZI 3LCYA 4WFHE 5F7NC 1PKOA 1W0WA 3JBG7 4PJBE 3RP1A 1F3DH 3C8HA 4NPYB 4U6HB 4LU5H 4I4WB 4K9EL 1FNEA 5LXGL 4MXQC 5F1IB 1A2YB 3GZKA 2FATL 4JFXB 4K55A 4XPFH 3MRQB 4P2YA 1D5XA 3L3OB 3MRDB 2WW8A 3M17A 2D0GA 1LO2H 5FDYA 3WL9A 3I2CH 1AIFA 1A7QH 3SDAA 1WITA 2ZNXA 1ZHKB 4EIZC 1U8NA 3VGEA 2H6PB 3MGOA 5DEFA 3NTCH 3VXSA 1GRWA 2DKSA 4Q74A 4XXDA 3SDXF 3LEYL 5BOZG 3O3AB 4ONFL 5DUPH 1MI5A 3V4UH 2VN4A 5I71B 3ZDXF 2QQNH 1T66D 2NTFB 1TQBB 1NAMA 3TLRA 4ZNEE 4UT6H 3RWFA 2F53D 1QFWH 1D6VH 4ONHA 1HHKA 4HWEL 1G9ML 4OLUL 3NZ8B 5EORL 3SEPA 4PB9L 4X6FB 4Y19D 3RVWC 4KRPC 5CIPH 1PKQA 3DX8B 2W65B 2AW2A 3QUKB 3HPLA 4JM4H 4WO4D 1XT5A 1MHCA 5GJTH 2HJLB 1TZIB 3RIAF 5D2LA 3RUGB 1RMFL 4GBXC 3BKYH 1QSFD 3F6IA 3KPOA 2YRLA 1IARB 1FC2D 3LEXA 3BPCA 3SY0B 3LIZH 3P4OA 2ZOLA 4L5FH 4Q97A 2W9LA 4P4KA 2YPLA 3CU1A 1H8NA 5EA0L 3WN5A 5INDA 4XVSH 1D5ZA 2FIKB 3TVMC 3VFTB 3I6GA 2MCPL 5I19H 4KKBC 3EHBC 3GBLA 4EXPX 4P99A 3VFNA 4OFVA 4M8QA 5C6PB 4NOFA 4V2BA 1MJJB 1XH3B 2JLLA 1GSMA 5TPWL 1T21A 1MFCL 4YHKL 2CUIA 2DDQL 3LEYH 3OB0K 2Y06L 3AS1A 3QAZB 1BVKB 4ONFH 4WI7A 2Q86B 4U33A 3CFEB 5GZOD 3LZFL 2VKXA 4ODSL 3C6SA 1T5WB 4QXTA 2D7MA 1RD6A 5HHME 2FLBT 1F6FB 2LTQC 3QNZB 4HZLB 5H2BA 4KUZL 1A7NL 1U8HB 4OLUH 4ZO9A 1F3JB 4MJIE 5AD0B 3H6JA 2EH7H 3OKMA 3C8KA 4PB9H 4EDWL 3DV6A 4G8GB 5SX5K 2R2EA 5HHPB 1KJ3L 5E8DH 3RGVC 4UDUA 3RZCC 1CLOH 5F6HI 1IAKA 1JZ2A 2HG5A 1AO7A 1BIHA 1J8HD 3T0VA 1DBJL 4BH8A 1RMFH 3KPSA 4R0LA 4ZAKB 3MLXL 4TUJB 4DUXA 1WZ1H 5GISH 2EDFA 1AY1L 2VZ3A 1NMBH 1ODAA 3VCLB 4QHNB 5D7IF 2KQMA 1NFDF 3EYFB 3T0WA 4RWYL 1OTSD 3BDXA 2WUBL 4R96B 3E6FA 3F5WA 2V7HB 2QSCL 3WIHH 4S0TD 2Z31B 3QT2A 1Q9WB 1QZ1A 4JFEA 2IAMD 2VH5H 4RNRB 4G9FA 1DFBH 3LPGA 5TPWH 1P1ZB 4PJ8C 1E4WL 2X4UA 1BBDL 1F4WL 4PR5A 4YHKH 5DRZB 1TFHA 3MA7B 2DDQH 5MEQB 3A0OA 1T5XA 3BKJL 2BDNH 4XB8A 3AY4C 3FQUA 1FNHA 5EO0A 4PJHF 2I9LA 5IVNA 1G6VK 2K7PA 2QV2A 5I17B 3L5HA 1K6QH 2XZZA 4UZGA 1SVZA 3HZKB 5C0IA 2X4OA 2HT2C 1N4XL 3LKPA 4D0BB 4JQVC 3BQUA 3O3EB 5ICYA 4W6YB 2ENYA 5JIKA 4X6DF 1V3MA 1WBXB 5FYLE 4EDWH 1BFOA 2R1XB 1KJ3H 4WFFD 5BRZD 2AEIT 4G3YH 4P5KB 4ELMB 4NQCB 2DQIH 1DBJH 5F89B 1MCPL 5HGBB 4NPYA 1NUFA 4I4WA 3NFNB 3QUYD 2FO4A 3X12B 5F7YC 1OTTD 3GSRB 5HHOB 3MRQA 3IT8D 4PP2A 4XNZB 5J9PB 1UKQA 3MA9L 5FO7B 3EO9L 4W4NA 4RWYH 3QIWD 4GW5B 4G8FB 2P8MB 4WFGD 4HEME 2JJUA 4LOUC 4KJWC 3QISA 1TVDA 2IPTH 2H6PA 5C09A 4YHOH 3LS4H 3O6KH 1MRFL 3ZYZA 5F44A 3GSUB 2V9QA 4MQ7B 3C5ZB 1BBDH 4ODVH 1P7QD 3CVIL 3HMWH 2I60L 2QSVA 3V6OE 2VISB 1HQRB 2AK1L 4BYHA 1T2JA 1FZOB 1CFNB 3BN3B 4JO1L 3Q2CA 4P5TD 3QG7L 1FGVH 4HWZA 4PGZA 4RMQA 1NKOA 2EE2A 1FFRA 2OL3L 1ITCA 3OV6A 3WD5L 4OQTH 3NZ8A 1MUJB 3RIFK 2H2SD 4X6FA 4YBQC 1WUNT 1AGEB 1FG2B 5EU4A 4OJFL 1C12B 1TNMA 1L0QA 3NBNA 1CGSL 3DX8A 2W65A 3QUKA 32C2A 5IVOA 3VA6A 4J3SA 3HC0B 5C2BL 1KCSL 2WBWB 2YD9A 1TZIA 4OF6A 3SKMA 3SDXB 4TSBH 3OR6B 3LY6A 2A9ML 4LCCB 4N8VG 4L3AA 3QDJB 5CCKL 2MCG1 4NFCA 1EMTL 1MFAH 5HVHC 4ENED 2C4FU 3OZ9L 4RGMC 1HNFA 3MZTA 1AHWB 4NZTL 2FIKA 3VFTA 1TJHL 1G7HB 3EO9H 2FR4B 1RIHH 2P46B 1Y6KR 1IAOB 1MJJA 1XH3A 1UH3A 4HIHB 4QRRE 1H3VA 1JZ6A 3HC4L 1MJUL 3EYOA 3N9GH 2BHYA 3KS0H 1WBYB 3UTSD 1JIBA 3GMNB 1BVKA 2Q86A 3CVIH 3CFEA 4U1MB 4XPAH 3V5HA 3QUMH 3VXRE 2AK1H 5CEZD 1G7PA 4ORZC 1GL4B 4ZUTB 2R0LL 3DOSA 1MCNA 4EXKA 4EN3D 5IR1B 3QNZA 1T20B 3PV6B 4KTYA 5IV2B 1F3JA 5AD0A 2WUCH 1LWRA 4LCYB 2VXSL 1HHIB 5F3HA 5T1LD 5IROA 1GGBL 4G8GA 2WWMC 1MWAH 2Z92B 3WLWD 3ULUH 3KPRB 5HDQL 5IB2A 1M4KA 4XX1E 4HJJL 4R8WH 1LVEA 4ZAKA 1EDQA 2GT9B 4TUJA 4R97C 4YC2B 4XRCB 1WIUA 3VCLA 4QHNA 4WFEE 4Q2ZB 2L7UA 4KV5E 4UT7L 3EYFA 5IMLA 1DLFH 4Z76B 5H8DA 4NZTH 3D5OF 4R96A 1TJHH 2QHRH 2V7HA 2Z31A 4H5SB 2GJZB 1Q9WA 4J8RA 4XX1G 4K3HA 1K3ZA 1JFQH 2CK0L 1IQDB 1RIUL 5JLZB 3WLBB 3LKNB 4UBDD 1MJUH 1NJ9A 1P1ZA 3R4DA 3JVGC 3BHBB 5DRZA 1FYTA 1R0AL 3MA7A 3RWCB 5EOQH 3SCMD 5FA4B 1LEGB 4F7EB 5LQBL 3K7UA 1EEZA 1YNTB 3PWVB 1M6OA 3MRGB 1J18A 3KLSA 1K3IA 1S5HB 1EEUA 4V1DE 5I17A 1J87A 2D31B 1ZKAA 3HZKA 1URLA 1WEJL 1GC1L 4U3CA 5D7IB 3RHWF 3VH8B 1NFDB 3O3EA 3VWJD 4Y4FC 3MNZB 4FTVB 4TVPE 4X6CE 3GUTB 3K1DA 1WBXA 2VXSH 4FZEL 5SWSB 5DD3H 3NIDE 1OSPL 1Z3GL 2Y07L 1FVDA 4P5KA 4LCWB 3RTQC 3LS5L 4M7JH 4ELMA 4UINH 3ILQC 4O5LL 4RMUA 5F89A 3C6LC 4Y2DD 1QFHA 1CBVH 1FLRH 3ULVL 4PJHB 1HINH 5HHOA 1DJSA 2O5YL 5DFWH 2C3XA 1SY6A 5ACLA 5J9PA 5FO7A 4Z7QF 4OD2B 4YHLH 1CVRA 2P8MA 5E2WL 2V5MA 2JCCE 1S9KC 4X6DB 3UDWA 3F8UB 4MCZA 3IFPB 3OJDA 5C7XH 4LP5A 2DQHH 4U1LA 4B7LA 1YEFH 3CNKA 3H8NA 2ADIB 3RDTB 2PR4H 3C5ZA 4QRPB 5ITBL 1NC2D 1YJDC 4OF5A 4YE4H 1IBGL 3BUYB 4JKPH 5GRVK 2VQUA 2EH8L 2VISA 1HQRA 4NKMB 5CEZH 1FZOA 2VR5A 4NC2B 1CXLA 5IBLC 2XTLA 1CFNA 3IGAB 1U8JA 1YQVL 2VWEC 4K3GA 4S1RH 2E9WA 1G7LB 4PJ7A 1TIUA 4XVTH 3B5GA 5I2IB 3ZYOA 1QSEB 3PWLB 1WEJH 2F74B 3IJYB 5J6GB 1MUJA 3BW9B 3ZE1F 2X4TB 4XP4L 1AGEA 1FG2A 3I50L 5ADPH 1OGAA 2H32B 4BZ2H 1X4YA 3BZ4B 2X4RB 4AG4L 4ERSL 5D7LE 5AUMB 2V5RA 1IM9D 1Z3GH 2Y07H 2A9NH 1OLLA 2COQA 4X9IA 4OZHA 5B8CB 2UYLB 3OR6A 4O5LH 4LCCA 5L9DH 1JHKL 1ZA3B 5DQDH 5AZ2L 3T0AA 5I15H 3I85A 1KN2H 3B9EA 3QDJA 4QHMA 2JK5A 1Z2KA 3G6JA 2EYTB 3GHEH 5C8JB 1C1EH 1AJ7L 4M9PA 1CG9B 1XGTA 3REWA 3SGJA 3LOWA 1ADQA 4FQIL 2IH3B 1HYSC 2FR4A 4WU5A 5HVGB 4HIHA 3G6DH 3SDAC 5DD1L 3TV3H 2OK0H 4UV7L 1ZEAH 5D93C 1ND0B 1VPOH 3ZT7A 1MOEA 3L5XH 1QVOB 4DOHE 5HYSG 3GSNB 1F5WA 4U1MA 3MJ8A 4RA0C 3SGDH 3QXWA 4X9FA 2ADGB 3BKCL 1I9JL 2ZUUA 3QQ4B 1T20A 3K4DA 3PV6A 3VDAA 3BIBX 3E8UL 5IV2A 3UTTD 3QQ3B 4NM4H 4LCYA 5FF6A 1HHIA 5I6XB 4LK4A 4XP4H 1I1AB 4GAGH 3I50H 5E6YA 3CK0L 2Z92A 3VW3L 1KYOK 2DI8A 5GHWH 1VFAB 2NYYD 1ZLWK 2O5ZL 1KTRL 5HYIA 3HKFA 3VFOA 4XZUB 2BVQA 3O2DA 5JQ6H 1OWRM 2KPNA 4KKNA 3NPSC 3O8XA 4JANB 1J86A 1QRND 1ZT7B 4XCYB 3TJHD 2BJMH 1B2WL 5AZ2H 5IIEB 5CZVH 4K7FB 4DW2H 2IGFL 1A7RH 2DBJA 4JDZA 4NZRH 3DRTB 3DX6B 5F9AC 4P2RD 4LHJB 4P4KC 1LQSR 2N56A 2WBJB 2VQTA 2HMIC 2R69L 3V7AE 5DMIL 3WN5C 4Z76A 2APBA 4PJFF 4H5SA 2GJZA 3INUL 1KBGH 5JLZA 1UXSB 2CIKA 5E94B 4DK6A 1M7XA 2V9TA 4GS7B 1LEGA 4GG6A 5GS2D 2J8HA 3VRLF 4F7EA 3PWVA 1YNTA 4JR9L 1NGYB 3JUYA 3V7AG 2EICA 4BFGA 1EGJA 4AEIH 1S5HA 1I9JH 4FFYL 4XPTL 2D31A 3V5KB 4JPKL 2P4AB 3U0PB 2C5DC 3GMPB 5D7IA 3H9YA 1NFDA 4TVSa 3ECBB 1MCLA 4KZEL 1JNLH 3TZVD 3DVNB 5ID0B 4LEXL 1FFOA 4IBLT 4JFDD 1JNNL 5C0CA 2BOBB 4ZODA 3TYGL 1CZ8L 2ZZUT 3E2HC 4R0LC 5K9QI 3WO4B 2NX5B 1WJ3A 4NN5B 2JELL 1UC6A 2V2XB 3HC3L 1KLGB 2GIYA 2IGFH 4HGMA 3KPNA 4KHTL 1TITA 4WTWA 3W0WD 3LH2L 1Q9OA 3IXAB 4P57B 2MQCA 2R69H 4I0KA 4EOWL 4PJCF 4OD2A 3B83A 3ARUA 3IDYB 2Z93B 3WFHB 5CEYA 3MLRL 4C59B 3SPVB 5E24E 4X6DA 3ARFC 5IJKA 3CH8A 2YD8A 4J2XA 5KAQF 4PUBL 2ADIA 4QRPA 4OGZA 4LHQB 1IQWL 4FN0A 4I2XE 3BUYA 5IB1B 4NKMA 3V0WL 2OZ4L 2VDPL 3IGAA 4TNVK 5HD8C 1WAAF 1MY5A 5EFIB 3WHXB 4JPKH 1QSEA 3ARDD 3PWLA 2F74A 5J6GA 1DQTA 3BQUC 4PRHB 3BW9A 5D1QD 2BSTB 2E6JA 1GZPB 2X4TA 2OQJB 2FX7H 1L4IA 2H32A 1EO5A 3C5SB 2ENSA 3I3DA 2X4RA 4UIKL 4EQ2A 1FNGB 5AUMA 4LEXH 4Z8FL 2R9HC 3MOAL 3LRGA 5B8CA 2D03L 2UYLA 3VI3E 3U9UB 1T22B 1ZA3A 3SBWC 4KQ3L 1QKZH 1KTDB 2X6MA 5DWUL 3DO7B 3QCTL 4ZUWA 2EYTA 5C8JA 1WLHA 5FYLH 2ICWJ 1RZIB 2QQLL 4DZBA 4C83B 3QDAA 1CG9A 2X7LB 3P0GB 1ORQB 1MCWW 4EOWH 3VXQB 1I9IH 2D7QA 4TN9A 4U4BA 5AYUH 4YNYA 4QY8B 1RUKL 4XI5D 1MRCL 1GZQB 2G9HB 4ZDHB 1ND0A 4XMKL 2A6JB 2Y72A 3HR5B 1U8MA 1T89A 5C0JB 1QVOA 3RPKA 3GSNA 5GS2H 1KSRA 2Z8RA 2VLJD 3P4LA 2ADGA 2B1HH 2OLDA 1KIQB 4Z0BL 3V0WH 5KS9E 1OSZB 3QQ4A 3GMOB 4L1HA 2DQFA 1TQBC 1PEZA 3QNYB 1AE6H 4FQJL 1IGML 3VFMB 4DTGH 3M8OL 4K3JL 4M7LT 2ESVD 1EJ6A 4M02A 2C1PB 1UKSA 5EU6B 3HA0A 1INQA 4MA8H 4Y16D 2AQ1A 4WUKH 5JPMB 5F9JB 1TPXB 1VFAA 5BS0B 1BREA 2BK8A 4KJPC 5J12B 5JHLL 4JPWH 1AH1A 3TP4A 4XZUA 1J05A 2VSCA 2ZPKL 1AQKL 1RZ8B 3GIVA 3BRDA 1K5NA 4JANA 2YN5A 1ZT7A 4XCYA 2BVOB 4QNPF 4BSJA 5IIEA 1I7TA 4TVPD 4PJ5D 3DX6A 4ZTPL 3H7BA 4Z9KB 3DJ9A 4A6YA 3AXLB 3W5NA 3HUJF 1JUFA 2QADC 5I30H 1XF2B 2J6EH 5C0NC 2X10A 4B41A 3FRPG 4XMPH 3U46B 5SWZE 5E08L 4CAGA 2V17L 5J0BA 2QR0B 1AD9B 1UXSA 4OFPA 3UBXG 3ZE2F 1EJOH 5E94A 4TPRH 1U92B 3S36X 5B4MD 3TO4D 1ZGLB 4M3KB 2ZSWA 4NHCH 1CN4A 2DQGL 2GJ6E 1NGYA 4MAUH 3GO1H 4Z0BH 1BX2A 1LO3H 4FOMA 3S36L 4PTTA 3V5KA 3B9KD 4C55A 2OYPA 3GMPA 4Z7NE 2VR9A 1BZ9B 4FQCL 3M8OH 5ETUA 4HXBH 3ARWA 1QFPA 3ECBA 4J3VA 4BK5A 4Q9RL 4PY8J 1AQDB 5L8LB 4PJFB 1NH6A 5IROC 5D1XB 4APQB 1NBYB 3LSOB 1BECA 5B3JF 1BP3B 5TE4L 2FX8L 4I5BB 5JHLH 3DMMA 3A6BL 4XPBH 1GAFH 4YHNB 1QYGL 4G43B 3DV4B 1AR1C 1T6WA 2NX5A 4F9LA 1MIML 1WSST 3IU4H 2FGZA 2VWEE 1KLGA 1KCVL 3CD4A 5EG6C 4PG2A 1IAIM 5INCB 3IXAA 4P57A 5FA3B 2X42A 1MHPH 2Z93A 5ANME 4JQIL 3V2AR 3WFHA 1T1ZB 2YUZA 5I1GH 2ZUTA 2Z31C 4F33B 2P44B 4J3TA 4AY0A 5E08H 1T7WA 2V17H 2NW2A 2NY4D 1J5OH 4XCNB 3NCYP 2N7AA 2VDLH 4NRXA 5IB1A 3UROR 1JHTB 1Z5LA 5IHUH 4F57H 4NWTH 3F7VB 3S35H 2DQGH 2IJ0C 1GHFH 3HNTL 5MI0B 4XP6H 3WHXA 1CDYA 1YEDB 4FFVC 3EGSB 4FQCH 5EBGA 5MERB 2PETA 3RQ3A 3DYOA 2R2BB 4NO5B 4X4MA 1GZPA 4PJCB 2EO1A 3OHXB 3SKNB 3C5SA 2OP4L 4HUXB 1LE5B 3OGOE 1P4IH 2ZUVA 4JFQA 1KIRA 1FNGA 2AK4B 3UZEA 4Y7MA 4D9QE 4BFBD 4G6FB 3EYUL 3VXSE 5IBTL 3HE6D 5E03A 1NANH 2W1NA 4NZUL 1MI5E 3IXTB 3V95A 1A6UH 1QEWA 4JLRB 1T22A 4KHXH 1ZLSH 2D7TH 1KTDA 4MJ4A 3NACH 1MIMH 4TVPH 5BV7L 1A6TB 2OSLB 3HS0B 4QT5B 1YY9D 4YUEL 4HS6B 1FVEB 1RZIA 2RBLA 2PYFB 1ORQA 1VESA 4MA1C 4XNZC 1JF6A 1P2CB 4K2UL 3FFDB 3OAZK 1RVFL 5EBMA 2NPLX 5F9OL 5A2IH 2HAZA 4IRSB 3UDWC 4QY8A 2G9HA 1RHHA 5EPMB 4HWBL 1I7ZB 5IW1B 4GUPB 5D2LE 4UQ3B 2HT2D 1L6ZA 4QYOB 1PD6A 1KIQA 5FB8B 3DX7B 1OSZA 3QDMD 2EDEA 4S1SH 3GMOA 1XCQB 4NT6B 3QNYA 3HNTH 1P7HL 2YPLE 3VFMA 4G8IA 1UB5B 4M5ZH 3KHOA 1V5JA 2AXGA 5E2UL 3HRPA 2IADB 5ERWB 5F1OB 1XF1A 2C1PA 2DMCA 5EU6A 2H2PD 3QEUB 2B4CH 5F9JA 3MV7B 1CLYL 3OBAA 5BS0A 1VEPA 5FCUL 2AV7A 5L0QB 1NCBH 1F4HA 4S1DC 5IKCB 1XF5B 5IBTH 3DYPA 1YMMB 3JV5A 1VHPA 4M6ML 4XNMB 4P3CL 5DI8A 2YEZA 3C9NA 4LOUD 2DQEH 3AXLA 4TTDD 4GXUN 1A0QL 3SGJC 1KEGL 5JXEA 4RGOL 5K9JL 2XFXB 1QLFA 5IHZB 4P23B 3U46A 5E8OA 4C56B 2VXTL 1FPTH 5DMGC 3KPMB 2ILLA 1U6AH 4KK9C 4UV4L 1UWXH 3OMZA 4ZFFB 4KZDL 1JZ3A 5KVFH 4Y4KB 1RZFH 3QIUB 1FFQA 2DTML 1AO7E 1C5CL 5HI5C 1XFPA 1U92A 4F3FA 4HCRH 2NXZD 3KPSE 4WIQA 4NJ9L 1OQOA 5H94B 4KTDL 4LIQE 2W9EL 2VABB 2YBRB 1BZ9A 2QJDA 1ZHLB 2IBGA 5IHLB 1EHXA 1KCKA 3HUJB 2CLVA 3MODH 2Y23A 4PJFA 5D1XA 5DLML 1NBYA 2MFNA 3LSOA 4JFEE 1CLYH 4L1DA 4YXKL 2C1OA 3G5ZB 4KVCH 1CD1B 4CMMB 4G43A 4PV9A 1INEL 3O8XC 4ZOBA 3Q1SL 1BZQK 1S7UB 3WSQH 1UQSB 1A6VH 4PYGA 5INCA 2B5IB 2N1KA 1E6JL 1MEXH 4Y2OA 1KEGH 5HI3D 2V2WA 4RGOH 5K9JH 1JP5A 1T1ZA 4RDQG 5H37H 4F33A 2FZ3A 1FBIH 3MLYL 4ESKA 1IEHA 1HILB 3QXUA 3AAZB 1TNNA 4M00A 1VSCA 2DTMH 5ELIA 4XCNA 3QB7C 1JHTA 1MHEB 1PLGH 1LDPL 1D5MB 2ARWA 4Q6IB 5LKNA 2RIKA 4UILL 2XXCB 4G5ZL 4NO3A 1YEDA 2OJEB 5HDBE 2ZWLT 1C7SA 3EGSA 4MCYA 5MERA 5KZCB 4NO5A 5I8OH 2EEAA 4G6KH 4PJCA 4I18C 3OHXA 4OUOA 1KIPA 5JUEH 3SKNA 5IFAH 1S7VB 4HUXA 1LE5A 4LKCA 2GTZB 3ZE0E 4GAJH 5C09E 2DJUA 3RL2A 4JY5H 3VXUB 1FCGA 2CDFA 2GAZB 4QRUB 4JLRA 2ORBL 3EDEA 3AS3A 2X4SB 4K3DL 4X4XB 3GI8H 1HXMA 4MB3A 3Q1SH 3ISWA 1A6TA 3JWDL 4QT5A 2CH8A 3VG0H 5I16B 1GJIA 12E8H 5IFJB 5GSRB 1WAAA 1FNSL 1Y6MR 5JDJA 2PYFA 3S34L 2IANB 5L2KB 5IM7A 4HMEA 5D1ZD 4MSWB 1HHGA 3QWQB 3FFDA 3MBEB 3NCYS 4NSKB 2H26B 4HSQA 2NXYC 3K74B 2P24A 2EKJA 3GHBH 5EPMA 3MLYH 2QSQA 5HY9B 5HGGS 2YUXA 3TN0A 1N0LA 1I7ZA 4OCSL 4U7SA 4FQPA 1ETZB 1OAUH 5IW1A 4UQ3A 5GS1C 5C07B 5CIPB 1L0XA 5M95B 4QYOA 5FB8A 1LDPH 3DX7A 1XCQA 4NT6A 3BPNB 1R24B 2AKRB 1YQ2A 5FUOL 2B39A 3GSQA 1C7TA 1NUDA 3T65B 3RTQD 4KKAC 1U2CA 1PSKH 3EFDL 3T4YB 4AQ1B 3QEUA 4KH2A 3ZTNL 4M8VA 3OB0H 2AABL 2IALA 5MEPB 2R0KL 4F7MA 5CZXD 5IKCA 4ODTH 3BSZL 4CBPA 1XF5A 4OLEA 4LSDA 4N68A 1R5WB 4A2MA 1X7QA 1T04B 1A6AB 1NUNB 5KSUA 2NY2D 4NJAL 2ORBH 4NWUH 4B5EA 3OJMB 3ULUF 1MCJA 3VFGH 4XNMA 3GGWB 3JWDH 2EE9A 1ZT1B 3NIGF 1LMKA 2IQAA 4CVXB 5SX5H 2ICWI 5HYFA 5I1IL 1WF5A 5E8NB 7FABL 5F70A 1G6RL 2DD8H 1YDPA 2RQ8A 3PABB 4R4NC 3KPMA 4G8GE 4IOFC 4TUKL 3I6KA 5FYJD 4Y4KA 1FE8H 5I1KH 1UGNA 2DKUA 1CT8B 4HBCH 4K8RC 5KOVC 3SGDI 4JN1L 1T89C 5JOPD 1IKFL 4TNWF 3L1OH 2QHLA 5CGYC 4U7KA 2VDKH 2EKSB 1ITBB 4RGNC 3MV9B 1XIWB 4JO2H 1HH6A 4M93B 3RJDA 2VABA 3UYPA 2YBRA 3VXOA 2L7JA 4ALAH 1ZHLA 1DUYB 4RISH 3BZDA 2K1MA 1G84A 5I6XC 4PJXE 1F6AB 3QUXA 3EFDH 2GI7A 4C4KT 2OI9C 4WI9A 3A6OA 1E4JA 3ALXA 4PRDB 1WQVT 2AABH 4POZC 3G5ZA 4CMMA 4N8PA 4YBLC 3Q6FB 1RJZB 1FYTE 2LAAA 3D0VA 5DD5L 5DSCB 1PG7W 1FLTX 2EC8A 4HC1H 4GKNB 1I1CA 3ARVA 4WW2F 1QLRB 5MEND 1W72H 4HWUA 4IIQA 5I1IH 4DGVH 3FQTA 1FZJB 3T0BA 5I1JH 2F53B 2BMKB 5ECJE 1RZJL 5GS0D 3B2VH 4OV5B 4JDVB 2YA0A 3E0GA 1J12A 4F15B 4JVPA 3AAZA 1UT9A 3NMEA 3NVQA 1ZTXL 4Y19B 2FHCA 2UZYB 4K3EL 4ELME 1VCAA 2IG2H 1RUMH 4JN1H 3V6FB 1MHEA 1IKFH 1D5MA 5FM5M 2MKLC 5DS8B 4NQUA 2WQ8A 1NBZB 5HGDA 4F8TA 1NFIB 4ZFOB 5E1AA 1R3LB 4MD5A 1QSFB 1FNLA 5HHOE 2NY6C 4XC3H 3CU7A 1X5LA 3PP4H 4PRNB 4Q9CA 5CINL 2GQHA 3H9ZA 2GTZA 4PY8I 1MLBA 4DEPB 1EFXA 4MXVF 5IHBA 1OM3H 3VXUA 3SDYH 3EO0B 3DMMC 4KC3B 3JWOL 5JOFB 2XY1A 4JO4L 1R5IB 3UTQB 4ZUUB 5DJ2B 3PXHA 4X9GA 5I8EB 4X4XA 2FLRT 4UI2A 1K8DB 2CKNA 1CE1H 3WO4C 2YUVA 1OTUD 3O9WD 5KSAB 4JFHD 4MB4A 2DI9A 3WXWL 5FIEA 3CFCL 5HYQA 4PG2C 3DRQB 4PJ7E 2HJFA 4LRIA 4CKVX 5L2KA 4JRYB 1U41A 4HS8L 4JKKA 4KROC 4MSWA 4P0DA 5LVEA 1T0MB 4LHUB 4N8CL 3CLEL 1YJDH 3IDYC 4NSKA 3T0EA 2H26A 5IUSA 1A9EA 1OGAE 3RRQA 2A83A 4JGMA 5FYJH 3CSGA 1FZKA 4PJBF 4Y5VB 2VZSA 1ETZA 3DETC 3K8KA 4JM2C 4DN4L 4OZHE 3DGGA 1QBBA 4JFFE 1RJCA 5FO8A 5I1CL 4ZS7L 3OKEB 3QDJE 1HI6A 2BFVL 1LK3H 2AKRA 3OAYK 4HJGA 1KC5L 4YGVB 3G6JE 3PDOB 4GQ9L 3W2DH 1ACYL 5TFSL 3O0RL 4UTBL 5CJ5A 4ZFZB 1JYWA 4N0CC 1P7KA 2LV4A 4Q0XH 3CX5K 3T4YA 1G7MB 2AJXH 5DVKA 2P5ED 3CX2A 4L9LB 1OLZA 5D7KD 3KWWB 4TSAH 5D96B 3EO1B 3RY4A 5E2TL 4NQSB 4JRWA 2HFFA 5K9KB 4DKDC 1T04A 1A6AA 3HZMB 4TRPH 4EUPA 2HKFL 4JKMA 3KJ6L 5T3ZD 1E4KA 3U82B 2VLKE 2YD3A 4JB9L 5DA0B 4ZUSA 4L3ED 3SKOA 3CFCH 4CVXA 1TTUA 3QUMB 5E8NA 1CTOA 1TTGA 5E2VL 3GI9H 4NKOB 2EDYA 1CGYA 3PABA 3UMTA 2R4RH 4YXHL 4L3CB 5GS0H 1U93A 1CL7I 1NLBH 4JCLA 5GRUL 1YEKL 1EO8H 2PYED 4G6JL 4XBEL 1QO3B 1MWAB 5I9QB 2CO7B 5HXMA 5DK2A 4R4FL 2AEPL 2EKSA 3MV9A 2J8OA 1XIWA 4HLZH 3QG6B 5C0AA 5CEXB 2F5BL 1Q9KB 4DJMA 2OTUB 3P0YL 4Y4HB 3RU8L 4KJYB 1JGUL 1J0YA 1DUYA 3CJJA 4LFHG 3QUYB 5A1AA 2R9HD 3IDIA 1MCOH 2AXFB 4J6RL 2ZSVB 4XAWL 5E7BA 4FP8L 4KPHL 1DQDH 4GRWE 5ACZB 4N5UA 4PRDA 2DIAA 5BZDB 4P59H 3QIWB 1E28A 1SEQH 1A7OL 1EXUB 4H88H 1RJZA 4GLRI 3BEWB 3K1KC 5E2TH 4GG6E 5T3ZL 5I1EH 5FYKE 5FXCH 1JZ5A 1J0JA 2Z35B 2NY0C 4GKNA 1A3LL 3EDJA 5DJ8B 1F90L 4IOIB 1QLRA 5FHBL 5D7IE 1CLZL 5JXEC 4FQ1L 1OAXL 4ZSOB 1EBAA 2EDQA 5E95B 4OCRH 4XHJD 3TH4T 2F53A 3KJ4B 4N0FB 4LPYA 2WNGA 4U6TA 3EOTH 5GRZA 3V6ZB 4M9OA 4JDVA 4MVBD 3UP1A 4Y89A 1WZKA 3H9HB 4OLYH 4HG4K 5GRUH 4Y19A 1RZ7H 1YEKH 3GJEB 5C0CE 4JPVH 2DM4A 3V6FA 5KW9L 1DQJB 1BWMA 2LU3A 2ED9A 2W59A 1NGQH 4WO4A 5DS8A 2AEPH 1R3IL 1NFIA 4R7DB 1R3LA 2HFEB 3QA3B 5AYQA 1QSFA 5FV1L 4L4VD 4GW1B 3P0YH 1A1MB 4KJPD 1F6LL 4WW2B 1S9WA 2AJZB 4NGHL 3U1SH 3PE9A 3AREC 4O58L 4PRNA 4J6RH 4XAWH 4X6DE 5D1XC 4KPHH 1QBAA 4X80H 2BCKA 3FT2B 1FAIL 3O4LD 3EO0A 5F93C 4LIQH 1A7OH 3K4ZA 3X3FL 4QRPE 5JOFA 2NZIA 4O2FB 3UTQA 5DJ2A 2VAJA 3U0WH 5I8EA 3DVGB 3ELAT 2BNQD 2A1WL 3UPCA 3PWPD 1ES0A 3UTSB 3WYRA 3DRQA 1A3LH 4OLXL 1DVFB 4Z0XB 5GS3A 1F90H 1ULVA 1QSEE 2YC1B 1MFBL 5LAXA 5AZEL 1T0MA 2R4SH 1GIGL 5C0BD 1OAXH 4EN3B 3WO3B 1JPGB 2J5LC 1ZGLP 5C6TL 4P9ML 1P84K 4OTXL 2KZWA 1Y0LA 4OQTA 5DD6B 4GMSL 4NO2A 4Y5VA 1KFAL 1RZKC 5F7MC 5T1LB 1CTNA 3ET9F 1YEHL 1OGTB 2P8PB 3BP5B 4ISVA 2FJHB 1A3QA 1J8HA 1XGUB 3OKEA 2VDNL 4LF3B 3PDOA 3PL6C 5MI0C 2BRRL 3FT4B 1YECH 1HSAA 1OF2B 4FXGB 4R2GD 4HZAA 5L2JB 3D9AH 2BY2A 3W9DB 1G7MA 4JPIA 4O58H 4L9LA 3NABL 4LLDB 5GZNC 3KWWA 4LSTH 1CIUA 3SOBL 1CYGA 1FAIH 4U7MA 5FGBA 4M6AA 2IAMA 4RGNE 3L6FB 1A7PH 2EIBA 3ZSTA 1DE4B 4HKBB 4Y1AD 2E3VA 4KMLB 3SCMB 5TE7L 1UWEH 3SO3B 5FOBB 1X5FA 2BC4B 3SQOH 1ZLWH 4MD4B 4NKOA 5J1AB 2I5YH 1NBQA 4N0RA 1GIGH 4GRMB 4L3CA 3SDCB 5C6TH 5HHQB 4OTXH 3RWJB 3FO2A 3WNOA 4Q7DA 1CDJA 3TN0C 1KFAH 3Q6GL 1MWAA 1R3KB 3P4NB 1YEHH 3P2TA 4YFEA 3CLFL 4YDIL 1J1XH 5BRZA 1CXHA 2E9JA 3AMLA 3FFCD 1MCKA 5HDOA 1BZ7A 5E6ID 4P5MB 4HUKB 4TULL 5CEXA 1FCCA 1Q9KA 1V3JA 2C3VA 2OTUA 3QCVH 2AAVA 4KJYA 2IF7A 4ZTOH 1HQ4A 4Y2DB 2J7LA 1K2DA 3QUYA 5HJ3A 3S3JA 3S8WA 2ZSVA 3KPLB 3UPAA 3AU1B 5JR1L 3V0VB 3PGDA 3VWKD 3LRSB 3NABH 5ACZA 5BZDA 3LVEA 3F7YB 5DJ6A 3QIWA 5E99L 2DQTH 3BEWA 2ARJQ 3KYNB 1F97A 4FG6D 3NAAL 1Q8MA 1XGQB 4KWUA 2CDGA 1Q1JH 1NC4D 4XP9H 4KI5C 3AGVA 2Z35A 3EYVB 5D7SL 1P7QA 3QQ9D 4H8WL 2JB6A 2Q87A 5BW7A 3LEVH 4IOIA 4PB0H 4XHQA 5TQ0L 2QLVB 4MAYD 1XZ0B 3BJ91 4G7YH 4WGVB 4ZSOA 2I9TA 2FH8A 4HBQA 5D7JD 4P5TA 2PTVA 3V6ZA 4MNGB 4PJEA 5ENWB 1BJ1H 2B1AL 2PW1B 1XGPB 1C16B 1SYSB 1AKJB 3CIQA 2VZVA 4OKDA 3VFRB 3H9HA 3ARBD 4Y4KC 5DHYB 4I0PB 1U8OB 3FO9A 4JREC 4PRBA 2GYSA 5HSFA 3BKML 4R9HA 4OIAA 1DQJA 5JIHA 3GMMB 1J1OH 5J11B 1CL7L 2NX5E 5MHSD 1IM9B 5ITFB 5HHXH 1MREH 2YD7A 3DSFL 4HIXL 3QA3A 3UPRB 8FABA 1PG7X 2DB8A 5IQ7H 4GW1A 1RK0B 2EEDA 1IC7L 4NUJB 2OJZL 1I75A 5BVPH 3U9PH 2RB8A 5K33A 5TGBB 1PG7L 3GBNH 3QUXC 1TJIH 4FQHA 3D39D 3VGBA 4TQEL 2YRPA 4UB0L 4W6XB 1WFOA 1TZGH 4O2FA 5CSGA 1N6QH 2AGJH 4YHML 3FQWB 3DVGA 5IBUG 3UTSA 3S4SG 2BXZA 3JTTA 4EZMA 3MRIB 4XP5L 4Z0XA 3RBSA 3F7RA 1L7IL 3DURB 2CRIA 4X6CF 2AJUH 4IIQC 1NGWB 4X4ME 3NIDF 1H3XA 4EN3A 2R0ZL 3CDFA 1JPGA 2X70A 1A1NB 1KGCD 4RA3A 2HRPH 3O3UN 1LGVA 2VLKD 5DD6A 1IGCL 3QUZD 1I9RH 5T1LA 1P84J 4QCIB 1S5IL 4Y8DC 3V4PH 1OGTA 2P5WD 4GH7B 1S78C 4WEBL 3BP5A 3SDDB 3AB0B 4PGCB 2FJHA 1N7ML 1VGEL 4HX1B 5E00B 1HCFX 1TMCB 3O3BB 4XVJH 4LF3A 5L6YL 4RAUB 4M03A 3MPCA 4FXGA 5L2JA 3IDGB 5FAAA 1NSNH 3ZKSD 4KRNA 4LCUB 1BHGA 1K8IB 3OAUL 3BAEL 3W9DA 3IF1B 1T03L 1DQQB 2X9XA 3L95B 1ZVSB 4DVBA 4LLDA 5ILTL 2FYYB 4MQXC 5I1LB 4JZJB 4NP4L 2AJSH 2IFGA 2DYPB 4MLSA 3T0DA 3X3GL 2IFFH 2JE8A 3KNBB 3U6RB 1WC7A 4TQEH 3DXAD 5IGXL 4LASL 4YHMH 3IFOB 2Q3ZA 1X4ZA 3QDHA 4M43L 1DE4A 4HKBA 2VR4A 2BOCB 3FQXB 3SCMA 2MTPA 4NHUB 5FOBA 4LRIC 4XP5H 3S96B 4FZ8L 2EE3A 3MV8D 5J1AA 3O11B 2VLRD 5EU6E 4GRMA 3T0EC 2R0ZH 4MXWH 3ZHKA 3QQNA 2DLFL 5HHQA 2Q3AA 5BS0E 3RWJA 1TETH 3VWJA 3EZJB 4MA7H 3T1FB 3T3ME 3GSWB 3TZVB 3D85D 3L5JA 1R3KA 3P4NA 1S5IH 5JPNB 3D6GA 1Q0YH 3DARA 3MTRA 4JFDB 4P5MA 4N8VB 2F54E 3WCYA 2HA1A 3BPNC 5IEKA 3KLDA 5L6YH 4NNYB 3RKPA 4Y2DA 1GGIH 3VRIA 4KDWA 2D7NA 1T2QL 4HDIA 5TH2A 2X4NB 5F21B 5GGTL 3OAUH 4NKIL 3IFLL 3KPLA 3BAEH 3AU1A 4K9EC 1BPVA 3V0VA 4HKZB 3MLTB 5DO2C 2AEQL 3PUCA 5EUKA 4NP4H 4M6OH 2ZCHH 1JBJA 4NO0D 4KMTH 3R1GL 1N0XL 5JTWA 1XGQA 2C3WA 4LDEB 3QPQC 3ETBF 2NLJA 1REIA 5GXBB 3G5XB 4PGJA 1H3PL 3EYSL 1E4KC 3EYVA 1QBLL 1NC2A 1CD0A 9CGTA 4K7PX 5DT1L 1GVIA 5FKPB 1W2KT 1XZ0A 4GKZB 2C3HA 4FZ8H 2EDDA 4MGXA 2QSTA 1EX0A 4MNGA 5ENWA 4Z5RA 4QRRB 3D69A 4PJFE 4K7PL 1XGPA 1C16A 4JO3H 5IK3B 1MFEH 2DF3A 5DHYA 3OF6D 1G9MC 1U8OA 3B2UD 2OXHA 4ZNCD 3QIBC 3EOYG 3ARXA 3IS0X 2IWGA 1NCWL 2YK1L 2ZCKH 4QOKD 3VXRB 2GK0B 2IEPA 1FIEA 3RVUD 1IM9A 2EYSB 5ITFA 3MC0A 1XIWC 2UWEA 5J1TC 35C8H 2MSPA 4M93C 3UPRA 4QGTA 4UOJA 2DJSA 1HIMH 1MH5A 3MNWB 2CLRB 5J6HB 4O2CB 3TNNA 1RK0A 1LO4L 1G0YR 1XR9B 4JY6A 4KTEH 4NUJA 1T2QH 3V0AC 2W9DH 5GGTH 4NKIH 4AL8H 1KELH 4BKLA 1YY8A 2B8OT 1JF5A 4UNTA 3KLAB 3GBML 4ELKB 2CD0A 1S3KH 4FQXD 2YOCA 1UFUA 2XZAH 4PD4J 2NY5H 3QHFH 5BOPA 3HMXH 4D0CB 4K23H 1H15B 2BNRD 1N5AB 1N6UA 1BEYH 2XA8H 3QZWG 6FABH 1A47A 3PG2A 1BQUA 4D3CH 1BJ8A 1WGOA 3B6SA 4X5XB 2X1WL 4GRWH 3MRIA 4OGYL 3V8OA 3RWHB 1T66C 2XIDA 3UBXI 1DN2A 4U05A 1NGWA 1RI8A 4WTXA 4PJCE 2G2RB 1V7NL 1A1NA 2HWZL 1W8NA 5JZ7D 2Y7QB 4NYLB 5FYKH 4AM0A 3ARGB 2F15A 5F9WB 4F15C 2LVCA 3T04D 2OM5A 3SDDA 1LO5A 3A67H 3VFWB 2Q7YB 2YK1H 3CAFA 4WO4C 4NQED 2YD6A 4NIKB 1BFVL 4LPCA 4K7PY 1KB5L 3OAZH 4RAUA 3TFKD 1WAAE 1RU9L 1EHNA 1QRNA 2E8ZA 1ZLUK 1LO4H 1FN4B 2R39A 4LCUA 3V52H 1EAPB 4X6CB 1YYML 3IF1A 4P2RA 3L95A 1ZVSA 3SHSA 1A02N 2FYYA 1EUTA 2B2XH 5EN2A 5I1LA 4JZJA 3Q5YA 3HNVL 3PNWB 3KNBA 1JL8A 3RWGB 2DLIA 3STZA 2CR6A 4H25B 5C0RL 1PZUB 4C58B 3GRWH 1PEWA 4PS4H 5DA4A 3WS3B 2Z8SA 2BOCA 5DVMA 1MQKL 4HUMB 4NHUA 3P9LB 4H0GA 3VFSB 3C2AH 3TA3D 3FOLB 2EZ0D 3LMJH 3S96A 5GZOC 4BZ1H 2OZ4A 4M4PA 3ROLB 1VADA 1RULH 4KRPB 3O11A 4U2YA 3ZYJA 1OHQA 2HN7B 3NCJH 3R0NA 3PGFL 5CLTA 1X5ZA 2HT4D 2XQBL 4Y5VC 2VQ1A 2EDKA 1CFVH 4YPJA 3GSWA 4GBXB 3TZVA 5SX4H 4PLJC 4YDVB 5JPNA 1IM3B 2NY6D 3NCFB 3FT3A 2CKBL 2DJ4A 3N1MC 4KI5E 4L9DA 3PWJB 3PIQB 4JFDA 4MDIB 5ALCL 3SN6N 5IMKB 4OFKA 4NM8L 1D9KD 5T3XE 3BD3A 3TBTB 4GMTH 2F19L 4CL7A 4JHWL 4NNYA 2AVGA 4D8PB 1Z9SA 1ZVHA 2X4NA 2XWBA 2E8YA 4NDMB 3Q5OA 4LARH 2ZUXA 5DMKB 4HKZA 4L9LC 1E27B 1TZHB 1OTSC 2VERN 3C60D 1QPPA 1FL6B 2P8LB 5KS9F 1KPUA 2NY3D 5FGBC 1F4XH 4WWID 2IAMC 5F7EL 3QO0B 2FEDD 3G5XA 1XF3B 5HYSB 3QCUL 2R2HB 2NNAB 4QNPE 4DFIA 2Y9RT 5IB3A 3B5HA 1FAKT 3I6LE 1MQKH 1GXEA 15C8H 3LDBC 3NCEB 4GKZA 4JJHA 5A2KH 4KRMB 4QRQB 4K8RH 3DETD 1C08A 5C86A 4FFWD 3D3VD 3RZCB 3EDDA 3HZVA 5FKAB 3ARDA 5E8PA 1WFTA 1YN6B 5D1QA 2CXGA 3GSVB 1IEAB 2ZUWA 3B9DA 5GRJH 1MIEL 5F71A 3S88H 3RWDB 3BEVA 1XAUA 4OF3A 1DSFL 2GK0A 5KSBB 4X6EA 4M7LH 2EYSA 3R8BB 3V6BR 4QTIL 3UTOA 1A4JB 3F12B 5ALCH 2FB4L 1IAIH 2CLRA 5EC2B 4O2CA 2NQCA 4MZ2A 2VDOH 1XR9A 4XNUL 5DYOB 2CIIB 1QSZA 4HFWB 3QUYC 2DBLH 4CNIB 1OTTC 1E4XH 2W60B 2PUQT 5JW4N 1RHFA 1U8QB 4CJ1A 3H9SD 4JRXE 3FQNA 4ELKA 2E27H 1UA6L 2EDWA 1EAJA 3ARZA 1ZGLM 4A6YH 5DZOA 4QHLA 4D0CA 3ABZA 3FCTB 5DDHB 2PO6D 3QCUH 4Z7NF 1WFNA 4OZIA 1K9TA 3GM0A 4IMLA 4N1HB 5BW7C 2VLJA 2IQ9L 3QDMB 3JZ7A 3RIFF 4XC1H 2G2RA 3L3IB 4NCC1 2GTWA 4P5TC 4NYLA 4IDJL 3ARGA 4DK3A 2ESVA 1I3VA 1NGXA 4O4YL 3VXUE 3O81A 4Y16A 1MIEH 2X2YA 3T2NL 2Q7YA 2YWZA 1CF8L 4GW4A 1NMCC 2GY5A 2YR3A 3D25B 4KY1H 2CRZA 5HVFB 5L7XL 2G5BB 3MX0A 3HI5H 1FN4A 4XAKE 4ETYA 4OM1L 3I3BA 1DN0B 3T0EE 2OR9H 4ENEC 2NR6D 3DYMA 3BO8A 3UZQA 1U58A 1KN4H 1T6VN 1OARL 1T1WA 3DPBA 3GK8L 4XNXL 4PRPD 1PY9A 3PNWA 2DWDB 5DJAB 2F54D 4JFPB 4UDTB 1K85A 3RWGA 5IMOB 4XGZA 5C2UB 1BQHB 3KYOB 4H25A 5JW5B 4NOBA 1MAKA 3NGBC 3ZHLA 4WUUD 1KLUB 3WS3A 1OD9A 3TO4A 1F11B 4MNQE 2NXZB 3P9LA 3VFSA 5DUBA 1CDHA 1GYAA 2YZ8A 4O2EB 3UCRA 3WKNA