4KROD

Nanobody/vhh domain ega1 in complex with the extracellular region of egfr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
213
Chain Sequence
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
molecule keywords Epidermal growth factor receptor
total genus 36
structure length 213
sequence length 218
ec nomenclature
pdb deposition date 2013-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kroD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kroD01
5TDOA 3B5TA 4PJGA 3OGOE 3TJHD 3TPUB 1I3GH 2KUTA 5EUOE 2APBA 4JRXE 4OQTH 3GSOA 4PJIA 4X9FA 5E2WL 5DWUL 5JHDE 4NO3A 1RUAH 1I1AC 3ZTJG 3TNNB 5IEHB 4MJIB 2LAGB 2A9NL 1NGXB 1F4WH 4DK3A 4M4PA 1LD9B 4ONGL 5CEYB 3N0PB 4O58L 5IF0B 1ES0B 2C1OB 3PGFL 2F54A 1L0YA 5J06A 3BEWB 5L2KA 2NTFB 5ACZB 5DR5H 3O2VL 4HC1A 5BQ7A 4N0YL 3X3GH 5EWIH 4PJ7E 5MEPB 3TO4D 3ZE1E 4XNXH 3WXVH 2I5YL 1DBBL 4XGZA 3KYMA 3INUL 4BSWB 4NQDA 3GMOA 4TQEL 1CCZA 2C3XA 2BC4B 1WT5C 4GRLD 3NPSB 3TBYA 5T1KD 2H1PL 2HP4A 1SY6A 2X4PA 1CGXA 3RTQD 2AJXL 4NJAH 3TBWA 3ELAT 1F2QA 5I71B 1JWUA 1XF5B 3VFNB 1LO3H 3BE1H 3ZL4H 5L7XH 4CN6A 1HHKA 1TCRA 4K7PL 3LEXA 2E3VA 3D2UA 4OCYL 4M7KL 4EQ3A 5I75B 4YUEH 2F74B 3EDEA 2AK1H 1WWBX 3QDMD 3B6SA 4N8VG 5B8CA 1NCAL 1A7BA 3FMGH 3N1PC 1S5IH 2QHLA 2GI7A 1AJ7H 5FUZL 4LLVA 4HXAH 5GS0C 4U31A 2JJSA 1F90L 4LPXA 4PJEB 1MCWM 1KIRB 4Q0XL 1DQTA 1OAQL 1N6UA 1UG9A 4PRHE 2YD5A 3C5SB 1B2WH 4LVEA 2B4CL 1MVUA 4NRYA 1A6TB 1FL5B 3MRCB 5KAQG 4JPKH 1RZFL 5D70L 5D7IA 5ILTH 3SGJC 1EHLL 1KB9J 3PDGA 2YA1A 4UB0H 3MV11 1BZ9B 1FGVH 4DUXA 1OB1A 3RFZC 1S9VB 5DYOA 3VWJA 3MLWL 5IOPB 5HGBB 1YJDH 2JKXA 2AXFB 2Z8VC 5CZXD 5EBMB 3FB6B 4YNYA 1BIHA 4PY7B 1BFVH 5DK0B 3BPCA 1I4FB 4LHJB 1I8LA 1FZOB 4OM0H 4BK4A 1GGIH 3OPZL 3WD5H 3NMEA 2F54B 2XTJC 3GSWA 4K2UH 4MJ2A 3VU2A 4YHIB 3BKMH 4CVXA 3EHBC 1FL3A 4Y8AA 2HFGH 3S96B 5IT2L 2VXUH 2DQTH 3GJFH 4ESKA 5DRWA 1RURL 2FYYA 2VH5L 4NNXA 3BVNA 3BJLA 4IOFC 1UWXH 2V2WB 1BD2B 3GSWB 1EX0A 3BUTA 2C3GA 4X0KA 5IVZB 2AXJA 3FKUS 1A3QA 1S9WA 3TBWB 3L3JA 3THMH 3MREB 4DZ8A 2APTA 4GRWF 4FOMA 2VTFA 2YN3A 3MUGB 2HFEB 1LGVA 4HPYL 1KLFA 4ODTL 3IKKA 2V7HA 3FO0L 5CUSH 5IMKA 1KCRH 5D7JC 1VB9A 4XXDA 4YHKH 4Q2ZA 4UQ2A 2R15A 4LP4A 1A0QL 3RA7L 1RUKL 4LSUL 1L9MA 5F7FA 3AY4C 3STBA 5HD8C 1LVEA 3L9RB 1ZLWH 5D1ZB 5D2NC 2YHGA 2B20A 3EDFA 4NQED 1PJ9A 1RUKH 3S4SB 4P46C 1J5OL 4O51A 1K8IB 4FQCL 1CDIA 2WQRA 5GSVA 3S35H 3ET9F 3F58H 2HLAA 1ROWA 1JN6B 2UWEE 2ERJC 2AEQL 5E1AB 1QSZA 4JREC 1CQYA 5TE6H 4BKLB 4HK0B 1LMKA 4Z77A 4IMKA 3RZCA 4OKVA 3BH9A 1EUUA 3D3VE 1XF2A 4PJ8B 1PVHA 1CG9B 4N8PA 5DGRA 2YRZA 5HI5D 5C9KA 4AL8H 4NRXB 1BQHG 3FO9A 1NUGA 4Y16B 3AS3A 3LPGA 4X6EA 4B7IA 3BUYB 4HHAB 4H1LH 3PWNB 5F3BB 4C59B 4Y5XC 4R6UA 1I7RB 1FL6B 2VDRH 1MCSA 4LSSL 2DWDA 3EO9H 3REWB 1J1PL 4OF7A 2YD4A 5MEQB 4AIXA 3WHXA 4TTDD 2VQUA 3MRRA 3P9LB 1N4XH 3BP6B 2O5YH 4V1DA 5FO8A 4F7PB 4L9LA 3P4LA 1NGYB 1WBXB 2H26A 3TV3H 3IJHB 5CS7A 4HWUA 2PTUA 1YEIL 4BQBA 5D5MF 4LCCB 1OW0C 2WINB 5C08B 3FOLB 3DV4B 3D25A 3ULVE 4WFGD 4KC3B 3K0WA 4JJ5A 4X4MA 2XKSA 1WBXA 4HUWB 2XXMB 4ACPA 3CFDA 4DQOH 4OUUB 1KCKA 4B41A 5GJSL 3U46B 4PS4L 4CMMA 4X5XA 3VRJB 3SKUD 6FABH 1K8IA 1S7VA 4GXVH 2OR9L 3WFBL 2CDFA 2NZIA 1UACH 4JDVA 4NQCA 5KVDL 1RJCA 3IETA 3BPNC 3O0RL 2JJUA 1JF1B 4WW2F 5A3ID 1FBIL 2PYEA 2BHZA 5E8PB 2ADFL 2WP3T 1CLYL 3HR5B 3ILQC 5HYQB 4WO4D 3D39A 2V17L 4O9HL 5T5NF 1QEWA 4FNLL 3IU3B 3MXVH 1K5NA 3D39E 3GIZL 3QNZA 4PJEA 4CJ0A 1NDMA 1VEPA 3FCTA 1M1SA 4M7ZC 2Z91B 5JR1L 3VG0L 4LBEB 4MQSB 1SY6H 1GIGL 1JNJA 3BI9X 4I0PB 4JO1L 2NW3A 3O11A 4JRXA 1F3RB 4Z7UA 3RUGF 4PGBA 3MODL 1YEEL 3LKNB 4ZOCA 3UJJH 5CJXA 1P6AB 1HYSD 1ONQB 3RWIA 3LS5H 5T1MB 3QQ9C 2X4SB 3MRDA 4IS6B 2AXFA 1P1ZA 2X7LA 5FCSH 1IQDB 1RZ7H 1JPGA 3AVEA 3BPCB 3KGRA 4HAFA 4EI6A 3LRGA 2BVEA 4W81A 1MLBA 4Y19E 4HKZB 5CEZL 2OL3H 1DE4B 1FFQA 4KHTL 1F42A 2PNDA 4FZ8H 4NFBA 4WI3A 5IB4B 2FIKA 4P4RA 3V52L 3S98A 5D1QB 3BIBX 2Q8BL 2VH5H 2VDNH 5FYJL 1CICD 1JPGB 2GTZB 32C2B 2Q76A 1DVFB 4M8VA 5EN2B 5J89A 4R9HA 2P5ED 3SY0A 4P2QA 5DUMH 3VRIA 1OF2B 1EO7A 4KTYA 1YY9C 4PGEA 4KHTH 4K2UL 1RJYB 4JHWH 4YHNB 4OSUL 4Y5VB 4JZNB 1WIPA 1DQLL 1J11A 2X4TA 3SOBL 2EH8L 1BWMA 4YDKL 4F15B 3BKJH 2D7MA 5IM7B 2PO6B 5CSZB 1KBGH 3PGCA 2VQ1B 3S4SA 1SMOA 5EOCH 2Y36H 4XWOD 2R0ZL 4L29A 1OVZA 5BVPH 1GZQB 3CK0H 4JPKL 1JZ2A 3KPNA 4XP5H 5GS1B 1F4XH 4DVBB 1EEZB 4DAGH 5SX5H 5IG7B 1F4YH 1K8DA 5IB5A 1IRAY 4RGNC 1BIIA 1BFTA 1OTTD 3ZKXC 3AAZA 3UYRL 3HC4L 2VQ1A 1AC6A 1XT5A 1VADA 4HJ0C 4P5MB 3GFUA 4I3GA 3U6RA 3UP1A 4JRXB 3I75B 1I4FA 5TDOB 2DQGL 1MRDH 2CXGA 4R0LB 4H26A 5ADOL 1FYHB 1T1ZA 2DI9A 3LDBB 5M95B 1ORQB 5HY9B 5KVFH 1BBJB 3DX9B 4XNYH 4MJIA 4WHYH 3I3BA 4OIIH 5C0BE 1F3DH 3O6FD 4UT9L 3ARRA 4YIQA 2OQJA 3QFJD 5DRNA 2VXSL 4EUPH 4DQOL 2CLZB 5GRYA 3IDXH 5CWSA 4P2YA 5SX5K 5B8CC 3ULUH 3O9WA 2EO9A 5E2VH 2E27L 3IKCB 5FO8B 3VWKB 4Z0XA 5J6GA 3VI4F 2J8HA 3EFDL 1K4CB 1TZGL 2Q86A 3NCYP 3DVGA 3L5WA 3ILPA 4CW1B 1BOGA 1P84J 3QEQD 1N8ZA 5SWSA 4LRIC 3ZYZA 3TO2B 3WKML 3WJJC 3IKCA 2WQ8A 1GGBH 5C3LD 1ADQA 3MYZA 1T1WB 3T4AB 3WNPA 2A6KA 3AM8C 2UZYB 2XWTA 2C5DC 3DYOA 5I1JH 1IAIL 3RWJA 4ODXB 3O45A 4YC2B 3AFLA 4F33A 4ZFFA 1IEBB 4JLRB 1N8ZB 4X99B 1XGRA 1UXSB 3BE1L 2XTJB 5HI3C 2Y5TB 1OLZA 5LGHL 3VFMA 3A0OA 5KTEH 3WBDA 4KPHH 1A6WH 3JWDL 4MD0A 4NM4H 3PP4H 3TO4A 4IDJH 3S88H 4XRCA 5E08L 4PRPE 3HNSL 2MJWA 4XMKL 3WSQH 2OK0L 1CT8B 4U6XA 1ZE3C 4L5FH 4OCSL 1HINH 4S0SD 3VFUA 1FN4B 4XPHH 1H3XA 2DKUA 4GXUM 1IT9H 1A14L 3VGAB 2PCPA 3VFVA 1E4JA 4M48L 3P9LA 3U83A 2AERT 1J9CT 2ZUXA 5EZJA 4M8QA 2NY2B 5EOQL 3MNVB 3VRLF 4CNIA 4TSAH 4GUPA 3S5LA 3WS6A 1DL7L 5E2WH 4N0UE 4UDUB 1G7QA 1NDGA 5IHBA 2OR9H 4AK1A 3LQAL 3W9DA 2NY5H 4IRJC 4UT6H 3SE9L 1ZANL 4DTGL 3FFCE 5T1MA 3VXRE 3MRDB 4NZTL 1T5WA 4KI5E 5IROC 3BVNB 1MPAL 4E42A 4NQDD 1A6ZB 5B22A 4C56A 1DE4A 4HT1L 3WN5C 1I1RA 3J8F7 3TZVA 1HQ4B 4XNUH 3QO0A 2F54E 3QUZD 1PQZB 5IVXF 2Q6WA 1NGZA 4XX1E 2WNGA 4NO0A 3WUWG 5IMKB 4QTHB 2ENYA 1B3JA 3RWHA 2EXYD 2W60A 1C5BL 2O61B 3P0YL 5DQJB 4YR6B 2R0ZH 5I8EB 1EFXB 2HTKC 2FX7L 2RCSL 3U1SL 4NFDA 4X9IA 3EYSL 3N1MC 3P4MA 2O61A 3BEVB 3S97C 3ULVD 3RHWK 3RNQB 3ALWA 1G7LB 2NXZC 4HWBA 5I30L 5EDXA 3NH7L 2P46B 3HMWL 5D2NB 2R39A 3PGCB 4HUMB 2OTWA 4FFWC 1U8PB 4PBWD 4AM0B 3EFFA 3HC0B 5F97E 1RZFH 5D2LE 1T7XA 3CDGA 4JDZA 1B2WL 2NY0D 4OAWA 4KJQC 5L8JB 5DJ0B 4Q58C 4RFOL 1A6VH 3OHXB 3QWRA 1FRGL 4KROD 3MBEC 5GGTA 4OLWH 5JOFB 3KPSB 4HIIA 4IS6A 3BD4A 5F1NA 7CGTA 4LLMB 4GUPB 4DN3H 5FGSA 4FQJH 4G6ML 1X9QA 4YDIH 3AS1A 5C0AA 4D0CB 1G9NL 1FNEB 3DXAE 2RR3A 3SDXF 5I0DA 3CMOL 4KTDH 5IW6A 1F00I 1WZ1H 2AK1L 2I25N 4JM2A 4NQCE 2WBJC 5J11C 2EICA 5EU6D 3BP6A 3ZYOA 2JIXA 1B0WA 2EDKA 3L3JB 3WIIL 2HTLC 1YDPA 1RUPL 1Q9WA 2HRPH 4N8CL 3VW3L 1BD2E 1T03L 2C3VB 5I6XB 1NANI 1JTPA 2AJXH 4NJAL 4EDXA 1DBJL 4ZQKA 1HHIB 2VO5A 2R4SH 4L3CA 5F44A 3QPQD 1YEKH 4G8GD 4S1SL 3AC0A 3B9KC 1I8IB 4NKDA 1HOCA 1GXEA 3VDAA 3MRMB 2CR3A 3HUJE 3IVKB 3RBSA 2V5RA 3CNKA 5F1OB 4NO5A 3TNMB 2IMMA 4AMKL 4QRPD 4L3CB 3V0WL 4YC2C 4Y89A 3FN3A 5E00A 2XNAB 3QQ4B 1YEJH 5GSRA 1LDPH 4PV9A 3FJTA 3L5WB 3EYVB 1OGTA 4OKVB 3T0EE 4P5KA 4MNHA 5I19L 2BHUA 3IVKA 1ULVA 1CLOL 1GC1L 4X7CC 2F58H 4XT1C 5CKAA 1A7PH 2V9QA 2XN9A 5IR1A 3C08L 3QFJB 4GXVL 4PJAF 3D39B 4CDHA 5C8JA 5E56A 1YEJL 2V2XB 1A14H 2XTLA 3V0WH 1RZGA 2KQNA 2AEIT 4KDTA 3MLUL 2WIMA 2B4CC 4JDTL 4TSCH 2HMIC 2QQLL 5TE4L 4N0UA 3SE8L 3DIFB 1KNOB 4AT6B 1ORQA 5FHBH 4ZUTB 1QHOA 4OM1H 5DD0L 6CGTA 1FCCA 3LHPL 3O2WL 3L3DA 2HVKA 3O8XB 3IAPA 4ELMB 4DZBA 1SVZA 4HKJB 3ARBA 5LGHH 1IC5H 3ZDXF 4G3YL 4GG8B 4WI2A 4JFPA 2IGFH 4M4RA 3STZA 3N50A 1YQVL 2A74A 4RAUB 4NO2B 5I1IH 2A6IA 4LSSH 4KKCC 4X9HA 1G6RH 4ONFH 3BH8B 3BYYA 3C9NA 3P73A 4C58B 4QXTB 2ZZUT 5BOPA 4XH2B 4PLJD 3PDOA 4PJ5A 2YD2A 4P4KD 5TPWL 5FKPA 5IQ9A 1BOGB 1YECL 5T1LA 2EDHA 5EPMB 3H3KA 4ZS6D 2VRAA 2FEEL 2YEZA 3DSFL 4JVWA 1DQML 2FLRT 3VCLB 3VI3E 4PGEB 3L7EA 1QRND 2D31A 2Z31D 4YJZL 1V7ML 4JFFB 3V2AR 5FO7B 2AEQH 4O51B 3WFZA 4OQTA 2FO4B 2J8OA 4L8BA 5LAXB 2HAZA 3RUGE 2VKWA 1KJMA 2ARWA 4P5TB 4P4KA 3PL6D 35C8H 2ICEA 4JY5H 4TTGA 1L0QA 4LQ1A 2WMPA 3HTLX 3O4LA 3C6SB 1XGTB 5FF6B 4NQVB 5KZCB 5FO9B 3H9YA 5AG8A 1MCDA 4FQ1L 4CGTA 4HGWB 3QUZA 5DUML 4P2QD 5BS0D 1LK2A 4Q9BA 2UWEB 1S9YB 1U8JA 3D6GA 1ONQA 2BMKB 5FKAA 3GMQA 5DMKA 2DQIH 2CR6A 2NYYD 3S3JA 2WANA 3MBEA 3PNWA 5GISL 3UMTA 2WZPD 3UPCA 1LEKB 5ITFA 3S88L 5SWZD 3WJJA 3QNZB 1RUQH 5GJTL 5DVMA 1EH9A 5GS2H 1KB5L 4PGJA 3OHXA 4L4VD 4OTXH 2PXYA 2W92A 1W8NA 4NOFA 1TXKA 4U1SA 2EDLA 4WFFE 1QUNA 5F9AC 5DRNB 1KT2B 1L7TH 1WWCA 1ZGLB 1A7RH 2H2SC 3GMOB 5C0GB 4MD5B 3T4YA 3DROA 1MVFA 5C0CD 5GGUB 3EO1B 5HYSG 1HIML 4X7SH 1U8OB 3DBXA 4GBXC 4LDLB 4I5BA 4E41A 3RWHB 1EMTH 3SDAB 1K4CA 3L7EB 5TDNB 1KT2A 2RIKA 4HPOL 4LLUB 4Q0XH 5HYJB 4PUBH 2ZUQC 3RIAK 2E27H 4M7LH 1HSBB 1MHCA 3T4AA 4K23L 3X13B 3HCVA 1UKTA 1UM4H 3BD3A 4TVSa 1I9IL 3IS1X 4XBPB 3KHQA 4POUB 1ZHKA 2WUCL 5ICYA 2VITA 3O4LB 4GAJL 4OV5A 4WUKL 1OTSC 1YNKH 1H5BA 4UDTA 1HQRB 3MFFA 3MNWA 4TRPL 3T3ME 2NX5B 4KRPD 2EYSB 3SJVE 5D72L 2VXVL 2X9YA 2AGJH 1KJ2B 2NPLX 3TO4B 5H2BB 3RP1A 2Y4SA 2NY3C 2VSCA 3QI9B 4WFHD 5BXFB 5KW9H 1F2XK 5KVEL 4F8QA 3MROB 5DUBB 3G5YB 1SVCP 1A6UH 1A9EA 1IGFL 5KG9B 2LTQB 2EECA 4OCWL 5I1HH 2ZCHL 1UB6A 1U93A 4JO4L 1IKFH 2HT2C 3Q3GB 4DVBA 4FQ2L 3MLPA 2CUIA 5B3NA 3D69B 5C08E 3IDXL 4PGDB 1PLGH 1R3IL 3TVMD 5KW9L 3CK0L 5E6ZA 2G60L 2NY7H 4QEGA 5KG9A 5JIPA 2DBJA 4PRIE 3I75A 4PJ5D 4R26H 4Y4KD 4N8CH 15C8L 5KSUA 5DT1L 3L3IA 3GSVB 1LE5A 5CGMA 2IAMB 4G8EA 3LKSA 5LCVL 3MLRH 3SJVD 1F8TH 4HKXB 2A6IB 4X98B 4PJ7B 3CUPB 2YBRA 5D7KE 4PJ8C 3HB3C 5EZOH 2FJFB 3BWUC 2VE6B 4N0FB 4W68A 4AEFA 5HHXL 1FZMA 2GJ6B 4P2RB 3TBTB 1MFCH 1RVFL 5CZXC 5DFVD 3VMPA 3FN0L 2LE9A 1T7WA 4TNWK 5I8OH 5SWSD 1FYTD 3TBVA 4GKNB 2D7TH 2DIBA 1BF2A 3EFDH 3VXPB 1QFUH 4U1HB 5IHUH 4F3FB 3CFCL 3V5DB 5JIIA 1ACZA 4O02L 4KU1A 1CXFA 4P46B 5FOJA 2XKUA 1A1MB 2OMNA 2XZQH 3L3HB 4KY1H 3P0VL 5T3XL 2FBJH 5CD3B 4M6ML 5FK9B 3TT1L 3KWWA 3VE0B 3S4SG 5I2IA 5IBTL 5FYKH 1RD6A 5BVJB 4PV8B 3QXDA 3WXWH 2AJYL 5F7NC 4MAYB 5DMGC 2Z35A 4XHJD 3ZO0A 2GK0A 1U8LA 4Y1AE 4NBXB 4IMLA 5GJTH 1HNGA 5T1DL 2BHYA 2E6PA 1NGWA 5DJXB 3ARFB 2HVKB 2W38A 3SDXA 1LEGA 2CXKA 3LEVH 4JKPL 4GT7A 1KUMA 4X8JB 3BT2L 4XBEH 1RULH 1T1XA 2D7TL 3JUZA 1MWAH 3QQ3B 1KFAH 3FQXA 1P9MC 1U3ZA 5AWNH 2Y5EA 3G5XB 2Z8WC 4ONHA 4K3JH 4NDMA 1P7QA 4EBQL 3KNBA 4LPUA 5FKAB 5IGXL 2Q3ZA 3MR9B 5D71H 4F7PA 1P2CB 3FMGL 3LKQB 5T1DH 2NY5L 3C5JB 1OSPH 2AJ3B 1T21B 4NZUH 1ZKAA 2M26A 4X4XA 1BQUA 1G0XA 1B88A 1UQSB 3O0RH 4L8SA 1MFBL 3WXWL 3KNBB 4MZ3A 4M8QB 2I07B 2VZOA 1EEUA 1REIA 1BX2B 2H3NB 4PJAE 3X11A 4QRSA 3O8XC 3ARED 4JCLA 1LO4H 3BDYL 4L4VA 4X4XB 4TVPL 2C4FT 4UB0L 3LD8B 1CE6A 2VN7A 2BSTB 5EO9B 1HINL 1MAMH 2A1WL 3EJZD 2NMSA 1RIHH 4JQXA 4K7PX 4UV7H 5DQDH 4OCLC 1AD9A 3BP4B 2BVTA 3D39D 3ZSSA 2XZCL 3X11B 3EOBB 4CUCA 1BLNB 4Y5YB 1ZS8A 5CIPA 1JGUH 4PRDB 5DDHA 1UGNA 4E41D 2YOCA 1IKNA 2P44B 4PJDE 1AJ7L 1NAMH 3U0PB 1VCAA 4MNQD 4ISVB 2CMRL 4NPYB 1ZT7B 2AJSL 3PWLA 1SM3H 4G8FB 4HEME 4KV5F 2KL6A 4Y88A 5HI4C 3RDTA 3QNYB 4WUKH 1J0JA 6FABL 3RVWD 3FT4A 5E99H 1DP0A 1IL1A 3WFCH 2DTMH 3IGAA 2FJHB 3GMQB 5DMKB 1RUML 2UY7A 4U6YA 5C0AE 4K23H 3D48R 2BNQE 2VDOL 2VR5A 3GSQA 4PD4K 2DJ4A 4TQEH 4PJGB 3ZDYF 3QFDA 3DTXB 1C5CH 3U7YH 3OR6A 2MPAH 3L3DB 3O8XA 4CN4A 3MQIA 5I1HL 4G5ZL 1P7KA 1LNUB 1T2QH 1NKRA 3BGFB 3CSGA 3MRFB 5F6IC 4R97B 1V5JA 3G6JB 5EC2A 3A6CL 2H8PB 5JMRA 3VFSA 5IFJA 5E1HB 1OAZL 1OP5H 4KK5D 3S37H 3PQYA 5TE7L 5TFSH 5EU6A 4APQD 2PTVA 3TZVC 4QRSB 3MRQA 4MXVF 2MKWA 4NO5B 5GGRA 4XXDB 1FG2B 4EZMA 2EDJA 1LDPL 4MYWB 4UQ2B 1BGXL 1TZHB 2HJLB 5SWZE 1ZT4A 3HI6H 4XP9H 3H9HB 1E28B 4OZFG 4EJ1C 4ODTH 4YHPA 1OY3B 1P4LB 3GSRB 3MLXH 2W60B 3AXLB 3MJ9A 4U7MA 1XF5A 4HV8A 1BWWA 3SO3C 2NY5C 4YK4B 4EN3D 1IGTB 4JG1H 4BH8A 3IU4L 4OZGA 4M1CC 2DYPD 4PJBF 1DEEA 1PG7L 5F9DC 2EEDA 2CO6B 1EHNA 2GFBB 3LY6A 1RIVH 4JFFD 3RBGA 5F8RC 3NA9L 3BAEH 1AGFA 2FEDD 4I77L 2Y36L 2O5YL 3X12B 4PJIF 3CFEA 3E8UL 1XGYH 2GSGB 4ZSOE 4Y4HD 4NQEA 4S1DD 5DUBA 3BQUC 5CD3A 3CFBA 4FMFA 3NIFF 5KBNC 2XV6B 4QCIB 1QR4A 1YY9D 4QGTA 1A4KA 3QRGH 1W72A 1I7RA 1C1EH 5EA0L 2ZOKA 5HPMA 1X5GA 4YFLF 3TFKD 2W9DL 4Y2DA 4JM2C 1AO7B 4KY1L 3GO1L 4DGVH 3W2DL 3SCMD 2NY4C 4XCFH 4GXUN 1KTRL 3FAWA 4KUZH 5JLZA 3ULUD 2H6PA 1CZ8L 1NMBL 3CLEH 3P4OB 3TH3T 4QXUH 3ZKQD 3MRIB 4G9DA 4I13B 2HT4C 4WFHE 1P7QB 3N9GL 3O9WB 4EI6B 2D7NA 1OTTC 1EPFA 5J8OA 3ARGB 1UJ3C 2Z8RA 1AI1H 1WTGT 1YMMB 2IF7A 3P9MA 1JRHI 2HG5A 3LOWA 1XZ0B 1FFNA 5CAYB 1U42A 2BVUA 1EEQA 5IFAL 4BZ2H 2P49B 3V79C 1S7QB 3CGTA 1A0QH 3RA7H 1IM9B 4QXGL 2CKBB 2OP4L 1A7QH 1SY6L 1WITA 1CF8H 1T6VN 1YEFH 1S7WB 3MRGA 3QWOB 4MGXA 4JO1H 4RGOH 1ZTXH 1MCRA 4UAOC 3NA9H 4GW5A 4ZXBB 4KV5E 4PRPD 1A4JA 3EYOA 3F8UB 4P3CL 3LKOA 5C07D 5TDPA 2IQAA 1NFIB 2CLVA 2LFGA 3Q5YA 3TT3H 3N06B 4FNLH 5JDJA 4P48A 3HC3L 4ZD3L 4U0QB 4L4JA 4NQVA 5T3XD 3RJQB 3LEVL 3T1WA 1OM3L 1MCOL 1IILE 1RZKC 1UKSA 3MV9B 2R9HC 1NGQL 3MOBL 1QBLL 5C9JA 5MHSD 1UZ8B 5IWLA 5SWSE 1X4XA 5F1IA 4L8BB 4K8RL 5DWUH 5HDQH 1ZHBB 3OKMB 2Q7YB 1DZBA 5DJCB 1BFVL 3ALXA 4ZSOA 5J3HC 2OJZH 1NMCC 4OKDA 4O5LL 1R5IB 3DX6A 4GRLA 4JAMB 4OLXH 5D7JD 2YPLB 1AY1H 1IC4L 1A3LL 1U2CA 3RZWA 3GMRA 1F3JB 3RVTC 4CJ1A 4RAVB 4NO3B 2VDKL 3MV7E 1T2XA 3MMEA 3C5JA 3VWJC 4HC1L 5BO1L 1VEOA 1TJHH 2OR8A 5JIKA 3TJHC 3SDDA 5HY9A 2P47B 3E0GA 3V5KA 2ZCKH 3EOAB 4QTIH 2DKMA 4YAQB 3UZVB 3ROLB 5D1QA 1JP5A 4HH8A 2DKSA 1IC4H 5E99L 3WFCL 3D3VB 4HWBH 4BFIB 4XGZB 4HKBA 4HKXA 2ADGB 4MA8H 4OGXH 3S6CA 3RU8H 2O5XL 2X4NB 3K3QA 2AEWA 3SQOL 3QXWA 1DUYA 4YHOH 1BVLB 3SCMB 5ITBL 3QJHA 2XQYG 4DEPB 4Q6YA 3T4YB 2PYFA 2P42B 5EU7C 5DMIH 3WNNA 3CX2A 3GSNH 1WWAX 1A1OA 2FWOB 5JXEC 4LGPB 2CDEA 3DNKA 2UVEA 5ERWB 1KIUA 4LIQE 3UPAA 1A3RL 4GAFB 5DLMH 1P84K 3QXDB 5K9QI 2Y23A 1DQQB 3S35L 2VUOA 1DN2A 3TCLB 2AXGA 2QQNH 4MD0B 3GSQB 5GGTL 5B21A 5EH1A 4PG2C 4YQXL 4GBXB 2RFXB 3V95A 4U1GB 1UADC 2BRRH 3IDNA 3PJSA 4UBDC 5SX4H 3WKNA 2N56A 5IP4A 5C0EB 3WO3B 3FB5A 1Q9KA 4GW4A 5IVXB 5HDBE 3ZYIA 3A6BH 1SYVA 4IRJA 4I8DA 4J3VA 1A6AB 4KI5C 5IW6B 3UYPA 2RGSA 1DBML 1F4AA 4PRNA 3GNML 3LKSB 4DGIL 1JV5B 1ZA6A 3ETBF 4XVTH 3ZMRA 1F4YL 5K9OA 2XTJE 2N1KA 3PQYB 3CDFA 3GMNA 4Y4FB 1YDPB 3U0WL 4GS7C 4NCC1 1E4KA 1KJ2H 4APQB 4FTVA 1NC2B 3BZFB 4QY8B 4MD4B 3Q3GA 4AIZA 4Z0XB 5C09D 5J6GB 5EU4B 3H9SB 5SX4I 3FB8B 1N2RA 2ARJB 4RMVA 4J8RA 3WD5L 3GMNB 4Y4FA 4ZXBC 1DL7H 4G80B 4KHXH 5HYSB 5EUKA 4ETQA 4GMSH 4TUOA 3TNMA 1WAAE 4NWTH 4U2ZA 2JJSC 4P5TC 4WU7A 3SDCD 3TT1H 4Q7DA 1HCVA 1N26A 5TGBA 4QXUL 2L7JA 7FABH 1QSFA 2FH6A 4WO4B 3ARDB 2EDYA 1DLFH 3CVIH 2DM7A 1QFUL 3U79A 5HVFB 4OT1H 1T20A 3CFCH 4HMEA 4NYLA 2HTLD 1CGUA 1HSAB 2QEJA 4QYOB 5IBLC 3ZTJH 5C09B 1G7HA 1HXMA 5DJDA 4IRSB 4OQ1A 2IALB 4K71B 4HK0A 3ARYA 4EUPG 4NUJB 3AS0A 4W6XB 4YHMH 4JRYB 5E7FA 2YD8A 5DQ9A 1VFBB 2ZOKB 4MJ6B 5GS1A 4XAWH 1OQXA 4I2XE 5FA3A 2J6EL 4ORGB 3FT4B 1SBSL 1RMFH 4XAKE 4ZODA 5FHAL 5GIRB 2Z4QA 1F45A 4RMTA 2OZ4A 3HE6D 3ZE2E 4NUJA 5D6DC 3U6RB 1CLOH 3UTTA 1AXSA 2R29L 1KJ3L 4ZAKA 3MJ6A 1A6AA 1CFVL 4KXZI 1MIEH 1U3HB 3FFDB 4P57B 5I17A 1P2CA 1EJ6A 1E4XH 4ZDHA 3E1F1 4MNGB 5JW5A 1J0HA 4MWFA 3WHXB 3WXVL 3RWFA 2VLKB 2CK2A 4PG2A 3O9WD 3FO1A 1U3HA 4FP8H 3VDCA 2YPLE 3L5HA 5IMLB 2HN7A 3HNSH 4XMKH 1ACYL 4TVPH 3VFSB 1DANT 4OZGF 4LAQH 2QQKH 5FKPB 3VFGH 1RJLA 5DC4B 3PWPD 3FO2B 4F7EA 4XPBH 2A83B 3VXQA 1QR1A 3FRPA 1MI5E 5HYEA 4PGCB 4NZJA 4B5EA 1HEZB 5FHAH 4OQTL 2UY6A 4LCWA 3GKWH 2ADIB 3S34L 3NACH 4Z77B 4RQQA 1KENH 2R1YB 4X83A 2WUCH 3MOAH 1HOCB 4XCCH 4HXBL 5FECB 2EDFA 2V7HB 1JI1A 3MLZH 3WEXB 3LN9A 5FDWA 3CCHB 1DUZB 4U1IB 4YGVB 4AH2B 5BZWB 3P77A 1T0MB 1TJGH 1IQWL 2XZCH 3GEWB 1TQCB 4PLJC 2WWMD 1VACB 5CBEA 4HUUA 4HUNB 5F6IB 5CBAB 5F7KC 4U1JB 4X7SL 1S9XA 1WIUA 2DLGA 4G6FB 4XCNB 3UEZA 3PWJA 3GGWB 1MQKL 4PRDA 3RZCB 1JPFA 5I6XC 3RGVD 2ORBH 3M07A 3U9PL 3DX7B 3PHOB 3WS3A 5I17B 2PTTA 1DQLH 1J18A 3IJSA 5DURD 4OGAC 3DECA 2NY1C 1WBZB 1SJEA 2EYTB 4PP1D 1JGDA 4Z8FL 5KSAD 4L9DA 1FSKC 1QTYT 3GSNA 4KZDH 4YEEA 2GJ6D 2VAAA 4TSBH 4FTVE 3VI3F 3BXNA 4ODWA 3WS6C 3VD5A 2NY1B 1AGDB 4D2NA 1KB5A 4HQQL 4L8SC 3CLFH 4I0PD 5EBLB 1WF5A 3BEWA 5L2KB 4PJCA 5TQ0H 4PJFF 2B0SH 3BHBB 3AU1B 1RPQA 2BVQB 3KLHC 3QHTC 1ITBB 3CD4A 4HMDA 2ADIA 3ARZA 5HYJA 2PW1B 4FG6C 2QQNL 3LIZL 4JFZL 3BSZL 1MCLA 2VJXA 4XBGA 2NXZB 4NN5C 5FYJE 3OKLB 4KK8C 4GJTB 2DWEB 1K4DB 5FB8A 3T0XA 5C0NC 3IFNL 4OFPA 2E6QA 4TPRH 2APXA 5BV7L 4WU7B 4PJ5E 2FBOJ 3D1MC 2YUXA 1PG7H 4G5ZH 5LAXA 2I9LA 3DSFH 2Y6SC 3KPLB 4JPWH 3W39B 1DQDH 4WFEE 4JKWA 4U6VL 3SE3C 1MRFL 5HPOA 2E7LA 3IJYB 1G6VK 3HG1E 4D9LH 1A2YB 2DJUA 3OF6A 1I9EA 1WFNA 3MV7B 5KSAA 5F1IB 2COQA 2VQTA 4P23C 1FO0L 3QIWC 2YUZA 3LV3A 3GBNH 5T1KB 3PGDB 3V6FB 4IRJB 2FB4L 3LMJL 1DQJA 3RY6A 3MLRL 4RZCB 1RMFL 1EJOH 1LK2B 2AABH 3RVXD 1BMGA 4NWUL 5DJ6B 4TUJB 3H7BA 3NAAL 1Q72H 3WN5A 2X89D 2XZQL 4AJ0A 1J1XL 2EC8A 3MV8E 3TYGH 4G3YH 5E95B 2G60H 4KI5F 4KK6D 5ESVA 3NPSC 4JG0H 5ADPH 4KDTC 2E9WA 1I3RB 1CQKA 4JFDD 2YSSB 1FFNB 1VESA 3TBYB 2BVOB 1VERA 2YRLA 3NN8B 4ERSH 1M7DA 3SE8H 1CIUA 1UWXK 1Q9WB 1KN2L 4ORZC 5K9KB 1I8KB 3ULUL 1ZHNA 1PEWA 1L4IA 4LIQH 1TCRB 4V2CB 5EZOL 2V2WA 1LO2L 4LSDA 5GGUA 2FIKB 1C5DA 1ZANH 4ONOA 5C0DA 2ZSWB 3C8DA 1UWGH 1CD8A 3D5OF 5ANME 4OIIL 5F9OH 3LRSA 5DT1H 5A2LH 2BX5A 1YNLH 5TDNA 5KVGH 4LQFH 4JQVA 3O3EB 3WLWC 2DQJH 3LVEA 1DBKL 2X4RA 3HUJB 4UTBL 3FT3B 1S7TA 4HS3A 3EJYD 3AAZB 1II4E 4XPGH 1Y18A 5F1KC 5T5FH 3HC3H 4ZOEA 5E6IC 1IC7H 4QWWC 3MJ7A 3IDJA 4YBQD 3UPRB 3MRGB 3QWOA 3O2VH 4KK9C 5CJ8A 4XVUD 3FTGA 4HLZH 3BP7B 1MJ7L 4E5XA 4F7CA 1TENA 2X5PA 1HDMB 5C0BB 2ZJSL 3O6LL 2FEEI 5E8OA 1J0YA 4YDVB 3BWAB 4IDJL 4HJGA 4NGHL 1O0VA 3DX9A 3ARFA 2F8VA 1GAFH 3RGVB 4KMQA 5BZDA 1RUAL 2R29H 1EEZA 1GJIA 1FYTB 3PWJB 5AUMB 5JW5B 4U1MB 3EOTL 4PJFB 1K2DA 4OFDA 3PIQA 4RMQA 4LNRA 1F6FB 1V3MA 2EIBA 4R90H 1NAML 4LCIL 1VGKA 4PRID 1KC5H 4KVNL 1IJ9A 1QO3A 2J8UA 2XOTA 4UIMA 2BZDA 4OFYA 1QLEL 2DQCL 3CFJB 5GGSB 2UUDK 4JKPH 1KELL 1XF4A 4TNVK 3QNXB 3RY5A 2FATL 4RSVA 3VD7A 1CGWA 1KLGB 3K8MA 4MJ5B 5IQ7L 4DW2H 2EC9U 3OAYK 1EK3A 3RL1A 2EE3A 3JBG7 2VLRD 3KLAB 2C26A 3KPPA 3QR2A 4LSTL 1LO4L 3V7AE 2EIDA 1Z9OA 5F88B 5CLWA 3O2DA 1N64L 2AEPL 1XIWC 4A6YL 2EE6A 3R8QA 5HVGB 1AD9B 2OR7A 3KDMA 2AK4D 2CRIA 3LS5L 1MY7A 4YR6A 5LCVH 5JW4Q 4DVRL 5A2JH 4HWBL 3IFLL 3ZLQC 3VXTB 3OAZK 1NBVL 4X6CF 2DQDL 1I1YB 3FQRA 3KR3H 3CX5J 5HDBF 3O6ML 4PJ8A 1GGYA 1C16B 3N1GC 3PP3K 1KN4H 4RMUA 4HIEA 1CYGA 5D70H 2DOCA 3U0WH 1WC7A 3HAEG 2EDOA 3NZ8B 3MCLH 1P7HL 2OTUB 4TTDC 4NC0B 3W0WE 4JFYA 3PJSB 4HIEB 3HNTH 4M61B 4ZUVA 3HI6L 1IEHA 1BQHB 1EO8L 1K5NB 5JA8B 3AGVA 3H0TB 2Z4QB 3WHE1 4LCUA 2DI8A 1R5IA 3C5ZC 2VLLB 1CU4H 4NN7C 1OAKL 3PHQA 3QDGE 3SDCA 1RZKH 4YDKH 1T83A 15C8H 1FC2D 1PZUB 1D6EA 3UAJC 1KPVB 1MHPH 4I3SH 4GBXA 5CD5C 2RFXA 4ZFOL 4JHWL 5I15L 1PLGL 1R3IH 4QNPE 2FGWH 4GKZA 1JE6A 5D1ZD 3HPJA 3MRHB 1XH3B 3NPZB 3Q6GH 4P0DA 2ATPB 1J10A 2PW2B 4P9HC 1ZTXL 4KPHL 3ARSA 1NMCB 2WW8A 4NZRL 3H6JA 4R3SB 1JPST 1HE7A 4C56B 1E6OL 4I0CC 4WU5B 2X1XR 1DFBH 1QBBA 2GJZA 4OZIB 4UV4H 2ATKB 3CDCA 4JFEE 1R3LB 3M45A 4HLZG 4BUHA 5IBUG 5I2IB 4NN7B 4QRPA 3ZKSD 4Z7QE 4ODSL 3ARBD 3W39A 3RNKA 1MI5B 1U8IB 4R4BB 2Y07H 2W9EL 2Z91A 3BZ4A 1G9NC 3HE7C 3HKFA 5ID1B 5C07A 4A6YB 1RK1B 4BA8A 2NY6D 1KTDA 2DLTA 4V1DD 2ILLA 2VXSH 1AO7A 5H94B 3CSBA 1AH1A 3WFDL 3FONB 1FH5L 4FHBD 5J1TC 1CI5A 4JHBA 2HJFB 3QCUL 1MHHB 3WE6B 1NAKH 4DZBB 1T1ZB 4WWKC 4FQIH 1OD9A 3FAXA 4M7LT 1WCBA 2GIYA 3C60C 2J6EH 3SGKC 4LLMA 5GGVL 3MJGX 3B9AA 5TQ2L 3ARUA 3RAJL 1QLFB 4JVUA 4S1QH 4NN6B 2FRGP 2WM0A 4K3JL 4WW2C 2ZUUA 4POYA 4P3CH 3ZT5A 5ALBL 2E7HA 4K7FB 1TCMA 3HAEA 4PJ7A 1S5HB 4UIMB 5JTWA 2R1YA 3HNVL 4XWOC 5EULV 1I8MA 1QLFA 3QFJE 2D2OA 5GS0D 1EEYB 3BP5A 3EYQC 4XHQA 3T0WA 1KN4L 4KVCH 2NY4D 3TJEL 1N4XL 3VFPB 1J0IA 3LEYH 2AV7B 4JRYD 4PR5B 1S5HA 1HN1A 1HXYA 3QG7H 5I73C 3BKJL 1RZGB 2FH8A 3K46A 1G9MC 2QKIB 4OZGB 1N5AB 3HG1D 3BDBA 5DEFA 4R4BA 3VFPA 5JZ7C 2IGFL 3RWGB 3QDJE 2D0HA 4ODUA 2I9LB 4OI8A 1AGBB 4XB7A 4XP1L 3N1QC 4WTXA 5JIHA 2QKIA 2DQIL 4J7RA 4UTAH 4ALAL 1DN0A 2HT3C 3WSQL 2VDNL 5FYJH 5H37G 2J1KA 2XTJD 3O6KL 3FRUA 1NEZG 1KACB 4NO2A 1RZ8B 1BJ1H 1J7VR 5ITBH 1RZJL 3MLZL 1CGSH 3OGCB 3VGBA 5HHMB 2C7UB 1UM6H 5FUOH 5C09E 4RFEA 5C71A 1WFUA 5LGKA 1P7KB 3O2DL 1U8HA 3GIVA 3V6OC 4TOYL 2LAAA 4QF1B 3RWEB 3EYSH 4YPGA 4MA8L 1LP9F 2R8SL 4LARL 1CDBA 1KYOJ 1SEBA 4I48B 3F5WB 3RZCC 2AJSH 3PQYD 3VFWA 2GKIA 1OAUL 3NCEB 4RFEB 5DURB 1NC4A 4OLYL 4NRZA 2PTTB 1JYXA 5EU6B 5CJXC 5DXWA 4QRRB 4AG4L 1I1AA 4S2SA 3IAQA 5IVZA 4EVNB 3DVGB 2R56H 3VGHA 5C0GA 1WQVT 1L6XA 4HF5L 5DJZB 4UNTA 5HYFA 4QO1A 4LLAA 3I84A 2AAVA 4HK3J 5EU3B 1XH3A 4GG6E 4X6DE 3MRKB 3QDME 5DMYA 1J05B 4HGMA 4NQUA 5J1AA 2GITB 2DMKA 4O5LH 4PR5A 1JF5A 5I74C 1D9KD 3QDMA 3UBXG 1A7PL 1LDSA 4U3CA 2NNAB 3CVHB 4BH7A 5D72H 3BP4A 4HW6A 4EQ2A 5IIEB 4OD1L 4HFUH 2PKDA 1NH6A 2VABA 3T65B 1MWAB 4XRCB 3MV01 5EIIB 2F8OA 3C60B 3TVMA 5H35A 2A6DA 4P23B 1A22B 3GBLA 3TP4A 3VFUB 3ARTA 3UO1L 2IFGA 4LF3A 4G8IB 1Q1JH 2PF6A 5HVHB 2J8UE 1EBPA 1A02N 4N90D 3MRNB 3BW9A 1CFTA 1OTSD 1CIDA 5ETUA 3TGXA 4KAQH 1OAYH 1VGEH 3R0NA 1U8PA 1FCGA 4RISH 3TWCL 3GHBH 1MEXL 5ADPL 3H9ZA 1OARH 1WBYA 4CU7A 2NXYD 2NY3D 1MLCA 3T1FA 2JJTA 5AAWA 1TVHA 1YNTB 3KYOB 4GSDL 4LHUA 4Z6AT 1UWEL 4PP2B 1U8OA 1FLRL 1AI1L 1S78D 4V1DB 4NFCA 1IE5A 4NJ9H 3PV7A 3T3PF 3U7WL 5L2JB 2HJFA 1NCDH 4APQA 4UUJA 1XFPA 4DUWA 1FGNH 5JUEL 5KSVB 4XP6H 1ZVSA 3L3GA 4QTHA 4ZO7A 1NUDA 5L2JA 4E9LA 4IRSC 5EZIL 1D9KB 1QPPA 3CSYB 3T0EC 1BVKA 1MRCL 4Z7WB 1YY8B 4CKVX 1FG2A 4FFYL 4DGIH 4UILL 4N9OB 4MAYC 4Y2DD 4X5XB 4ZXBA 2DQHL 2UUDH 3ILQD 4Q9CA 3Q5TA 3M1BA 3QCTH 1BP3B 3DUUA 3TC9A 4Z7WF 2OZ4H 5B3JE 4TPRL 1TJIH 3HZMA 1CF8L 1PX4A 2CLRB 2W65A 2XXCB 1IGTA 1G7LA 3KYKL 1KYOK 3T65A 3VGAC 1HHJA 5JORB 1TTFA 1BIIB 4HEPG 2ITCB 4WV1B 1GSMA 1Q0YH 2AXHA 4XC3H 1QEWB 1WLHA 3EFFB 3HC0A 3OSKA 5C07B 1FQ9C 3HRPA 3P0YH 1XR8A 5E9DB 4D0DB 4PRPB 5FUOL 5GRUH 3ES6A 2IBGA 5I73B 4ZXBD 3F7QA 4ZSOB 2X70B 1CE1H 1NLBL 4PJHA 1JHLL 3ZTNH 1KCUH 5DA4A 5L88L 3D85B 4F7MA 4L5FL 1EERB 1ZEAL 5B38G 5KN5A 3MJ7B 1FFRA 3KPSD 5JOEA 4Q6IA 3W2DH 4Z7WE 4IDLA 1MCNA 3IDMA 1I7TA 4Y2DB 5DMGD 5T3ZE 3PHQB 3U0TB 1CL7L 2NY0B 4H5SA 2FJGA 4YBHA 3QUMB 2X4UA 4ZNEE 1QHPA 2L0DA 4C4KT 3EOTH 3VFRA 4HKJA 5LVEA 5CEYA 4UU9A 1S7XA 1YEEH 4P59L 2BSED 5DS8B 5I1JL 1IAII 4YZFF 5D1XB 3GB7A 1AKJA 2A0LC 3VXPA 3PF2A 3QZWB 5C92A 3JUYA 1G7IB 1AP2A 1MHEB 1XIWB 2B4CH 4PUBL 1KOAA 1R3JA 4P49A 3T0BA 5JR1H 3O41A 4LPTA 2JB6B 4LASH 3L3HA 4XCYB 2DD8L 4AEIH 3BMVA 2IC2A 5D1XA 1IQWH 5E08H 3GBML 3NCJH 2ESVE 3MLYH 1KC5L 3F7PC 5JW3H 4YFLI 4XNZB 2DQUL 4U7SA 4N9GB 3TA3B 3CH1A 3H42L 4XPGL 5DF0A 3VFMB 4D9RD 5JORA 3EYFB 5IWLC 1LK3L 4I4WB 3EGSB 2XY1A 3BN9C 3I3EA 2GJ6E 3QDGD 3I6LE 4IIQA 4L29B 4NM8H 5E2UL 2YWZA 2IH3A 1E6OH 1FO0H 2MHAB 3SGDH 5L2KE 1DLHA 2EKJA 2N7AA 4WUUB 2BNRB 3MGTB 4YDVA 1XCTB 3DUSB 3BWAA 1UZ8A 4PRIB 4NQSA 4WGWB 4WGVB 4KI1A 3QIUA 2YZ8A 2ZCHH 2FGZA 3ABZA 5DR5L 3ARBB 2DYPA 1X6LA 3WUWB 1BZ9A 1AQDA 3S5LB 1Q38A 2PO6C 1KTLB 4JPVH 3VWJB 2GK0B 2XI9A 4BZYA 4DAGL 1JZ5A 1JNHA 3HPLB 4ZO9A 4JO2H 1SEBB 3MRNA 5IFHH 1A7NL 1UQSA 1R5VB 1VKXB 2AW2A 3P11L 4WVRA 1T03H 3BPLB 4PBXA 3JTTA 1WCQA 4U6HA 2EDBA 1LQSR 5FDYA 1RHHB 2IEPA 1RZKL 4J3WA 2AABL 2WWMC 1AGDA 3JV5A 4X6FB 4L4TD 4KTDL 5DD3H 4ONHB 4YHKL 1JHTB 5E8EA 5DRWB 4Z7UF 3FB8A 5TF1H 5I1EL 2YXMA 1XF4B 2P5WD 3D18A 4PJBB 2XN9E 3QEGH 1SQ2N 1T66D 5E03A 5FGCE 1T1YA 1SEQL 3V7AG 4F57L 1D5IL 4D3CL 1LILA 4Y5YA 5GGRB 2EE2A 4AENB 1T89A 3C6LC 4X6DA 5GPRA 5HGDB 2CRYA 3F6IA 3H9HA 2W0FA 4CMHB 4KH2A 3ZE1F 4D8PA 2NLJB 5DZNA 5DRXA 1QSFB 3GDBA 5E2VL 1AHWB 4UOJA 1LP9B 3QPXH 1FGNL 4LVHC 5HHNA 3KYNB 1IKNC 3VXUA 3LQMA 5D96C 4UQ3B 1C7TA 5JHDA 4YWGL 3V0VB 1MVUB 4NQXA 2R0WL 4AYFA 2BY3A 2FB4H 1HKFA 1S9KC 4M3KB 2K9UA 5C0FA 4AH2A 2HFFB 4LLQB 1I1FA 2UYLA 4WU5A 5GZND 4Y4KA 3BW9B 4WWID 1OSPL 4MXQC 5CUSL 3CFBB 3RWDA 3WUWA 4NQXB 4KAQL 1BQLL 4ENED 1DANU 5ISZD 3O4OB 4PJCF 2R2BA 3HLAB 1TJGL 5DZOA 1KEMH 3QI9A 5I1LA 3BRGC 4Y4HC 3AM8A 4OF5A 4RMWA 2G2RB 3V9FA 4RCAA 4JKMA 2JIXB 4JY4B 4OZFH 4ZMAT 3RWDB 5DA0B 1AGCB 4MSWB 3MOAL 5JLZB 5I1EH 3OKEA 1B0RA 1TNMA 5C2UB 3C08H 3GMLB 1FAIL 1ZVSB 3U0TA 3DVFA 4WFFD 1CGTA 4LAJH 2VAAB 3OB8A 4NKIH 4TSAL 4NCC2 1JGLH 3JTSB 2VZVA 2B2XL 3T8XB 1JIBA 3CZJA 2HT2D 4Z7OF 3OAUL 5CEXA 2IBZY 3QDJD 3FFCA 2FBJL 4N8VB 1GL4B 3QQ4A 3VXUD 3S7GA 3FZUD 2CPCA 2AS5M 3UTPE 4D8PB 4UT7H 1FFPA 4AIOA 4F37K 4MXVE 3GI8H 4KMTL 1NLDH 3RVXC 1AGFB 1KPRB 2NXZD 2GITA 3FN9A 1JHKH 4JKLA 1D7FA 3VD9A 5IVXE 2VLRB 5FM5O 2FO1A 5DD1L 4EOWL 4KRLB 3FQNA 2GJZB 4FZ8L 1CLYH 2A9NH 2P8PA 4CVZA 4LFHG 4LCIH 1G7PB 2CUHA 3GJFB 4PJDA 3BH9B 5LKNA 1KENL 2HFFA 3ECBA 4GLRH 4M7KH 4E5XB 1FSKB 4F7CB 1WZ1L 2ICWA 2BXZA 5LQBH 4K7PH 4LPVA 4XWGL 3CMOH 4JJHA 2BVPB 1AD0B 1TITA 2UVFA 2IH3B 1KIQA 3OX8B 4OV6F 1A6VL 1PW3A 2QQKL 1OAXH 1AXTH 1Z5LB 5EO0B 1MNUL 4RAUA 3LSOA 3FB7A 1IKFL 4LGRB 1INQA 1FLTX 3AY4A 1NLDL 4Y8DC 2B1AH 2A77H 5M7QA 3L1OH 4Y1AD 2ZUSA 4UU9B 3FFCD 4M1GH 4PRBA 1U41A 5KVEH 1NCAH 3HG1A 3MYJB 3A67L 1S7QA 1IQDA 4JN1L 3FL7A 5ESVB 3SE3A 1JMXA 3L95A 4KKBC 2E7LC 3FO1B 3LMJH 1YEHL 4WY7L 5MP6H 2MCPH 1LO3L 3HMXL 1QKZH 1NUNB 1QFHA 2L4OA 4P4RB 1CL7H 2VXTH 4MCZB 5HI5C 3NN8A 2RBLA 2E7CA 5CINH 1RJLB 4QGYA 4OBRA 4H1LB 2CJUH 3MUGA 3KVQA 4Y5YC 2IAMD 2B0SL 4Y1AA 2X09A 2XNAA 4H25B 2WV3A 3L9RA 4K8RC 3O45B 3P0GB 3MCLL 3WHE0 4EIZC 4RQQB 3C60A 3TVMB 1ETZA 1XGRB 4IM8A 1MFEL 2AQ2A 4KRPB 4MAUL 4PJHF 4OF6A 2DQDH 5JMOC 1JN6A 4PJDF 1YQ2A 3BSZH 3LKPB 3QUKB 1G7MB 3MCKA 1GGUA 3AS2A 4BZ2L 4XP4L 5IJVB 4H8WC 2AK4A 3FQWB 3B3IA 3VH8B 3K1KC 4HX1A 1XF2B 4NIKB 4KFZC 5DRZA 4ISVA 1BZQK 1DQQA 1OWRM 2C4XA 1F11A 3OXSA 5BW7A 3B2UD 2VKXA 3QPXL 5D8JL 1W0WA 3I02B 1JPFB 1IFHH 1T04A 3QWRD 1YPZB 1CVRA 1I7UB 3CVHH 2JTDA 5IHUL 1K6QL 3GIVB 5T3ZH 5HJ3B 5ID0B 2F8XC 1AC0A 3U4EA 1FG9C 1CFQB 2DM4A 2HKFH 2PXYC 3HE6B 4JFHE 3S36L 5FYLL 4L8SB 2FECI 4UBDD 4HIXH 3D9AH 3FOMA 1BBDH 3UTSE 3QT2A 3VFOA 3SJVA 3DPBA 3RVUC 3SDAA 4WO4C 1NBYB 1CXKA 1WBYB 3OKEB 3SBWA 3T0VA 2OJEA 1IM3B 3F62A 4LCCA 4XI5C 5I1IL 3TZVB 1WAAF 4O2EA 4WFGE 5CFHA 1BZ7B 2BSTA 4ZPVA 2D7PA 4KJQD 3DX8B 3Q6FA 4X80H 5JQHC 3PWUA 4HCRL 3T2OA 2BP3A 5I76B 4KROC 2X4TB 4R7DA 3DXAD 5F93C 4MDIB 1ZGLA 3ILPB 1TIUA 2A6JB 1YEGH 4R97C 4EXKA 4CMHC 2DQHH 1Q9OA 2MQCA 4N5EC 3V0AC 4XVTL 4MS8C 3UJTH 3DBXB 1L7IH 2XWBA 1IGMH 5JHDB 3ARVA 2LVEA 4LU5H 4NPYA 3TCLA 5D7JA 4LOUD 1A3LH 5KSAC 5L2KD 5IIEA 4X9GA 4D0BA 5GGVH 2OL3B 1BVLA 2XZZA 3SCMA 1S5IL 4P5TD 1RI8A 2ZKHL 5EORL 3SDCC 5DSCA 3QWQB 3B5HA 5HHPB 4U3HA 2J6EA 4LVNB 2L7UA 2BY1A 4D94A 1VENA 4QHMB 3VXNB 1A6TA 1NCDL 5KVFL 1TETL 5JQ6L 3WFBH 5ALCH 1NAKL 4EN3C 1UWGL 4YDJA 2SEBA 4JN2A 1MCPL 3MOBH 4M48H 5DC9B 2G2RA 1IT9L 4I2XA 1D6VL 1EUTA 3GJEB 2IG2H 2OS7A 1AD0A 1JZ4A 3NIGF 1MHHA 2VL5B 2MPAL 2UV3A 1CDUA 4JFQB 5CJQH 1N7ML 5BXFA 4OIBA 4RGMB 4WEBL 1YEIH 4FQLH 1LE9A 3BQUD 2VYRE 1VFAB 4NNPL 1MJ8H 2FX9H 2NX5E 5C0ND 4NSKA 7FABL 1JTTA 1RUMH 2FJFA 1OCWL 3CFJA 5GGSY 1KPVA 1H8OA 5JPNB 1YMME 4JM2D 3SQOH 1IBGL 5D5MA 3CU7A 3CPLB 4YHPB 2NY6C 3MREA 4FXKA 2JE8A 4KWUA 3QUMA 1EXUB 1LWRA 2XKNA 4G6MH 4YDIL 2FEDC 2WBJA 4OLUH 3V4VL 3I9GL 4KXZH 1PQZA 2ARJQ 2QADC 5EBGA 3C09C 5DK2A 1N2RB 5DD1H 4IMKC 2YZ1A 2NLJA 1ACYH 1TJHL 3MRCA 5A1AA 2Q8BH 2HH0L 4ALAH 4DKFH 4C56E 1AR2A 2DL2A 3IFPA 2XRAL 1DBAH 4WI5A 3P2TA 3TA3D 2VXQL 3HZKB 1AY1L 5BMFL 5C0IA 3NZ8A 2A9MH 3MRLB 5C2BL 4KGLA 3NFPA 3IDUA 1A4KB 4GMSL 2APVA 1VACA 1Y0LA 5CBEB 3ULUC 4G6AC 1I1FB 2UYLB 3BN3B 2MOVA 1I3VA 1CDCA 5IW3A 2JF1A 1HSAA 4XTRC 1MCBA 4L4TE 2J3SA 3WCYA 2IALA 1NEZA 3VE0A 3DETC 5I66A 2RAMA 4NP4H 5BW7C 5B38A 1R24B 1HYRC 3THML 3GK8H 4WHTB 1QA9B 3MNVA 4LVHB 5DJ8B 2EIEA 5AD0A 3IJSB 1O7SA 2X1WL 5GXBB 4LVNC 4Z95L 4JFDE 4YDLC 5L8KB 4W4OA 4PREB 4RMSA 2X4UB 2BNQB 3DVNB 2NZ9D 1RURH 5IT2H 1FZOA 4PJ9A 4DGYL 5C3TA 1RQ5A 3A6BL 3CFKB 4LDOB 1T1YB 1QOKA 2JK5A 3KXFD 1QO3B 2HJKB 1NSNH 3C5ZA 5AZEH 1H8SA 4YLQT 1JRHL 4HDIA 3RVTD 3UZEA 4OD3L 3UX9B 2W0FB 5TE7H 2MMXA 4KROB 3BHBA 4OF8A 4ZUUA 1U36A 4MLIA 1RHHA 4Y4FD 5DO2D 1CD0A 2QSTA 4QRQB 1J88A 5GRZA 3DOSA 4F9PC 3U46A 4CADA 3LN5B 1I8IA 1OARL 4L8CB 3QHZH 2VXQH 1JWSB 5ANMB 4M5ZH 3M17B 3DX8A 1UZ6E 4MAUH 4FFVC 1G7JB 4M43H 1VPOH 3QIBD 3G08B 4NNYB 2YUWA 5FHBL 3DMMA 4ODVL 2OLDA 3FN0H 4QOKD 3C6SA 3QULB 1IVLA 4IEFB 4P3WA 2H2SD 3MLUH 3E3QC 4YH6A 1Y6MR 2ESVA 3QRGL 1AHWA 1OT2A 2F9BT 1ZS8B 2EYRA 5DJ0A 1EJOL 1MSPA 3NACL 3T3MF 1GOGA 2VLKE 2F19H 4F7TB 3ZKNC 1HKLL 4DEPC 1NGWB 3V4UL 3C09B 3OR6B 3RKPA 1XGYL 1TETH 1GGTA 3O3BB 5JOFA 4UQ3A 3V7MA 5CBAA 1ADQH 5GHWH 3HZYB 2H26B 1FIEA 1BECA 1ZMYA 3WV0A 4XPBL 5LXGH 3DIFA 5FYKD 4ZUWA 5L6YH 3RWCB 2P48B 1F5WA 3HPLA 3LKNA 2ZJSH 2H2PD 3FQUA 3CXHJ 1DQDL 4MDJA 1DDHB 4FP8L 1KJVB 4H8WH 4I2XB 2VDLH 2EIZA 3ULUE 1RIHL 3KJ4C 3CFKA 3QYCA 4JO3H 1T7ZA 3DV6B 4RRPA 1UH3A 1S7UA 2ADGA 4BZ1H 1YEGL 2BY2A 3VXOA 3IFNH 5L6YL 2PW1A 4OLXL 1N0LA 2NTFA 4L3ED 4RGMC 3E2HC 1VA9A 4W6YB 5EO1B 4UT9H 5HDOA 4ODSH 4YFEA 4O4YH 4QXGH 4NKIL 1BJ1J 4TN9A 1K85A 3IJHA 3MV8B 2VLKD 4R4NC 3G5VB 4YK4C 3SO3B 5I76A 1GYAA 5IV2A 1KCSL 2VN4A 4CADB 1HKLH 3QXVA 2IANE 4LEXL 1HNFA 1XMWA 4P2OA 4BYHA 5EO9A 1LO2H 1AQKH 5E2JA 2YPKB 3MRPB 3HZMB 4OFIA 4FQJL 3TN0C 1EGJA 3X13A 4M1DL 2HLFD 1X7QB 1EV2E 3RIAF 1PY4A 5CEXB 3B9VA 5EUOF 3CIQA 4CMMB 4N8VA 2F74A 1T83C 4Y4KC 1H15B 1T22B 2R23A 1ZT4B 5F3HA 5TGBB 4HS3B 2NNAA 3MLVL 4HC1H 1SYSA 4G8FA 1ZT7A 3IDYC 3PWLB 4FMKA 4HV8B 4LSQL 4QRPB 4QCIA 2YUVA 1I8LC 4Z8FH 4RIRB 4F2MB 3MSPA 3MXWH 1N6VA 1MI5A 2ED8A 1QFWM 4GAYB 4GG6A 4LKCA 1KXTB 2HWZH 1EVTC 4LRIA 4MVBC 5BJTB 1IL1B 2R69H 3T0ED 5DRZB 1VHPA 5DJ2A 3DMMC 4LLDB 3QPQC 4MMZC 4JRYA 1F11B 2CGRH 1J8HB 4ELMA 4F58H 1FVDA 2R2BB 3B9KD 4PLNC 4XP4H 4I18A 4XVUC 3PP3H 5E24E 3IXAA 5LGJB 2QL1A 1MCEA 4FFZL 4FQHA 5ACZA 1GZPB 4PJ9D 1WAAA 5DJ2B 3NA4A 4YXHH 1IC1A 3LPWA 4WW1A 1LNUA 2FATH 3VXRA 1MFEH 3BH8A 1AIFA 5ID0A 2LU7A 1JPSH 5FA4B 4RZCA 4AIZB 3MO1A 4Z95H 5CMAA 4K94C 5EU6E 4HT1H 3U30C 4JG1L 1P1ZB 2FHBA 1HHGB 5T1LB 4ZFZA 4S11A 1NBYA 5GGSA 1AQKL 1FVCB 3DRQA 5J9PA 3V6ZA 4DTGH 4Z9KB 3LH2H 3P4OA 2X9XA 4KJPC 5DD5H 3CFDB 1QSEA 4OUOA 4EI5C 5GGTH 1QKZL 2NW2A 3MRPA 2BK8A 4PG9B 4JRXD 5EIVA 4M6AA 1KCRL 5F88A 1FNGB 4HZLA 4HS6A 1FVCA 3DRQB 1H3VA 1T20B 4ZFOB 3ULVL 3LB6C 1UA6H 4S1RH 5DLML 3MXWL 3OR7B 3QQNA 1I9RH 4WHDA 4JE4B 1FE8L 3AREB 4M93B 5HYQA 2OXGA 4ODBD 5EZIH 4DFHA 1C16A 4R0LA 2HLAB 5I1KL 4NN6C 3EZ8A 3QUML 5DEFB 4GFTB 3WEXA 4XCFL 5I75C 2KDGA 4WW2B 2XWJA 1FZKA 5DYOB 5A40E 5LXGL 5SWQA 3EO0A 1CK0H 1SEQH 2BMKA 3V6OA 3ORJA 5INDA 3TF7C 3HMXH 1PSKL 4ONFL 2DQFB 5E8DL 3B43A 5F6HI 1F8TL 3BO8A 4NQEE 1N59A 1J8KA 2V2TA 4MZ2A 3NGBC 4X6EB 1OPGH 3U4EB 1IAKB 1MLCB 2VLLA 3UTOA 1W8OA 2BNQA 2C7UA 1ZK9A 1ZT1B 2FZ3B 4JFOA 4U4BA 2DQUH 4WI4A 4CU6A 2ICES 3TWCH 3UTSD 4FXGA 3BOVA 3OF6D 5F7MC 4FA8A 1BM3L 2HN7B 1MCCA 4LKXB 3QIUD 3NABL 5HVWA 2JK5B 4Y2OA 2DDQL 5EZLA 4YO0B 2OI9B 1XEDA 1N3NB 2YD1A 1INEL 3UO1H 3QXUA 2AJVH 5JZ7D 5K9JH 1MFDL 2EDNA 2F5BH 3ZE0F 4ZO6A 5JPNA 3TYGL 1NBQA 2BOCB 3UBXA 3CXDL 4XPAL 3UTTD 2ZNXA 2B1HH 2A6JA 1RZJC 1JGVH 3CUPA 2PYFB 3QH3A 5EPMA 1QLRA 1NFDA 2Q7NA 2MSPA 2YWYA 3LAFA 5EO1A 3N1FC 3Q5OA 4PLOB 3VD3A 3NZHH 3FQTB 3O3DB 2YPLD 3MV8A 5J13B 4PB0L 3MX0A 2ZKHH 1ERNA 5FCUH 1BOYA 3LKOB 5TDPB 4RX4A 1T4KB 5GRXG 3MUHL 4BZ1L 5FYKU 1OGAD 1R3KB 5HGHA 3Q6FB 1FNSL 2AJZA 5ESQB 3KLHD 1JHKL 2EYSA 1FYTE 3VWKC 5BS0A 5ISZE 5KS9F 3KG5A 4OCWH 3MV9D 2B5IB 5JPMB 1KEML 3BYTA 5SWQB 1GOHA 3OKYA 1R0AH 3MROA 3UCRA 3G5YA 4P23A 4JFEB 3WS3B 1MIEL 4KK8D 1ADQL 2ADJA 1X4ZA 3GSUA 4PTUA 5DD6A 2VNCA 1NDGB 4M7JL 4XWGH 2XY2A 4JY5L 4DKDC 4Z7UE 4NZUL 3N9GH 3OKKA 3FT2B 4U49A 4D0CA 1FN4A 5FAAA 3BD5A 1Q94A 1UM4L 3UC0L 5D71L 3BXNB 4OLWL 3HRZB 4FQXC 3KXFE 5EZLB 3QCTL 1YMMD 4MQTB 3WMSA 3GMLA 3VGDA 1RU9H 1MWAL 3ARGD 1D5XB 5KSBA 3QDHA 5KS9E 1NMBH 3QI9D 2BJMH 1IGCL 1P7QD 3GJEA 3ESUF 3SBWC 5LWYH 4S1DC 1BFOA 3WDIA 3QA3B 3ZHLA 1FNFA 4HD9A 2VZUA 4KVNH 1T80A 4PJXB 1ZA6B 2BSSA 2Z8SA 1M6OA 1FFPB 1JNNH 5D7LE 3E2HB 4NZDA 3WFEH 1BFOB 1OW0A 3MOQA 4LLVB 4ZPTA 1BQSA 4KKLD 3QO1A 5FYLE 1QRKA 2KZ1B 1C5DB 2FD6H 4OCXL 4DOHB 2Q3AA 2H9GA 3QXTA 2NXYC 3T0AA 4FXKB 5T33H 5E8NA 3KPMB 4LSQH 1C5BH 1Y0LB 1RIVL 2EXWC 3QZWG 4OB5H 3E6FA 1DEDA 1DBAL 1U8QA 5E0QA 1U8LB 2CD0A 4WUUE 3WFHA 3OKOA 4C83A 1JPSL 1KCLA 4PRIA 3AMKA 1N6QH 3GK8L 4NQTA 2ADJB 1V7NL 5C0FB 3FZUC 4KI5D 1CICB 5CZKA 2IQ9H 1KEGL 4PJ8D 3WO4C 1A8JH 3QCVH 1Z5LA 5EO0A 3GKWL 4Z5RA 3S34H 3EJYC 5DJ6A 3O3BA 1WT5A 3LQAH 1NGPH 4F7MB 4JQXC 2IBZX 2QJDA 4QWWD 4TUKH 3U9PH 2DQFA 2HT3D 5I1CL 3WJLC 4XMPH 1WISA 5AG9A 3HR6A 2P45B 5H94A 1A7NH 4WV1C 1A6PA 3A6CH 4M6NL 3BDXA 2W0PA 1PBYA 3P4NB 3P73B 4O02H 4EN3A 4FTVD 3G6JA 5EC2B 4ZUUB 3MJ8A 3KPRE 2B8OT 5KZCD 2B5IC 2IAMA 2R0LH 2P8LA 5MERB 5ACLA 2W9EH 1JF6A 2Z92A 3X14A 1CFSB 2R1XA 5I8CB 1NC4D 3F7VA 3K4DA 1XGPA 3CXHK 3TV3L 1EXUA 3FOLA 4U05A 3ALPA 4KQ3H 5EUKB 5J3HD 1MAJA 2A73A 5F7UA 3VW3H 3HMXA 2LABA 1XIWA 1KLGA 3MRKA 5IR1B 4K3EH 4J3TA 1E27A 5HHQA 1E28A 3NCYS 1LP9A 1M7IA 2WLYA 2HKHH 3KLAA 3KPPB 1WSST 3C5ZB 3QH3B 5I19H 3D9AL 1YC8A 4NZRH 4KQ3L 5I1GL 5FYLH 3C2SA 5GRWA 1S9XB 2VZSA 2NY7L 1H15A 2R23B 5F3HB 4M7LL 2DIJA 3HZKA 5E8PA 5DD0H 4D9LL 3VXTA 3QIBA 5EBWB 4X4YA 1MFAL 4ODVH 1TZGH 4LPYA 1V3JA 4M02A 3W9EA 1ZLSH 4IIQC 3MRJA 1ZWIB 2IG2L 3STZB 5GS1C 1CVSC 4HGWA 3BDYH 4IHOA 2FR4A 1I1CA 2V2XA 3OAUH 1ZV5A 4FQ1H 5I66B 1CBVH 1KV3A 4JY4A 3PXHA 5DHVA 4XNYL 1NGYA 3MMEB 3VXSD 1X5XA 1T1XB 1CGVA 4AEEA 5F7DA 1RZ8A 35C8L 3PL6A 2ZCLH 1FAIH 4PRAB 3MRBB 5DHXB 2VZTA 2CDGA 1NAMB 4Z7VA 4CAGA 3BISA 3BN9D 3ZT7A 2XA8H 1XIWD 4U6HB 1B0GA 4PJEF 3JTSA 1J05A 1D6EB 1GC1C 1U91B 3GUTB 4GQPH 5INCB 2JCCF 3GHEH 1G7QB 4FFYH 5FO7A 5C0RL 5LBSH 3EO1A 1KSRA 1DQMH 1QLRB 1KJVA 3T2NH 1QR1B 4QXTA 3B2UC 4AQ1B 1B0GB 1JF1A 3PWUB 1X7QA 3FHQA 5IVOA 4I9WE 2W59A 5CD5D 4AENA 5EIIA 5JO5A 1CE6B 4YGAB 4BFBD 5D1ZC 5GSRB 4W4OC 43CAB 1HI6B 4IBLT 4P5KB 2ZUTA 3G5VA 5FFLA 2Y7QB 3EOBA 2ZUVA 2FX7H 4GG6B 2DBLL 3TJEH 2IQAB 1JWMB 1FGVL 1S9YA 1U8JB 4PRHB 4NQEB 5KJRH 5F7EL 5IMOA 1BEYH 5GISH 3BEVA 3MRJB 4OM1L 3K8LA 4LGSB 1PY9A 3SDDD 1EZVY 1K4DA 1DQJB 4IHOB 4ZFGL 1OAQH 5FV1L 4E0RB 3QG6B 1JPTL 1Q8MA 4YPJA 2Z0BA 1B90A 4FQHB 1GHFL 3LSOB 5TQ2H 1IGYB 1D5ZA 3C6LD 5CP7A 1U9KA 5F6HJ 3S3SA 2H6PB 2CIKA 4HG4K 3MO1B 5GGQL 2ZP0T 1PZ5B 3MV7A 5KSAB 1RSFA 5T5NG 2GCYA 4XPTH 3WL9B 1YUHA 4MLSA 4XCEB 1A6ZA 4X6DF 4LLWB 1D9KA 5C2BH 2LV4A 1QG3A 2CIKB 5IHLB 1EVUA 1QQDA 3T1FB 3BKCL 4KQ4L 3JV4B 3UTSB 4FG6D 1YUHB 1Z3GH 2RHEA 4JHAH 2C3VA 3BQUA 4UUJB 1AIFB 1T7YA 3P40A 4WIQA 3IXTA 4JZOB 4ENEC 1HQRA 3MFFB 1S7TB 1OGAE 1UCTA 2H9GB 1HHGA 4HS8H 4XBGB 1KCVH 3EAKA 3E6HB 4F8TA 3PWPB 1G9EA 5J12C 1RUPH 2HRPL 1IAMA 4PJGE 2D03L 3BGAA 1CLZL 5EG6C 4LARH 1JGVL 2XG4A 1INDH 1K8DB 2ED9A 3M1BB 4P4KB 1A47A 4DWHA 3OAYH 3QDGA 5C0DB 2Z93B 2MWCA 1LK3H 5DFWH 3UXFA 3M8OL 3CSPA 5HHOD 4HWZB 1DR9A 5IMMB 3JWOL 2D9QB 3HNTL 4HJGB 5KVMC 4PV8A 5GSVB 3WYRA 5ERWA 3LHPH 3GBMH 3UBXI 4ZS7H 1H3TA 3P30H 4XVJL 1H9VA 4LKCB 4WWKD 4Q9RL 4ZFOA 5JXAL 3WIHH 2VLMD 3ROOB 2BNRA 4EEEA 3C60D 1CFNB 43C9B 3DX6B 4GRLB 4P2OC 4UMGA 3FB6A 4YNYB 3RX7A 1EMTL 2E5EA 3LV3B 1MCFA 5MI0C 1F3JA 3Q2CA 3KS0H 5IEKB 4KJWD 1AE6L 2UWEF 1X6NA 4XX1G 1LEKA 3OWEA 3IDNB 1U3HC 4XMPL 2DL9A 4R2GD 1CFBA 4HFUL 4TOYH 1Q94B 2DS4A 4PJXF 1XGUB 4RMRA 5FYKL 3W5NA 1FL6A 4YAQA 1HILB 2YRPA 3GRWA 3EYQD 3D69A 5CMAB 4B50A 1LE9B 3U9UB 1J12A 1NGQH 4U1MA 4G8GB 2HKFL 4CW1A 4NSKB 3B8SA 3W0WA 3FRPG 3QA3A 4KUZL 4XB8A 4E42B 1R5WA 4I5BB 5FYJU 4NRZB 3R8BB 2C3WA 4LEOB 2BNUA 4HH9B 4X98A 3R0MA 4F57H 2YD3A 5GRUL 4JZNA 4F80A 3CX5K 4L8CA 3D25B 1T4KA 4MQXC 3I3DA 5E6ID 2YD7A 4ZUSA 3KPQA 2AJZB 5ESQA 1E4WH 3U36B 4B0MM 2J4WH 4G6JH 1WGOA 4L8DB 3DMMB 2O5ZH 3IDGA 4J6RL 1NC2D 4PTTA 4IMLB 2AI0L 4R26L 1TTUA 1PGRB 1D3CA 4HLJA 1UENA 2FIRT 4J3UA 2ESVB 2QV2A 3E6FB 3VDBA 4L8DA 1FZKB 4WCYH 2I9TB 1T6WA 3I2CL 2E7BA 3U48A 1P4BL 1QNZH 3S36H 3RI5K 2P4AB 1VADB 4GS7B 5M94B 3VH8A 4Y4FC 5DO2C 2G5BB 1F13A 1EGJL 4DN4L 2XRAH 5ESAB 3CJJA 5T5FL 3E3QE 3TNNA 4YXHL 1FYTA 3B9EA 1OB1B 2GTWB 1WZMA 4WDIA 2IAMC 1QRNB 1D5IH 1U8NA 2Z31B 4D3CH 5I1LB 4R2GB 2OL3L 2YPLA 3MV8D 2UWEA 3DTXA 3V4VH 1T3FB 4NQSB 2NQCA 1DDHA 5E8EB 1D5XA 2ICWI 1VFAA 4HAGA 5GS0L 4IRZH 4OI9A 3SDXB 1QFWH 1D5ZB 2QBWA 4J3XA 2R2CA 3G5ZB 1MIMH 3G6JF 4LK4A 4LHQB 5LG1A 1AR1D 3U9UA 3MLWH 3QG7L 5JXEA 1S7UB 1JNHB 3NVQA 2VLKA 1NFDF 3G5XA 3QEQE 1P53A 1NCWL 2ZWLT 4EDWL 2GCYB 2X4PB 5EU7E 3PUCA 1GIGH 4PJGF 1MJ8L 2FX9L 4P23D 2OYPA 4Y5VC 5D2LF 2DD8H 1CLCA 1M71A 1MH5B 3OZ9H 5HHNB 1OD7A 3VFTA 5DDHB 4YXKH 1CXLA 1TZHA 2HJLA 1AXTL 1OAXL 1XF1A 4HDIB 5CJQL 3L5XH 1FNHA 4J3SA 3OB0H 2I07A 3H2WA 5A2KH 4JQIL 1E27B 1Y6NR 3Q1SL 3HS0B 5D1QC 1OF2A 1A7RL 4YUEL 1ORSB 3OJDB 8FABA 5I1CH 3ZKMC 4PRHA 1JWSA 5ANMA 3EW3B 4OD1H 1A1OB 5E2UH 4J1UA 4L1HA 2PXYD 3OG6B 1HWGB 2WUBL 4XBPA 3X12A 5JPMA 3ZE0E 3KYNA 3CDYA 1YMHA 2ICWB 3JSSA 4Z7VE 2PR4L 4UDTB 1EHXA 3SDAC 1T89C 3C6LA 2DICA 5K93A 2IJ0C 4K71C 5CP7B 4RWYL 2JCCE 3B83A 5C7XH 5JOPE 1XR8B 5E9DA 1JHLH 1KIQB 1NUFA 3OX8A 2ID5A 3ZTNL 4DOHE 2DRUA 4Z7NE 3TPUA 2AV1A 3BKCH 1MUJA 5BV7H 1T3FA 5KSBF 2JCCA 2ICCA 1DBJH 4AT6A 1GZPA 2R4SL 5IVXA 1T7VA 3D85D 1NJ9B 1RK0A 1CS6A 1EHAA 4G43A 4FQCH 1NBVH 3ARDD 4ZQKB 3IFLH 4HIHA 1BD2A 2R8SH 4LOUC 2EDXA 4JM4L 3IF1A 2R4RH 3S35X 2FJGB 4HK3N 3D0VA 3VJ6B 5ENWB 4F7EB 32C2A 1AGEA 2GT9A 3C8HA 3MRMA 4G42B 3H42H 3CSYA 2KKQA 1KPRA 2DQGH 3WKMH 4HJJL 4G9FB 4HIHB 1CGSL 3G04B 3QEQA 4NBZB 4OD2A 4YIQB 3WIHA 1SJHB 3DXAB 1T5XA 4QHNB 2RJMA 1U8MA 3MNZA 1MRFH 2RQ8A 4MX7A 2GY5A 4PV9B 5CP3A 1WEJH 4OLVL 4JPWL 4X5WB 3KXFB 1IM9D 1FNLA 2XZAH 3QZWA 4RWHA 4ELMF 3HCVB 1EO5A 1G7IA 3R4DA 4YHLH 4G9FA 2HFGL 5B3JF 3TEUA 1HIMH 4LEOA 1P4IL 2JB5L 2VR4A 3HUJA 2J88L 5DFTA 4GKNA 1MJJA 2YPKA 4DZ8B 3F58L 4LSRH 1QFPA 5EA0H 1NCUA 2D4DA 2R0WH 4ZUSB 3S37X 4U1GC 1Q0YL 4XC3L 1J5OH 1GPOH 3GRWH 3JZ7A 4UNVA 5EIQA 1MCHA 5E00B 5IB5B 3O9WC 4WW2A 2YKLL 4OSUH 3K4AA 1MJJB 4WI9A 3O6FB 4QHLA 2JB5H 3WFHB 4QRPE 5EFIB 2IQ9L 5F3BA 4F15C 3D85A 3GHBL 1TJIL 4KJPD 1TFHA 4RIRA 4F2MA 5L0QB 3T2NL 1N5AA 1XF3B 4DKAA 4K9EC 1NDMB 4GG8A 5DJCA 3D0LB 2DWDB 2NY4B 3SE4A 1DBMH 2QQLH 5TE4H 5C8JB 1A7OL 1OP9A 2JLLA 4NUGL 1J8HE 2XA8L 3VFWB 4XP5L 2VDPH 3RL2B 1EBAA 4NZTH 5E94A 2WIIA 2JJVA 4N0UB 1HH6B 4XH2A 4JM2B 3PNWB 3MRFA 2OQJB 3FO9B 4LKXA 3LS4H 3GUTA 5HJ3A 4EVNA 1T2JA 2PYED 4Z78A 1NBZB 3TA3C 5FXCH 2IANA 4NJ9L 3MR9A 1QRNE 3T04D 1FH5H 2ZUYA 1MHEA 5F89B 3QCUH 4GW5B 5IB4A 3NIDF 2PO6D 4PRBB 5HTSA 4OUUA 1TPXB 4YPGB 3EOYG 4HWEL 1DSFH 3QEHA 3CXDH 4J4PC 4Z76A 8CGTA 2D7QA 1BZ7A 3ARFD 5EWIL 3L1OL 3QEUA 3T3PE 2VL4A 3KPQB 4L9LB 1WICA 1S7SA 3D18B 4H8WL 4PJBA 4ERSL 3NFNB 1KJMB 3IXTB 3NCFB 4WENB 2OK0H 3QUKA 4TULL 5ICXA 2FL5B 1MNUH 1MWAA 5C08A 1DVFD 4UTBH 1TNNA 2CKBA 5HHXH 5MENE 1FBIH 2YEZB 3MGAA 1MOEA 2C1PA 1NCWH 5EUOB 5CKGA 3RVVC 2XICA 5BCAA 4RRPG 3SGJA 1HK6A 3CZFA 2PO6A 4YHZH 4NM8L 5I8EA 4M9PA 4IJ3B 3DYMA 4QRRD 5LQBL 2DM3A 1X5LA 2VR9A 4BQ9A 2GUOB 3KPRA 5C0BD 4LBEA 8FABB 1QFWL 3D2UD 3K2MC 1T04B 2AP2A 1GGBL 4IRZL 3NIDE 1SM3L 4KUCD 2C1PB 3X3FH 3IETB 1AQDB 3BPNB 4HGKC 3Q48A 4D9RE 3D0LA 1GAFL 3V6FA 2GTWA 3SKOA 3MCKB 5A43C 1CD9B 2X4OB 4G6KL 1YYLH 5GRJL 5TH2A 3VG0H 3VGEA 3PWNA 5J6HB 3IAGC 1KGCD 1YJDC 4HX1B 3OGCA 1A1NA 1MJ7H 1ZHBA 9CGTA 2F54D 5DHVB 5C7XL 2C9AA 5FV2A 5KJRL 3SJVB 1AKJD 1D6VH 2KBGA 3D3VA 4UDUA 2OTPA 5C0CA 2DQEH 2OJZL 2JCCB 1YPZA 2EDQA 3MRIA 4M5YL 5ETUB 5KANG 1WJ3A 3H7LA 3V6BR 5ALCL 1JZ6A 4E41B 4LSVL 3OTTA 3ZL4L 5L7XL 1JRHH 2EZ0D 1QBLH 2BCKB 5DD5L 1A9BB 5C08D 1YA5A 1NGZB 2VDML 5C0AD 5KS9A 4XMLH 5KSBE 4JFDB 3UTZB 3R1GL 1FAKT 2V7NA 5C70A 3B5GA 4KTEL 1RZJH 3T8XA 2BNUB 2XKNB 1BVZA 5E5MA 3ZE2F 4JHAL 2IH1B 1PG7X 2IADB 3LEXB 1YN7A 4QT5A 4OB5L 3I6KA 2B7DT 1IMHC 4MXWH 4HPOH 4QKXB 5SV3A 1KULA 2EEBA 3W11D 2VXUL 4JHZA 5FYJD 2ICEB 3IDJB 2DWEA 3V6OE 5E5MB 2F53B 2QADD 2MQ0A 3TYFB 1RJYA 3PDDA 5KOMC 4A2MA 5FGBC 2XWBB 3MV9E 3UJIL 2AK4E 3UROR 2F5AH 5D7IB 4QLRA 5E8DH 2I9TA 2R69L 5HYJD 2IBBA 4MJ6A 4U1LB 1CT8A 4P3DB 1NKOA 1JGEB 1SBBA 3MUJA 4RFOH 2EKSB 1KJ2L 3QUXD 1YEDA 4NT6A 1ZLSL 2QHRH 5C0AB 5AZ2H 1SHMA 4YDJB 1ZT1A 5C0CB 3GSVA 4PGBB 1WEJL 4XTRD 3MCG1 2HLFC 1WCBB 4KGJA 4HUKB 5IFJB 2X4SA 3ARWA 3FB7B 4HULB 3BZDA 1ZHLB 5IEHA 2VL5A 5I8KH 4UV4L 4TUOB 1QQDB 3SPVB 2PUQT 3FFCB 1CXIA 3UBXB 1YJDL 2D0GA 1HZHH 4MX7B 1S7RA 3BIKB 4KK9D 2YPVH 2VIRB 2Q87A 4LSPH 4W6WB 1H3GA 3BAEL 1E4WL 2X4NA 5HGAB 3IFPB 2ATPA 4J4PA 2X10A 1PD6A 1EEYA 5FGBA 2IH1A 1KPUB 4MHHG 4WRLA 1OAYL 1VGEL 2A6KB 3ZDXE 5TQ0L 5F1SA 2XPGA 5BS0E 3DO7B 1UJ3A 2VLME 2CLZA 1M7IB 2YK1L 3Q6GL 1UEMA 4NCDA 4PTTB 5FK9A 2HVJA 3X3GL 4JO4H 4A2LA 3VGFA 1I1YA 3FQRB 1C12B 3QEUB 1AP2B 1EFXA 4Y1AB 4QRTA 2MQ3A 4IOIB 3JWOH 4N1CA 2VSDA 3G6AA 5IW1B 1LEIB 4HXBH 2ITCA 1RIUL 3RWGA 4G7YH 5GIRA 3VXUE 1OQOA 3BGMA 4HIJB 3O6FA 2IPUG 3RHWF 4CN1A 2VC2L 3BKYH 3L3KB 1OTUD 1CFVH 1ETZB 3V5DA 3UTTB 4U33A 2H41A 1CG9A 3RNKB 5KVGL 4HFWA 4JPIA 1G1CA 3FFDA 5EOTB 4P5TA 2VB5A 1U8KA 2XWJB 3EGSA 4I4WA 2GJJA 1SBSH 1HH9B 3LKPA 3MGOA 4P2CG 4K8RD 5C0CE 1HDMA 5J1SC 2VZ3A 2G75B 3C5SA 1CD1B 3QISA 4XNQA 4PD4J 5F7YC 1JNLL 1YPZE 2IPKA 1I85A 5DVOA 4GQ9H 2WBKA 3IGAB 5C0EA 3SDYH 3L5XL 2J7LA 3TT3L 5I71C 5IMLA 1HH6A 4MNQB 5MEQA 2G9HA 4FQLL 2CIIB 4G9DB 1S3KH 4Z78B 3DGCR 3MRRB 2A0LD 4RX4D 4RGOL 1AXSB 4LNRB 2CKBH 4G43B 4LLYB 4QHUA 4R8WH 1F4WL 4PBVC 3X3FL 4BM7A