4KROD

Nanobody/vhh domain ega1 in complex with the extracellular region of egfr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
213
Chain Sequence
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epidermal growth factor receptor
publication title Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
total genus 36
structure length 213
sequence length 218
ec nomenclature
pdb deposition date 2013-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kroD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kroD01
3VXRA 4NQED 5JPNA 3Q6GH 4JFHD 3BH8B 3ISWA 4I0PB 4O51B 3RX8A 3LEYH 2VH5H 4PRHA 3OJ2C 5T5FH 5F89B 1IBGL 5C70A 4G8IA 2W65A 5HHNB 3I84A 2D03L 1G9MC 4NRZB 5DO2D 3RGVA 3VXPA 1KPUA 2NY2D 3I02A 2VDKL 1EO8H 1OGAD 1ZLUK 5IESL 2C1PB 3IFNL 2V7NA 2F54D 1PY4A 2RCSH 3G5VA 3O3EA 5GGRY 3WDIA 2X9WA 1N7ML 3NCJL 3VFOB 4P4RA 4MNQA 2MJWA 5ANMA 3WEXA 3QUYD 3BGAA 5KN5B 4O00A 1T5XB 4QTHA 1S7QA 3LKPB 4LIQH 4EDWH 3O6FC 4X8JB 1FFPA 2EYTB 1NCCH 4R96A 1D6VH 3KLHD 2LV4A 3STBA 2Z91A 5IUSA 4PP2B 4NHUA 3RZCA 1MPAL 2ADFL 1SQ2N 1YEKL 4OI8A 3MRBB 4XC3H 4XH2A 5EBGA 5ISZE 5I19L 4JO2L 1XR9A 5DFVC 4APQB 5C1MB 1MEXL 4ODXA 4KK5C 2IWGA 4OKVA 4NKIH 3QRGH 1IEHA 3N85H 4HS3B 1JF6A 5IHZB 1UACL 3C5JB 4Q6YA 1HZHL 3PWNB 1RZ7H 4P3CH 4RNRB 2QQLL 4GAFB 1FYHB 4XZUA 1RUML 5FF6B 3ULVH 1P1ZA 3O4LA 5IJVA 3RL1A 4Q7DA 5I15H 1CFQA 3ROOB 4HK0B 2DKUA 4H1LB 5D7SL 1IGCH 4LF3B 5IOPB 4Y1AD 1K6QH 2IANA 3VFNA 3DTXB 1INEL 1YEHH 1Y6KR 2HVKB 4M7KL 4XNMB 2IAMD 1RZKL 3VWKC 3ZKMC 5DJ6A 3TBYB 3BMVA 3EO0A 2F74B 4I4WA 4R8WL 4UINL 3RBSA 4KVCH 1GGCL 4KKBC 3QQ4A 5C7XH 1N0LA 3W82A 3FQRA 3LKSB 4C54A 3VXSB 3U0PA 1NEUA 4QRSB 2RFXB 3ARBB 4LLUB 5F72S 4LVOC 2EDHA 1WWWX 1KIRA 2MPAH 5AUMA 5DRZA 3QFJD 3IYLW 3V5DB 4D0DB 4WIQA 4LLAA 4S0SD 3CSPA 1ED3A 3MLPA 3FKUS 3KPRD 3IF1B 4G6MH 5D7IE 1B90A 1Q0XL 3QDGB 1TQBB 5E8NA 4OV5B 5ACMA 1R5IB 5K33A 3QRFM 3K0WA 4UIMA 2I24N 4XGZA 1N8ZA 2NLJA 2WP3T 3SJVA 4A2LA 2CIIA 4K8RC 1VB9A 3CXDL 1CDCA 2RB8A 3DIFB 3ILQC 4XHQA 4HJ0C 4P5TD 5F7EH 1MELA 4PJDE 4N1CA 3GKWL 4P23B 4QHNA 2XZAL 4KMTL 4FQLL 3L3GA 1FNFA 3U1SL 3E6FA 4JDVB 4PRIA 1WC7A 4PJXE 5DEGA 3HLAA 3MV9E 2C3VB 4RFNB 1IAKB 4ELKA 4OCMC 1BGXL 4LASH 4RA3A 4XVJL 5GSRA 5FFLA 3V5HA 3TO4C 4AENA 3F12B 3QEUB 4OFIA 4I18A 1NDMA 4UNTA 1ZTXH 5CEXB 4KJPC 1HKLL 1TZGH 4JREB 4RWYL 3UTPE 4JFFB 4Y19B 4DUVA 1VEOA 2R2EB 1OWWA 3QUMH 3PUCA 2RGSA 1WIUA 4KUZH 5BO1L 1RUQL 2E27L 4LNVA 3UJIH 1Q9OB 4G6AC 2Y25A 5FYJH 4CNIA 4KRLB 3BUYA 4MCZA 3TT3H 3KPPB 1MHCB 2ADJB 1ZLSL 3RWHB 1HN1A 1VGKA 3QT2A 2DLTA 1YEEH 3S96A 1VESA 4Y8AA 3S4SG 5FHBL 5ICXB 4M1GH 2CSPA 2BNUB 4ORZC 5LGJB 3WJJC 4PS4H 3PGCB 5C0RH 3EJZD 2WZPD 4PJFA 3VD3A 5L2KA 1R6VA 1QVOB 1TMCB 1NANH 4Q0XL 4HBCL 1UG9A 5FK9B 4BH8B 3TA3A 4G9FB 3ZT5A 2VDRL 3QIUD 2UVFA 2ZNXA 4OCSL 2L7UA 3RJDA 3IS1X 3RWGA 4P57B 4MNHB 2HT3D 4HBQA 1JWSA 2HG5A 3FCTB 1DBBL 3CD4A 4ZDHB 3TVMD 4WTZG 2BHYA 1G6RB 4KC3B 5IP4A 5DQ9B 3PV7A 4AL8L 2BVPA 1SJEA 3MREB 3D5OF 2O5XH 1AGEB 3QUYC 2VKWA 2HJFB 1GIGH 3IETA 5CHNB 5AD0B 5HGAB 2FD6H 2QEJA 4C58B 4FABL 5L88L 5DD1H 5DRWB 3H3KA 2FBOJ 2VLJA 1Q9WB 2NXZC 1LO3H 5C0EB 4DCQA 1I4FA 4D9QE 1MFCL 4CL7A 3QEQD 1MCNA 1RZGA 2X4TA 4HV8A 3UTQB 3KLHC 4WGWB 4XBGB 2FIKA 4O02L 4KVNL 5D2LF 1NBYB 1BBJB 1DZBA 3HZYA 1CL7L 4O2FB 1QRNA 1P6AB 5EO9B 5KSAB 1QYGH 5HHME 2B0SL 5E7BA 4GRLA 3L3IB 3FONB 3UTTB 5CILH 5H2BA 1G9MH 2WWMC 1CZ8L 2PYFB 1JGLL 1CG9B 2ICWJ 1AP2B 2VSCA 2NPLX 1A6TA 2XKNA 1NCDL 3BZFA 5J1AA 4XXDB 1AHWA 4HWEH 4LSUL 3LKOA 3OJDB 3HUJE 1SYVA 5EOTA 5IB3A 3HB3C 2AK4A 4G42B 1BQHA 4AEIL 3IDMB 1AGFB 1FGNL 3ZZ1A 3MXWL 4LK4A 4NO2A 3QHTC 3LV3B 1C5CL 1MRCH 2UUDK 1RIUH 2O5YL 3IRPX 1A1NA 4NIKB 5E1AB 1IGTB 4X5WA 3ILPB 3PWUB 2AEQL 5JHLL 4MMXC 1CGYA 3ZKSD 5IR1A 4PY8I 1N3NB 4WW2F 3SE8L 4GS7B 3EFFA 1T21A 3PP4H 5EBMB 5F44A 3TNMB 3BAEH 2K7QA 3T3PF 1UWXK 4Z7UE 3VXMA 4U7KA 4X6CB 4PJAA 1BJ8A 2PO6C 4L3AA 1P2CA 2AV7A 2EDEA 1NAMA 4X7SL 1CK0L 1CICA 3MRIB 4GG6F 1T1YB 2IADA 2DD8H 4U1HB 3DWTA 5KJRL 4X7TB 1TQCB 4XPTL 3Q48A 4BQCA 2CLZB 4IJ3C 4N8VA 3CK0L 3HPLA 1OSPL 1HXYB 2IPTL 2NQCA 3GK8H 3L95A 3AFLA 4HKJA 2HTKD 5EDXA 4GRWH 3FRPG 3MGTA 3OZ9L 3T4AA 5CJXC 1UZ8B 2V5TA 5TDNA 1TPXB 1XGRA 5E8DL 4JN1H 4JRXD 2CDGA 5CGMA 4N1HB 3BYTA 2BNQE 2CRZA 3BP5B 3ULSA 3OKOB 3QCVH 1JNNH 3WHE0 5I73B 1BIIB 2O61A 5KTEL 1YEJH 1CFSB 3QUMA 1EAPA 2J2ZA 1DN2A 5F7WC 1BMGA 4PJBF 1DQTA 5EIQA 2NXYD 5E5RB 4B50A 5I1AA 4JM2D 2RR3A 4QLRA 2XV6B 4JY4A 3SPVA 5CEZD 3WFBH 4NPYA 4UT6L 1LGVA 4IRSA 2BNRE 1N2RB 3N50A 2QSQA 4K9EC 4H26A 3VFSB 1MRFL 4KJYA 4ONGL 3LOWA 3UO1H 4HULB 3L5XL 3SE9L 3QBTB 4GMTH 4U31A 3ZTJH 4EN3B 1WWAX 2FGZA 4IMKA 4IRZH 3RWCA 2F53B 2JCCB 1TDQA 4K8RH 5C0DB 4WENB 3BH9B 2OL3A 2BSTA 4M5ZL 1ONQB 2YD3A 4YDKL 3MV7B 3K2MC 1RURL 1J1PH 4PV8A 3V8OA 4NC1C 4GW1B 2X4UB 4RGMB 4PUBH 3I3EA 2XZCH 3TNNB 2WNGA 3H0TA 3B83A 3UROR 5SWZA 3QP3A 4G3YH 1QSEB 3T0EB 3B9KC 4CU8A 3MJ9L 1MCRA 4N0FA 2HT3C 3IXTB 5E8EA 5GS0C 3H9SD 2BVOA 5D7JD 2Y9RT 3V0WH 1OB1B 3TVMC 3MOAH 4H20L 3L3JA 1MHHB 3DYPA 5D1XD 4Y16B 2WINA 1OQXA 3EO9H 2P1YA 3MR9B 3VJ6A 4OZIF 4O9HH 5LQBH 2YEZA 2PXYB 1R3KA 3DRTA 5HGHA 4PLOB 5A40E 2H26A 1F58H 5SWSB 3QNZA 1IGIL 3PG2A 1WAAF 2P7TB 4WNQB 3QXDA 1UCBL 4LGRB 4OCXH 1YC7A 3T2NH 3UJJL 2C1OB 2Y7QB 1ZHLA 1QFWM 2WMPA 4M6NH 4KK8D 1EAJA 2XXMB 3S35L 4X6BB 3MLWH 5I1DB 3P77B 2R56H 1FO0L 3GJFH 2V17L 3KNBB 2C3HA 1NSNH 2A6DB 3HRZB 3L3OA 3GMPA 3RY6A 2DMCA 4M61B 4EVNA 1HNGA 4F8QA 3CDCA 1LO2L 4I2XE 3PXJA 2AK1L 5J6HA 4ONHB 5CJOH 3LKRB 3LEVL 3KYOB 5HYEA 2E7CA 4J3TA 4XAKE 1HHIA 2P43B 4OT1L 4HEPG 4KDVA 3RL2A 4UOW0 1OAQH 1MIEL 4X6FA 2XA8H 2BMKB 4UBDC 1O7SA 4I5BB 5FGCE 1GZPB 1NKOA 4HIIA 4WEBL 2EIZA 4POUB 1A6WH 3L5HA 4TYUA 2R15A 5I76B 3SKJL 2Q7YA 4KRMB 4L4VE 1LP9E 5E2VL 1NUGA 3GGWB 1CD1B 4L3CA 1JK8B 4HCRH 1GC1C 4L4TA 5C71A 4LCUB 4RRPG 3IVKA 4QXUL 1FZOA 2BXYA 5FYKL 1JN6B 2WP3O 4MJ5B 2OSLA 1YN7B 2ED7A 4X4YA 2NY7H 1M1SA 3FRUA 1XIWD 5INDA 2X70B 2DKSA 2IFGA 4C55A 1HQRB 5I1KL 4OCWL 3MNWA 5IW6A 1B3JA 3G6JE 4OZFG 5CKAA 1X5KA 1YDPA 4XPGH 3BDXA 4I13B 3PWJA 1ZGLA 2YKLH 5IK3A 5B39B 1Y6MR 4MJIA 3QUKB 1UGNA 2ZUQB 4NKMB 2WK2A 4NM8H 4K7PY 2UZIL 2LQRA 1KEGH 3O0RH 4FQHA 3T65B 5EBWA 3O41B 4OLVH 3K3QA 2HJKB 2HFGH 2I9LA 4HQQL 1P4BL 2UWEE 5DK2A 3VXTB 3ZHDA 3FQUA 5IF0B 2V2TA 4L8CA 1QA9A 3MJ8A 1XCQA 1YEDB 3SDCB 2ERJC 4ORGA 1UFUA 3C6SA 4RBPH 3CZJA 5FUCE 5HGGS 1UYWL 5CD3B 4HUWB 1BD2A 1RK1A 1YY9D 2JJVA 2HTKC 1CDBA 3BN3B 4LKXB 1XF4B 3N1MC 1JGDA 4ZAKC 4JQIL 2X4NA 3D2UA 2YUWA 2R1YA 1BM3H 3UP1A 3U30C 3O2WH 2P8MA 1A47A 4RGOL 4YXKH 3KXFE 1QBML 1A6ZB 5EIIB 2ZOKB 2AJSH 1ZVSB 5J9PA 4NNYA 2AP2A 4HZLA 1JJUA 4GKZB 4HFUL 5L9DL 3SDYL 2Q3AA 1LD9B 4JM2C 1CU4H 5F8QC 4OUOA 3NMEA 1KELL 3RUGF 4CMMA 4N1EA 1O5DT 1R3JB 2EDXA 1FZMB 4G7VL 4XHJD 2OI9B 3LEXA 4YPJA 4ZFOL 4R90H 3QA3A 3OPZL 2DKMA 3MLUL 2RJMA 4KV5E 1BAFH 4LARH 4MZ3A 4NRXB 5E9DA 2NZIA 3DUUA 4U3XA 2EEAA 3MNZB 3QR2A 2P8PB 1RZIB 1JYWA 2MFNA 3T2QA 4EEEA 1NGXA 3LSOB 2YRZA 1BQLL 2NX5E 4N90D 3VXRE 2Q86A 4PJCA 1X5AA 3IU4L 1KC5L 3NAAH 4PBXA 3MRRB 1NCWL 4BSWB 4PRHE 2BVQB 5JQHC 1JUFA 3F7VB 4LLDA 2OMBA 1PG7X 1QSFD 3TO4A 1IKFL 2W9EL 4YWGH 4NUGL 3VRLF 3GHEH 3TN0C 1ES0B 1E28A 1P7QA 1OT1A 3LRHA 5F6IC 3UC0L 3B43A 3S4SB 3FFDA 3C60B 5CP7B 2LTQB 1UXSA 1CLYL 2VLRB 4MNQE 2UV3A 4I3RH 5ANME 2AXFB 15C8L 4MQSB 1ZGLP 3OX8B 1HHKB 3ARDB 5D7JC 4HLJA 2ARJQ 5HYJD 1IGYA 4PJGE 4E9LA 4YZFE 1QKZL 2VDMH 5D1XC 5TFSH 2A0LC 4DQOH 1C08B 4P2OD 3QH3A 1GYAA 3U0TB 3UYRH 3HRPA 4K9EH 1Z9LA 3BP6A 5EU7C 4LMQE 3WJJA 3CMOH 4NQEA 3VGDA 4HUUB 4U6YB 4HIJA 5FGBC 3QULA 1OF2A 4JY5L 1MCDA 3W2DH 3GBMH 2NW3A 5D93C 4KK8C 3HS0B 1OGAA 1MAKA 2F54A 2HJLB 5ESQB 1RHHB 5D7KD 3SDAD 3UAJD 1ACZA 4YHKL 1FHGA 3GMOB 5BXFA 3DVNB 2OP4L 4FQIH 3F7PC 3QUYA 5D6DC 1G6VK 4L8DB 4V2CB 4HCRA 1B0RB 3WS3B 3QZWA 2V5RA 5D1QB 5TQ0H 3UPCA 2HN7A 3D0LB 4KU1A 4XNYH 3K8LA 5GS0H 4ZFZB 3WKML 3Q6GL 3BD5A 3LEYL 4HJJL 2VH5L 5GHWH 2V2XB 4P2RE 3LY6A 3GM0A 2JE8A 3RHWF 4XBPB 1QRKA 5CGTA 4PGZA 3ESUF 4OLZL 4UU9B 4F3FB 2A83B 3QJFB 4G43A 1UWGL 3QIWC 2GJ6B 1IEBA 4EXPX 1B88A 4K55A 3I6GB 1QBAA 2RCSL 5DMIH 1J12A 4HS6A 2Q6WB 1NMCC 4U3CA 2BSRA 1ZK9A 3EYQC 5E2WL 4JFYA 5JORA 3O6ML 1R24B 4LCWB 4M5YL 3C5ZB 5GGUB 3SCMC 5CMAB 5F1OB 4KRNA 1YPZB 1ZHNA 3RVTD 3V6ZB 1UM5H 5DRXB 3CFBA 2AKRB 1EMTH 5ITBH 1FO0B 2NY1C 4NZTH 5IVXF 1FRGH 3PWPD 4GAJL 4Y1AA 2X4PA 4ETYA 5GS2D 2M1KA 4DZBB 2IAMA 1DSFH 5TDPB 4PJEB 3JWOC 5LBSH 3SDXB 3EOBB 3WKNA 1S7TB 2LE9A 1EK3A 4LSRL 2WBJD 5T1DH 3B3IA 3QQNA 1VFMA 3PWLA 4PB0L 2C3WA 4U6VH 1YY9C 4PG9B 4O2CA 4W81A 1HQ4B 4PRIE 1CLCA 4PLKC 1EX0A 3L7EA 1BPVA 3N85L 4TSCH 5K59E 1CE6B 4NO0D 3QFJA 1WWBX 4P49A 4Z95L 5IB4B 5MERA 1YEIH 3BYYA 3NIGE 1XMWA 1GC1H 3ULVL 4IMLB 3KPRA 3KYMA 1IAOB 5I15L 3GBLA 1KJ2A 3C6LD 1FBIH 3GSNL 2X89D 4GBXB 3U79A 3QEHA 1H8OA 2ESVD 3EDJA 5DHVB 3GI9H 4JEGB 4Y4KD 1K6QL 1BIHA 2FEDD 1YEHL 2CIKB 1TNMA 5JHDD 3BWAB 1KTDA 5CIPB 3VGAC 5I18L 2ICWI 4YDLC 4IOIA 2VXSH 1G7QA 4G8GB 4LRIC 2HFEA 4UQ2A 3CCHA 3BT2H 4XXCA 1RUPH 3OKDB 3DUSA 1KN2H 3FQNB 4MQ7B 3T0BA 1T5WA 3THMH 1CL7I 2MPAL 1BFVH 4C83A 3AB0C 3RVWD 4PJFE 4X7EC 5KSBF 1S3KL 4LSSH 3BZEB 3HZMA 2ZJSH 4FHBD 3EZ8A 1T3FA 3LD8B 1U42A 2N7AA 3MV11 3X14A 4ZPTA 2I27N 5IFAH 3IGAA 4C56A 2DQJH 2OJEA 1CFVH 2H3NB 4D9RE 4D8PB 4NQDD 3D39E 3PF2A 4XNZC 1I3UA 2V7HB 3CFIC 2YXMA 1CE1L 4X7DC 5MENB 5EFIB 2XFXA 3FAWA 1VACA 4HKBB 1J88A 3INUH 1HEZB 3ZKQD 3X13A 3FMGH 1BZ9B 4JFQB 4WW1A 5CZVH 4Z7WF 4OGXL 5DTFB 3TIDA 2DLFL 3OKNA 2VLJE 4FQJH 4V1DB 3PHQB 2Z92A 5FCSH 1VFAA 4XPFL 4XVUD 3MYZA 2C7UA 5EC1B 3WD5H 1I9JH 1IC5L 3SKUD 4FXKB 3X11B 4KDTC 1TVDA 5F7KC 2DQGH 3VMPA 3T0XA 1ODAA 1U91A 3MPCA 4ZFOB 5I2IB 4LASL 1G7HB 2FSEB 4D2NA 2D9QB 4M6OL 1OTSC 2JF1A 4LAJH 1KPRA 3REVA 2CR3A 5L8KB 1KLGA 1NEZG 1BVZA 4LPTA 1ZTXL 3QIUA 3CFJB 3B9KA 4BQ8A 2HT2C 3L1OH 1QQDB 1TZGL 1U8JB 3U46B 5FYJU 4M9PA 2IJ0C 4U1JA 2ICES 4XI5C 2DM2A 5CUSH 3MRMA 3TVMA 3SDAC 1VADB 3CSYB 1Q72L 3NFNA 5E24E 5E2JA 3DBXB 1FL5A 1VSCA 3FO2B 5FYJL 4JFOA 1S9WB 2NY0D 1ZANL 3TPUA 4PJIB 1ADQH 5F7HA 5E8OB 2GEEA 3R06B 1TZHA 4V2BA 1A9EA 4PJ5B 2NTFB 5FCUH 5L7XL 3RZWA 4HXBH 4PS4L 2EE3A 3QEQA 4DFIA 2H2SC 3WIIL 4MZ2A 1E4WH 4U1NB 1U8OA 2IBZX 1MCOL 1F4XH 5A16A 3BEWA 3W5MA 2EH8L 1J87A 1PAMA 3G6DH 4I0CC 1JHLH 1KFAH 5GJSL 5J89A 4WHYH 3G6AB 2FH8A 5I1CH 4U1LB 2CXKA 2VZSA 2X4SA 3U82B 3WJLA 3E6HA 1EHNA 2VR5A 5A2LH 5AWNL 3VXME 1Y0LA 4I48B 1A6PA 2A73B 4JG0L 3SY0A 2YK1L 1BZ7A 1C12A 4RIRB 5EC2A 4MXVF 2ZSWB 3MRCB 2VABA 4JGJA 2VQTA 3LN5A 4LAQH 3UTOA 1HSBB 3HC3L 3F6LA 2R0WH 5DD1L 4U6HB 1LO3L 4JKPH 1MFNA 3VWJC 5BVJA 1KJ3H 1NUNB 1IZKA 2N4IA 2OR9H 3TJEH 3QHZL 5E6IB 3PP3K 1T7YA 5C9JA 4PJ7B 3V4VH 2IH1B 2WBJC 4N9GB 1URLA 3WFEH 3PHSA 4NOFA 5F9OH 4U2ZA 3L6FA 3QXAB 1QYGL 1FSKC 2CPCA 4ZSOA 3S3JA 3U0WH 1CXLA 3K4DA 5DJ8B 1PX4A 5C08B 2VUOA 3KPLB 2XNAA 3EGSB 4OZ4A 5CILL 4J3UA 5GSVB 2WLYA 1T2XA 5EPMA 3D25B 2FX7H 3FFCE 4WJ5B 3WLBA 3Q1SH 3NA9H 1F2QA 1PQZB 1NFDA 3C6LC 1REIA 1XGUB 4WU7A 3A67L 2EDNA 4XPHL 4GAYA 2LVCA 1IJ9A 3MA7B 2I25N 4UI2A 3FB7B 5J1TC 5MP6L 3S36L 3QAZC 3WMSA 5IEHA 3T3MF 1LO0H 3S88L 2Y07H 5BS0D 3STLA 1WCBA 2XTJD 5DR5H 1HYSD 4TVPD 4G6FB 4JRXA 4QHMA 2UY7A 4JKMA 4WFGE 1UVQA 1F3JA 5ICYA 3HCVA 1D9KD 5GRZA 5TPWL 3ZKND 2OR7A 1EUUA 4PLJC 3AY4C 3JWOH 1ZHKB 4YK4B 3PP4L 1U8HA 3HA0A 1C5DB 4P4KD 5HHQA 3RVWC 1LEGA 3BAEL 2DYPD 4MSWA 4WY7H 5ILTH 3ORJA 1OY3B 3V5KB 1FNGB 3RKDD 4O4YH 3VDBA 5SWZE 5ESAA 2MSPA 4JM2A 3NFSH 4M93C 3RVVC 4I0PD 1ZT1B 4JRYB 2ZP0T 3NACL 1CFNA 3A6BH 3HZKB 3WL9B 1MUJA 5FDYA 3S37L 4UQ3B 1FZJA 4H0HB 3KLDA 1UQSB 3GK8L 1U3YA 5C0AE 3VE0A 1OT2A 3GSNB 3UBXG 1KLUA 3DI3B 4MMZC 1K5NA 4YUEL 4JFDA 3VG9C 3G5YB 3QCVL 2BFVL 3RGHA 4FMKA 4F7TB 1KTLB 2BRRH 4YIQB 3CFKB 2EKJA 5DC4B 4X6CF 2H6PB 2OK0H 3TN0A 4PD4K 1MH5B 1ADQA 2DRUA 3V7AE 1MJ8H 3Q0HA 4NJ9L 3BQUB 5M7QA 1TJHH 2EIBA 3WFBL 2R2CA 2GUOB 1A7QH 4XT1C 2DBLH 1U92A 4JANB 3C8DA 4KPHL 5E5UB 3H9SA 5D7JA 3GSXB 4APQD 2PCPA 1I8MA 4GQ9L 2HA1A 5D1XA 1G9NL 4DK3A 5E4IA 1RQ5A 2NY0C 1PY9A 5F3HA 2MHAB 1GCFA 4IRZL 3W9DA 1S9YA 2GK2A 5E8PB 4FTVB 4L8SC 1L7TL 2DLGA 4TTDD 4UIKH 4ZTOL 3LH2H 3P11L 5FGBA 5ERWA 1SJHA 2R2HB 3BSZH 1J1PL 3GRWH 3CFDA 3TBWB 4L4TE 1J1XH 3WHXB 4F9PC 3V4PH 2E6JA 4PUBL 3KYKL 3VFVA 4KI5E 1HDMA 1P6FA 2XPGB 5CCKL 3LS5H 2D7MA 1U2HA 1KCKA 4XNQA 3RI5F 5SX4H 3VXSD 2A2QT 4B5EA 1HILB 1ZS8A 3JV6B 1JI2A 3U4EA 4N8CH 5D6DA 2APBA 3ARBD 4MJIE 2HLFC 2CXGA 4YDVB 1HHJA 5F7UA 1P84J 4OTXH 1B0GA 3TFKC 1DQJA 2XZZA 3F5WB 4O9HL 5LQBL 1HH9A 5JZ7D 4NZUH 2ATKA 3EYVB 4NQCE 2WUCH 2DQHL 3BJLA 3RVUD 3BO8A 1P5UA 3SGEH 5BRZB 4QGTA 4K71B 4MXQD 1A0QH 3WE6B 4OCXL 3T2NL 1D6EB 3P0VL 1CGXA 3P9MB 2C4XA 2E6QA 1M7XA 1U58B 3CJJA 4M02A 4P46B 1BD2E 3QDME 1AD9B 5HJ3A 3ZSTA 3QIWA 3MLWL 3MLVL 3DETC 4U1KA 2R56L 3U2SA 1FVCB 2UZXB 4JZNB 1CS6A 1FC2D 3FQTB 3HPJB 3RA7H 5I17B 4BYHA 2JKXA 4F58L 2XY1A 1XIWA 4X5XA 1FIGH 4HIXH 1RIVL 5CJOL 4WI4A 4PV9A 1DQMH 1U2CA 1FFNB 4TSAL 5J7CC 3IFPB 3MRFA 1O0VA 5EU4B 3CLFL 2XA8L 3GKZA 2GITA 5T1KB 2YUZA 3GMQA 4LPWA 3D18B 2R69L 1A6WL 3C5SA 5E9DE 1KPVB 3V6OA 2I5YH 2C5DC 5JR1L 1IAIH 2P49B 4N0CD 5JIKA 3ZT6A 1T7ZA 1E4XL 4XAWH 3RWDA 4Y19D 2E7LA 1HKFA 1HYSC 4LLVA 1OWRM 5IQ7H 4PJCE 2UYLB 4XCFL 3JV5A 5MI0B 4JPIB 4XCYA 5GS2H 2IMNA 4R7NA 1EO7A 1W72H 3IDJB 3UPRA 3GB7A 5BW7C 2NY3B 2ITDA 4OZGA 3QNXB 1JMZA 4P4KC 1JBJA 2YKLL 3VFUB 4BSVB 1KJMB 4F37F 3WNOA 4ZTPL 1S9KC 1V5JA 3S34L 4ZPVA 5IBUG 1VFOA 4NM8L 2FNBA 4OCRH 2YD7A 1KNOB 5C3LD 3ARFB 1T7XA 2QHLA 4DVRH 1F02I 1HI6B 3BGMB 4MJ2A 4YBQD 3LDBB 4G9FD 1VCAA 3QPQD 3UCRA 3I2CH 3KPSD 3MLSL 4LRIA 1I85A 1EEZA 1FL6A 3KDMA 1AD0B 3GJEB 1UWEH 4KK6D 4WW2A 3NPZB 5BMFL 1WZLA 4Q9QH 5EO0B 5HYSG 5C07E 3U7WH 4JFHE 1BM3L 1S7RA 4R3SB 2IBZY 1TENA 2V2WA 3O2WL 4PTUA 3WNLA 3H7BB 4UZGA 5HDBE 4YXKL 4ZO6A 1W0WA 2B4CL 3EYFB 4MAYD 3OJVC 4GG6A 1QSFA 3DUHA 3KS0H 4OD3H 3OMZA 4YO0A 1KEMH 3VXOB 2ITCA 2F54E 1BFSA 4JZJB 1CIUA 5FO8B 3WFZA 1CU4L 2X5PA 4Z76B 5H94A 3MRKB 1WZKA 1AGDB 2O5ZL 4ZNCD 1P4LB 4NO5A 2LU7A 1A2YB 4F7MB 3BPCA 4M1DL 5FUZL 1FFOB 2B1AH 1P9MA 4LARL 2OBGA 1UB6A 5KSAD 5HYJA 4EBQH 5C2BL 1NEZB 4UAOC 3AU1B 2H9GB 3OB0K 4Z7VF 1S7UA 3P9LA 1K8IA 1CF8H 2VXUH 3MX0A 2YD6A 2VRAA 4OBSA 4P2OA 1FPTL 1UM6H 3ARWA 3Q6FA 3IXAA 1IILE 3VFWB 3NAAL 4N5UA 4PJBA 1XGPB 4PJHE 4GOSA 3WNPA 2X4RA 4U7SA 5DSCA 4PJXB 1YNTB 4KHXH 2IQAA 2J8UA 4LNRA 4OGAD 4S1RH 3MV9B 2Z8RA 3KGRA 4YWGL 4GRWB 1OPGH 4HPYH 1BWWA 5DWUL 5ABDE 1U8LA 3VWKB 3KLSA 4PGBB 4NBZB 5SV4A 3SDAA 2OTWB 1AGCB 4R2GB 4N8PA 2XZQH 4DK6A 1MOEA 3S5LG 5ENWB 4JZOA 3ARBC 3TLRA 1YN6B 4MA7L 2VDML 1A7OL 3QWOA 1KENL 3R0NA 2Z0BA 4LVOB 5TFSL 3B9VA 4EUPH 4KROC 4O2EB 5DMKA 4DQOL 4Y1AE 2OJZL 3WO4B 4XP5L 3GFUA 2DQEH 3UYRL 1AGBA 1A4KB 3DHMA 1CDIA 3RVUC 4NNXA 2FRGP 2EC9U 4MXQC 1TQBC 5K9KB 4U1MB 3JBG7 4HGKC 3PGDA 3FTGB 3IFOA 3W2DL 3GBML 4JGMA 3VH8G 1EXUB 4KAQH 3TM6A 3ULUC 1Z9OA 3HTLX 4QO1A 1JPGB 2YWYA 3HNVH 1S5IH 3FZUD 1ITBB 2P8LB 2CRIA 1I7TA 5DMJB 2COQA 3VRIA 5F88B 2DI9A 2FIRT 1KCVL 1NC2B 3EYUH 2JJTC 2ATPA 4QY8B 3QHFL 4OZIA 4EIGB 4P23C 4FQIL 1CTOA 1EERB 3H9HB 1U8PA 1WAAA 1Z0NA 4OF0A 5TQ0L 4ZFFB 4XNYL 3ZYZA 5A2FA 3PWPA 4RFNC 1UCTA 5TGBB 2CLRB 3MODH 4S2SA 4PGDA 4YQXH 4FG6D 3WUWG 4J8RB 1JPTH 3QXWA 5GHWL 5F7LB 1OD7A 4HIHB 5IV2B 5IGXH 3KPNA 4JG1L 3VXNB 1KCLA 4N0CC 1I1YA 1E6JH 2WBJA 2XTLA 4KY1L 5T5NG 4KH2A 4ELME 4JREC 3MOBH 1H3PH 4JCMA 3TJHD 5DJXB 4BQ9A 3BHBB 5DD6B 1TVHA 5DMIL 2GAZB 2X10A 4YGVA 3MA9L 4NO0A 4FFZH 5HHMB 1J5OL 3NABH 4EN3D 1S5HB 4BFIB 2Q8AH 5KS9B 1UM5L 4FQPA 1EMTL 1WF5A 3C6LA 1V3JA 5K9JL 4XCNA 3GJFB 3M1BA 2X89A 4NZTL 3BPOB 3DX6A 1FRGL 1NCTA 1FLRH 2JIXB 3RPIB 2ESVA 3CXHK 4LLYB 5I6XC 3DX8B 1DLFH 5JHDA 3TP4A 2XT1B 3HUJB 3QUXD 1DQDL 5LBSL 2ZCHH 5JIHA 5IKCA 4MWFB 3QPQC 1ZHBA 5T1DL 3T0ED 2DQFB 3DI2B 4K3GA 1NANI 3HG1B 4L1DA 2MQCA 2VITA 4HKXB 4LGPB 5DDHA 3BP4B 1MCHA 3UZVB 4RZCA 1GOFA 1S8DB 4QRQB 2DQCH 4QCIB 1JE6A 1YMHB 1RZ8A 4WTXA 3AY4A 4XP4H 2XI9A 5A3ID 4Y16D 4LLMB 1U9KA 4HFWA 3V95A 3IAPA 4LP4A 1YEIL 5DJCB 1NDGA 2PXYD 1GC1L 3VFMA 1CGSL 4QF1A 4BSJA 5BQ7A 3PQYB 5L0QC 4S1DD 2FZ3B 4Z7OE 3LMJL 4F33A 4QXWA 2BJMH 4LCCB 1NL0L 1T03H 3EO1A 1GGBL 1EHLH 3IDIA 1MI5B 4NQDA 5I71C 1EJOH 5F7FA 3NCYP 4BJLA 4PJEF 4J3XA 5TE6H 4PRBA 2ZUYA 3PGFH 4HGWB 2VXSL 1BF8A 3OKMB 1FG9C 5KSAC 1CGVA 1RUPL 3NFPA 4UV7H 4JFEE 3KPMA 1KN2L 5IFHH 2NYYD 3KPOB 3THML 1M4KA 4J6RH 4JE4B 3CVIH 4LP5A 4QHKJ 4X5LA 3MNVB 1VFUA 1H3WM 1L9MA 2DI7A 3QEQE 3UEZA 4Y7MA 3ZDZF 4FFYH 3FT4A 3SE4C 4OLEA 3ZLQC 3MFGB 1ZLWK 1BFTA 1UJTA 1HSAA 1A14H 2J6EA 3WSQH 5FXCH 4OGAC 1VFBB 4D0BB 2F5AH 3P4LA 5DD5H 5BZDA 3OB8A 2DQJL 5HYQB 1KIUA 5F6HI 1OARL 5DUMH 5DHXB 5D8JH 4LVNC 4YHOL 1OSZA 2G75B 2MMXA 1OM3L 5GXBB 2VDLH 2R9HD 4LBEA 3E8UH 3GEWB 3RNKA 2PR4L 3N1QC 1OTUD 4Q74A 1G7MB 4L9LA 2L7JA 4PBWD 1PLGL 1A7RH 3INUL 3FMGL 1FNSH 2H8PB 1EJ6A 5SWQB 3SN6N 1ZA3B 2EIEA 3MJ7B 4FQJL 4NNPH 4GS7C 4G8FB 3WD5L 4PRAB 5LAXA 5I16B 4NYLA 3QG7H 1JZ4A 1B6UA 3K80A 3JTTB 1NGZA 1MFBL 1D5BA 4F9PA 4NSKB 3GSUA 5ID1B 3VFPA 4Z5RA 4NCC2 1A6AB 2J8HA 4OFKA 3V6FB 1MIMH 1YECL 3AREC 4ZSOE 1FYTD 5HHXH 3TBTB 5GZND 3PWVA 3UJTL 5H37G 1TQCC 5JO5A 3SDCD 4K7PH 2AQ1A 3HI6H 3CPLA 3O11B 5DJYA 2BSED 4IJ3B 1IEAA 1DBKL 4P3WA 5CUSL 1AY1H 1BJ1H 25C8H 4BK4A 4H1LH 3C9NA 4CADB 1JFQH 2Q8BL 1TPXC 3WLWC 4WUUE 5DJAB 1AO7B 3FT3A 1FQ9C 4E42B 4EKXA 2VAAB 3BKJL 5CEYB 5I73C 1G7LB 5TE7L 1T22A 4E5XA 1W0VB 3J7HA 1TITA 3RTQB 3CX5K 4HXBL 1KIQB 1RULH 3TBVB 1KJVA 4FG6C 3X12B 1E4WL 1JNLL 1A3RH 5TQ2H 2X42A 2YD9A 4LSDA 4MQTB 5J6GB 4JRXE 3G6DL 2ZZUT 1JHLL 5A2KH 3EOAA 1FNHA 4MQXD 3DO3A 3IJHB 5I1CL 2ZSVA 4P5KB 5DLML 5EBLA 1MLBA 1MFAL 2FECI 1UEMA 4JJ5A 4I9WD 4AIXA 2P5WE 3LQAL 2GSGA 1EHXA 1IC4H 1KGCE 3A6CL 3ULUH 35C8L 2Z93B 4EN3C 4I2XB 1T0MB 4MCYA 1I3VA 2MNUA 4HIEB 1OAZL 3T4YB 5CEZE 1EFQA 4OSUL 3MBEC 3FO1A 3U6RA 1FIEA 4R97B 3RWEB 5FECB 1B9ZA 5KVFL 1DE4B 5HVWA 3MO1A 5TJWK 3BW9A 2FB4L 3G5ZB 1KJ3L 1JZ2A 4XP9H 2OR9L 3FOMB 5FIEA 3ZE2F 2W60B 4ZOAA 4RGMC 1KULA 4NFDA 5BS0A 5IROC 1LDPH 1ND0A 4Q6IB 3C60D 1IM3B 3BIKA 3OAYH 1J7VR 2OQJA 1GHFH 1LP9B 3V4VL 5IBUB 4RMUA 1DL7H 3T0EC 2FYYB 2ZPKH 3WFEL 4QOKD 4MA3A 4ZMAT 4FQCH 5GPRA 1TNNA 3MSPA 4N0YH 3ARDD 1D9KA 3QO0A 5BW7A 2QR0A 1CLZH 2AJYL 4JKKA 4P4KA 4Y16C 5A3IC 1HHGA 4JY6A 4KWUA 5DUBB 1JPFB 2IALB 4YAQA 3G6JB 2FX7L 1PZ5B 4RWHA 5K9OA 3R4DA 3NA9L 4MNGA 4FQ2L 3MV8B 3PL6C 1FLTX 3VRJB 1AKJD 2JJWA 3JXAA 4XNXH 3BH8A 4I0PA 1RUAL 4O51A 4PJ8B 5BJTA 4NQVB 5F89A 3H9SE 5HHNA 4E41B 4W6XB 4NRZA 4ONOA 1LO0L 3BGFB 2Y07L 2R2BB 4OM0H 3IAGC 5C6TH 5DR5L 3CFCH 4PJ7F 3U48A 4KMQA 3TO2B 4HXAH 3VFOA 2R29L 4DW2H 5EZOH 3QEGH 1IGMH 5J56B 2HT4C 3NCFB 3H3BC 2Y6SD 4BQ6A 4JFPB 2YPVH 2ZG1A 4DKEH 5JOFB 5KN5A 1NUFA 1T5XA 5D1QD 3T0DA 4NM4L 3LKPA 3KXFB 4UT7H 4UTAL 5T33H 2AQ2A 3QYCA 4JDTL 1G6RH 2AJXH 4GQPH 4F57L 4OFYD 3RBGA 4QRTB 1A7BA 1WZ1H 3MRBA 3B9EA 3A6BL 5DJ0B 5AZ2L 3FB6B 3QJHA 2D7TH 5CKGA 1VPOH 3BPLC 2ZWLT 4P2QB 4MD4B 3C09C 4APQA 2R9HC 5FM5O 2V9RA 3S7GA 4IRJB 1GGUA 2ZKHL 4J1UB 1DDHA 5HHPB 3C5JA 5KSBA 5KVGH 3PWNA 4LCWD 3C5ZD 4H25B 1R3HA 4RNRA 4QRRD 1IT9H 5FF6A 2DQTL 5GRUH 2VDOL 5KANG 43C9B 1H0DB 3S5LB 4HK0A 3GSVB 4H1LA 3SGDH 4JB9H 2NR6C 3DX7B 4FQ1L 3IS0X 2OK0L 2MKLC 4LF3A 5IOPA 4OUUB 1YJDC 4DAGH 3DTXA 1U36A 2HVKA 4HDIA 4M4RA 3MMEB 4XNMA 4X6EA 4JPVH 4D0CB 3QI9B 4H88H 5GZNC 1U8KB 2F74A 5B8CB 3H9YA 1IBGH 2Q76B 3S3SA 2DBLL 3LKSA 3VXSA 2ERJB 4QRSA 2VDKH 2JTDA 1CXHA 3HC4L 4X4MA 2GIYA 3ARBA 3IFNH 4LLUA 3VH8B 3ULVF 4B0MM 4YXLL 1FE8H 3C87A 2A1WL 4ZAKB 5I1LB 4PJGB 1N7MH 3NCJH 3V5DA 4D0DA 1GH7A 3U30B 5D2LE 3V6BR 4UIKL 3V6OE 1FFPB 3IF1A 4S0TD 3V7AG 3LH2L 4NUJB 3QDGA 3BSZL 1N6QH 3EJJX 4OV5A 4Z77B 3S35X 4GBXD 3GRWL 3TH2T 1D5ZB 2VWEC 4ODUB 4CW1B 1R5IA 4P3DB 1L0XA 4PJ9B 4XH2B 5ESVB 1DTUA 1XF2B 3CXHJ 4HPOL 1MCJA 2RIKA 4A2MA 5H35B 2FJHB 3LS5L 4KKCD 3DJ9A 2OI9C 2PYEB 5IB2B 1YEKH 3WUWB 4MQXC 4G8GD 1D5MA 2ENYA 2Y23A 3TH3T 4Y2OA 2DQDL 1JRHH 4P23A 4N8CL 4Z0XB 1MEXH 3TC9A 3ZE0F 4XZUB 3VXQA 4JDVA 4LLQB 5GZOD 1UACH 2BDNL 4NZUL 1F8TH 1G7IB 2C3VA 1IAKA 2WUCL 3ZE1F 1NQBA 2FDBP 1XH3B 1D7FA 2HKFH 1QNZH 3KPTA 1DVFB 3F12A 3EO0B 1K8DB 5D7SH 3ZYOA 4NZRH 5CEXA 3P0YH 1QG3A 1WBYB 4P2RB 5HGBB 3DVFA 3C60C 4M7KH 4RAVB 2EDLA 4JFFA 2LTQC 2F8XC 4Y19A 1I1FB 2E3VA 3U0PB 1AR1C 3T3PE 3RA7L 5MEND 4R8WH 3B6SB 4AK1A 1HWHB 1Q9OA 4WI9A 1FIGL 3KPPA 1MHCA 1AQDB 4GG6E 1QSFE 2ADJA 4V1DD 3RWHA 5FEBA 4U6XB 5ICXA 2B5IC 5EU6B 1CFBA 1L7IH 3O2DL 4M8VA 4OM1L 5LGJA 4EUPG 3PGCA 5DQDH 1QVOA 5FK9A 4CDHA 4EQ3A 1Q0XH 4G9FA 2I5YL 2W9DL 1JI1A 1BWMA 3KPSA 3QCTL 1P5VA 2IAND 5D93B 4P57A 4MNHA 4XAWL 1FVDB 5C0GB 3M8OH 3QUZB 3FCTA 5FM8A 5IQ7L 4ZDHA 3MUGB 1XZ0B 4PJBE 1G6RA 1KLFA 5DQ9A 5EA0L 1W72L 3MREA 1RI8A 2K1MA 1AGEA 3MLYH 1KUMA 3GKWH 2R0LL 2HJFA 2XZAH 3ZYJA 5CHNA 5AD0A 4FQLH 5HGAA 1DANT 4FQQB 5D1QC 4I3SH 5DRWA 2HKHL 1Q9WA 4PJ5D 4FQXC 1ZT7B 4EI5D 5C0EA 4AENB 2QV2A 4ZYKB 2QQKH 4QHLB 1LE5B 1NDMB 1WIPA 1EZVX 4KKAD 3DVIA 3UTQA 3BX7C 5D7KE 1BGXH 4LL9A 3IDGB 4XBGA 4DVRL 4MLIA 1FGVH 1IKNC 3SE3C 4QNPF 1NBYA 4Z7NF 4HAGA 2BHUA 4O2FA 1QP1A 4ZOBA 1F3DJ 5EO9A 1MCWM 5KSAA 4YBLB 2EO9A 1UWEL 2XG5A 5FHAL 1MHPH 5HPMB 2UY6A 2V9TA 3H3PL 4RX4D 1YYML 5F7DB 4XBEH 1VGKB 1NCNA 4Q9QL 3FONA 1RUQH 5IQ9B 1TXKA 1MLCB 1NJ9B 4JLRB 4KI1A 3SE4A 1HINH 4RISH 1CG9A 1AP2A 3V79C 5CWSB 1ZLSH 1LK3H 5MHSD 4PR5B 1WTLA 3OJDA 2NY1B 3U9PL 4G42A 1P4IL 3IDMA 1AGFA 5E6ID 3VD9A 3OQ3B 4HBCH 1VHPA 3LV3A 2KH2B 2HFTA 2AJ3B 4OZIE 4Q9RH 1EEYB 2B1AL 2VDRH 3D39B 5E1AA 1IGTA 3ILPA 1T2QL 3PWUA 3VG0L 1SJXA 1WAAE 3KLAB 1N3NA 5C08D 1CF8L 3PWPE 3RWFB 3T1WA 5EBMA 3KS0J 3TNMA 1ETZB 4AL8H 2V5MA 3BJ91 4X6CA 4DCQB 1I4FB 5EZJB 3TYGH 4KHXL 1S7SB 5D70H 4FABH 5L88H 2VR9A 3MRIA 4GBXC 5AYQA 3OBAA 1T1YA 3LKNA 1OPGL 4U1HA 2VSDA 4LVHB 3KAAA 4X7TA 3QZWG 1TJIL 4HF5L 1GPOH 2E5EA 1AJ7H 2CLZA 1HXYA 1B0WA 4KVNH 4XMPL 5L2JB 1UZ8A 4GXUN 4G6FD 4GW4A 2XZQL 5GGRB 3BPNC 5H2BB 1LNUB 1YJDH 3VMOA 3QSKB 3RWJB 3BP5A 2APWA 3OKOA 1KXVC 2ESVE 1JGEB 2XKNB 1BIIA 4LPVA 5GZOC 1UH2A 1AHWB 5JHDE 5CINH 1CZ8H 1JGLH 4OD1L 3LD8C 4TRPL 1OP5K 1G1YA 2ADIB 5JIPA 4JRYD 4GRWF 4PYGA 5TH2B 3JWDL 3BZDA 3SDDB 1N2RA 2EDRA 2LFGA 2VQ1B 4HX1B 3VFSA 2YC1B 2FATL 2CKBL 3VCLB 1DQQB 3ULVD 2O5YH 3EYUL 4KKNA 3V0AC 1EPFA 4X8XA 2AEQH 5JHLH 1SBSL 2EYSB 4EN3A 5C0JB 3ZHLA 2JCCA 3MRNB 1XT5A 1NAMB 5ETUB 5C0DA 3VGFA 3BH9A 4G80B 4WHDA 1ONQA 4XB7A 1CICB 2MCPH 4ZO9A 3EHBD 1G9EA 4YQXL 1JHKH 1JPTL 1ROWA 2XKSA 4GW1A 2X4UA 4BFBD 4PP1C 1U3JA 3TNNA 1OHQA 3BQUD 5IGXL 5IMLB 1QSEA 3T0EA 5JA9A 5JW3H 5FKPB 4X9FA 3MGTB 1T66D 3MOBL 3OF6D 1H3PL 3RVXD 1XGRB 4F7CB 2FJGA 5KW9L 1OB1A 4I77L 4NCDA 5FKAB 1OTTC 1MHHA 3BMWA 3BP7B 4Y16A 3OZ9H 3OAZK 2KKQA 3MR9A 5JXEC 3VI3F 1CDHA 2PXYA 1C16B 2Q8AL 3RUGE 4JKWA 2NY4B 3EYSH 5SWSA 1VEMA 4ZS7H 5HD8D 3FB5B 1ZLUH 5KTEH 3FFCB 5HSFA 3OGOE 1FLRL 2C1OA 2Y7QA 4IHOB 5B38G 3UTZB 4IRSB 5DEFB 1F13A 4CKVX 1K2DB 2R23A 3GBNL 3BDBA 2ZCHL 5I1DA 3P77A 4U1IB 4AM0B 3KNBA 4MD0B 4R9HA 5IMOB 4UT6H 2A6DA 1N5AB 3HRZA 3PJSB 4QGYA 4LHQB 3TCLA 4M61A 2DQCL 4Z78B 2D9CA 4HWBL 4O58L 4ONHA 1MJJB 4MX7B 3VRLE 3KYOA 2BSTB 2VOTA 2DI8A 2CMRH 1U3HC 1P69B 5EO1A 2BMKA 3LZFL 5KS9F 4I5BA 4NT6B 4EI6B 4TUOB 5BRZD 2EXWD 4DUXA 4B53A 3NIDF 5K9QI 3IFLL 3VWJB 1T03L 4K7FB 1EHLL 2CDEB 5SWZB 3L7FB 4P46D 3GGWA 5FYLH 1RJLB 1CD1A 1W72B 3GSQB 4FOMA 5FYJD 1EJOL 2QADC 3W0WE 5I0ZA 4LCUA 2BVOB 3PGFL 4C4KT 1TTFA 1FNLA 1JN6A 4MB5A 3L3JB 2D7OA 4MJ5A 1W8OA 1YN7A 2YOCA 3MJ9H 1BP3B 5I8EB 4UV7L 4NGHH 5C0AB 2ICWA 2XG4A 1I3GH 3ZL4H 5JOPD 5HGHB 1PKQA 3LN9A 5FV2A 1MREH 4FFYL 3I6KB 5B39A 3EOTH 2AEWA 3QUKA 4G6JL 4R7DB 2VDQL 1A14L 1QACA 3IU3B 4ENED 5T1KD 2DIAA 4TNVF 4MVBD 3T65A 3O41A 5DD5L 1MCLA 3H6JA 5KOVC 1UCBH 4YPGB 3VXTA 4ZNEA 1FYTA 2CLVB 3CGTA 4XVSL 1GJIA 5DUML 5IF0A 1DCLA 1J0KA 3ALXA 3EZJB 3GMRB 2W0LA 1YEDA 3QAZB 5HHOE 4G5ZL 3SDCA 5CGYD 5CD3A 4HUWA 4OV6F 4EVNB 4MGXA 4HWUA 2YD5A 4LKXA 1XF4A 3HC0A 2JJUA 4GSDH 5F71A 4PRNA 1A7RL 2P5EB 3GMMA 1HHIB 1FNSL 1IC7H 3GIVB 3MCKB 1EDQA 4NNPL 1A1OB 3UTSB 3SQOH 2FCBA 2NY3D 3VFTB 4ZXBD 4YK4C 2FHBA 4OAWB 1A6ZA 4KFZC 5EIIA 5IJKA 4OCLC 3LEVH 1ZVSA 4YGAB 4HIIB 4WEMB 4YDJB 1J1OL 5BS0E 4AEFA 2YR3A 4GKZA 1U6AH 1KCUL 4LSTH 3DGGB 5FO7B 2XTJE 1LD9A 2OS7A 4TVPE 3IAQA 2KBGA 4M93B 2VISB 4WEBH 4NWTH 3OGCA 1R3JA 1FZMA 1X6NA 2Y5TB 3ZDXF 5DURB 1YEGH 2E9BA 4L4JA 4K7PL 4NRXA 4FNLH 5J3HD 5JPMB 1AY1L 2PW1B 25C8L 3MNZA 1J11A 5JDSA 5IVXE 2P8PA 1RZIA 5FYKH 4LGSB 4MNGE 5DHVH 1OAYH 3WNNA 5E70A 1EZVY 1K3ZA 4XPAL 3LPFA 5I1KH 4X99B 3MRRA 4OCWH 5C2UB 4BSWA 2HRLA 2BVQA 5CIPH 4L3EE 3F7VA 1IZJA 1I1AC 4ERSL 2AERT 2WAHA 3IJYB 4FQHB 4FFVC 4L5FL 5EBWB 4NQCB 3EHBC 2C4FT 12E8L 3R1GH 1CI5A 3FO9A 1ES0A 3ARYA 3O6FD 4ISVB 4AEHH 1A3RL 3S4SA 3NTCL 3MRHB 3C60A 5CP7A 2Q3ZA 1BJ1J 5B3NA 2AXHA 4XVTL 1P4BH 3D0VB 3QDMB 4EUPB 2ORBL 3DROB 2AXFA 3OR6B 3ZDYF 4QOKA 5HBBA 3OX8A 1HHKA 3ZKXB 5JLZB 3ARDA 5DFVD 4D9LH 3BVNB 4DVBB 1V7ML 1IC4L 1Q9KB 1C08A 3ULUL 3V8CA 1NC4B 3U0TA 3SO3C 3BIBX 2DB8A 4TUKL 5LXGH 1AKJA 5I1EH 1XR8B 4HUUA 4U6YA 2CKBB 3AM8C 4XCEB 4X83A 1T7VA 1I9RL 5CZXC 1ZLVK 5DZNA 5E94B 5JDJA 1JNHA 3LEXB 4NKDB 4HFUH 3SDYH 1HXMB 3HS0A 4KGLA 4UOJA 1MJ7H 1GHFL 2HJLA 1KELH 3VWKD 3ZKMD 4GLRI 5KSBE 1RHHA 4G7VH 4WGVB 5D96B 4KKBD 4R2GD 1YYLH 5C0ND 2ICEA 3GMOA 4N0YL 3DVNA 1I8LC 2DLIA 3EDEA 4QYOB 4PJCB 4WTWA 2VZVA 4RDQF 4L8DA 1B0RA 4QXTA 1CLZL 1ZSDA 3WS3A 3NCYS 5FOJA 5SX4I 2HLAB 5D1QA 2BK8A 3D0LA 3PDOB 3ARRA 2BERA 4QRUA 1QEWB 3OKKB 3IU4H 3MJ9A 4ZFZA 1NCWH 4U4BA 5TF0A 2YPKB 5E0QA 3IKCB 1P7QB 4YXHL 4K71C 3DXAE 2V2XA 2BY2A 4OFYA 3MXVL 1Z3GL 4Z7WE 3VXSE 4XBPA 3CU1A 2W9EH 2KDGA 1KYOJ 2A83A 3QJFA 4F3FA 4X4ME 2R4RH 2GJ6A 3JV0A 1Z6JT 3I6GA 43C9A 1HK6A 3CFCL 5DGQA 2Q6WA 4J12A 3BFOA 15C8H 3ILQD 2FJFB 3QQ9D 4HJ0D 4DW2L 2IBBA 4LCWA 1R24A 4ZUUB 5GGUA 3C5ZA 1IGML 5CMAA 1YPZA 4MAUL 2YPVL 3V6ZA 4P59H 4DKEL 5C07B 2AKRA 3S9DB 3K81A 2DJSA 1FO0A 1FVEB 5DK3A 2UUDH 1OF2B 4GH7B 4JM4H 4DZBA 4D3CL 5TDPA 4PJEA 1I9EA 3AS1A 1FL3B 3SDXA 1WZ1L 3EOBA 4JY5H 1S7TA 4G6KL 5IEKB 1OVZA 3JTSB 2FX9H 1JHTB 2YA2A 4KJPD 1VPOL 2NNAB 5CGYC 4GFTB 3D85B 1UWXH 3LS4H 1IGJB 4J23A 2X9YA 4PG9A 1IAII 1HQ4A 5T1LB 3FT2B 2YPLD 4X9GA 5MI0C 5GGSB 3CUPB 4OZFH 1CE6A 1I8KB 4LQ1A 4U1GB 5KVGL 2CUHA 4XTRD 4G6AD 3SGJC 1M05A 2EDDA 2OP4H 5GRUL 3FRPA 4IMLA 1IAOA 3VGHA 1FP5A 4XP6H 5SV3A 1UT9A 4JB9L 4GBXA 5DVOA 4PJHB 3BN9C 3A0OA 4Y19E 2ARJB 4DAGL 5BV7C 1QUNA 3ARFC 3F7YB 3STZB 2CIKA 4G43B 4JPVL 3BWAA 1JV5B 3EFDH 4HJJH 1S9XB 1AC6A 5CIPA 3LDBC 4H88L 4OCNC 1HCVA 3LRSB 1VEPA 4MXVE 4OLZH 4G8GA 4TSBH 2XWJB 4YHNB 2E9WA 3HG1D 5J3HC 4HUVB 2BSRB 1UWGH 4YR6B 4JFYB 5JORB 5F9DC 3OKDA 2H1PH 4W68A 1DBJH 1QFWH 1D3CA 3FQNA 4MQ7A 4XC1H 3HMXL 1RJYB 4U05A 1FE8L 3CFBB 2KZWA 3H9ZA 5E2WH 1ORSB 1JTOA 4Y5XB 3O6MH 4M5YH 4M4PA 4OJFH 2VR4A 3BZEA 1KSRA 4G9FE 3P4NB 4CMHC 4Y1AB 5EN2A 3PQYD 2FEEL 2IAMB 3KPSE 1N6QL 2NXZD 1BFOB 5D9SA 2XN9B 5T3ZH 4GAJH 1WFTA 4JZJC 4D8PA 3B3IB 1MI5D 4YH6A 1KB9K 2EDKA 3MFFB 4XX1E 3MRQB 1NFDF 4AH2B 2V7HA 4LHUG 1AXSB 3MLTB 5MENA 2VDNL 5EFIA 4LSRH 1P7KB 1J86A 2H32A 1HEZA 1L6XA 1BZ9A 4JFQA 5SX5K 2R0ZH 1JRHL 4PB0H 4I8DA 5DTFA 1TJGL 4V1DA 3PHQA 4UAOB 2PTVA 1BLNB 4GG8B 5EC1A 2Z31B 4FXKA 3X11A 1FH5H 4PJGF 4M6MH 3T3ME 4AT6B 1F8TL 5F1KC 4Z95H 2HMID 2YMXL 1MFEL 2WWMD 4ZFOA 5I2IA 1G7HA 4BZ1H 2FSEA 1RV6X 4TVSa 2HKFL 1QNZL 4BELD 2QKIB 3GSNH 1I7ZB 1WISA 2AXGB 3DV4B 4NZRL 3P0YL 4HUXB 3CFJA 4XB8A 1WFNA 3HB3D 4P5TB 1QQDA 1U8JA 3U46A 4K3DL 4MB3A 4JM2F 5FOBB 4OLWH 5DQJB 3VFGL 5B38B 1BOGB 3GMLB 5I18H 1VADA 4ELMB 4R2GC 3CSYA 1T20B 5C0NC 3DBXA 1Y18B 3QXTA 3FO2A 4KJWD 3DLQR 2P24B 1S9WA 4C4KO 1XF3A 4PJIA 3CVHH 5E8OA 2VLMD 5IBTL 3R06A 1T3FB 3CH8A 4KROB 5HY9B 3WO4C 4PJ5A 3X14B 2LAGB 4EI5A 4ZPTB 1L7IL 4M00A 3AS3A 1S3KH 5DQDL 2AXJA 2D2OA 2PO6D 2OZ4H 1EEUA 4JO3L 4HG4J 3GMNB 3CH1B 4K2UH 5ELIA 2J8OA 4UV4L 1G9NC 3OG6B 3QB7C 5E08L 3G6AA 4U1LA 3X13B 3M8OL 3QDJB 5CJ8A 2D7NA 5EOCH 4ZS6D 4ZQKB 2DJ4A 2YD2A 2DWDB 4RX4A 3P2TA 1CE1H 4X6CE 3MRPB 3QQ9C 1IAMA 1H3TA 4I48A 2A73A 4K3EL 2QQNL 4J2XA 4RRPA 1KB5L 3MLYL 4OGXH 2ZSWA 3MRCA 4QTIL 5CBAB 2DLFH 1AO7D 1A6UL 4WDIB 1HSBA 4XPFH 1EFXD 4PRPD 1FV1B 2OCFD 1IC5H 4I3SL 5EUOB 2CRMA 3B8YA 3JV4A 1J05B 5GS3A 3RTQD 4EIZC 2QQKL 2XICA 1CXKA 3ZSSA 5IVNA 3HKFA 5JNYB 5E6IA 4BH7B 3CDGB 4M6OH 1T04B 1FGVL 1F42A 4MA8H 4JDZB 4PJ7A 3AC0A 4C56D 2IH1A 4JFZH 4N9GA 2OYPA 3LQZB 1ZXQA 1FL5B 3K4ZA 3QXAA 1CGWA 1MHPL 3MROB 5DJ8A 5C08A 1HHHB 3SHSA 1U8MB 1NGPH 3KPLA 4HHAB 4XBEL 3CIQA 3EGSA 2PNDA 1Q72H 5GSVA 4JFEB 4XTRC 3FQXB 1HINL 4RISL 2BX5A 3D25A 4NN5B 4WJ5A 3O4OB 4ZG1A 4GKSB 5GS1C 1ZANH 4TUJB 1LK3L 3QEQB 4NC0B 4M7ZB 1PQZA 2JELH 4ZD3L 4Y5YC 2ENSA 1XGUA 2WV3A 1N6VA 3BPOC 3F62A 4K94H 3MA7A 5L7XH 5C09B 3FB7A 5I6XB 3O45B 5D1ZB 3WIIH 3P73B 1J0IA 1MCOH 1CCZA 4FZEH 3MCLL 2X4SB 3E6HB 2EH8H 4Q9RL 2ZCLH 1Y0LB 5GJSH 3B9KD 1TZIB 3SY0B 2LU3A 4X98B 1JWUB 5GS0D 3GHBH 4X9IA 4M48L 2OXHA 1ZHKA 5AWNH 4CAGA 2K7PA 1C5DA 4JG0H 5I0DA 2YK1H 1MVFA 5A1AA 1Y6NR 2EXYD 4PGCB 3V5KA 1FNGA 1Q0YL 3RIAF 2D31B 3TYGL 2P44B 4GKNB 3MV8D 5D70L 3HC3H 5L0QB 1PG7L 4JHWL 1ZT1A 5C9JB 4JRYA 4RMQA 4PJ8D 4LCCC 3ETBF 3WL9A 3HZKA 4E41D 5I74C 1GPOL 4UQ3A 1AJ7L 1K4DB 2GTZB 3QHZH 1K85A 5I71B 1YY8B 3K2UH 4ZSOB 1UQSA 5L6YL 3VW3H 4YHZL 1NCAL 1BHGA 5KVEH 1A22B 4MHHI 3GSNA 3HI5H 5FDWB 1YJDL 5BV7H 4K07A 1XCTB 1T6VN 1YQ2A 1QLRB 4GO6B 3G5YA 1QFUL 1BVKB 2GHWB 1I1CA 2JB6B 4HWZB 5GRYA 1KTLA 4WUUB 5LCVH 4YIQA 3CFKA 3BOVA 2HMIC 1RSFA 5CINL 4LPUA 3TWCH 3CZFB 2H6PA 4OZGF 3J8F7 2VC2H 1JYXA 1XAUA 4UBDD 2VXVL 5T3XE 1LE9B 1UJ3C 1MH5A 4PREA 1SYSB 3BQUA 3A67H 4XPHH 3ALWA 2GUOA 2P47B 1WCBB 3BKCL 5D2NA 5MP6H 2BXZA 4JANA 3S36H 3OF6A 5E00B 1OP3K 4LVNB 3S88H 4P2QD 3GSXA 1RFDH 4N0RA 5FGSA 2B4CC 3HCVB 2VZ3A 1A5FL 4KJWC 5I66B 4IRJD 2DM3A 4FZ8L 2H41A 3DYOA 5CFHA 1MWAH 4YHIB 2VIRB 3O3AB 2FGWH 5TPWH 2P5WB 3RDTC 1BX2A 5E8PA 3GO1L 1M7IB 5E5MB 3RHWK 4OI9A 1VKXA 3L5JA 3DX9B 2MCPL 2R2HA 5HDLA 1QO3B 3TBWA 1JHKL 3WHXA 4KRPB 2IG2H 4M3JA 1X44A 5F3BA 4ODVH 2CJUL 4WI3A 4OLYL 3QI9D 1RZFL 2XPGA 1FN4B 3SO5A 3AREB 5JW3L 5HDQH 3NACH 2Z8WC 3VE0B 4YBHA 1T0NB 4N68A 4JAMB 1JTPA 4DGYH 3S37H 1PKQE 3MBXL 4ZS6C 3RNQB 1I8LA 1LWRA 1BVLB 1INDH 1HILA 3JV6A 5JUEH 3T08A 1ZOXA 3WHE1 4U1SB 4JPWL 4JFXB 4ZAKD 3F5WA 1W8NA 2QSCH 4YUEH 3R8QA 4IIQC 5IM7B 5INCB 3EYSL 1J9CT 3MYJB 1J8HB 3HE6C 4ZS7L 3WXVL 1FYTE 3ALPA 4CJ0A 3HZVB 2BFVH 5BRZA 3UX9B 5I8KH 4WCYL 3RTQC 3WE6A 3DSFH 1D6EA 1OLZA 4UT9L 2DTML 3L5WB 3P9MA 1IARB 1KCSL 4P46A 3QQ3B 1AD9A 3BDYH 4PJ9D 4Z7VE 3BZ4A 1U93B 3H9SB 2J8UF 1I8IB 4S1QL 1IQDA 5IBLD 4NJ9H 1FVCA 1E27B 3B4NA 3FQTA 3HPJA 3WXWH 2PYED 4G9DB 1OCWH 6FABL 3HR6A 5ITFB 1IM9B 4KPHH 3EDDA 4PGEB 1XGQB 4WHTB 1A7NH 3BKYH 3W9DB 2JJSC 2IF7A 2GSIB 3DMMB 4GQ9H 2Y36L 1FFNA 1AIFA 5IB5B 1G9NH 3IFPA 1SJHB 2CMRL 3E2HC 4JFDD 5EU4A 1W2KT 2PF6A 1J0ZA 3MV01 2BY1A 5T1KA 4R97C 5JOEA 3MBEB 4MYWB 4OD2B 3GNML 1L7TH 4RMTA 4ZTOH 5ID0B 4F9LC 3D18A 2ICCA 3P11H 1DVFD 4GUPB 1KPVA 4JR9L 5FYLL 2DF3A 4F15B 3TN0D 4X4ZA 1KB5B 4Q6IC 1B6DA 3KYKH 3QXUA 1H9VA 1PX3A 2QSVA 5CCKH 2UZYB 2UYLA 5F9JB 7CGTA 2AI0H 1FJ1B 4JPIA 4NGHL 2F19L 2PW2B 4YJZL 3IDJA 3X3FH 1I3GL 3SGJA 3ZL4L 4N5ED 3QNXA 3LB6C 4B7IA 4ZXBA 1A1MB 2AJUL 5GGSY 1MREL 3VFUA 4BSVA 1BQSA 1KJMA 3EOTL 2A0LD 2EXYC 2VL5B 5EU6D 1E4KC 4UILH 2BVTA 2DLEA 1KTKE 4FXGB 4YEEA 1KNOA 5C0FA 3ARFA 4LSPL 2DQHH 4CVZB 3PL6B 3VXUE 1CT8B 4QOKE 1HI6A 3BGMA 2WQ8A 4PJ8C 4U1KB 3MRDB 2EDYA 3P0VH 4OKDA 4X6DB 5GGVY 2CUIA 3BGFC 1YA5A 4RFEB 2YZ1A 4QT5B 1AD0A 3MLVH 3GJEA 4EQ2A 1OW0C 3JSSA 2VTFA 3QUZD 4TPRH 1IGFH 4NDMB 4F7EB 5JW5B 2DM7A 3SKNB 4GSDL 2E9JA 3B5GA 2R1WB 4WV1B 5FUCC 1CVSC 1H8SA 1IC7L 4F58H 5T3XH 4LDEB 5K93A 3WS6C 3LVEA 3MRFB 4R3SA 1JGVH 4LHUB 3SQOL 5AAWA 1RIVH 4UOW1 3GSWB 4DOHE 3EYFA 5IVOA 4TSAH 5D2LB 1U6AL 1T2JA 2DL9A 4LSTL 3VXOA 3O6FA 3CLFH 1OAKL 4JZJA 4M03A 3QO1A 5FO8A 1PVHA 4MD5B 3MRKA 4NWTL 1AGDA 3RWDB 1P4LA 2R69H 1A2YA 4YNYB 4LLVB 5FYKU 4F7MA 1FFOA 5JR1H 4P9HC 1YEGL 2O26U 4U49A 4FNLL 3B8SA 4MDJB 3QIWD 3BPLB 5EZIL 3SQBA 1E4XH 3G08B 2LU4A 1NEZA 3C09B 3X3GL 1G84A 5DC0A 3AU1A 3FOLB 2VLLB 2FWOB 2BOCB 4IRJC 1OAYL 2V5YA 4XCFH 2B1HH 4OGZA 3EYQD 1HH6B 4OQTH 4R26H 3VFWA 4JN2B 5A2JH 5C0IB 7FABH 3SCMD 1F90L 2KPNA 2HWZH 1YNTA 3TV3H 2X41A 1JYNA 4OZHF 4PPTA 2BCKB 2NY1D 4ZTPH 3R1GL 3S34H 5DUPH 2Y72A 5DK0B 3IJSB 4AEHL 4RGNE 3SGDI 3RGVC 1EEZB 3QI9C 4R4FH 3VWKA 1X5GA 1U8IA 3QCUH 3CDYA 4PGBA 4WW2B 5B8CC 4D9RD 3ELAT 2DMBA 3L3HA 4QRRE 3D39D 3FO0H 3MLSH 3MJ6A 5ENWA 1HNFA 2DAVA 1Z2KA 2IFFL 1YN6A 2IPKB 4D9LL 2XXCB 2WIIB 2XWBB 4PLKD 3TYFB 4O2EA 5BMFH 1DLHA 1RUKL 1NLDH 4GG6B 4HMCA 4OIIH 1A4KA 4PJEE 4RA0C 5LXGL 4LPCA 1J18A 4ZUSB 3W11C 5I1EL 2B4CH 4X4XB 4DKFH 5K9KA 3E3QE 3NCMA 4U1MA 3FTGA 5FM4A 1EXUA 1OAUL 4WO4B 1WBXB 4PJ9C 1JPGA 2R1XB 4X0KB 2WANA 2P8LA 1MJ7L 5IBLC 3ZDZE 1EGJL 2O5ZH 5F88A 4WVRA 3UPAA 3P9LB 2J88L 4M1DH 5FUZH 4DTGL 1YYLL 1JP5A 4P2OB 4QY8A 1M6OB 2MCG1 5ICZB 5C2BH 1K4CB 4PJBB 32C2B 3H9HA 1RIHH 2X4RB 5DSCB 3PP3H 1JRHI 4ZFFA 2Q1EA 1OP9A 4LNRB 1F5WA 1FPTH 5TGBA 5F70A 2CLRA 1F3RB 2HFFB 2VL4A 4J8RA 3D69B 4POZD 1KG0B 3VGGA 4G8GE 1DVFC 4HIHA 5IWLC 1U8LB 5IV2A 3VXNA 5EU3B 3SDDD 2R4RL 3LIZH 2APXA 4NP4L 5DWUH 5MEOB 2A6KB 1HCFX 5DJXA 2GI7A 3BHBA 4JZOB 5DD6A 2YPLA 5ALBL 1TLKA 1BEYL 5C8JB 3LN4B 1ZEAH 4N5EC 3E0GA 2G2RB 2V6HA 1AGBB 1S5HA 4BFIA 4MA7H 2DOCA 1A7OH 4Y5VB 5KS9A 1MVUA 4P59L 1KENH 3SKMB 4Y89A 5C0BD 1RJZB 3SOBH 3GJFA 3G04B 2OJZH 2B5IB 3RPIA 4XP5H 5DMGC 3PGDB 1Z0MA 4LLYA 4JM4L 3DX8A 4PTTB 1S78C 1KXTB 2NTSP 4WI5A 3HUJA 1NMBL 1OTSD 3IDNB 5JTWA 5AYUH 5LGHL 2GY7B 3N06B 1DR9A 3LQAC 4MWFA 5IW3A 5KSUB 2IQ9H 2FX9L 1MCPL 2DQFA 3HG1A 4S1SH 2EDOA 4HKXA 1PYWB 3LS4L 2HT2D 5C6PB 1JNJA 2P46B 3BP4A 4OFDA 2ATPB 3JZ7A 1S8DA 3QUZC 4QRQA 3PV6B 1F4YH 4QCIA 1YMHA 2VMFA 3BEVB 4XI5D 4X7CC 5HGDA 4D94A 1JZ7A 3WFHB 4HC1L 5DFWH 1KCVH 1FG2B 3MLRL 1GGIH 1GOGA 4LLMA 1SEBB 3O4LE 5DJCA 3QHFH 1ULVA 4IBLT 2GYSA 4Q2ZA 4PGDB 3PQYA 2FZ3A 4IDLA 4M3KB 4XP6L 2CKNA 3HAEG 5JIIA 2D7QA 2IANE 4FQXB 5HDBF 4I18C 4LCCA 2I9TA 3QNYA 4L29B 1MI5A 2H2SD 3RAJH 2N7BA 1N0XL 3F7RA 3EFDL 4UNUA 4J7RA 1A8JH 2IH3B 3DARA 3RU8H 4JG1H 4TSBL 1X5HA 3OKMA 4KY1H 1L0YA 4YBLC 5T1MB 2H1PL 4HS8L 1DBJL 1QFWL 3OWEA 4PJ5E 3KPOA 4XC1L 5EU5B 4E0RB 1K9TA 2A6JB 2KQNA 3MNVA 4WFGD 2JK5B 4MA1C 3ZE2E 3MA9H 1HE7A 4KTEL 2DQIH 4OJFL 1J5OH 3MLZL 2ESVB 1WQVT 3F7QA 3MGAA 4ODWB 4Y4KB 1H15B 1ZWIB 4D0BA 2XQBL 5JHDB 5K9JH 1MAML 3TA3C 3FHAA 3SJVE 4MLSA 5T3ZL 5HYQA 3VWJD 3RI5K 1C5BH 4QRPD 3FHQA 2NMSA 2EZ0D 5GGQH 2CR6A 2G75A 1DQDH 3DECA 1T1WA 3LPWA 3BIAX 1G7MA 4ETQA 4HUNB 5DZLA 3TT1H 3GSRB 1MSPA 4M62L 1KIPB 2R0ZL 2H8PA 1S7WB 5SWQA 1ZA3A 3MJ7A 5C0AD 4RMWA 4G8FA 5J8OA 4PRAA 1A4JA 4AYFA 5I16A 1FH5L 2XRAH 1H3UA 4M6ML 1MNUH 4P9HH 1CR9H 1QLEH 3WIHH 4G8EA 3JTTA 4PY8J 1KV3A 4QHUA 4WWKB 4BZ1L 2PO6A 2FR4B 2YRPA 4PJ7E 1CGSH 2EIDA 4NSKA 4XX1G 5GGTH 1NBQA 4PY7B 5ID1A 1A6AA 5F7NC 3LMJH 2C26A 4LVHC 3TBTA 1NL0H 5C08E 1GGBH 2VO5A 4UDTB 3T1FB 3O11A 4OLWL 2R8SH 1YQVH 1PD6A 4CADA 3T77B 2P5ED 4DGVH 5CJXA 2W59A 3BPNB 5DJAA 3O8XB 4H0IA 3IB4A 3HI1B 3CVHL 1AO7A 1WT5C 2YN3A 3UTSD 4E42A 2VAAA 5CEYA 1QOKA 1EFXA 1G7LA 1YNKH 4PLJD 4PRPA 3L3KA 3AXLB 1AHWC 2APVA 3FAXA 5IHUH 3RTQA 3RUGB 3WNKA 5FA4B 5L2KE 5BZDB 1KIQA 3TBVA 1MFDH 2W07A 3X12A 2X4OB 4POZC 2OZ4L 3RJQB 2E9IA 2D7PA 1Q1JH 3EOYG 4K2UL 3RVVD 5J6GA 4LIQE 1X5ZA 1DBML 3SDDC 4M7LT 3NPSB 5E99H 3G5XA 1OARH 1DEEB 3CFEB 5DURD 4HW6A 4GT7A 3IJHA 3VGEA 4WU5B 4YEFA 4YHOH 4P5KA 5EOCL 1OM3H 3ZYIA 4F37K 4PRDB 4O5LH 2JJSA 2PR4H 1RU9H 1MRDH 1PLGH 3O3DB 5LAXB 5I75C 3IT8D 3L3DB 4Y4HB 1T0MA 5LKNA 4HIEA 3T4YA 4JRYE 3HN3A 4R4BB 1PGRB 3KJ6L 1JF5A 5DT1L 3RWEA 1AC0A 4LPYA 5FECA 1J0YA 1DE4A 4Z7QF 1JF1B 1AQKH 1CICC 4GRMA 4NQCD 1EV2E 1X3DA 5FUOH 3CDFA 3OR7B 1R3IL 3FOMA 2CRYA 1T1XB 1DQLL 1MFBH 3ULVE 2EDBA 2W60A 1YEFH 1JPSL 1FNEB 1AI1H 1ZVYA 2WIMA 5EOCJ 4Q6IA 4UUJB 1IM3A 1QRNE 4MA8L 3IRZA 1IEAB 1LP9A 3QDMD 4JFZL 3ROLB 1YECH 3B9AA 2FYYA 3BI9X 3W0WB 3UJTH 3ULUF 3NIFF 2OXGA 4B7LA 3FL7A 3NN8A 1DBKH 1NGPL 3QFDA 2D4FA 1JPFA 1OOAA 3C8KB 2Q8BH 1LDSA 1RJCA 2F5BL 2H2PD 3RY4A 1CXFA 1NC4D 1E4KA 4NKOB 5GQBA 2NY4C 3BKJH 3MV8A 4LCYA 1U95B 2JELL 3VRJA 5TE7H 5D2NE 5EUOF 1G7PB 2AK4E 3ARGB 4K94L 2EICA 2LAAA 4PJ8A 4N0UB 4NQVA 3BWUC 1V7NL 2GK0B 1GRWA 4E41A 5EUKB 4IRSC 1U8QA 4I1NB 2FX8H 4L9DA 3ZE0E 3KPQB 2AW2A 1JNLH 4FZEL 2R2BA 1OW0A 2I60L 1MLBB 2EYRB 3QWQB 2ZCLL 3P30H 4JJ5B 3OKEB 5HHOB 5J57B 1SJVA 3ZE1E 3TO2A 4CN4A 2OTUB 5DLMH 3WS6A 3GHBL 4UDUB 1MFAH 1MHEB 4PJAE 1T0PB 2QQQA 2APTA 2HLFD 5JOFA 3LQAH 5D5MB 5HVFB 4CVXB 1LVEA 1GZQB 3A6CH 3TFKD 35C8H 5DD3H 2DWEB 1LEIB 2F8OA 3KXFA 1RZJL 1Z9MA 1AR2A 3WO3B 1U3HB 1OAZH 2X40A 4ZFGL 4OSUH 4PBVC 1K3IA 1RK0B 5J0BA 5KVFH 2VLKB 1ND0B 2VNCA 3DHJA 4QRTA 3OB0H 2FB4H 2G5BB 4OZFB 5DJ0A 3FB6A 3GSOB 4JHAL 1UKQA 2EZ0C 2AGJL 5IT2H 1N6UA 4P5MB 4P2QA 5EULV 2QADB 4DKDC 3K2UL 4F80A 2V9QA 3DETD 5D7LB 3VW3L 4ODSL 5KVEL 1PG7W 4ZUTB 4GJTB 4OI7A 3UZEA 4IRJA 3HI5L 5BV7L 2DYPB 5HHPA 4RFOL 5C0CB 5IVXB 4ODTL 4H25A 3SKOB 1NAKL 5DJDA 1T80A 1A7PH 2YSSB 5LCVL 1H0DA 2AJYH 2CH8A 5C07D 3S5LA 3NOIA 5FYJE 3GSVA 4BFGA 3LAFA 4WI2A 1WBZB 5BJTB 3TWCL 3DX7A 4L3EB 4KUCF 4AIZB 4OUUA 2VC2L 4TOYH 4FQ2H 1T1ZB 4XCCH 3MMEA 3KHQA 4D0CA 3QI9A 1RUAH 3D3VB 1U8KA 5B8CA 2Q76A 5JOPE 1X4ZA 3OXRB 5IHLB 5D6CB 3D85D 3RY6C 4XRCB 1RFDL 2W0FB 2AJVH 2BY0A 1NGWB 3X17A 3REWB 2B20A 3VH8A 5CD5D 4IS6A 5FAAA 5T1LD 5F93C 4ZAKA 2C9AA 5I1LA 2GFBB 4PJGA 3FQWB 1XGTA 1MWAL 4LCIL 2R29H 1F11B 1C7SA 2FGWL 4QNPE 1Q9LB 4Z7NE 3QXVA 1UH3A 1SEQL 4NUJA 2KUTA 5E03A 2ZOLB 4Z77A 4NM4H 4AMKH 1D5ZA 1R3LB 4ODUA 3I6LE 4CW1A 1YNLL 4P3DA 3QG6B 4PJ9A 2W38A 4M1CD 2IG2L 3G9VA 3QJHB 3KWWB 3P0GB 4ODVL 5ESVA 1XF2A 4UTAH 5H37H 2J7LA 4JDTH 4NHCL 4JHBA 4F57H 5H35A 2FJHA 4J3OC 1TETH 2PYEA 1VGEH 1MCFA 5J12C 5HDQL 3D48R 5IB2A 1GGYA 5AZ2H 3WUWA 4XWOD 2GT9B 4DGYL 1WEJL 4JQXC 5E2TH 4KI5C 1DDHB 1INDL 5KSBB 1KXQE 4Z0XA 2HVJB 1R3HB 1IC1A 5JUEL 4MJ6B 4ZO7A 3T8XB 5AG9A 4LLQA 2QSCL 2ZKHH 2FLRT 4MJ4A 1WFOA 2NZ9C 1G7IA 1E4JA 1WJ3A 2DQTH 2VDOH 1XH3A 1I1AB 4HDIB 5I8KL 5J1SC 4X6EB 3DSFL 3U36B 1QBLH 1DVFA 4M6AA 2A9MH 4Y2DB 2CDFA 5IWLA 3MGOB 1K8DA 2XN9D 3BDYL 4FQ1H 1WBYA 1A9BB 4L8BB 2J5LB 3DXAB 4P2RA 1EHAA 5HGBA 2GTWB 1NGYB 3MZGB 4RAVA 1DN0B 4Z7WB 3CVHB 4HUKB 5B39G 3U9UA 1I1FA 4HEME 2XWTB 3WXWL 1OCWL 4KQ4L 3B6SA 4NBXB 3NH7L 3ZKXC 3IKKA 2XKUA 5MEQA 1A7NL 4NQSB 3BKYL 1AQDA 3CU7A 3HC4H 4W6YB 5E2UH 4MS8D 4U6XA 2Z31D 4YXLH 2H2PC 2Z4QB 2A1WH 5EU6A 3JWDC 5IMMB 43CAA 4BZYA 1N64L 1CXIA 3SO3B 4RMVA 4RQQB 2VE6B 5F1SA 5ACLA 3NZ8A 1SY6L 4IOFD 5IVZB 5J11C 1SHMA 2C3GA 3ABZA 1FNAA 4JJHA 2EDFA 3RIFK 4CVUA 3PABB 1D5MB 3HAEB 3OXSB 1NAMH 1FVDA 5C0GA 3L9RB 4HPOH 5DYOB 3QUZA 3OV6A 4L1HA 4LVEA 4TULH 2XYCA 1X4YA 1N5YL 3MUGA 3Q3GB 4XPBL 5KAQF 1XZ0A 5LWYH 3C08L 5D96C 2AI0L 4OGYH 3P3YA 2F58L 3VXQB 5BZWB 1NBZB 2R39A 3X3FL 2DQDH 3WFDH 2DIBA 4OCYL 1DUYB 4GRWE 3OHXB 4FQQA 3F6IA 4KROD 1YMMB 2NW2B 2XQYK 3DOSA 2AEIT 1ZT7A 4ZYKA 4UILL 2BDNH 4QHLA 3IDYB 1LE5A 1SM3H 2JCCF 3AS0A 3IDGA 1S7VB 4WFFD 3Q5OA 4KZEL 4HMDA 2HP4A 4F7PB 2EKSB 3QDGD 4K7PX 2EO1A 4HH9A 4NO3B 1DBAL 1M7DB 5I1GL 3ULUD 5F1NB 1ZLWH 4EZMA 1JPST 3QDJD 2XA3A 4TPRL 1IGFL 5ALCL 5HPMA 3Q5YA 5F7DA 1PDKA 4YHLH 1M71B 4BKLB 5IQ9A 1HOCB 5T3XL 1QLFA 1MLCA 1NJ9A 2V5SA 4JLRA 1PBYA 3LHPL 3T2PA 1JGVL 2BSSB 4Q58C 5I30H 3SCMA 3PDDA 4P23D 2J3SA 2GCYA 1V3KA 4W4OC 5CWSA 5HDOA 4PR5A 2PUQT 5I1IL 3N1GC 3RQ3A 2QLVB 3O2DH 3VDAA 4OM1H 1LO5B 5DO2C 3D1MC 3DRQB 3KPSB 3OJMB 1WUNT 3U83A 2NY2C 2OL3H 2AJ3A 4YX2L 3VI3E 4DFHA 4RAUB 2W9DH 1NFIB 1EEYA 3JUYA 4X6DF 3D39A 1TTUA 2DDQH 3QCTH 2CK0L 3MJGX 3B2UD 3WDJA 3KLAA 4JFFD 5CD5C 2H45A 5EOQH 5ISZB 1BF2A 5MEPB 3RWFA 1A6VL 2B1HL 4MAYB 4U1GC 1ETZA 5EA0H 4JFED 2IEPA 4OQTL 5CBEB 1F3DH 1PSKH 4R26L 7FABL 1LK2B 5EZJA 5AZEL 2R0LH 1J10A 2GW5A 5I1HH 2EC8A 2HWZL 4LEOB 1S7SA 3TV3L 1X7QB 3QISA 1ZT4B 2HKHH 5GJTL 3DURB 5DUPL 3KR3L 4M1CC 4X9BA 5C09D 1DUZB 1N59B 5D1ZD 5BV7B 2DICA 2YPLE 1WWCA 4R4FL 1QTYT 3GUTB 3QCUL 4XWOC 5L2JA 4G7YH 1P7HL 3FO0L 5GGRA 5KS9E 1LNUA 1INQB 1JMXA 3QWRD 3RWJA 3P4OB 3NIDE 5FHAH 3Q5TA 1WT5A 3H3PH 1JGEA 1YYMH 4URTB 3NBNA 1NLDL 5CLTA 4U0RC 1QFWI 1KT2B 4NQEE 4OIIL 4Y5XC 1AXTH 2FL5A 3P9WB 4KUCD 4A6YL 1U41A 4CMHB 4DKFL 2IAMC 2VZOA 3A6OA 3PIQB 2ADIA 3HG1E 1Q8MA 1I9IL 1OGAE 3PHOB 5TH2A 3U9PH 3D9AH 2Q87A 3SDDA 5ACZB 5FO9B 5D7IB 1P4IH 1MWAB 1I3RA 2VQ1A 4HX1A 4CJ1A 2D0HA 2YC1A 4XP1L 5F96H 3VCLA 1OD9A 3NZHH 1DQQA 4LLWB 4P9ML 4U33A 1UB5B 4MB4A 3VG0H 1T2QH 3H42L 3PQYE 3GRWA 1T89C 1P53A 2EYSA 4EOWH 4KZDL 5C0JA 4MS8C 3MRNA 1RIHL 5ETUA 4NQXB 2Z31C 5C0BA 3I75B 1TCRB 4G80A 4WUUD 3UTTD 1DFBH 4PJDB 3TIEB 1MI5E 4KDTA 3OG4B 3LKNB 3WBDA 3AAZA 5FA3B 1MCQA 3EYOB 1CN4A 3CC5A 4IOFC 1QR1B 3T04D 5EB9A 3WFCL 1A64A 4KDWA 5IMKB 4HKZA 3DVGB 3I9GH 4Z9KB 5IMLA 3QPXH 3N9GL 3UYOD 3LIZL 5FKPA 5JW4R 4P5TC 1Q38A 3ZTNH 4LFHD 4GW4B 1TJIH 3VFRB 4DZ8B 4HF5H 4XXCC 4F7CA 1F4HA 3DSNA 5FKAA 1QHPA 2XQYG 4XMPH 3BP7A 1Q94B 4GW5A 1ZEAL 3W9EB 1C16A 3KYAA 2P5WD 1KGCD 3MRLB 1U8NB 2GKIA 3SOBL 5HVHB 3ZDXE 2EECA 3FB5A 3FFCA 5HVGB 5B22A 4IHOA 4MXWL 3WN5B 3UTZA 1CXEA 4OD1H 5DEFA 4KRPD 4TRPH 1K2DA 2B2XL 3P4MB 5AYUL 2X2YA 4U1IA 4OIBA 5EWIH 4AM0A 2YBRB 2IQ9L 1O7VA 4MD0A 1XFPA 5IMOA 1S9VB 3ARED 3JWDH 4RSVA 4S1SL 2VLME 4Z8FL 2J12B 2F15A 4ODHL 4UB0H 5TDOB 1N5AA 3PJSA 4OF7A 3O2DA 3ECBB 1F4YL 4Z78A 5JA8B 2FATH 5IFJA 3QFJE 2CKBH 4W6WB 1MJJA 1IL1B 4MX7A 3HR5B