4KROD

Nanobody/vhh domain ega1 in complex with the extracellular region of egfr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
213
Chain Sequence
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system
molecule keywords Epidermal growth factor receptor
publication title Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 213
sequence length 218
ec nomenclature
pdb deposition date 2013-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kroD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kroD01
2WW8A 2IANE 5F1NA 4LHUD 1D6EB 2HFEA 5E99L 4BSVA 4Y7MA 1D5ZB 3VGDA 3CXDH 1HEZA 3OJVC 4ZPVB 1A1OA 3OG6B 1JN6A 1S7WB 3M1BB 4HX1B 2FJHB 4M5ZH 1DQMH 3NFSH 4YDLB 2D7NA 1NLDH 2ZG1A 3HNTL 2AQ2A 2D0HA 4M1GH 4OV5B 5E2WL 2A0LC 4NQEA 3H3BC 4KQ3L 4XVJL 1HHJB 1E6OL 1S7XB 3KYMA 4OUUB 4ENED 2VWEE 2CK2A 1I9RL 2PN5A 4PD4K 3O4OC 4R3SA 4NGHH 4YDKL 3FT2B 4N9GB 4X7SH 4DKAA 1E4XH 3VXUB 3ZE2F 3V6ZA 2ZUQC 2KH2B 2DWDA 1LO0H 4AH2B 5FCUL 4NNPH 4I5BB 2XIDA 4NSKB 2AXHA 5E8DH 1NMAH 2HN7B 1QO3A 1MFCL 2X42A 3MBED 1F11A 1WQVT 2W9LA 1FNFA 3T1WA 1JE6A 2CSPA 3OAUL 4N8VB 3TO4A 4YX2H 2XA8H 4D0CB 4ZAKD 3REVA 3WIFB 4PBWD 3HAEA 3VXTA 1CS6A 4YBLC 1AGFB 2YBRA 1YN6B 1FVCA 4YH6A 3GJFK 1BF8A 4X7EC 3L3DA 2Q3ZA 3R1GH 2XQBL 3GJFH 2R2CA 4G8FA 1D9KA 3B4NA 2UY6A 1EEYA 3UBXI 3V4UH 4C54A 2B0SL 1C12A 4DKFH 3H9ZA 2WM0A 1XGTA 4FS0A 4EI6B 3VG0L 2APFA 4Q0XL 5ICZB 1NBZB 1RZJH 1E0OB 1A3QA 1I7TB 3RL1A 1WFOA 5A43C 4FFVD 5I1IL 2B4CC 3Q3GB 4GH7B 3VGHA 2HTLD 2NY5C 1RZGB 4U1KB 3O2DA 4BZ2L 3OAZK 5LG1A 3ARUA 3TJEH 1EPFA 1TJGH 2P49B 4A2MA 3RWGA 2DQFB 3HKFA 5L88L 5HVWA 1DUYB 4YXKH 1PX4A 5KG9B 1XT5A 3S36L 5GS3A 1JZ5A 3U9PH 2XKNA 2WP3T 4BUHA 4GW5B 4PG2C 3SGKA 5DJ8B 2AEPH 3ABZA 3C08L 4LCUB 1JRHH 3WE6B 1EMTL 4LDEB 3D85D 4JR9L 4NBYB 4RGMC 3QQ9C 4F7EB 5IUSA 1KLFA 1AD9B 5DO2D 2A77H 1VGEL 1F4YH 2F15A 1IARB 4G8GD 4RIRA 5CZVL 1LEIA 5I74B 4WV1B 5HY9B 3G5VB 4NKMB 4G43B 4YAQA 4CJ1A 4ZUUA 1X5KA 5IQ7H 2UWEA 4YNYA 1JV5B 5CJQH 4ZNEA 4WTWA 5CP3H 1NCTA 4NUJB 3EJJX 4F7MA 2AKRA 2VDML 2LABA 1R3IL 4HIJA 1IKNA 4BFGA 4GG6A 2A1WH 1Q1JH 5IROA 4HUVB 4Y4HD 4G8GE 4JVUA 1CFQA 2EDNA 1TNNA 2Y6SD 1PW3A 1FYTA 1NGPH 4G3YL 1GIGH 4G6MH 1IC7L 2GAZB 43CAB 3EYOB 1ZS8A 3IKKA 4CUCA 5J56B 1Z6JT 3UTTB 1FFQA 4HHAA 5D96C 1S7VA 3GHBH 3RX8A 3HZYB 2VDLL 3C9NB 5EU5B 5GGQL 1WIOA 4YFDB 3L1OL 4TNWF 1OGAD 4LSVL 4MDIA 2X2YA 2BNUB 5MEOB 3V0WH 2DBJA 3V5HA 2P8PA 3K0WA 4UB0L 5E6IA 3Q6FB 2GSIA 4W4NA 5J12B 3T4YA 4PJCE 3RAJL 3JTTA 3C8KA 2H1PH 4P46D 4QT5A 3VRJA 5HGBA 4HKJB 4NJAL 3KPMB 3QPQD 2BC4A 3R0NA 4M3KB 3ARVA 1OGAE 1CFTB 3CDCA 3DSFL 3IU4L 1HOCB 4YHLL 5FF6B 5DWUH 3PIQB 5DHVH 4HMCA 1WISA 4L3CB 3HPLB 4PIRF 5KVGL 5IB5A 1ZTXH 2C1OB 1G7LB 2XNAB 4KVNH 1NDGB 3S37X 1IM3A 4UUJB 3O3BA 1MI5D 3QUYC 5ALBL 3IFLL 4X4XB 4NQUA 3W0WB 3NAAL 1HH9B 1U8NB 3IGAB 1JNNL 3OB0K 3BH9A 3U7AA 4GAYA 2VLJB 4PJGE 3JWDH 1FZMB 5GJSL 3WFBH 4W4OC 4O2CA 3M45A 4KPHL 4WNQA 5BZDB 5KSBA 3VWJB 1MHCA 1J1XL 1KCUH 2VDNL 3O6ML 1FC2D 1MHHA 1MI5E 2P46B 2YZ8A 3SCMA 2AABH 4YC2B 4GBXB 4JANA 3P30H 4QCIA 4PREA 4TVSa 2H2PD 1Q9LB 1NCDH 3CH8A 4AENA 1XZ0A 3L5WA 4LAJH 3K80A 1SJEB 4HPOL 2B7DT 3IF1B 4HKBA 1DE4B 3LN5B 4ORGB 2VZ1A 3T08A 2O61B 3X12A 1UENA 3D25A 3VXPA 3ILQD 4FQ2H 4WO4B 5GHWH 2IFFL 5IKCB 4L9LB 4JY5L 3BP5A 5LXGH 4P3CH 2JCCA 5DD5H 1CGVA 1HHKB 3ULVL 3HTLX 3WS3B 5K9QG 2NY2D 4O9HH 2D03H 4KJPC 2ICEA 5F3HB 5I74C 4ACPA 1CFSB 1UJ3C 4QTIH 2FJFA 1PSKL 5FHBL 1TJHH 3GM8A 3FQTA 4XMKH 3PG2A 4J7RA 5IFJB 4PLKD 3ZSTA 3U82B 1CGYA 1NC2D 3O45A 1FGNH 1X5IA 1CG9A 3IJYB 3LKRA 5C0IA 1UB5B 3RGVC 4OGAC 5JW5B 3QO1B 2OZ4A 4M43L 3G5ZB 1J9CT 1M7IA 1IGIH 3ZKSD 2WWKT 5JNYA 3VFNA 2DQHL 1M6OA 3MRGA 3X3FH 4N0FA 1XIWD 4NIKB 2JTDA 3TNNB 4OZIA 1ROWA 2NR6D 3T8XB 3HC0A 3MLWH 2HJKB 4H20L 5CCKH 2Z91B 3HE7C 1FSKB 3C6LB 1EEQA 2GITB 1ND0A 5J12C 1RY7B 3RRQA 2CO7B 4PJHE 1YEIL 2OM5A 3HE6D 4E42B 1QG3A 5F7UA 3X11B 3F7VA 3GBMH 3LPGA 4M7LL 2MOVA 4X6CB 3BKML 4Z7NE 4XNUL 3BRFA 2VXVL 1IFHH 5IMLB 2EKSA 2F8OA 2NY4C 4ZS7L 1LILA 4ODUA 5KSVA 5CP7B 1JZ7A 3TYGL 3C5ZA 4XPTL 2ADGA 3LS4H 1F4XL 4BH8A 3S9DB 3GSVB 2FATL 4AL8L 2PNDA 4Y5YA 3G04B 1RUPH 4YHOH 4Y4FD 5TE7H 3HRZA 3RVWC 3WJLC 3QXWA 2ZUYA 4QHUB 4NO3B 4J1UB 5CJXC 5TE4H 4U1HA 3QG7H 3BSZL 2IH3A 5DD3L 5JO5B 2LU4A 4WVRA 4LGPB 3VFUB 3GSRA 4EZMA 4HCRL 2E27L 3OF6A 3MJ9A 4Z7UE 3D1MC 3VWKD 5L2KA 3RBSA 1I1CA 2H32B 1FJ1A 4FQ1L 2EIZA 4YQXH 3NABL 2VN4A 3PGDB 5E4EB 5I1EL 3REWB 1NFDE 4OV6F 4NP4L 1N6QH 3P0YH 4XCCL 4L3ED 2AJYL 3TC9A 4NUGH 1OAYL 5GRJL 4R0LB 1JGEB 2DN7A 3OPZH 5IR1B 3RWIA 5HYJD 2RIKA 4KMTL 5HGDA 1CD9B 1GHFH 4FG6D 4PB9L 4ZUTB 5JXEA 3IKCB 3OJMB 5CEYB 1I7UB 4OQTL 3CCHB 1YN7A 1FL6A 4U3CA 5CMAB 4L3EE 5IQ9B 3LEYH 2DQEH 3KXFA 4WHTA 1FO0H 3ARDA 3MXVL 3VXMB 1BD2D 5F88A 4GW4B 3T0EA 2VABA 5IVOA 2W0LA 1HIML 2IBBA 2QSCL 1I4FB 2ZUXA 3LRGA 2P45B 1I8LA 5HYJE 4HXAL 2YPVH 2FH6A 5IWLC 2V9QA 1S7SB 2YK1H 1I8KA 5CEXB 1UZ6E 2AJXL 1QLRB 3SKNB 3WFEL 4U7SA 3TO4C 4OFKA 2ZUVA 1BZ7A 5HDOA 5IVZB 2E7MA 3EOAB 3E1F1 1XGUB 2P4AB 2BVUA 1RJLA 5DEGA 1JPFB 1DVFA 4GRWF 2FO1A 3UTQA 3IXTA 1A6WL 3QWRA 5GS0L 5CSZA 4Z77B 2CR6A 2QQNH 4AQOA 3EDKA 1UWGL 2O5YL 2IANA 4DZ8A 6CGTA 2F53D 4HW6A 3ZT7A 2AXGB 1P84J 1YEKL 3ZYOA 1C1EH 1AQDB 4CN1A 3DIFB 5FGRA 3IU3B 3RVXD 1PG7L 1OSPH 1U58B 1URLA 1JTOA 4OLYH 2WBWB 4ZUSA 1NCAH 1F6LL 4TUJB 5ELIA 1YMHA 4AG4L 4HWBA 5F6HJ 4JO3L 1WFUA 1NJ9A 1U8PB 1Y18A 2Z35A 3C6LC 4EDXB 4MAYA 2OLDA 1MRCL 5E7BA 2F53E 4M7ZC 4FZ8H 2VQTA 3EO0A 3QCUL 4LQFH 4BKLB 5DQDL 4XVUC 1HCVA 2Q8BL 2H8PB 1HINH 1A9EA 4LU5L 1QFWM 3V95A 4CN6A 3U9UA 2NW3B 2XWJA 1J1OH 3QR2A 1BM3L 4Y8DC 1Z0MA 2MCPL 1A2YB 3FAXA 3O9WD 4KUZL 2OJEB 4PRID 4ODHH 3GHEH 5FKAB 4LHUG 3IDGA 4JFHD 5DK0A 5HYQA 1LP9B 3S35L 5GZOD 3RIFF 1W0VA 4YWGL 3IYLW 2YD6A 3SGKC 1XR9A 2SEBA 4M1DL 3IS1X 5IFHL 5KVEH 4HD9A 2DD8L 3KYAA 4NRZB 3WNPA 4FABL 2EH8L 4HS8L 3FQXB 3GRWA 3MCKA 5DVMA 5FOBA 1KJVA 4PRIE 1TTUA 3LKQA 3T3PE 3TBWA 3SY0A 2PW1A 4MQTB 3BQUB 2P5WB 1MCKA 4JFHE 5DR5H 3C2SA 1FIGL 3N1FC 5B4MD 3EW3B 3MFGB 2Q87A 4HPYH 3VA6A 5IB1A 3DV6B 2Y5TA 1JBJA 1K8DA 4LAQL 4NO2A 3UZQA 5FKPA 2X09A 1MVFA 3FB8A 1W72A 5KANG 3GUTB 5J9PA 4KV5E 1A4JB 1J05B 4J12A 4UMGA 4GFTB 1ES0B 3DX9B 4HZAA 3K8MA 4TUOB 1GGIH 1YY9C 3JV5A 3WIHH 2VYRE 2L4OA 2I24N 4FFYH 4R0LC 4TTGA 4PRNB 4UAOB 4WUUD 2NY0B 4PGCA 1SEQL 4KK9C 3SN6N 4OD1H 5EBWB 4QXUH 2APVA 4JKKA 4LSDA 5GGSB 4R7NA 4UT9L 3GMQA 4MD4A 2R23A 2A9MH 4PGJA 3WNNA 4UDTB 3VFWA 5KJRL 1MCWW 3HMXL 1NGQH 3INUH 3LKPA 2PR4L 5C07B 5EO0B 1PY9A 3V7AG 2CDGB 3DGGB 2BHYA 4WUUE 1Q8MA 5F9JA 4RFOL 3LKSB 4NQTA 3D2UB 3LQAL 4HSQA 2ATPB 4BZ1H 1GGUA 2I9TB 3MMEA 4PR5B 4XBPB 2Z31B 3TJHC 1CGTA 2EDTA 1H8OA 1ZLWK 4S1RH 2R9HC 1U8MB 2CKNA 3FT4A 4JFPB 1CR9L 3MRLA 1C5CH 3SO5A 1BMGA 2WWMD 4DKEH 4YJZL 1QA9A 3U1SL 3TP4A 5E1HB 1HQRA 4BH7A 5IV2A 1DQDL 1HH6A 4EUPG 1XAUA 3VGAB 3NFPA 1MFAH 4XP1L 3BVNB 4Z8FL 1I7ZA 1Z9MA 4MA3A 1H3PL 4TOYH 4JAMB 4JFXA 1TZHA 3FOMA 1DEEB 1HXMB 3D85A 3LDBC 4JY6B 4PJXE 1UA6L 3FRPA 4M62L 1N8ZB 3G6DH 3F65A 4J4PC 1K4CB 1LNUB 1ITCA 3VFMB 3NZ8B 2R2BB 4O58L 2V6HA 2IG2H 3G08B 5DD1H 4GOSA 4KJYA 1VFBA 1S9VA 4JQVC 2G2RA 4KROB 5IW6B 1ITBB 2R29H 4YDJB 4P2QB 5CBEB 4B53A 3MXWL 5GGVY 4HJJH 2VIRA 5T1DH 1RUAH 4ODTL 3QNXA 1JNLL 4LSPH 1JUFB 1OARH 4L8BA 5D6CA 4K7FB 4U6XA 4NQCB 2OSLA 1T66D 2XWTA 1P5UA 3P4NB 2J6EA 3B43A 4I2XA 4X9BA 3IJHA 5I17A 2JIXD 2YD2A 2GY5A 3FB7A 1QHOA 3JBG7 1KYOK 3EYUH 2QR0B 1H3GA 3L5XL 1I1FB 3RUGB 2ESVA 1DBJH 3G5YB 4FQHA 2Q3AA 4K3EL 4Z0XB 5IB2A 3SDXB 3BQUC 1PKQB 3CLFH 3CD4A 4P46A 3H7BB 1T7WA 1S5HB 4YBHA 2B4CH 1YNTA 3BO8A 4HIXL 4LIQE 2NY5H 2PYED 1XGQB 3U46A 3RKPA 4ZOBA 3S4SA 1DLFH 4XXCC 5GSVA 3VD3A 4JRYD 1LE9A 4M93B 1V05A 1U95A 3CC5A 3DVNB 2A6IB 3BUYA 2E7LC 2LVCA 1P4IL 2VNCA 3DJ9A 5KW9H 4RX4A 5SWZA 1P7KB 1VDGA 2CXGA 4UAOC 2N4IA 3WNMA 3GSWB 3L7EB 1ZV5A 4OT1H 3RPIA 2PYEE 5D5MF 1PQZA 1QD0A 5C1MB 5BQ7B 4EN3B 4YHIA 5E08L 3KWWA 4JRXD 1L7IL 2W59A 3N06B 3IFOB 4JM4L 4JRYE 3DUUB 5D7SL 1A7RH 5IW1B 4D0BA 1P7HL 1F4WL 4L4VD 4N5EC 4UILH 3J7HA 1S8DA 1CVSC 2GJJA 4LEOA 4LHUB 2Y07H 1OSZB 4C4KO 4WUKL 2G5RA 1D5BB 4PB0H 1CDGA 1HHJA 1DLHA 2Z31C 4QGTA 3BD5A 2FJGA 4RFNC 5IBTH 4JRXE 3HZVB 4D9LL 4FQJL 4RQQB 1FL3A 2D7MA 1QSVA 2B5IB 2MTPA 4XNYL 3NGBB 3AVEA 3PL6D 3FT2A 1YYMH 2PCPB 5HHPA 2HMID 3VXUA 1QEWB 1I9JH 4L4VE 4Z7WF 4K8RL 2DLFH 4FTVD 1KV3A 5DZLA 2W0FB 4MVBD 4Y5YC 2HJFA 3U0WH 5ACMA 1KTLB 2BDNH 4P49A 5ILTL 1B2WL 1S7RA 1AD0B 3EFFA 4KTEH 2CIIA 3UJJL 2EZ0C 5F9WB 1QKZL 2FLRT 1Z9SA 1R3KB 3O81A 4JGMA 2FX7H 4XWGL 5C0NC 4JEGB 1MHPL 3TV3H 3WKNA 5F7KC 1IAKA 2PTTB 4FTVE 4MQ7A 4Y5VA 5I8EA 1ED3B 1GGBL 2VAAA 4BJLA 1T6VN 3MBEB 4NZRL 1A1MA 3T77A 1T0NB 1QFWI 4KROC 5JHLH 4ZAKB 2R1YA 1IC4L 2CMRL 5HHOD 3I3EA 3L3IB 4NWUH 4YFLI 5C0BD 2AQ3A 4JFFD 4OCWL 3ULSA 1E4KC 2QHRH 5ICZA 5GZND 4Q9RL 1GZPB 5BO1H 1FNEB 1FFNA 4LCWD 3MTRA 1I7TA 1KLGB 4GJTB 3VFGH 3HZMB 4F9LA 3OKKA 1RHHB 1JYNA 2R8SL 3TIDB 1Q38A 1KB5H 5I8OH 5HHOE 1T2QH 3OKDB 4PP1C 1FZKB 2J4WL 2J88H 1FDLH 3KYKL 3ARDC 5ICYA 2HLAB 4JFFE 5C0BE 1S9WA 1YEHH 4Y5XB 3OQ3B 1JP5A 3P11L 5LWYH 5F96L 1BBDL 3KNBA 4DUVA 4MA8L 4A2LA 4XMPH 1WBXB 4LCWE 3UAJD 1I8LC 2OL3A 1KIRA 1ZHLA 1T1ZA 1ZLSL 1LP9F 3HE6A 2DJ4A 4P2RD 3HG1B 1A6TB 4U4BA 3MLZH 4XRCB 5DJ8A 1BVLA 4JPWL 4OLWH 5L7XH 3RZCD 2WV3A 2NX5E 4HJGB 1L7TL 4HUUA 1JGVL 15C8H 2OMNA 1DVFC 4KKBC 4F58H 3W5MA 4ORZC 3DVIA 3P73A 4WV1A 2BRRH 5F44A 4P2RE 1XF5A 1DDHA 4FZEL 1J11A 2KUTA 1U8IB 5AYUL 1FH5L 5FDWB 1RURL 1E27B 5T5FH 5KOMC 4ZOAA 5IG7A 5I1CL 4MNGE 5B38G 4UI2A 3U48A 4HUVA 1IRAY 2BFVL 3CSYB 4G8GB 4M6MH 3IFPB 4XNQB 2GTWB 3I3BA 1ZHKB 5C3LD 1BOYA 5D1XD 4QRQB 1MUJA 3ULUD 4CVUA 3FFCD 4HMDA 4ONHB 4I3RH 3EYOA 2EEDA 3KPOA 2VWEC 4LCCC 3C9NA 4TSCL 1E4JA 4JN2A 2RFXA 1WBZA 3QXUA 5HXMA 2XOTA 2KL6A 4GW1A 1JMXA 5C0AA 3NGBC 4JPIB 5F7NC 4Y4HB 3WO4C 2BNUA 1J0JA 5BRZA 2Y72A 3IAPA 2AXJA 3SE8H 3AU1B 1ZOXA 4LSQH 5JHDD 4KK5D 2R2EB 3ZTNH 1F8TH 3ULUE 1F2XK 2JK5A 2P5EA 2JELH 4LARL 3FFCE 4C56E 4OD2B 4ENEC 5IP4A 4KZEL 3E6HA 3WUWB 5IB4B 4LNRB 1OGAB 1OQOA 5ITBH 5HTSA 4BSJA 5F9WC 1T7ZA 3EYFB 3U4BL 2FBJL 2IPUG 2FHBA 4JQIH 1UM5H 3MUJA 3WFHB 1ZLUK 1DBBH 2ADIB 4N0UA 2R15A 1KJ3L 5JHDE 2DM4A 4ETQB 2F5AL 3HI6H 1ZLUH 1BQLL 1KNOA 2HKFH 3MBEC 1YDPB 4OUOA 4N0YL 4OTXH 4Y19D 4MA7L 3FOLB 1NDGA 1YEDA 3IAGC 4ZAKC 2DI8A 1RK0A 5BMFL 1U91B 4ONGL 4PJGB 1JPSL 1G6RA 1G7MA 3DPBA 4KKAD 3SPVA 3BRGC 5IJKC 4KH2A 5F8QC 3VWJA 1MI5B 4Y19E 4YZFE 3LKNB 5ID1B 1MCLA 4LOUD 1N64H 4JY4B 3ZLQC 1IC5H 5CIPB 1CF8H 4Y5XC 3BKCL 1XCTB 4NQXB 1XH3B 3WXVH 4FFVC 3MA9H 1WZ1H 3AMLA 2HTLC 5C6TL 4X9IA 1UACH 4H0GA 3Q5OA 1NL0L 1N5AB 2AI0H 4XPFL 5DF0A 2W9EH 2FR4B 3BKYH 1I1AA 4WO4A 1T5WB 1ZHNA 4HWNA 3L3HB 4YHPA 4P48A 4L9LA 4A6YB 1OP9A 3MRNB 3B5TA 5EIIB 3GKWL 3RUGF 1SJHB 2A38A 1P4LB 4YHNB 3LY6A 2DYPD 2QV2A 5HGAB 3WS6C 3K1KC 1JJUA 1WWAX 1WCBB 5KVDH 2YMXH 4J23A 2GUOA 4D9QD 1UVQB 2WINB 4OFVA 5IFJA 2CKBL 4OQ1A 3SDYL 1I9IL 5JOPD 4AEHH 3QH3A 2NY1D 1WTGT 5DMKA 4G8IA 1UWXK 4MQSB 2NY7H 5DO2C 1NGYB 3MLTB 4ODSH 5GGVL 4LGRB 5CLWA 4KDTA 4ZO6A 3PJSB 2ZZUT 7FABH 4H0IA 1AJ7H 2IPKB 3CXDL 1M05A 4D9QE 1IAOA 3OJ2C 2YN5A 2KZWA 5E5MA 2AEIT 5D2LE 2M26A 5JOPE 5CJ8A 4M5ZL 2IMMA 2VDKL 1VFUA 4PD4J 1X5HA 1NLDL 3MV8A 4XBGB 1ZT1A 4JDTL 1QUNA 3H0TB 1T7YA 4M1GL 4Y4HC 5LCVH 3ZE0F 1CZ8H 5EIQA 3TNNA 4WUUA 4Y1AD 2Y6SC 4EI5B 1K4DB 2J3SA 4GMTH 1RPQA 3UJIH 4PJHB 3OZ9H 1BFSA 1NLBH 2VQ1B 4NGHL 2J8UE 3KLAB 2FZ3B 5CKGA 2AW2A 4LK4A 2OMBA 4ZTPH 1E4XL 2HVJB 1BX2B 1ZLVH 3O6FA 5E4IA 4OF3A 2JLLA 1VPOH 1LO0L 1QFOA 4G7YH 5D93C 4Y1AE 4NNPL 5CP7A 2R1XB 5E8DL 1NMAL 3U4EB 3BKJH 2JB5H 4P46C 2X10A 3TNMB 1ZE3C 3SE9H 3DROB 5JOFA 4EKXA 4YX2L 3QPQC 4D3CH 2XA8L 1LEGB 3G04A 1DN0B 4Y2DD 2V5RA 4U6HA 4OZHB 1A7QL 3VXQA 3B3IB 5SWSA 4IOSD 4NO0D 5BV7B 5IVNA 4WFFD 5B38B 4PS4L 1A1NA 4Z7UB 5ICXA 4TSAH 1T89A 1IGTA 4JPKH 4PRAA 4HAGA 4Y4FB 1S9XA 1CCZA 3MNVB 1LEKB 5D5MA 4DJMA 3N9GH 2YHGA 1SEBA 4NDMB 1NFDB 4X6BB 3PGDA 3ARTA 3REWA 1GJIA 2FD6H 4WFFE 3T0BA 1Z5LB 3WFZA 4X6DB 1MCEA 1T0MB 5D7JD 2BOCB 4MNHA 3VWKB 25C8H 1SVCP 4PTUA 1WAAF 4JFEB 1BJ1H 4LKCB 1MRFH 2Z4QA 3TJEL 2NLJB 3W11D 1TJGL 3DBXB 2UYLB 1HN1A 4ZUTA 2AJSH 4P23D 1TDQA 1KJMB 2W0PA 4YXKL 5FM5O 1ORQB 1TVHA 2XZAH 5I8CA 4JM2D 5CMAA 4MCZA 4RMSA 2HFFA 1VACB 5HYJB 2O26U 2E9BA 2ITCB 4CMHB 2AEPL 4Z7WA 3ILQC 3K4DA 1JRHL 4G9FD 3L5JA 4H26B 2EXYD 1GPOH 2OR9H 2XQYK 4MGXA 1LWRA 2X89D 1Z2KA 3BIAX 1IE5A 1BD2B 1EVTC 3SKMA 1F4YL 4XH2B 2VERN 5A16A 2ED7A 3QZWA 2NY2C 32C2B 3VFSB 4JZOB 1OVZA 3P4MB 1RQ5A 4NQDA 1NC4A 4CVZB 1RHFA 4M5YH 3WLBA 1RIVH 5CJQL 3OJDA 1N59B 3BOVA 4XPBH 5T1LA 5KTEH 1D5MA 4G9FE 4PLKC 3FB6B 1YUHB 3ULVD 3CNKA 4D8PB 5EUOB 3BEWB 2A1WL 1Q1JL 1UXWB 2VXSH 5HGHA 1ETZB 4W68A 1CXIA 1VFAB 3QUXA 1V3LA 4NWTH 1X6LA 1NCCH 4B41A 1NGPL 2O5XH 1GIGL 2DQCH 4G6ML 5CGTA 1W8NA 5F9AC 4E0RB 5FGCB 2GYSA 1A4KA 4UQ3B 1S7QB 2DQJH 2Z0BA 2X4QA 3GHBL 2F53B 2NYYD 1AE6H 2ZCKH 4FQQA 4CADB 3ZDZE 3ULVE 4F9LC 1F6AB 2K7QA 3MO1B 3VXOB 3FHAA 1YECH 1I8MA 1J87A 2VL5B 1KTDB 1XIWC 3DOSA 5I8KH 1X7QA 2NR6C 5C8JA 4ESKA 1EHLL 3CUPA 3RJDA 3HA0A 2ZJSH 3BPNB 1MWAB 3QUMB 5DRWB 5ACZA 2H1PL 4ZNCD 2XXCB 2FO4B 3G9AB 4DW2H 5DQJB 4QHKI 3DMMD 3LZFH 2HFGH 4L8DB 3HE6C 4HV8B 1LP9A 1F3DH 2EO9A 1FE8L 2M1KA 4YIQA 1TETL 3QQ4A 2FHFA 3MX0A 3FT3B 2B1AH 5BJTB 4XP6H 1NGXB 3QNZA 2X4UB 3NZHH 3PL6A 1B0GB 3O9WB 4G7VH 3SDAA 1MQKH 5FV2A 3HLAA 5MERA 4X5LA 2EIEA 4PRIB 3A6CH 1MCNA 5TF0A 5IFAL 3OHXA 4BFBD 1Y0LB 2ERJB 3IJSB 5DYOA 5HDBE 5HBBA 3ARGA 2NXZB 4P5TA 4KVNL 2BHUA 3QNYB 2DTSA 3QDMD 4Y4FC 3WL9A 3TWCH 2QBWA 5F7DB 3BEVB 1T20A 1UQSB 1J0KA 1ZANH 2AAVA 2D7TH 1G1YA 5DA0B 4ELMF 4LRIA 1H0DA 4HT1H 2X41A 1QRNB 5L9DH 1AXSB 4NZTH 3SDCB 4TUOA 3DO7B 2DOCA 4X83A 1KTRL 3B9KA 5IT2H 3MUHL 4JB9L 1KCUL 1LDPL 3VWKC 4PJFE 3QDME 4U1GB 1F97A 4F2MA 4XBEL 1TQCC 3Q6GH 5CLTA 2AABL 4S11A 5FYKD 4HK3J 5HHOA 5IHUH 1U3HD 3P30L 3TIEA 4PJ7B 3EDJA 2VMFA 5C0BA 2KQNA 5GRZA 1QSFD 2J1KA 4PP2A 4Q74A 1MFDH 4JDVA 5I71B 1UYWH 4UU9A 5C07A 2GTZB 4JCMA 4Y16D 1CI5A 5IHBA 1LVEA 3SO3B 3LKSA 3WCYA 4FQ2L 1U42A 4CMHC 4FG6C 4AT6B 5GHWL 4JZNA 1WWBX 2BSTA 5D7LA 4TULH 2I9TA 4PR5A 3DYPA 4I1NB 3VXRD 5FUOL 1KGCD 2AK4D 3UTPD 5LXGL 3GIVB 3GSNB 4P3CL 5D7IB 1B9ZA 2C9AA 2DB8A 3BIBX 2NNAB 2NX5A 1WEJH 4OLUH 3U6RB 1QQDA 3BMVA 3L3GB 4O9HL 2D03L 1QSFE 1G84A 3AM8C 5J57B 4HKXB 1WIUA 1ZGLB 4QTIL 3W9DA 1TJHL 3NA9L 1B4RA 5DQ9B 1FQ9C 4XMKL 1SQ2N 5TDNB 3FO0H 3MRPA 3NA4A 3ESUF 1RZIA 4P2OD 3VXRE 1U41A 3ZZ1A 1KGCE 2AK4E 2JJTA 1FGNL 3UTPE 5HHVH 4PJXB 1H9VA 2ENYA 3PGCA 1NCBH 1SYVA 3L3JA 5IB3A 5TH2B 2GFBB 2ZPKH 5E8PB 4MNGA 3BD3A 5FOJA 3B83A 1MREL 1TNMA 1T80A 3P77B 4X5XB 3MLVH 1G7JA 1YEFH 4HFWA 3VFMA 1RJYA 1U8KB 1CGWA 1AGBB 2R2BA 4RZCA 3S37H 1NBYA 1WBYB 1AI1H 3T4AA 4IMLA 3RVXC 3X3FL 5D1ZB 5HPOA 4WI8A 5IW6A 3IDMB 1Q94A 1RULH 3C5JB 4CNIA 4BQ9A 4PUBH 3MLWL 5CCKL 3QRFM 1RVFL 3EO9L 1N0XH 4H88H 2Q86B 5C0RH 3K8LA 4IIQB 3BPNC 5F6IC 3OL2A 2Q6WB 2DM7A 2YUZA 1IGCH 1N5YH 3V6FA 4C56A 3GJEB 5H2BB 2IADA 2DLGA 5EBMA 4S1QH 4DGYH 2OJZH 4Y2OA 1IFHL 1RK1B 5T1MB 5CHNB 3MLRH 3VFPA 2KDGA 4RWYH 4ZQKA 4QRTB 3O9WC 4RRPG 2B1HL 2VDPH 3IAQA 3RUGA 1BQHG 5BS0D 4OD3H 4KI1A 1D6VH 3D48R 5JHDA 4U1SB 2A6DB 4CVXB 5SX5H 1RUPL 4KRPD 4YHOL 4XP5H 5TE7L 5DSCB 5GZOC 5BVJA 2ZSWA 5E94B 2JIXB 5ENWB 3CH1B 5IF0B 4WU7A 2ARJQ 2YA0A 4HWEH 2R0LH 3QG7L 4OZHF 1UM4H 4H1LA 2X1QA 3OKEA 5DUMH 5GPRA 4QXGH 3S88H 3MRJB 5D72H 5BS0E 1KPRA 4E9LA 3VFVB 3DVNA 4S2SA 3CSBA 5DJ2B 5B4MC 1CT8B 1YZZA 2OBGA 1HSBA 3CPLB 3Q5TA 4JZJB 4KK8D 2YWZA 4YQXL 2XA3A 2CUMA 2X05A 4U1GC 2PYEB 3L7EA 3G5XB 4Y19A 1V7MH 3P0YL 4QO1A 1NMCB 5JPMA 1KN2H 4XB8A 3KPSA 3QPXH 4NUGL 1E6JH 3RP1A 1I8IB 4JRYB 4HBQA 5DMIH 1NGZB 4LLUA 1JL8A 2A83B 5GRXG 1MFEL 5I71C 1NAKH 5L0QB 4LBEB 4X6DF 4ODXB 1GHFL 3JWOC 3B5GA 3SO3C 4OCRL 1P4BH 4TVPD 4GS7C 3RVTC 1MFNA 5LGHH 3LEYL 1EGJH 2XZCL 4JRXB 2VLRA 4P0DA 4N9OB 2RAMA 1EEZA 2HH0L 4PV8A 3S8WA 1IAIM 2BERA 4MMXC 4RNRB 4G6KH 3U30B 3MA7B 4PLOB 5EBLA 3OGCB 4MLIA 3LKOA 3MRQB 2YPVL 4L4VB 1BFOA 2ITDA 5DJZA 2IBGA 1QEWA 1HXYB 1LO5A 1EX0A 2C3WA 4TVPE 1KPUB 2VKXA 2I07A 4XNMB 1G9NC 4OCYH 2N1KA 4ZO8A 4C57C 1EK3A 3CMGA 1MAMH 2NW2B 2PW2A 2IALA 1T1YA 3MRKA 2WWMC 3IRZA 1RMFH 4JFZH 2ILLA 2FIRT 2VSCA 4I3GA 5D9SB 5SX4H 4F7PB 2EDFA 2QQNL 2DLIA 3VDAA 1CLOH 4FTVB 4HGKC 4LCYB 3LRHA 5HHXH 1WK0A 1MPAH 3SGJC 2BMKB 1ED3A 3AS2A 4LLWA 4UTBH 3GSUA 4WTZG 4XMLL 5DEFA 5DGQA 4ZUVA 3UTZB 3UO1L 4NNYB 1AR2A 2MJWA 4OLYL 5I6XB 2HWZH 3D18B 2UZIH 5EUOF 3HPJB 4PRHA 3QEUB 2ZUSA 5INDB 2UUDK 4CBPA 5M94B 4Z7OE 3NFNA 5FB8A 2EEBA 2V2TB 5F71A 4IRSD 2G75B 3ARFA 3EO1B 3HUJF 4U1LB 5EU3A 4IIQC 1F13A 4UV7H 4LQFL 1JZ3A 2XZZA 1FNEA 4KJWD 3MRDB 4WHDA 4IDJL 1WAAA 4PJIE 2UZXB 2W60B 4LLMB 5EO9A 4OGXH 5J11C 1OGTB 3HZMA 5BZWA 1J1OL 5E8EA 1PLGL 1I1YA 2NQCA 1AQKH 4L1HA 4JFFB 2GCYA 3JVGA 3ZDYE 3C2AL 1FZKA 1E4WH 1Q9WB 3UTSB 4ODHL 3GHEL 1GOFA 4OF6A 3ARBB 1VHPA 4B7LA 4JO4L 4LCWB 4LHJB 1VB9A 1I3GH 4B5EA 1CD0A 4ERSH 2GJ6B 1T66C 1QOKA 5FAAA 3MREA 1JPGB 4EUPA 2X70A 4YUEH 5GS1A 3I6KB 3HHRB 3UYRH 1AKJD 1D5IH 3D0LA 1IBGH 1AGEA 5I1KH 3FO1A 4I0KA 4Y88A 2QKIB 2YRZA 3DRTA 3NACH 2QTEA 1M7DA 2WANA 2X9XA 1YY8B 1U8JB 1F2QA 5DR5L 4F7CB 5C0JA 3HZKB 3FO9B 4WW2A 4P2RB 1EXUA 1RSFA 4HUWB 1IGMH 1A6ZB 3CZFB 3TVMD 5HDQH 1NAMB 4BSWA 1U8IA 1GGIL 1XGRA 4JREC 3RZCB 2HVKB 5AAWA 1NUFA 4EVNA 3GRWL 1E27A 1HDMB 3BXNB 4FFYL 3FZUD 2VITB 3LPFA 4RAUB 1KIPB 2EDQA 4RGND 4PGEA 2GT9A 4MD0A 3ZE1E 3NIDF 5GIRA 5L0QC 2V5YA 3MLXL 4OD1L 1EERB 4QXUL 4XC3H 5KBNC 2A74B 1IGFL 1U8LA 4GXVH 1VKXB 2A6KA 3VE0B 3KYNB 1JNHA 3MNWB 4QRQA 4CMMB 4OZGE 4WJ5A 1JF1A 4L1DA 5DHXB 4WU5B 3FFDB 5EZLA 1NGQL 4DEPB 4GAFB 3INUL 1AGCA 3MJ7B 4PJ7F 3MROA 1H5BB 3DHMA 2FNBA 1NUDA 2DMBA 3U30C 4JPIA 4RGNE 3RNKA 2GI7A 4BZ1L 1BQHB 4DAGH 5D1XB 3QFDB 4HS3A 4G8EA 1U92B 3AU1A 2GW5A 3FFCB 3KJ6H 5CJOH 4R96B 4S1DD 4X7TA 3TBVA 5MP6H 4YLQT 4HLJA 4OD2A 4R8WH 1T83A 4P23A 2AJZB 5TDPB 5D7IF 5H94A 3RWJA 4DKEL 3PL6C 3QIWD 1XF4B 2I9LB 1Q9OA 2CLRA 3U2SB 3EYFA 4ZPTA 1JZ2A 1MFAL 4FMKA 5J13C 2MWCA 3QO0B 2DMKA 4MVBC 1IM9D 3DRQB 4X4MA 5KVFH 4IRZH 4YDIH 2AJ3B 1XR8A 5C7XH 5I6XC 4GKSA 3G6DL 1RJZB 4HH9A 4NN6B 4R26H 4YK4B 5DUBA 5GS2D 3CK0L 3TH2T 4ELMA 1SJXA 2VH5L 5E2TL 3CFIC 1IEBB 5E95B 4FP8H 1U91A 1YMMD 5F6HI 2IG2L 4P4KA 3TBYB 1ZSDB 4O2FA 5F89B 3TCLA 4LP5A 1KXTB 4QTHA 1A14L 2DTMH 4JGJA 4POYA 1FZJB 3TN0B 4M00A 4MCYA 2R29L 4FQLH 2ICWA 3F6LA 4X6FB 3FTGB 1MJJA 1QSEB 5K59E 4HJJL 4JFQB 1RUAL 5GGRB 5HHNB 3D6GA 4KY1L 4LSPL 1OARL 3QIUD 4ALAL 1V3MA 3F6IA 3BGMA 4FQIH 5GZNC 1YMME 3V0AC 1AR1D 1CXFA 1XMWA 3W9EA 3OG4B 1GZQA 1DL7H 1FCGA 2BVYA 3RGHA 5HI4D 1I3UA 4IMKC 2F54B 4ZFOL 4D2NA 4M8VA 3BPCB 4R90H 2DWEB 3DXAD 3EYUL 4NKIH 1FLTX 1GGYA 5EU6D 4ZFZA 2IMNA 1OWWA 2R39A 5J6GB 1DBJL 2VLLB 1T5WA 3CX5K 4LPYA 1TIUA 4NN7B 4A6YA 1JGDB 3D69B 1L0YA 5CIPH 5E9DD 3OKYA 1SJHA 3BH8B 3RWDA 3UAJC 2PXYD 4YHNA 4O2EB 1BZ9B 2BSRA 3F7YA 2IF7A 3UEZA 4JO2L 3DLQR 3P4OB 2RJMA 3BP7B 1DLFL 3FCTB 3DXAE 3L3OB 5EU6E 2IQAA 4DCQA 1BFVH 3KAAA 3MLYH 1OAXH 2VOTA 3RZCC 3VFRB 4WRLA 1K2DB 2BVQA 4DUWA 2CIKA 4X5WB 2DYPB 5JLZB 4ZOEA 5E9DE 1NFIB 1N2RB 4KTDH 4AZ8A 3PWUB 2IQ9H 4LDOB 1L4IA 4U1JA 4V2CB 1N3NB 4OKVB 2EDHA 5EFIB 4F80A 3VI4E 4KQ4H 2IPKA 1U3JA 4LMQI 2H6PA 1IAII 1MVUA 4UOW1 5CKAA 1YEJH 2BVTA 5D2LB 3GMNA 5I73B 5EA0H 4DEPC 3MYJB 2NY1B 3BFOA 4OZ4A 1H5BC 5FYJL 4PJAB 1BF2A 2EE6A 3HCVA 4Z5RB 4ODBD 3WD5H 1S3KH 4M8QB 3TO2A 3S35X 4DN4L 2XN9D 4UNVA 2Y25A 5D1XC 2HT2D 2P42B 3ULUC 5C0CA 5HSFA 2C5DC 4GAJL 5IBTL 3I02A 1AC0A 4LASH 3LSOB 1JI2A 3GJFB 1XCQA 5EN2B 2J8UB 4HUNB 3K1DA 3LD8B 1J0ZA 1S7TB 3O3DB 4HCRA 1YYML 3HNVH 5J1AB 5K9KB 1CD1A 4ZUWA 3V0VB 4I18C 4N8CH 3TZVD 1BX2A 1I9JL 1TJIH 1T03L 3UP1A 2C7UB 1FL5B 2XN9E 4KK5C 1BQUA 5J06A 3MCG1 2ARJA 3P9MA 2BDNL 4O51B 3HFMH 5ID0A 1KIQA 3WEXB 1PX3A 4G9DA 3TYFA 4GRLA 4HIEB 5SWQA 1LEGA 5C9JA 4YK4C 2FX7L 4P59H 2V2WB 5KN5B 5GSRB 3UBXG 4KUCD 3TV3L 4G6FB 1SHMA 1ZA3B 4IRJD 3UJTH 4OQTA 1CFNB 1B88A 4ZS6D 4LHQB 3IVKA 2EYTB 3CXHJ 3KDMB 3MRMB 1EHNA 5JHLL 3QXDA 1UEMA 2WP3O 4Y2DB 5I1JL 4V1DA 2IAMD 1F90H 1LEKA 2HTKD 4NWUL 5J6HA 5IHLB 3P4LA 4X6BA 3TA3D 4D0DA 4M61A 3QEQD 4NO0B 1D3CA 2C4XA 1EIBA 1KFAH 3LQZA 4ODVH 5I1HL 3TF7C 4KKAC 5C0FA 4LPWA 5E7FA 2BOCA 1CQKA 1X5JA 4RMQA 1AGDA 5I8OL 1T2QL 1OTSD 4JFEA 3WXWH 4AEIH 2OI9B 2V7NB 3MRIA 2J88L 1FDLL 4NBXB 1G1CA 3DBXA 3EOBB 1BOGA 4LOUC 1YEHL 1MHEA 1ADQH 3QEQE 5LWYL 2BOBB 4NN7C 3ROLB 4NCDA 3IS0X 5EZJA 3NCBB 2V7HA 4LPXA 2VZSA 3LHPH 2GHWB 4QXTB 4ELKA 2LU3A 4FFZH 2FWOB 5EPMB 3MLZL 5FM4A 4RA3A 3W39B 4UQ2A 4OLWL 5L7XL 3QISA 4PJEF 5FYJU 2OXGA 1JGUH 1A0QH 2R0WH 2DQGL 3V6OE 1FIEA 4HLZH 4JM2B 3RKDC 2VISA 4UNUA 3NCYP 4G42B 4XP4H 4NN5C 4P9ML 3IRPX 2QADD 1WWWX 2EDEA 3AAZB 3ET9F 4JZOA 4KKNA 3QULA 3GSQB 5ISZD 3RIFK 4G9FB 4PJ8D 4I0PB 1N59A 3OR7A 4G80A 3HE7D 1P84K 4GG8B 2JJSA 5T5FL 1AHWA 2Y9RT 5BVPH 3C8HA 3ECBB 4QHMB 3WDIA 3QDGB 3DUSA 3PHQB 1VERA 2NY1C 3WMSA 4M6ML 1L0XA 5A40E 3LH2L 1XF2A 3B5HA 5DK3A 2OTWA 4LVOB 4LSRH 4HUKB 1SM3L 1RU9H 4OBRA 4Z7VE 3HUJA 3RY6C 5CBAA 1XGYH 1FG2B 1X5AA 4PRBB 3VGBA 5ISZE 4QNPF 4UQ3A 5B39B 5IK3A 5CUSH 1IEAB 1JHKH 5D2NE 3KS0J 4CADA 1J0YA 1CLZH 4MMZC 4LVHC 4PYHA 1GGCH 5C3TA 4XZUA 1F6AA 3BWAA 3OTTA 1HE7A 1FCCA 1M4KA 4E5XB 2R0KL 3SE8L 3WSQH 3IFNL 4LSQL 4LFHD 7CGTA 4YE4H 5HVFB 1BLNB 1F8TL 4D9RD 2BCKB 2JELL 5DRNB 2ZOKA 5JDJA 2XWBB 5F1IA 3CFJA 3O4LA 1TZIB 3EBAA 1A7OH 1XGPB 2DLEA 3MGTB 5ITBL 2FL5A 2EE2A 1DJSA 1FV1A 5KZCD 1QNZH 4JQIL 1UM5L 3RX5A 4N1HB 1DBBL 1NCWL 1B0GA 2VDQH 1T04A 2WUCH 4OF8A 1R24A 4WW1B 4D9RE 4OCXH 5F3BA 5GGSY 3HI6L 1G0DA 4I48A 4Q2ZA 2X4TB 3DMMB 2HKFL 3QUMH 1DQJA 3PP3K 1MWAH 4GUPB 4M6NL 4F33B 4XAWL 1Y0LA 2Z8SA 1ONQA 3R8QA 1GC1L 3HMXA 5TQ2H 4NPYA 3QNYA 1OF2B 3ZT5A 4Y2DC 2Q76A 4NQED 3SE3A 3BEVA 1UQSA 5E2JA 5I75B 5JQHC 1P1ZB 5E00A 2DQDH 2XG4A 3O3AA 1MRDH 3MLSL 3ZKMD 1EFQA 2IEPA 4K71B 3SDCA 4WEUD 1KC5H 4MD5A 2EKJA 4PJFB 1RZKL 1OW0A 4Z76B 5MEND 4JGUA 2V17H 1V3JA 3ARRA 4NQEE 4DN3H 2F9BT 3N85H 2E7HA 5F9OH 3VJ6A 4NRXB 1EHXA 4LEXH 4QHLA 5JUEL 1D5XA 2OTUB 1FFOA 2AJVH 4ZXBB 3RA7H 3CVHB 1U6AL 4HH8A 3WXVL 3TO4D 5DD6B 5DMGC 5D7JC 1UACL 3EKCA 5LGJA 3VXSB 1A6VL 4ZYKA 4NNXA 3VFTA 5MENE 4WI4A 3BKYL 3W11C 5E2UH 4HMEA 1OHQA 1C08B 4TQEL 4P23C 4U6TA 4NQSA 5JORB 5C09B 1D9KD 4JM2C 4JHAL 1BEYH 1V7NL 4MNQA 2YPKB 1QSFB 5FIEA 5HYSG 4FXGB 4U6VH 3UBXB 4OJFH 4I4WA 4QY8A 4Y16B 3PWNA 4O02H 4I0CC 5KVDL 5I76B 4X98A 3RIAK 2A73B 2YMXL 5IVXE 3JWOH 4BA8A 1F58L 4PJ5B 2EXYC 1AKJA 35C8H 4GRMB 3O8XB 5BW7C 1IQDB 1VESA 3ZHDA 4AEHL 5AUMB 5J7CC 3NTCH 3KPNB 4MX7A 3SDDB 2NY7L 2GJZB 3GSNH 2XFXA 3QEGH 4ODSL 3EYVA 4K3JH 3STLA 4DK3A 7FABL 4Z7QF 2C26A 2F74A 2AV7A 1AJ7L 4XXDB 5FO8A 2VSDA 4TPRL 3SQOH 1RIHH 3GFUA 5ESAB 3F5WA 4X5XA 4NYLB 4P2OB 3ULVC 4OI8A 3U7WH 1YC8A 3DX6A 3PABA 4LLDA 2J5LB 3SOBH 3DX8A 1V8HA 4MXVF 5EOCL 1KIUA 2LQRA 1G9NH 3U0PA 5LCVL 3JUZA 5EU4B 3IDMA 5D1QA 3S96A 2Z9TA 4QOKE 4PJAF 1QLEH 4MWFB 5EWIH 4GMTL 3RU8H 2PYFA 2E9IA 3UJIL 4JHWH 4XHQA 2Q86A 1NEUA 3QDJD 1LD9B 3AXLA 2NYYC 1NLBL 1U8OA 3JXAA 3VG9C 5FO9B 1OPGL 3L7FA 2FYYB 5E70A 3C5SA 4QF1B 5I16A 5DHYA 4HC1A 4ZTPL 1WICA 4U33A 1E28A 3ALWA 43C9B 4JDZB 3RWCA 4L8SB 4G7YL 4NOFA 1Q72H 1J0IA 4KDVA 2YWYA 5CWSA 1CBVL 4RAVA 4PGDB 3M17B 4Y89A 3BZ4A 3QDJE 3DMMC 1RFDH 1WWCA 2DQIH 2ICCA 2X4RB 3K74B 4NKOB 3K81A 4PRPA 1JVKA 2GQHA 4MAUH 1JHLH 4JHBA 5D8JH 2VE6A 3EOYG 5IESH 3GGWB 1KT2B 2UWEE 5DURD 5IMKB 1JHTB 1WC7B 3LEXB 5EIVA 3OKOA 3UPRA 1YNKH 5BS0B 3VXNA 3NVQA 1GL4B 1WZLA 1FO0B 3MRJA 4K71C 4TSAL 4GG6E 4HDIA 4JPKL 5DRXA 5I1LA 3GMLA 3I85A 3NOIA 5DJ2A 3N9GL 5EOTB 3CPLA 3OV6A 3I6GA 4JZJA 3I50L 1BGXH 3TPKA 1S9YB 5EC1A 5E5UB 5EC2B 4AIZB 5E6ID 4LIQH 3PXJA 4YHMH 3NCEB 1O0VA 2FD6L 4OLXH 3P9LB 2V2XA 4WIQA 2BJMH 3CDGB 5A2KH 5LBSH 3F12B 4KZDH 3TJHD 4POZD 2UV3A 3V7MA 1MFBH 1IZKA 3QHFH 2HG5A 4Q6IB 5H35A 1HILB 1IT9H 5AZEH 1HQ4A 25C8L 1Y6MR 2A83A 2LVEA 1R6VA 1MRFL 1N7ML 2NCMA 3QA3B 3QUZA 4LBEA 5MI0B 1HHHA 5FYLD 5HVHB 3ZL4H 3FQNB 2AJSL 1OB1B 1U93B 2N7AA 2W65A 1NDMB 2PO6B 2XZAL 1U3HC 1YNLH 4P5KA 1EBPA 1SJVA 4PLNC 3TT1H 5JOEA 1U36A 5EORL 3MFFB 5FUCE 1A6UL 4Y16C 5L8KB 1ACZA 1FORH 3MCLH 2D7OA 4ONFH 1CTNA 1FHGA 5FYLE 4HUXA 2Y23A 1JYXA 3AREA 1GPOL 4WWKD 4FA8A 3LOWA 3KHOA 4GRLC 4OFDA 3RI5K 2WBJB 2ATKB 1CTOA 4YR6B 3ZKXC 1VGKA 3QI9A 1A6AA 1EBAA 4M5YL 3SCMD 2PXYA 2R4SL 2H3NB 4XPBL 4OB5L 3QEHA 4GKNB 2XPGB 4OLVH 4S0TD 3O3EB 4ZTOL 4F7PA 1QPXA 1CLYH 1OLLA 3X3GL 4QKXB 4P2OC 3DHJA 4LLAA 1G7PA 2J5LC 4AY0A 3DETD 3QCVH 5KSBE 4NWTL 4PJ9D 1R5IB 3D18A 4JJ5B 1NCCL 2AVGA 5I2IA 2P7TB 2VUYA 2O5XL 2DQCL 4HK0B 3RX7A 2DQJL 3MJ8A 3GMOB 1JWUA 2Q7YB 2ICES 1AE6L 3EO1A 4RWHA 3VRIB 2PTUA 1SY6A 4LLYB 1YECL 4U1NB 2EDBA 3OKNB 3C60D 1DEDA 3ROOB 5MEQB 5I8KL 4HEPG 3JV4A 2WLZA 2J2ZA 5DMYA 3NN8A 4H25A 1IL1B 4L8SC 2DM3A 4F3FA 3SKOA 4NC1E 3T2QA 2CRZA 3EFDL 4M48H 5CZKA 2XN9A 3LZFL 1DBAH 5HYSB 3ARBA 1A9BA 1MH5B 2JCCE 4GLRI 2J7LA 3R0MA 2HFTA 1I7RB 4IOIB 4ZSOB 4FXKB 3ARSA 2X7LB 3NZHL 3O2WH 4PJEA 4G7VL 1NMBH 2CDEB 1MQKL 3Q48A 4N8VG 1UKQA 1AY1L 3A6CL 4RBPH 5DVNA 5C6WH 1A64A 4LVNC 5K9JH 5IEKB 4HIHB 4AEEA 2H26A 5GGTH 4QHNA 4KRPC 3NIFE 3TWCL 1UJTA 3QFJD 1ZANL 2D7TL 3U0TA 5GXBB 3LB6D 2D9QB 3DX7B 3MRRB 4KHTH 3CZFA 1AHWC 1EO5A 4LLQB 5L9DL 1K9TA 4NZTL 4UT7H 3V9FA 2VXUH 5A3IC 2HVKA 4MHHG 2FECL 3LCYA 1J0HA 5AG9A 1HDMA 4IRJA 1CL7H 4Q6IC 5IT2L 3L95B 3PUCA 1S7UA 2G9HB 1MCQA 4KK8C 4HQQH 3KPTA 3QFJE 4OZIE 3TVMB 2ZUWA 3Q6GL 3BZDA 3C5ZD 1BVKA 4OZGB 4Z0BH 5IHUL 5FECB 1AIFB 5KS9B 5TGBB 4TSBH 4BQ8A 1L9MA 4G6AD 1YEEL 2IAMA 5IIEB 2RCSH 5FA4B 4HKZB 1NAMH 4XC1L 1PZ5B 2MPAH 3TA3A 3UDWA 1MFDL 4ODWB 1IGJB 2R4RL 1XEDA 1UYWL 2B2XH 3RBGA 3O4OB 3R06B 4RGNB 4TNVK 4HZLB 5CD3A 3BP6A 1JGLH 3CFDB 4OI7A 1BQHA 4TULL 4L4TD 2ZUQB 1U92A 3LV3B 4R4BA 1ZMYA 3MACH 1I85C 1KPVB 3BDYL 4KK6D 1T1WA 3OF6D 1WEJL 1WGOA 3V6OA 1T0PB 2VLMD 5I66A 5L2KD 1BIIA 3OKMA 1J7VR 4LLVB 4UZGA 4MSWA 5T3XL 4U1MA 3RWEA 1OTUD 1QBAA 4APQA 3FO0L 3QAZB 4YBLB 1KEGL 2O5ZH 4L4TE 5I15L 3ULUH 5I19L 5HHVL 3U7YL 2JB6B 1CE6A 4X99A 1NCBL 3LAFA 3RNQB 2E6JA 2VLME 2ZPKL 4XGZB 5I1GH 5L2KE 3LQAC 3GI8H 3E6FB 5JXED 2RHEA 3U36A 2F5BH 2WIIB 5T5NG 4RDQG 3MLVL 1MAKA 1YEFL 5E99H 2ADJA 3OWEA 3OSKA 1EAPB 3C6SB 3KXFD 4NO5A 5GGUB 4XPHH 1IM9B 1AI1L 2DKUA 4PJ8A 3T0ED 2OP4H 5I18H 2CLVB 5F1SA 4LDLB 3ZTJH 1RULL 2QQKH 1L0QA 3BHBB 4PUBL 3RY4A 4P57B 3FRUA 1QSEA 3X13B 4EIZC 3BAEL 1T3FA 1UZ8A 1KLUA 1F45A 4H88L 3BIKB 5E2WH 5GGRA 5C0RL 1MCHA 4IRSC 1YMMB 5CGMA 4NFCA 1E6OH 4IJ3C 5HHQB 1IGCL 3KXFE 1N5YL 2CKBA 1I9RH 4QRRB 5FM8A 4KJWC 3T0EE 4S1QL 4OM1H 4DGYL 1UH3A 2OJZL 4X6EA 3ZE2E 3X14A 2HKHL 1DVFD 4XVTH 3MLRL 4EDWL 5DJYB 4YGVB 5ETUA 3QWRD 2VRAA 4RWYL 2N56A 2D3VA 5TDOB 3STBA 3QIUB 5HGGS 3GO1H 2E9JA 3CGTA 5FCUH 5FA3A 1X4YA 1D6VL 3GEWB 4X7FC 1TCRA 1MFCH 4XP5L 2AGJH 4YPGA 4XCNB 2P8MB 1FRGL 2WQ8A 3BH8A 3OAUH 3SBWA 5IEHA 5B3JF 5ESQB 1K3IA 2BVPA 5JA8B 3L9RB 1TQBB 2R0LL 1Q9KA 4QYOA 3WJJA 3UC0H 1U8QA 1J8HD 2X4OA 3DXAB 5DUML 4C83B 4MAYD 1SYSB 5JPNB 2JF1A 3QJHB 1YQVL 1T1XB 4QXGL 4WTZA 3CLEH 4WY7H 3S88L 4LFHG 5D72L 3DVGB 4MDJA 1OD9A 3VFRA 5JQ6L 1DQQB 3PDOA 2VZVA 4WGWB 5E9DB 1MLBA 2FRGP 4X5WA 1YYLH 1CICD 1N2RA 3FB5A 4MB3A 5HDLA 4JFYA 2DICA 5AD0B 3QJFA 3TVMC 3JWNC 1J8HE 4DZBB 2F8XC 4PY8I 1Z0NA 2YD1A 3BJ91 1RZ7H 1BVZA 4Q0XH 3QSKB 3QPXL 4RFEB 1E6JL 1F4AA 1PBYA 1ZA6B 2D31B 5BXFA 5DMIL 5D96B 4U49A 2A6JB 2WUBH 3FZUC 3CFBB 1NAKL 1MCPH 4GKZA 3CMOH 2YD5A 4RGNC 4XCFL 2HA1A 5IGXL 3TBSB 1V3KA 4BZ2H 1P4BL 1X44A 3G6AB 3HI1B 4HIIB 5MENA 4QRUA 5K33A 1EGJL 3BN9D 3DSNA 3LRSB 4HGWB 4QHKJ 3T1FA 4RGOL 3MRCA 4XNXL 5FO7B 5EUKA 3GJFA 4ZODA 4WFED 3P0GB 4G6KL 4YGAB 3BZEA 3SE4A 5J1AA 4N5UA 1INEH 1YEGL 4BFIA 5DJCB 4UDUB 1RD6A 4HWZB 4CW1A 4EXPX 2IBZX 4MJ5A 4IHOA 1YPZF 1U8HA 1S5IL 1RUQH 2APWA 3QAZC 3DGCR 4FQXA 4NKDB 5IVXA 4XNZC 4S1DC 1KJ2B 5LJYH 1MAML 3SKJH 3MV9B 4WFEE 4HS6A 3WEXA 1RMFL 4HIEA 2P24B 3QIWC 5F7EL 1KB5B 1W2KT 3TZVB 2IGFH 3QUYB 1XF1A 3F62A 3MRBA 5KN5A 1CLOL 2XI9A 3RL2B 1FVEB 3BDBA 3MR9B 3PQYD 5AZ2H 5HHXL 5JW3L 1HHGA 1MPAL 2X6MA 3P40A 1CFNA 4PJDB 3GZKA 1EO8H 4DOHE 3VD9A 1R3IH 3JZ7A 3QHTC 2UZIL 1R3JA 3MRMA 4UIMA 4M9PA 1YQ2A 1A3RH 4G3YH 4QOKA 1IC7H 4LCIH 3H7LA 4K7PX 1AH1A 1KB9J 5A2FA 3PQYE 3I6LD 2EDKA 3OAZH 2F58L 1QR1B 4YO0B 4BELD 3PP4H 3HR5B 4OGXL 1T22B 3JV6A 4LSVH 3LN4A 4LKXA 1AQKL 2WK2A 3DNKA 3MRFA 3MRHA 1WVZA 3TBTA 1E4WL 3QEQB 4NHUA 3ALPA 3MC0A 3MV7B 2QQQA 3QIUC 1BP3B 5CP3A 1I3GL 4ERSL 1AR1C 3BW9A 4E41B 2BOBA 5DFVC 3I6LE 3ARZA 1I3RA 4X7DC 3FQUA 3QDJA 5HI4C 1CDCA 1QBMH 5TPWL 4LRNL 1CWVA 1FNGB 2APTA 1SVZA 3UYRL 1JF5A 5JTWA 1D5IL 2XZQH 1IBGL 1TQBC 5I1KL 4PRDA 3BP4B 2ID5A 3DURA 3DSFH 1UJ3B 2X4PB 4MJIA 1DANT 1K85A 1INDL 4YHLH 2BNRB 2MSPA 2Q1EA 1JWSA 4QEGA 5IMMB 1KEMH 5KVGH 4G42A 5GISH 5MEPB 4KI5F 2PXYC 2FSEA 3QDAA 5LAXA 3AAZA 1IGML 3RGVB 5HDQL 1MY7A 2YC1B 3BT2H 2BY0A 3WHE1 5EULV 4I0PA 5DXWA 3D0VB 1KOAA 3ZMRA 1IQWL 3WHXB 3ECBA 1TENA 3BE1H 2HLFD 3EOTL 1LK2B 4Z7VB 1FZOA 1GXEA 3MLUH 1QPPA 1ZWIB 5ERWA 1BJMA 5ISZB 2CDFA 2ESVD 3O41B 4M6OH 3T2NH 4S0SD 3FQRA 3MOBL 2BSED 2BNQA 3O6LL 3DV4A 3HE7B 1NUNB 5D2NB 4OZGF 3DECA 5DHVA 5JIKA 5KS9F 4HBCH 5TE6H 3QUKA 4J8RB 3KPLA 5D6DC 3JTSA 3M8OH 3OKLA 4JJHA 4I2XE 1X5FA 3UX9B 2XQYG 1AO7D 4DAGL 1LK3L 1HWHB 2HT2C 3KJ6L 2CUIA 2NY4B 5CJOL 2ESVE 4TUKL 1INQB 2DL9A 3QG6A 4JY5H 1NUGA 5MP6L 5T3ZL 3K2MC 1CU4L 4R8WL 1OAQH 3MUGA 5FYJD 3MBXL 4JFDE 1TZIA 4RX4D 3ULVH 5SWZD 4YPJA 4P9HC 1LE5A 2AEQL 5E8OA 2XKSA 4PGZA 4RMUA 2UVFA 1GH7A 3R8BB 3TZVC 1AO7E 4ZMAT 2Q8AH 3VCLA 3FHQA 1K8IB 1SBBA 5F7WC 2AV1B 2BY3A 3RTQA 1VADA 4XCYA 4OFIA 1JPTH 4F7TB 1VCAA 2ZOLB 3PWLB 2Y7QA 2OQJB 3TCXA 4YDIL 1G7QA 4WWKA 4OZFB 5FYJE 4PJBF 4GUPA 4JFOB 2DLHA 5C7XL 5C0EB 3OB0H 5SWZE 5HI5C 3HMWH 2CPCA 5E8NB 3T3MF 1CXEA 5KZCB 3LEVL 1KENH 2HFEB 4G5ZH 3IDXH 1OQXA 3AUVA 1CN4A 4M43H 4IM8A 5FEBA 4IRJC 3CX2A 1P7QA 2BSSA 2LTQC 2DTML 1A1OB 1DSFH 4ZS6C 2YUVA 2DQHH 1OM3L 3MYZA 1J8KA 3VXUD 4Z76A 2IAMC 2UVEA 2HTKC 2D7QA 4PJ9A 4H20H 2W1NA 3TA3C 5EO1A 4FQIL 3RDTA 3KYMB 5B8CA 2E6QA 1DL7L 3BYTA 3CX5J 4R3SB 1YEIH 4ZXBA 2AXFA 4F8QA 3Q1SH 3N1PC 5DD6A 4EOWH 3QWOA 3I84A 3VXSA 3V6ZB 2VXVH 4NKIL 1OTSC 3VXUE 3S5LA 2DWDB 3C60A 5ITFA 1MCRA 3G6JF 5FM5M 3V6OC 5GRYA 1QO3B 2R1WA 2CRYA 1NPUA 1RUKL 3CIQA 4MLSA 5JORA 1F11B 2FATH 1ORSA 3TO4B 5FXCH 4X4ZA 3V5KA 3X17A 3WHE0 3QXAA 3REVB 3WN5C 1ZK9A 2KQMA 3CVHH 3WFCH 3T0DA 1FVDA 1CQYA 3HAEB 3IDUA 5F21B 2YBRB 1FVCB 1P9MC 1HSAA 2F19H 1BFVL 3BGFC 1HZHL 3L3DB 5I30L 3KG5A 5DD3H 4PJ5A 4Y4KA 1HI6A 3GSXA 4JO1H 4G8FB 4GRMA 1D9KB 4N1CA 5FYKH 1TVDA 4A6YL 3QB7C 4PTTB 3RHWK 4KTDL 1C12B 2JE8A 2QADC 1PGRB 1CE1H 2IQ9L 4WDIA 1XGTB 3AB0C 5EU7E 4WEBH 1C7SA 1KELL 4PV9A 1A7BA 3QFJA 4NP4H 4PJ8C 4XCCH 3RL1B 5D2NC 2AJYH 3KYOA 2MHAA 5C08A 5EA0L 4XX1G 4M7ZB 5GRVL 1OTTD 3QHZL 3VI3F 1NGWA 4P3DA 3WD5L 4K23L 3GI9L 5EDXA 3QIBA 3C8DA 4PB9H 3RWGB 4MWFA 5INCA 3CU7A 4X80H 4LASL 2DJUA 3DO3A 1LD9A 1P69B 1FLRL 2XKNB 3PWVA 5F9DC 3HNVL 4WHYH 1ACYH 3B6SA 3NPZB 1QZ1A 3IDIA 5IHZA 1TJIL 2VZTA 4HXAH 3UROR 2XTLA 4X4YA 2WAHA 4NRYA 3MGOB 3HFML 2AJXH 4P4RA 3WFEH 4L4TA 1FFPA 1R5VA 1LEIB 3WJJC 4GRWE 3FO2A 2VXTH 3H9SA 4YAQB 3A6BH 5EZOH 1RV6X 2UWEB 4YNYB 4W6YB 5F1OB 8FABA 3UJTL 3UTTD 1KACB 4F7MB 4R9HA 2AKRB 3IDNB 2NXYC 1TFHA 1YEKH 3MODL 4HIJB 4GG6B 4KAQH 4UV4H 3D3VA 2DI7A 2E3VA 1Y6KR 5C0AD 3PNWA 4J3VA 4PJDF 1OY3B 1CGXA 5BRZD 1CFQB 1B0RA 3SJVB 1G7IA 1FYTB 5C0DA 4AG4H 4UIKL 1ZS8B 4JO3H 2P5ED 4HHAB 1CVRA 2LAGB 1J5OH 1KFAL 4FQPA 1CD8A 2VAJA 3UTTE 5ADPH 4ODVL 3L6FB 2M2DA 3ZKMC 5BV7L 1R5WA 1HILA 4MDIB 5C0AE 3IDYB 5CD5D 1LGVA 2Q8BH 3V5HB 2P8PB 4AEIL 3EZJB 5BRZE 2HT4C 5E6IB 2GSIB 2MCPH 3V4PH 1ADQL 3T4YB 1T21B 1OB1A 2DS4A 2P5EE 2Z93A 3C8KB 1ZEAL 4QT5B 2ADFH 1QFHA 2CH8A 5HGBB 2C3HA 3VRJB 5KSAA 5DJAA 3RWFA 3SE4C 2BC4B 1MIMH 1KCVH 3K7UA 3ILPA 3LHPL 4YWGH 2APXA 3PWPA 4FFZL 1YPZA 1M7XA 5IFHH 3D39A 3W0WD 1UCTA 2DD8H 1KBGH 1JGUL 4OBSA 2R0WL 2P43B 4N0UE 4DFHA 4KJQD 2VLJD 4PG9A 1H8SA 1KXVC 5IB5B 4IEFB 1D9KC 5DJ0A 3VWJD 1IM3B 1ZHBA 3S6CA 3O3BB 3LDBB 4YR6A 4AEFA 4QLRA 5CEZD 1EUTA 5DJDA 5T5NF 4RDQF 3AS1A 3BH9B 3W0WE 2L0DA 4GAYB 4GBXD 5D70H 5F1KC 1J8HA 5BVPL 2VLJE 4TVPH 4WNQB 1MHCB 5KAQG 1TVBA 4N68A 1MHHB 1RU9L 4JJ5A 3QCTH 3WV0A 1SEQH 3SCMB 4F57H 2P7TA 5CEZE 1XGYL 1I1AD 4WO4D 1CICA 2DI9A 2QSQA 4JANB 4QCIB 4X0KA 1IGYA 4PREB 1MQ8A 2HAZA 4AENB 3L5WB 4NHCL 3U83A 3HS0A 3RPKA 3SGEI 4OLEA 4HKBB 1MOEA 3T2OA 4BK4A 2PR4H 3X12B 1YA5A 3D25B 3VXPB 5K9OA 1OT1A 3GMMA 3WSQL 5CZXD 3STZA 1CDUA 4W6XB 5IOPA 3LQAH 5ANMA 4B7IA 1Q0XH 1IL1A 4LSUH 5E5RB 3BP5B 1T4KA 2IC2A 2JCCB 3CFKA 4IBLT 1A21A 3WIHA 2YPLA 2J8HA 3JV0A 2EH7L 2ICEB 1CDJA 1I7RA 2P8LB 1CR9H 3BZFA 4ZSOA 2ZG3A 2FJFB 1QNZL 4KXZI 4MJ6A 3FQTB 4JQXA 1B4JL 5MHSD 2WUCL 3PV6A 4XP1H 5M7QA 4I13B 4UINL 2XTJD 4MQXD 3KPRA 4LMQE 1NQBA 3QUML 1MWAL 2R2HA 1IKNC 1RZ8A 1CG9B 5IROC 5TQ2L 4WHCA 3LKRB 5C0IB 3MV8D 2YSSA 1UA6H 4M62H 2C3VA 4FQCL 2ED8A 4OGYH 3T09A 2FIKA 4ISVA 4PFEA 1C5DA 4OIIH 2VLKA 1G9EA 1OWRM 3VH8A 1XF3A 2DQDL 3MRRA 1M7IB 1MRDL 4EBQH 5MHSE 4NM4H 1NBVL 4AM0A 5JNYB 3VFNB 1MNUH 5ALCH 2XTJE 4O58H 3RVTD 2XKUA 1M6OB 2OR8A 5E56A 4Z18A 4OCSH 3PQYA 1TZGL 3MRGB 2AK1L 3MV8E 1T5XA 4W70A 3O6FD 2ZSVA 3IDYC 4OZIB 1NSNH 4IS6B 4OM0L 3HC0B 4QRSA 1DBML 3MXWH 3N85L 4L29A 5E6IC 3U4AA 1P2CA 5F9OL 1ND0B 3ZO0A 1MJ8H 4LEXL 1EAJA 2EECA 2AJVL 2CUHA 3RA7L 4POZC 4RFNB 1PZ5A 1JWMA 2AJUH 3V8CA 5FUCC 1TTFA 3ES6A 1TLKA 4WCYH 2BVEA 1ZLWH 5DRZA 4LSSH 5SWSD 5F7HA 5DJXA 4J3SA 4ODUB 5KSVB 5E2UL 3H9HA 5E6ZA 3C5ZB 3EYSL 2ZUUA 1PZUB 2ADGB 3ESVF 3L5XH 4BH8B 1K5NA 2AEWA 1BEYL 1VEOA 4Y5YB 3VFOA 2EYRA 3HRZB 4U6VL 4OJFL 3KJ4B 1N26A 4O02L 4F15B 2YA2A 2I25N 3T65A 4U1HB 2VO5A 5SWSE 3ZDXF 2IH3B 2FGWH 1VSCA 3JSSA 4WWKC 3B9VA 1N4XH 4YFLF 5GGRY 4UBDD 4M7KL 4HJ0D 4PJBA 4UNTA 1BBJA 3NTCL 4GO6B 2X1PA 5L2JA 3GSNL 2OCFD 1C16A 3O6KL 3OAYK 3P0VH 2WBKA 3ISWA 1P4IH 3BJLA 3PHOA 4K3JL 1FJ1B 2VL4A 3B8YA 4ZFOA 5D5ME 2NTFA 3OX8A 2ORBH 1REIA 3BYYA 4Q9CA 4ZO9A 4ZDHA 2FX8H 3E6FA 3SCMC 1TPXB 3G9VA 2GY7B 4KU1A 3SQOL 1RIHL 4L3AA 2K3TA 2QL1A 4I77H 1EAPA 5LVEA 1YJDC 4ZFFA 2G5BA 5DZOA 1G9NL 5KSUA 3OXRB 1EFXA 3DETC 5JR1H 5HGDB 4PJ9C 4LPVA 1QLEL 5EWIL 3RU8L 3N1GC 5HI3D 4JHWL 4NC1C 4X6CF 1GAFH 1YN7B 4Y8AA 1FL6B 3BIKA 1MELA 4WUKH 2DKSA 2VXQL 3KXFB 4WHTB 3ARDB 5HHQA 5F88B 3T0EB 2VABB 4D9LH 1F3JA 2FEEL 1R3LB 4H8WL 3I3DA 4OAWA 2E8YA 4XNYH 2EDDA 4JFDA 4LPCA 1NC4D 3C60C 4NQDD 2GK0B 1HYSD 4L5FL 3G6JA 4Z7WE 4YGVA 1Q72L 2EDLA 2D0FA 5T1LD 4Q9QH 1I8KB 5A2LH 3WUWG 4PG2A 1AO7A 1AP2A 5I0DA 1BZ7B 1LHZA 4JKLA 2DQIL 5T1KA 5ESVA 3QUXD 3RFZC 1RJLB 3B9EA 4MAUL 1JHLL 5E1AA 5DEGB 4HC1L 3KPPA 1DVFB 4QRPA 5D8JL 3UJJH 3UTQB 3IXTB 4NQDE 5ESQA 3MNZA 4XPAH 1NEZG 4XWGH 1OCWH 2IANB 1UB6B 4XCEB 5ADOH 1D6EA 1D5ZA 1ODAA 3ARPA 4K9EL 4HFUH 2I26N 2X1XR 3GNMH 1YMHB 4ZPVA 1BGXL 2DRUA 1IC4H 5TF1H 3D87B 4XVSH 1S7WA 1NJ9B 1W0WB 3M1BA 2FJHA 4HX1A 4LIQL 4YHML 1X9QA 3LB6C 4MAYB 1AFVH 4NKQB 4DZBA 4N0RA 4OCWH 5C2UB 4OV5A 4KZDL 5LBSL 4Q9RH 1OAKH 3EO0B 1MFBL 3HN3A 4RFEA 3WNKA 4LCCB 2A6JA 1S7XA 4KKCD 4OUUA 3QIBC 1A9EB 3U9UB 2XWJB 1KCRH 1A6PA 1E4XI 3ZSSA 3ZL4L 1QFUH 2R8SH 4P3WA 3WO4B 3SDAD 4N9GA 3C5ZC 1YNLL 3KYKH 4G6AC 3IDGB 5DK0B 5HYQB 3TT1L 3ARGD 2X9WA 4P5TD 4AH2A 1W0VB 4GAGL 3H42H 1LP9E 4KHXL 4I5BA 4MA8H 4NSKA 2OYPA 1XR9B 2HN7A 2R69H 2SEBB 4EIGB 3MGAA 4RISL 3KJ4C 4J3WA 4AQ1B 3O2VH 1EJOH 3D5OF 3MCLL 4F15C 4N8VA 4W6WB 3T04D 1EDQA 4D0CA 3WIFA 3AMKA 2XG5A 3MCKB 5FOBB 1KJVB 1LO2H 1MEXL 3TBWB 1AGFA 1UT9A 1YN6A 4KK6C 4ZOCA 1K3ZA 3B9KD 4N90D 1FNAA 1GOHA 3LMJH 3V52H 1QR4A 4H0HB 2V5TA 3MV9A 2Y5TB 1K8DB 4NO2B 5FKPB 2P24A 2G60H 3FB8B 1W72B 5J9PB 1FGVL 4OLVL 1TPXC 1OTUC 1CLYL 4EI6A 5L6YH 4DOHB 4KWUA 3CXHK 1NBZA 4PJDA 3QCVL 4N90E 5C07D 4CJ0A 2B8OT 4W4OA 1KJ2H 2CRIA 5T3XD 3UPAA 4P9HH 3Q3GA 4R7NB 5CGYD 5JXEC 3W2DL 5D7LD 1RZGA 4U1KA 4MD4B 1R3HB 2R23B 2PF6A 3B2VH 4S1SL 2NX5D 3LKPB 3Q0HA 2DQFA 3T0EC 5J1TC 1EV2E 1M1SA 3UYPA 1DUYA 3NPSC 1FNSL 5KG9A 5C07E 5F9JB 2OTPA 5T3XE 3SEPA 4JPVH 2CR3A 3RJQB 3MMEB 4QWWD 1JRHI 5CJ5A 1F00I 4GW5A 5D7LE 1A7PL 3MV7A 1DBAL 4LARH 4P2CG 4LCUA 3WE6A 3FT4B 1SY6L 3MRLB 5A2JH 3IETB 5FK9B 1Q0YH 4WGVB 1QA9B 4F7EA 2P1YA 3A0OA 1HQRB 4BH7B 5IV2B 1HH6B 2CGRL 1AD9A 3GDBA 3A67H 3WNLA 1NMBL 2Z92B 3NFPB 3EDEA 2IPTH 5HY9A 3G5VA 3V4VL 4NKMA 4G43A 1KG0B 1WCQA 3AY4A 1KJ3H 5K9JL 3TT3L 4JFXB 1TZHB 3FOMB 5GGTL 1JV5A 5DT1H 3D85B 3P2TA 1B6UA 4NUJA 3NIFF 5MEPA 5L8JB 3MJGX 4MA7H 4YXLL 1CYGA 3VMNA 4KHTL 3RGVA 4NZDA 2CK0H 4POUB 4MAYC 2VXUL 3EIFA 4JE4B 4XI5D 4KJYB 43CAA 4C56D 2GAZA 1S9VB 1BECA 1CL7L 2G2RB 3UTTA 2NZIA 3DYOA 1MCJA 4OLZL 4OF5A 3HZYA 5EU5A 4NQVB 1FNHA 1ZKAA 4HQQL 1CICC 3OB8A 5L8LB 2VIRB 4P2QE 4Z0BL 3QNXB 4TSBL 5MEOA 3O41A 4L8BB 2RCSL 1NAML 4U6XB 5D71H 2ZCHH 2OSLB 3GKZA 2XWTB 4PJCB 1WF5A 3QQNA 3Q6FA 4RMTA 2B2XL 1UM6H 1T7XA 4I2XB 4HLZG 3T0VA 3KS0H 5I17B 1UCBH 4HKJA 1JGLL 3FB7B 3NIGF 3KPMA 3V5DB 5IBLD 3KLHD 1NL0H 2E8ZA 2ESVB 1C7TA 1CFTA 4WI3A 3MACL 4FQHB 3RUGE 4BM7A 3BN9C 5D93B 1INQA 5IB2B 1HOCA 5FF6A 3FJTA 4NJ9H 3PIQA 4P46B 2QQLH 1NEZB 1YNTB 4L3CA 3HPLA 1AXIB 3BO8B 2BXYA 4JQXC 4H5SB 3T0WA 3U46B 1UFUA 5JA9A 2C1OA 1G7LA 2XNAA 3WJLA 4PGBB 3P3YA 9CGTA 2DLTA 2Y06H 4UUJA 2O5ZL 4EN3D 5GSVB 4X4XA 2AV1A 2K7PA 3KPSD 2YUWA 1LE9B 5CJXA 2DBLH 3W0WA 1U95B 3CC5B 5FHAH 1HH9A 1U8NA 1MCSA 3IGAA 5TFSL 3SDYH 3BUYB 3ZYIA 3NH7L 1PVHA 1ULVA 4CN4A 2VC2H 5SWZB 2VLJA 1UKTA 1FZMA 5C0EA 4LPTA 3GI8L 3RPIB 5GGVH 3TGXA 2F5BL 1PQZB 5BZDA 3WFDH 4YHIB 4BYHA 4PY7B 3KWWB 1A8JH 2EDJA 2VLRD 4XPHL 4OCMC 3KPSE 2OP4L 5I18L 4NT6B 5E6YA 4GBXA 4PLJD 5D7KD 2QQKL 1MJUH 2HJLB 1X4XA 3J8F7 3ZE0E 2VDKH 4D0BB 1Q9LA 4OZFH 4JDTH 1S8DB 1SJEA 3IF1A 4P99A 4LEOB 1DE4A 3LN5A 4ORGA 3VRLF 2O61A 1DLHB 2Y36H 2FJGB 4MJ2A 5E2VH 2VLRE 1B0WA 4D94A 1FL3B 2OXHA 5IKCA 3S34H 4OM1L 3RKDD 1WUNT 4C59B 5TQ0H 5D7KE 4XVTL 5HHPB 1PAMA 4JG0H 1HHKA 1TMCB 4XP9L 3WS3A 3SDXF 1JYWA 5F3HA 1CXKA 3GO1L 1CFSA 2HJFB 2BK8A 5IWLA 3OMZA 3LS5H 2AGJL 1S7RB 3EFFB 2CIIB 4PRHD 3E3QE 4HUMB 1VENA 1A7QH 2NY2B 3UC0L 3IJYA 1UB5A 3ARFD 1IAKB 1UWXH 3CLEL 4WY7L 4MQ7B 4Y5VB 5I8EB 4CL7A 5JW5A 3NCCB 2VAAB 3QO1A 1A1MB 3T77B 4PS4H 3G5ZA 1NC2B 5AWNH 5KAQF 1YYLL 4M7JH 5H37H 4PTTA 2R1YB 1OT2A 4PRHE 1DQML 1QFWH 3NFSL 4R6UA 4LSTH 4MZ3A 2XV6B 3ULSB 1RZ7L 3HAEH 1KUMA 4J6RH 3GSOB 4MZ2A 3T8XA 1FFNB 2HJKA 2D9CA 2OK0H 2WUBL 2Z91A 1CK0H 3C6LA 3V7AE 4NFDA 1FN4B 3ORJA 1MCPL 2CRMA 1WAAE 2GITA 2LAAA 3CMOL 3OKKB 5EBGA 2IH1B 2J8OA 4E42A 2HLFC 3X11A 1F02I 3HG1D 4X6CA 4X7SL 1XIWB 3K3QA 2ZCLH 1DQLH 5ICYB 1S9WB 5IMLA 4HWUA 2FB4H 3F7RA 3KNBB 3CVIH 1PKOA 2OL3B 1KIRB 1ZHLB 1T1ZB 5SV4A 3CSGA 3HE6B 3GSVA 2VDRH 2FGZA 1INEL 5DGRA 3O2DH 3HG1E 1BVLB 1RUQL 4QHUA 3MGOA 4OKDA 3V6BR 4NO3A 4HUUB 1JZ4A 4J1UA 3SKJL 4RCAA 3R1GL 1LO4H 5JO5A 4GRWB 5DC4B 3P73B 3HC4H 2WZPD 3VFUA 2EYSB 2IGFL 5JIHA 3BPLC 1V5JA 1XF5B 5A2IH 1DDHB 3V4UL 4DKFL 4AMKH 5AZ2L 5T3ZD 2H32A 1RZJL 5IG7B 4HXBH 3IDNA 1EO8L 4M6AA 4K3DH 4I3SH 4YDLC 5DMGD 3EGSB 4R0LA 3MPCA 1JGEA 5IR1A 1MUJB 1FBIH 2YKLH 1A3RL 3SJVA 3UZVB 4LCIL 2WNGA 3KPOB 1TQCB 5T3ZE 5LQBH 3IKCA 4JN2B 2RFXB 1WBZB 3L6FA 4L3EB 5CEYA 1I7UA 3CCHA 4GW1B 3PP4L 5C0AB 5IQ9A 3U9PL 3VMOA 3VXMA 5BRZB 5DUPH 4GW4A 5LKNA 5CAYB 2P5EB 1I4FA 2JK5B 2CO6B 3VGEA 1EHLH 1BWWA 1T21A 3E6HB 5AEAA 2VR4A 3FKUS 1S7SA 4U2ZA 5CEXA 1WV7T 2ZNXA 4P5MB 1QLRA 1QBML 2PETA 3SKNA 1FE8H 2HYMA 4Q9BA 6FABH 5IVZA 2A77L 2XZQL 1TETH 3EOAA 1XGUA 3KLDA 4N0UB 5IQ7L 1JPFA 4P4KD 4Y5VC 3M07A 1KEML 1KNOB 5IFAH 4X4ME 4Z77A 5GISL 2AXGA 1CFVH 1YEDB 1AQDA 1UWEH 3DIFA 3IU3A 1RK0B 5EU7C 2EICA 4ELME 3QZWG 1U58A 3BT2L 2ZKHH 4TUJA 1G6RB 4J4PA 5FYLH 1G7MB 5EH1A 3RVUD 2EC9T 3SPVB 1U8PA 5SV3A 3O11B 3L5IA 4EDXA 3BE1L 4JB9H 4XHJD 1LDPH 4JQVA 4X9GA 3MLUL 4BKLA 4YHKH 1EZVX 4IDLA 3T2NL 4M6OL 3V0WL 4DTGH 1PEZA 4XBEH 2H8PA 2NW3A 5JIIA 1FPTH 4HBCL 5TE6L 1IC1A 1A2YA 2OJEA 5F6IB 3M8OL 1VEMA 2ICWJ 4PJCF 5FKAA 1OTTC 4K7PH 4QGYA 1I1AB 1ZHNB 2ENSA 4YHPB 2V9TA 4KVCH 1OAQL 5DWUL 5FUOH 4NRZA 4AYFA 1YJDH 4Z6AT 3FQXA 2FEDD 4JKWA 1ZTXL 4IOFD 2P8LA 4WV1C 3BQUA 2P5WA 2Q8AL 2H9GB 3F7PC 3NA9H 3AY4C 2GUOB 1JPTL 3DV6A 5DMJB 2YUXA 3GUTA 4XXCA 3QH3B 5CS7A 1A4JA 3JWDL 1J05A 1FAIH 5DMKB 4G8IB 1ES0A 3DX9A 3WFBL 4RA0C 3HMWL 4PJGF 4XPGH 5DI8B 1EEUA 1KENL 2E7LA 1G9MC 3HC3H 4G5ZL 4AJ0A 1MREH 3IDXL 4PRNA 3H3PH 4PY8J 4EI5D 5C0CD 1M05B 1IILE 2JKXA 2XTJB 5EBWA 1SBSH 1IAOB 1BAFH 5GGSA 1DSFL 5E5MB 3F58H 1NCDL 4CRPA 1DCLA 1F5WA 3MV8B 1ZT1B 4UDTA 3EHBD 4WUUB 4IS6A 3AROA 5EO0A 2CDGA 2YZ1A 3DGGA 2YXFA 3BRDA 4JKMA 2OZ4H 1RVFH 3D2UA 3EO9H 3MZTA 5C0CE 3W5NA 4GS7B 2ATPA 4XBPA 1GC1C 5DLMH 2Z31A 2BHZA 2YN3A 3Q1SL 4GRLD 2MKLC 5DD5L 4EOWL 2VUOA 1U8MA 3O6FB 4OF0A 4XWOD 5CD5C 5JIPA 5KVMC 1CIUA 4JFPA 1ZXQA 3N50A 4S10A 5DD0H 5IBUG 4LVEA 4MS8D 2B1HH 3I2CH 2X5PA 5BOZG 1YC7A 3BVNA 5JOFB 4UT6H 1B6DA 1RZKC 4JAMA 3CVHL 4U6HB 3WFCL 2GKIA 3VXQB 4V1DD 4Z9KB 1DEEA 1HXMA 3JUYA 4JY6A 4OZHE 4WFHD 4V2BA 5SWSB 2F19L 3FMGH 1N8ZA 1K4CA 4BQCA 4KJQC 4JO1L 1A1NB 1LNUA 5FYKL 1OAZH 1IGIL 5ICXB 1IGTB 4PRAB 1H15B 3NZ8A 1S9XB 3BDXA 3G08A 1CE1L 3MOAH 3VWJC 3MJ6A 5D5MB 4JFED 4YDVB 1SEBB 4V1DE 3AGVA 1II4E 4WEBL 4WFHE 3S36X 4JLRB 5GS0D 4YDJA 4P2QA 5CBEA 3V2AR 3W81A 4YC2C 2KBGA 4GBXC 4TYUA 1E4KA 1C5BH 1JUFA 4MNHB 4KFZC 4X6DE 5KOVC 4PTUB 4K7FA 3GBML 5B21A 4NQCA 1MFEH 3MJ9H 3OXRA 4PJHF 1FYHB 2Z4QB 4JFEE 5J11B 3P4NA 5IM7B 3CZJA 1I1AC 4G6JH 4WO4C 4X80L 4OCRH 4Z7NF 5AAMA 3VGFA