3MUGA

Crystal structure of human fab pg16, a broadly reactive and potent hiv-1 neutralizing antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
212
structure length
212
Chain Sequence
SALTQPASVSGSPGQTITISCNGTSSDVGGFDSVSWYQQSPGKAPKVMVFDVSHRPSGISNRFSGSKSGNTASLTISGLHIEDEGDYFCSSLTDRSHRIFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody PG16 Light Chain
publication title Structure and function of broadly reactive antibody PG16 reveal an H3 subdomain that mediates potent neutralization of HIV-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 212
sequence length 212
chains with identical sequence C, E, G, I, K
ec nomenclature
pdb deposition date 2010-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mugA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mugA02
3IU3A 3LS4H 2ATKA 4ELMA 5ITFB 3BDBA 2BSTA 1EFXB 5C0AB 5SWZE 1GCFA 2OP4L 1VFOA 4XXCA 1JF1A 2VDQH 4MQXC 1P9MC 4LSUH 1G7JA 3DX8B 4X9HA 3MRNB 2JELH 4PJFB 1MFCL 1SY6L 4DAGL 3WLWD 5ISZA 2R4RH 1QA9A 2H26B 2WIMA 3BKYL 1JCKA 3BH8A 4KXZH 3LN4A 2X4OB 2FR4B 3DX7B 2DMBA 5GGTH 3IAGC 4QHNA 1CFSB 1C16A 4NUJA 4Z7UE 1L0YA 3TN0B 5CSGA 4JFFA 4KRNA 4MA8L 1Z3GH 4HWZB 3LMJL 1CLCA 3U2SB 5DMYA 3WXWH 2YPLA 3DLQR 3DROA 4JB9L 5F9AC 5I18H 1T6WA 1L7TL 3HHRB 3G08A 3RTQD 3EYUH 5C3LD 1RULH 1Z5LA 3CFBA 2LFGA 3O3DB 3ILQC 3Q48A 2EDKA 1KCSL 4I77H 4S1QL 3MA9L 1GJIA 4UIKL 1GC1L 2A6KB 3FTGA 4BKLA 3W39A 1AQKH 5KVEH 4XXCC 4ZXBD 2B2XH 5GS0L 3MRGB 3NCYP 5GGQL 4PRBB 1E27B 5EC2B 3KPSA 4ODWA 4XGZB 4GXVL 4RRPA 1U42A 4O5LH 5CUSH 5DD5H 4MMZC 3IDIA 4HGKC 5L2KE 3LN5B 3UJIH 3MZGB 4A6YL 3NFSH 5FOBA 3VWKA 4WHTB 1FL3B 5K9QI 4Q9RL 3LS5L 3T0XA 4YZFF 2EXWD 3HE6A 4KJQD 5J11C 3KPLA 2ZUWA 5ID0B 2X1XR 3SJVD 1IGML 1PYWB 2FECI 3QJFB 4LKXB 2NXZC 1WZKA 2C7UB 2AVGA 3PDGA 4PRHD 5K9JL 1D5BB 2VXTH 3MUZ1 2FECL 3QDME 5SWSE 3LHPL 4OGYH 4K71B 4YHPB 2W9EL 3QIBD 1QSVA 4POZC 4I3RH 2BXYA 3ZMRA 1RZGB 4EDXA 1KIRB 2FZ3A 4LCWA 4AM0B 5HTSA 5DO2D 1IEAA 1QPPA 4N90D 1YN7B 4QRPB 1U9KA 3KXFE 4LASL 1BFSA 4CMHC 3QHFH 4HS8L 5KVGH 1BZ7A 5GGSY 4FS0A 2WWKT 1AHWB 2RJMA 5FKAB 2CR6A 1H3WM 5IMMB 3VWKC 3KLHD 1RJYB 3GHEL 5JIHA 1OSZB 4C59B 5CSZB 3HE6C 4JFOB 1OT1A 4TUKH 4Y16D 1J1OL 2R2HB 4M6MH 2VR4A 1MHHB 1OGTA 4TNWK 5IVXA 2IPUK 2R0WH 3MUJA 2Q86A 3G5YA 1FYTA 1B2WH 3RWIA 3S6CA 1GYAA 3ARPA 1KT2A 2ZNXA 3MLYH 1GH7A 4LL9A 1KENH 4TOYH 4U1JA 3LEYL 4F3FB 3QXAA 2J88L 3SBWC 4Z7UF 1OAXL 4Q6IA 1RURL 1JPTL 1QPXA 2D31B 3HFML 4PJ5A 5D1QD 2OL3H 4OCRL 3P3YA 1IILE 2ZCKH 4MA1B 2D7MA 3SGKA 4JZNB 5JXEC 2WZPD 5T1KB 4Y5VB 5A3ID 4MNGB 1DLFL 5MERA 4O2CB 5IB2B 3FCTB 2X1WL 1JRHH 5C3TA 3E2HC 1T2XA 3FFDB 2A6IB 3B3IB 2VRAA 3BZFB 3GDBA 3K80A 4U1LA 1NMCB 5TDOB 1ERNA 1KGCD 4JFZH 3MV7D 2PW2A 1GZPA 5J3HD 1A7BA 3EKCA 5IBLD 3PIQB 1SEQH 3JV4A 4XBPB 2MPAL 4DKEH 3S96B 4L4JA 1RUPH 4ODSH 3GI9L 1O5DT 1K6QH 1PKQA 5FHAH 4W4OC 1INQA 2C9AA 4J3VA 1CICD 1DUYA 1CU4H 4LLWA 5DYOB 1T5XB 3QZWG 1KIUA 3TIEA 4Q6IC 5IQ7H 4LSPL 2C1PA 2VDOL 1JGUH 3LV3A 2BHZA 3SGKC 5IB5A 5K93A 1FZKB 2ZCHH 3BYYA 1QFOA 1UH3A 5KN5B 5F7FA 2QKIB 4NQVA 5HPOA 3ARVA 4DW2H 1WWBX 1MH5A 4RAVB 5F7KC 1U91A 5HI4D 2J4WH 1ES0A 1Z6JT 4OZIB 1MI5E 4Y1AB 5E2UL 4QGYA 4HC1H 3V79C 1X4ZA 2HRLA 1H3TA 1LO4H 2ZSVA 4D8PB 1S8DB 4MQTB 1NUGA 2Q8AL 5DXWA 4PJ9D 5C08B 4PLJD 3WN5B 1UCBL 1UXSA 2XA8L 4OTXH 4JO4H 4L4TE 2ZUSA 1OCWH 5FUCE 1UGNA 2JIXA 1EBAA 1R5WB 3AS3A 4J6RL 2DS4A 4KQ4H 3OG4B 3D25B 1IL1A 1KACB 1S7SA 1KCUH 3LY6A 3QEHB 3RQ3A 4DZBA 1SVCP 1E6OH 1RIUH 4ZOCA 4LCUA 4MJIB 4HKZB 1RUML 4UQ3A 2W0KA 3MV9E 1Z9MA 1MFBL 2I5YL 4X80L 3R0MA 2X4NA 5DD3L 3KWWA 1KN4L 5I16B 2OTUA 1T1XB 5IEHB 4WI5A 1QFHA 2Z9TA 2XZQH 3RIAF 2IWGA 3V6OA 4WI6A 2A9NH 5C0EA 1A4JB 3O0RL 4G9FD 4KWUA 2D7TH 5ADPL 3BRFA 2DM2A 3FHQA 4XNMA 1R3KA 4B7IA 4O58H 1OP5H 4GSDL 3SKOB 5HHPB 2EZ0D 2BOCB 2OZ4H 5FYLE 3LZFH 1DANU 5KSAB 3JTSA 4BFGA 2CMRL 4RFOL 4OJFH 4F80A 2VTFA 3IJSA 1MCNA 5CSBA 4HKBA 2BNRD 5HGAB 1DSFH 3VXQA 3HI1A 4C54A 2UWEA 4OT1H 4QHMA 2BSRB 3IDNA 5LWYH 3VFSA 5GS0D 5INCA 1BHGA 2UY6A 1MCWW 2NX5D 4XCFH 4XPGL 1HQRA 2EC9T 1FZOA 5I1KH 2X9YA 4B5EA 4ENED 2OM5A 5DQ9A 2AEIT 5FYJE 1ZLVH 2FYYB 5C8JA 1YPZE 4NQSA 2PTTB 4M93B 3OKLA 4HK3N 5D96C 5IIEA 3RWFB 3V6OC 4KDWA 4AT6B 1JGEA 1KELL 2CDEA 3VFPA 5BOPA 5BO1L 3IXTB 4OSUL 1B0GB 3O11A 4K9EH 1WISA 1AI1L 4NKMB 4GFTB 1T0MA 4X6FB 3NMEA 2QTEA 5ANMA 2Y23A 4ZOEA 3CVHH 5CEXB 3FRPG 4YX2L 1CK0L 5I6XC 4YGVA 4OD1L 5GGSA 3QDJA 2WWMD 1ZANH 3RIFK 5DJXB 5KW9H 4KZEH 3VRIA 1IMHC 3W0WE 2Y36H 5T3XL 4MNHA 4KHTH 4GKZB 1F00I 3U0TA 4OD2A 2AAVA 3CXHK 3MTRA 2QHLA 1BD2B 3CFKB 1I3GH 4XWGH 1NDMB 4E41D 4KAQL 1P2CA 3X13B 1QQDA 5B3NA 5ICYB 4QHUA 2PR4L 1HILA 5D5MA 4Y2DB 1DVFA 5DWUL 2R1XB 1RUKL 4X98B 4ELME 1WZ1H 5JQHC 2COQA 1EJ6A 5JDSB 4OCNC 4G5ZH 3K3QA 2ZSWB 3MRPB 4Y8DC 1YN6A 5E8NA 3QWRA 4E5XA 3W2DH 4TULH 3VXTA 3BXNA 2EDQA 4WU5B 4ZFFB 1KLUA 3VXRB 2IMMA 3BZDA 2Z35A 1CDGA 3HI6H 5TH2B 4OIIL 2WINB 2F19H 4YHML 4F7MA 1YMMB 5KVFH 4KUZH 1G7MB 2P8MA 4PP2A 2EDLA 5HD8D 4MCZA 1ZHBA 2WQRA 2HVKB 2E7BA 4ZSOB 1UM6H 3RHWK 1EHNA 4P99A 1AGCB 4RZCB 3FQRB 2YPLE 3V5DB 4P2CG 4KPHH 1I4FB 2LE9A 1U6AH 3F7PC 3T8XA 5EIIB 5HPMA 3WO3B 4WFED 1OF2B 2FWOB 1AKJD 1DVFC 5FHBH 5BMFH 2AK4B 5EORL 3S5LG 1MOEA 4X7TA 3VFWB 3L5WB 3WXVH 5C09A 5T3XE 3SEPA 3ULUH 3GUTB 1IAII 2DM7A 2A9MH 4O9HL 2Z93B 1YPZF 2WK2A 1S7VA 3PWLB 4FFWC 4R7DB 4OF5A 3DRQB 4O51B 1F58H 1IAIL 2XTJD 3WFHB 2K3TA 5FGSA 3KPSE 2X40A 4ZUTB 3T2QA 2FATL 3BZ4A 1HIMH 3ILPB 4LVHB 2DLTA 1IM3B 2RCSH 2NZ9D 3DXAA 3L95A 4Z95L 4N9OB 4LIQH 2KKQA 5FA4A 2EKSA 3MRFB 4EVNA 4ZUUA 3QI9D 1NMBH 4HH9B 5T1MB 5DVMA 3OGCB 4LLDA 1C5BH 5IM7B 2F54D 2R2CA 1BJ8A 3MZTA 5FK9B 4JN2B 25C8H 3RPIB 5IB3B 4MCYA 1VEMA 1TVHA 1ETZB 1FG2A 2BRQA 4IIQA 4PRIA 2PW1B 4X9FA 4EIGB 1WBYA 2QQLH 5JNYB 3C5SA 4QRRE 5HY9A 5C0RH 1HKFA 3U9PL 4NUGL 3T0ED 1NGPH 1OTTC 2MFNA 3MNZB 3H9ZA 2AABH 2ZP0T 4I4WA 1YY8B 4X5WA 2W65A 1T1WA 4EKXA 4PTTB 4X6DB 4LCWE 4CADA 4WW1B 4MB3A 5HHMD 2P8PB 4TUJB 4EXPX 4LARL 3S35X 5EBWA 2F8XC 3QUZD 4R3SB 2V6HA 1FAIL 1FFOA 4K3JL 4X9IA 2XRAL 1N6QH 1LO2L 3HG1A 3O41B 1KG0A 2AXGB 1TCRB 4ELMF 5I1DA 5L88H 2J8UB 3MJ9A 4PJXA 4NWUH 4FQHB 3WUWB 4MQXD 4OD3H 5F1NB 4YEFA 4HZAA 4P9ML 1M05A 1T5WB 3GKZA 4YE4L 3U1SH 2X5PA 2I27N 2ZCLH 4L9LB 5IK3B 5IVXE 5JPMB 1UENA 4RQQA 5DR5L 1KTDA 3AU1B 2IALA 4IIQC 3BP5B 4G8EB 4JDTH 2EDXA 1RJLB 1TJGL 4R4FL 1X3DA 3PDOB 5DZOA 4M4RA 1HHJA 1BQHG 4NO0A 3SDXB 1A7QL 1KF9B 1S7QB 4FXLA 5D7IE 4DUXA 1RIHH 2AP2A 2QSTA 2OLDA 1ACYL 5FAAA 3WO4C 1IAMA 3QYCA 5AYQA 5J0BA 4NCC2 1RZ8A 3ILQD 3PWPA 1FNEA 1HHHB 4R9HA 2FLBT 3OKEB 1TCMA 5FDYA 4HAFA 4LDLB 1F3JA 4I1NB 4NQEB 3KPOB 1EERB 5HHOE 4I5BA 3KLAB 1IC4L 1UQSA 1W0VA 1CF8L 4P3CH 1CLZL 1WWAX 3GMRA 1ZVSA 5ISZD 2BC4B 3ZE2E 3MACH 1ZLUK 3GI8L 2VAAB 3RL2B 5D1XC 3AMKA 3DWTA 2IQAB 2MQ0A 3A6BL 1AJ7H 1TQCC 4FQCH 5I8EB 2D0FA 5D7JA 5DJ6A 2ID5A 1W0YT 1INEL 4ZNEA 5A2KH 4GMSL 1KIPB 1IGYA 4G42A 1W8NA 4JFFD 1QRND 3VD7A 3SDAB 1QUNA 3UTQA 1QG3A 4H26A 2IFGA 4MWFA 4M6NH 4LVOB 2MQ3A 4AYFA 4NNYB 4UQ2A 1HXYB 4JFDD 4OQTL 5MENA 2FSEA 3PGDB 3H9SD 1EJOH 4HFWB 2LV4A 3TNMB 2I9LB 1I9RL 2YZ8A 2VLKD 1KJ3L 1OWRM 2WM0A 1NANH 2EH8H 2MOVA 1U2CA 2P45B 5HYQA 2NW3A 3RA7H 4JRXA 2EDHA 1YQ2A 4I0KA 2IH1B 3QCVH 3V5HA 5I8OH 1FAKT 3F7RA 3WFBH 1KV3A 4KQ3H 1NEZB 5IOPA 1NFKA 1B4JH 5D7JC 1FLTX 4HX1A 1MWAA 1OQOA 4WFGD 2GJJA 5T3ZD 3O6ML 5DEFA 2CIKA 1ZLWK 3B5HA 1UM4H 2IBBA 3QQNA 4PJ8D 5IVXF 2NY1C 3L3KA 4V1DA 3CSYA 5F9JA 3MODH 5KZCD 4LCCB 3TBVB 3I2CL 4X99A 1KIQA 4N0RA 3BMVA 4S0SD 1ORQB 4J3OC 1A7NH 4WI9A 3LPWA 4FHBD 4JY6B 1WGOA 1WUNT 3MUGB 4OGAC 3ESVF 2XWTA 3FQXB 3P4OB 4XRCA 2HG5B 4KI1A 3QUYD 3JVGA 3RTQB 1AQDB 3QULA 5JXED 1TPXB 5ENWA 2EDNA 4ZD3H 5FM4A 4F57L 2H45A 3OKKB 15C8H 3IFPB 3UAJD 5C6WH 4L29A 1ZT1A 1WJ3A 4ZXBB 2DKMA 1LEGA 1HHKB 3IU4L 2XXMB 3VGBA 1MRFH 3GRWH 2AW2A 3RNKB 5E08H 1KXTB 5HVFB 5K59E 5DRWA 2NY2C 3D18B 4GRWH 1IGJA 1KNOA 3V8CA 2APXA 3ZE2F 1FYTD 1Y18A 3KGRA 1FPTH 4KTDH 4EI5B 3S36L 1JZ2A 3BMWA 4R90H 4AEEA 3OZ9L 5DMGC 1M71B 5DJ0B 4RMUA 2YC1A 4JPVH 4OAWA 4YK4B 2ENYA 4NRXB 4XI5C 4M7KL 2V17H 3G5VB 3SJVB 5TF1L 4PJ5D 3C8KB 3VFRA 3GJFA 4ZO9A 2F53D 3KJ4B 5ETUB 2VDPH 4LSSH 3NN8B 5EBMB 3EOBB 3DIFA 3MLVH 3GSXA 1ZGLA 4G43B 2EYTB 4UT6H 2R23A 1V3JA 1JVKA 5A1AA 3BKCH 2Z91A 5D70L 2ZG1A 3HNVL 3V7AG 1MCBA 4X9GA 5D7KD 4P5TD 1F2QA 3QDJE 1G9NH 4ZUSB 4KK5C 2ARJA 3QXWA 5CP7B 3O81A 2O61A 1KJMB 3BIBX 1R3HB 1AD0B 3QXVA 4P2YA 3FHAA 4JFHD 4GRWB 1DP0A 3N9GL 2IPKB 1A5FH 3L3GA 1MLBB 2GTZA 5F72S 1U8NA 2GYSA 3HAEA 1JZ8A 4M1CD 5DQDH 1I7RB 3X14B 1AFVH 4Y16B 1MQ8A 5HHNB 4LLMB 1YEHH 1E4KC 1FE8H 4Y5XB 3MLSH 4U49A 1RY7B 3QNYA 4JKPL 4L5FH 5EPMB 2OTWA 4N1CA 5D5ME 4P5KB 4I48B 1B9ZA 1LGVA 3MJ7A 4OCXL 1N5YH 5DC0A 2Z31A 5SX4I 4HUVA 3I9GH 4WEBL 1RK0B 4WUKH 1UWGH 5GGRA 4NZDA 4HXBH 2H9GA 1NJ9B 4XNYL 2W0FA 1K5NB 2OSLB 4OZ4A 5D1QB 3KPMB 5J4MA 2FHFA 3H3KA 2B0SL 1NGZA 5DLMH 3ULVH 4DVBB 2APBA 4FFZH 4TVPH 1KCRH 1TJHL 3OKNB 1IGTA 3CVIH 3SO5A 4X6EA 1VPOL 2WP3O 2EE3A 4LLVA 3BP6A 3QPXH 1XIWA 2GK0A 5DHYA 1S9WA 1T1ZB 2XTLA 1JPSL 8FABA 3MV7B 1SEBB 5CJ8A 1T7WA 1TQBC 4WU7B 4L3EA 5E1AB 1TZIB 2R1YA 4NQDA 5C0JA 4YIQA 3GIZL 5K59F 1A3RL 4L4VD 5MI0C 3HAEG 4OF7A 4ZS7H 2YEZB 3RVTD 4MLIA 3PQYD 3GSOB 3MJ9L 3ZDZF 3HB3D 4FA8A 3SN6N 4UBDC 5LCVH 1NC2A 2Z31C 2XYCA 5DGQA 4LP5A 5C09E 1CICB 5FOJA 5ALBH 1CZ8L 5IB4B 3EGSB 2GK2A 1G7PB 2W0LA 3ARRA 4Y4KA 5ERWA 3BRGC 2YK1L 3SGJA 1A2YB 4TPRL 5DJDA 4Y88A 4QHLA 3AB0C 5A2LH 3MO1A 5DRZA 1PFCA 3QCUL 5ICXB 5AAWA 2ED9A 5I8CA 4CVXA 1UYWL 4LGRB 1XIWC 4R8WH 1TETH 3HMXA 4LSTH 5EFIA 3MGTB 4JY4A 5EBLA 4NKDA 5T5FL 3P0VL 5D1ZC 3TV3L 3OXSA 4PRIE 4RDQF 3MBXH 4QYOB 4CDHA 4DFIA 4PV9B 1P4LA 5FYKL 2DBLH 1XF4A 2HKHL 3DOSA 5JW5B 3LIZL 5IT2L 2ITDB 5ACMA 4DGIL 1JP5A 3NIGE 3L3IB 3MRCB 2XWBA 7CGTA 2LTQC 4JN1L 4JGMA 3HUJE 4LF3B 4IHOB 4P57A 2W59A 3EYOB 4Y4KC 1CFTB 1XF5A 2AJUH 2C1OB 2HT4C 4MJ6B 1IKFL 1ZXQA 3ZT6A 3OL2A 4HJ0D 5D5MF 5FV1L 3HG1E 3SGJC 1FGNH 2QR0A 1OAQH 4XC3L 3WIHH 2XKNB 4PJXE 2EH7L 1IT9L 1B0RB 4OI7A 3U4BL 1OOAA 4RBPK 1P5UA 1DQLH 2WV3A 5MEQB 4IOFC 5HYSB 5HGDB 4G9FB 3FRUB 3EDDA 1TZHB 4ZPTA 4AL8L 5BJTB 4S2SA 1R3LA 4FQIH 3CPLB 5MEOB 4MAYD 5CCKH 4AH2B 1Q1JH 1KPUB 4O2EB 5TPWL 5E5MA 5E95B 3PHQB 2VLLA 1LNUB 4LEOA 4LLUB 2DLGA 2BNRB 2MTPA 2VQUA 2NNAA 2O5YL 3U6RA 4IJ3B 4D9RD 2P48B 1MPAL 5J56B 1HSBA 4JPWL 3OB0K 1I8MA 3TESA 1I9EA 2NX5B 1QSZA 3V6ZB 2VDKL 3BDXA 1B88A 4OCWH 5A16B 3PWPE 1DVFD 3MFGB 2GTWB 4UTBL 1ZLSH 3RWEB 2B4CC 3FB8A 5FYKE 2VDLH 3V5KB 1MWAL 4GW4A 3HZYB 2R0LL 4K8RC 3G9VA 2FJGB 3CFCH 4BZ1H 3SE9H 4BZYA 1HWGB 3SCMD 5CFHA 4P3DA 3HE7D 1ZTXH 3CFJB 5HXMA 3TBYB 3NCMA 4RMQA 4NFDA 3PHSA 2ADIA 1OGAA 2L7JA 4H0GA 1KPRB 4Z0XA 1RFDL 3NH7L 1RU9H 2FO4B 3VMNA 5IKCA 1SJEB 3HNTH 4I3SH 1JI2A 5DK2A 3ZHDA 2E3VA 4ZNEE 4PD4K 1QSFA 1FN4B 1Q0YH 4JAMA 1CXKA 3OAZK 5D8JH 4D94A 3VXOA 4J1UB 2A0LC 4JHZA 1DBKH 1FFNB 1T20A 5CJQL 4BSVA 1VFAA 2V2WA 4ZTOH 5L9DL 1ITCA 5DMIL 3GJEB 3MPCA 4LQ1A 5JUEL 5TGBB 2EDTA 2OXHA 1UZ8B 2NY3D 5MENE 4NYLB 12E8L 2XQBH 3GGWA 3IFNL 5K9KA 5L7XH 5TE4L 5IBTH 3TJHC 5B38A 1MREH 1S7UB 5GISH 3S98A 3HUJF 4E41B 3ZLQC 5J6GA 2R0KL 3OR7B 4QTHB 1NGQH 1HSAB 3DUUB 4JRXE 4I0PC 3SQOL 3RVXC 1SYVB 2E7CA 3DXAD 1BF8A 5GSRA 3REVA 5FYKU 4J4PD 1NGYB 3V6BR 4J12A 4PJXF 1A0QH 2DQHH 4KJWC 2X4UB 1WCBA 3L1OL 3MR9B 5DJCA 3PWNA 1DQML 5TQ2L 5JOPE 4PLKD 5HJ3B 4XPHL 1OAYH 3RUGE 5J12B 1UEYA 1PG7X 3IFOA 1CVSC 2DQDL 3DV6A 4MD5B 4OZGB 4C83A 2YPVL 4R4ND 1IGIH 3QFDA 3W5MA 1ADQH 1I7UB 4YHYB 4OZFG 3N1FC 1QEWA 4HQQH 4MSWB 2YA0A 1J9CT 4UAOB 4JRWA 4Z8FH 3QG7H 3MV8A 3OBAA 1U0QA 4L8SB 1XF2B 4CAGA 2GY7B 2AJSH 4NNPL 5CJ5A 5FCUL 4PJAA 4GQPH 1AKJB 2A77H 1LDPH 1KLGB 3QO0A 1UACL 5JPNA 1I1CA 1I9IH 3G6JA 4HT1L 2VH5H 2Y6SD 4AIZA 4GAJH 4M1GL 3SY0A 3B2UD 4X8JB 1AXIB 4FZEH 4M5YH 1BX2B 2APVA 2XTJB 1OP9A 4U6VH 5AWNH 3O3BB 3KYMB 3E6FA 5HYEA 2VIRA 4ZQKB 1RZJC 3D39A 2DQTH 2APTA 5DF0A 1AR1D 3T77A 3U7WH 2ERJC 1WC7A 5D1XD 5AYUL 3RL1B 5DJYA 2RGSA 1IGFH 3BX7C 4YQXH 2EDEA 4ODUA 4OLWL 5B4MD 3QI9B 1EXUA 4FXKA 1RK1B 4LMQI 3C6LD 2YD9A 3EYVA 4Q9QH 4YHKH 3PNWB 1ED3A 1WBZA 3VH8A 2F54B 4EEEA 4HSQA 4DQOL 4BQCA 5SWQA 3SKJH 1AY1H 4P5MA 1WEJL 4ZTPL 1XCTA 1YNKH 2PCPB 1S5IH 2GUOB 1U8LA 3AXLA 3T0EB 5FF6B 1ZWIA 2NXYC 4OCSL 4XVJL 4BFIA 4FTVA 5HHMB 3MRKB 1UM5H 3QUZB 4HKXA 3CXDH 5CILL 4NN6B 4X6BB 5EUKA 2HH0L 1FH5H 4Y4FC 3S35H 1JHLL 2BRRL 2YUWA 3DI3B 3EFDL 1JNNH 2H32A 2DJUA 1IEBB 4NKQB 2IG2L 4RIRB 5D7JD 3U0WH 3IB4A 4XHQA 2LAAA 4DOHB 1YEEL 2CUMA 4NQUA 4DEPC 4PRNB 5GXBB 2NY1D 3RUGF 4RGNC 3GMPA 4AZ8A 4XVSH 3WNLA 1M6OA 3CLEH 3E8UH 3HPLB 2AV7A 4FMKA 4AIXA 4HUKB 5IHBA 1RJCA 2NY0B 5D9SB 2VSCA 1PY4A 3HMXL 3TBSB 2HFGH 4X7DC 4NC1E 4OGAD 2X42A 2DYPD 1CBVH 3ARFD 1WTLA 1C12A 1BFOB 4RX4A 4M8QB 3VXNB 1ZT4B 5IFJA 2IH3A 2CRMA 1FL6A 5F3HA 2BSED 3K4DA 3MUY1 4C56A 1BQLL 1KJ2H 2OCFD 2F58L 4HCRH 4RFEA 4OUUB 5EU6B 4PRDA 3QNXA 3QT2A 1MJ8L 4L8CB 4HXAL 4QWWC 4JEGB 3VXME 1FV1B 1UWXK 3FQNB 4M7LL 1IAIM 1ACZA 1P4BH 1UB6B 1YNLL 2EDJA 3EAKA 4GLRI 3TJEL 3S4SG 4NJAH 2WANA 3UTZB 4L3CB 1KB9K 5E94B 5IV2B 1DUZA 1T7YA 3ISWA 4HKJB 4L3EE 1BGXH 5ISZB 4P59H 1J11A 2NY2D 4KHXL 1DR9A 1VSCA 2B4CL 3P77B 4V1DD 1U8HA 1FO0A 3L3JA 2XN9D 3SDDC 4M1DH 4K8RL 1W8OA 2CKBA 4NM8L 3EOTH 2GAZA 4FOMA 4TUOA 1AXSB 2ICWJ 4KI5C 5DMGD 5I17A 1C16B 3PV6B 5J11B 1A6WL 4JREB 1QRNB 2EIDA 4XI5D 4AG4H 2VC2L 1QBMH 3QRGL 4D0DB 3WD5H 1P69B 3BWAA 1N8ZA 4M00A 3DSFH 5JTWA 3Q6GH 5DVKA 3RBSA 3NCEB 5CEZD 4FQXA 4JFDB 1FIGH 4LOUD 2GJ6A 2H41A 3UTSB 4M61B 3H9SB 2HJKA 4TRPH 4WJ5A 3H6JA 3FTGB 3LQAC 1HXMA 2VLKB 3FQUA 1OP3H 3T2NH 1DQDL 4JE4B 1R6VA 4UTAL 5F93C 5EU4B 3MBED 4OM0L 2R56L 1FZMA 4KK5D 1MJ7L 1OD9A 1R3IH 2B1AH 3FT3B 4AK1A 3LKPA 4FZ8L 4JQXC 4KRPC 4YHIB 3HC4H 1DQTA 3O3EB 1K85A 4PJGE 4OLYL 1PX4A 2VLRA 4WV1B 1V05A 3H8NA 4KDTA 4P23B 3QDGA 2A2QT 4GBXD 4HBCL 2H1PH 3EJZC 3NFPB 4WGVB 1HEZB 4FNLL 4HWUA 4PJ8B 4WHCA 4PRPD 4NZTH 1QZ1A 5KZCB 3MRHB 1QVOA 1Q94B 1RV6X 3O4LA 1SMOA 3T04D 2AI0H 1K8IB 3TVMD 1VEOA 2UYLA 5GJSH 3WJJA 3BKMH 3RGVA 4BK4A 1U8QA 1BWWA 4FQXC 4Z18A 5I0DA 5EIQA 2NTFB 1Z9SA 5CBEB 4MA7H 1SBSL 2P5WB 4HUWB 3OGOE 1IAOA 4XTRD 5E2TL 3QUYB 2EO1A 1IEAB 1G9MC 5HYFA 3UTOA 3TBTA 3RJDA 5JW4Q 4U7SA 2IMNA 3CU1A 2V7HA 2OBGA 5EA0L 1U3ZA 1HH6B 1GGTA 3PG2A 3IS0X 3O6LH 4KY1L 1U8PB 2A6JA 2HFEB 3F5WA 2VL5A 2ADGA 4WI3A 2I9TA 3MCKB 3U82B 2RAMA 2FGWL 3BOVA 4KDTC 1EGJH 5JDJA 2GFBB 4PJCE 2MCPH 2Q86B 3TZVC 1FYTB 4HH8A 1DE4B 3QZWB 1I8LA 3BSZH 1V7ML 3JTTA 4UBDD 3WJJC 1ZGLP 3RGVC 1BOGB 4UOW0 3VXPB 5GGVY 1RZJL 1U8KA 4ZUWB 1I1RA 1FNLA 1BVKA 1F8TL 4PJ5B 4HGMA 2F53B 5EZLA 2D4FA 2NY6C 3V4VH 4X4XA 2DQEH 4JZJA 1P84K 1H5BA 3JWOH 4PJDB 2VDNH 1MAMH 4PJHA 3MFFB 3LSOA 1F4XH 2X9XA 5D93B 1OARH 3A6OA 1QSFE 2M26A 4P5TB 1X4XA 5D1ZD 4G7YH 4MXQD 3K2MC 4KGLA 1EFXA 3QQ4B 5C0AA 3QWQB 4NQDD 3CSGA 1LK3L 1BJMA 1FFRA 2CGRH 4B0MM 3DX8A 1T66C 1FNFA 3MRNA 3A67L 1D3CA 4N0YH 1I8LC 3MXWH 4PJFA 4XP9L 1P6AB 3F7QA 1GHFL 4UDUB 1NC2D 4XMLH 2H26A 4PJGF 4OI8A 1JN6B 2YXMA 2DIAA 2X4OA 2FR4A 3P30H 3GBLA 4JHAL 3DX7A 1T22B 1YEGL 3VGAB 3NCYS 4GXUN 5EOQH 2FD6L 2HT4D 1CFSA 5I8KH 3L3HB 1YEKH 3DYMA 5IB5B 4RAHA 3TN0A 1I8IB 5L6YH 4HWZA 5EB9A 1LE9B 4JZJC 4O02L 5DI8A 2XNAB 4JM2B 2I07B 2I60L 1HE7A 4X8XA 1JNLL 2DQIL 3Q5TA 3O3DA 5DUBB 4Z6AT 4F9PA 4JO2H 2HLFC 2KBGA 4RDQG 5IHUH 2ZSVB 4D9QE 2UY7A 4JCMA 2A74B 3GHBH 3MRGA 1KJVB 1N0XL 3H3PH 1MRCL 4PRBA 2E27L 1CG9B 4KZDL 5EC2A 4FQQB 4XGZA 5EZOH 5C7XL 3J7HA 5C2BL 3MV8E 4OCLC 4HPYH 4UINL 4W68A 1B6DA 3LN5A 1S7SB 3VE0B 2GSIA 4WHTA 1FL3A 4L4VB 4PJCF 2IQ9H 2IPTL 43C9B 1OHQA 3MV9D 4CU7A 2YZ1A 1TFHA 3PQYB 1Q0XH 3KAAA 4F7TB 4GAGH 5ADOH 4WENB 3TN0C 5ID0A 1WWWX 4HJJH 1I75A 5BXFB 4LKXA 3QJFA 2C7UA 3KJ6L 4HS6B 4K8RD 5D96B 2OTUB 3Q1SH 5I1EL 3LEXB 4G6JL 4M62L 1GOFA 4F9PC 3VXUD 4YHPA 2PYFB 2ITCB 4HZLB 5I19L 4OLVL 2BMKB 4P2QD 1RZGA 4FQLL 1KIRA 2DWEB 3BDYH 4NGHH 4AM0A 5HBBA 6FABH 4L1DA 4XVUC 1YN7A 5DVOA 4QRPA 2FIRT 1QO3B 1PG7W 3AMLA 1AE6L 3HI1B 2UWEB 35C8L 4WHDA 1AHWA 3FONA 2A0LD 3FOMB 5FKAA 2YPKB 2AK1H 1LWRA 4YWGH 5IMMA 3KS0H 4Z76B 3OKOB 1RJYA 2CLRB 1FVDA 5T5NG 2P46B 5HDBE 1OSZA 5CSZA 3LQAL 3EYFB 2F5AL 5DK3A 4JFOA 2R2HA 4JKMA 3MLWH 5IBUG 1BAFH 4HUUB 4Z0BL 4LAJH 5E2WL 1NCCH 4FTVE 3TJHD 5MHSE 1HYSD 3SKUD 5F6IB 4Z7VB 4UILL 5E4IA 2CK0H 1FO0L 3QEQE 3KPQB 4K71C 4MZ2A 2CDEB 4I0PD 5D4QA 3NIDE 2HTLC 3K8KA 3RVXD 2XY2A 3P11H 1YEFL 4WI2A 2BDNL 5GZOC 2FRGP 3MLUL 2V5RA 2D31A 2IAND 5AZ2H 3OXRB 3DHMA 5CD3B 5AG9A 4KJWD 1T0MB 4JZNA 3GIVB 5T1KA 2EYSB 4Y5VA 4MNGA 4JFEA 4M7LT 4O2CA 5IB2A 3FCTA 2AEQL 4X5LA 4YGVB 1AHWC 4JG1H 3NVQA 5DT1H 3FFDA 2A6IA 3BZFA 5HI3C 4MAYB 4M7JH 3VRIB 1MFDH 1NLBH 2QSCL 3D87B 5MP6L 3IXAB 1G9ML 3BISA 3PIQA 1AO7E 1LP9E 1REIA 1UA6L 1A9EB 4XBPA 1J5OL 3S96A 1UG9A 5CZVL 1MY7A 5F96L 1DN0B 3S5LB 3TFKC 2OMNA 1EUUA 5HHXL 4PJAF 4HHAB 1MFEH 4G8IA 4PB9H 4OLUH 3QO1B 5DYOA 1T5XA 4H8WH 4OIAA 3UYPA 2X4QB 1N0LA 4ZODA 3O45B 2OXGA 4YDLB 3M8OH 1WBXB 3G6JF 3V4UH 1X5YA 1JF5A 2F9BT 4F9LA 2V9TA 3V95A 1AGEA 3CGTA 4MA1C 1F90H 2FBOJ 1KBGL 1O0VA 2CDGB 3SCMB 3BWUC 4EOWH 3HE7B 4Y5VC 5KOMC 4R26H 5KN5A 1OM3H 2QKIA 3BJ91 1IQDB 1IAKB 1D6VL 2X1OA 3WFDL 1TNMA 4RAVA 5F1SA 1NMCC 1NLDH 1UADC 2ZJSL 5DJZB 4OZIA 3NAAL 4Y1AA 4N9GA 3VFVB 3C6SB 1QBLH 2DQCL 4KKNA 1S8DA 4D8PA 5TDNB 1P1ZB 1G7LB 3V9FA 5C08A 4N8VG 5DMKB 1S9XB 1T03H 4EQ3A 3LN9A 3B83A 3UX9B 2VABB 1CDCA 1R5WA 4UT9L 2R2BB 1YJDH 5DJ2B 3VXSB 2W38A 3T0DA 1QHPA 4CRPA 2DQGH 2YWYA 3CFEB 3ZKSD 2NY4D 5HDBF 2NY3B 2GJ6E 4NBXB 3QEHA 3QWOB 1AD9B 1FGVL 1H9VA 3NCBB 3IRPX 5IMLB 3VWJD 4F9LC 2ZKHH 3HZVB 5INDB 4MJIA 4S1RH 4DWHA 4HKZA 2XQYG 5BS0B 1MJJB 5DHVB 3GSNH 5KANI 1T7ZA 5I1HL 1RUAH 1J87A 2AXFA 4ETQA 2HWZH 5I16A 4WUUA 1T1XA 4Y4FD 1MF2H 5IEHA 2FX7L 3NIDF 5IF0A 2VERN 1ZLWH 3QXTA 5DUPH 1A4JA 3MSPA 1Q9OA 3T1FB 3ZE1F 1WAAA 2VDRL 3BEWB 3N1GC 4OFYA 4WW2A 3SKOA 5HHPA 5ITBH 1BECA 4NC0B 2BOCA 3QIUA 3CH1B 5KSAA 4RGND 1NFDE 3T08A 3O4LE 1BQHB 3SHSA 5HGAA 4KUCD 5D71H 4NO5A 2BSRA 4XNXL 1G6RB 1M7IB 1LP9F 4WEUD 5DFWH 5LQBH 3NCFB 3ZO0A 5E6ID 1KTRL 1FFOB 2R0ZH 3AS1A 1QP1A 2FYYA 2R69H 3C08L 5JORB 3CU7A 2D0HA 4LU5H 1BFVL 5F3BB 3AY4A 2GI7A 3RWFA 2DL9A 4MB4A 3V52L 2NCMA 3ARGC 3ZTNH 1KB5B 2HFFB 3DNKA 4AT6A 1F3RB 5J89A 2DTML 5GRUL 5ESVA 1JHKH 5TF0A 4WW2C 3G6AB 3WS6A 3IXTA 1KTLB 4GQ9L 5KVDH 1B0GA 5EIVA 5IFHH 3QIUC 3JUZA 4C4KO 5D1XB 4NKMA 5KSAC 4HIHB 1ZSDB 4X6FA 1X5FA 5LGHH 1AC0A 1R5IB 5C71A 3SDDD 2R8SL 2R29L 1H8NA 3C6LB 5CEXA 4KI5D 1BEYL 3RVUC 5HSFA 2KPNA 4U1MB 4R2GD 3P73B 2ZUQB 5DJXA 1LVEA 2QEJA 4PLOB 3WEXA 3VFUB 4KVCL 4Z9KB 2Q8BH 3LS4L 4FFYH 4GKZA 5C0BE 3RY5A 2WP3T 4JO1H 1BD2A 4W81A 4LSUL 3AY4C 5HHOD 4PJHE 1WITA 1NDMA 2JELL 1LO3H 4WIQA 5ICYA 3X13A 4X7SL 3ALXA 4Y2DA 2R4RL 3LRSA 4KXZI 2R1XA 4X98A 1ORSB 5JDSA 2CUHA 2ZSWA 3MRPA 3WS6C 5EWIH 5C0AE 1AXTH 5GGTL 4G8GA 2HMIC 4YDVB 1OAKH 5IHLB 4WU5A 4ZFFA 2WBJA 2F8VA 1I1FB 3VXRA 1EK3A 3WXWL 5I18L 5TH2A 2OR9H 5F7EH 2ZUXA 2WINA 2ZPKH 3EYUL 1RULL 2V9RA 2VZSA 5DVNA 1EEZB 1YMMA 1G7MA 2NYYD 3O2VH 2W1NA 4H26B 4PREB 2HVKA 1IM9D 3LKOB 4I77L 4ZSOA 4JFXB 4L9DA 5F1IB 1AGCA 4RZCA 3FQRA 4OLXH 4DN4H 1OT2A 2B2XL 3V5DA 1LO0H 2FSEB 5T33H 3WFZA 2DYPB 3ARFB 3Q3GB 2C4FU 1I4FA 1CGSH 1PEZA 5EIIA 5CGYC 1OF2A 2FWOA 4OGXH 4P48A 4Y19D 5CEZH 4Y2DC 4O5LL 2XY1A 2AK4A 3UJIL 3VFWA 1S9VA 2CK2A 4LCIL 3NFSL 3GUTA 2NW3B 2Z93A 3PWLA 4R7DA 1Q9LB 3DRQA 4O51A 4ZO6A 2CKNA 3WFHA 3V5HB 3LRHA 3HCVB 5I75B 2WBJC 3QEUB 4K9EC 3LKSB 4ZUTA 4F58H 4K55A 3ILPA 4ODHH 3BVNB 1IM3A 1TVDA 2BP3A 3QDGD 2VXTL 2OP4H 2NY2B 3MRFA 2JB6B 2VUOA 4E9LA 2HT3C 4HH9A 4V1DB 1E4JA 3TZVD 4OGYL 1IJ9A 2XN9B 3OGCA 5IM7A 1SY6H 3PXJA 1WFUA 4EQ2A 1EHAA 3TO2B 1FZJB 4HPOH 5FK9A 4JN2A 3RPIA 2ORBH 5IB3A 5KTEH 1C5CH 5DJ8B 2PW1A 4RFNC 3ARDD 3GJFK 3UJJH 5JNYA 1S78C 4UDTB 1J12A 3QHFL 3MNZA 4ODVH 5KVGL 4G6KL 1YUHB 4G8FB 4BJLA 1YY8A 4K94H 4PTTA 4X6DA 4WW1A 1L7TH 3GBMH 2P8PA 1X5HA 4Q6YA 3IETB 4PJHF 4R3SA 1RZFL 4RGMB 4TUKL 5F7DB 4M6ML 4KKLD 1KCSH 3CJJA 5DTFB 4LVHC 4X4ZA 2R0WL 2AXGA 1TCRA 4S1QH 3MBEB 4G7VL 2J8UA 4FQHA 3WUWA 3FAXA 3PXHA 2ZUUA 3MRMB 3MLYL 5F1NA 4AENB 1HK6A 3ZKMC 1NCAH 4TOYL 1T5WA 4DKAA 4IDJH 4PJFF 3S36X 1CD0A 4YBHA 5JPMA 2N4IA 2OL3L 3VFTB 2YC1B 3AU1A 1QLFB 2DIBA 4GBXB 4A6YH 3BP5A 4G8EA 1F97A 3GFUA 5SX5H 4YJZL 3L7FB 4Q9RH 1RJLA 3GM8A 3PGCB 1JRHI 1EUTA 4PRPB 3PDOA 3GJFB 2BVPB 5BVPL 1JRHL 3TVMB 2GJZB 3SDXA 1S7QA 1JE6A 1FFPB 5EZJB 4JFZL 1OQXA 3OJVC 1CXEA 3CZJA 3FB5B 5FO7B 5DHXB 4MNGE 4OFDA 3LHPH 1PQZA 3X17A 2W9EH 1SEQL 1HHHA 5ESAB 5HYJD 2HLFD 2DQFB 4DKEL 3OKEA 1RUPL 4ODSL 5DS8B 4JRYE 1JZ7A 3BPCB 1K6QL 3FQTB 2ARJB 1OTSD 4GJTB 2ICEB 3AVEA 4NQEA 2JJSA 5IG7B 3UTPE 3DETD 3KPOA 3KLAA 3RKPA 3RX8A 1CU4L 1U93B 2BERA 4YHOH 4LASH 3I75B 3QR2A 2BC4A 4U1IA 4YFLF 1DQJB 3HAEB 5IQ7L 4GAFB 4ZS6D 2VAAA 3FMGH 3TYFB 1FFQA 2IQAA 1JGUL 2J8OA 3THMH 3TCLB 3QAZC 4Q7DA 1UWEL 1QRKA 5MI0B 1KC5H 4JVPA 1UT9A 3GHEH 5I8EA 2ZCHL 1CXLA 5F44A 1KIPA 5E9DD 1S7WB 3SDAA 2J4WL 5F97E 5GRYA 3MNWB 1EHLH 4WY7H 5JO5B 4NNYA 5EZIH 2BFVH 1HXYA 1FJ1B 3OMZA 3MOBH 1K2DB 4D3CL 1IC5H 3PGDA 4UNVA 2J88H 4OTXL 4JO4L 4LVNB 4P3WA 4HFWA 1OCWL 3CH8A 3HFMH 2YD7A 4MQ7B 3TNMA 2I9LA 2JJSC 4XVUD 4LDEB 4PV8B 3N06B 1KCUL 3WNMA 3TT1H 3UCRA 2C4FT 3S37L 5D1ZB 1L9NA 5IROA 1E6OL 1RIUL 5H2BB 4GG6A 2IH1A 4NQDB 5C0JB 4YIQB 2HVJB 3UBXG 1R0AH 5HDOA 3WJLA 2ZG3A 4H25B 4LSRL 2J12B 4XPBH 4NZJA 3UTTD 4G6MH 3VG0L 4GUPA 2XZQL 3SDAC 2A9NL 5I9QB 1EO7A 2AS5M 2BJMH 4LCCA 4FQPA 3TBVA 3QUMB 4MJIE 2D7TL 2P8LB 3CNKA 1ORQA 4U1GB 4O58L 3KLSA 4JY6A 3MUGA 4JGJA 2YSSB 3LZFL 2Y1VA 2CO6B 5GZOD 4OJFL 4L8BB 3MO1B 4GW1B 3FQXA 3P4OA 4MJ5B 3IVKB 3H7BB 5CGTA 2HG5A 4HIEB 4UNUA 1DSFL 4OUOA 2DD8H 1WAAE 4LSVL 5FYLH 4QRPD 3T2OA 5LWYL 2B7DT 4N1HB 3OKKA 4XCFL 5IROC 3IFPA 5FB8A 5IFAH 1LQSR 2E8YA 4ZXBA 5HI3D 5I1KL 1HHKA 1GAFL 2ILLA 4RISH 3WJLC 1JI1A 2Q8AH 3RNKA 1RHHB 3D18A 4C58B 1JF6A 2P1YA 5FYJH 5IW1B 4LCCC 4EI5A 4TNWF 3E1F1 3MV9B 1XGPB 3NA9H 4HIJB 4G3YH 1M71A 1VESA 4PGCB 4K9EL 2EO9A 2MKWA 1RVFH 4NRXA 1IZKA 3G5VA 3SJVA 3NZHH 1F13A 2OJZH 4PG9B 3CVHL 2KDGA 1F45A 4U1SB 5ETUA 3NN8A 1GXEA 5EBMA 4Z5RB 3C9NB 1ZANL 1MFBH 4JFED 5DD3H 2V9QA 3VXUB 5KW9L 2DTSA 4KZEL 3S88H 4G43A 2XACC 1CR9H 4P2QB 4ZXBC 1A1MB 5FV2A 4JFQB 2UZYB 4QKXB 1X6NA 2D4DA 1IRAY 3CSPA 5B3JE 1X44A 4J3XA 5E5MB 2JB5H 1B0WA 1I3GL 4ZUSA 4XWGL 2M1KA 3U6RB 3GRWA 2ICWI 5CP7A 2A1WL 4Q74A 4RFOH 3WDJA 1ZVHA 3T65B 1KJMA 1HSBB 1R3HA 1AD0A 1WSST 1Z0MA 5D2LB 4EI5C 1WZ1L 1JNJA 4OLZH 2YD6A 2JJUA 1WVZA 4JQVA 3QEGL 4G5ZL 2IPKA 3V0WH 4ZFZB 1T6VN 1MLBA 2DQUH 1Y0LB 5KOVC 5TQ0H 4JJ5B 4NQCD 3X14A 1BD2E 4Y16A 5KJRH 5D7SL 4YK4C 4LLMA 4M4PA 4NQXB 4TULL 5GHWL 2CD0A 5FGBA 4XPGH 2PYEE 5EPMA 3CFDB 4E42B 4P5KA 4I48A 3KJ4C 2HT2C 4ZUVA 1TTGA 4NHCH 2YA2A 1RJZB 4HUXB 3OKMB 1RK0A 5J1TC 4H20H 3MMEB 2OR8A 4I0PB 2Q1EA 4IEFB 1NJ9A 1RUQH 4Z0XB 1K5NA 3QPQD 1QKZL 5D1QA 2IANB 3KPMA 1F6AB 1YEJH 1T83C 1UM6L 5DO2C 1Y6KR 4Y1AD 1J8HD 4DVBA 1WAAF 1EA9C 4ZPVB 5BO1H 4KPHL 4OSUH 3O8XC 1U6AL 2AEWA 1YMME 4OZFB 4RMRA 2V2WB 5FHBL 5BMFL 2VN4A 5KBNC 4JQVC 3VFGH 2QSQA 3MV7A 4YX2H 1CK0H 1SEBA 2UZIL 2A9ML 3DGGB 5IVOA 4Y16C 4WU7A 5E1AA 1TZIA 1DTUA 4UV7H 1F58L 1R24B 3PWVB 2NY5C 5FGBC 5T3XH 2OMBA 2P47B 2YEZA 2M8XA 1HIML 5I15H 1MJUH 1VHPA 5ACLA 3L7EB 1UWXH 3E6HB 2D7NA 2RCSL 5J6GB 1SM3L 1CICA 1JGVL 1QNZH 5IB4A 3QHZH 1NMBL 3EGSA 3EDKA 4Q9BA 4WUUD 1EVTC 4FFVC 4KAQH 1G7PA 1NL0L 5D1QC 3ARGD 5FKPB 5DWUH 25C8L 3OAUL 1A2YA 5D6CB 1VFMA 1KCLA 3PWNB 3BPLB 1QACA 3M1BB 4HJGB 4CN6A 1A3QA 2DJSA 2QQLL 3MRLB 5ICXA 3RWDB 3QIUD 5C0RL 1NGPL 5KSAD 5FO8B 3QHTC 3PABB 2F8OA 2AABL 3G5XB 3MGTA 5C6TH 5J3HC 4OI9A 3RVUD 1TNNA 2BOBA 4MLSA 5IBLC 3WFEH 5J8OA 4YHMH 1DEDA 4QYOA 4PV9A 3B5GA 4MDIA 2LU4A 5EN2B 4X4MA 5JW5A 4OF8A 1N6QL 5DRXB 2FX8H 4K7PH 1IC7L 1RZKH 4PJEA 3L3IA 3MRCA 4Q0XH 1CICC 1JWMB 1XCQA 2NY4B 5E03A 3B6SB 4X6DE 1L0QA 5B39G 5B8CB 1DBMH 3HLAB 3WKMH 4IHOA 3U46B 3U1SL 3EYOA 2Y72A 3VWJB 4MJ6A 2C1OA 1QSEA 5TE6H 2ZCLL 2VZTA 4I13B 1MCSA 1WFOA 4XAWH 4ZOBA 1GGIH 1VB9A 2KUTA 2KQMA 2XKNA 1LO5B 3ULVC 1CFBA 3T77B 2HMID 4Y4FB 1XF3B 3MROB 4AEFA 2O5XH 3D2UD 3I02B 4HD9A 2D2OA 3C2AL 4MX7B 5HI4C 5C07D 5MEQA 2HYMA 5HYSA 2CQVA 4G9FA 3SDCB 1DEEB 3BHBA 1RIHL 1TZHA 4NNXB 2ZNWA 4LGSB 3BGMB 4WFHD 5BJTA 4LHUG 5I30H 3R06B 4DEPB 1CE1H 4HMCA 3CPLA 4QRRB 4YHLL 5MEOA 1WK0A 4AH2A 2QHRL 4RGNB 3JWDH 3X3FH 4O2EA 3EBAA 3P2TA 1L7IH 5J1AB 3PHQA 2JCCE 1MNUL 1LNUA 4JQIL 4APQA 4LLUA 1RMFL 2BNRA 2YRLA 1GL4B 5DEGA 1ZWIB 2UUDK 2NX5A 4P3CL 3V6ZA 1A3LH 3PP3K 5A16A 2BY1A 3SKNB 5E6IB 1YYML 2GTWA 3F58L 3RWEA 4FQ1H 4HKXB 5HHQB 3MLXH 3V5KA 1T3FB 3RDTD 3ALWA 3HZYA 1AGBB 4NQEE 3S4SB 1A22B 4G8GD 2BNUB 2IEPA 2FJGA 4XBGB 3KS0J 4JVUA 3WIHA 3FT2B 4O00A 4U6HB 2HLAB 2WBJD 3CFJA 1K9TA 2XRAH 2PKDA 1LO2H 3PP4H 3D1MC 1U41A 1KPRA 5CKAA 5E5RB 4JPKH 1CVRA 2EZ0C 5E6ZA 4F7CB 4XP5H 4YPJA 2FO4A 2JJTA 1SJEA 1U8JB 2HT3D 2VLMD 3U9UB 4U05A 4YE4H 3SDDB 2W0PA 5FUZL 4APQC 1EJOL 1FN4A 1I1AB 2H8PA 4MXVE 5D7IB 1J10A 1NANI 4IJ3C 4J1UA 1DBAH 4R2GB 3RHWF 1QBAA 2EH8L 2BCKB 3PL6A 2PF6A 1S78D 2X1QA 3GJEA 4I0CC 5TGBA 1UZ8A 3RA7L 1D6EB 2AK4D 4NYLA 3BEVB 1A7QH 3KR3H 2XZZA 1XZ0B 3QCVL 5I8OL 4JPIB 3WFBL 5E70A 4KQ3L 4KC3B 4X6DF 1S7UA 5HHOB 1B4JL 1CDUA 2EE6A 2G75A 1G7IB 3DECA 3OR7A 1UM4L 4QTHA 3DUUA 4A2MA 3VDBA 1SYVA 1H3UA 3MODL 4PR5B 5E8OB 1NGYA 2J8UF 1RI8A 4ZFGH 1WCQA 1A7NL 2PNDA 3OPZH 4U1KB 1U8HB 1IC4H 4WWKD 1CF8H 5GQBA 1F11B 3GNMH 1NBQA 2X2YA 2AJYH 4DFHA 4HFUH 1NCDH 3U7YH 3UC0H 3X11B 3V7MA 1OSPH 4JGUA 1W72H 1A9BB 4MD5A 4OZGA 3GEWB 3PL6C 4ODTH 4XX1E 1A47A 1I7UA 1UKTA 4W6WB 5DJAB 4ZD3L 3ZZ1A 1N8ZB 1ZV5A 4MSWA 5EG6C 2YUZA 4GMSH 4O2FB 15C8L 1IM9B 4ZOAA 3ZKQD 1JYVA 4L8SA 4MXWH 1MCRA 4NT6B 3JV0A 2JF1A 4EBQL 3EZ8A 3OF6D 1OAZH 1RZ7H 2Z92B 4YAQB 3GRWL 1EMTL 2BXZA 3ULUD 4RMVA 3VRLF 5E08L 4Y19B 1AKJA 2EEDA 4WI7A 3K1KC 4ZAKD 2AERT 1MFAL 3TBWA 1FPTL 4KTDL 4X8JA 1I9RH 2VE6B 5ALCL 4R90L 2A83B 1RQ5A 5B22A 2NY5L 4B53A 3O3BA 3KYMA 4XNZC 4JPVL 4ZQKA 3HZKB 2V17L 4OF6A 1NAMB 2OTPA 1JFQL 5HHVH 3RL1A 4PIRF 5FO9B 3KPNB 4YXKH 2VDPL 4LSSL 5HD8C 3TZVB 3MLVL 1W72B 3PNWA 1QVOB 2ADFL 2F54A 1JNHB 4UAOC 3UEZA 4UT6L 4KMQA 1ADQA 3HKFA 3SJVE 4L8SC 3BKCL 4MXVF 1SJXA 1G7HB 4PRHE 3BW9B 3ARDB 3ZT7A 4P0DA 2GUOA 3I2CH 4N68A 3IDJB 4UUJB 1C5DA 1A14H 2J7LA 3OJ2C 5FF6A 4NOBA 1OPGL 5E8EB 1I85A 5JZ7D 2YA1A 4MAUH 4OKVA 3R8QA 3FO2B 4X6CB 1A5FL 3MRKA 4N90E 2XTJC 3QUZA 3KHOA 1AFVL 1YEHL 4NJ9L 4X6BA 3GBNH 1QTYT 4L5FL 3IF1B 2FB4L 1WQVT 2NZ9C 4W6YB 5GIRB 1JWSB 4CJ0A 5J9PB 4U1HB 3CDCA 1IEBA 4PY8J 1D9KA 4RIRA 1HKLH 1CTOA 1MLCB 3I9GL 4YNYB 1UWGL 3UXFA 2BNQD 4PRNA 1P6FA 3S3SA 1MCQA 2EICA 2HJFB 3ULVL 4HUMB 1F5WA 1ZT7B 4FFZL 3MRJB 1KCRL 4TVPL 2K1MA 3HPLA 4AIOA 1NKOA 1CI5A 3ZDXE 5D9SA 5EZLB 3TBSA 4WCYH 1K3ZA 4RSVA 5TF1H 3BPOB 1BFOA 3QPXL 4M8QA 3VXNA 3BPNB 4LDOB 1ZT4A 1KEGL 1I7TB 3DI2B 4HK0B 1SQ2N 1IQWH 2FNBA 1DDHB 2IFFH 3QUZC 3U36B 5KAQF 4OUUA 5EU6A 4NN6C 4L8CA 5HYJB 3U0PA 2PO6D 4LLYB 1FV1A 3FQNA 1NC4D 5KG9B 1MAKA 1UB6A 1KGCE 5LCVL 4NWTL 1D9KC 2ZOLB 3MV7E 1X9QA 2PN5A 5A2IH 2V5MA 3UTZA 4Q9CA 4L3CA 5E94A 5IV2A 1QBBA 3DMMC 2APWA 3MJGX 5KS9E 4HKJA 2PETA 4WO4B 2G5RA 1ZE3C 2UV3A 3OAYH 1VACB 3P77A 5DRNB 2QQQA 1LHZA 4EIZC 2J6EH 5E7FA 2N7BA 1AXSA 5J1SC 4PP1D 1XEDA 3PV6A 4OFKA 1NAKH 2NY0C 3VU2A 3JWNC 5E9DB 1VFBA 3JXAA 4JFYB 1QRNA 2HP4A 4JKPH 3VFMA 4R8WL 5KSUB 5DI8B 4D0DA 5EO1B 5BW7A 3K0WA 5D72H 5AD0B 3BZEB 3EZJB 3GMLB 3MBXL 1HNGA 1ZK9A 2LQRA 4JFDA 3UTSA 4HCRA 4M61A 2DBLL 3H9SA 5DUMH 1P5VA 4XNYH 1DFBH 2ARJQ 2OI9B 4QLRA 1RIVH 1QFUH 1VERA 2C3VB 4KTEL 4IMLB 2VLKA 3E3QE 3ZT5A 2B0SH 3QRFM 3MV11 4MDJB 2FBJL 3QUXD 5EU4A 5C0ND 4I9WD 1NEUA 5JMRA 1C7SA 3FT3A 2AJUL 4X4ME 1DZBA 2GSIB 3PJSB 4YHIA 2AJVL 3O3EA 2FH6A 3LH2L 4EI5D 5C2UB 1FGNL 1BM3H 2IPUG 4PGEB 1OAQL 3TH2T 5IBUB 4YBLB 3N50A 4GRWF 3WIHL 4WV1A 5JXAH 4P23A 2X89D 2ZZUT 1ODAA 4KKAD 2QBWA 3GIZH 4XCCH 4U3CA 3LEVH 4JREC 4PJIB 3NFPA 1A3RH 3UTTB 1HEZA 1DQLL 2ZUYA 4PJ8A 1UXWA 1HYRC 3UZQA 3MRHA 3HI5H 5BW7C 2ARWA 1Q94A 1K8IA 3LCYA 1U3HA 2HT2D 3GMQB 3ZYJA 4FQJH 4C4KT 4JKLA 1EVUA 4FQIL 2XKSA 4ZNCD 2NTFA 3ZDXF 5CCKL 5CBEA 4GAYB 3SBWA 5ILTH 2P5WA 4HUWA 3F6LA 3NZ8A 1MVUA 3QUYA 1A7PH 4G9FE 4HG4J 5JXEA 3UYRH 1TLKA 4KK9D 3O8XD 4DGYH 2VDMH 1HH6A 2C3GA 3FONB 3MQIA 3GSRB 1U8PA 2HFEA 1C08B 3TPUB 1ZLSL 1FC2D 1Q38A 1F4YH 1MIEL 2VDLL 1FVDB 3H42H 3LRGA 5TDPB 1FORL 3MCKA 4WV1C 4K2UH 3MXVH 4P23C 3QCTL 3R4DA 5MHSD 2GFBA 4KK6C 3CFCL 4BZ1L 5KS9F 4CU8A 5FYKH 2NX5E 3RWCB 4V2BA 4PJ8C 1ZTXL 1SJVA 1DE4A 3KYAA 3QZWA 3MOAH 4DJMA 4DGIH 1U3HC 4W4OA 3G6DH 3KDMB 1BOGA 3OB8A 1O7VA 3VXPA 4JN1H 4D9LH 3GZKA 1RU9L 3QUKB 5FECB 3O9WD 5EU7C 4ZUWA 2WBWB 5IVNA 4I3SL 4XPFH 4FFVD 3RNQB 1N64L 3FKUS 1CD1B 1IKFH 1CFNB 3QUYC 1Q0YL 3RWHA 2F53A 1I8KB 4CNIB 4N0UB 2UZXB 4J3SA 2DJ4A 1DBKL 4HWBH 4XC3H 3QIWD 1NGWB 3ES6A 4JFEB 3QXUA 4ZTOL 2EH7H 5DURB 4PJDA 4OV6F 3TP4A 3UAJC 3MFFA 3ZKNC 2XQBL 1PLGH 4N8VB 5D7LD 4IDLA 4WTWA 1XF1A 5L7XL 5I66B 4LCYB 4K3GA 4P5TA 5IBTL 2AEPL 1MREL 5GISL 3QQ4A 3ALPA 1DBJL 2YR3A 2E6QA 4P4RB 1ZOXA 3V0AC 1EGJA 4UU9B 2YD4A 1NGQL 2ICCA 3MLZH 4UDUA 1S3KH 2OK0L 2EDFA 4DVRH 4G8IB 4NKOB 4NQCB 3BT2L 2IAMD 1JN6A 1E6JL 1A0QL 2DQHL 4JPWH 2B20A 1T22A 2JE8A 4PB0H 3VD3A 4E41E 4J2XA 3DVNB 1CL7H 3L3HA 2CXGA 1AGEB 1OAYL 1I8IA 2OL3B 1LE9A 5D6DA 1XR8B 2R0LH 2XNAA 1TENA 2VXUH 2I07A 4JM2A 3ULVD 1IGIL 1QLRB 4TVPD 1ADQL 1JUFB 2C3XA 4HQQL 1QHOA 5D93C 1EBPA 4LHUD 5DUBA 1MUJB 3HMWH 4Z8FL 3QG7L 4N9GB 1J8HB 3CLFL 4NZUH 2DOCA 4P5TC 3TIDB 3P4MB 1KPVB 2AJSL 1B4RA 1JYNA 2A74A 2WQ8A 3N1MC 5LXGH 1KJVA 2K7QA 2F74B 5LGKA 1CG9A 5IMKB 1LDPL 4LPXA 3PE9A 4FQQA 3IGAB 1KXQE 4GAJL 4M1CC 4FZEL 5BVJB 4EZMA 3VE0A 3QDHA 4L4VA 5AWNL 4CUCA 3F65A 3S97C 3V8OA 2GITB 3JV5A 4HLZG 4OKDA 3VGAC 1DJSA 43C9A 1ND0B 1QSED 3PQYA 2DQTL 3TGXA 4F7TA 1N3NB 5I1GL 1F4AA 1E4XH 1OB1B 1IGFL 4CDGC 4X0KB 4NN5B 5D6DC 4YQXL 1P53A 2AXFB 2I25N 4ETQB 5BXFA 1YNTB 4JM2C 4HS6A 4WUUB 4MD4B 4DN3L 4Z78B 4Q9QL 2XTJE 5CGMA 5IF0B 3FB6B 3ARGB 3LEXA 3JWOC 3BAEL 3SKJL 1Q9OB 2PYFA 2ITCA 1IBGH 4IRJD 3SQOH 3WSQH 4HZLA 5C1MB 1H3GA 4YXLH 1JZ6A 1T4KB 4NOFA 1YNKL 2BMKA 4WW2B 4XAKE 4FXGB 1OP5K 1S5IL 2DWEA 1ROWA 3QIUB 3EOYG 3FRPA 5E8PB 1YQVH 4JR9H 4ODBD 1A1OB 2EKJA 3NPZB 4OQTA 3WHXB 1QO3A 2KL6A 4XPHH 4APQD 5GRWA 3L6FB 32C2B 3EW3B 1QLEH 3S34L 3R1GH 2DRUA 4NO5B 3FOMA 4LAQL 1J7VR 4ZYKB 2YPKA 1TDQA 1UM5L 2FDBP 3D3VE 4Z76A 3OKOA 1UKSA 2CLRA 3T0EE 4WFFD 4IOIB 3UYOD 3RVTC 3HB3C 3EYFA 1HOCB 5CP3H 1FDLH 2B1HH 1JNNL 1ZLVK 2C3HA 4HUUA 5BRZD 5HHME 1V3LA 1CGVA 3TT3H 3U0WL 4Z7VA 1VCAA 4LNVA 2MKLC 2W9DH 3KPQA 3X12B 4IRSD 1UACH 3OR6B 4XC1H 5ESVB 4QRTA 4XVSL 2XWJB 4L8DB 3CLEL 3E8UL 3OXRA 3PHOB 1D5ZB 3RY4A 5CD3A 3D2UB 4QOKE 4Q2ZB 4WTXA 5CEYB 3GIVA 2EYSA 5C07B 4DOHE 4TQEH 2HFGL 5IMOB 1CBVL 2DDQL 4BUHA 4YUEH 5FCSH 4LPCA 3WBDA 3Q0HA 4IOSD 5DSCB 1KJ2L 4OZGF 3PL6D 4MAYA 4HCRL 3WEXB 4ONHB 4LSDA 5BZDB 3F6IA 4NQTA 4DQOH 3IXAA 1MCFA 1BBJB 3ZE0F 2YRZA 1A9EA 1P4BL 1L9MA 3L3OB 4HWEH 3IDUA 4MA3B 1DN0A 1G6VK 3S5LA 5F6IC 3LD8B 1UEMA 1UB5B 3EYSH 3LKRB 1BGXL 4HHAA 3UO1H 5BCAA 4P59L 2V2XB 3LRSB 4HJ0C 3QO1A 4LQFH 3TYGL 4DCQB 2X4QA 3O45A 1NH6A 4XVJH 3RDTB 1WBXA 5T3ZL 4GS7B 4M1DL 4TSCH 4G8GB 3EOTL 4EUPG 5F8RC 3SCMA 1NSNH 2CDGA 3HE7A 4N0FB 5IB1A 2WBJB 4N1EA 2G2RB 5ISZE 1IQDA 1F4HA 1IAKA 1JHLH 1I9JL 3EFDH 1L0XA 1VKXB 3CVHB 5E4EB 2QQKH 3DSFL 3GKWL 3ECBB 4MAYC 3Q6GL 5DJZA 2CIIA 3VW3H 1XGUB 2YOCA 4XCEA 3VFVA 4KFZC 4CBPA 3C6SA 1J1XL 1FIGL 2V7NB 3D69B 5EO9B 5TDNA 1MCWM 2EDWA 1P1ZA 4TRPL 1G7LA 4JFFE 2BVOB 5DMKA 1S9XA 2J8HA 4P46D 3T2NL 3FT4B 4RFNB 2YD1A 2VABA 1TTUA 2R2BA 3VXSA 5DJ2A 4ZFOB 3TCXA 1AR2A 3CFEA 3VXMB 2B1AL 3H9SE 1H8OA 1S9VB 4YBQD 3QWOA 1AD9A 4YDLC 1X7QB 3HC4L 5IMLA 2ICWB 5EBGA 3TLRA 2VLKE 1OAUL 3HZVA 5INDA 3SO3C 3IT8D 2F58H 2XXCB 3SCMC 2HN7B 4P9HC 5BS0A 3HE7C 1MJJA 5DHVA 4HEME 3PWUB 5CJXA 4NBYB 5GS2H 1S9YB 4NZTL 4M7LH 2VZ1A 4J4PA 4LSQH 2DN7A 2AI0L 4IM8A 5GJSL 5J13C 4ERSH 3BP4B 3BKML 3T1FA 1J18A 4KROD 4WWKB 5KSBB 4WFGE 3BEWA 3HR5B 5T3ZE 4LBEA 1FCCA 1U36A 2ESVD 3B9KB 4MA7L 4KHXH 2PUQT 5T1LD 3SE3A 3CH1A 1BQHA 3W82A 4U4BA 3MLRH 1MHEB 1VEPA 4HF5H 2NY3C 5EDXA 5EU7E 3O6LL 1G6RA 1DANT 3QQ3A 4P2OC 2VC2H 1M7IA 2NY7L 1SJHB 3AC0A 4H8WC 2XI9A 2Y07H 4HGWB 4NO3B 4KKCD 3BQUC 4N8CH 3GO1L 2YBRB 1EGJL 3H9HA 1PY9A 5JORA 5CJXC 2MCPL 1BJ1H 4RMSA 2DLFL 4ZAKB 2BY3A 5F3BA 5E2JA 2EEBA 2XIDA 3HC0B 2AJZB 3BSZL 4J4PC 5C9JB 4PJGB 1DQDH 1KB5A 2HFFA 2OQJB 3S7GA 1D9KD 3B9DA 1WZLA 1H15B 3GB7B 3DMMD 3FZUD 5FGCB 1CWVA 3G6AA 2DI7A 4PLKC 1KTLA 3O6FC 5HI5D 4R6UA 3O6KL 5DD0L 5D1XA 3G04B 3SE3C 4HIHA 1ZSDA 5SV4A 1FYTE 3MLTA 3QAZB 1R5IA 4GG8B 3ZTJG 4R4NC 3MOQA 3O2WH 4PY7B 3C6LA 2BSSB 3W9DB 3JWOL 2NY0D 4U1MA 5M7QA 1YJDC 2VQ1A 3P73A 3BESR 2V2TB 1F4XL 5EOCH 4PJ5E 5GGRY 1OARL 3VFUA 1M7DB 4WI8A 3NTCH 3RWJB 3ZYOA 4G7YL 2D9CA 3P9WB 1FVEB 5EU6D 2Z8VC 1PQZB 2GW5A 2YXFA 1H0DB 2Y6SC 3B2UC 4KMTH 3MXWL 5L0QC 3HZMB 4MGXA 3VD5A 4XMLL 3KNBB 3UDWC 5D7KE 1ORSA 4TTDD 3AREB 1TMCB 4PJCB 3MYZA 2CLZB 3P30L 4OCYL 5EA0H 1AR1C 1FCGA 4U1IB 3UBXB 5ELIA 1FG9C 3K46A 4YDVA 3BE1H 2YUXA 3FOLB 1NBZA 5I8KL 1PKQE 5B4MC 4JFHE 4R0LC 5L6YL 3IDMB 4NKIL 3C6LC 1I1FA 1YC7A 1RSFA 1C1EH 1KFAL 3GMMB 2FX9H 1G0DA 3QG6B 2BNQB 2ZUQC 4OLEA 3VFOB 1HH9B 1EEZA 2XZAL 1URLA 1YY9D 4JO2L 4PREA 1E28B 3TM6A 3K8MA 3ARXA 5ACZB 3LKOA 4YDIL 4JFXA 5F1IA 1LK2B 5D2NB 2E7HA 1HCFX 3GHBL 5DD6B 3UTSD 2DYPA 3ARFA 3Q3GA 1HHGB 4QXTB 5F7UA 3BUTA 5EZOL 3TPKA 4D0CA 4DKFH 2DI9A 4M5ZL 3BIKB 5SWZA 5LBSH 3RWGB 1WIOA 2ZOKB 2IQ9L 3S37X 2PO6B 2NQCA 1Q9LA 1KN2L 2X4SB 3NACH 4GG6B 1NC4B 1Q0XL 4NCC1 3HCVA 1YYLH 1P4IH 5C9KA 4GAGL 3QEUA 3LKSA 2Q7YB 2VR5A 4NC2B 1J1PH 1N5AB 4F7PB 3BVNA 4H1LG 3Q6FB 2XZCH 4P23D 5TE7L 3Q1SL 4KH2A 3STZB 4KK6D 4GUPB 2JB6A 1MCEA 4ORGB 5J06A 3IDYB 3PQYE 2GY5A 1FSKB 2XN9A 3I6LD 4XP9H 1U8OB 3QFJD 2R1WA 2H6PB 1X5LA 5TFSH 1U3HD 4R7NB 5E6YA 1FZJA 3TO2A 4MZ3A 2H2SD 4XBEH 2AXJA 3BDYL 2V5TA 5DJ8A 1NMAH 4U2ZA 6FABL 3ARFC 3V6OE 2P5WD 4IRZH 2FD6H 4UDTA 4AMKH 3F7VB 1YUHA 4G8FA 3MCG1 4O02H 4URTB 2AK1L 3P40A 4NIKB 4OFVA 4YWGL 2FIKB 1CGUA 4PJDF 5FB8B 3IETA 4PS4L 1VENA 1H3PH 1YMHB 3ZKND 4EN3A 5I75C 5T1DL 1F02I 5F7DA 4BH7B 3MLWL 2N7AA 5DTFA 1BAFL 1W2KT 2UWEE 3X3GH 2Q6WA 4P2RD 1NCCL 1PSKH 3A6CH 3K2UL 3QUXB 3MBEA 3U7AA 4YGAB 4UB0H 2DM4A 1XGRB 1XGYH 1SYSB 2CK0L 3QDAA 4TSAH 1MRCH 3MRMA 3LOWA 1BZ9B 5BZWA 3ZDZE 4AENA 1F3DJ 3KPRD 4AEIH 4P9HL 3VFTA 5FDWB 5AZ2L 1QLFA 4GBXA 3A0OA 4M3JA 1E4KA 1TVBB 3L7FA 1Y6MR 1EFQA 5C0GB 3PGCA 5GS1B 1QR1B 4PRPA 5C0CD 4ALAH 2BVPA 1WFTA 7FABL 3TVMA 2GJZA 5DT1L 3EO1A 1NCBH 1N4XL 2CRZA 1FP5A 5GS3A 2X4RB 4M7JL 1FFPA 4LOUC 5EZJA 4DUVA 1MFDL 5I1EH 4JKKA 3FB5A 3D85D 5FO7A 1DLHB 4RGMC 5ANME 4EN3C 3BO8B 1FNSH 3DO7B 4N0CD 5ESAA 1I1YB 2DQFA 3DV4A 5FM5O 5DS8A 1LDSA 3MBEC 3BPCA 3FQTA 3O8XB 3TEUA 4FG6D 2ICEA 4U31A 5IG7A 4M3KB 5HVGB 5M95B 4F15B 1IZJA 4LPTA 4PB9L 1U93A 4OLUL 4H8WL 1UKQA 4QXUH 3I75A 3M8OL 3V4UL 1DQJA 3PP3H 4WTZG 1ZAGA 4LRNL 2D3VA 4D9RE 3TYFA 4GBXC 3TCLA 1A6VH 3BFOA 5I1CH 2NMSA 3ZL4H 5LGJB 1F90L 1NDGB 4EOWL 3DGCR 4R26L 1OM3L 3LQAH 3TVMC 4Q58C 4ZUVB 3ARBD 3KYKH 4B41A 1S7WA 3OKDB 4JM2D 3O9WB 4QRSB 1J0KA 2ZUTA 4OB5H 4K94C 3MNWA 4K23L 4XTRC 4OZHB 4YR6B 5JO5A 1QBLL 2XFXB 1FO0H 1RZIB 1FJ1A 1KYOJ 1K2DA 2CKBH 3FO1B 1TTFA 5F7LB 3W11D 3QIWB 4JG0H 1AGDB 3CCHB 4MQ7A 1YJDL 4QY8B 1G6RL 1V7NL 2DQGL 3NGBC 1HINH 3DVGB 5JHLL 1I7ZB 5JIIA 3ARUA 4FABL 4TNVF 4PV8A 3OHXB 3V4PL 5JR1H 2YS4A 1SMAA 3DURA 2QV2A 3SE8H 4BZ2L 5D7LB 1AO7B 1LP9B 5D1ZA 2VKWA 5K33A 3QISA 2UWEF 4P49A 5H2BA 2ZKHL 3IKCB 4S1RL 2HVJA 1BVZA 1RUAL 1P7KB 4H25A 3IDGB 5MP6H 5ABDE 4LEXH 5B39B 2HWZL 4X5XB 4JJHA 1KB5L 1MF2L 3N1PC 4XNUH 2XA3A 3UJTH 3F12B 3VDAA 2IAMB 5DUPL 4KVNL 1O7SA 1IFHH 1CXIA 3RX7A 3QUMA 4J8RB 1KEMH 2P8LA 3RI5K 1S7RB 5K9QG 4QHKJ 5ITBL 4YXHL 3ZKXB 2YSSA 5H35B 4LVNC 3DXAE 1PJ9A 5I1IL 4L8BA 3BD3A 4GW1A 2B8OT 3IVKA 4MJ5A 3OKYA 3H7BA 4HIEA 2CSPA 4J3TA 2UVFA 1T0NB 4MHHG 2WUBH 5D71L 2NLJB 3N1QC 1T80A 4Z7WB 4KJYB 4LHUB 1UCTA 2IADB 1A1NB 1VFUA 1CFVL 1T2QL 4PY8I 5H94B 2EXYD 4MXQC 2WSKA 2BOBB 4PJ7B 5LQBL 3HR6A 2HJLB 1GIGL 4MDIB 2R0ZL 3B2VH 5JHDD 4LU5L 4XP4L 4PJEB 5J57B 2BVQB 1RHHA 43CAB 1XCQB 5I9QC 4MMXC 3ZTNL 2NR6D 5IW1A 4YDKH 1NBYB 4MS8D 1LE5B 3QBTB 5JOEA 3MV9A 1XGPA 4U1GC 5E00B 1JHKL 4HIJA 4PPTA 1QSEB 5K9OB 4PGCA 2FCBA 4ACPA 5IFHL 1N26A 2X44D 4GMTH 5LGHL 2X7LB 3TNNB 5LJYH 4PG9A 3T4YB 2CJUH 4U1SA 2PXYC 4CU6A 2DM3A 4GW5B 4Z5RA 3C9NA 5I76B 4M43H 3VXUA 4IRJB 3W81A 3BHBB 1X5IA 5FUCC 1NFDB 2Q8BL 4LKCB 4P2QA 1A1MA 1U95B 4JFQA 1DL7L 5FEBA 1BPVA 4JO1L 3BUYB 2EECA 4O4YH 4APQB 3C5ZA 3C8HA 5DEGB 5EUOB 1LO3L 3UPRB 3O2DA 4YFDB 3T65A 5D2LA 1DCLA 3V0VB 4ZFZA 1Y0LA 1D5MB 5EWIL 4JJ5A 3CSBA 4PUBL 3V6FB 1OAKL 4NQXA 1QFWH 2K7PA 1ZHLB 5BRZB 2R2EB 3AS2A 3CFDA 2D03L 4E42A 4XH2B 4YDJB 1PGRB 5DGRA 1J8KA 2OR9L 1RJZA 4M48H 2BY2A 4HUXA 5F7EL 2A38A 3M45A 2ZPKL 3OKMA 3EOAB 5CWSB 4IRSB 3MMEA 4I0PA 2RFXB 3FFCD 4HULB 3V52H 3EO0B 2IANA 2Y7QA 1F6AA 1MCCA 1A7OH 2ADJB 4OLXL 4DN4L 3DRTB 3H9YA 4RAUB 3AAZB 4ZPVA 2VLJD 1S9KC 3T09A 3C5ZC 2H8PB 3B43A 1CGSL 4OZFA 4LK4A 4OGXL 3EJJX 3T0VA 5CEZL 2O5ZH 4BFEA 3PL6B 2P4AB 3MGAA 3VXSD 1ZEAH 4FQ2H 1AH1A 3DGGA 1AIFB 1A6UH 2BVTA 5HDLA 1NBVH 2EDOA 2OJEB 1JPGA 5EU5B 1XGQB 1R24A 3C87A 4OFIA 4P2OD 3PWVA 3O3AB 2XG5A 3RZWA 1YEIL 4F58L 1HYSC 1CLOH 2KZ1B 4ODHL 2G75B 3E6HA 3L7EA 3BQUD 4U7MA 5BS0D 4ELKA 3LQZB 3MYJB 2EIBA 2DBJA 3AM8A 4RGOL 4LPYA 1MVFA 4NDMB 2H2PC 4ZG1A 3WHE0 1CLYH 4OM1H 4X7SH 4K3EH 5FKPA 5I1JH 4OF3A 1CIUA 4HPOL 5D6CA 2ORBL 5KTEL 4XNZB 3CDGA 1C5CL 3GSVB 3HC3L 3M1BA 4HJGA 1N59B 4PYHA 3MNVB 5DDHB 1CS6A 2CUIA 3O6FD 3UJJL 5FFLA 5IGXL 3MRLA 3RWDA 4PRAB 4NPYB 4V1DE 5FO8A 4ODVL 3PABA 1G1CA 2XN9E 1PDKA 3RJQB 3OG6B 3GK8H 3D5OF 3G5XA 4K94L 3FB7B 4NZRH 2BHYA 3LKQB 3GBML 4MNQD 3VMPA 1JZ3A 5EN2A 4P46B 4BQ6A 1BBDH 5DRXA 4ISVB 1XH3A 5CEZE 1F4WL 3MGOB 1JWMA 5LAXB 3NABL 3B6SA 3AM8C 3V7AE 2W91A 5B8CA 3HLAA 3EJYC 3TBWB 3P9MB 1NCAL 1EHXA 3U46A 3S8WA 3VWJA 4IDJL 1GGBH 3SE4A 1GGCH 2MSPA 3BPLC 4LCIH 1LO5A 1H3XA 4DTGH 4Y4FA 1XF3A 3MROA 4JANB 2P5ED 2XPGB 2JK5B 3I02A 2CPCA 4ZMAT 1D5XB 4MX7A 4JDZB 1DN2A 4NN7B 2MMXA 1FRGH 4KROB 3SDCA 1DEEA 3SOBH 4NNXA 4MHHI 2X1PA 3BGMA 2DAVA 2ESVB 1IGCH 3LKNB 3R06A 4E0RB 4QRRA 1OTUD 5T1LB 5DFVC 4G9DB 4PRPE 4CVZB 5J1AA 3VFNB 1FLRH 1C5DB 5F7YC 1DQQB 4XHJC 2NY4C 2O26U 4NSKB 5E0QA 4S1SH 2HKFL 1LMKA 5B8CC 4OKVB 1MCPH 3GSWB 3WE6B 4XPAH 4YHOL 3VWJC 2EC9U 1HHIB 3SKNA 4G6KH 4KJPD 5E6IA 3SE4C 1WWCA 2VZ3A 4XPTH 3GSUA 3FMGL 5HHQA 2GT9B 3RRQA 3THML 3N85H 1T3FA 4J7RA 2Y06H 4RRPG 1E4WH 1AGBA 3S4SA 1KC5L 2BNUA 2F5BH 4F8TA 4XBGA 3M07A 3LB6C 2GCYB 1RZFH 3K8LA 5CJOH 1BIIB 3FT2A 3SDYH 4U6HA 2HLAA 4IS6A 1D9KB 3QUML 5CIPH 2MCG1 3SDCC 3BKJH 4G7VH 3DMMB 1EHLL 1CTNA 4F7CA 1F6FB 5DK0B 4WY7L 2OYPA 5GGVH 1U8JA 1JPST 1HCVA 4WNQB 1K4DA 5EZIL 3U9UA 2BFVL 5I74C 3MOBL 3SDDA 1IC5L 4S10A 1I1AA 5D7IA 4C57C 1U58B 1RZKC 2CLVB 3NOIA 1J0JA 4QCIB 2BCKA 3F62A 4U1NB 4LMQE 3TT1L 5BVPH 5E6IC 1D6EA 4S11A 3BEVA 4F33B 4JRYB 1XZ0A 5SWZD 2WBKA 4JPIA 4MD0B 3U0PB 5E8DL 5HHOA 4YH6A 1R0AL 4XPBL 1G7IA 5FIEA 3TA3D 1ONQB 5F9WC 4AY0A 1KSRA 4G6ML 5DQJB 2NW2B 4LNRB 3K1DA 2BJML 3EHBC 4JCLA 4PR5A 1CGXA 4NQDE 4QT5A 4EDWL 1JZ5A 2J5LC 5E8OA 5CIPB 3VGHA 5E2VH 1MSPA 3HRZA 4U1KA 4YPGA 4JQXA 4ONFH 1F11A 1S7TB 1CCZA 2SEBA 3IFLL 3T1WA 4XZUB 5IESH 1EAPB 1I1AC 1YDPA 3JWDC 4EI6B 3X11A 5F7HA 3ULSB 4X9BA 2D9QB 4R2GC 3F8UB 5F9OL 1A9BA 1UWEH 1N2RA 1VFBB 2DD8L 2FJHA 4KRMB 1A6AB 5EULV 2YMXH 5FYLL 5KSVB 3VFMB 1S5HB 1X5ZA 3V2AR 5DJAA 3RVWC 4PTUB 3JSSA 1K4CA 4O2FA 3BN9C 1IM9A 1YECH 3S9DB 4AEHH 3MRRB 3PDDA 1I3RB 1DBBH 5IFAL 2BVEA 1A21A 4NT6A 1KJ2B 2QJDA 1QFPA 1KUMA 1HZHH 2Z92A 4RISL 3INUH 4YAQA 5DVLA 5ICZB 3O2DL 4TN9A 1U3YA 4Y5YB 4Y19A 4EN3D 1KCVH 1OP3K 4D3CH 4G6AC 3WNKA 5FYJL 5L2KD 2VXSH 4KRLB 2VO5A 3ARQA 1ZA3B 2VE6A 4H0HB 3NA9L 2A83A 5HGBB 4G3YL 2W07A 4JDVB 5I2IB 1ZHKB 3DUHA 5F6HJ 1EEYA 1U92B 1RVFL 3HZKA 3BD4A 4GO6B 3S37H 1EEUA 3NZHL 2PTVA 1NAMA 5HDQH 2OJZL 1A6ZA 3FO0L 5FO9A 3KPNA 2D7PA 3NA4A 3QDMD 1OL0A 3KLDA 5SWSD 4CL7A 2NYYC 3TZVA 1UXWB 3AUVA 4LSRH 1W72A 1JJUA 3QFJB 3S88L 1JNHA 5IW3A 1U3HB 3VG0H 1CR9L 3FO9B 3FN0L 2AGJH 3NCCB 4LLQB 1G7HA 3BW9A 3VMOA 5IHZB 3ARDA 4GKSB 4DGVH 4UUJA 3IDJA 5JW3H 3C60B 3KXFD 2JB5L 3NZ8B 1MVUB 3VXUE 5E8EA 2X4TB 5CD5D 3P0YH 4P2QE 5C0IB 4BFBD 4OLZL 3FO2A 4X6CA 3V0WL 2KZWA 4LSVH 2DQUL 5TQ0L 1GSMA 2E9IA 5KJRL 2R15A 4P2RB 3IF1A 4JY5H 5C70A 5GIRA 1JWSA 5J9PA 4LVEA 4U1HA 5D2LE 1MEXH 1AGFB 1CIDA 4NHCL 1GAFH 3D9AH 3FJTA 3VRJB 5CMAB 1MLCA 3SGDI 3WS3B 4HLZH 4YNYA 5EOTB 4H20L 1EPFA 3REWB 3KPRB 4PJBB 1RUQL 1JMZA 1LEKB 1BJ1J 5KVMC 3OX8B 1YEJL 1R3JB 2HJFA 3ARDC 2E9BA 3TWCH 1F2XK 1ZT7A 3MRJA 2AQ3A 5CLTA 2EIZB 5C0CB 3WIIH 3RWHB 1U2HA 1OGAE 3CK0H 2J3SA 3ES6B 4XMKH 2IANE 3RVVD 4XP6H 3SQBA 1I7TA 4HK0A 4P4KD 3VFGL 1VGEH 3KYNB 1DDHA 3L3DB 3D85B 4HV8B 3U36A 2CDFB 4XCYA 4KKLC 4UV7L 3CC5B 2H3NA 5HYJA 3WIFB 4LLYA 5H8DA 3BN3B 3FQWB 5I15L 1MJUL 5EOCJ 5KG9A 3GSQB 2ZOLA 3U83A 2MHAB 1TZGH 1QNZL 3OTTA 3PWJB 4M6OH 3ZHLA 3QHZL 4XXDB 4XNQB 4WO4A 4DUWA 1U3JA 2AJ3A 4JO3H 1VACA 2A1WH 2PYEB 2R4SL 4BA8A 5DRNA 1U8IB 1Z2KA 1BOYA 3QEGH 5BOZG 3P9LB 5FYJU 5MEPB 3IYLW 5D7SH 1ZA6B 3RU8H 3OV6A 5GJTH 5E9DA 3ARBB 3WMSA 4JFYA 5GHWH 5EC1B 3BPOC 1Q9KB 4NBZB 5KSUA 3BPNC 1PX3A 1MI5D 5EO1A 5C6TL 2VXQH 2PXYD 1RHFA 5AD0A 2DWDB 1MIMH 2P7TB 3BZEA 3WFEL 3GMLA 4JLRB 2Y4SA 4L4TD 4TNVK 1QKZH 2FX8L 4K7PL 2VXVH 4QXWA 3VCLB 2C3VA 1OTSC 5C92A 4UV4H 4IMLA 2VQTA 1RZKL 3DETC 4Q0XL 4MDJA 3QXDB 3WFCH 4QRUB 4WO4C 1V3MA 1DBML 2B5IB 3IDXH 3WKML 3TF7C 1IARB 3BYTA 3MCLH 4ZS6C 1CQYA 2HRPH 5JIPA 4WRLA 1B90A 5TE6L 4J3WA 3MRBB 3PJSA 2W60B 4CW1B 2P44