4ERSH

A molecular basis for negative regulation of the glucagon receptor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
231
structure length
231
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVMYYDGSNKDYVDSVKGRFTISRDNSKNTLYLQMNRLRAEDTAVYYCAREKDHYDILTGYNYYYGLDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Molecular basis for negative regulation of the glucagon receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2012-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ersH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ersH01
3D85A 3BN9D 5JHDD 4I4WB 3GI8L 2MFNA 3PWJB 2EDTA 5DFVC 2XWBA 4NCC2 4UNTA 4X5WB 2X09A 3LS5H 1NGQL 2PW2B 5I1GL 5SWSB 4FQ2H 4UV4H 3OKNB 2XY1A 4K9EC 3BDXA 3NCJH 4MQ7A 4WO4B 4C83A 3BH9A 4EXPX 4KKBC 3HPLA 1N64H 2ZUXA 4TUJA 3UJJH 4E5XB 4H26B 3AAZB 2YEZA 3IDUA 1A5FH 2VDLL 5HHQA 4HJJH 3BGAA 3HUJB 1EX0A 1XCTB 5DK2B 5CJ8A 1WBYB 5CMAB 3V6ZA 1BM3L 5GGSY 3KJ4C 3ZE0E 5T1LB 3T0BA 2PTVA 3LAFA 2BC4A 3SGJC 4KRLB 2W1NA 1EAPB 2CDFA 3HE7B 1WGOA 4KMTH 3VGAB 5IGXH 2EDNA 1A7BA 4NO3B 4P2RA 2ADGB 4I9WD 1T2QL 1WWCA 2HFTA 2MSPA 5ITBL 3BD4A 5DUMH 1CU4L 3IXAA 4KUCF 1ZVYA 3F5WB 2AK4E 2IADA 5C0EB 1JHTB 5FKAB 4KDWA 1NFDB 4G8IA 1IC5H 4P9HL 4PGDA 3MO1B 1P2CB 5J89A 1V7ML 1FIGL 4JG1H 4XCNA 2NLJA 3QWQB 5IJKA 4X0KA 3GSNB 1X5XA 3MLRH 4I1NB 3CVHL 1JHKL 1IAMA 4GAGL 5KG9A 1YN6B 1YEFL 4PJDB 1CGYA 4YHYC 4FXLA 1BEYH 2ZPKH 3BZFA 2GK0B 1ZS8A 3HZKB 5KSVA 3QUKA 2Q8BH 4OLVH 3DO7B 2DI9A 5HVFB 1KGCD 5MEPA 5HVGB 4LEOA 4MJIA 2HKFH 2OSLB 4F7PA 3SGDH 5D1XC 4CW1A 3RJDA 2VUOA 2YZ1A 2NXYD 4GXUM 2GITA 2GY5A 1WCQA 4S1DC 2CK2A 2VMFA 4JCLA 1UA6L 5JIIA 3MREB 2WBJC 3HPLB 9CGTA 2ORBL 4PJAF 2MPAH 2YC1A 2QSTA 3QA3A 5D4QA 3EGSA 3GM0A 4XNYH 2YEZB 5FYJU 5KSAA 3EYQD 4X6DE 2GT9A 4CU8A 4FQXC 1JYWA 1A8JH 5BS0B 2BVTA 1UXSB 1I9JL 1JWUA 2DB8A 3U4AA 3WEXA 4FZEH 3ARRA 1Z0MA 1P9MA 5DZLA 2HKHL 4KH2A 5H37G 5INDA 3C60D 5IIEB 4P2RB 3TLRA 1FYTD 5EOTA 3IXAB 4UT6H 2VH5H 3T2NL 1G7MA 4ZYKB 3V4PL 4OZGA 1CTOA 1NCWL 3VFTA 5GZND 4LCCA 3SKJL 5DRWB 2BP3A 4OB5H 4U0RB 3U7WL 3EJJX 4MNQA 5DD5H 4H25A 3MMEA 4MNHA 1T20B 4Y5XA 5ACZA 3HZVB 3VMPA 4PGDB 4O2EA 2ESVD 5IROA 1G6RH 4XCNB 4PLJC 2YA2A 5EFIB 4PLKC 1YPZF 3G9AB 3NTCH 5JNYB 4ZPVB 1KLFA 4HD9A 2Z93A 1YQ2A 2XTJE 1U8LA 3RDTD 1TQCB 4K3DL 4QWWC 1KJ2A 2JB6A 5JR1H 5TFSL 2N56A 2P7TA 3DX9A 3U36A 2NTSP 1WIPA 3BZFB 1T3FA 1J1XH 4XX1E 2ICEB 4HWEH 2L7JA 2R29H 4L4TA 1S9XB 2IBBA 4LSPL 4LEOB 5DD3L 1YMHA 1T6WA 4WI8A 4D94A 5K9KA 2F5BL 2GITB 4PJ9C 4UOW0 4OCSL 3U30B 5J13C 4M48L 3U4EA 1K2DA 3LS4L 4PJHA 2YC1B 4AEIL 1EPFA 4BELD 2HT4C 4YFLI 1OM3H 1MEXH 1NGWB 5KSAB 4LLQA 3HCVA 4LLYA 5F7EH 4D9RD 4X7SH 4UUJA 2UWEB 4Z7VA 1GZQA 4OLZH 1WBXA 5IF0A 2X5PA 4HWZA 4X7EC 1CE1H 4S1QL 3ULUD 1FO0L 1V3MA 2VQUA 2P5WA 2NW3B 3SQOL 1D9KC 1WSST 1GHFH 3T0XA 5I73B 4RGNE 2YD2A 1MI5D 1LHZA 5DTFB 1T1WA 2WWKO 4P2QB 2MQCA 4PJEE 1G7MB 4OLWL 1KTKE 4OZGB 4LQ1A 3F7YB 2OR9L 4LCCB 1AO7E 4Y5VC 4GQPH 4WDIA 3FRPA 1MCHA 4ZODA 1T66D 1XZ0A 3ULVE 3MMEB 4Y8AA 7FABL 2CDEA 1OWWA 5ACZB 1ZLSL 1MAJA 1OD9A 1OTTC 4YGVB 2XY2A 4RMSA 3SJVE 3S35X 3TN0B 3W9EA 2V7NA 4G6AD 1S7RA 1XGPB 1TETL 3WNNA 1D6VH 2Z93B 5DHYA 1FFNA 5TPWL 3DUHA 1NMAL 2DQUL 1XR9B 1DBBL 4MCYB 4H1LH 1AI1H 1KJ2B 5TGBA 3EDEA 4Y2DC 4MD4A 4HPOL 1OSPL 4HPYL 4IOFC 1WZKA 3B9KC 4I8DA 5ID0A 1PGRB 3HC3H 2LAAA 3QXDA 1TCMA 4L4TB 1G7LA 1HWGB 2NW2B 3OB8A 4NC1E 5JUEH 5EU6D 3B9VA 5F9OH 4HT1L 2OCFD 3TFKC 4XP6L 5CD3A 3BKJH 5K9KB 3JBG7 4EDWL 3KHOA 4KK8D 3CUPB 3WS6C 4DFHA 1IARB 4L8CA 3U4EB 4NNPL 1RY7B 2H3NA 4HXAH 3MRJB 2A6KA 1TXKA 5HJ3A 1A0QL 2ERJB 4JN2B 2NY6C 3SCMA 4LLQB 5FYJE 3EJYC 4UUJB 5SX4H 2PTTA 4I18C 1EFXA 5H35A 1WBXB 5IF0B 5L2KE 3TV3L 5BV7B 1A7RL 4JQIH 3KYNB 3NZ8B 1ZK9A 4LMQI 4QHNA 5JMOC 3F12B 4YJZL 1X6LA 3DIFB 5ALBH 5BMFL 2J5LC 1SY6A 3BZ4B 2C5DC 2Q6WA 3SOBH 2NZ9D 3BIAX 2J8HA 3RVXC 4XHQA 3LQAL 4OGAD 3UTOA 5DEFA 4HZLB 4JFDD 3BEVA 4LFHG 4RA0C 4WDIB 3P3YA 5DMKA 5LGHH 4L8SA 3U2SA 1TTFA 2CDEB 2IALA 4KUCD 5FUOH 3DNKA 4C4KO 5I71B 2MJWA 1S7RB 5DD1L 1UB6A 3GI8H 5IW3A 4K71C 4EXKA 3UDWC 1F3DJ 5DHYB 5F9WB 3MROB 1NGQH 4Y4HB 4G7YL 2CJUL 2H2PD 1Z9SA 1FIEA 4MD4B 3L3KB 1VKXB 2OI9C 3ZDZF 1B3JA 4RRPG 2X1OA 4H0GA 4U1IA 4W6YB 1G7LB 3UBXI 3D9AH 3QIWC 2AJUH 4HKZA 3T8XB 2I9LA 2HTKD 1N59B 2A74A 2JJTC 3LN5B 3K7UA 1KB5B 8FABB 4X6DF 1YJDC 3EAKA 3ZTJH 3IDIA 5E94B 5EBLA 3B2UD 4OUUA 1QBLL 5D7SH 2PR4H 3BRGC 2H3NB 1MFCL 4BFIB 2E9IA 1BM3H 4NRZA 2Z31C 3VE0B 2WIIB 5HJ3B 1AR2A 1Y0LA 3HG1D 3GRWL 2C7UA 2XG5A 1UKTA 1BQHG 1AKJD 3L3OB 4YE4L 2CRZA 2VIRA 5FO7B 1UWXH 2HFFB 2PTTB 5FA4A 4JO4L 4OCLC 3OMZA 4K8RC 2YPLE 4U3XA 1T2QH 3TVMB 5DYOB 4XVUC 4MJ4A 1H3WM 4JRYD 4XGZA 5EORL 4QHNB 1H3PH 1P84J 3RL2A 2J8UA 2EZ0D 4LCWE 5F8QC 1SJHB 4IJ3B 2WWMC 4F33B 2P5EE 4JY4A 1NAKL 5JXAH 4CVUA 5ENWA 1IEHA 5D2LA 3MRLA 5E6YA 1V7MH 1U92B 2ICWJ 2PF6A 4QOKD 1KC5H 1QLFA 4U49A 1BPVA 1UWGL 5DMKB 5KSBE 1PZ5B 4L8SB 5GGTA 3T0VA 3MUGA 2AABL 3BP6A 5DK3A 4YEEA 4OCMC 1RIUH 1FZJA 3HNVL 4TN9A 4UOJA 3U83A 1KN4L 1RSFA 1NMBL 1UKQA 2OL3H 1NC4A 4P9MH 4MS8D 3QI9C 3FAWA 5F3BA 5IB3B 2OX5A 4XPGL 1U8OB 5AZEL 4PJCA 1HHJA 1ZVSA 2XQBH 4JKWA 3MRCA 4DGYL 5JDJA 1UZ8A 3OGCA 5HYJB 4CUCA 5JORA 1XIWA 1T04B 2PYEA 4ZFOB 2BVOA 4YHNB 1UA6H 5IB1B 5DUBA 1J8HA 1J7VR 2ORBH 2NY3B 3RWGA 3QAZC 4QYOB 4LRIC 1X9QA 2A74B 1GAFH 4LLVA 2ZUWA 4PRBB 3WO4B 2DLIA 3TBSA 5IHUL 4K55A 3LPFA 3RPIB 5F7KC 3ULSB 5ANME 1XGTB 2ZNWA 2O26U 4K3HA 4P4KC 4FABH 4J6RL 5CLTA 2XN9E 1H5BA 3QDJD 4M4RA 3LN4B 1Q72L 2VIRB 3LKRA 5D6DC 4ZFGL 1IGJA 4Y19D 1JNHA 2GCYA 4C56E 4Y7MA 4PJEF 4OI8A 4P3WA 2X89A 4L3CA 2FJHA 4IIQC 2ZCHL 4DWHA 3RL2B 3QIUA 5EU7C 3QXTA 3T04D 4RSVA 4FQLL 4L8BB 4UTBH 1AR1D 1T7WA 5GRYA 1P4IH 4P99A 2ZG1A 4AEHL 2D7NA 4I5BB 5E99L 4JRXE 5D2LB 1F4XL 2RFXA 4L3AA 3SDAD 1PY4A 4HS3B 3S8WA 3QH3A 1MIEL 4X99B 3MUGB 3BP6B 1DQQA 4ZOAA 3X3GL 3VXRA 5TFSH 3MCLL 3FHAA 3DO3A 4Q6YA 1QA9B 1UJ3C 4XP1L 3EYSL 4MAYA 4L29B 2R0WH 4O02L 3UPCA 1KIPA 1AP2B 4ZUTB 5AAWA 1LE5B 4KK9C 3Q48A 4AZ8A 1HHJB 4ZUSA 1MJ8L 2F54E 5KTEL 4G6KL 3D0LB 2XZZA 1UZ8B 2AJSL 3EDDA 3OGCB 3DXAD 3H3PL 2VLRA 1U8JA 3MUJA 2PYEB 1V7NL 4OCSH 5CGYC 2BVOB 2RHEA 5B8CB 5A2IH 3BPOB 5L0QB 1MCQA 1UH4A 3RWGB 1MWAA 1CVSC 4AEIH 1MJUH 1F4HA 3RTQC 2J6EH 1RZJH 4PY7A 1HHGB 3OPZL 1QSFD 2VSCA 5IB4B 2VZVA 4WEBH 1MFAL 2W9LA 1C16A 4AMKL 1TJGH 4NFDA 3L5WB 1AQDA 2CMRH 5HGAA 1BJMA 4NYLA 1OSZA 5I1HL 5D9SB 1MUJA 1NJ9A 1FO0H 1ZHNA 4XNMA 5C6TH 1IAIL 3DMMC 3SQOH 3V0VB 3F8UB 4U1SB 2AEWA 3R06B 3ECBA 5HHOE 1JNHB 2GCYB 5ALCL 1RIHH 3ZYZA 3P2TA 3PIQA 4L3CB 2VXUH 4Z7WF 1DN2A 4RMTA 4OLWH 4JQXC 2DM4A 4F15C 2OR9H 1P7HL 2XXMB 3MRIA 4XH2B 3QIUB 1ZT4B 1R3IL 1IGYA 2X05A 4DAGL 4BQBA 4TUOA 3TBWB 5DO2C 4HLZH 3FOLB 3THML 3FAXA 4RX4A 3RWCB 2RFXB 4GW1B 4ZNEE 1YC7A 3BWAA 3P11L 4JM4L 2X1PA 3A6BL 2WWKT 5C71A 4JM2C 5C2UB 4XMLL 1TETH 3QH3B 3OAZK 4E41E 1WF5A 2FJFB 1NMAH 1DBBH 2B4CL 4NSKB 1UZ6E 2ZSWB 4HPOH 2NY5C 1OSPH 4HPYH 2NY1C 1NLDL 4XNUH 2AJYL 4Z5RB 4G9DA 2BVPA 1KIPB 1ED3B 3FFCE 5DRZA 2WUCL 2BSED 3JVGA 4NN7C 3LD8B 4JKKA 1QVOB 2FEDC 5D7JC 8CGTA 1NLBL 2I5YL 4HT1H 1TTGA 3D2UD 1P1ZA 4U6TA 4XP6H 5D1ZD 1KJ3L 1RJZA 4I13B 2VLRB 1U8JB 2D31A 1X5LA 4D0DA 5EUKB 3O2VL 3FO2A 5C0CA 5T3XD 4NNPH 1I8LA 2R56L 4I3RL 2FO4A 1MWAB 4MHHI 3OXRA 4A6YA 4NOFA 2QKIB 2Y6SC 1A0QH 3FO9A 4PY7B 4ZFZA 4NFBA 3TIDB 3DI2B 4X4ME 3HS0A 4L4VD 1C16B 1KCKA 1X5FA 3TV3H 3TIEA 5HGAB 1ZANL 1NJ9B 2BNQA 4XNMB 2EDRA 4I77L 3B5GA 4UU9A 5ADPL 4YZFE 3WN5C 4KJPC 4UBDC 3WUWG 2A38A 3GSOA 3UAJD 3OF6A 3RUGA 2R0KL 4KPHH 3GJFA 4CMHB 3MLUL 2YS4A 3LQAH 2BVUA 4ZUVB 5F96L 3MRIB 4H0HB 3C9NA 2P48B 1A7NL 4U4BA 4G9FD 1IGYB 2VR5A 3C5SB 2IC2A 1GZPA 2A77L 2DQEH 3DUUA 4KKCD 4JN1H 2GUOA 4Z8FH 1WUNT 2AJZA 4JFPA 3MA9H 5FCUH 2YA1A 3W0WE 3EHBD 4N0CD 3T0EE 5DD1H 5JW4R 5FHBL 3VD4A 1PFCA 3DV6B 1J10A 1E4KA 4OLYL 5D1XB 1CFNA 3CXDL 1UFUA 1CGSL 4FQ1H 1BIHA 4X7DC 1S9KC 5GGRA 2CJUH 5E5UB 4FA8A 5AD0A 2WBJB 2VDKH 4WEMB 2BVPB 4Y1AA 4DOHB 1T7XA 4C4KT 2AJ3B 2IFFL 5FAAA 3KXFD 3X14A 3FO1A 3CDGA 2D31B 1WWWX 1S5IH 4RFNB 2BHUA 3CDYA 4NUJA 4P2YA 4EIGB 1QBLH 3MOAL 5C0CB 3QIBD 4GAJH 1H15B 4NZJA 5CP7B 1ZLWK 4OAWB 4TYUA 1MFCH 3OXRB 5I16A 1MI5E 3VFNA 1KEML 4M7JL 3IGAB 2YHGA 3KPRA 4AY0A 1CLZH 1KF9B 5IG7A 3HS0B 1JNLL 3OJDA 3WDJA 4JO4H 2ENYA 5HDOA 1U8KA 3GMPA 3TIEB 3RX7A 1ONQB 5EORH 1UEMA 2BNQB 3MRPA 3GMNB 5I1KL 1T6VN 3W9DB 3ARGA 3D48R 5CD5C 1DSFL 3QRFM 3KYOB 3I9GL 1MCWW 5EULV 1ZHKB 4Z7QE 3GSOB 3OB0K 3MV9D 1EEZB 1BFOA 4K7PY 4YHKL 3EO1A 3GJFB 1GOFA 1W8OA 3BT2L 3B3IA 1L7IH 1UWGH 5TE6L 3DUUB 2AABH 1MFDH 1EHLL 4M9OA 4KKAD 1KN4H 3BXNB 3P0VH 1NMBH 2NR6D 5DD6A 3SDXE 2AVGA 4RQQA 5AZEH 4U7KA 4RMQA 2W0PA 2ATPA 4YDJA 5IFJA 4XCYA 2X7LB 4DGYH 3HMXA 4ELMA 4PJ9B 4NZRL 5HDQH 2WZPD 2L7UA 1EEYA 4WW2C 5AD0B 5J13B 3KVQA 5EO9B 4Y1AB 3TBTA 2DDQL 4OTXL 1I7UA 2D03L 2G9HA 1I3GH 3FO1B 2HJLA 3CDGB 2PXYC 5GPRA 3NPSC 1PLGL 1UG9A 3HNSH 3IRZA 3N9GL 1TJIH 3PL6C 1CWVA 3WKML 4GT7A 2JCCF 1MPAH 4NUJB 3H9SA 3OKEB 2GFBB 5D7LA 4OT1L 3SE4A 1S7WB 5I16B 2CIKA 4J6RH 1CICD 4M7LL 3TO4D 1D9KB 2JK5A 1DL7L 1Q72H 1Z2KA 3KPRB 5IG7B 1VA9A 4JFDE 4ZFGH 4ONFL 3UTSD 2AEPL 5EUOE 3GMPB 4BM7A 1P7QA 1JMXA 4KJYB 3ARGB 2ZCHH 3UBXG 4LQFL 4WUUB 2HP4A 5C0JA 1I4FA 5DJZA 4M1DL 4R97B 4FXKB 1ZVHA 5LG1A 5E99H 1BD2D 1F4XH 4APQD 3IF1B 4Y2DB 1DUYA 5GS0C 5IOPA 3LMJL 3RGVA 3P4OB 3IFNH 3O4LD 4O51A 3K2UL 1MRFL 4UDUA 1BIIA 4XP1H 3MRGA 4NUGL 1NCAL 5DD6B 5BVPH 3E1F1 3N0PB 3N06B 4O02H 5E4EB 25C8L 3RU8L 1H3XA 1MJ8H 2FWOA 1N6VA 4YDJB 4XCYB 3MJ7B 4EN3C 5KTEH 1JZ2A 5IFJB 5DFTA 4G6KH 1QYGH 4ELMB 1EEYB 3H3PH 2OK0L 4HUXA 1JTPA 2FX7L 3VXOA 3HG1E 5HI5D 2B1HH 3NCEB 2BSSA 4B53A 2AEIT 3QFJD 3ZYJA 2NY6B 5ECJE 2OTPA 4R96A 4D3CL 2X9WA 1BQHB 2HJLB 5IVXB 3OPZH 4LHUG 1ZEAL 3IXTB 4AMKH 1LP9B 3UTQA 3KR3L 1AGDA 2DI8A 4KRMB 3V9FA 4UILH 2JK5B 1NSNL 5A1AA 2J5LB 4GRWH 3RZCD 4JFEB 43CAA 1KJ2L 1SEBB 4WUKL 1G0YR 4JDTL 1RZGB 3G6JA 1UACL 2IQ9L 1C5CL 3PV7A 3MLXL 4CJ1A 2Y06L 3SE9H 4NO2A 2FSEA 4HUWA 3QJHA 2MWCA 4B5EA 4X9GA 1T21B 1I4FB 5DJCA 4LGRB 1HI6A 5LWYL 4L8DA 1M7DA 3CFKA 1J5OL 5IM7A 3SO3B 3RAJH 5EDXA 3HAEA 4PD4J 4JAMA 5KS9E 3OZ9L 4XMPH 4K71B 5AUMB 3P11H 3ARYA 3AY4C 3KPQA 3SDDD 4P5TA 1ZT7A 5IOPB 5C3LD 3D87B 2B4CH 2OI9B 1IGCL 4O51B 5IB2B 3WJJC 1BIIB 1X5JA 5D70L 4DKEL 1WIUA 5K9QI 2HMID 3QIWB 4HEME 4XWGH 2WUCH 2EKJA 4R3SA 4OV6F 1FV1A 4DKDC 4LF3A 5BV7L 2YK1H 4XP4L 1NLBH 1TZGL 4GKSB 1FVEA 4O58L 2D2OA 3QUYA 3MLTB 3VXOB 3DSFL 4DKAA 1JRHH 2ATKA 4GS7B 2BSSB 3MRKA 1DVFD 3ZMRA 2P43B 2Z31B 2UY6A 3QNYB 1HXMB 2OQJA 4GOSA 4R96B 5C09A 1G9MH 4PGCB 3W2DL 3CLFL 4N0UB 4X6CB 5HPOA 4KHTL 3EO9L 5M95B 4PR5B 3VI4E 4KQ3H 4UOW1 3UTQB 1JF1A 2AV1A 5HPMA 1HKLL 5F7MC 1ZANH 2VLKB 3EFFA 4PJ8A 4I77H 2JTDA 5ADPH 3C5ZC 1CXEA 4WI4A 1EHXA 2CK0H 3O9WA 4M6NL 3RWJA 1RZFH 3NCYP 3ARED 3EYOB 2NXZD 3G6JB 1DR9A 4UTAL 4JFHE 3MLUH 4QO1A 5SWZD 2FSEB 1LQSR 3NN8A 3TGXA 3QSKB 1YMMD 3QJHB 4WTWA 2E27L 3GI9L 4O5LL 4LLDA 2GTZB 4X5LA 4NKOB 4L8DB 1T03H 3QI9B 2ICWI 5BXFB 3HI6L 1X5HA 4RDQF 5B39G 5IBLC 3DXAE 2IQAA 4PB9H 4RGNC 5I74B 5FHBH 1HEZB 1ZT7B 5C0BA 3QDAA 3QDME 3CXDH 4UIKL 1CK0L 1CGSH 1A9BB 3ARBA 3AVEA 3VI3E 3AB0C 3MRMB 2MCG1 4MJ2A 1F6AB 4HDIA 3PWPB 1LK3L 3GSQA 1VGEL 5FECA 3MJGX 6FABL 3QAZB 3ULVC 3QUXA 3VDAA 1FV1B 1FYHB 1RVFL 2NNAA 4G42B 1YY9D 3TPKA 2AW2A 3BD3A 4EEEA 4XBPA 2AQ1A 4PRPA 3FT3A 1OTUD 2ATKB 4P4KB 1SY6L 4M03A 2G5BA 3KPMB 1FQ9C 4YO0B 5E6IA 4DUWA 4NRYA 5GRJH 2V5YA 4GH7B 4M7JH 1MOEA 4XX1G 3ESUF 3GSNH 1TNMA 3D5OF 5L9DL 2H6PA 2DS4A 1DANT 4IM8A 1EVTC 2Y07L 4NC1C 5C0NC 3U4BL 5EC2A 5HY9B 5EUOF 1JF1B 3QO0B 5CINL 2HFEB 5HPMB 2Z35A 3BEWB 3VGEA 1C5DB 3D18A 5K59F 4FQPA 3EFFB 1A7PH 1LEIA 1OCWL 4HCRA 2YD6A 2F53B 1A6ZA 3ZE1F 4YDLB 1MREL 1LO5B 3O9WB 1MJJA 1OL0A 2HH0H 3FQRA 1CYGA 5IEKB 4ERSL 4YHKH 2B20A 3Q2CA 4EIZC 3ARPA 3OKYA 3V79C 1KPRB 4LSDA 3B5TA 2IG2H 3CH1A 4MHHG 2E5EA 1N5YL 2OTWA 5TE6H 5EOCL 3ARTA 5J7CC 4WFEE 1C08A 3MRFA 5HI3C 2ZOLA 1YNKH 4NFCA 4BSWA 1F00I 4N1HB 2JB5H 5HI4D 4GRWE 4JFQB 5C0AA 1CFSB 3RBSA 2VQTA 1F02I 3QDGD 3O4OC 3R0MA 3FFDB 3GSQB 4O4YL 2ARJQ 3QUXB 2VWEE 4PP1C 3RTQB 5DJ2A 2NNAB 1U8QA 2W92A 2D03H 3NCYS 4XP9L 5DGRA 4S1SL 4S10A 2JELL 5I1LA 1PLGH 1T89C 4PRPB 4PS4L 3MRRB 3N9GH 1T83C 1GPOL 5H94A 4MAUL 3RVUC 5HI5C 4L9LA 4OT1H 1JV5A 2YN3A 1FL3B 4R4BB 4NRYB 1IM9D 1DBMH 3D39D 4TTDC 3PQYA 1T7YA 1DL7H 2HLFC 3WUWB 3RKDD 2YD5A 1RJCA 1P4LA 3WXVH 3X11A 2VLJA 3O8XA 5E9DD 3Q5OA 5GGTL 3TBVB 4NBYB 4ZFFB 1UENA 2E9WA 4NHUB 1XAUA 1XR8A 4G6FD 2DM7A 5HD8D 2EE6A 4MD5A 2FGWL 1LEIB 1EK3A 3TESA 1OGAD 2G2RA 3U1SL 3AM8A 3T4AA 1MJJB 2IWGA 3E8UL 3EFDL 4LAQL 4M1DH 3FQRB 4KJWC 3ROLA 3HMWL 4OD3L 4JM2B 4LGPB 1PSKL 1N3NA 2PO6D 4U6HA 3MV8A 1MHHA 3CH1B 3GHBH 4P2CG 5IBTL 5JXEA 2BDNL 5IFAL 1UXWA 4YXKL 2NY1B 3UPAA 1C08B 1CFBA 1ACYL 3RWFB 1TDQA 3MRFB 4LDOB 3MV7E 1MRFH 2ZOLB 3VD9A 4NUGH 4U1NA 1HNFA 1KLGB 5C70A 3FZUD 3RU8H 5J06A 4MQXD 1A6VH 3MC0A 5EU5B 2HLAA 5ISZD 2WIMA 5I6XC 1XCQA 1RZKL 1SMAA 1FDLL 1KIQA 3QXUA 2OK0H 2ZUYA 4OF6A 2A73B 3MLPA 4DQOL 1HH6A 2HMIC 2NTFA 1F90H 4R4FH 2VXTH 4O2FB 5DJ2B 1U8QB 4G8GD 4URTB 5I1LB 4X5XA 2ADJA 2AXJA 2W9DL 3JTTB 1CDJA 2X4UA 2EO9A 2OLDA 1ZEAH 2KZWA 4Q6IA 1Q94A 3GM8A 1JV5B 5L8KB 2XV6B 3REVA 3MYZA 2C1PB 5I76A 3DSNA 5IB5A 2IPKA 5J6HA 3WN5B 4Z78A 5FUCE 3MJ8A 1ODAA 3F7VA 4KRPC 3X11B 3N50A 3O8XB 1SYVA 1VFUA 1KJ2H 4WUKH 2IFGA 2BY3A 3VCLA 2IAMC 2B8OT 3GMOB 1UACH 4NO0D 4OZHE 5TH2B 1C5CH 4EUPG 3MLXH 1PKQA 1YEIL 4KK6C 5D5MB 2MHAA 5DEGB 4R4ND 5C07A 1N8ZB 3JV6A 3RVVC 5LWYH 1YYLL 2H8PA 1WV7T 2AV7A 3ROLB 4E0RB 3IVKA 4N9GA 4V1DD 3BQUD 4ONGL 4PJ7F 3MV8B 2GJJA 1MHHB 4HKBA 1OGTA 4GAYB 1MWAL 5D1QD 1GH7A 4D0BA 1RUPH 1J12A 1UXWB 1N4XL 5IW1A 1I1YA 2JJUA 1D5BA 4U1NB 4PRNB 1HOCA 4GKNA 4PJXE 4QHKJ 5JHLH 1HNGA 1K4CB 4LL9A 1T0NA 4BSVA 5JA8B 3L3GB 4X7TA 4F57L 5BV7H 1XCQB 3PGCB 2EEBA 1SJXA 1TZGH 3JTSA 1IQDB 4LHUA 4O58H 4YHOL 1P84K 2EH7L 2ZUSA 4QRTB 4L1DA 2CQVA 5DVOA 1MCKA 2PUQT 3W11C 3D1MC 1X5ZA 3JUYA 3DSFH 1HH6B 2NTFB 3RFZC 2H32A 4R2GC 2H2SD 2C3VA 1JGLL 1UWXK 2HT2D 1MY7A 3S34L 1P6FA 4EQ3A 3W2DH 4EJ1C 4WIQA 2IPTL 3RVTC 4S2SA 2X1XR 4Q6IB 1C12A 4FXGB 3TJEL 3D25A 1HCVA 4JZJC 3SPVB 3REVB 3CXHK 1HKLH 1AIFB 4GKZA 5IHBA 4LCIL 5FB8A 3UBXB 5IB5B 2IPKB 4PGBA 5J6HB 3S97C 4RGOH 4Z78B 2FL5A 3F7VB 3TJHD 4V2CB 5CCKL 4M6NH 4U1GB 5GZOD 5J3HC 4P2RE 2W0KA 3I50H 4JFZL 1PKQB 4LNVA 5I1IL 3BZEB 3KJ6H 4XRCA 2MHAB 4PY8J 3GKWH 5DR5L 4Z77A 3JV6B 5GJTH 4OD2A 1KB5H 2H8PB 2AV7B 2R69L 3HI6H 4N9GB 1N0LA 1G7IA 3NIGE 35C8L 4NQCD 4P46A 1EMTL 3VRLE 2H26A 1U8HB 1TNNA 1OGTB 1VFBA 1W0WA 1WEJH 2RB8A 2V9RA 4GRWF 5ELIA 1YNLL 3Q6FB 4NN6C 1QFWM 4A6YL 5KVGL 2D7QA 1B9ZA 4WW2B 4PJ5D 1X7QA 2APTA 1CD9B 5T3ZH 1I1YB 4GUPA 5EH1A 4NWUH 3MUHL 4Q97A 1HOCB 4GKNB 3DVNB 6FABH 4NIKB 1T0NB 3WLBA 4WJ5A 3MRDA 1E6JL 5IT2L 2PXYB 2X4OA 3NPSB 4MJIE 1K8DA 5DJ0A 2X6MA 3LKSB 1I7ZB 4W6WB 3PL6B 4LHUB 5K93A 4LKCB 5T5FH 3ZDYE 2EXYC 4L3EA 1T22A 3HE6A 1SY6H 4HJ0D 5SWQB 1WIOA 3U9PH 2G75A 3TCXA 2EIDA 2MQ0A 1AJ7H 5IMKA 3AU1A 5HDLA 2V6HA 1SYSA 5GS1C 1BVKA 4R26H 3BKCH 5FXCH 1C12B 3UTTA 3U0WL 4LSQH 5CINH 4CJ0A 5K9QG 4XWOD 3K8LA 5EC1A 4PJIF 4P9HC 4PGBB 2M26A 1OCWH 2X4RB 2FL5B 4OUOA 3EOBA 3KPNA 4Q9QL 2QQQA 1LD9B 4U1MA 4OV5A 4LLUA 1A14H 2GK2A 4IDJL 4ERSH 2AXHA 4F37F 4N8VG 4NQDA 2SEBB 3JSSA 4OZGE 3WFBL 4XRCB 4JANB 1WLHA 4U3CA 1N5YH 2QQKL 4MNQE 2F19L 3IFLL 4OD2B 2AK4B 1LK2B 2VITA 5AYUL 3BOVA 3GBML 5BZDA 4NC0B 1JCKA 3PJSA 1H8SA 4F58L 1G7IB 3SDCA 3DX7B 4EN3B 5F1IA 5E24E 2ITCB 4QRRA 5C08A 3V6OA 3T3ME 3H42L 2YD7A 1FZKA 2I60H 4J3OC 2DKSA 4JDZB 3WDIA 4GUPB 4Q58C 5I30H 5EOCJ 2RIKA 5FO8A 1U3HC 2UZIL 4L4TE 3WLBB 4WJ5B 4FFVD 1BAFH 3MRDB 1JNJA 5GISL 3PHSA 1OT2A 2X4OB 1D5ZA 3FQTA 4JKPL 3T0EC 4KDTC 4GRLC 4L3EB 3HUJF 4AENA 3HE6B 4MAUH 2CR3A 4F3FA 5GXBB 5D7IA 4KROD 4NJAH 2G75B 3TYFB 4PJHE 1ZE3C 3FRUA 1M05B 4WWKC 5IMKB 2NX5A 4ZAKC 5HGHA 2DD8L 1S78D 1BVKB 3O6LL 2VZTA 5GGTH 4PYHA 4YFEA 3BGMA 4Z7VE 1I1AD 4CGTA 3EYVB 2FR4B 4ACPA 5B38G 2XPGA 3WIFA 1W8NA 2FGWH 1BZ7A 1JFQL 2P5WE 3BW9A 3EOBB 3KPNB 4OV5B 3VXUA 1AD9A 1RMFH 3O45B 1NFDF 3EFDH 4LAQH 2H45A 1J88A 3HMXL 2O5ZH 3VFGL 5B39B 4HLJA 1MCFA 4OD3H 3OKKA 4NZUL 2OJEA 2J4WL 4QHMA 2DQTL 5F6IC 5HYSA 1AXTH 2PYFA 1S5HA 5T5NF 1WWAX 5F21B 1IAII 3BJ91 4NWTL 2VITB 3WNPA 1AO7A 3VRIA 1ACYH 4PJDF 4GXVL 5BZDB 4WGVB 3SKMA 3ZT6A 5DVKA 3PJSB 2V5TA 3FN3A 4KI5E 1I9IL 2GJ6A 3TZVA 5LGKA 4QRRB 1IMHC 4K7FA 5C08B 2WK2A 1K4DA 5KVFH 2NPLX 1NEUA 2RBLA 4LK4A 2XTJB 2XFXB 1H8OA 5J6GA 2R15A 3I6KA 5BOZG 4IRSA 2C1OA 4ESKA 5GSRA 4P5MA 3FQTB 4OZFG 2ARJA 1R0AL 1PQZB 1PZUB 4U7SA 2W9DH 2AJVL 3I6GA 2CIIB 5I8CA 4AENB 3KYKL 4RNRA 3K3QA 1JWSB 3ARDD 5FUZL 3FRUB 3ZHLA 3ZKSD 4YC2C 3UYRL 3MCKB 3C5ZB 4KKNA 4QRPD 1LGVA 4F7EA 5GHWL 2EH8L 5HGHB 3BP4A 3D69B 4M62L 4KFZC 5C9JA 1MFNA 4K9EH 4I0PD 2X4TA 4RMVA 3SKOA 2KKQA 1VCAA 2B1AL 1EGJA 4UDTA 1BQSA 1BZ7B 1G1CA 3BW9B 4OF3A 4NBXB 4F9PC 2IEPA 4MA7L 4LPXA 5ICZA 2FD6L 4WU7A 1YEGL 1XF5A 1YYLH 3GGWB 1DTUA 1WZLA 3OKKB 4XZUA 4RGNB 5DZOA 5AAMA 2YUWA 2X42A 5E1AB 4Z18A 2PYFB 4GBXD 3EIFA 5CHNA 3ZYIA 5IV2A 1B0GA 3HLAA 4NDMB 1WAAF 1FNGA 3AB0B 4HXBH 1AO7B 2VE6B 5FIEA 3VRIB 5C2BL 1JZ6A 1UVQA 1KIRA 5H37H 5C0DA 3RKPA 1CTNA 32C2B 4BK5A 3OWEA 1FNEB 2GJ6B 4XI5D 4BH8A 4K7FB 5MP6H 5AWNH 3INUL 4X98B 3CC5A 1NCBH 4MB5A 3A6CL 1ZGLM 3HB3C 4MYWB 1F11B 1TJHL 5E8PB 1KLUA 1RUAH 1TLKA 2CO7B 1BMGA 1JIBA 5J6GB 4IBLT 3TT1H 2C1OB 5GSRB 4M5YL 3QRGL 3U79A 3A6OA 4U1JB 1M1SA 3BDYL 4WRLA 3RWEB 5MEND 1ZLUH 5DVNA 3HN3A 4QT5A 2IPUG 2DQFA 1F58H 4WW1B 2UWEF 5ABDE 4JFYB 3VMNA 2BRRH 5GJSH 3ROOA 3ARFC 5F3HB 4HJGB 2GEEA 4MXWL 1G7HA 2FIKA 4KJQD 4BKLA 4MA3A 1DQLH 1A6AA 1IGML 5HYEA 3LQAC 2DBLL 1QSEA 4RMUA 1D7FA 5BZWA 5A2KH 3LHPL 5C9JB 3KYMB 3NCBB 3DVFA 2NCMA 3TEUA 3BP5B 3SKOB 4JFZH 4OZGF 2UV3A 4UDTB 4CDHA 2J8UE 3VWKD 2GSIB 3VJ6B 4WU7B 3KPOB 1B90A 5MI0B 4L5FL 4OKVA 2R69H 2R2HA 4JJHA 4PTUA 5E2WL 5D2LE 4XAKD 5DRXA 2BHZA 35C8H 4B41A 5CHNB 3T3MF 1VFAB 3HLAB 1UWEL 1V8HA 4M6MH 1YNLH 3O4OB 3O6FC 2YD4A 1EUUA 2LU3A 4UT7H 1F3JA 1UVQB 1KIRB 3OG6B 4NQED 3VXMD 1NFIB 3D3VD 1IL1A 2YSSA 5KN5A 1EV2E 3BMWA 3GJEB 3MBEA 3P0GB 4ZXBA 4P23A 5HDBE 4PJCE 1FLRL 3QDHA 3EW3B 5I18L 2IAND 1XGRA 1DQTA 2CH8A 3S7GA 1GSMA 2QSVA 3V5HB 4DEPC 4ZOBA 5HHVL 3FN0L 4FQHB 4LSRL 3R0NA 2PYEE 3H9YA 1VACA 3L5XL 1J8HE 5SWSD 4WV1A 1CXFA 1LO3H 3GJFH 4PBWD 5EZJA 3LEVL 5TF1H 3GBNL 3OX8B 4LVOB 5JA9A 2DQFB 5JTWA 2DQGL 4PV8B 3QYCA 1DLHA 4DUXA 3VWJA 3IS0X 4JZNA 4H20L 5TE7L 4ENEC 5DJXA 3STZA 2VZSA 4EUPB 3QCVL 5E8OB 5IW6A 2EC9U 3G08B 3LEXB 4Q9QH 3QG7L 1TVBA 3MLZL 3I02B 4OZIA 5BZWB 4JLRA 4X6EA 4ORGB 1EAJA 4P2OA 4WHDA 1Y18B 5SV4A 1Y6MR 5HGBA 1FPTL 3HE7D 2FATL 4MJ5A 2UZYB 3WFBH 2YPLB 1TPXC 1WCBB 4F9LC 1HINL 4HK0A 5DD0L 2YPKA 1CD8A 1CLOL 1KV3A 2F19H 4HIIA 2XKSA 3QT2A 4LCWB 5JHDA 2ADIB 4XVTL 4PTUB 2CO6B 4F58H 4KWUA 4MZ2A 5FEBA 1EZVY 4LP4A 1UADC 4P57A 5EO0B 4OLEA 5I6XB 1LO2H 3LB6C 4DK3A 1FHGA 3H42H 3VXRE 4BH7B 5KSBB 4ODHL 1AE6L 1IL1B 5KN5B 4NJ9H 3BH8A 3O2WL 4CRPA 4P23B 5I8KL 5K33A 1QEWB 4M1CC 4O9HL 5GISH 2X70A 4JHZA 3ZKND 1MELA 5HGGS 4Y8DC 3CJJA 4HCRL 4AL8L 3VXSD 2VLRE 2DKMA 2DTMH 4NHCH 2O5XH 5CSBA 1KCRH 1Q0XL 2DLEA 4PRIE 4HW6A 5EIIB 5CBEA 5IEHB 1CFQA 2O5YL 4KRPB 3K4AA 4JFXB 4GMSL 4PUBH 4C55A 1DLHB 3QUZC 3VWJB 3CIQA 5B3JF 4JZNB 3Q5TA 3Q0HA 1JGEB 4DZBA 5DJXB 1S7UA 2BCKB 2H9GA 2EIZB 3C6LC 4N8VA 1RULH 1RK1B 5TQ2H 2V17H 5IW6B 3PNWA 4WTXA 5FOBA 1G6VK 2EDBA 2IMMA 3BDBA 2M8XA 5ANMB 4HUKB 1JFQH 2XN9B 5BS0D 2OZ4A 2BSRB 4ODVL 4OZIB 4ZUWA 3GSUA 1YEHH 1AXIB 3DHMA 1UH3A 4Y88A 3HMXH 4XVSL 5DMJB 1FFPA 3QNZB 2DQHL 1FLTX 3SGEI 3VFSA 3ILQD 4NZUH 4MVBC 2J4WH 3A67L 4MJ5B 3BKYH 4H8WL 5IESL 1H0DB 1MCPL 4HK0B 5D7KD 3QP3A 4HIIB 1DBAH 5I1AA 1C8PA 4U6YA 3UP1A 1PG7X 5EU4A 1JN6B 1RUMH 1EEQA 5BW7A 5DJDB 3P77A 4KKLC 4P57B 2KBGA 3JV0A 2DRUA 5CIPA 1T0MA 4Z9KB 1BJ8A 4PG9A 3T08A 2XQYG 4Z0BH 3L1OL 3BPLC 4F37K 2ICWA 1UEYA 3BSZL 5GRVL 4Y4FD 5E56A 3MBXL 3P9LA 1N26A 4YH6A 1LWRA 1ZSDA 3TP4A 4HF5H 1R0AH 2AJVH 4BZ2L 4JZJB 4S1RH 1Z9LA 2BVEA 5C0CE 3GSXA 4X7FC 5IWLA 5B38A 3MODL 4EI5C 3LKPA 2HJFA 4I3SH 1CFQB 4TVPH 5GHWH 3C60A 1JGUL 3M17B 2P8LB 3EUUA 5FYKH 2VWEC 1S7XA 1FYTA 1XF4B 1F45A 3SBWC 4DZBB 1J05B 1NDGA 4QLRA 2H9GB 2R4RL 1BQLL 4N8VB 4Y4KD 4Y2OA 3DRTB 2Q87A 2B1AH 5D93C 3MTRA 4D8PB 3MZGB 5KAQG 5F1OB 4ZUWB 4JPIA 5SX4I 1YJDH 2QHRL 1WTGT 4U31A 2ESVA 1FFPB 2B4CC 2IH1B 3VFSB 5D2LF 1OARL 3RUGE 1P6AB 4OM0L 1U8NA 4PY8I 4ZS6D 4UIMA 4EOWH 4NN6B 2GHWB 3RDTA 4IRJD 4UNVA 3GDBA 4AEEA 4YX2L 1RHHB 5AEAA 3U48A 4P2QD 5KOVC 3F6IA 4WI6A 4ZTOL 4HGMA 4G7VL 3WD5L 4K8RH 3NIFF 2XI9A 3OR7A 4OZFA 5INCA 5CIPB 4I0KA 3WL9A 3TN0D 3TA3C 4PG9B 4MQTB 2VXQH 1TJHH 4E41B 1JGDA 1BLNB 2ICWB 1CGVA 3F7RA 3SE3C 5CZVL 3MACH 4M5YH 3QRGH 1RZ8B 3P9LB 3CK0H 1C5BL 3FFCB 4IMKA 5GS1B 3P30L 3V52L 4NP4L 3EYUH 3V6FA 3RP1A 1WWBX 3ZT5A 3WIIL 3T2OA 2FECL 3GSXB 3MZTA 3WXWL 1MHPH 4G6ML 5B38B 4LLWA 1Z6JT 3LKPB 4GXUN 1AGEB 4MA8L 1A47A 4XBEH 3WFHA 2DWEA 2Y5EA 3C60B 4WO4C 3KPRE 1MI5A 4KK5D 5C6PB 2X4QA 3OTTA 3CVHB 4AH2A 3AMKA 2YWYA 1QR1A 1N5AB 5BCAA 5CGTA 1D5XB 1W72A 4PYGA 4LU5L 4FQCH 4LCUB 2VQ1A 2F5AL 2N1KA 4JZOA 3VGDA 1D3CA 4JPIB 4B7LA 1HSAA 4DGVH 2CUMA 5DLMH 5DC4B 2ESVB 4L5FH 2WUBL 3MQIA 4DTGH 2M1KA 2Q86A 5FUCC 1U8NB 3C2AL 4DCQA 1CL7H 3E2HC 4UIMB 4FRWA 5CLWA 2D4DA 2P42B 3RDTB 4X80L 2CDGB 4QXTA 3KPPA 1UWEH 3MLYH 3BWUC 4QHUA 1WK0A 3CFCL 4XB7A 1CXHA 2OJZH 4JE4B 3V95A 4JDVB 4LARL 4QXUL 4POZD 3FCTB 1X3DA 1A6UL 2R2EA 4S11A 5EU6A 3T2PA 1F4YL 2X10A 3OR7B 4OZFB 3CFIC 1WFTA 4ONHA 4ZNCD 3T0EB 4IMLB 1MCOL 4NM8L 2AKRB 3G9VA 4ELME 1YN7A 3FN0H 1JGDB 2P49B 1N0XL 4J3TA 1A7OH 1A4KA 2MMXA 3GMRA 1MF2L 6CGTA 4WWKB 3S5LG 4Y4HD 1HHIB 2CXGA 2EDXA 2L4OA 1Q9WB 1QKZL 4X4XA 3LEVH 1KPUA 3LQMA 3GBNH 5KZCB 1S7QA 1V3JA 3PWNA 4TQEH 2C3WA 4H20H 3H9SE 1AD0A 4Y16D 5D7LE 4LLWB 1C7TA 4P3DB 5E08L 2VAJA 4C54A 4NKIH 2HRLA 3KLAA 1BF2A 5FDWA 2XZQL 5HHXL 4DVRL 3KPSD 1S9WB 1MI5B 1SEQL 2K7PA 3QG7H 5E4IA 3MLZH 4XPTH 2IJ0C 4NNYA 4DW2L 1QR1B 3IDGB 3DYOA 4Y5YA 5T3ZD 1AGCB 5F6IB 1IEAA 2WBKA 4JFDA 3GB7A 1EHNA 1Z3GL 3TO2A 3VG0H 4RFEA 2YD1A 1MSPA 1HINH 3TVMD 1HSAB 3QHZL 3ZE2E 1NFKA 1CLYL 2DQJH 2FHFA 5A3IC 4PRHD 4XVTH 4JQVA 5DURB 4ZPTB 1FORL 4JHBA 1KJMA 1T4KB 4DGIL 2VABA 4U7MA 1ES0B 4QXTB 3KPPB 5E95B 3LH2H 4J4PD 3BISA 3B8YA 4GG8B 1Q38A 2A1WL 2W60B 4KVNH 4F2MA 1KB9K 4ODHH 3BPCA 1XGYL 1ETZA 4U0RC 3O2WH 5EU6B 2R2EB 4AK1A 5EG6C 3GSRB 3CX5K 5HVWA 1I7RA 4M1GL 3SDXB 4X83A 3RWIA 5MEOA 1NQBA 3BJLA 5E2VL 1NAMA 5DZNA 5ICYB 5IJKC 2F74B 2G60L 3C5JA 4HFWA 3HPJB 1YUHA 1FJ1A 4RCAA 3T1FA 4YC2B 5HYJD 3HG1A 2Z4QB 2BJML 3GEWB 1AKJA 3LZFH 3CFJA 1PD6A 5B4MD 1S7QB 1XH3B 1FE8L 3BX7C 4DVBB 3PWNB 4BK4A 2NY3D 4X6FA 2NY5H 4LCYA 1R3LB 4JRYA 5EZOL 3KLAB 1KN2L 3IJYB 5FDWB 1J0YA 2KQMA 5CP3A 4K3EL 4ODWB 1OTSD 5GRUL 1OAKL 4JO2L 3FHQA 1FCCA 2OM5A 1CQKA 4NNYB 2DWDA 4OCWL 1IAOA 4L9DA 2DQHH 4FG6D 4QOKA 3G6JE 1ACZA 4KUZL 3ARXA 4JFDB 2QADD 3QPQD 2VZOA 5KSAC 5LJYH 1YEKH 4K3JH 3D3VE 4IOIA 3IJHB 3TO2B 4AIOA 2A6JA 3RNQB 1MCPH 1RZIA 3DX6A 2AK1L 4WFHE 4PJFE 5GGQL 4AG4H 1TZHA 3DOSA 1P9MC 3EZ8A 1JUFB 3NFNA 4WNQA 4MD0A 4FFWD 1HYSD 1QO3B 3BVNB 3VFVA 5I73C 5T1MA 3WDHA 5DT1L 3C08L 1YPZA 2BNRD 5FYLL 4LCCC 3JWOL 5F1NA 5I1EL 4Z7NF 3RWDB 1MLCA 4Y5XC 3CMGA 5DJ6A 5F93C 1I75A 4K2UH 3RWIB 2R1WA 2D0GA 4X9FA 1W2KT 2JIXB 1DFBH 4W70A 5IROC 4N0RA 2VLLA 1J86A 4BZ2H 1BBDH 1QLEL 5HSFA 1YQVL 3ARFB 5I9QB 1FJ1B 3QDJA 1R3KA 4YNYB 4PB0H 3HG1B 4HS8L 2VZ1A 4NKDA 1K8IA 1R24A 5E2TL 5DS8A 5DWUL 5C09E 1HDMB 4WGWB 3OGOE 2X40A 2Y72A 3WJLA 3QQ4B 4KTDL 1JPSL 4Y19A 3OR6B 5IHZA 4X6FB 3F58L 1PEZA 4PLOB 2E7HA 1MNUH 4GMTH 4W4OA 4R0LA 4U05A 1RJYA 3ILPA 3UTPE 5F89A 3IFPA 4TSCL 5IVZB 2DWDB 4G6JL 3QXAA 5F7DA 1MHCB 3RWHB 1GGIL 1IAOB 1IEBB 1KCVH 3O2DA 3PWUB 3VW3L 2CLZB 2ERJC 1I9RH 3SDAA 3S3SA 2XZCL 2A6JB 3CNKA 4OLXL 4XMKL 2EYRA 4YX2H 3DX6B 2R8SL 1M71A 4TRPH 4ZTPL 5C7XL 3L6FA 5BV7C 1UM4H 3OKOA 1CDHA 1RIVH 4ETQA 5ICXB 4G7VH 4WNQB 4HX1A 4M8QB 4MD0B 1E0OB 2FH6A 2HJKA 5D8JL 5KS9B 5C0BE 3DXAA 3G6AB 3IU4L 4ELMF 1KYOK 3MXVL 5FGRA 3QHFH 5FO9A 5DFVD 1I3VA 3FO0L 3VFMA 2JJWA 2EKSB 3N1GC 4HC1A 3K80A 5DMYA 4X4YA 5L8LB 4BFGA 4KZDL 3RRQA 5DJ6B 2LU4A 4NQXB 1F2XK 1C5BH 1QSFA 4KKBD 1EGJL 5B21A 4UB0L 5IVXF 4KI5C 3NFSH 3K1KC 5I71C 1IGTB 3GUTA 4MQSB 3EYFA 4U1HA 4R8WL 3CMOH 2HA1A 1QD0A 3CCHA 1LP9F 5F9WC 1RFDL 3CSYA 3WXWH 4G6MH 1R3KB 4LNRA 2ZKHL 3VXPA 4NKDB 4HGKC 4N0FA 5DS8B 3HI5H 4GQ9H 1INEH 2VL5B 4OF5A 2VAAA 3X12A 2DQIH 5MEQB 4K23L 4R0LB 1E27B 4JHWL 5F9JB 4QY8B 1RJYB 3PDOA 1JGVH 3ILPB 1F4WH 4LU5H 5F89B 1CBVL 2ENSA 3ZE2F 1MQKL 2X4PA 3QUMA 4PJBA 5CUSL 3QXAB 3VFWB 1C1EL 3V5KA 5C3TA 3SDAB 3SCMC 3C2AH 1FG2A 3TH2T 2Z91B 4R7NB 3QG6B 3TBYA 4E42B 5CEZL 2BSTA 1UYWL 2K3TA 5DRNA 2EYRB 4HBCL 3MFFA 1SM3H 3CFCH 1J1PL 4JJ5B 5F7UA 1UB5A 5TDPB 4ETQB 1I7TA 2DM2A 3QB7C 1QLRB 5TDNB 4FS0A 1JK8A 4ODSH 4MX7A 2PNDA 1IFHL 3RIFF 3G5ZB 1F4YH 4IJ3C 5D1ZA 3D2UA 5HYQA 3HRZA 1VADA 1HHHA 3DXAB 4YUEL 5C0AE 2XA8H 5FO9B 1MCOH 2GAZB 3QDMB 1BX2A 4ALAH 5D1XD 4OGYL 1G7JB 4L8SC 3JV4B 1VSCA 4S1DD 2A9ML 3OXSA 4YHLH 3IDYB 1NCDL 1DP0A 1QSFB 4MNGA 2WBJD 5BVJA 2LVCA 1KNOA 4X6CF 5JOFB 4L4VA 5GS0H 1BBJB 2VXVL 5I2IA 1FNHA 2VLME 4RAVA 3C6LB 3CCHB 3S4SA 4JFFD 4FQXD 4FZ8H 5E08H 1F3RB 4J8RA 5C9KA 3PUCA 4Q7DA 3PQYE 1IILE 4DVRH 5HVHC 5FA3A 3ZZ1A 2ZZUT 4QHLB 4X8JA 4BYHA 3PP4L 4WHYG 4OGXH 3ZTNH 1VEMA 4MMZC 2VLJE 1MAML 3G6JF 43C9B 3I6LE 4IEFB 1EDQA 3MV11 2QJDA 2QLVB 1CXKA 4G9FA 1CFVL 4UV7H 4HAFA 2FJGA 2X4PB 4PJBB 3U0PB 3VD7A 3V5KB 3P4MA 5JLZA 1LO0H 3VGFA 4JHAL 2K7QA 4DGIH 4PGEB 2BSTB 4GW4A 2X41A 1B4JL 3MV8E 3UJTL 4XPFH 5D72H 5DDHB 1U91A 1OAQH 4N0YL 4LMQE 2HYMA 4PLJD 4PLKD 1UB5B 3W39A 2A1WH 5AG8A 4OD1H 2JKXA 2BHYA 3ZKMC 4QWWD 5I1DA 3GNML 4MX7B 1SJEA 2FLRT 3KXFA 3D2UB 3HRZB 1KBGL 1VADB 1HHHB 4KTEH 1EBAA 5IR1B 5E2VH 1XF3A 3QIBA 3S3JA 5LQBH 4CVZA 4EI5B 4P4RA 5J9PA 3NA9H 4LGSB 1OHQA 4PJ9D 3OXSB 1JI1A 2BJMH 1KNOB 1HXYA 4L4VB 5MHSD 2W9EH 1IT9H 4YQXL 2HT4D 1FE8H 3IFOA 4M00A 3HR5B 1S7SA 5EZOH 4MDIA 5D93B 4J8RB 3T3PE 1KN2H 1XIWC 1NBYA 2VOTA 4K3EH 4P0DA 5IK3B 4GLRI 1BZ9B 4QF1B 5FA3B 4JO2H 3E6FB 3ET9F 4X8JB 3MV9A 4CU7A 2DJSA 3AFLA 1R5WA 3DARA 1D9KD 3PHOA 4KUZH 4WU5A 3WHE0 1PKQE 4RZCB 4OZHA 1NL0L 5C07E 2AK1H 3HKFA 2VZ3A 5DSCA 5GGQH 3GSVB 4Z6AT 4FQJH 3NABH 4LFHD 1RZKC 3P4MB 3GMLA 3QEUA 3QZWA 4WUUD 5JLZB 1QNZL 5F7WC 1MY5A 3O3BA 1OTTD 3FB6A 3HC0A 3RQ3A 3TA3B 2NYYC 5GIRB 4KZEL 1HSBA 5DT1H 4YHZH 4KV5F 3W39B 1IGFL 5E70A 1QFUH 3DV4B 5I1DB 4Y2DD 3S5LB 3QIUC 2CLRB 1ZLUK 5I1EH 4IOFD 3H9ZA 3B9KD 3E0GA 2O61B 3QJFA 5HHNA 5D96B 4XAWH 4JVPA 2R1YA 3H9HB 4YDKL 3PV6A 1ZA6A 1NC2B 3I75A 1I8MA 2J88H 2OZ4L 2BVQA 3O3DB 4FQQA 5BRZD 3TFKD 1GJIA 1UGNA 1QLEH 3K74B 1MRDL 4P4RB 3NCMA 4Y0GA 2AP2A 1CICA 3G5XA 3TO4A 2OTUA 2EDYA 4TNVF 1K6QL 5E2TH 3C8HA 1MIML 4MAYC 4S0TD 5JDSB 1MAKA 1QFPA 3MNWA 4KTDH 1OP9A 1JPSH 1O0VA 3IFOB 3T65A 3UTSA 2NY6D 3F58H 3LD8C 4W6XB 3LRHA 1AH1A 2WM0A 3OBAA 1O7VA 3EJYD 4YDIL 4MDIB 4FFYH 3OHXA 3ULVH 1CE6A 1DQML 1NBYB 2VB5A 3P40A 3EOTL 4YFLF 1SQ2N 4TSCH 3R4DA 5E00A 3IB4A 1BD2A 1GGIH 4APQA 3E2HB 3K0WA 1L9NA 4JM2F 4CDGC 4ZUUB 2AXFA 2YMXL 4NGHL 2PW1A 4JFED 5CEYB 1FCGA 3L3JB 4N68A 4Z7WA 4OZHB 4UQ3A 3J8F7 3RVXD 3GSWB 3O4LA 3W5MA 2R8SH 4PG2A 1QQDA 2WNGA 1A1MA 4ZTPH 5C7XH 5JPNA 1BZQK 2DLFL 4D9LH 1P4BL 1U41A 3R1GL 1JWMB 3IRPX 3S9DB 2FCBA 3DBXA 4IRZH 5TDOB 4NPYB 1RURL 1PX4A 3MXVH 1G9NL 4YHML 3IKCB 4CMHC 4TVPD 3MOQA 3BIBX 1E4XL 4ZD3L 3GJFK 5FYKD 3QFJA 4YAQB 5T1KD 4U6XB 5DC9B 5FYJH 4YPJA 2C4XA 5HHNB 1OAUL 3RY6A 4PJXB 3D85B 3I75B 3MUZ1 3QIWD 4XCFL 2EYTA 1I8MB 1KCUL 2XWBB 1M7IA 2BVQB 1EIBA 2F58L 4L3EE 3CH8A 1CICB 4POUB 4L4JA 5CJ5A 2OTUB 1OPGH 2ZKHH 4HHAA 1G6RA 3KHQA 1MCWM 1S3KL 5C8JA 4MQ7B 3RZCA 4C83B 3BH9B 4HK3N 2Z31D 4TUJB 3JVGC 2IMNA 2HWZL 5KOMC 3VXQA 3UTTE 4OI9A 5BQ7A 5CILL 4JHWH 5HHQB 2OP4L 4K8RD 1IBGH 5D5MF 4RFNC 4XVUD 3VU2A 1OD7A 3V6ZB 1GGBH 1WZMA 4LSSL 1I8LC 5CUSH 1BGXL 2BC4B 1BD2B 2VLKD 4PRAA 4K94L 3TPUA 4APQB 5JPMA 2CDFB 4OFVA 5FV1L 2WWMD 3SDDA 4NQDE 1FFQA 4M93C 4RMWA 3PWVA 1Q0YL 3SDYL 4UQ3B 4JKLA 1YY8A 5C86A 3KNBA 4YFDB 4WFGE 2B39A 1QQDB 1A1MB 5JPNB 1NUNB 4GO6B 3B8SA 2IADB 1J9CT 1NCCH 4UNUA 2A6IA 5I0ZA 3P9MA 3B9AA 1IFHH 1U58A 4G8IB 4HG4K 3ULUL 2C4FT 4QRRE 5FGBA 4EUPH 5C08E 3QI9D 3V6OE 3DBXB 4IS6A 1F6LL 2NLJB 3T1WA 4X0KB 3KLDA 1DVFA 4HK3J 4BSJA 2XNAA 5KG9B 2A9NH 4G43A 1W72L 4RA3A 1K3ZA 1M7XA 2A9MH 3MFGB 1ZS8B 1NCDH 5KSVB 3QUKB 4WCYH 3PWPD 2CRIA 3L7FA 4RWYH 1M7IB 2MOVA 5MEPB 2OBGA 2DLGA 4MJIB 1DQJA 4W68A 4F7PB 1E4KC 4CW1B 1YEEH 2EDOA 5D7IE 2C3XA 3QCUH 5EBMA 4HHAB 3P4LA 1QFOA 5C8JB 1HILA 3RZCB 2NX5E 1VDGA 4P4KD 4WFFE 4H1LA 3AREA 5FYLE 3QA3B 1AXSA 3EGSB 1A3LL 2X44D 3EJZC 2GKIA 1MAMH 4EBQH 4R90L 5SWZA 2GT9B 4NZTL 1YMMA 1AFVL 1N7MH 3VFUA 4HWNA 3N1PC 3CU7A 1JWUB 5D71H 3WEXB 2DQDH 3VXTA 3VXUE 1UCTA 2UVEA 2VO5A 3TPUB 2V2WA 2D4FA 4XP5H 4J23A 5INDB 2F53D 4YHIA 3ME0A 4JHAH 3PWVB 3NZHH 1FNFA 2DKUA 4TNWF 5EOTB 3UJTH 3CSGA 3HC4H 4N0YH 4WW2F 2CUIA 2V2XA 3V0AC 5JW4M 4RAUA 3VFTB 5L6YL 4TSBL 1DBJL 3IDNA 2A6IB 2FB4H 4MNQB 1H3UA 3ARGC 4H25B 1X5GA 4MNHB 5KJRH 4Y5XB 2GJ6E 4IHOA 5CS7A 4N90E 1KBGH 2DIAA 4O2EB 4R97C 2VJXA 4KK9D 1I8KA 5KANG 1QRND 5DUPL 3T4YA 1RV6X 2XNAB 1NKRA 1U8LB 2HTLC 3UYOD 1A6WH 2JB6B 3UZVB 1B2WL 4YDVA 1I1FA 2P7TB 3DX9B 3U36B 3WIHA 5CGYD 1T3FB 4PRDA 2Y36L 2QR0A 1ZMYA 1KFAL 2KZ1B 3RI5F 1QHOA 1YMHB 1DQJB 5E4EC 3RTQD 3N85L 3V7AE 3S96A 3RIFK 5EBMB 2JCCA 4JO3H 4XC3H 1WBZA 5ILTL 3AXLA 2VKWA 1K2DB 4RFOH 3H3KA 5F6HJ 4PJHB 3AREB 2NY0C 1AXSB 3ZE0F 5DQDL 2Q8AL 4HAGA 2QQNL 1LEGA 2Q3ZA 1CLCA 3DMMD 3HCVB 4LLYB 4N8CL 1YMMB 2GJZA 1HN1A 2YBRA 1KPVA 3VFUB 4RISL 4I0CC 1WFOA 4P3CL 1T1ZA 2MCPL 5EOQH 4Z7VB 1GZQB 4HWZB 5JO5A 1IZJA 3SE4C 1GYAA 2VL4A 2V2WB 2P5WB 1NAML 1GGUA 5E8DL 5CSZA 1QNZH 5DO2D 5AG9A 4EVNA 1T1WB 1JNNL 3FL7A 4OIIL 1F3DH 3F65A 3QDGA 4KZEH 5ADOH 4JM2D 2PN5A 1IGFH 4HIEA 2XZAH 4HFUH 4YBLB 1XZ0B 2D0FA 2NY1D 1MCJA 1MCEA 3SO3C 4N8PA 4ZSOA 3W9EB 2V7NB 4YDKH 2FBOJ 2PTUA 5F7LB 3BESR 2FEDD 3CPLA 5J12C 3T4YB 3NPZB 1FFNB 5D7JD 3DTXA 1L0XA 3V4UL 5TGBB 1IM9A 4U0QB 4LPCA 5I1GH 3D39A 4YDVB 1I1FB 5CEZE 2APBA 2FBJL 3RGVC 5ID0B 4PRDB 4M6OL 2YA0A 1I85A 3MNVA 2QR0B 1MIMH 3QXDB 4WY7L 5E9DA 2Y6SD 2FIRT 4LLMA 3S96B 5CD3B 2E6JA 2OL3A 3FB7A 2VDLH 1OW0A 3STLA 1TENA 4FTVD 1OP3H 1DQMH 4AYFA 1IRAY 1OGAA 4L8CB 3EOTH 1QSEE 2A6KB 4GS7C 4ODTL 5CIPH 1CIUA 1LEGB 1Y6KR 1XT5A 3C6SA 3SCMB 4RGMB 2NY4C 3GIVA 3WNKA 2FECI 1B6DA 2PO6A 2GJZB 4KJPD 4UBDD 1QFWL 2YBRB 2X4SA 3CSPA 4QCIA 1T1ZB 3FTGA 3TNMA 5FYKU 1EFXB 1NANI 5H35B 3R8BB 2D7TL 5ITBH 3VH8A 1CU4H 3MJ6A 5JQHC 3O41A 5ESAA 3VXNA 3QQNA 3LKQA 4I2XA 3LRSA 4EVNB 5ISZA 2Q6WB 4P9HH 5JW3L 1AC0A 3QXVA 2E3VA 4XC1L 2I9TA 3CVIL 4XBGA 1FIGH 5DEFB 4HIEB 3BEVB 4LBEA 3CVHH 3U2SB 1JHKH 1JL8A 3QQ9C 4GAGH 4G8GA 2GSGA 4J3UA 4UQ2A 2IALB 5HHME 1YEFH 2AQ2A 4J7RA 4MXVE 3CFEA 3I2CL 1ZOXA 4J2XA 2UYLA 1UB6B 3Q5YA 4OCYL 1KCUH 3MGAA 3CPLB 4XPHL 5GS3A 1QP1A 4RIRA 2F58H 5I74C 4P5TC 1IM9B 3E3QE 4PV9A 3O2DL 1ULVA 5HVHB 1JPFA 4U1IB 4YBHA 5IP4A 3MNVB 3SKUD 2Y5TA 3ZKXC 3UYPA 4HKZB 3C8KA 2I9LB 2R1XA 5KW9L 2VSDA 2PCPA 2HWZH 4ODXA 4NO0A 4G6FB 4NKMA 3T0WA 3FB7B 3IDIB 3STLB 5CILH 4XB8A 2OP4H 5EBLB 1AGFA 1A4JA 4OUUB 1OGAB 4U2YA 5BO1L 3QUYC 1AHWA 1I9JH 4OZFH 5JZ7C 4NRZB 3QNXA 4LSSH 4OZIE 2PKDA 3DLQR 5CD5D 4V1DA 2HKHH 1BQUA 3QEQD 3MLVL 1Y0LB 1ITBB 2C7UB 3BQUA 4F7CA 1GC1L 1JZ4A 2X4SB 3MOBL 5DA0B 3IKKA 1NBZA 4HC1L 4A2LA 5D1QA 5FA4B 2W07A 3NFPA 1Q0YH 4LVNC 3WLWC 1EO8L 2J6EA 4XGZB 3T2NH 3V4PH 3O41B 1NCWH 2APVA 3B6SA 2ZUUA 3SKJH 2J8UB 3U7WH 3ULVF 5JHDE 4PJ8C 4Q74A 3LKQB 4H88L 4JY4B 1OAXL 5ISZB 4YDLC 5BRZE 3O9WC 5ENWB 3NCCB 5EBWA 5TE4L 3MRLB 2I9TB 2VUYA 5F1KC 3EOAA 3MXWL 4JRWA 1QLFB 1QR4A 1LMKA 1D6EA 4K3DH 2GSGB 1DEDA 2DMBA 3QEGL 1FZJB 3MX0A 4RBPH 1FVCA 1NC4B 3HAEG 4F7TA 5F3BB 2UYLB 4M5ZL 1U6AL 4PJCB 1QRKA 3MLWL 5AZ2L 2BERA 2PETA 4LSPH 1ZVSB 5D6CA 5DD3H 3QUML 1TTUA 3MRCB 2PXYD 3ARBC 3PL6D 5JORB 1XIWB 2AI0L 1IQWL 2F5BH 1FAIL 5HHPA 4CL7A 1JPTL 5GRXG 4PRIA 4M48H 5KVDL 2Y5TB 1J8HB 1TFHA 5DUBB 4BUGA 3LS4H 3QUXC 1A3LH 3VGHA 4I9WE 4LLVB 4NO0B 1RUKL 1MCCA 4NKMB 3TBSB 4BZ1L 1A4JB 1L6XA 5J1SC 1AHWB 2NZIA 1DQDL 4UAOB 1R5IA 1PKOA 1H5BB 5DFWH 5E6IC 4S1QH 1R3HA 2DLHA 3BQUB 4NQCA 5T3XL 4LDEB 3LKRB 1DDHA 3U46A 1IGJB 2DTSA 4TOYL 4PJ5A 3NAAL 3G6DL 4GKOA 1JVKA 2X2YA 3L3IA 2FJHB 2WP3O 3MRNA 4LPWA 3B6SB 3KWWA 4TSBH 4I48A 1DBJH 5GS0D 3LRGA 1KGCE 7FABH 5DHVA 1ZLSH 2AK4D 4XPAL 1A2YA 5EBWB 2VNCA 1FH5L 1EUTA 3BE1L 3K4DA 1RHFA 3EOAB 1YZZA 4HKJA 3ARQA 1G7PA 5DUPH 4KRNA 4EN3D 3UC0L 5TPWH 4KU1A 2DQUH 1DQQB 1YC8A 1D6EB 3WFEL 1OY3B 4DFIA 3VXRB 2FRGP 5CJQL 4MAYB 3NCFB 2EDLA 3GMQA 3DETC 3ZDXE 5CJXA 5TJWK 1KFAH 2P44B 4TVSa 4ZUSB 5I17A 2AXGA 4OI7A 3LV3A 4M02A 3LEYL 4HIHA 7CGTA 2M2DA 1EVUA 4MJ6A 4EDWH 5C0FA 4PRIB 1S7TA 2Q20A 5F1SA 4H8WC 1FYTE 1BWMA 4GG6E 4WHTA 4N8CH 1QTYT 1IAKA 4YPGA 4RISH 4P3CH 4NRXA 1MFEL 1AQDB 4L9LC 3VFOA 4Z7UE 3UZEA 1T1XA 3O0RL 4NYLB 1OSZB 1A7RH 1MUJB 1R3HB 1QHPA 2Z9TA 5GS2H 1ZHNB 3PXHA 2HVJA 2ESVE 5BMFH 3ECBB 5J1AA 1RU9L 4ZQKA 4OFYD 1D5MA 3O8XC 4PJ5B 4LPUA 4ZO7A 2ADFL 4OIIH 3PIQB 4Z0XA 5JW4Q 3KWWB 3ZKQD 5KSBF 4I48B 5FCSH 2EYSA 4Q9BA 4TUOB 5DHVB 3AM8C 3FONA 1ZT1A 1HYRC 3FQWA 2ITDA 3BWAB 5CP3H 3PF2A 1LNUA 3C2SA 2VN7A 1G7PB 4PREA 2YD9A 1X5AA 4FQ2L 3TH4T 4UV4L 5JXEC 4G7YH 5IMMA 2D9CA 4AQOA 4TNWK 4YR6A 2FBJH 4G9DB 5DRZB 4TTGA 1N64L 2YD3A 4AT6A 4D9RE 2APFA 5JQ6L 5F7YC 5I17B 2DYPD 1I1AA 4JGUA 1P1ZB 1DUZA 1RJZB 4HJJL 5DMGC 1RQ5A 3ULUE 1B6UA 3EDKA 4D0DB 4MJ6B 3FO2B 3MRQA 2P4AB 4LEXL 4LHJB 2FO4B 4OZIF 3CGTA 4A6YB 4ODTH 1JYNA 3FO9B 4ZFZB 3GRWH 3C5ZD 1HQ4A 4KMTL 4M93B 4YE4H 5KBNC 4QTIL 4YPGB 2R23A 2E9BA 3WBDA 1X4XA 5DUML 4Q6IC 1EA9C 1T1XB 1FZOA 3RI5K 4N5EC 2HVJB 4UU9B 1V3KA 4S0SD 1BOGA 5D2NA 1IC5L 5J1AB 3FJTA 1CDIA 4ZQKB 1NAKH 1D5MB 1TIUA 3DUSA 1P69B 1PYWA 3RUGB 4U1GC 2XKNA 4JG1L 4NO5A 5IBLD 5JW3H 3OKDA 4XC1H 1JF5A 4PJ7A 4RGND 3C9NB 5DGQA 2EYSB 4J3WA 1GZPB 1EJOL 2P8MA 2GUOB 5EU6E 3HNVH 2Q7NA 2VDOL 2AJZB 4JFPB 3FQWB 2Q8BL 5JW5A 3JWDL 3I2CH 5DQJA 3ULVD 1CFTA 4XPGH 4OCYH 4NN5B 4ODUA 1L0YA 1S7VA 1CFNB 3SJVD 3V4VL 5GGRB 3ARDA 1CQYA 4IOSD 3JXAA 2APWA 4MWFA 4QRPA 4YR6B 1TQBB 1UM5L 1BFSA 4G80A 4AT6B 1G0XA 2MPAL 2C26A 4YIQA 1P53A 4XNYL 4OCNC 4I0PA 2BRQA 3QULA 5GGRY 2FH8A 4BZYA 1I1AB 2X1QA 4JY6A 3X14B 1NKOA 4Z76A 5IHUH 5C0ND 5BO1H 3T09A 4F7MA 3B9EA 5CZXC 3VFNB 1NDMA 1OWRM 3NIDE 3IETA 4K7PX 1LE9A 1BREA 4MMXC 1GC1H 1HQ4B 2DIJA 4GBXA 2FO1A 4LLAA 3MA7A 3O3AA 3OJDB 5E03A 1J11A 2CR6A 4HBQA 4UT6L 2VH5L 3VA2C 1U8KB 5FYJD 2P47B 4X7CC 4BFBD 1ND0A 3MRPB 5DD5L 4R7DA 2A83A 2V2TA 1BOGB 1IE5A 5L2KD 4JB9L 4FQLH 5HI3D 3Q3GA 1BFOB 4HWUA 2XXCB 3X3FL 4AEHH 2XKNB 1G6RL 3CDCA 3EO1B 2DN7A 3OKDB 3H0TA 1CD0A 5FM5M 3B3IB 3MXWH 1MIEH 5I66A 1UZ6F 5JR1L 3FB8A 3X3GH 1NCUA 3MCLH 3HI1A 1DCLA 4PBXA 5MENA 4QRQA 3EYSH 4HWEL 5FV2A 2R29L 1R5VA 5DQJB 4RQQB 3ZDXF 2FEEL 1QZ1A 4M5ZH 4ODUB 4PP1D 4P46C 2F15A 2ATPB 4BQ6A 1QBBA 2UVFA 2AJSH 2D7OA 2AI0H 1YA5A 1FAIH 3RVUD 1L6ZA 1V7NH 4JREB 4XNXL 2NY0B 3TBTB 5I8EA 4YIQB 4L1HA 1I7UB 2YKLL 3QULB 3L95A 3LKOA 1MEXL 4TTDD 3DYPA 1OM3L 3BZDA 3HZYA 2G9HB 1PG7L 1RUKH 5F7EL 4BFEA 1U2HA 2HLFD 4JRYE 3ES6A 5F6HI 1MFAH 3H9SB 4TPRL 3VWKA 1K3IA 1CXLA 3L5HA 5D7LB 3C87A 4F7MB 3MRBA 1DQDH 3HE6C 2CIKB 4PJIA 2VDML 1R6VA 2I26N 3FQNA 5I1HH 1XF1A 1FBIL 1WT5A 3O3UN 1LE9B 4YZFF 1CDBA 2ZG3A 5T3XH 1IAIH 4QOKE 3MA7B 5HGDA 4KJWD 3IT8D 3JWNC 5ALCH 4OCRL 3G6DH 1II4E 1KJVA 2CRMA 1P7QB 5J8OA 4NQEA 2YRLA 3VXMA 3D3VA 3IJSA 3X13A 4R7DB 4JFOA 3GIZL 1XGQA 2YPLD 5C0JB 1R3IH 4PJFA 2NMSA 2MKLC 4BA8A 5DJZB 4DAGH 2IANA 3NMEA 1CGXA 3THMH 4XPAH 3IDXL 4LCWD 3PWJA 1D6VL 2ZWLT 4JM4H 5J12B 1OQXA 2P5ED 1YPZE 3A6BH 1JE6A 4XMLH 1PG7W 1DUYB 3UC0H 2PW2A 2WP3T 3FQXA 5SWSA 4XNZB 3RGVB 3HI1B 4M3JA 4UDUB 4WTZA 4QRQB 5MENB 3MRGB 3HC3L 1NLDH 2AJYH 3QWRD 2AAVA 4CN1A 3SDCC 4NT6A 5F9OL 4E5XA 2FWOB 5GGSA 1LO4L 1F6FB 3AAZA 2WQ8A 3V6OC 2I5YH 1AQKL 1GL4B 3LEYH 1KJ3H 3QDJE 4HUXB 3HUJA 2EE3A 3O2VH 4F80A 4HXAL 5IFHL 2XTJC 2R56H 4I3RH 1KXVC 4Y19E 3MNZA 3LKOB 2NY4B 1EAPA 3HE7A 4XVJL 4KRPD 3VWKB 2ADGA 2IAMD 2W0LA 3MRBB 2IF7A 1AGDB 3F5WA 3FQNB 4KK6D 5IVNA 5ALBL 4YBQC 4Z7QF 3RVVD 3O3EA 2CUHA 5FKAA 2XN9D 1NFDA 3RVWC 4HH8A 5HGDB 1HWHB 43CAB 1RU9H 3JWOC 3MO1A 1WZ1L 2C3HA 3TCLA 2ADFH 2R0KH 3WIHL 1C7SA 1QACA 5DVLA 3VXMB 3D3VB 3IJSB 3GSNA 4NO2B 4ELKA 5EIVA 5F96H 4C56D 4HUWB 5E0QA 1A7NH 1FRGL 2DAVA 4XXCA 3DECA 5DJCB 1HI6B 4PJFB 3LIZL 3QEHA 5FUOL 2A77H 1M7DB 3CFKB 2IANB 4PJDA 5IM7B 3U82B 1X5IA 3HAEB 3HZKA 3SDXF 4JAMB 4K3GA 1J0IA 3VGGA 3DO7A 3VXSA 3KPQB 4P5TB 4MB4A 4OLYH 2OSLA 3FQXB 4JRXD 4KAQL 3P73A 3L7EA 2V5SA 2CKBA 1T0PB 4MXQC 4AIXA 1WQVT 3W11D 5FGSA 3MREA 3ZKXB 1WICA 4LRNL 1NEZG 2WBWB 3D9AL 1QSFE 2AJUL 3U9UA 4R2GD 4R3SB 4NT6B 3TZVC 5JQ6H 2IFFH 1GVIA 5GGSB 4LF3B 5TQ0L 1E4XI 2XKUA 1FVEB 3RVTD 3X17A 5JIHA 5L88L 3QUYB 2NY2C 5HTSA 1KCSL 5D7SL 2PR4L 2F54D 5BS0A 5ETUA 3TYGL 2Q7YA 1UXSA 3FQUA 3MOAH 4GSDL 4LPTA 1YDPA 3MRKB 4LEXH 2OQJB 1QSZA 3MNZB 3NIDF 1KEMH 5C09B 2ZNXA 3V8OA 4IRSC 3SO5A 4NCDA 1CT8A 5IIEA 4QTIH 1JNLH 4LVNB 5EBGA 4PTTA 5J3HD 3CX2A 3F7PC 4J1UA 2AV1B 1EERB 4ZYKA 3RX5A 1H3PL 4PJBE 5DRWA 5I1KH 4PJ8B 1DSFH 3I9GH 2N7AA 3O3EB 1T20A 5JXAL 4K07A 3RWJB 3HZVA 4M9PA 3ETBF 1R3JA 3EBAA 3TCLB 3BPNB 5DXWA 2KUTA 1ZGLP 1KC5L 5EFIA 5JNYA 1EXUA 4ZPVA 4ELKB 5C0RL 3BT2H 3NN8B 5HHOD 2XICA 1WAAA 2RJMA 4LLDB 1CL7I 1RIUL 3QEHB 4Y4FA 1EJOH 1EHLH 2OL3L 4P9ML 2VDOH 2ICEA 5MI0C 3JWDH 4W81A 3UXFA 3VXSB 4CU6A 2IQAB 4M7ZB 1F5WA 1S9XA 2XQBL 5HYSG 1J0JA 5C0BB 1NGPL 5T3XE 1G7QA 3ARBB 3V4VH 3P73B 3L7EB 2CKBB 4PGZA 4NZRH 4NQUA 2D0HA 2EXYD 4HDIB 1UM5H 3ZDZE 4E41D 5FECB 4MNGE 5EU3A 4GJTB 2R9HC 3U9UB 2DDQH 4L4VE 2N4IA 3HZMA 4OTXH 1GAFL 4Y4KA 1NGWA 2DMCA 4LSVL 4QRSA 4XBPB 4QGYA 2AQ3A 3FFCD 3FT3B 2IBGA 2R2BA 4MDJA 3WKMH 2UWEA 5ETUB 3FQUB 2Q7YB 1YDPB 4FABL 2G5BB 5E6IB 2DI7A 4M7LH 2NW3A 1QUNA 1X5KA 4LOUC 1CT8B 3KLHC 2H6PB 4MGXA 4IRJA 1BECA 4LVOC 4PTTB 5DTFA 4ONFH 5EC2B 4G9FE 3V7AG 4P2QA 4J1UB 2AEPH 3SGKA 5J4MA 2Z35B 3K46A 4C57C 3D18B 3F7YA 3OG4B 3BAEL 4LQFH 3KGRA 4UTBL 3EO0A 1A6ZB 1P4IL 4JB9H 1Q9OA 2DJ4A 2X1WL 2XOTA 4YGVA 1R3JB 3X3FH 1JF6A 3TN0A 5KS9F 3M07A 2VKXA 3DWTA 1EXUB 3QWOA 1XGPA 2RAMA 2E6PA 4HH9A 1XR9A 2XG4A 4MCYA 2OTWB 3LN9A 4RWHA 4Y4FB 5E2JA 3LMJH 3LCYA 1TITA 3RHWF 3K2UH 3KXFE 2R0WL 4BSWB 1NCAH 1ROWA 3LQZA 3ALPA 2LFGA 3PDDA 1U3HD 2WLYA 2NW2A 3C09B 25C8H 1G7QB 1PAMA 1Q8MA 5C0AB 3W0WD 3OJ2C 3T0ED 4GRLD 1URLA 3CUPA 2FX7H 4XNXH 5EU3B 3PG2A 3MRJA 1MJUL 3HZMB 4WWKD 2YKLH 2J6EL 4Y4KB 4JN2A 3MBEC 4ZXBC 3P9WB 1RZJL 3K1DA 4P23C 4ZAKD 3VDBA 1PG7H 4D3CH 4QRSB 4WEBL 2R2BB 3VI4F 4MDJB 5KZCD 5H94B 1TJGL 4PJGA 1LEKA 5A2LH 4L9LB 3P4NA 1HIML 4TPRH 5ACLA 2CMRL 3SGEH 3E3QC 3MGOA 3MV9E 3KR3H 3KYNA 3NZ8A 4NCC1 2VDMH 3T0DA 2Q3AA 3PQYB 3F12A 4WV1C 5C6TL 1FBIH 1NSNH 2EXWC 3DIFA 5F7FA 3G5YA 1P4LB 3BZ4A 4IRJB 2VLJB 2HT3C 1OAZL 3OV6A 1RIHL 2E9JA 2WSKA 2EIBA 2VXUL 3VWJC 4OCRH 4JDTH 1KELL 1MJ7L 2IQ9H 4TUKL 1XR8B 2A0LC 4HZLA 2Y06H 4MD5B 4ZDHA 5E5MA 3GIZH 3EO0B 2LVEA 2G2RB 4MB3A 3T4AB 3BRFA 1Q9OB 3QQ3A 3L5IA 1J5OH 1NGZA 4FQIL 4Z95L 3IDXH 3JV5A 2FYYA 4P2OC 3OZ9H 3QWOB 1ITCA 4XHJC 5DURD 1IC7L 1N3NB 3HR6A 4U6HB 4HH9B 1IKNA 3MROA 4Y4HA 3VI3F 1OB1A 3L3KA 1VKXA 1IGCH 4XNUL 1BHGA 1J1OL 5D70H 4DKEH 2FX9L 3LQZB 3ABZA 4J3XA 4HMCA 3BN9C 3T8XA 3I84A 1N59A 4Y16A 3LN5A 1OP3K 1KB5A 8FABA 1LO4H 1FSKC 2HLAB 4XP4H 5H8DA 1AQKH 1KIQB 3BIKA 5E94A 4MA1C 1NPUA 1NBVL 3KPSA 5KAQF 1P7KA 5IFHH 4BFIA 3VE0A 2WIIA 4G5ZL 3STBA 5EO1A 3UTSE 1SBSL 4LVHC 3L3OA 3CLFH 4X5XB 2ADJB 4XVJH 5FO7A 4KHTH 3EO9H 3NGBC 2WV3A 2HFFA 2X4UB 1LEKB 4PJGB 3P4NB 3TVMA 1Q94B 5DYOA 2VERN 3MGOB 1I9EA 4PJBF 5I76B 1VFMA 4PRHA 2X9YA 1BD2E 3MJ8B 1SJHA 3G5YB 4F33A 1SYVB 3VCLB 1ADQA 4KPHL 4J4PA 1WZ1H 4Z7WE 1JZ5A 1U92A 3WIHH 4UTAH 2J8OA 3O4LE 4ZDHB 5E5MB 2DL9A 4WHYH 1PZ5A 2E27H 3GI9H 4O5LH 2WAHA 1FRGH 2DQEL 5C07B 4JN1L 1JYVA 1U95A 3LIZH 3QQ3B 4EZMA 5FK9A 4Z8FL 1QFWI 3H2WA 3EDJA 2P24A 1NGZB 3MA9L 5FCUL 1GIGL 3IVKB 2FYYB 5IB3A 2WW8A 1U8OA 1HHKA 4H0IA 4HKBB 5KSUA 4FQ1L 4FOMA 4UIKH 1CK0H 4D0BB 4YXLL 3HB3D 1OB1B 2DL2A 4KAQH 5HYJA 3QFJE 1T2XA 5IW1B 1T04A 2VDKL 1D5BB 4FP8L 4ZFOA 1LK3H 4YHNA 5IB1A 1VGEH 4LRNH 4LAJH 5IBUB 3AMLA 1ZA3A 3FMGL 4QYOA 4BSVB 4Y16B 5BW7C 1RVFH 4PRBA 4X7TB 5TQ0H 2NXYC 3JTSB 3BIKB 5CJBA 1S5IL 4LKXA 5GS2D 2Y7QA 5IQ7L 2JIXD 5L88H 2VXSL 3RPIA 3KPSB 4GAJL 3ULSA 1KCSH 3TYGH 1P7KB 1XGTA 4GSDH 2F9BT 2H32B 3ARFD 4ZOEA 3E6HA 5EO1B 2C3VB 3LN4A 5ERWA 1OQOA 1FFRA 5E5RB 1CLZL 1GOGA 3EYQC 5L9DH 4S2SB 4HUNB 4M7KL 4OZ4A 1F4AA 1P5UA 2Y07H 2E7LA 3U4BH 2BNUA 3D25B 4GKZB 5I75C 1I1CA 5FB8B 4PRHB 5IWLC 3GKZA 5HXMA 2H1PL 3S36L 3CAFA 1G9NC 4L8BA 1X4ZA 4JG0L 1MREH 3C60C 3ZT7A 4I5BA 2BOBA 1ORQA 1YECL 2BNRA 3BUTA 5C0RH 4HS3A 5GZNC 1L7IL 4RBPK 3B5HA 5EN2A 4X99A 2VR4A 1MFDL 4Z77B 3O6FD 1WFNA 5EOCH 1U95B 5FK9B 1QA9A 2P24B 3CXHJ 2JJSA 3P0VL 2QQLL 4JEGB 4L29A 1NEZA 3S3PA 1LE5A 1AP2A 4ZUTA 1HHKB 4P46B 5HBBA 2J3SA 1NMCB 1ZV5A 2H26B 1W0WB 1VFBB 3PP3H 5KSUB 1KXQE 3I3BA 1NGPH 3D0LA 3RDTC 5HDQL 1X7QB 1K5NA 1EFQA 5B8CA 4O4YH 1ZA3B 5SX5H 3PHQA 5AYQA 1CN4A 2K9UA 1I3GL 2EC8A 4RAHA 1K8DB 4V2BA 4XP9H 5DJ0B 3HNSL 1HHGA 4LSVH 4S1SH 4LKXB 1TJIL 2JELH 5IB4A 1SBBA 2Y7QB 1MPAL 4WHCA 4PS4H 4K94C 1GPOH 1T22B 5LCVL 3WO3B 4ENED 2EICA 3L5WA 3V5DA 2IPUK 2YXMA 3E6HB 3QISA 5D9SA 3ZYOA 3BKML 4JPWL 5ERWB 3AU1B 2QADB