4ERSH

A molecular basis for negative regulation of the glucagon receptor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
231
structure length
231
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVMYYDGSNKDYVDSVKGRFTISRDNSKNTLYLQMNRLRAEDTAVYYCAREKDHYDILTGYNYYYGLDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab light chain
publication title Molecular basis for negative regulation of the glucagon receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2012-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ersH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ersH01
2HWZL 4JFOA 3CIQA 4I3RH 2HH0H 3U2SA 2X41A 4G5ZH 5T1MB 5FCSH 3ZTJH 1D7FA 3BD3A 2FL5B 4IDLA 4BH8B 3DROB 4O02L 1NGQL 3BP5A 4LCWE 4QT5B 3UTSD 3DIFB 1U3YA 4XCNB 3ULVE 4KTDL 1W72A 2F8VA 4O2FB 2AJ3A 4YDVB 3OX8B 4PGCA 4H88H 5SWSD 2JJUA 1A6AB 2MCG1 3WFCL 3U36B 3CUPA 3QXDA 5HI3D 1NCTA 4PP1C 1UH3A 5IFAH 2UZXB 4OBRA 4ZOAA 3D0VB 1Y6KR 1WZMA 2Y1VA 3L3OA 1KLUA 3G5XA 1AGBA 1N0XH 3H7LA 1FVCA 1F8TH 3VJ6B 4I5BB 4X99B 3VFOB 4WV1B 3VW3L 4WGVB 2VL5A 4FTVA 4OZGA 5CHNA 3BN9D 1JF1A 1CU4H 3KJ6H 3LVEA 2VDNH 4UDUA 3VRJB 5EH1A 1MHEB 1NH6A 2ATKA 2VR9A 5H8DA 5E2TL 4AL8L 1T6WA 4P3CH 4PJFE 5HPOA 4XBEL 1JHTA 5D5MB 2D7PA 2QSVA 3ESVF 3VDAA 4FQIH 1FIGL 1UACH 2R2EB 2IAMB 3CVHL 2CRZA 4UAOB 2NX5D 1RUAL 2EE3A 1LEKA 5DD3L 3S37L 5E94B 3M1BB 3MNVB 1DN2A 1FZKA 1ERNA 1U8MA 2NLJA 2NXZD 5GRWA 5HHOB 5HYEA 2VE6B 3RUGF 4MJIB 3E6FB 4PG9A 5JW5A 1T89A 5DUML 2OTUA 2VR5A 5I6XC 2GTWB 4YR6A 4GRMB 1NDMA 3EOAA 2C1PA 4V2CB 3VE0A 3DVIA 1MWAL 3GBMH 2HTKC 1Q9WB 4NKDB 3UX9B 3WFDH 3MO1A 4P9HH 3BQUA 1T1XB 2UZIH 4GBXD 2FR4A 2BVEA 5JO5B 3UJJH 5HHQB 3BDYH 5CEZH 3MRBB 1AIFA 3VA6A 1IL1A 1T89C 3U48A 1ORQA 3FO9B 2VLLB 4IRSA 4P5TD 1CN4A 1OB1A 4QHLB 2PTTB 1J0ZA 5HPMA 1Q0XH 3GB7B 2Z8SA 4RA0C 2FYYA 1IC4L 1W0VA 2CKBH 3KPMA 3WCYA 3BQUC 4XT1C 4LLYB 2X4SA 1EJ6A 1Q0YL 3ARUA 1RURL 1KC5H 4NKIH 3Q2CA 5BVPL 5HYSA 4WW1B 5ESQA 1KJ2A 4V1DD 1KCUH 3DETD 1NC2D 1U3HA 1S5IH 1NAML 4H8WH 3RP1A 3KNBB 1X5LA 2IANA 3G08B 4QRUB 3D87B 3ROLA 3M17A 4YXLH 4ZUSB 4ZDHB 3Q3GB 4OTXL 1NMCC 4WFGD 4PJ8A 4OZFB 5DJXB 1T0MA 3IU4H 5EIIA 1U3HC 2NNAA 3BISA 2IH3A 2ZNWA 1RI8A 1FZMA 4RDQG 4BKLB 2HJLA 4P4RA 1RUPH 3BKYL 3B2UC 5GRJL 2VISB 4HUWA 2CKBB 4TSBL 4JO2L 4TVPE 2W91A 3GSVB 3UJTL 4WY7H 4AT6B 2GQHA 1X5GA 2VO5A 3BSZH 4PJ8C 4HJ0D 4FQCL 3TJHC 2D9CA 1IMHC 2G2RA 2OJEA 2SEBA 2ZSVB 3SKMB 5FA4B 3SHSA 3MRQA 4M43H 2W07A 4CADB 1BBJB 2B0SL 4JFQB 1WGOA 3G6DH 5FDWA 2P49B 4J6RH 4AIOA 4PRNB 1QZ1A 1C5DA 2J5LB 3HZMB 3L3IA 1GJIA 2E9BA 5LGHL 1CZ8H 1X6NA 1FFPB 5L2KB 3NCJL 4ZYKA 3OHXB 5ILTH 3BHBA 3DO7B 3WFZA 1XIWD 3W39B 2P8PA 3HKFA 4YGVB 1S7TA 5DD1L 2PXYD 5GIRB 5ALBL 5BO1L 4TSAL 3QWQB 3S5LB 3EGSB 1NGYA 1KJ3H 4HFUH 3UTTB 5I17B 5KAQF 4XVSH 2GSIA 4ZO9A 1UH4A 3PQYB 5GJTH 3FAWA 2ZUWA 4OKVA 1CDJA 5EU6D 4K7PH 1NJ9B 4CW1A 5IM7B 2QQQA 1PBYA 3W11D 3PG2A 1N64H 1LD9B 3T2NH 1F6LL 4AEIL 1HEZB 4BK4A 4EUPG 1DUZB 3DV4B 4IOIB 4OKDA 5GHWH 4OB5L 1LO4L 3OBAA 4K8RC 2NY0B 3I6KA 3NA9H 3OZ9L 1NCWL 1MCDA 4PLNC 1B6UA 3WS3A 4OZHB 4YDLC 1ZVSA 3CXDL 1OTUC 3D9AH 4AEHL 3FZUC 4JFDD 3DURA 1Q94A 5SWZB 2R1XA 3UYPA 1UA6L 4ODSL 2HG5A 2GW5A 3V5HB 2VQ1A 4PRIB 3KHOA 4JKPH 4F80A 1YNTA 2AJSH 3BGMB 3C09B 2XN9E 2HVJA 4DZBA 4LVOB 2BMKA 4I8DA 5M7QA 4HK0B 2QHRH 3Q0HA 5IBTL 1IQWL 1ROWA 5GJSL 4O2EA 3BPLC 3CJJA 1FORL 1ZT7A 4KDWA 3RL2A 4HS3A 3EDFA 4YHPB 3U7WL 1HWHB 2KDGA 4Y16B 5EU7C 1U3JA 1ZLSL 2X4RB 5FDYA 4XWOD 2YMXH 5B38G 3IT8D 3C60D 5HGAA 4L9DA 4OI9A 3BZFA 1MF2L 1I8MB 4O51A 3VD7A 2UZYB 1VB9A 1Q1JL 4DGVL 1EO8H 1RVFH 3I3EA 5FHBH 1G0XA 1IEBA 2V9RA 2OXHA 2DD8H 5I1LA 4RGNE 3GMRA 3B9KB 1XH3A 3EYFA 4DOHE 4U31A 3LPFA 3VXQB 1C16B 3O6ML 1S9WA 1DSFH 4JO4L 4M5ZL 1KN4L 2AXJA 2WBJB 3W2DL 3NZ8B 3VDBA 1NAKH 4WHDA 4LVNB 1BX2A 5IK3A 3DVNA 3NFPA 4XRCB 4KHTH 1RIVH 4OD1L 5F7KC 4UV7H 5FOBA 4WUUB 4PJ5A 3ILPB 5IB2A 3CDGA 1M1SA 5IJVA 1WAAE 5CP7A 3S36X 4JN1H 3BH9A 2HKHL 4PV9B 4RFEB 5DK0A 1T1YA 3G5YA 4Q7DA 4XCCH 4WFFE 1UJ3A 3UZEA 2BVOA 2JTDA 5A2JH 1FPTL 2F54A 3JTSA 2IQ9L 5E9DB 5IVXE 3MGOB 4TUOA 1BFSA 1BZ7B 1OP5K 1OARH 2BOBA 2JCCF 2VLMD 3BEVA 4HIIB 1ZKAA 3BDBA 1ZEAL 4JZOB 2Q6WA 4DGIL 2NY5L 1UJ3C 4K7PY 1HN1A 8CGTA 1A2YA 1FN4A 2UY6A 1GGTA 2O5XL 4Y4HD 3HR6A 3ZYZA 3FOLA 2K7PA 4HDIA 5E2JA 4X7FC 1JZ2A 4J2XA 1KF9B 2GITB 3U1SH 1OAKL 4X7EC 2Z31D 2Q1EA 2ZCKL 5IMKB 4F9PA 5HY9A 4MXVE 5FO9A 1MWAA 4DFIA 3GUTB 4PV8A 1S7UB 4Z77A 1OGAB 3Q6FB 1BMGA 1UZ6E 3OJDB 2OSLA 3ZE0F 2NTFA 3QQ3A 5KVGL 1MLCB 3ULUC 4G7YH 4DZ8B 3JTTB 4AEEA 4F9PC 2W65B 1LO2L 2FGWH 3L5WB 4NM8L 1KLFA 2IEPA 4MAYA 5EC2A 2AXFA 3I75B 3FTGB 4HT1H 3UTSE 1YEIL 4FQLH 3TN0A 4ZPTB 4FS0A 3MJ8A 5SWSE 5D7SL 5E8NA 4S1QH 1YUHA 3S36H 3RDTA 3HRZB 2NXYC 5FV2A 3OKLA 4DVRL 1IAOB 2FX7H 2VOTA 4PJAB 3V0WL 3GHEH 3S6CA 1FL6A 1YMMD 5H37G 5K9JL 4MAYC 5EUOB 1AGCA 3DMMC 4HH9A 5E8PA 5D72L 4ZSOE 3SKJL 1MY7A 3T1WA 2EZ0D 4PGDA 4UOJA 5D1ZD 5DRXA 1NDGA 4X4ME 3ARGA 4XPGL 3RDTC 3BOVA 3AB0C 2JJSA 3KYAA 4NFDA 4GFTB 3IXTA 2VZUA 4MQ7A 4Y1AB 1OAQL 4NQXB 3IDXH 1T2XA 2HJFA 3BW9B 3F7VA 3TJEH 4TULL 4WI3A 3TT3H 3UCRA 3T4AA 4HJGB 3EKCA 3D18B 3WN5B 4N5EC 2HLFC 1DQTA 4HEME 1NGZA 3EZ8A 5F72S 5C0AA 3PWJB 3PHQB 5DYOA 3P40A 4KMLB 1ONQB 2JJSC 2NX5E 4QRQB 1AI1L 1S3KL 4M61B 2ZPKH 4M7JH 1A6PA 1WZKA 4QGYA 3BKCL 1HXYB 3PWNA 3X12A 3QRFM 3BESR 2IPUK 3P4NB 4L3EB 2DQUH 2BNRD 5IR1A 5E2VH 4OGXH 2P24A 1EFXA 2C4XA 2D2OA 3RVWD 4Z5RB 2V5SA 4NO5B 1MAJA 3GSQA 5E6ZA 3CFCL 5EZLA 1D5ZA 1EBPA 5C0IB 5EOTB 2ZG1A 5T1LD 3QUXA 4DUVA 3DX6A 3GSUA 1E0OB 3QG6B 4DVBB 4K3DL 1AR1D 1KLGB 4ESKA 4N1EA 3ZL4L 1DFBH 3IFNH 4HPYH 3T0EB 4XBGB 3MV9B 4YHNB 1G6VK 4OLZH 4LL9A 2ENYA 1DLFL 2AERT 4Q6IA 1A5FL 3GO1H 3QUXC 5L9DL 1JFQH 3QCVL 4S1DC 3QPQD 1NL0H 1I8KB 5MERA 2VSCA 2CMRL 3Q5YA 5C09D 3MOAH 4OF6A 25C8H 4RZCB 4V1DE 4ORGA 4GRLB 3HMXH 1A14H 5E2WL 4J3TA 4Q6IC 1A9BA 5DVMA 4RSVA 5GGVH 4A2MA 2VLJD 2J8OA 2VIRA 4Y5XB 2V17L 2XTLA 5C0EB 4KFZC 4WFGE 1JWSA 2APWA 4HWBL 2PYFA 4KDTA 5DURD 4HC1H 3GHBH 3NCCB 1CXIA 3SDAA 2QSCH 2IGFH 4ZUUB 3PWLA 3R06A 1NFKA 5CD5C 2UVFA 1RZ7L 5AAWA 4F7MB 3HZKB 4LQFH 5I1KL 1U8PA 3TVMB 3L7FA 4YHIB 5IBLD 1Z9LA 4R96A 4ODUB 4KDTC 4PJHB 5CLTA 4NKOA 3QIUD 1PGRB 5C0CD 3SDAC 2MQ3A 4I2XE 2VXTL 4F2MA 1HKLL 3T08A 2I5YH 4NZRH 5FXCH 1BP3B 3S3JA 2L7JA 5F6HI 1HINH 1JGVL 1MCNA 4OI8A 4LMQI 5F9DC 1A8JH 5D8JH 5KTEL 4GG6F 3PDGA 1GPOL 5DI8B 4DTGL 1Q9OA 2ADJB 5FA3B 1OAXH 5FK9A 1T3FB 2BC4B 4OAWB 1CLCA 1X9QA 5IV2B 4QRPD 5CBEA 1XR9B 3PV7A 1KTRL 2EKJA 9CGTA 4LHQB 1J18A 4KVNL 5DZLA 4GW5A 4BSVA 5EORH 3MRIB 2H8PB 4PYHA 4MA7H 5ADOL 1SMOA 1PSKH 2R69H 1KEMH 1BD2A 4PJXA 5D93B 3TFKC 1IC5H 3MRHB 3D85A 1E4XH 3INUL 4OD3H 1I9RL 1Z9MA 3BE1H 3C5ZB 2WIIB 1UXWB 3CFIC 2B5IB 5EU6E 4Y19D 1BM3L 3O3BB 3MRRA 5F96H 5D7IA 4YHKH 1MCKA 4DCQB 4MCZA 2I27N 5FUCE 3OAZH 3MODH 3VXOA 3UAJD 1NFIA 3HTLX 1BECA 3HN3A 1I8LC 5JXEA 3OAZK 4TSCH 3FQWA 3O6LH 1A1MB 4AIXA 4PJIF 1A22B 5JMOC 4KUZL 3K8MA 5IBUG 2CIKA 2M8XA 4JFDE 4O5LH 2BSSA 4C4KT 3EO1A 3U4BH 5ECJE 3D2UB 5T33H 4B7LA 4L5FH 4JDTL 2WWMC 1J0IA 1HYSC 5JXEC 1HSBA 1CLYL 3GIZH 3WLBB 4JPVL 3VFSA 4XMPH 5D7LB 5FGRA 4LPTA 1WIUA 1WWBX 3ARDD 3GSOA 2FX9L 5C07A 5IHZB 5H37H 3RBSA 5DRZB 4KGJA 3BT2L 3FT3A 1HILA 4ZTOH 2IPKB 5GGRY 4OUUB 5SV3A 5E4IA 4RAUB 4IEFB 1M05B 1NGWA 1A02N 4D8PB 3VFUA 4R7DB 1CXEA 4IIQA 4XGZB 3CSYA 1AHWB 4MNQD 1N2RA 4K3JH 5F89B 5GGVY 5TH2A 3AS2A 4J3UA 4KKCC 1F58H 1MHCB 4FZEL 2AEPH 1PY9A 3UROR 3QIBD 1VEPA 4GMTH 2F5AL 3H42H 1KTKE 3RUGA 4IIQC 1FLTX 3GK8L 4HIHB 1UKTA 2AEQL 4ZQKA 2WWKO 4HK3J 4HS8H 5HVGB 3GMPB 3BXNB 1YNKH 3HS0A 2CR6A 4WDIA 1IARB 2H32H 3UTPD 3B43A 4E5XB 1DVFB 4LNVA 3NIDE 5I30L 1QD0A 4Z7WF 1P9MA 2GSGB 1J10A 3HG1A 3DX7A 1SM3L 1J1PL 3RJDA 5E1AB 1AO7D 2F53B 4MA8L 3ELAT 4PJEE 4YFDB 3KPRD 4G7VL 4PRHA 1CK0L 4JM4L 4G8EA 2JIXB 1DLHB 5E6ID 1V3LA 1QFUL 1TQBC 2XQYG 4OM0L 5DT1L 32C2B 4JFXB 4M6OL 1C5CL 4XI5D 2A6IB 5CJQL 1P9MC 2YPVL 5LAXB 2CO7B 3KPQB 1WBZA 3QDAA 3QNYA 1AD9A 4MDJA 5FYJD 4CUCA 1HI6B 1IM9A 3TESA 5BS0D 2A77H 2WZPD 1TJIL 2XWBB 3WO4C 3PP4L 1RJZA 3NFNB 1FDLH 3C8HA 5KG9A 2H32B 2VLME 3HC3H 3BUTA 3RPKA 3CH8A 3P73A 3VXUD 2QADC 4OLVH 3RNKA 3JVGA 1KNOA 1W72H 4FFZH 3BRFA 4KY1H 4JRYB 3DPBA 3DUUA 4BZ2L 5EU5A 5F8RC 3T2OA 4QXWA 1ZT1A 3DNKA 4F57L 1V3JA 4X4XA 1N7ML 3E3QC 1JF6A 2OI9C 3V6OE 3DRQA 3JVGC 2YC1A 4WW2B 4ODVL 4CVZB 4OLUL 4L4JA 4KJWD 1MNUL 5HYIA 4JFOB 4OGYL 1PLGH 4YH6A 3BN3B 3U2SB 4G9FD 4OD2A 5I19H 4L8SA 3RY6A 4MA1C 1QFPA 4WCYL 4S1RL 4OIAA 1NLBL 3BP5B 3R8BB 4R0LA 4KK6C 2N7AA 2DMBA 1W72B 4U3CA 2EDLA 2YA1A 2AJ3B 1F13A 3C87A 4PGCB 1LDPH 3B6SA 4EDWH 4M48H 4BZ1L 3ZKND 3RY6C 3CUPB 3ULVC 3QXDB 2EE6A 5D1QD 3ALWA 1RMFL 4OF7A 2DN7A 1FYHB 1UH2A 3DXAA 4R0LC 3OXSA 2E9IA 3L3OB 1KLUB 1T2JA 3G5XB 4P2RD 1AGBB 4WU5A 5AG8A 3VD3A 1FVCB 1YMME 4RGOH 5ENWA 1HQRA 1DBML 3KDMA 4BSJA 4G3YL 1YN6A 3HE7D 1HK6A 4FTVB 4OZGB 5CHNB 1HXMA 1JF1B 3K8KA 4WIQA 4R4FL 4ORZC 3RAJH 3LDBB 4UDUB 2ATKB 2P43B 3OTTA 4I18A 3VI4E 1Z9SA 2YWYA 3GMQA 3IS0X 5I75C 3UTQA 1JHTB 5I6XB 3WE6A 1QFWH 1SY6A 4FQXA 1LWRA 1D5BA 3UYRH 5KVEL 2O5ZH 3K4ZA 3BKML 1I7RA 2B1HL 3PWPD 4FG6C 1LEKB 2YRLA 1U8MB 1FZKB 2NLJB 1F4HA 4WENB 1KJ2H 4X6CF 4K2UL 4PG9B 5JW5B 4QTIH 1V7ML 2OTUB 3TYGL 3GRWH 1X5HA 4YR6B 4FQXC 1NDMB 2DIBA 4MB4A 3I3BA 3EOAB 1R6VA 2BNRE 2C1PB 4S0SD 3VE0B 1MAMH 4KJPC 5CEZD 1UB5A 2I60H 1QBML 3MO1B 3BQUB 2OK0H 2FR4B 2FD6H 3QUMA 3BDXA 1AIFB 2FJFA 1IL1B 1ACZA 1ORQB 2D4DA 4IRSB 4PLOB 1OB1B 1MCJA 5HPMB 2BFVH 1TXKA 4UNTA 2FYYB 1FHGA 1W0VB 3KPMB 1NUDA 3T3ME 4P48A 1JUFA 2X4SB 2E6PA 5TE7H 4YQXL 5HYSB 4NSKA 5L2JA 2C3XA 1NMCB 5ESQB 1KJ2B 1MCWM 4DW2H 4LSVH 2GI7A 3TYFA 1KCSL 4U1IA 5C09E 1U3HB 3VH8A 5D2NE 3ETBF 4F7CA 4PJ7E 2HYMA 1AP2A 1NCAH 2DJSA 5EO0A 2WUBH 2IANB 2YZ1A 3IDJA 4NJ9L 3ROLB 3M17B 4G8IA 3A6CH 2VLJE 1FFOA 2VAJA 1CXLA 3DI3B 4PJ8B 4BELD 4JPWL 1T0MB 4OZFG 5EIIB 2NNAB 5BXFA 1T66D 5DO2C 2IH3B 5IB5A 5L7XL 1FZMB 2HJLB 4P4RB 5B21A 4HUWB 1JTPA 2Q8BL 2VZTA 5HDBE 4BQ8A 1E6JL 2EDTA 4KAQH 4D9LL 3X3FL 2E7LA 4YHZH 1A7NL 5EIVA 4K8RH 2G2RB 2OJEB 2SEBB 3MRQB 1IGIH 5C0CE 1BIIA 5DMGD 3S34H 4ELKA 1OW0A 1ZV5A 1PQZA 1NANI 5E8DL 5FDWB 4JAMA 1H8NA 4LPCA 4H1LH 5DC9B 1C5DB 3L3IB 1F6AA 2IBGA 3QIWA 5IVNA 3U0PA 2E7LC 4UTBH 1JIBA 4ZYKB 2JCCA 4N0YL 3BHBB 2Z91A 5SX5K 2VL4A 2XKSA 3WDJA 1OW0C 1S7TB 1JNJA 2P5WA 4QRPE 3RIFF 5FYKL 3QDGD 3CFJA 4KI5D 1CR9H 2C5DC 4NN6C 1IAIM 3QIWC 3S97C 3NCFB 3T3PE 1NGYB 2E9WA 3SE9H 3WHE1 3B4NA 2KQNA 1S9KC 2GSIB 5IFJA 4Y8AA 1MRDH 1NC4A 2OJZH 3IAQA 2KQMA 5KSUA 4OKVB 3EOBA 5CZXD 4ZUWA 2LTQC 1UT9A 3SGEH 2AJXL 4M8QA 4CW1B 5GISL 3MLWH 4YDLB 4Y19E 2BP3A 5DRWA 3O11A 1CDHA 5J3HC 4EBQH 5T5NF 4GRWH 3I6KB 2VH5H 4RWYL 4ZTPL 5CUSH 4GSDL 3WS3B 3N0PB 1ZVSB 1DBBL 1EZVY 2AEIT 4GJTB 1DQQA 3DURB 1Q94B 1Z9OA 2R1XB 2XNAA 3BPLB 3FN0L 3QQ9D 4LSRL 4RFOH 4NZUL 3MROA 5T3XL 2CGRH 2HG5B 4UNVA 3FRPA 1I8IA 2VQ1B 1YNTB 1RULH 1FNEA 4ZD3H 1INDL 4MS8D 2HVJB 1BJ1H 4DZBB 2BMKB 5F7MC 3SKOA 2EYSA 4R90L 4CN6A 3T0DA 3IS1X 4O2EB 4JQVA 4MHHI 5HDQL 2E7CA 1ZT7B 4ONGH 1RUKL 2HRPH 3RL2B 4HS3B 4QXUH 3T3MF 1SEQL 4LCUA 3RZCA 1CD8A 4KZEL 4LKCA 2DLFL 2ZSWA 3IB4A 4FFWD 2Q8AH 5HGAB 3U0WH 1FRGL 3BZFB 3EBAA 3IFPA 4MNQE 4ONFL 5E03A 4PJ7F 5CJXA 5IF0A 4KK8C 5J8OA 4O51B 2QEJA 4YFEA 2D7NA 5C9JA 1MJ8L 3AY4A 3RZCC 5ID0A 2VXQH 3LSOA 2Q7NA 2QV2A 4JY6A 2WAHA 2DWDA 1IEBB 1L7TH 1JI1A 5F9OL 4GS7C 2GKIA 5I1LB 4KJQD 3GMRB 5IHBA 1XH3B 3EYFB 4XP4L 2WQRA 5CJXC 4YBHA 4KJYA 1FLRH 1J5OL 4NM4H 4RGNC 1S9WB 3AY4C 3UTPE 4E42A 1ZK9A 1QACA 1CT8A 3VXRD 1BX2B 5IK3B 1LE9A 5E8OA 3DVNB 3NFPB 1AO7E 2RIKA 5FOBB 1UZ8A 1P4BL 1MJ7H 3KPRE 4PJ5B 5C0BE 4CKVX 5IB2B 1PKQA 3CDGB 5IJVB 3LS5H 1AC6A 1H3PH 2VDRL 3GKWL 2QSQA 3OB8A 3GGWA 5CP7B 4LCYA 4TUJA 3BH9B 3ULUH 5IVXA 5TFSH 3S88L 5FYJE 2NY2C 1T1YB 2XKNA 5DK0B 3G5YB 4XMKH 4NKMA 3QB7C 4LKXA 1UJ3B 5BS0E 2BVOB 4UU9A 3CFKA 1J7VR 2F54B 3JTSB 2OR9H 1MEXL 4TUOB 4L4TD 4FOMA 4UNUA 2BOBB 4MX7A 2AV7A 3BEVB 4QCIA 2ICCA 4XTRC 3OAUL 3BAEL 4U0QB 3T0XA 2F5BH 3VMOA 1XGPA 4OF8A 3PL6D 2Q6WB 1G9NC 3VXUE 2EDHA 3GI9H 1A2YB 3MACL 1FN4B 2XZQL 4J3XA 2XI9A 3JWOL 3RWIA 3FOLB 4UTAL 4HDIB 3EJYD 1UWEH 1UJTA 2NYYC 4M7LL 2V9TA 4OCSH 5LCVL 4UT9H 5HY9B 1G9MC 5KW9H 5E6YA 5FO9B 1GOFA 5GGUA 4PV8B 5FYJU 4Z77B 3PGFH 5D7JA 1MRFL 1YJDL 4G9FE 4JLRA 3JWDC 2OSLB 2NTFB 3QQ3B 4KMTL 5JHLL 3ZDZE 5ACMA 2F58L 2NXYB 1BQLL 2Y4SA 4CMHC 3OAYH 5GS1A 3C2AL 3V5KA 5SWSA 1FG9C 1RZIA 3RTQD 4MAYB 5EC2B 2AXFB 1KSRA 2RCSH 4OLXL 5D7JC 1BBDH 4I0CC 2NTSP 1X4ZA 5TF1L 3TN0B 3MJ8B 5IESL 3RGVD 5E8NB 3SBWC 3MRMA 1YUHB 1ZHKA 3RDTB 6FABH 3AB0B 3W9DA 1MFCL 5D70L 4ZSOA 5GS1C 3OKLB 3RIAK 5AD0A 1QPXA 3O6KL 4X4MA 3MV01 1FL6B 4HFWA 4P2RE 5HI3C 2O5YL 1UQSA 3CFBA 1AGCB 4HH9B 4M5YL 2GYSA 4LLVA 5E8PB 5CILL 4PGDB 5DRXB 1NDGB 1VEMA 1IGFL 3ARGB 3RWFA 3WS6A 4YWGH 2F74A 4HG4K 3IXTB 5GSRA 4MQ7B 3TEUA 2DM7A 5D7KD 1H8SA 1R24A 2HJFB 3F7VB 4Z7OF 3BN9C 2NX5A 3T4AB 3KS0J 1CF8L 1SVCP 5HHMD 3VMPA 4ZFOL 3UO1H 4PJDE 1RIHL 5DLML 3RY4A 1NGZB 2HFEA 4RMTA 5C0AB 1KB5H 3WS6C 2KH2B 5DYOB 2NY1D 5ICYA 4ACPA 1EHAA 3LKPA 4QEGA 4PJIA 1UEYA 4LMQE 4PYGA 3E0GA 2VDQH 3CSPA 4KPHL 3PWPE 3QCTL 4ELME 4XVUD 1RZFL 2X89D 3T09A 3X12B 4HBCL 1PJ9A 4OT1H 4LSSL 2HMIC 4OCYL 5IR1B 4GBXA 5I9QC 2NXZC 2P24B 1EFXB 2FECL 2OZ4A 1JJUA 3E2HC 5CEZE 4FXKA 4Q9BA 3GSQB 2W92A 5EZLB 3O2WL 1D5ZB 5H2BA 1CXFA 4P5TA 4HH8A 4LRNH 3QUXB 1RJYA 3DX6B 3QP3A 3GSUB 1JHLH 3ZE1F 2FHBA 3LN5A 3HNSL 2HFGH 4U0RC 2BNQE 4FXGA 4PP2A 1P4IH 2DM2A 4GBXC 3TPKA 5HYJD 1S7RA 4MNGE 5LXGL 1QBBA 3MV8A 2IF7A 1A6UH 2IBZX 4Q6IB 4FFYL 4P5TC 4V1DA 1KFAH 1NC2A 2XG5A 5MERB 5SV4A 4HCRL 2H26A 4Q9RL 1FGNH 4ORGB 1KCVH 1UFUA 4TNVF 4U1GC 1JHKL 1A9BB 1EMTH 5KVFL 3DETC 2PO6D 2VIRB 3DO3A 3L1OL 2EDXA 2VNCA 3SKNA 4JG0H 5GS2H 1JWSB 4KUCF 4WI9A 2PYFB 2XZCL 5E08H 2XOTA 4M3JA 3NCEB 3SDAB 2X5PA 4LCCA 4XPFH 3PWLB 3R06B 2D7MA 5I1EL 4O9HH 2C9AA 1U8PB 3MLVH 3L7FB 4I2XA 4OCNC 1K6QL 4G8GD 2DMCA 4R96B 3V4VH 4N8CL 3MLYL 2AGJL 5I1CH 4NKOB 2A9MH 2ICWI 3V6BR 2DQCH 5IROA 4F2MB 1R3IH 1EO5A 1S5HA 1HIML 2D7OA 2QQNL 5L8KB 1NUNB 4M62L 1ODAA 2VXVL 5I74B 1UWXK 2PXYA 3KYNA 4JZNA 1T03L 4ZFZA 1A1NA 3ZHLA 4ZNEE 1DBKL 2IPTL 2VXSL 1Q9OB 3IDMA 3QXAA 5FK9B 3ILQD 3TH3T 3QCUL 1YEDA 3V6ZA 4DGYL 5IROC 5B39A 1XF2A 3GMOA 5K33A 5CBEB 4I77H 3QDGE 4OZ4A 4GW5B 4KI5E 2QHLA 4BSVB 2DQJH 3OKMA 4FMKA 4KKLD 1LNUA 4Y5VA 4E41D 3LV3A 5HDLA 2PXYC 3PNWA 3T0BA 3F58H 3HMWL 5EU6A 1WV7T 1BD2B 1F2XK 4PJXB 4DKFH 5T3ZH 4HIXL 4WHTA 3D85B 5CBAA 2RHEA 4RISH 3RWCA 1JMXA 3LEVH 3S8WA 1PD6A 4FFVD 3MRRB 4Y5VC 5FECA 5D7IB 4OFKA 4XVJL 4MCZB 2R2HA 4PJDF 3CLFH 3U9PH 4JRXA 4NWUH 3VXOB 3W11C 1NFIB 1X44A 3SGDI 1FE8H 2A73A 5FUOH 3VFWA 1WTGT 5FUCC 4Y89A 5C0ND 4DK3A 2VDPL 1YYLH 3FQWB 2WK2A 2HT2D 2Y36H 1N5AA 2CIKB 5D9SA 2BSSB 1UG9A 1VFMA 1YPZE 4LSPH 3EO1B 1LK3H 3N50A 4DEPC 4NWTH 1AR2A 1YEFH 4P46D 1X5AA 3RPIA 1JYVA 2XA8L 1ZS8A 2XTJD 1HSBB 3S7GA 1U8LA 1N5YH 3VFSB 4TQEL 2OS7A 2B2XL 4TOYH 1C1EL 4XVTH 2F8XC 5C07B 3V4UH 4FQJH 3C60A 3FT3B 1QKZL 5E5RB 4K3EL 2AS5M 1VEOA 3EDJA 1NGWB 2XQBH 3VFUB 3GKZA 2PTVA 3LEYH 3QUZA 4IIQB 3CSYB 1N2RB 2ZZUT 4XWOC 5TH2B 3WFBH 3C60C 5TQ0L 3VGAC 3LD8C 2Z35A 1BFVL 2FJGA 2UV3A 2Z8WC 3JUZA 2DTSA 3RUGB 3QUZC 3CX2A 4ZQKB 2ESVD 4GLRI 3HS0B 4WDIB 5D4QA 4XMLL 4PJEA 1TQBB 2DS4A 4ZFGH 5EOQH 4QNPE 3QBTB 5F1NA 4NQUA 4U49A 3HNTL 3HG1B 3VXRE 3DX7B 4PD4J 2DWEA 1KPRA 4PRHB 5DTFA 4G8EB 4ZO7A 1WTLA 1GZPA 4NQSA 3OSKA 3WO4B 2BRQA 1UENA 3WHXA 1TZHA 4YBQD 1NKOA 1WBZB 3QNYB 1QYGH 1HHHA 1AD9B 4HMDA 2QADB 4MDJB 5HDOA 1QHPA 3MBED 3U7AA 1IM9B 1EGJL 5C71A 4B7IA 4K94L 1WWWX 1QNZH 5DMKA 4RX4A 4WTWA 4Y2DD 1RJZB 3CVIL 4U6XA 3VD9A 1F90L 5I1JH 5KG9B 5C6TL 1LMKA 4L4TE 3SQOL 3ULVH 1E27A 1IGMH 3P73B 2FLRT 3F8UB 2OI9B 3RNKB 2C3WA 1A7BA 4OLYL 1KNOB 2OL3H 5A2FA 3IJSA 4IRZL 1UVQA 1U2HA 3DUUB 2ZWLT 5EU5B 2WUCH 2Z31A 2PKDA 3OKEA 5JZ7C 3NABH 1ZT1B 4M6ML 4JFED 4X4XB 2EH7L 3PV6A 4MA1B 3DRQB 3NH7H 2YC1B 3MUHL 5IP4A 3CAFA 4F37F 2DJUA 1XCTA 3S98A 3V6OC 1B4JL 4QYOA 4QTHA 2ED9A 1I9JH 1RPQA 2VMFA 4EN3D 2Z31C 5C70A 4POYA 1CWVA 1A3RL 1DBJL 4WUKH 4OD2B 5E5MA 1KXVC 3GMNA 3L9RA 4L8SB 1H3GA 3NOIA 2CDEA 4QRTA 3H9SE 3I6LD 4LASL 1ZANH 1EXUA 1YPZF 5KZCD 5I8KL 1LE5A 1ADQA 2VKXA 4R0LB 5JDJA 2R0LH 5FO7A 2OL3B 1SY6H 4U1HA 1PKOA 3X3GH 2V2WA 2G9HA 3B6SB 1FJ1A 3ZHKA 3DYOA 3VG0L 5JQ6L 2R0WH 4NFCA 1J8HA 5FUZL 2R4RL 3DXAB 4OV6F 3OXSB 4Z8FH 1YYML 1N4XL 5D1ZA 3PUCA 1T80A 4TPRL 4WU5B 5ENWB 1HQRB 5I75B 3KDMB 3PWUA 3AS3A 5KJRL 4K55A 1YN6B 2EICA 1B88A 4LPWA 4PJFB 1HXMB 4N0CD 5DUBA 3QRGL 4B53A 5LWYL 2EZ0C 2QQKL 3IFOA 4I18B 5D1ZC 3PP3H 2NY3D 4CJ1A 3GMQB 5D7KE 4JHAH 3JUYA 3UTQB 3S35H 3WE6B 4WWKD 5HHME 1QG3A 2AK1L 4FQXB 2APTA 3BP7A 3MXVL 1D5BB 1DQMH 4R8WH 4HKXA 1I7RB 5DEZA 2FRGP 3P77A 4I3RL 2BNRA 4QKXB 2HH0L 3VFMA 1G7HA 4PJCE 4KROD 4PBVC 3JV0A 3HAEH 3SE8H 3P3YA 5AWNH 5GXBB 2VQUA 4HD9A 3FN9A 1TJGH 3QAZC 2Z9TA 4U3HA 2MKWA 1UB5B 1LK2A 4P4KD 3PGDA 4UI2A 1VFUA 5JIKA 1RQ5A 1HOCA 3MOBL 2P48B 3QUMB 3HE6D 3RVWC 2FJFB 3GIVA 1QFWM 4H88L 2R29L 4TVPH 2MPAH 2J88L 4JFZH 1NEZA 3B83A 5HYJE 5IFAL 4RAHA 4XC3H 3GMLA 4I0PD 4KDVA 1AR1C 1N0XL 1MJUH 5C09A 3RU8H 4LU5H 4XP6L 1F8TL 1JUFB 1OP9A 5D2NA 2Q3ZA 4PJ7A 4NSKB 5EO1A 1E4KA 1JNHA 5L2JB 3RFZC 4QHKJ 5DD0H 2NY7H 3MSPA 3N9GH 2JF1A 3EAKA 3TYFB 5HYQA 4J7RA 4PD4K 3KJ6L 4U1IB 3HAEB 4HUNB 4LSQH 4XBPA 1J1OH 3VH8B 4F7CB 1ND0A 3DECA 4CVXA 1FGVL 1ZHBA 3DI2B 1AP2B 3QPQC 4L29A 5EO0B 1YEEH 3GBNL 3IDJB 4DN3H 4G8IB 4P3CL 5D2NC 4RDQF 1NGXA 1E4KC 2FIKA 4OGAD 4FQIL 4NNXA 4KK9D 1FFOB 1UACL 3O4LA 1NLDL 1IAII 3QZWA 3SO5A 5BXFB 4RBPK 5EUOF 5J6GA 1G7IA 5IB5B 2HFTA 4OGZA 4YIQA 3QT2A 3QIUA 3TV3L 3IDIA 3VFNA 3K8LA 1JZ4A 1CLOH 3ZKSD 2VJXA 3IFLH 3FB5A 4P2OA 1IKNC 3GBML 3WFDL 1FNLA 4P9HL 5F44A 2UZIL 5IBLC 2UY7A 1BIIB 5IT2H 2XACC 1OAUH 4ELKB 3BDYL 1PQZB 1BOYA 1J1XH 2DYPA 4JAMB 1IKFH 3P30H 1ZLVK 1OLLA 1JRHH 2W0FA 3QIUC 4NN6B 2FNBA 1X4XA 1F6AB 3QIWB 3U0PB 4ISVA 4QRPA 1Q0XL 1AY1H 5GS0H 2J12B 1G1CA 2CKBL 5IQ9A 5M95B 2Z91B 3H0TA 4NO0A 1RU9H 4UIKH 1KC5L 4NKIL 1T21A 2P5WB 3MJGX 3CFJB 2LTQB 4TTGA 1KCUL 1S5IL 3WSQH 2YD5A 1QBLH 4E41E 1DR9A 4APQD 3H9YA 5IW3A 5IFJB 1NC4B 2AEWA 4YXLL 5KSUB 3EOBB 4ZUWB 4M8QB 4YFLF 4XP1L 3IU4L 1MCSA 5E0QA 3FQRA 1J0HA 4KZDH 1CE1L 1JV5A 5DRWB 4EVNA 3GFUA 2JELL 3O11B 1RUPL 4XPTH 5E7FA 5CJBA 1A6TA 4F9LA 5HHPA 4B0MM 1LO3H 3RI5F 1GGBH 3NPSB 4HHAA 3BSZL 4PJCF 2J3SA 5GGTA 1IAIL 2BVYA 1NBVH 3UAJC 1TTGA 4D94A 4BQCA 1DQQB 1S7VA 2XNAB 4UBDD 1Y18A 2EC9T 4F9LC 2PN5A 1VGKA 3NPZB 3MROB 1EGJA 4J6RL 1A4KA 4AQ1B 1RZKH 1I8IB 3NAAH 4NZJA 3ARDA 2XTJE 2P5EA 5DFVD 1CZ8L 1FNEB 3ARSA 4CMMA 5ILTL 3SKOB 2EYSB 1RZJL 2E8YA 4X6EA 1T1WA 5HGDA 4LCUB 3RZCB 2EE9A 4MNQA 4U1SB 3ARDC 1A64A 1Z6JT 4LKCB 2ZSWB 1KJ3L 1TCMA 3J7HA 4HFUL 1FZOA 1F02I 1WFTA 4GS7B 4M6NH 1U91A 3IFPB 1I9IH 5GJTL 5IW6A 1L9NA 4X7SH 5IF0B 3QIBA 5GGQL 1DEEA 2J8UE 4K7PL 4RGNB 5C9JB 2VR4A 5BMFH 1LO0H 5TDNA 5ID0B 3LSOB 4JY6B 4DOHB 2ZOKA 5ISZD 3T2NL 3QPXH 4MJID 2DWDB 5GRYA 1G9NH 5GHWL 1GGYA 4JQXA 2AV1A 3MLXL 2ESVE 3QIBC 3ZLQC 3EUUA 4KJYB 3C8DA 3M8OL 3NA9L 2X4QA 2VDOH 4E42B 3RVUC 4HF5L 4TTDD 3KPRA 4WRLA 3D9AL 3MC0A 4GMSH 1CT8B 4ZO8A 4L1DA 3ARED 5E6IA 1LE9B 4JQXC 5E8OB 1G9MH 1UZ8B 2NY2B 2Y9RT 3B2VH 4YDIH 5DMIH 1PKQB 2CRIA 4Z9KB 1N6QH 3D0LA 2AJSL 3SGJA 1K3ZA 4OFYD 5I1HL 3VFGL 3WNPA 1AGFA 4LCYB 1RIUH 5BS0A 2QHRL 4TUJB 2IG2H 5E6IC 5IVXB 1AFVH 3LQAC 4XI5C 1QUNA 5AZEL 1EVTC 2HKFH 2XKNB 5IHUH 3QHFL 3TH4T 3EJZD 4NKMB 5AYUH 1C8PA 4LKXB 3U79A 4X6BA 4UU9B 1MHPH 3CFKB 1MI5A 3SGJC 1GGCL 2YMXL 3EFFA 3OWEA 4MX7B 2AV7B 5TPWH 4QCIB 5BJTA 1R0AH 1IE5A 4NZDA 1RD6A 1FP5A 3F6LA 3R4DA 3T0VA 4Y88A 2EE2A 5C0FA 5FGBA 1EO8L 1P7KA 1RVFL 3QWOA 1SBSH 1DQJA 1KGCD 1XGYH 4HWUA 3RWIB 2DD8L 2XT1B 5BW7A 2C7UA 4JFYA 3U9UA 1K8DA 5B3JF 5CCKH 1X7QA 4JFEE 5EC1A 4JKKA 1LDSA 1P7QD 4CMHB 1DSFL 4G9FA 5FGBC 5BV7H 5GGUB 4HGWA 1T83A 3UPCA 5BW7C 5D7JB 4JFPA 4KHTL 1RIVL 4UV7L 5F71A 4JLRB 4KJWC 3K7UA 5HVWA 5L2KD 4X0KA 4NHCL 2E7MA 3HNVH 1NSNL 3I6LE 1U6AH 2AJUL 5GS1B 3KXFA 4U1LA 3HI6H 2CSPA 3V5KB 4U1KA 5J1TC 5SWSB 5F70A 1UWGH 3F5WA 2QTEA 1RZIB 3G6JE 4JN1L 4PS4H 2MFNA 1T83C 1FYTA 5D1QA 4ONHA 1MLBA 4QXTA 1JPST 1F4YH 4Z7VE 4ODBD 3MRMB 4XCCL 2P47B 1ZHKB 4NP4H 4B41A 2ID5A 4JJ5A 3W9DB 4ZSOB 5HHQA 1OARL 1CFBA 3MRBA 5AD0B 3HE7A 1BVLA 1KXTB 4HFWB 4HWZA 5I8EA 3KLHD 1UQSB 2RB8A 3CFBB 3EDDA 2EEDA 5D1QC 4LLVB 2OZ4H 3BIAX 1GHFL 1I4FA 3CDYA 2CRMA 3RWFB 2V5TA 2F74B 5GSRB 2NY0D 5ITBH 3GSNH 4PJDA 3HE7C 3L3GA 1R24B 3HHRB 2NX5B 4X9FA 4YHOH 3PWPA 5T5FL 2P45B 5I9QB 2ADFH 2HFEB 3KYMA 5ICYB 5DJ0A 4OJFH 2EDYA 5DD5H 3TO4D 3LKPB 5INDA 4PJIB 2RAMA 4FQQA 4KU1A 5JXAL 4W81A 5FYLD 3LKOA 5TGBA 3BKJL 4PRID 4HUXA 4U0RB 5GQBA 4K3HA 5E56A 1MCOH 3OR7A 4G7YL 4GBXB 1IGCH 2V7HA 4KC3B 3FQXA 1I3VA 4FXKB 2FGWL 1E4WH 5H2BB 4P5TB 5J13C 4W6XB 1RZ8A 4P9HC 1RJYB 3OF6A 4FQLL 1CDCA 2J4WH 4N90D 3RA7H 3LN5B 5JHDD 1IAKA 1VENA 4FXGB 4PP2B 4S1QL 3EYOA 1FO0H 3S36L 4OZIE 1OPGL 1S7RB 3MRDA 2FX7L 2CRYA 3MV8B 4U1GB 4EIZC 1YEGH 4V1DB 2WSKA 5B22A 1H15A 1NC2B 3ALPA 1MFNA 3CX5J 2EIDA 1C7TA 2APXA 1CGXA 5K93A 2H26B 2GJ6A 3ARBD 1JPTL 5JOEA 1CTOA 3EHBD 5C0GA 2XXMB 4LSTL 4M9OA 5A40E 4H8WC 5KN5A 3IDXL 3TJEL 12E8H 2Z93A 4KQ3H 2YOCA 1YECL 1P53A 3SKNB 5EU3A 4OFIA 3T1FA 4PJ9A 2Q87A 2NZIA 5SX4H 4PREA 4R4ND 4LCCB 1HHGA 4YEEA 4RMRA 4CAGA 4KTDH 1KENH 1N6UA 4MB3A 4I2XB 4U7KA 2K3TA 2DQUL 2CXGA 5E2VL 3DYPA 4JM2D 4C59B 4XPAH 3HUJF 3U30C 4LPYA 1IT9L 1GOGA 4MJ2A 5C7XL 2W59A 3DHMA 4ZNEA 1S5HB 5E9DD 4JR9L 5TQ2H 1HKFA 4CVWA 4LPUA 3V9FA 3G6JF 1ZLWK 3RX5A 2VDKH 4HPYL 4OFDA 5CEXA 4JZNB 2PXYB 2Y5TA 3KYNB 4MVBD 4ZFZB 1A1NB 4OLZL 3QDGA 3IDMB 3QXAB 1YEDB 3V6ZB 3VXNA 2VQTA 5B39B 1XF2B 3GMOB 3GO1L 5E2TH 3ARFD 1CL7I 4AL8H 2AXHA 1JFQL 3N1QC 4PLKD 1QR4A 4XBEH 4Z7QF 4OZ4B 2EXYC 1R3KA 3SGKA 1G7MA 3MOAL 3KYKH 4LCIL 25C8L 5TDPA 3OKMB 3OKKA 1S78D 4Y5VB 1LNUB 3HMXL 3CVHH 3LV3B 3O0RH 3PNWB 1A14L 4XCYA 5C8JA 1RUAH 3KR3L 5EU6B 4KI5C 1OAZH 3S37H 4WHTB 5CBAB 5I1AA 4FQ2H 2VUOA 5ACLA 2N1KA 1KTLA 5DUMH 4HULB 2XY1A 3HI1A 3LKRA 1VFBA 3RWCB 1OGAD 4HC1L 3ZDXF 5FECB 2H2SD 4GRWE 1RY7B 2IGFL 2R2HB 4JRXB 1XGUA 2ICEA 4DEPB 5A1AA 1NMAH 1U92A 2N4IA 2FEEL 4LQFL 2A73B 2YHGA 3VFWB 3OJVC 2M1KA 1YPZA 1EV2E 3IJYA 4GAJH 2I07A 5DD6A 5D71L 1GOHA 4RFNC 1S9YA 1N5AB 2EEBA 5D9SB 5F7NC 1HCVA 3ARQA 4RMQA 5JR1H 4NZRL 5GRZA 3LMJH 3RPIB 1HINL 1ZS8B 3SOBH 5D8JL 4PB9H 1U8LB 3QQ9C 5DR5L 1NMBL 4M02A 1NAMH 4Z7NE 1A7RH 5FFLA 4MS8C 3C60B 1FNGA 5K59F 2XWTA 5D6CA 3VGAB 3RJQB 3LD8B 3QDHA 4MA7L 3TZVD 2APBA 2R69L 1PSKL 4J12A 4G6FD 1KEML 3QUZB 1IC5L 5HJ3A 3L7EA 3BKYH 3O2DA 4TSBH 3L5HA 3UJTH 2PR4H 5D2LE 5F21B 1VPOH 2Z35B 5F96L 1PZ5A 2FJGB 5ISZE 1QLRA 3P9MA 3B5HA 4MJIE 1BQHG 1EVUA 1NQBA 1RUQH 3D39D 1EUTA 2AABH 3MODL 4HUUA 2B0SH 3BPNC 5E7BA 1IC1A 3VXRA 4ODWA 3B8YA 4PJEB 4ZS7H 4OQ1A 3BD5A 4TSCL 2W0KA 2C26A 4KJQC 3KG5A 5LGKA 2W38A 4XHJD 5F1NB 5LGHH 3O6LL 2Q86A 2YD1A 3CX5K 4JPKH 3GDBA 5F1KC 4DAGH 4O5LL 3ROOA 4DKDC 2AK4D 2MOVA 3U4BL 3TBTA 1MFDL 2DWEB 1KPRB 4K3GA 5DTFB 3GJFA 3LRGA 4L5FL 1GZPB 5F1SA 1BFTA 3AXLA 4NQSB 5KANI 1KPVA 3OG6B 4XMPL 3WHXB 1TZHB 4N5UA 2LAAA 1MLCA 1HHHB 2OLDA 3WYRA 3WIFA 1OTTD 1GAFH 5CGYD 2ZOLA 5A2KH 2BSRA 4HXBL 1O7SA 5DMKB 4NIKB 4U6XB 3PL6A 1E27B 4K3JL 2ZUUA 3BVNA 3LZFH 4OB5H 1LO4H 4Q2ZA 4O2CA 4HS6A 1JWMA 2RGSA 1F58L 1KULA 2L4OA 3IJSB 4JO3L 5T1KD 1UVQB 3PL6C 1KGCE 2Z31B 2BHUA 3H42L 3OKEB 2VSDA 3CU1A 4HS8L 3RIFK 3PV6B 1YNKL 1JBJA 4GRWF 4ODSH 3RX7A 5F3HA 3EJYC 4KKNA 1CLZL 4TYUA 2CD0A 1XCTB 4QYOB 4QTHB 3K4DA 3FT4A 1LP9E 5E5MB 4KKBD 5F9WC 1Z3GH 3GMNB 3L9RB 2AP2A 4OQTL 5F1IA 2CDEB 4QRTB 2PTUA 3RTQA 4EI5D 5C86A 4BUGA 4OCRH 5L2KE 1EXUB 1LE5B 4M7ZC 3MYJA 5GZND 1W8NA 5HD8D 4NQDD 5FO7B 4ZODA 4U1HB 3MCG1 2V2WB 4PRDA 3MJ7A 2J1KA 2P4AB 4LPXA 4KQ4H 2G9HB 4RMSA 1SEBA 2BNUA 3MTRA 3RTQC 1J8HB 4NFBA 3L5JA 5I2IA 1BGXH 3A0OA 2K7QA 5DA0B 4HLZG 5D1ZB 5D96C 4DN4H 3C5ZD 3HC3L 5FAAA 4OFVA 1Y0LA 4L9LC 35C8H 3PWUB 4OLVL 1H3XA 1P69B 4LAQH 5C0DA 3GNMH 2PUQT 1FSKC 1YEJH 4XNZC 4PG2A 1W72L 4LVHB 5DUBB 4FFZL 3HCVA 5J7CC 1C12A 4KY1L 1KIPA 5FM8A 3IFOB 5C3TA 1I8KA 5EOCH 5CIPH 1R3HA 5D2LF 4NJAH 3TT1L 2VWEE 2DQFA 4OZHE 4PJCA 3BP7B 3QAZB 4U1JA 1X5ZA 4HKXB 1CFNA 1CGTA 1P5VA 3OKYA 2X89A 3P77B 2M2DA 2VN4A 3WXVL 5ICZA 3D2UD 1PLGL 5LKNA 2BNRB 1EJOL 3VFMB 4RQQA 5FYLE 3IYLW 5I19L 4HPOH 3LH2H 2NY1C 3QI9D 2Z4QA 4PRIE 1U0QA 4NYLA 5D7LD 5T1LB 4XVUC 2YPKA 4GG8A 1U3ZA 1LK2B 5LG1A 3AU1A 3MR9A 2IQ9H 3QHZH 1WT5A 3PGDB 1HOCB 3VXMA 4GO6B 3O3DA 3S3PA 3VWJD 3ULUF 5HYJA 2MJWA 4KXZH 4EDWL 3OMZA 1LDPL 3GIVB 4M48L 4N90E 4U2YA 4WNQA 5GGRA 4ZNCD 3F7RA 2BXZA 2X2YA 1NEZB 4DGIH 2KL6A 4N1HB 4ALAH 3HMXA 4HMEA 3KJ4C 3W5NA 3GMLB 4JEGB 1WT5C 4QGTA 2YD8A 2D7QA 5C09B 5D2NB 3EIFA 4PJ7B 3NACL 5EO1B 1JNHB 4NHUA 1BVZA 1OAKH 4MSWA 4XBPB 3VH8G 2B8OT 3RAJL 1ND0B 5IV2A 4CVXB 1JZ6A 1ZHBB 4L29B 1MIEL 2G75A 5BZWA 4LHUG 1YY9C 1R3LA 3FONA 1A3QA 1BJ8A 1Q9LA 5DURB 3ZE2F 5KS9F 4PIRF 1NGXB 1QFWL 2FIKB 5F7EH 1X6LA 4NNXB 1FZJA 3O4LB 3UYRL 5KVGH 5LQBH 2O5ZL 3QZWB 4LOUD 1NCNA 2F53D 3TA3D 2PO6C 3MJ6A 1G7IB 1LO2H 4I3GA 3S9DB 4AMKH 2JIXD 4G8GA 1KJ2L 4L8DA 4MZ3A 1XGQA 4YIQB 3QIUB 3IDIB 2B7DT 3VFNB 5KVDH 3LKNA 5ACZA 5D7SH 5HI4D 1JZ8A 5J4MA 1MAML 1LP9F 3FB5B 5ETUA 4P2OB 1NCBL 2I60L 2OXGA 2KPNA 4GQPH 4JDZA 5HGHA 2OK0L 3WUWA 2ENSA 4HZLA 1S8DA 2DYPB 5GS0D 2UWEE 2YEZA 2A6DA 5E9DE 2W0FB 5DRNA 2D7TH 4X98A 4ISVB 3X14A 2BFVL 4QRPB 5DGRA 4XPGH 1ZLUH 2X1QA 5IQ9B 4RGMC 5C0RH 1HHKA 3QYCA 3H0TB 4NO0B 4U7SA 5TE7L 1OAQH 4L4VD 1T21B 4TULH 2J6EH 1S7XA 4JRYD 4PRBA 1KBGH 4U2ZA 4DW2L 3ILQC 5KSBE 3P9LA 3FRUA 3SDDD 5HSFA 1TZIA 3AS0A 1JPGA 1NEUA 2WUBL 4JDVA 3MXWH 5I71C 3CFEA 3NMEA 3CGTA 1DDHA 3BKCH 5JPMA 4C55A 3MGAA 1XCQA 3V95A 1H5BC 3FQRB 4HAFA 3WXWH 1OGAE 1JV5B 3QISA 4EVNB 5C2BH 3CFCH 3RRQA 2AQ3A 1A6TB 5HHPB 4PP1D 2VZSA 4JGJA 2IBZY 2K1MA 1HDMA 1ORSA 4HHAB 4LF3A 5B8CA 1MQ8A 4D0BA 4YHZL 3ZL4H 4JVPA 1M7DA 4K8RL 2ADIA 4F33A 1S7VB 3F7PC 1IGIL 1OGTA 3UDWA 3S34L 5C0NC 1Y18B 5JOFA 3AM8A 1A5FH 1VGKB 1D5IH 1CQYA 2HT2C 3V5DA 5L9DH 1A4KB 2C1OA 3T2QA 5B8CC 3ARDB 3A67H 2CMRH 2P5EB 4UTBL 1G0YR 1AE6H 4CMMB 4JE4B 4HLZH 1CGSL 3UDWC 2XTJC 4FTVD 4GW1A 3AM8C 3MYZA 2HT3D 4X6EB 1T1WB 5TE4L 1CR9L 4MNQB 3CK0H 3EFDH 4ZUVA 2V17H 5BOPA 2QKIA 3QEQD 5E2UH 3SE9L 2J8UA 1F6FB 1FZOB 5DHVH 3N1GC 3VXTA 1U91B 2YD6A 4LP5A 3QH3A 3MRGA 1TMCB 4Z78A 5IW6B 2OJZL 1OSPH 3SDYL 2EDKA 1RZ7H 3QIBB 4S1SL 5FYJH 1DEEB 2DQGH 3F6IA 4LARL 5TDNB 2D03H 3MLWL 2ZOKB 2ESVA 1I7TA 2FDBP 2AV1B 3T0AA 4L3EE 3ZYIA 4EBQL 3D39E 4N8VG 1HKLH 2VXUH 4NKQB 3GBLA 1VKXA 3UPAA 1WZ1L 4KHXH 2X4QB 5C0JA 1ACYL 4A6YA 2MMXA 1L9MA 3BQUD 5CUSL 2YXMA 3KPRB 2NY4C 4MB5A 2E6JA 4DTGH 5E6IB 3FMGH 3HFML 4IRSD 3QEGH 4JM2F 2AK4E 1BZQK 2BY1A 2CGRL 3VRIA 1OM3L 4LIQE 5D7IF 1WCBA 3P0YH 3D0LB 1RULL 4ZD3L 2UWEF 5ADOH 1AGFB 5BS0B 5F7HA 4X5WA 4PTUA 1BHGA 2GJZA 2HRPL 3CFDA 1T04A 2J7LA 4QXUL 5I1DA 4X6BB 2IAND 4WGWB 1AGDA 4MD4A 1MI5B 4Q97A 3EFFB 1BM3H 2Q8AL 3MBEC 1KB9J 3P0GB 1M6OA 1XFPA 5K9QG 1OP3H 5BJTB 1LQSR 2BHZA 4PJ8D 3W9EA 2H3NA 3IRZA 4Y2DC 3UJIH 5GRXG 2W9EH 4QRRD 5C0FB 3K2UH 3UBXA 4Q58C 4RIRA 4JFEA 1P7KB 3QWOB 1DQJB 5ESVA 1L7TL 4H0GA 4BFIA 2C7UB 4JFYB 3U9UB 4KUZH 5HI5C 1QVOA 1K8DB 1X7QB 5EC1B 4KVCL 1FLRL 3SDCA 4NM4L 4G9FB 1X3DA 3HUJA 3I3DA 4HGWB 1X5KA 2EDDA 4JFPB 3EYUH 2FX9H 1A3LH 1J05A 3G6JA 3SKUD 4X0KB 3MJ9A 3SDCC 3BT2H 4EN3C 5A2LH 3KXFB 4U1LB 2ARWA 4U1KB 1H3PL 1IQDA 3F5WB 4NQDE 1MCRA 3W0WD 1FNFA 3ULUL 3WL9A 1FYTB 3JXAA 5D1QB 5E70A 4ONHB 4L3CA 4BFEA 1MLBB 4QXTB 1AXTL 5F7YC 2A1WH 1V7NL 4XMKL 4N8PA 1ZA6A 4JJ5B 2OR9L 4UQ3A 3LCYA 1MVUA 3HE7B 1BVLB 4HWZB 5I8EB 2F5AH 2HRLA 4X4YA 1U9KA 4LLMA 2Y6SC 1JN6A 3V52L 1QLFA 1OTUD 2AEQH 1I4FB 5EB9A 3FZUD 5AEAA 3GI9L 5CJ8A 3OKOA 4WVRA 3R8QA 5I30H 4PJDB 3L3GB 1UWEL 1SM3H 4N0CC 3U4EA 5FCUL 3PWPB 3GRWA 1MFEL 4G7VH 4FHBD 3FQNA 4OCSL 4K7PX 3CH1A 3KYMB 1I3GH 5DJ0B 5KW9L 4GKNA 2ZCLL 5INDB 4FQQB 5DT1H 1C5CH 5J13B 4MCYA 3LKOB 4FMFA 2OP4H 5CJQH 5TGBB 3CMOL 5DJZA 2YPVH 3LHPL 4HUXB 2FEDC 5JDSA 3OR7B 1JF5A 2V7HB 2LQRA 3FQXB 3J8F7 4KROC 2DLIA 3HE6A 5D7LE 1TJIH 1JZ3A 3PP4H 1GIGH 1RZ8B 4Z7UE 5IMMA 2RCSL 1BBDL 1IAKB 3QDMD 3EYOB 2XA3A 4CU6A 3P11H 4XNXL 1TJHH 3MRDB 3HE6C 5HVFB 1NCUA 1WIOA 5J06A 5HVHC 4NBYB 3D69A 4BZ2H 2APFA 1WQVT 2IJ0C 3ULVF 4HX1A 2WP3O 1H15B 1F3DH 5CGMA 1TDQA 3FQUA 1N7MH 1F4AA 2GJ6B 1GH7A 2CUHA 3G5VA 1Q72L 2FH8A 4ODVH 5C0GB 3RX8A 1MUJA 3O4OC 2FBOJ 1FL5A 3QNZA 5F7FA 5KN5B 3U0TA 2Z93B 3BPCA 4QHNA 4M7KH 3C6SA 5I8CA 3UO1L 3G04A 3RHWF 4JG1H 3BZ4A 4MJ6A 5EU3B 3EYVA 1F97A 2FWOA 3NIGE 3T1FB 4PJ9B 4ZXBA 3U30B 2F53E 4HXAH 2C3VA 2VDQL 4PREB 4RAVA 4ZOBA 4OGAC 2G5RA 1KYOJ 4KK9C 1HHGB 1P84J 1FL3A 5E5UB 4PJFF 2IMMA 4TNWF 4H1LA 5GRUH 4OT1L 4DKEH 1KB9K 4ZXBC 3AS1A 2EXWC 2AJVH 3BJLA 4JFFD 2MHAA 1JHLL 2F54D 2HFGL 4LSDA 3STBA 5DSCA 3MV11 1P4IL 4KTYA 2V2TA 4F37K 5CEXB 2HP4A 3S4SG 2Y5TB 1TIUA 4NRXA 1DJSA 1D5XA 3QDGB 4JB9L 1A6UL 4UB0H 5IQ7H 3VXNB 4K23L 5B39G 1KFAL 4PTTA 3TCXA 1U8OA 3DHJA 4RMUA 3B5GA 4L4VE 3I50L 4APQA 1OCWH 2XY2A 1R3KB 5DJAA 1G7MB 4JRYE 1FGNL 5TDPB 3OKKB 2YS4A 1KCVL 1QSFD 4XCYB 5C8JB 3BKMH 1AH1A 3M45A 5I1AB 2HT4D 1KPUA 4K2UH 2DBLL 1KTLB 5ELIA 4APQC 3HI1B 3LKRB 4JG0L 1VFBB 4RFNB 5E08L 1IAMA 1T7YA 2GFBA 4XPFL 1QBMH 3L3JA 1QRNA 4NC0B 1XGUB 2ICEB 2YA0A 5AZ2H 1U92B 4D9QD 1OSZA 4O9HL 3MLVL 4DKAA 3BIBX 1YPZB 2JJWA 4K7FA 4MAYD 3IJYB 2GCYA 2I07B 5DD6B 4FXLA 4QXGL 4NZTH 4FRWA 5EUKA 5L8JB 2OMNA 5I1CL 1RSFA 1S9YB 4FABL 1BPVA 2A9ML 3O2DH 3TN0D 2DQCL 1J9CT 1O5DT 2FJHA 1R3IL 3BWAA 3RDTD 5J9PA 1QSZA 4YEFA 3B9AA 4JZJC 5DQ9A 3EDKA 3PHOA 2R0ZL 1I7UA 4G6MH 5HBBA 5IEHA 1MOEA 3D48R 3QXVA 3REVA 5KVMC 3ARGD 4FTVE 4OZGE 5DFVC 5F7LB 1PEWA 4MHHG 2X4PA 4I77L 4TN9A 2FATH 4BYHA 5JPNA 1FNGB 2XWTB 5D6CB 1DQDL 2DQJL 2R4SH 5ABDE 4PGBA 1RHHA 3CDCA 3F58L 3QEQE 3GJFH 4DKFL 4NOFA 5T3ZL 5D2LA 1CDBA 2LAGB 5HJ3B 1WEJH 3BPNB 5ISZA 3L7EB 4NQVA 3ZSTA 2Q8BH 3GJFK 1TVBA 4X6DE 1N0LA 3MFFA 3NFSH 4RISL 4D9LH 3X3FH 3LEVL 5BZDA 1PZ5B 5L88H 1QLRB 2R9HD 3P9MB 4KV5E 2EIEA 2P8MA 3U9PL 1R5WA 4NWUL 4HUUB 5LBSH 4HJJH 1FE8L 3VXRB 5FUOL 4ODWB 4EXKA 4BZYA 2GEEA 1O7VA 3AREA 3ZTNH 1YYLL 2DQDH 3MBXH 4S1DD 2Y36L 2Q86B 2Q7YA 5DK3A 1L0XA 1K85A 3ROOB 4N0YH 3TBTB 1OT2A 4TTDC 2XKUA 3GJFB 4NWTL 1YEFL 3HLAA 1AQDA 3AXLB 4PRPA 5CSBA 3AREC 3VXSD 1JE6A 2B4CH 1KPVB 5J11C 1N5YL 5DVKA 2OQJA 4TOYL 5D1XD 4HGMA 4XVTL 2H6PA 3UP1A 2JKXA 2OM5A 4LDLB 4R4BA 1K9TA 3V4UL 1UCBH 5ANMA 5EWIL 4U6VL 1PG7W 3WIFB 3PXJA 3GSWA 2DTML 5DF0A 2ZOLB 3QHTC 4Q9QH 1U95A 4YUEL 3WUZA 1FAIL 1KYOK 4FQ1H 2BSRB 1RK1A 5JORA 2AJXH 1P84K 1V3KA 2XQBL 3DMMA 3PL6B 2IANE 4LEXH 1N26A 5KS9A 2E7BA 3BVNB 4P5KA 4Q2ZB 2AJZA 4O2CB 4HS6B 3DVFA 4XPBH 3WFBL 4DQOL 3VMNA 1JWMB 1QA9A 4QRRE 1LO5A 5E95B 1ZGLA 2ZJSH 4LLUA 4PUBH 4L8BA 4P9MH 1J0YA 4OSUL 1P7QA 3ZKQD 3R0NA 5ERWA 5F9WB 2A74A 2EDEA 4LSRH 1QOKA 3S3SA 5F3HB 1REIA 4ZFGL 5EOQL 1LP9A 4EUPH 4M7ZB 5ALCH 1ES0A 1T20A 4QHUA 3NIFE 1INDH 2V5RA 5ID1A 3NZHH 3FT4B 4JRWA 4M03A 4R90H 5IUSA 1ZWIA 2CLVA 4UILH 5F1IB 1NANH 3RTQB 4O58L 3GMMA 1DTUA 3TFKD 3FT2A 1TQCC 2A9NH 2CLRA 3MYJB 5I0DA 5D96B 3FFDA 2L0DA 4OCWH 5JUEH 3BMWA 2CR3A 4LP4A 4PRDB 3W0WE 3MJ7B 4KGLA 1FRGH 5IMLA 3WMSA 3RI5K 1R5IA 3GM0A 1SEBB 2BNUB 3RWJA 1FSKB 4XNZB 1QNZL 1BD2D 1WFOA 1VFAA 3D85D 1WAAF 5I1JL 5I2IB 5HHVH 4OFPA 3FJTA 5HXMA 5IB1A 3AVEA 3ULVL 3TC9A 1Y0LB 4B5EA 3VI3E 5C0DB 4XP4H 3ARPA 1BREA 2OL3L 3KLHC 3GJEA 1CS6A 1KB5A 2G5BA 3HCVB 5IVXF 1A7OH 1C12B 1KIPB 2F9BT 2WUCL 3ECBA 4X6DF 4FZ8H 3QUYD 1R3HB 2NY1B 5T5NG 4AY0A 4KV5F 4HV8A 2DQFB 4BQ9A 3NH7L 4PJCB 1JWUA 4U1JB 2NMSA 1CFNB 4RWHA 3V8OA 3OJ2C 4YNYA 5ICZB 4JGMA 2BOCA 4H5SA 1I9JL 4RQQB 4WUKL 4XC1H 3TO4C 2Z4QB 5EU7E 3FKUS 1I3RA 4NYLB 4HMCA 1ZANL 3S88H 4UT7H 4J23A 2YPKB 4GG8B 5DJYA 5F7DA 3MRFA 1B2WH 3AU1B 3KJ4B 3MR9B 4CU7A 3WDHA 5JHDA 3UTOA 4MXVF 4CGTA 2RFXA 1SY6L 2GUOA 3BP6A 3VXMB 3X3GL 3O3DB 2ZCHH 5HYJB 5TDOA 4WNQB 1UZ6F 4UINH 1S9VA 5GGRB 1OTSD 3QDME 2W1NA 1HZHL 2NY6D 5A43C 1WWAX 4NUGH 4BH7A 2YBRA 3KPSA 3TIEA 1GXEA 2Z8RA 4Z8FL 4IM8A 2PCPA 3JWOH 1U8HA 3ARBA 4UOW1 4UTAH 3QO1A 2DI9A 2CPCA 2MCPL 2YKLL 2YRPA 1QTYT 4NHUB 4M7LH 3OQ3B 4YXHL 3HC0A 2WV3A 2EECA 4MSWB 3QUML 5HHNA 4CDHA 2I26N 2PO6B 1C7SA 4MA3A 1GGUA 2G75B 5BZWB 3K74B 4WTZA 4IOFC 3FONB 1R3LB 1Q9LB 4JHAL 3ARBC 3WFHA 3S35L 3EHBC 5C3LD 1FZJB 4KMTH 4R8WL 5HGBA 2F58H 3MPCA 4F58L 4EJ1C 4G8GB 2NW2A 3K4AA 1I8LA 2E27H 4L8DB 4JM2A 2PW2A 1XGQB 1PAMA 1RUMH 2ORBH 2XYCA 1MCWW 5TF1H 3LKNB 5ACZB 1TJGL 4KMQA 1JNLH 2UWEA 1JNNH 5ETUB 43CAA 1MFCH 4NOBA 4RGMB 4JDZB 5HGHB 3O6KH 3WUWB 4GAGH 4IMLB 4HZLB 1SJEA 1S8DB 3K2MC 4FNLH 4JM2C 2O26U 5CJOH 4JFFE 4TVPL 4PGEA 2YEZB 2A6DB 2GAZA 2MPAL 4M5YH 2F54E 5DRNB 4ODHL 4JFZL 4X98B 3SJVD 4R9HA 3ARFA 1MPAH 3X14B 5H94A 4XX1E 1EPFA 1YEKH 4XC3L 1FFNA 1N6VA 1HHKB 3FB7A 5KSBA 1MJUL 3HI5L 3WJLA 4LU5L 2XXCB 4MVBC 2NY7L 1CF8H 3N9GL 1LHZA 1S7XB 4PRBB 1BOGA 2VLRD 4S2SA 3P9LB 1KOAA 3ARFC 4LSQL 3FRUB 1SBBA 1TZIB 2DDQL 1QSFE 4PY8J 1JPGB 2CQVA 4PLKC 5IIEA 2CLZA 1YEEL 4JDVB 3WJLC 4DN3L 3O3AA 3FAXA 1RZFH 3CFEB 1S78C 1MCHA 3TBWA 1BAFL 1UEMA 1DDHB 1WJ3A 5HHXH 2YPLD 4HBCH 5JPMB 1GC1H 1XCQB 4P2CG 4JO1H 2FH6A 5I1GL 3MLZL 2I9TA 4PJGE 5EBMA 3BD4A 5I8OH 1RFDL 1CD0A 3AROA 3O2WH 1OOAA 5F6IC 1ZHLA 3P4LA 1W2KT 4I1NB 4D9QE 3Q6GH 1HDMB 1ORSB 1PYWA 4LF3B 1WC7A 5B8CB 5I1IH 4ZS6D 4D0BB 3IFLL 1M7DB 2ADIB 4N9GA 4F33B 3BRGC 4XNQA 1OGTB 5DXWA 4P59L 5IT2L 3FOMA 2XTJB 2NR6C 3KWWA 4YE4H 5JOFB 1JGLL 1J1XL 3WKML 1IKFL 3OXRA 3V5DB 1JRHL 3DXAD 2C1OB 1B0WA 3OL2A 3SY0A 4HCRH 5JQHC 3FO0H 5GPRA 3EO9H 4Q9RH 1F2QA 4H26A 5C0BD 1CG9A 2QJDA 2HVKA 4UIKL 3V0AC 4IBLT 4A6YH 3MMEA 3BMVA 4GW1B 3O9WD 4K71B 1G6RA 1MCPL 3P0VL 4QLRA 2BSED 4ZUVB 2QKIB 3WIHA 1QBLL 2J8UB 5DEFA 2FCBA 3VXTB 3IRPX 3QH3B 3MRGB 4Z78B 3T8XA 3H3BC 4NCC2 3TZVC 3MCKA 4QHKI 5J1SC 5I1EH 3VGEA 5K9QI 3D39A 1K6QH 2NY4B 3VWKD 2ESVB 4WI6A 4N8CH 3MLYH 4DK6A 1I7TB 3ET9F 3G5ZA 5AUMA 1K8IB 4MXWH 3V8CA 1LO3L 4F3FA 1GGBL 1VKXB 2VTFA 5C0JB 2QQNH 4A6YB 3KPPA 3HPJA 2X7LA 4XXDA 2AK4A 4PJBE 1NBVL 5C08A 1QQDA 4P23D 1T03H 1YC7A 1DBKH 5GZOD 3QCUH 2EIZA 3WEXA 4XHJC 4U05A 3VRIB 2BHYA 3NAAL 1WCBB 5E99H 4M6AA 3VXSE 1EZVX 3OB0H 1BJMA 4LCWA 3TBSA 4BJLA 4ENED 4NO2A 4OLWL 4X5WB 4PTUB 1VERA 3O6FA 3OB0K 2GJZB 3CFDB 5INCA 1T04B 1LILA 5I1DB 3QXUA 4M9PA 2OL3A 5F9JA 4LHUD 1AGDB 3BZDA 4MD4B 5CEYA 2UYLA 1E6OH 5CGYC 1M6OB 3MJ9H 1I9IL 3IDGA 4X7SL 3RKPA 2H3NB 1FAKT 3O6FC 3OGCA 5T1KA 4U3XA 3W9EB 3QQ4A 3BYYA 1JTTA 5D6DA 3ZMRA 4KKAD 1BLNA 3UBXB 5BMFL 1LO0L 4JKWA 4RIRB 4Y5XC 4JFEB 2LU3A 2X9YA 3QPXL 5ESVB 1A7PL 4S10A 1UB6A 1KJVA 1G9NL 4BFIB 1XF5A 1KT2A 3TGXA 2VZVA 4PJFA 1QVOB 3IDNA 5IKCA 2AW2A 5DQJA 1UC6A 5JA8B 4KK5D 5DUPH 4PJGF 3ZTJG 3OGOE 3SDCB 5D6DC 2R23A 2BCKA 5DDHA 7CGTA 2VDOL 1TPXC 3HUJB 3OJMB 4TQEH 4F15C 4EI5A 3KLDA 3O8XD 1C1EH 5JIPA 1FCGA 3GI8L 1G9ML 1BJ1J 3BGFC 1J05B 3MCLH 1XMWA 3G6JB 4NQDA 5CINH 3U7YL 5BRZD 4TRPH 2EDJA 4YDIL 5DMIL 2VLKD 1JZ5A 1H3UA 1JYXA 4K3EH 1N6QL 1IC7H 1QFHA 4U6HA 1ZE3C 1FQ9C 5A3ID 3NIDF 3W5MA 2QBWA 1IQDB 3JWDL 2X4UA 1EHNA 2P5WD 2ZKHH 4D2NA 3A6OA 2IG2L 4EI5C 5IOPA 3WL9B 1AFVL 3KPNA 3IGAA 5KBNC 4PJEF 4L3CB 3PWVA 3RL1A 2W9DH 3FQTA 3I6GA 2HKFL 3CPLA 5IHUL 5DS8A 4XWGH 1MHPL 1ZA6B 2DM4A 5TQ0H 1OD7A 1BD2E 4PJXE 4UQ3B 4G43A 1NC4D 5J3HD 1MVUB 2BNQD 3IAPA 1BFVH 4XNYH 1R0AL 1HH9A 4X4YB 2VZ1A 5I15H 4LLMB 1JN6B 1XEDA 3MRNA 3RVXD 5GGSY 1QLFB 4N0UE 4LRIA 1FIEA 3OKOB 1CD9B 2EO1A 2OCFD 1SBSL 4EDXA 4ERSH 5F97E 5DFWH 2EDFA 3HNTH 5IBUB 2IC2A 3U4EB 5CCKL 2N56A 2VKWA 3SCMD 3HAEA 3FQNB 4Q6YA 3CH1B 2GY7B 3SGDH 4LRIC 4DUXA 4KROB 1T5XA 1EDQA 1INQA 4GKNB 3QI9A 4GXUN 2WP3T 1P4LA 1DBAH 4MCYB 3BIKA 3IETA 5DJZB 3EYSH 4HQQH 4NC1E 5IMOA 2EDNA 1EK3A 4R7NA 5JDSB 3DJ9A 2ICES 3MQIA 4Z7UA 3HNVL 1PG7H 1U6AL 3VWJA 3HE6B 3HI6L 4MZ2A 3QI9C 3GEWB 5HVHB 1KTDA 1MRCH 3MRCA 5IMMB 4WEMB 3RZCD 1F4YL 2AQ1A 4C4KO 4NP4L 2FBJH 4LHJB 3VWJC 3IU3A 1QBAA 2XQYK 2P7TA 5DA4A 1KN2H 3FB8A 3CLEH 3FFCD 3D69B 1Q38A 2IALA 4HX1B 3U82B 2YN5A 3V6FA 2IFFL 1MELA 2OZ4L 3FQUB 2EH7H 3G5VB 2YUZA 4YX2H 3RUGE 5EU4A 1MUJB 5ITBL 1FL5B 3QNZB 1MCCA 4XNMA 1B4JH 4MJ5A 3U0TB 4NCDA 2OTWA 3BPCB 1DBJH 4QHNB 4YHOL 3S5LG 3TA3A 3C6SB 4XH2A 5I8CB 3G04B 1A6WL 3BZ4B 4LAJH 4YAQA 4MJ6B 4GLRH 4LNRA 4LASH 3EYVB 1R3JA 2FWOB 4OJFL 5DD5L 1JPSH 4ZXBB 5MP6H 5I8KH 1EHLH 2C3VB 4RAVB 4DJMA 3NGBC 2R0KH 5IB3A 1P2CA 4KRMB 3VI4F 1FL3B 4M00A 2DLTA 3TA3C 4E9LA 4H1LB 2DL9A 3VRLE 3C6LA 1CGUA 4U33A 3VG0H 4KRLB 3ORJA 4C56D 4XPHL 4HWEH 4BM7A 2F15A 3TNNA 3QQNA 1ZTXH 1E4WL 1YYMH 3MLTA 1AXSA 1MREL 2FB4H 2MHAB 4M1GH 2J4WL 1UXSA 2XPGA 3RA7L 1CFTA 3DTXA 5DSCB 3ARVA 3B9EA 1L7IH 2V2TB 3C6LC 3BUYA 4MAUH 4NRYB 3SJVE 4L4VA 2XN9A 4NRXB 4HG4J 1D5XB 5GS0C 3MLSH 2XZAH 5LWYH 3MLUL 4LQ1A 4PTTB 1U8OB 2WLYA 3SDDA 3SN6N 4APQB 1NFDE 5DJAB 2IBBA 2VLRE 2BRRH 3MGTA 1F00I 3GSXA 4C58B 12E8L 2B1AL 4P2QD 4U1SA 4KQ3L 1KPUB 4GRWB 3SDDC 1N3NA 3IJHA 4YPGA 4J3SA 1JVKA 3ARTA 5DJ2A 2YPLE 5D7JD 4IRJA 4WW2C 5JMRA 3RNQA 2GFBB 3L3JB 1NUFA 1QRNB 2MKLC 1RZGA 2G60H 1KENL 2IADA 1OSZB 3MOBH 2PF6A 3PF2A 4JZJB 3K1DA 4O4YH 2R29H 4ZFFA 4K7FB 2J88H 4NGHH 2R8SL 2GCYB 5GSVA 4Z95L 1I1FA 1XF3A 2DF3A 5EUKB 4IRJC 1RV6X 4XPAL 2CUIA 3BZEA 4GXVL 4OUOA 1FH5H 4LSUH 3QA3A 1P1ZA 1U8QA 2EH8H 2FGZA 3BWAB 2FJHB 4XP6H 5T1DL 5TQ2L 5J9PB 3MZGB 5HDBF 1BEYL 5DQ9B 4QF1A 3PHOB 1OQOA 3DXAE 1RZKC 3PXHA 2VDKL 1I7UB 5E4EC 4CN1A 1WAAA 4P2YA 3LQZA 4GH7B 5IEHB 4P3WA 3BP4A 4MXQD 2ZUSA 3REVB 3TCLA 1FGVH 3O41A 1RK0A 2QSTA 4N0FA 1D9KA 5KOMC 3RGHA 5FEBA 3GBNH 3QEQA 2X4PB 5JPNB 2JE8A 2Q76A 2E5EA 3TIDA 4NC2B 4Z0BH 1F45A 3KYKL 1U36A 1NLDH 3O0RL 4WFED 4PGBB 1D6VL 2HT3C 3C5SA 1RHHB 4NT6A 4X6DA 1J0KA 3T4YA 1AGEA 3LDBC 1OAZL 2HMID 5D2LB 3QDJD 1D9KC 1A9EA 4FQ2L 3TPUA 5ISZB 2ZG3A 4NQVB 1E28A 3IXAA 4TUKH 1TVBB 2HFFA 3MFFB 3TV3H 1UCTA 3AFLA 3VDCA 4G8FA 4GUPA 5BZDB 4ETQA 2COQA 3T3PF 3SDXE 4BK5A 4I3SH 2P8MB 2X1XR 1R5WB 2DQTH 3EO0A 5IG7A 1YZZA 2X1WL 1NMAL 4XP9L 5K9KA 2APVA 5FHAH 4OZFH 3AREB 4NNYA 5EPMA 4GAJL 3H3PH 5J11B 1YNLH 3ZKMD 2Q7YB 4WI5A 5FYKD 3VRLF 1GGIL 4F7PA 1KJMA 1AC0A 3L5IA 1I1AD 1FVDA 2FECI 4PGJA 4Y5YA 2UUDH 1U41A 5JR1L 3LMJL 2A0LD 3DSFH 3HLAB 2Y06L 1AQDB 3MV8D 4PRPB 3SOBL 1ZSDA 1S7QA 4I13B 4IRSC 2UUDK 4PB9L 1NGPH 2OQJB 3BFOA 3LN9A 7FABH 1NCDH 4I9WD 3H9SD 4RCAA 1F5WA 1WK0A 2H6PB 2VAAA 2VITA 3SBWA 1A7RL 4AIZA 3UTSA 4R4BB 1QO3A 5ANMB 4YHYC 4Y5YC 4WJ5A 3A6BH 5MEOA 3GSWB 1JGEA 1U95B 5EN2A 2EDWA 1AKJD 3UC0H 1RK1B 4M8VA 3JWNC 5JORB 3DMMB 3OAYK 4XP1H 1MSPA 1DANT 1NFDF 1CE1H 4W4NA 4QRRA 3WD5H 2FHCA 2JELH 5KS9B 5BOZG 4P5KB 2AJZB 3LPGA 1B0GA 3OPZH 1QA9B 3HB3D 1CGWA 2PR4L 1LO5B 1VPOL 1ZGLB 4OLEA 1IAIH 2WM0A 2HLAA 4LLUB 1FNSH 4L8BB 3QG7H 5T3XD 1P7QB 5FF6A 1RUQL 3EW3B 2EDOA 2AABL 2EYTA 5ERWB 2A74B 2OX5A 3L3HA 4Q0XL 4RRPA 3LAFA 1VGEL 4X8XA 4ZS7L 2NPLX 1PVHA 1LP9B 3BJ91 1TQCB 4R2GD 5BV7C 1ES0B 1T20B 5J57B 4QHUB 1MQKH 4JPKL 4DAGL 1AQKH 3KYOA 5ID1B 3ABZA 3O2VH 1KG0A 1KCRH 1ZWIB 4AH2A 2CLVB 1F42A 1RZJH 3I84A 2OYPA 1F11A 3W0WA 5BRZE 2JCCE 3GMMB 2VLKE 1EO7A 5CMAA 4G42A 3FT2B 1A6VL 2CLRB 1L4IA 4PFEA 3FFDB 4MQXD 2P5WE 1ZA3A 5FYLH 1A1OA 1OAYH 3DYMA 5IMLB 4MQSB 1R5IB 1GAFL 3T04D 3RWJB 1U42A 3NCBB 5DWUL 5GGQH 3L5XH 3L3DA 1VFAB 2ADGA 3GSNA 4RMVA 3MLRH 5IB1B 4CL7A 1D6EA 1FC2D 3LZFL 4YHLH 1ADQL 3MLXH 1B3JA 1CDYA 4CN4A 5DJCA 1F4WL 1S7WA 2DQIL 3IKCA 3GJEB 3M8OH 4YGAB 1KB5B 2LABA 1UM6H 4JRXD 4OM1H 2G5BB 1GYAA 4BFBD 4HF5H 3ECBB 3REWA 3N1FC 1DN0A 2IPUG 3ZE0E 3UZQA 2M26A 4M1DH 2NZ9D 3TO4B 3SDXF 4HV8B 2D0GA 1MFBH 2JB5H 1SJVA 4KI1A 1DE4A 1JWUB 3IDYC 4IS6A 3AMKA 2YD9A 1K4DA 1IEHA 1SJHA 4YNYB 2ITDA 2BOCB 4H5SB 4Y2OA 5I1HH 4YBLC 3VFGH 4S11A 3QFDA 4KXZI 5EO9A 2A83A 1Z3GL 2BDNH 5KSAD 1I3RB 1SYVA 1YEHH 5AZEH 5DC4B 1FO0A 4OCRL 4JREC 3QHFH 4YDKH 2D0HA 2XRAL 4XXCA 5DJYB 5F7DB 3MRFB 5JHDB 3QDMA 3ZT6A 1GGCH 1T1ZA 2RFXB 2GUOB 3BP6B 2Y25A 3QXTA 3N1MC 4KQ4L 3LQMA 3N85L 1IFHH 5TDOB 1S9VB 3OR6A 4U6YA 4XNUH 1WZLA 1DUYA 4WO4D 2C3GA 2Y07L 3ZDZF 1MJJA 3QUZD 4BH7B 1M71A 2YBRB 3KPSB 3R1GL 4XXCC 3TIEB 4HJ0C 1BGXL 4DN4L 1E4JA 2CXKA 2PCPB 5DHXB 3FFCE 3LB6D 2X70A 1U8HB 3ARBB 3PABA 2R39A 35C8L 3QO1B 1XIWA 2NQCA 4HKBA 4LAQL 3LEXA 3O45A 1EH9A 3GNML 1YEJL 5LJYH 3HC0B 2CIIA 5HHNB 1SQ2N 4LLDA 1EBAA 4MA3B 5C6PB 5EOCL 2PNDA 4OIIH 2PETA 4XHQA 2P1YA 3WFHB 4NJAL 1XIWC 2MNUA 3VFVA 4UT6H 3WNNA 1K5NA 3MRPA 4NHCH 2BJML 4NN7C 5HGBB 1NSNH 2AJUH 1VADA 3MV7D 1MCQA 2NW2B 5F93C 2JLLA 4JM2B 3W82A 2PW2B 4HPOL 3LH2L 1PKQE 1WBYA 1TETH 1CD1A 1OP5H 1UYWH 5EFIA 2ZUYA 5HGGS 4JFFA 4UQ2A 2UWEB 2YUXA 4C56E 2H2PD 43CAB 2ATPA 3EOTH 1UM4L 3QHZL 4D3CH 1MCEA 4JFDA 4QHMA 3WUWG 1ETZA 1SJEB 4ELMF 4POUB 4BSWA 1NKRA 4PGEB 4HUVA 4RX4D 1FCCA 4X80H 1OY3B 2GAZB 4UV4H 3HZVA 5EZIL 1GHFH 3ARFB 5DJDA 5ICXA 4ALAL 5JZ7D 5H94B 3CVHA 2GIYA 2YK1L 1FFNB 2AKRA 3FB7B 1DANU 5KSBB 4WFHD 3VGHA 1QSFA 2XWJA 3TWCH 5FGCE 4J4PD 4X9IA 3KLAA 5T5FH 1BOGB 4S2SB 1GSMA 2WWKT 2XG4A 2H9GA 1UKQA 5I66A 4LFHG 2XICA 4XCEA 2DM3A 4LLQA 4ZAKD 1GZQA 3THMH 5IIEB 2CLZB 2I9LA 5JXAH 3LN4A 5F6IB 4G6KH 3O3AB 2EIBA 4PJGA 4P2QE 3TBWB 1FFRA 2XV6B 3BKJH 5F7EL 5IFHL 3ARYA 2V7NA 5LQBL 1Y6NR 1GL4B 3VG9C 3Q1SH 4XP5H 4CRPA 3E1F1 2HT4C 5F7UA 2I9TB 5EBMB 4AG4H 2P8LA 4AMKL 2QQLL 1G6RH 4P99A 1F4XH 1M4KA 1TITA 1ZHLB 4PRAA 5CKGA 3WIHH 1FNHA 4QOKD 4QO1A 4GG6E 5KVDL 3V7AE 1PYWB 1G7JA 1WC7B 2AJYH 4N9GB 3KPTA 1OPGH 4LLWA 4XNQB 4JVUA 4OI7A 1NAMA 2DQEH 3C08H 3FOMB 3KWWB 5MEQA 4NPYA 3OXRB 1J8HD 1T5WA 2D7TL 3TN0C 5DVNA 1CBVH 3NTCH 1T7XA 3SY0B 3WNLA 5J12C 4D9RD 4L8CA