3QCUH

Crystal structure of the lt3015 antibody fab fragment in complex with lysophosphatidic acid (14:0)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
223
structure length
219
Chain Sequence
EVQLVQSGAEVKKPGESLKISCQAFGYGFINYLIEWIRQMPGQGLEWIGLINPGSDYTNYNENFKGQATLSADKSSSTAYLQWSSLKASDTAMYFCARRFGYYGSGNYFDYWGQGTMVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural characterization of lysophosphatidic Acid binding by a humanized monoclonal antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords LT3015 antibody Fab fragment, heavy chain
total genus 40
structure length 219
sequence length 223
chains with identical sequence I
ec nomenclature
pdb deposition date 2011-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qcuH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qcuH01
2FCBA 2BP3A 3CSYB 4JLRA 3Q48A 5DZLA 2R9HD 3BVNA 3BH9B 3ZKNC 1OAUH 1RZJL 2Z4QB 4PJHE 4BQCA 1TJHH 4CMHC 3ARYA 1IGFL 2VZ3A 4HIXH 5I17A 3MGOA 5DLML 5ETUB 1HHIA 1B0GB 4XMKH 2QQNH 5IJKC 1UJTA 3FQUA 4M62L 1D9KC 3GHEL 3LQZB 3CPLB 3QDGA 4GMTH 1BMGA 4P2QD 3DECA 5ANME 5F7EH 4AT6B 1ZOXA 5C0FB 1JGLL 4XCEA 4DGIL 1MJJA 1DLFH 1JHTB 4MD0B 1E28B 2P5WB 4V1DB 2DI9A 1DBMH 5BS0B 4GG6F 1OM3H 1DVFA 1NUNB 5DRNB 4M5YH 3MV01 4CVZB 4NYLB 1T03H 3EGSB 2H3NA 5T5FL 4PJEE 1J1OL 3HE7D 5E6IA 3BZ4A 4YHKL 1T2JA 2BMKA 1U8HB 3SDCA 4YUEH 1X5ZA 4YEEA 2X09A 5EC2A 1SY6A 3L3HA 5JHDB 1OHQA 5HGGS 4W4OA 4DKDC 3DNKA 4PRHD 1DBKH 4G9DB 4JFHD 4EUPA 5C0CE 4L5FH 4AEIH 3BWAB 3C5JB 4MHHG 4WGVB 2BJML 4HIHA 4P5TC 4PJ7E 4PJHB 4LCYA 2R4RL 1MCKA 3JXAA 1RZKL 5HDLA 4N8CH 5JW4N 5FA3B 4MCYB 5C0DA 5DURD 5EC1A 4POYA 3QUMA 1WBXA 1UM4H 2YD1A 3Q1SL 3ZDXF 2CKBB 2MQ3A 5CINH 4S1QL 1INEL 4C56B 3U79A 4DK3A 1IARB 1BQUA 4OI7A 2Y36L 4XCYB 4WTXA 2BX5A 4ONHB 1BQLL 4JPKH 1T89C 5TH2B 5D1QD 1FNSH 5I73B 3VFRB 1YEJL 3SHSA 5IBLD 2IPUG 1KPVA 4ZPTA 2Y7QB 2LU7A 3MRGA 1AGFB 2GTZB 4EN3B 4LRIA 2AKRB 2HN7A 4NWUL 4ELKB 4B53A 3SKNA 4DZ8B 1ODAA 4OGZA 1N59A 1P7KB 4WHDA 4B7LA 3QDJA 2M1KA 5IBLC 5IJVB 3VXMB 4CMMA 4IMKC 2ADGB 2D9CA 3T0ED 2HRPH 5KSAD 1YA5A 3QNXB 4O2FB 4DK6A 2QLVB 3NIDF 1YEDB 4X8JA 5GRXG 4LMQE 5CJQL 2QADB 2HJKA 4X5XA 3I9GL 3QWRA 1G7QB 3RWFB 5AD0B 1XGPA 3X3FH 1QUNA 3QIUB 3SJVD 5DS8B 4IRSB 1PAMA 4KRPB 3U36B 4HG4J 2Z0BA 4WCYL 2KDGA 1MCOH 3NGBC 4KKBD 1ZLUH 4MCZA 1J86A 3WLBA 4U6TA 4KJPD 1F45A 4GRWH 4CRPA 3L5WA 5CMAB 2VABB 3MRFB 5D8JL 3BSZH 1MFBL 5I6XC 5C08B 2YRPA 3QBTB 1MEXH 2YA1A 3B8YA 4NRYB 2NTFB 1F02I 2VXTH 3S4SA 3MXWL 3O3EA 3N1PC 1WK0A 5BW7A 1ZHNB 2PW1B 3WKML 4K7PH 2F5BH 1ZKAA 4KVCH 1MHHA 5D2LA 1QLFA 1I7RB 2F53B 4XWGL 4YNYA 2MKWA 3HUJE 4HIXL 5CD3A 5D70L 4K07A 1MAJA 5I1JL 3FONA 1Z3GH 2AW2A 3CC5A 2W9DL 2Y7QA 2NXZC 3ILPB 3A67L 4ZSOE 1NGPL 4ODVH 4FTVE 4M7KL 5LQBL 3MRRA 4GW1B 4EOWL 3VRLF 5INCA 1WCQA 4EN3D 3EFDH 1HXYB 3W2DH 2ITDB 3TNMB 1JZ6A 1F4XL 3G04A 3ROOA 1DL7H 3G5ZA 4N90E 4K2UL 1G7LB 1XEDA 3GKZA 3IRPX 3GSQB 2HWZH 4G6FD 4Y0GA 3QWRD 5E2UL 5K9QI 5D7JA 3OXRA 4BYHA 1F58L 4U6YA 5JORB 2VLRE 4LRNL 3MRQB 4R0LA 4PRPE 3SJVA 5HI3C 2EIBA 2G9HA 2Q8BL 4L4TA 2H32H 2HJLA 2YUZA 4FTVD 5C0BA 3V8OA 1OSZB 1X5AA 4F57H 3FT3A 3F7VA 3OSKA 4IMKA 3ME0A 4XTRD 1JGDB 3IDXH 1A7NL 3EOTH 4LCWB 1DBAL 2FX8H 5EORL 1N3NB 5HI3D 4FQHA 4M7LT 4CVWA 2UWEF 4FQXB 2VN4A 4BKLB 4L3CB 2EKJA 1XGUB 5TFSH 1P7KA 2XFXB 4FFYH 3BRDA 3BPOB 3C6LD 3OAYK 1LDPL 4XTRC 5EZLB 3SKJH 1WICA 5GJSH 4HUUA 5HHNB 1DFBL 1N7ML 2DIAA 1J1PL 3LN4B 1RJYA 4OT1L 5MERB 4LIQH 4Z76B 1WAAF 4R26H 2R56H 2XT1B 1QRND 4UDTA 1EO7A 4IOIA 3V5DB 2AJZB 4HK3J 3NZHH 4NSKB 4GKZA 4PJ5E 1KGCD 4JRXD 4JDVB 4Z0BL 3HI1B 3O6FA 5DHYA 5DS8A 4QHKI 2NY4D 5FGRA 2BSRB 3KWWA 5HI4C 4MSWA 4P5MB 3HR5B 4Y4KA 3UJTL 4LVNB 4LSSL 4PJFA 1NLBH 4QRUA 5C6TH 3G6DL 5HGAB 4U1GB 4BH7A 1MFAL 4HULB 4U7MA 3NTCH 1LK2A 3F12B 1TETL 2HG5A 2E9WA 2VMFA 3P11H 3FO1A 4GSDH 4IRSC 5DRZA 5ITBH 4WFFD 1WBZB 3L7EB 5FYJU 5ADPL 2IG2H 4JPWL 2M2DA 3HS0A 4LP4A 2PTVA 3RBGA 1KENL 4P2QE 4NUJA 5J9PA 1A6WH 4NOFA 1HNFA 3IFOA 4NN6C 3QISA 5IOPA 4GRWB 3T0EE 5AZ2H 3L5JA 2V7HA 3CSYA 1LD9B 3H9HB 4MA1B 1CK0H 2Z8SA 3RX5A 5JPMA 1VA9A 4M9PA 1OP3K 1XGRB 1E4KC 1MF2L 2D7QA 2R4RH 4G5ZL 3DRQA 1INQA 2JK5B 4YZFF 5ACZA 1ZA3B 3C2AL 1MCQA 1RURL 1YMHA 4L4TB 1JPSH 3Q5TA 3L3DB 5HHXH 2DTMH 1KB5B 5BV7H 1PGRB 2GT9A 3OKKB 1AGEA 3K7UA 3WYRA 3U6RB 4HMCA 5FM4A 3BDYH 2LV4A 4X7SL 1QQDB 4ZOEA 4HXAL 4L4TE 5HJ3A 2P5WE 4V1DE 4QYOA 2ED7A 3LD8B 4JG0H 6FABL 5BMFL 1KUMA 1MCWW 1S9XB 5DEZA 2BHZA 2R2CA 5D2LE 5F88B 3MJ8B 4MNGB 3HFML 4KTYA 3BZ4B 3T0EB 4NQEE 3OMZA 4MX7B 2B1HL 3QXDA 3EZJB 3FB5B 3ZKQD 2V9QA 1VENA 5CZKA 1MI5B 3AMLA 5I1CH 3FT3B 4Y4KD 4F3FB 3G5XA 3WFHB 3A6BL 4NRXB 1CICA 3P0VH 1T21B 4LVNC 3RU8H 4BKLA 4S0SD 3AREC 3IDNA 3NA9L 2V2WA 5IFHH 3BP7B 5DYOA 4TNVK 2NY4B 2PR4H 1MHCA 4MD4B 4JZNA 4TRPL 5EA0H 1LDSA 2VDQH 1A0QL 3VGBA 4QNPF 4E41B 3MRJA 1FAIH 1X5JA 5CBAA 1GGUA 3WN5B 3B6SB 5HXMA 1LP9A 2PW2B 1QFWM 4HFUL 5IESH 4ODXA 1T20A 5CEXA 2DMBA 3X3GH 1G7IB 1H3UA 4ODUA 3B9EA 4POZC 4F15B 2GTZA 4EN3A 4G8FB 2Y72A 2VDPH 3SDAA 1UEYA 2XKNB 1FORL 4XX1E 4HX1A 3K8MA 4K7FA 3S3SA 1OTUC 4FQXC 2WWKT 5JPMB 2C1OA 5D7JD 1T1ZA 1XR9A 3GNMH 2A6DB 5D4QA 4HHAB 5HYSA 1ITBB 2A1WL 4ZUSB 2HG5B 5EO1B 4OCRL 3LEVL 1IGCL 5FYJL 3JUYA 1A6TB 5HDBF 2MQ0A 3SGJC 4CVUA 4QKXB 3W0WB 4QOKE 2HH0L 2B5IC 5I1EH 3R0NA 3OBAA 5IESL 4NQEA 4O5LL 4PJHF 3OKDB 4U6HB 2JCCF 1JHLL 2AEIT 2HTKC 1KFAL 1AP2B 5JZ7D 2XPGA 4PYHA 3SPVB 2YBRB 3T0VA 4HKZB 4O02L 2AK1H 4JO4L 4WVRA 5C0AE 5BO1L 1BBDL 3NFPA 3SCMB 3IXTA 3O2VH 3BIBX 2DQDH 1CFQA 3N85L 3J7HA 5ADPH 3VCLB 3GZKA 5FYLE 3GGWB 1I9RH 1JWSB 2AJXL 4OBRA 4LFHG 1U92A 3UTPE 3MV7D 1XZ0A 4OAWA 5DJ8B 3UAJC 3RAJH 3EZ8A 4RDQF 4PRNB 3FOLA 2OLDA 2DL2A 3VGGA 1IGJB 5HJ3B 1FLTX 5IEKB 3QFDB 2GJ6A 2VR5A 1DP0A 3P4LA 2OL3B 4YFLI 3D85D 3UTSB 4ZAKD 3RA7L 5C9JA 2JIXD 3PABB 5CEZL 2EDLA 2B8OT 4I18B 5BO1H 3VFNB 3FB8A 3KJ4B 4DW2H 1QLEH 4CN1A 3GMRB 3V6ZA 4JO1L 3LKQA 3AY4A 3TO4B 4GMTL 1KJ3H 1T04B 4ETQB 5I8CA 4FQQB 2CXKA 3D3VB 3T0BA 4KHTH 2AXJA 3FOMB 3Q6FA 4LLQA 4PJ5D 1R3IL 5J0BA 4LIQL 2NLJB 5IMLB 4FG6D 3PWVB 1OP3H 5DD6A 2HVKA 3DTXA 3EYUL 3E8UH 4A6YL 2W9LA 4ODTH 4WI4A 3GBML 3W0WE 1W0VA 1X5LA 1T1ZB 1XR9B 2BVQA 5A2JH 4I13B 3UZQA 4KC3B 1WFOA 3LDBB 3WIFA 3LV3B 3WEXA 4Y2DB 5I8OL 4UT6H 4K3EH 4YXHH 1N8ZA 3FQXB 3O6LH 3IYLW 3ZKSD 1CLCA 4HBQA 3ARWA 4HAFA 2VL5B 4HJGA 3HZVB 4QHLA 4NQXA 1MIEH 4U7KA 2JJSC 4GXVL 4OSUH 4JHZA 5I19L 3U0TA 3HE7A 5E6ID 1RU9H 2BNRB 1D9KD 5FGCB 2NXYD 3RGVB 2UZIH 4R90H 3VXUA 4F7PB 2E7CA 2YBRA 1HN1A 3O3AA 1NCWH 3BVNB 3ZYIA 1CDCA 5T1KA 3Q3GA 5DR5H 4P59L 3QNZA 5D7KD 3OKOB 4TVPH 5KZCB 5DRXB 4LFHD 2NZ9D 3PJSA 5I73C 4UBDD 1RULL 3KYNA 4Z76A 5L7XL 1T0NB 3GGWA 4Z7OF 4LPYA 1QHOA 1KCRL 4X4XA 3SGDH 1WIUA 4HBCH 4PJCB 1F3DJ 2N7BA 4JRYA 4TQEH 4MAUL 3D2UD 1R5IB 4Z7WE 4MXVE 4FP8L 4ODWB 5E1AB 1NCCH 3IETB 1ZT1B 2X05A 5GS1A 3NCJH 3B4NA 2W0LA 4HLZG 4PTUB 4R90L 1PW3A 2QQKH 3V4VL 3PL6C 4DCQA 2R23A 5D1QA 1JZ5A 2VE6B 3HZKB 5LBSH 2ZOLA 5DR5L 3IJYB 5AG8A 4D0BA 4N8VG 1LO4H 3QWOA 2DQJH 3MXWH 3WS6A 3MLUL 5D6DC 3HI5H 3H7BB 4JY5H 1KELL 5DEFA 3I02B 1M7DA 4PJXF 4YGVB 3ZKMD 4OCMC 3RZCC 4YBHA 5CJXC 1WZMA 2CLRA 3NCMA 5D71L 1W0WB 3CGTA 5FEBA 4TSAH 5IT2H 3L6FA 5IFJA 5GZNC 2HVKB 4R0LC 3S98A 1MWAA 1HINH 1F11B 1GRWA 3BP5A 5HPMB 3EO0A 5F9OH 1F3JB 5D7IB 2XWJA 4YC2C 1P69B 1PYWA 5F9JB 1S7XA 5C0CA 4GG6A 5GZND 2BVPB 2C7UB 4L8BB 4QT5A 3UBXB 1KCVL 1UQSA 3NAAL 2GHWB 3H0TA 3RL1A 2XZAL 3EYQD 3L1OH 2VLKD 2EKSA 3CFBB 5AZEL 1S7RA 3VWJC 1CS6A 4U1KA 1S9WA 3DXAB 1FAIL 5FGSA 3WNPA 1PY9A 1MFCL 5I75B 4NKMB 2J7LA 2WBJC 4U1SB 4MS8C 2W0FA 3KPLB 1KCSH 1OWWA 1LO2L 1P7QA 3RTQC 2CUMA 2XICA 1IC7L 1IC4H 4QTHB 5DJDA 3MGTB 3ARDA 3B83A 3BAEH 5C07A 5D7JB 5JORA 4PJXE 4FMFA 3HZMB 1VGEH 3DO3A 32C2B 3QIBB 2KQMA 3LQAL 4JHAL 1KJ3L 1FVEA 3IDXL 2IEPA 2ADFH 4IS6B 2XWTA 4CGTA 2X4UB 3U4BL 2XQBH 3T2OA 4GLRH 1G9NC 3UCRA 1ZLVK 1R3LB 1PZ5B 3ARPA 1VGKA 1KT2B 3V5HB 1YPZA 2A9NH 1NGQH 4OZ4B 1A4KA 1YYML 4I3GA 4KZDL 1KC5H 3BO8A 1G0XA 5E5MB 4G9FD 3WXWL 3DVNB 3SDDB 2GSIA 4YHKH 3BP7A 1CDBA 3Q3GB 4JREB 4HUUB 4N5UA 5HHNA 2NXZD 1TQCC 4UNVA 4HKJB 2VAAB 4JDZB 4HGKC 4UT6L 1M4KA 4TUKL 4OFIA 3OKNB 2XZCH 5TF1L 4PJAE 5DJCB 4B0MM 4EVNB 5CBEB 2MWCA 4XXDA 2VITB 1XH3A 5KJRH 4JFHE 3O2VL 4Y5YA 3TBWB 2A6KB 5EZIH 3TZVB 1DQJB 1R6VA 1HKLH 4L3AA 2Q1EA 4N1HB 1MWAB 4D0DA 3GUTB 1W72H 4DEPB 4Y1AB 4B7IA 4KMTL 5L9DH 1OQOA 3ROLA 4UQ2B 2NPLX 4OZGB 1OCWH 1W72B 2OR7A 4ZFOA 1T83A 2A6JA 4LIQE 3RHWK 2P5EA 4M8VA 5DRZB 4J2XA 1DANT 4NPYA 4WUUB 2AJ3B 3D69B 1JHKH 3MOAL 3MRMB 4F9PC 1QFWI 2W92A 4PJGF 1JK8A 2PYEE 2XKSA 5DFTA 3MLSL 3GSXA 3P9MB 2P44B 5INDB 3P77B 2JF1A 1IGIL 5C6TL 1MJUL 3KPSB 2V17H 2GY7B 4PJGB 15C8L 5D6CB 4Z7UE 2R8SL 4P9HL 1HI6B 4MDIA 1AGBB 5B21A 1SJEA 1NUGA 4TVPD 4NC1C 5E5RB 4FNLH 5BRZB 3PHQA 1LO4L 2NQCA 4G42B 2C4FU 2JK5A 1G6RA 3LRSB 3VXMA 2WLYA 3C8DA 3B5TA 1PBYA 2R1YB 2X42A 3PWPE 1FCCA 1QBAA 4AH2A 3LB6D 1FNHA 4HG4K 3D2UA 4XMLL 1JWSA 4MQXD 4Q9QL 1NANH 4LPUA 1BD2B 2WLZA 4XNMB 4ODSH 4JHWH 3T8XB 3EFFA 2Q3AA 3W9DB 4NFCA 4FN0A 4EQ3A 2OL3A 2LE9A 3WJLA 1UKQA 3FZUC 5HHMD 2CDGB 4BSVA 4Q0XH 2GEEA 4J1UB 4KKCC 1CLOL 4J4PA 3C8HA 4MQTB 2I25N 2DYPD 5CWSB 6FABH 5KVMC 1JPTH 2ERJC 4WO4B 5C0JB 1BWMA 1A7RH 4Z7VB 2CUIA 2I9LB 4ZO6A 1KTLB 4NNYB 3VGFA 5L0QC 4HXAH 1FO0A 2BVYA 1WITA 2EXWC 3TVMC 2BVOB 5BMFH 4PBXA 1MQ8A 4X7EC 1IAIH 4Y16D 5DJ0A 3DVNA 3D18A 1CDHA 1FSKC 4Q9RH 4KHXL 2WANA 5EOCH 4RMUA 4JHWL 3OB8A 4Y1AD 2ZNWA 4XGZA 1DN0B 3DBXB 3RU8L 1W72A 5KVEL 3IF1B 1FE8H 4I48A 3TO4D 2YEZA 1PKOA 3O4LE 3B9AA 3A6BH 5L2JB 5I74C 4UT9H 3I2CH 1UB6A 5TE7L 5BZDB 5CAYB 2WWMD 2VERN 2W91A 4K3DL 1EJOL 3QJFB 3OGCA 2Y5TB 5IFHL 1OGAD 5HD8D 1CD0A 4LSPH 3P77A 3KXFE 3FAXA 1C16A 4PJAF 2WIMA 1T1XA 2XTJC 3SDAB 1S7SA 5E00B 5FA4A 3UJIH 3JWDH 2XKUA 1F58H 1TCRB 3ARDD 4LCCC 5GS0L 2FR4A 2ATKA 3S35H 1IEBA 4CADB 2FGWH 1E6JH 1YN7A 5D96C 5KS9E 1U8JA 2PKDA 4ERSL 1RIVL 1P5VA 2HP4A 3E3QE 3HG1A 3DSFH 5C0IB 3WS3A 1D5XA 3PF2A 3CC5B 4R7DA 4LDEB 3ARUA 1KB5A 4GXUN 1FIGH 4LLAA 3MA7B 3TBTB 3D0LA 1HKLL 5IB5B 1JYNA 4NM8H 2F74A 1EJOH 4I3RH 3BD5A 4RMQA 4OLXL 1HXYA 1CVSC 1Q38A 1D5ZB 1U8QA 5D2LB 4JM4L 2AEQH 5DVLA 4XPTH 1JZ3A 1F90L 4LU5H 1I1YB 1JHLH 3H9SE 4HUNB 5DJYB 1LO2H 2IFGA 3MA9H 4E5XA 4OLVH 4B5EA 1E4KA 1U8PA 3K4DA 3C08L 4HWNA 4PRDA 3CFDA 3RWCA 4TSCH 4BFGA 4Z78A 5C0JA 1BM3H 4OB5H 1U3YA 2YD6A 2AS5M 4AH2B 1BHGA 4Q6IC 4KJQD 4LPXA 4WO4D 1OL0A 4N1CA 4GG8A 4JFEE 4MMXC 1P84K 2XTJE 3OB0K 3ROOB 2C3GA 5F7YC 1FLRL 4M8QB 4NM4H 4BFBD 4OZFA 3SE9H 2Y9RT 1J5OH 2Q8AL 4JGMA 3H9ZA 5LGHL 1CU4H 1A9EA 3O4LA 1WT5A 4HUKB 3BUTA 1TZGL 3CMOL 4NC2B 3GMLA 2QQLH 4LARL 3QH3A 4GSDL 1C5BL 4OD2B 3SE3A 4OCXL 4LMQI 1KJ2L 3L3OB 5CBAB 4Z7VF 2MCG1 1JGVL 1V7NL 5FM5M 4LLYA 1VPOL 1SEBB 1A5FL 2W65B 3S36H 2F19H 1Z9OA 4FXLA 4MWFA 2IANA 4N9GA 2VLJB 4XC3H 4PJ8A 4HK0B 12E8L 4JY4A 3QIWD 4LDLB 4YE4L 2F5AL 5HGAA 3AM8A 4QRPA 1YQ2A 3QAZB 1EXUB 5ITFA 1J10A 3KR3H 3SDXF 3VXMD 1OT2A 1FQ9C 1GIGH 3VFSB 1N8ZB 3FQXA 4WI6A 3HI1A 3O6FB 1VACA 3SKOB 2HLFC 4M02A 5I1IL 3BDYL 4LBEB 4ONHA 1II4E 1ONQA 2FEDD 3MFFA 4L8SC 2CLVA 3U4EB 3EOBB 1R3LA 1NQBA 1EHNA 2YHGA 5T5FH 5FOBA 1OTSD 3V6OE 4ELKA 4HIJA 3FFDA 3T2NL 3GHEH 1AE6L 2X40A 5EU6D 3SKUD 1SBSL 4M03A 4OIIH 4LAQL 2OQJA 4JPIB 1FZKB 1P2CB 1MY7A 1BVLB 1ZT7B 2VXQH 2OYPA 4FFYL 2Y07H 5K9OA 5DRXA 3ARGB 1EVUA 4DKFH 3V79C 1BECA 4ZOBA 5FK9A 4JFDE 4TOYL 1YYLL 1V05A 5HHVH 2YZ8A 4AEIL 5T3XE 5HGDB 1AD0B 1UCBL 3QWQB 5IQ9A 2VITA 2RR3A 1F2XK 3RPIA 1AXTH 1U92B 3QUZA 3WFEL 2CGRH 1JNJA 1G0DA 4ODHH 4XAWH 5CZXD 3EUUA 3IETA 1ZS8B 3VFMA 2PNDA 3O6ML 3WIIL 5IEKA 2EYTB 2AI0L 4FZEH 3GMNA 3SDXE 4N0CC 4Y1AA 3D9AL 1UXWB 5DJAB 3VWJD 2ARJB 2DS4A 4R4BA 4P3DA 1DDHA 2PO6D 4P2RB 3TJEH 4QRSB 4M43L 4BZ1H 1QLRB 4Z7WF 2DQIL 2V2XB 4HEPG 3GFUA 3EJJX 1K85A 2Q86A 3IGAB 3MGAA 3REWB 2VOTA 2GSGB 3GM0A 4KY1L 2X5PA 3WNKA 4QF1A 1XF2B 4F37F 1MQKL 3QPXL 1MCLA 4XNXH 5L88L 2YMXH 5C2BL 3D87B 3W9EA 2NZ9C 4JY4B 2YA2A 1ND0A 4UBDC 4P4KC 2AABL 4NKIH 3W81A 4BELD 4IOSD 4MD4A 2AJVH 4I9WE 4JANB 3WNNA 3TVMB 4I4WB 2R1XA 1DUYA 5CGMA 4WW1A 5EBMA 3IDIB 4PP1D 3WIFB 4KI5F 4G7YH 2R2HA 4CL7A 2P24B 3KXFD 1HH6A 1H8SA 5DJZB 4OV5A 2O5ZL 3V5KB 4TSAL 5T33H 3CFBA 5EO1A 4KJWD 3N06B 1MCOL 1R3JA 5EBLB 4P9MH 1DUZA 4GRLA 2H32A 1FZJB 2IJ0C 4GAYA 1RZFH 5DC0A 1DEEA 1NPUA 3MCG1 5F1OB 3BGMA 3HUJF 2WBWB 3VGAC 4I3SL 5KVDL 1X6LA 4L8DB 2D3VA 4WY7L 1WZ1H 3OQ3B 4YBLC 4Q6IA 4HKXA 4M1GH 3B9KB 4PJDA 2R2EA 3WCYA 2D4FA 5DJXA 1TJGL 5CEXB 1H3GA 2VJXA 2XN9D 5C8JB 1WLHA 1UJ3A 4Z7VA 3QHTC 2XTLA 3JWOL 3PGDB 3BE1L 3WXWH 1UYWL 3F7QA 4XC3L 1X3DA 4U6HA 1NMAL 4QRRA 3RZCD 1N6VA 1Z0NA 4Z7QF 2OR8A 3V6BR 1L0QA 4TUJA 1YNKH 4RA3A 1B4JH 5EWIL 1NL0H 1TZHA 3JV4B 4ZFZA 5FHAH 1SYVB 5EZJB 4P2RD 2DWEA 4LPTA 4PV9B 2P7TB 1QBLH 1S5IH 2Q86B 3IGAA 3DX6A 1IM9B 4OFKA 1S7VA 3E0GA 1EEZB 3U48A 5ANMA 4YPGA 5F9WB 2EEAA 5C0FA 2P1YA 2CDFB 4KK8D 5ICXA 2AEPH 2HH0H 4ZUTB 2F8OA 3T0AA 2FLBT 5KJRL 5KSUA 3BQUC 2O26U 4XC1L 1D7FA 1MREL 3GMNB 4BQ8A 4QNPE 4LVEA 5B4MC 4DEPC 4NQCE 3RL2B 3WNMA 4PJBB 4MXWH 1KFAH 3DTXB 4PJFB 1WCBB 1A1MA 3WFCL 3JVGC 1JZ2A 2XG4A 5DFWH 1OAQL 1V7MH 1YNKL 3X14B 1CU4L 4JJHA 1FBIH 2ZSWB 5ADOH 3RJDA 2HMID 3OGOE 1CGTA 3L3HB 4YHZH 1BAFH 3QUKB 2AJ3A 3V0WL 4EBQH 3UEZA 4KDWA 25C8L 4WDIB 1JNNL 1U2HA 3G9AB 4GAYB 1WWAX 1X5KA 1KJVA 5FA3A 2HKFL 4XZUA 5DRNA 1G7JB 1S7TB 2P8MA 2YUXA 3QDMA 1W0VB 5K9JL 1C5CL 2AKRA 1MREH 4UI2A 4XNQA 2N1KA 3OXSA 5DMGD 4AL8H 5J56B 4J6RL 2ITCB 3ULSA 5KVFL 4K7PY 4MAUH 5CKGA 2ADGA 3BX7C 4ZG1A 1QHPA 4Z7UB 5EU5A 1IKNC 5IQ7L 2G2RB 2ZUVA 5DK2A 3R8BB 3EJYD 3GRWH 4MCYA 4CU7A 4POUB 3VFOA 4MJID 3T8XA 1GC1C 1R5IA 1HEZB 3VXRA 3RTQB 3BKJH 1R3HB 3WUZA 5JQ6L 1RK0A 4JM2C 3WE6A 3LEYL 3AGVA 4ZODA 4BSVB 5KAQF 3VWKC 1CN4A 4XCYA 1SBSH 4F80A 1RI8A 5IHZB 1J11A 1IM3B 5IMKA 5I1AB 5IGXH 2YXFA 3QUXA 2I07A 3UO1L 4PJFE 1BZQK 3VWKD 3MGOB 1I1AD 4ALAL 1J05A 4ZFFA 1NFDE 1X5GA 4OGAD 4AENA 3QEUA 5E4EB 2WM0A 4M4PA 4D0DB 5CJOH 5J13C 3BGFB 1DR9A 3WJJC 4GXVH 1N26A 2DLIA 1JGLH 4KAQH 2YZ1A 3BFOA 2AXGA 2YWYA 2DLHA 1EPFA 3D85A 2E5EA 2NY1D 3EYUH 4Z0XB 4ETYA 5I1DB 4OCSL 1KIPA 2ZCHL 3ZKXB 4F33B 1V3LA 4LKCA 4PGDB 3D9AH 4FFWC 2FDBP 1BFOB 5GGTA 4WW2C 2HT2C 3S4SB 3NFSH 4OGYL 3O6LL 3RX8A 1A3RH 3MFGB 2VZOA 1FYTD 4E41E 1ZK9A 5J6HB 3CZFB 2B0SL 1VESA 2WBKA 2R29L 1H8OA 2ZCLH 1CD8A 2X1OA 3ARBB 4WFGD 3DSFL 2RCSL 4OQTL 3HN3A 3NA9H 2ERJB 2KZWA 4WO4C 4EDWL 4HUVB 2APVA 2UV3A 4OI9A 1PQZA 1WSST 5J7CC 3TVMD 5JO5A 3VFTB 5HVGB 3ILPA 3P0VL 3HLAA 2I60L 3HC0A 3TYGH 4U1KB 4X5WB 1TTUA 4HS3B 1OB1B 4DUXA 2Z31B 3RQ3A 4TTDD 1NCTA 1XF5A 1FC1A 1P7QB 1G7LA 5D7SH 1JPGB 3RWDA 3B9VA 5D71H 2MFNA 4PB0L 4YHPA 4FTVA 1Q9LA 1R24A 1D9KA 3LN9A 3QUXD 4NQVB 5T3XH 4QRRE 1QNZH 3NCJL 3SJVB 3GBLA 3QDJB 2H2PD 3V2AR 5SWZE 4HFUH 5DO2C 3B5GA 4LF3B 1HYSD 2VLME 1BBJA 2MJWA 4XP9H 5FAAA 3P4NA 3BQUA 1U8LA 2GCYA 2ZG3A 4YFEA 5EN2B 1RUKL 3IFPA 3REWA 1QO3B 5FCSH 4ZXBB 3MNZA 1KT2A 5F3BB 2E7BA 3UBXI 5AYUH 5GRVL 2J6EA 4GAJH 5ACMA 5GRUH 3T09A 1HWHB 5E6ZA 2OTPA 1QFPA 4M93B 3MLPA 1OCWL 5BRZE 3KVQA 2V5RA 3UYRH 4PRAB 4QRTB 5D93C 2HLAB 5M7QA 3TN0B 1Q94B 1O7SA 1D5IH 1MHEB 3SQOH 3BPLC 1EHAA 3WO4C 3VU2A 4YX2H 3PIQB 1PKQE 2AXFB 5ESQB 4PPTA 1TIUA 5FECB 4FRWA 5HDQL 4WUUA 1WBYA 4NC1E 4OUUA 1KULA 4Q58C 2FWOB 3LN5B 3RVWC 3TM6A 3KG5A 4JKPH 4PTTA 2V9RA 4NZRL 2VWEE 4NBYB 3IDJA 1OWRM 1L9MA 1M71B 2XWBA 3NMEA 4YHLH 4Z7WB 4LHUG 4BJLA 2BRRL 2YUVA 3PDOA 2KBGA 3S96B 5C0NC 4GW4A 3HG1B 1J0ZA 2BK8A 5IBUG 1CD9B 1GC1L 3D39B 1WBZA 1IAKB 3L7EA 1SY6L 5DQDL 3UTOA 2HAZA 4G80A 3BXNB 4WV1A 5SV4A 3U9UB 1NGWB 4AM0B 5HVWA 4YHMH 1G1YA 4FQCH 4AZ8A 3VRJB 1NGPH 1SM3L 3H9HA 3VFUA 4G6JL 2BNRE 2GYSA 4NQCD 5FUCE 1KLGA 5J6GA 3DI3B 4JKMA 4X0KA 1DE4A 2WSKA 3UXFA 1RZKC 4HZLA 2A74A 2ZG2A 4H5SA 5I2IB 4FQLH 4MQSB 4DGVH 1GPOL 2YKLL 4JFFA 2CDGA 1N64H 4YDKL 4LPCA 5TQ2H 4R7NA 5LQBH 3JV6A 1FVCB 1HE7A 5KS9F 3IFOB 1CXLA 4LLWB 2DM3A 1I75A 5IOPB 1MY5A 3BYYA 3M17A 1KYOK 3U7WL 2HWZL 3NPSB 3K8KA 2Y6SC 5SX5K 4JQIL 3IVKA 3CAFA 3GSVB 1GJIA 5FGBA 2UZXB 3GIZH 4DUVA 2H2SD 1XGUA 3RL2A 3U7YH 3LKNA 1OY3B 2E7MA 5GJSL 5IMOB 1U58A 2AJYL 1BLNA 2VDML 4Z95L 4CAGA 1NAML 1OAZL 1XCQB 3GJFA 2DTSA 3VA2C 3HAEA 2ZSWA 5F7HA 3PIQA 1JFQH 1SHMA 3BMVA 3MNWA 4BH8B 1CTOA 4NN5B 4E42A 4RFOL 4UDTB 5IW6B 3PUCA 1U0QA 4QXGH 2IFFL 1GCFA 3ARFC 4L3ED 1TFHA 3QQ3B 1A3QA 1LO3L 3GSQA 4F7EB 5DHYB 3ZKMC 1LVEA 4YXLH 3RWHA 3UPRB 1NAMB 5C0BD 3LOWA 3DGGB 1F3JA 3ARFD 5D7IA 4PR5B 5T3ZL 4EDXB 2CKNA 5GGQL 1EERB 1RIUL 4MJ6A 2AABH 4P59H 2FX7L 2YMXL 5CP7B 1KIRA 4FQIL 3C6LA 3G6JA 4XVUC 5AYUL 3QHFH 4YQXL 3T0EC 3VXSD 3VXUE 5BV7B 1K3ZA 1A6TA 3O3UN 5EU5B 4YO0A 1TENA 5DDHA 3VRJA 3QQNA 4MHHI 4R3SA 1C12A 2I26N 4OM0L 1ZEAH 4M7ZB 4XPAH 5I1LA 1TCRA 4LASL 2FR4B 1ZGLB 1IEBB 4WFED 2IWGA 5EIIB 4DVBB 2C9AA 3WFDL 5F9OL 3DI2B 4NN5C 1PVHA 2OJEA 5C8JA 3X12B 2X89D 3MV9B 3VRLE 2AK4B 5K33A 4D9RD 5AYQA 2V2TA 3LPWA 2IPTL 1A6WL 1HK6A 1KJ2B 3MYZA 5IWLC 5JA8B 1KB5H 3GSRB 4WEUD 5HYQA 2C3VA 4H8WC 3W5NA 4M61A 1U8QB 4HX1B 3MUY1 5SX4H 4OM1L 3RNKA 3AM8C 1BVZA 1E6OH 3IJHB 1EBPA 3HPLA 3RI5K 1UCTA 5MEPA 1RUQL 3BW9B 4Y2DC 1WUNT 3RWCB 2GJ6D 5GRYA 4PLKD 5GGUA 4LKCB 5C08D 1MFBH 2QQQA 1OLLA 5MENB 3FB5A 4J8RA 1CDGA 3N9GH 4MD5A 5DFVD 2XZAH 2VXTL 1SEBA 4L9LC 5D1ZC 5HGHB 4K3DH 4K3HA 3LEXB 1KXTB 3F7PC 3CZFA 2L7JA 3IU3B 4PJAB 3RWIB 4JCMA 5AWNL 4QXTA 3P9LA 1BF2A 1XF4B 1T7VA 5EU6E 2F5BL 2A2QT 3FB6A 2DKUA 3TF7C 1GH7A 3JWDL 2IGFH 5BRZD 4I18C 5IVXE 5KSBA 2B1AH 1KG0B 1ZVYA 4PJBF 3MRJB 3CLEH 5IMLA 4Z0BH 2V6HA 2AV7B 3WHXB 1JMXA 1X7QB 5FYKH 3ULUE 3LIZH 5C0GB 1FZJA 1QZ1A 1FYTB 3QO1A 5JW3L 4R3SB 3TCLA 3G5VB 1CBVL 4I77H 4ODXB 1S9XA 3MROB 5K59E 4IJ3C 4KUZH 3SGKA 4P99A 5C09A 1VCAA 5GQBA 4P49A 1WWBX 2GIYA 2R0WL 3KLAA 4PGJA 1W72L 2BSED 2DIBA 2ZKHL 5TE4L 1QP1A 4ZSOA 3K2UL 1MI5A 3VD9A 1PKQA 2VL5A 4HJGB 5TH2A 25C8H 3HG1D 3FT2A 4GT7A 1E4WH 4ZPTB 1S9KC 4LCIH 4PB9L 3CFJA 4KGLA 4OLZH 1IAMA 3IFPB 1I9IL 4JN2A 2NY1C 1JYXA 3I3DA 4JPVH 4YHOH 3FZUD 5T1KB 1IQWH 4XNMA 1HEZA 4UU9A 3PWJA 2B5IB 3T0DA 3VFMB 1MJJB 4NRZA 4XHJD 1KLFA 4M6NL 1IKFL 1CZ8L 4JDTH 4HKZA 3WDIA 5GJTL 2XZQL 4LBEA 1U8IA 5I8KL 1U2CA 5I1EL 4E41D 2VE6A 3NZ8A 4D2NA 4ZAKB 1PZUB 4P4RB 3QDMD 5IHUL 1KJ2H 3HE7B 1MCFA 5BJTA 3WN5C 3QB7C 1NKRA 5I1IH 2EYRA 3AU1A 3GMOA 1P4LB 2GSGA 5CHNB 3REVA 1J87A 2X4PB 4YPJA 4U0QB 4K23L 5D72H 1ZA6A 3MOQA 3S36L 3P0GB 3SDYL 3TT3H 1XCTB 3CFCH 3NN8B 5I1GH 4H25B 4FQ1H 5DQ9B 1MFDH 3GJFK 1RY7B 2E6PA 1F4YL 3OR6B 1NAKH 3EJYC 4F58H 3CUPA 1T6WA 5T3ZE 3QDGB 5H2BA 1WEJL 5JOFA 3QUKA 2P49B 1K6QH 3LKQB 3IFLL 1JMZA 2ZOKA 3ZDZF 1RUML 1CGWA 2JELL 4MD0A 1N2RA 4QLRA 3T3PF 1S7WA 3WXVH 4NKOB 3Q6FB 4J3XA 4XVSH 2ZUTA 2IAND 1HHKB 3NGBB 1MHHB 4ZUWA 3SDCD 4CBPA 3EJZC 4BK5A 5DI8B 1SEQH 3U4AA 4KK9C 2DAVA 3QIUC 4QRPD 1CICC 2XRAL 3SDCC 4HQQH 4MA8H 5KSBB 4UV7L 1N0XH 1ZLVH 1QA9B 1BOGB 3AC0A 3DO7A 2DJUA 3CXDL 1VHPA 2WINA 5IK3A 1CG9A 4N0UE 2DQUH 4Z9KB 5DUPL 3DX8A 1FVEB 2VQTA 3QFDA 1JI2A 1AY1H 4EUPG 1E28A 2P5WA 3H3KA 4V1DA 3MCLL 3WD5L 3LVEA 3G5VA 2JIXA 1MCSA 3G04B 1TVHA 2C1PB 2WMPA 4JY6A 5CP3H 4L8DA 3LMJH 4YFDB 5FIEA 2I9TB 2VISB 4Y4KC 4YBQD 2DWDB 5I15H 3SE4C 4GOSA 2D31A 1PG7X 1GHFL 5HYIA 4EN3C 2B1AL 1XGYH 1BBJB 2QHLA 5F6HJ 5LWYH 4Z78B 2P48B 4NP4H 5D9SA 4HW6A 2BJMH 3S34L 5IKCA 3BN9C 4MZ2A 1I1FA 1YEDA 2R0ZH 4NN6B 1EV2E 2FD6H 1J8KA 2IAMD 1KTDA 1EEZA 4CMMB 2IPKA 1BZ7A 1A1OA 2X9WA 4XP1L 3FJTA 5GS2H 3SGJA 2OP4H 2FO1A 3WL9B 1E27A 5I76A 4OFYD 4QRTA 1IMHC 4N5EC 4TNVF 5EOQH 5CBEA 4EXKA 4NKIL 1J8HB 3QQ4B 4RGOH 5FKAA 3S5LG 4U1HB 3QUXC 5GXBB 4N5ED 1AKJD 4NKDB 3QQ9D 2BNQE 5BXFA 2X9YA 3TBWA 3BZFB 3I3EA 2V9TA 3LKRB 1CGYA 4ZUTA 5HHOE 3SDDA 5T33L 3F7RA 4XVJL 5KTEL 1C8PA 4JEGB 2V5MA 3HE6C 4QTIH 2AJUL 4L4VE 1ADQA 5I1LB 1SMAA 5D2NE 4G6MH 2UVFA 1FORH 5L6YL 4J12A 2P7TA 3MREA 4N8PA 2DLFH 1RSFA 4HIEB 4TNWF 3QEGH 1HHGB 4J3UA 5CSBA 3VGDA 2C7UA 3X11A 1JK8B 2YPVH 3D69A 3H7LA 4R97C 3FRPA 2EZ0D 5FO8B 4PTUA 5FUOH 2C1PA 1EGJA 3UDWC 5DLMH 4I2XE 3OZ9H 5MENE 2X4OB 3BUYB 2NY6D 4JHBA 4KQ4L 4OFPA 4DVRL 3PHQB 3OTTA 3RIAK 4DGVL 3N1GC 3I50H 4GXUM 1NBVH 4M1CC 2BVUA 1A7BA 1KJMA 5DEFB 3TIEB 5TFSL 2APXA 3BMWA 3IB4A 5AAMA 4ZNCD 3SDXA 5D93B 4B50A 3RWGA 4DAGH 2AK4D 2R1YA 2ZUUA 3RDTD 3ARRA 1J1XL 5CUSL 2NXZB 2GFBB 1AD0A 1FO0H 2O5XH 4MJIE 4YDLC 4M93C 4K7PL 5MENA 4UNTA 2YPLD 1KEMH 4FQLL 4U3CA 1H3TA 2XQBL 7FABH 2Q87A 3RJQB 1VB9A 4FFZL 3SY0B 3VFOB 4PJGA 1SYSA 3PWLB 4KMQA 3RAJL 2DLTA 3NZHL 3MV9E 3W9DA 3RZCA 1MH5A 4RNRA 4QT5B 5HDBE 3WNLA 4FQXA 3HB3C 3E6FB 3FRUA 3T0EA 2XRAH 2HFGL 5IMOA 4JFQB 3B43A 2VLJE 1TMCB 3HAEB 4NDMB 3M07A 2YA0A 3GHBL 4PJDF 4HS8H 1QRKA 4C56E 3T04D 2ZUYA 3O2DL 1FO0B 1I85C 4LQ1A 5J12C 1XH3B 2BVOA 3CH1B 4RFNC 1I1AB 3W9EB 4YBLB 3ARSA 5F7DB 2CGRL 2W9EH 4PTTB 3T1WA 1W8NA 2R4SH 3TLRA 2BRQA 2PETA 4BQBA 2WIIA 1KIPB 1ZXQA 2UVEA 3FQNB 3MC0A 5CLTA 1HH9A 3ELAT 5AG9A 2OR9H 1F4AA 3WHE1 3OKMA 3CFCL 4F7TA 3BYTA 1BGXH 2YC1A 2Z8VC 5GGRA 4QXGL 4P5KA 2H45A 5T1DH 2BSRA 5DD1L 1UWEL 5J11B 4X6BB 2GSIB 5CJ5A 2NY5C 2LTQC 2OM5A 3A6CH 3V4PL 3WV0A 4APQC 4L9LA 2DTML 5D1ZA 1HQRA 4P23D 3HS0B 4LPVA 4QCIB 4YWGL 1OSPL 2X1QA 5EO9B 3FO1B 1KACB 4RMSA 4NRZB 1JL8A 2A74B 4XXDB 4H5SB 4LKXA 1IZJA 4S10A 1SJEB 4TULH 1RUKH 4HIEA 1ADQH 4WHCA 4I0CC 3VFPA 3GMPB 4NNPL 5C7XH 1J0KA 4K9EL 4QHNA 2EDDA 4NZTL 1HDMB 5ISZB 4E5XB 2JB5L 5T1MB 4GKSB 4X99A 5E56A 2ZUXA 1KCRH 1HQ4A 1JGEA 3QFJD 1FDLL 2GI7A 3I84A 4QGTA 4NZUL 1R24B 3GM8A 2A0LD 4O58H 4JE4B 1QSEA 3OR7B 4JGUA 4LSVH 3HKFA 3EO1B 1KLUA 4ZFOB 4TTGA 1E0OB 1H3XA 3QSKB 3I85A 4WFEE 3IU4H 1A21A 3TIEA 2FHBA 4Y16B 1CFQB 1UM5H 4N68A 4PRDB 4XXCC 2CQVA 3DRTB 5FYLH 5I15L 2VKWA 4ELME 5ERWB 2H41A 1OP5H 3MA7A 3TBTA 5HDQH 1HSBA 4M7KH 3MRBB 2IH1A 2NY7H 2FBOJ 5D7LA 3U46A 2X4QA 1RUAL 3L95B 3S37L 3D5OF 3JTTB 2R69L 3DV4B 1KIQB 1JTPA 1DANU 1T7WA 1S9VB 2VZUA 1RIHH 5ESQA 4AMKH 3MLZH 4LLVA 5A1AA 2C5DC 5E2UH 2BNQA 3HG1E 2J8OA 3NPZB 3QUML 5DMKA 3ES6A 4BUHA 1AO7B 3G5YB 3O3DB 3WLWC 5F96H 2H26B 1Q94A 3CFDB 3ECBA 1LK3L 2P43B 4O9HH 3E3QC 5DUBA 2X70A 1HKFA 3MZTA 1RUPH 2R2BB 4F7TB 2G60L 1E4XH 3HRPA 4OKVA 4OLYL 4WEBH 4WI7A 4LHQB 1X7QA 4OUUB 2NX5B 3C8KA 4XHQA 5JR1L 3S7GA 3MNVA 3T77B 1A47A 5DTFA 2VUOA 3QJFA 3RKDC 5F7DA 5ESVA 3E2HB 3HI6L 5DSCA 3VD4A 3W0WD 2XWBB 3QULA 1DEDA 1OAXL 4PJIE 3NCYP 3SE8L 4L29A 4YDIH 4Z8FL 3WN5A 3B6SA 3ULUF 3PE9A 1MWAH 3M1BA 2RHEA 1KSRA 3FT4B 4HFWB 2AEPL 2PUQT 2V7NB 5IBUB 1Q9OA 5KBNC 2VXVL 2BHYA 3C09C 1YEHL 1RHHB 2EDQA 4MAYB 5D7IE 5SX5H 4YX2L 1DBBH 1DQMH 2EH7H 2OZ4L 2NMSA 5CD5C 1P4IH 4G3YL 5DD5L 2OQJB 4XCEB 1BFVL 4YJZL 4JKPL 3STZB 5CGTA 5BZWB 3MRCB 4MA7L 4LU5L 1QSFA 1C5CH 3SBWA 1NC4A 3SO3B 5F3HA 3V0AC 5E94A 2PXYA 1BEYL 2HKFH 4P2RA 4OGAC 4I3RL 4Y4FD 3L95A 4Q9QH 1U95A 1AHWA 4QXUL 4ZS7H 1ZLSL 1F97A 1ZT1A 4YHYB 3QCVH 3TPUA 4NZJA 4PGZA 1REIA 1MFDL 1ZA6B 4ZS6C 1YC8A 3L3JA 4NHUA 5HY9A 3X17A 1M05A 2WUCL 3TH3T 1QLRA 2GTWB 5JTWA 3C5JA 1B2WH 4FFWD 4R4BB 3QWOB 1T4KB 3MV7A 3B9KC 4LARH 1GSMA 3RWJA 3FQUB 1L7TL 1FNGA 4UDUB 4JFDB 3G6JF 2XQYK 3AS3A 3LV3A 1MLCB 4KWUA 1EHLH 4XWOD 2DQGL 5IGXL 2FECL 1J5OL 5LGJB 3PL6A 5EZOL 5TQ2L 3G9VA 3P4MB 2H6PB 1SEQL 3P30H 4RFEA 1J0JA 1L7IH 2W1NA 3MROA 3I3BA 2CIIB 4WUKH 4MWFB 3R1GH 1LEIB 4Y5XC 2VC2L 1J1OH 4ZO8A 2XZZA 3PWVA 5IB2A 3DUHA 1Z2KA 5DUML 2BMKB 5DA0B 4MGXA 4N8CL 3C60C 4PJ5A 1LP9F 3QXTA 5KW9L 4B41A 2QR0A 3BH8A 1NCWL 5BCAA 1RHFA 2IAMC 1PFCA 4ELMA 4LEXH 4TTDC 1L7TH 1AR1D 1CFBA 2NY2C 2BCKA 4LVOC 3QUYC 4L4TD 3WXVL 3WUWG 4CN6A 3QFJA 2KUTA 4R2GB 4P3CL 5E9DB 4PRIB 4JN2B 4LCYB 1ONQB 3QI9A 1FP5A 2RJMA 4XP6H 1NC4D 1PY4A 2VH5H 2A77L 4G8GA 2A6IB 2W0KA 3S35X 5CINL 3PV6A 4O2CA 4QRRD 2EDFA 2FHFA 3DYMA 2YSSA 5CCKH 5L0QB 4KAQL 1H0DA 1UJ3B 3M1BB 4RX4D 2X4UA 3VJ6B 3I6KA 3MPCA 1BD2E 1X5YA 1KPRA 1K4CB 3DIFB 4S1DD 4F9PA 1FZMA 3T2NH 3SGEH 2PYED 1CGSL 5DD6B 4NQED 4H0HB 5DXWA 4JPKL 1X44A 2HT3C 3ULUL 1FC2D 4MD5B 5B38B 2X4TB 5B8CB 1FNLA 3PV7A 3L6FB 4K3EL 4U1IB 3RVVD 3JV4A 5E08H 3QXAB 4UOJA 1BJ8A 4P2CG 2EZ0C 1JGUL 1LEGA 4YK4C 5GZOC 2OTWB 4PJBA 5BS0D 5JW5B 4Q74A 1A7PH 2F53A 3OJDB 2VQ1B 4UMGA 3OAYH 3WSQL 2HKHH 1MSPA 1XGQB 4GUPA 1CGXA 2HFFB 1AD9A 4FOMA 4DN3L 2AV7A 3WHXA 1TZGH 5DJ2B 1N5YL 1GZQA 5E8NB 2NY2B 3VH8B 2DQIH 4JQXC 3SOBH 2Z93A 5HHQB 1BJ1H 3FB6B 2MTPA 4OF7A 1RJCA 4OCXH 5GS0H 1G7JA 4ZFGH 3O0RL 4U3HA 5MI0B 1PYWB 1JGUH 4KTDH 2CLRB 4PJCA 1S7QA 3MV8D 1CL7H 1OAKH 1ZHKB 3DROA 4Y5XB 5GGSA 2VDNH 1M1SA 1DQLH 3HB3D 1F11A 5E6YA 4GLRI 1KYOJ 5C0ND 2CK2A 3E6HA 1A7OH 5HI5C 1OSZA 4P23B 1LE9A 4NO0B 4X9HA 1QKZL 5JW4M 1I9RL 4S1SH 1RZFL 1IKFH 1HXMA 5CEZH 3NIGE 1UZ8B 1EVTC 3W11D 5E70A 1FNEA 2DLFL 4JJ5A 4I3SH 4NGHH 1NCAH 5KVDH 3PQYB 1AQKL 1UQSB 1PEZA 2IBGA 4X83A 5EU4B 1EAJA 4Y4HC 1NUFA 3RIAF 1X4ZA 3IDMB 1S78C 4O2FA 1ZANL 3WJJA 3T3ME 1FL5A 1ZE3C 4Y88A 3EFFB 2C3HA 3RUGB 2CLZB 2ZSVB 4Y8AA 5B3JE 5C0RH 2HN7B 3O3BA 3HAEH 3GO1L 1RK0B 4OIIL 5CZVH 3GJFH 4FQJH 3RTQA 2CKBH 4QY8A 4RAVB 1MH5B 5T1KD 1Q0YL 1SM3H 2R2HB 4JRXA 2MQCA 4X4YB 1JF5A 4JB9H 5DJZA 4OV5B 4L1DA 1DL7L 5D1QC 4H25A 1A64A 3VFGL 5FUZH 1GGTA 2WV3A 2Z35A 3RWEA 4APQD 5JDSB 3HNVL 5GGVL 4O2EA 1S5IL 4F9LC 2NW3B 4M1CD 1G7QA 3AU1B 3GMOB 4IRJD 3QEUB 5FO9A 3U36A 4RZCB 3P73B 2IMNA 2JKXA 2WK2A 2EH8H 5E03A 2DOCA 3QIWB 3RDTA 4NZDA 1WAAA 3IAGC 2MHAB 5IHZA 1JP5A 1RULH 1FJ1B 3DGGA 4PGEA 5I75C 3K81A 4Q9CA 5BRZA 5ILTH 4TQEL 3R8QA 4BUGA 1K8IA 4PG9B 5FYKD 2B4CC 1CGSH 3DVGB 3A6CL 2VR4A 2YKLH 1Q9KB 1XF1A 1NBYA 2BFVL 4RGNC 4MSWB 3L3KB 4JFXB 5KSAC 1VFBA 3OX8A 1TNNA 5BVPH 5A43C 3BI9X 1H5BC 3O8XA 5T3ZD 3QCTL 3OKKA 4P0DA 4PUBH 4XI5D 1GHFH 3IT8D 3DJ9A 3G6DH 1UT9A 3GSXB 1ZGLA 4KZEL 1NLDL 5I74B 1T0MA 4H0GA 1I3RB 4XCNA 5E8OB 4DZBB 1R5VB 3G5ZB 4NPYB 3NFNB 4MDIB 1LO5B 3SDXB 3ZTJH 5F3HB 1NEZA 5KS9A 5FCUL 4OGXL 4R0LB 2A83B 1UH2A 5A3IC 5KSVB 4G6FB 4LHUD 1LGVA 2ZUSA 2BVEA 1IM9D 1BQHA 2PCPB 3QIBD 4NZUH 5B3NA 2CLZA 1K6QL 2Q7YA 1AXTL 3FO2B 3MYJB 3D2UB 2OCFD 4NQDD 5IV2B 2ITDA 3TNMA 2DLEA 5DK2B 1TPXC 4X7TA 1TJHL 1R0AL 5J1SC 4JFYB 3HC4H 5HYSG 4AEHL 3CDYA 3VG9B 3F7YB 4KMLB 3I6GA 4I5BA 5B8CC 3QRGL 5EU4A 4IRJA 3IS0X 2PO6B 3VDBA 1SVZA 1YJDH 2VB5A 5T3ZH 3W39B 2J6EH 1OB1A 4IMLB 4X6DB 3TJHD 4E41A 1YNLH 5INDA 1ZSDA 1DLFL 4EI6A 3PDDA 4L4VB 2P8MB 1C1EH 5DUPH 3O4LB 1Y6KR 4PLKC 4HF5H 5KAQG 3LKRA 2ITCA 1GOHA 1WFNA 4NWTL 1NSNH 3QJHA 5IB2B 1MAML 1IE5A 4YDVB 1Y0LA 1N5AB 2QKIB 3CX5J 2AERT 2FB4H 3HC4L 4N0FB 3TN0A 2P42B 1YZZA 2GCYB 1ZHBB 3AY4C 2MSPA 2Y06L 4X6FA 3C9NB 3HZYB 6CGTA 3IXAA 5GSRA 4Y5YC 2G5BB 4PJXB 1B88A 1KTDB 1SJXA 4AT6A 1WBYB 4AEEA 1UADC 5JNYA 3QO1B 4OZIF 3BEWB 5JHLH 5DYOB 3RNQB 4ZO7A 1HOCB 4O51B 1FH5L 1BWWA 1H8NA 1MCIA 3NVQA 1MCJA 1RUPL 2IADA 2ZCLL 4KH2A 5FKAB 2EDHA 2DD8H 4HWZA 3L3IA 2FYYA 3BPNC 4GMSL 2EECA 4WWID 1YY8B 3CH8A 1ZTXL 5JXEC 1N6QH 4H88L 4XBPB 5I8EA 5HYJA 3D39A 5JO5B 3MODL 2WUBH 1ZA3A 1JIBA 2ZWLT 1VEOA 4H1LB 4WENB 5GIRB 3VCLA 3LAFA 3NCEB 4HIHB 1M71A 4KK5C 2GJ6E 3VI3E 3WUWA 1TCMA 1C7TA 4M1DH 4ZXBD 4HJJL 2HMIC 1GL4B 5C0IA 5JLZB 2DQCH 5F8RC 1QTYT 3GSOA 3MCKA 3ZE2E 5BZDA 3FCTA 1MNUL 4JFFB 1ZLWH 4S2SB 2AQ2A 1XGTB 4KKAC 4XP9L 1Q9WA 4PD4K 5IVXB 4RGMC 1U58B 4C57C 3FTGA 2EE6A 4XHJC 1C16B 3JWDC 3QEGL 1MJ7H 3HMXH 1FN4B 4O5LH 4EI6B 1K2DA 3TCXA 4HDIB 3MBXL 1NBQA 2R0LL 3GEWB 5GS2D 3VXNB 1N59B 3WFBH 3KNBA 3L3JB 2VL4A 2JCCB 3BWUC 5D8JH 1A14H 3VH8A 1BLNB 1N5AA 2QKIA 3R0MA 4I5BB 4JFZL 4OFYA 3LS5H 4WU7A 2ESVE 5DWUH 3KPOB 3VGHA 4XNYH 3UPRA 15C8H 2R8SH 4EI5C 4ZQKA 3BP4B 3OAUH 4WTZA 3C5ZC 4P2QA 4PGCB 3V4PH 1NFIA 3H42L 4L4VA 2ZOKB 5KANI 3QR2A 1T21A 1G9MC 3UYRL 1ZT4B 4NQXB 2HVJB 4XMPH 1IL1A 1UXSA 1P7QD 4UUJB 3PWUA 2RFXB 3DGCR 5EOCJ 4OCSH 2CMRL 2GK2A 2WQ8A 1G7MA 5K9JH 4L8CB 3TO4A 5CD5D 2ICCA 4RBPH 4IIQA 5F1NA 1FGNH 2ED9A 3U0WH 4XB8A 1FYHB 4LHUA 1MHPL 1I1AA 3P30L 1EHXA 4G43B 1YEGH 3V52H 4J23A 4KDVA 1AXSB 1TTGA 2FATH 3BKCH 5JXEA 4Z7VE 4Y4FC 5I18L 2ZUQC 5FYLD 1MRCH 1S3KL 4PR5A 4ZMAT 4G9FA 3GSNA 2HTLD 1D6EB 1S7UA 1T5XA 1I7ZA 1T22A 5D7KE 5K93A 2XPGB 4GKNB 3BHBB 2P8PA 1QFUH 4K55A 2YS4A 5IW1A 4BM7A 5M94B 4XP6L 1S9YA 4Z5RB 2QBWA 1QSFB 1U8OB 3EHBD 4EXPX 5IMMB 4MNQA 3VXQA 3U1SL 4OCLC 5D5MF 5IB1B 1IGML 1O5DT 5F72S 1IGTA 5CGYD 3THML 5BV7C 4H1LA 4KROC 2P5EE 1BGXL 4PYGA 3ZL4L 3UTSE 1P4BL 2J4WL 3LQZA 5DD0H 2FGWL 3O9WD 4CU6A 3FOLB 5ITFB 3ARGA 1FG2A 2FJGB 4R26L 2H3NB 4BZ2H 2DWEB 3MLXH 3Q5OA 3EYOB 2H26A 3EGSA 1B4RA 3QI9D 1VFOA 5DVKA 2CDEB 4RWYL 4HBCL 1EBAA 1XF3B 3ARFB 1JUFB 1OGAE 3EYSL 4KKCD 3KPQB 3KPPB 1JFQL 1BQLH 3T1FB 1AGDA 3CPLA 2QSCH 4N0YH 3RNKB 3SO5A 1B6DA 3QI9C 3FOMA 3CNKA 4KI1A 3ZE1E 5TDPB 2UUDH 1JZ4A 4DKFL 1J18A 3O4LD 4OLWH 3BZEA 1HYSC 4N8VA 1DQDH 2R1WA 5EB9A 2M8XA 2BDNH 3KHOA 2SEBA 5CIPB 1BVKB 2FL5A 2B4CH 4H20H 4HJ0C 5IEHA 3SEPA 3PABA 1A7PL 2N56A 3BKYH 1P1ZA 3GBNL 2LTQB 4AJ0A 4LVHB 4D0CB 4BZYA 4WW1B 5EBMB 1GGCL 3ULUD 3O2DA 5JIIA 3OL2A 5C07D 5IT2L 4ONGL 3MJ9A 4HFWA 5CJQH 2YD3A 5DTFB 3WDHA 1Y18B 4W68A 4WHTA 2E27H 2BC4B 3ULVE 2OJZH 1PZ5A 4IOFD 4GRLB 1DUZB 4U05A 3ECBB 4ZO9A 4RGOL 1JV5B 1KCSL 5H94A 4AK1A 5IP4A 4O58L 3F7YA 2EDNA 2Z92B 2DIJA 2EYSA 4JRWA 5D7LE 4ZYKB 1I9EA 3UTQB 3FT2B 4RFNB 4K3JL 5C3TA 4X8JB 3O2WL 2D0GA 2VDKH 1CGUA 2GFBA 3BGMB 1CFVL 3ARGD 4YHIA 2VXUH 5EOTB 2YPVL 4NQDB 1CXIA 2CSPA 2J1KA 4IRSA 3GSRA 1MJ8H 3WS6C 1AQKH 2P4AB 3VXUB 4F7PA 2IALA 5I1HH 1ZVHA 1LEKA 1LD9A 3MRKB 1I8MB 5IJKA 3VFGH 4PG2A 2ADJB 4LRIC 4HMDA 1YEEL 3K1DA 2H8PA 3V5KA 3MRLB 2OL3H 4X6CF 3L5WB 5TJWK 43C9A 1FGVL 3QNXA 3SCMC 4U6XA 5EZOH 4WGWB 3ZE0F 4UIKH 3HC3L 5C09E 1ES0B 3CU7A 1V7ML 4S1RL 4MNHA 1BF8A 5EH1A 1MIMH 1FBIL 2IC2A 4X9FA 5ADOL 1QQDA 1YEHH 1ZHNA 3HNVH 2QSTA 5FYJE 5DUMH 2EDYA 3V0WH 4HT1H 2KPNA 1RUQH 4DVBA 1YMMA 1KJVB 1G6RH 1WISA 1KOAA 4X4ZA 4WIQA 2NX5E 1BVKA 1UACL 2FL5B 5F88A 4F33A 3HZKA 1BP3B 3N1QC 4URTB 3MUGB 1BFVH 3IJYA 3ZHLA 4M6AA 1O7VA 3CUPB 2NXYC 5I17B 1BX2A 4HGWA 2AJSL 3L9RA 4NKOA 4U6VL 3MV9D 1OAYH 5K59F 4E9LA 1FL3B 1CXEA 1BEYH 3FFCE 1NBYB 4XNYL 4WWKD 2AGJL 5CUSH 1S78D 4GAFB 4F15C 3IJHA 4HWUA 4PS4L 2BOBA 4OSUL 4MDJA 2ZPKH 5TQ0H 5EU6B 1QBLL 4U1MB 5CIPH 3CFEA 4JFDA 3FQWB 4MQ7B 4KMTH 2YN3A 1R5WA 3HE6B 1U8HA 1CLYL 4HUMB 4G9FE 5L8JB 5B39G 4NHCH 3WNOA 5IK3B 2Z31A 1CBVH 2HJLB 2GITB 4GRLC 4RFEB 3UPAA 5B39B 5E9DA 4PRIA 4DTGL 5MEND 2E7HA 1IQDA 2YPLA 2I27N 1OAYL 4XPAL 2AK1L 3GHBH 3D0VA 1MHPH 3ARQA 4MLIA 4Z7UA 5C1MB 2EEDA 2FEDC 4YIQB 5TE4H 1OAQH 5I9QB 1J1PH 4HEME 2WAHA 3VH8G 4JR9L 4PJ5B 3IJSB 2ESVA 4ZTOH 1RZGB 4CDHA 4PRHB 4NJ9H 1WTGT 5HGBA 5ICYA 1AQDB 4XNUH 1KTKE 4M6NH 4C56A 2G5RA 3MRQA 2YPLE 3PXHA 1EFXB 3LN4A 2XWTB 1NGYB 4WU5B 1NJ9B 4NNXB 1K3IA 5C0CD 5EOTA 3M8OL 3QHZL 1NFIB 3K4AA 1DBJH 1CD1B 2JB5H 3DYPA 1TQBB 1KNOB 4M6OL 1AD9B 4WTZG 3S88L 2ICEA 1MPAH 1PKQB 4JM2A 3V4UL 1L6XA 2ADJA 3H3PH 2UZYB 4JDZA 1A6VH 4LSVL 5DVOA 4BQ9A 3FO0H 5DUBB 4JM2F 1OSPH 1RMFH 1J8HE 4Y19E 3V4VH 3QG6B 3QFJE 3L9RB 1NMAH 4ZFFB 1U93A 1K4DB 4JRXE 1DN2A 5F7MC 4XVTL 1MVUB 1NCDH 2A73B 4OLEA 4UB0H 4JDVA 4GBXD 4NNPH 2PN5A 5AUMB 3MNVB 3T77A 1XIWA 5A3ID 4BSJA 1VSCA 2FHCA 5F70A 4CJ1A 4HSQA 1HZHH 1QSZA 4YUEL 5EU6A 3ZT7A 4WI8A 1DTUA 2Z31D 1Q1JH 4CVZA 1KXQE 1I8KA 3KAAA 3QQ4A 3VFNA 3OKYA 4OZIB 5I1CL 2DQFA 1P7HL 2J5LB 1F42A 5F96L 1DLHA 1LO0H 4LGSB 1MCBA 5BJTB 3QT2A 2JJTC 3V0VA 1RIVH 5DJYA 2GKIA 1NGWA 3LIZL 4OF8A 5KOVC 2B2XH 4FQPA 1RU9L 1QEWA 3FL7A 5J89A 4Y4FB 2W38A 3ZT5A 3E6HB 1S7SB 3BEVB 5CILL 4KJYB 1NCDL 1N6QL 2F54D 5MEOB 3QYCA 1N4XL 3MODH 4HS3A 4DKEH 3GSUB 2HFEA 3S35L 4HWBL 2DD8L 3MREB 4LDOB 1U8KA 3MMEA 3C5SB 5JLZA 1WF5A 3HC0B 1RJLA 1J0IA 4MJIB 3QUMH 4LLMA 4XC1H 2PO6A 4D8PB 5E08L 5F71A 3TPKA 1AY1L 3IDYC 2DL9A 1NCCL 5D70H 3PGFL 1D6VL 4HS6B 3FQTB 3L3OA 2I5YL 4EUPH 3KPPA 4JM2D 1CL7L 3RIFK 2J8HA 4DWHA 3G6AB 2D7MA 2MCPH 5C9KA 3SKNB 4XBGB 3PQYA 4ZUUB 2UYLB 2H1PL 3C5ZB 4TRPH 5EA0L 4LSRH 2FWOA 1PQZB 4OLXH 1I1CA 1FVDA 4HWBH 1BZ7B 2SEBB 3K8LA 5IEHB 3TT1H 4X5LA 3PJSB 3K74B 3R06B 1IILE 2Q3ZA 1XR8A 1U3HD 3MXVL 1JZ7A 3VXOB 4YHLL 3MLTB 2NY1B 2OZ4H 1MLBA 3KPRE 1Q72L 1XF5B 5F9WC 1S5HA 1Z5LA 2HFTA 5AD0A 3ZDYE 4M5ZL 1NCNA 1JHKL 5DC9B 2VLRB 4ORGB 2D31B 3CMOH 4FQ1L 2APWA 1MEXL 3TBYB 4YHML 2IADB 4LCWD 2E9IA 5FV2A 2XKNA 3KPMA 2DRUA 4MLSA 1AR1C 4HT1L 1BFSA 1R5VA 5C86A 5JPNB 1SJVA 1NGXA 5IFAL 2XA8H 3VRIA 5KTEH 2PW2A 4I2XA 3L7FA 5EU7E 1S8DA 1D5BB 4QHNB 1CYGA 1AIFB 1VPOH 2DQGH 3MBED 3I75A 3VI4E 4F7CB 1BBDH 4R96A 1EO5A 5CJXA 3FQNA 1OVZA 5HDOA 1ACYL 3QUYD 5HHOB 4JLRB 2DKSA 1NFDF 3ZDZE 3SKMB 2E7LA 5I6XB 3MLWH 4X7TB 5C0AD 3U1SH 3U7WH 3BPLB 4U1JA 3HPJA 1S3KH 3FCTB 5E2JA 4OBSA 5ISZA 1DLHB 1RAMA 2YR3A 4F2MA 3GMPA 1Q9KA 5IB1A 4JFXA 1CLOH 4X6BA 3QA3B 5T5NF 3DRTA 1FN4A 3ULVL 2FGZA 1INEH 4HIJB 3DX7B 1BOYA 3BPNB 1OP9A 3OAZH 4Z7UF 3ARDC 4EI5D 4PRNA 4OQTH 4W6WB 3RUGF 3LRGA 1QFUL 5IM7B 4PFEA 5MI0C 3NFSL 5DJDB 2YUWA 2EEBA 2ILLA 1GC1H 4F7EA 1AE6H 5FK9B 1A3RL 2OK0L 2X41A 4M9OA 4RNRB 1CK0L 1OARH 2EDTA 3GMLB 5F6HI 3K2MC 2Y1VA 5T1MA 3W39A 2CO6B 3AREA 3GB7B 4CVXB 5K9KA 1NUDA 2B2XL 1DQQA 4FFZH 4NKQB 4XAWL 2WP3O 3V6FB 1UH3A 1WEJH 1ERNA 1LQSR 3VFUB 5HHXL 4UT7H 4ETQA 5I8CB 5GGTL 5DJ8A 1N3NA 1A4KB 1JNHB 2JTDA 4JFYA 3WIHH 2I60H 4I0PA 5FKPB 4FQIH 4L3CA 4TVPL 4UOW0 1DDHB 4HMEA 3TBYA 4Z7OE 3NBNA 3JVGA 3ZDYF 4FQ2H 3VXPA 4YGAB 1YECL 4PG2C 1R0AH 4OD2A 5L2KB 5FFLA 3VG0H 4OIBA 2NY3C 3TNNB 4L3EA 3NIFF 4NQSB 3AXLA 2V5YA 3QXDB 4UINH 4CN4A 4KRLB 2NW2B 2QSCL 4RAHA 3U9PH 3SY0A 4OV6F 1MLBB 1CR9H 4OD1L 5E7FA 1TPXB 3OKMB 2VDRL 1S5HB 1EEYB 3TV3L 1VACB 2W9EL 3NCBB 3SKOA 1RMFL 2FJHB 4U1NA 1QFWH 3RY5A 2LVCA 5C0AA 1M7XA 2L7UA 1CE6B 1YPZE 5IR1B 4FFVD 5GGTH 1NCBH 5EUOE 4XVTH 4D9RE 1VADB 3MO1A 2DBJA 4JJ5B 3SQOL 4HF5L 3LS4L 1FHGA 1HH6B 2ZUQB 4PJ7B 2FZ3B 3ZKXC 1IC5H 3C6LB 3DSNA 4XMLH 2DQEH 2IBZY 1Q72H 4MAYA 1MRFL 4U2ZA 3W11C 4PJ7F 5GIRA 4HJ0D 1T0NA 3SGEI 1KCUH 2PXYB 1OAKL 1IM9A 3DMMB 3R4DA 4GQPH 1RV6X 1QRNB 4UZGA 4KI5E 5DJ6A 4ZD3L 4HXBH 2IAMB 4OCNC 3KS0H 2V5TA 3MRCA 5LBSL 1MOEA 1Q0XL 4ODWA 5JW4R 2FYYB 4YH6A 2C1OB 4HZAA 3TWCL 5TE6H 2OJEB 2CR3A 2FEEI 3VFVB 1N5YH 1KELH 4FMKA 2YK1H 1HHJB 1K5NB 3NPSC 4QXWA 1L0YA 1EFXD 4Y8DC 2VXUL 4IOFC 2BOCB 2FX9H 3QIWC 3FTGB 4K3GA 2RGSA 5AEAA 3X14A 4I8DA 1CI5A 3T1FA 3U46B 1MCRA 3GKWL 1IC4L 2LU3A 4X6CB 4A6YA 2XN9E 5D1XA 5BOPA 4QOKD 1ULVA 1ZS8A 1KIQA 4HPYL 1P84J 5GS1B 4U7SA 5EIIA 2HLFD 2D7TL 4JZJC 5I0ZA 1MHCB 5ECJE 4IRJC 3X12A 3VGEA 2R23B 5D1QB 4QRSA 5E1HB 1JCKA 5AZEH 4G8GE 2XWJB 3TVMA 4D0BB 3EKCA 3SKJL 1U3HB 2ATPB 5EWIH 2C3VB 3CXHJ 4Z77B 1TVBB 3B2VH 3PNWA 4F3FA 1AGCA 2CJUL 5IF0A 1KGCE 2ID5A 3DXAA 1KF9B 4H0IA 5GGVH 3KPRD 4MA3A 5CLWA 4LCIL 3QFJB 4P46B 3DPBA 5MEPB 5GISL 5KSBE 3ABZA 2HFEB 4ERSH 3SO3C 3OF6D 3UTSA 3EAKA 4NQCB 3RWJB 3VXPB 5FB8B 5E8OA 4DZBA 4HK3N 3IF1A 5HYEA 1RZIB 3RA7H 3PWNB 3ZYOA 2VDLL 2P8PB 1GOFA 2LFGA 3EJZD 4ODBD 3NACH 2K1MA 3BP6B 3LPFA 3H0TB 3RL1B 4RQQB 5ESAB 3EDDA 5B39A 3VI3F 4Y4HB 3NIDE 4RBPK 4XRCB 1K4CA 4K71C 1IAOA 2Q20A 2NZIA 3GSNB 3TP4A 3H8NA 1JWUB 4X9IA 1YQVH 3IJSA 4PRHA 5DD5H 3W82A 2R0KH 3D39E 4ISVA 5KVFH 5B8CA 5ISZE 3DIFA 5B3JF 4ZUVA 1AR2A 3BIAX 2NY0B 5E2TL 2ZP0T 5FV1L 1IGTB 3OKNA 1NFDB 4GW5B 3W0WA 4RMTA 5L2KE 1MJUH 2YN5A 3ALXA 2UUDK 4PGDA 4KZEH 5E7BA 1G9NL 2A6KA 4ZAKA 4QXUH 1ZLSH 4PP1C 1MPAL 4Y2DD 3OAUL 4G8GB 4JFDD 3UO1H 4U1IA 1VFMA 1U41A 2FO4A 3ZZ1A 3BO8B 4X4ME 3UYOD 1T03L 5DZNA 3DUSA 4NUGH 4AIOA 1XGRA 3ZLQC 2R4SL 5GS0C 5J8OA 1G84A 5E6IB 2Y23A 4HKJA 4KTEL 3DXAD 1U8PB 4X7DC 3V6ZB 3GSWA 3ALPA 4UB0L 2YD8A 4JO2H 1NBZA 5E2TH 4ALAH 1IT9L 1P4LA 4YAQA 1JE6A 4L5FL 5HVHB 3KGRA 1HZHL 3S6CA 3LKOB 4ZNEA 2VNCA 3DURA 1P9MC 1Z0MA 3NN8A 4C56D 2X1WL 3P40A 2C4FT 2PYFB 4LQFL 5I8KH 5JA9A 1A6VL 4NQCA 3Q1SH 1AGBA 4NUGL 5C9JB 2ZCHH 2QSVA 4FXGA 1A1MB 3B2UC 1EUUA 4I18A 1T0PB 4P2OA 4WY7H 5SWZD 2J8UF 4BFEA 1I3VA 2RIKA 2VUYA 3PWPB 2BNUA 3TPUB 2BHUA 5LCVL 4JFFD 3BIKB 4U2YA 3NABH 3PNWB 1F4WH 2EO1A 5JR1H 5JOEA 1IT9H 3SBWC 4ELMF 2FECI 2J6EL 3TYGL 1K9TA 2K9UA 5IKCB 3IDNB 2FB4L 5KANG 3BKMH 5JXED 3BE1H 3QUYB 4OKDA 1T7XA 3MV7B 4BFIA 4YDIL 2D2OA 4X6DE 5JXAH 1QPPA 2EDXA 4X6EB 3MRKA 1FH5H 1I8MA 2R29H 1H5BB 1MLCA 2P5WD 4V1DD 3LQMA 4YDJA 1ZWIA 3MQIA 3RTQD 2YSSB 4K2UH 4MNQD 4XVSL 5JHLL 1CF8L 2VLLA 5HI4D 1Q9WB 3TEUA 2D4DA 43C9B 4FABH 4GFTB 3FAWA 2K7PA 3ARVA 1TJGH 3RWDB 3TBSA 1A6AA 1PG7H 2VDOH 3C60B 1CDIA 3EO9L 3S37X 1A7QL 1YEIL 3KXFB 5IBTL 4PJDE 3C87A 2ZKHH 1HSAB 4PJ9A 3VWKB 1AKJB 4PRPD 1F13A 4LNRA 1T3FA 3HCVB 3L5HA 4F8QA 1I9JH 2A6DA 1J7VR 4HHAA 4Q2ZB 4WUUD 1P5UA 3PP4H 3T2QA 32C2A 3DV6A 2VABA 1F3RB 4I48B 3PP3K 2I5YH 2DBLL 3KYNB 3MNZB 3TWCH 3P0YH 1JN6B 4M5ZH 3S5LA 4LSUL 2AGJH 3MUZ1 5E5UB 4OZGF 4M00A 1TVHB 1MVUA 2A73A 4QWWD 3KPNA 4Z7QE 3FN0L 4R4FH 2HT4C 1VFUA 1WWCA 4U0RC 1E27B 5I76B 2JJWA 3T2PA 1MNUH 1MCNA 1J12A 4NIKB 1YUHB 4C59B 3HI5L 3UP1A 1TITA 1VADA 3S3JA 4FXGB 4LCWE 1I8KB 4Z0XA 3U30B 3KLSA 2BNRD 2QEJA 4MVBC 1I9JL 3RGVD 1IQWL 4Q6YA 3BGAA 4Z8FH 4KQ4H 1PEWA 2CIKB 5KN5B 4RRPG 4WFHD 3ARBD 1EHLL 4PY8I 3A67H 4ZS6D 1VFBB 3OX8B 4OD3H 1G9NH 1EX0A 2Q8AH 4P2OC 2VXVH 2O61A 1L7IL 3STLB 3EDEA 2VDNL 1AXSA 1SY6H 1CICD 4JZJB 4JFZH 3R1GL 2QV2A 2LQRA 1BQHB 2PCPA 3CVHL 1MIML 1F6FB 5BS0A 4BFIB 2EE9A 3V6OC 1EK3A 3O9WB 4LKXB 3JSSA 1LO5A 1I7ZB 1T22B 4MQ7A 3TZVD 1GYAA 1DUYB 2EDRA 2QHRH 3CFIC 2W60B 1OM3L 1TTFA 3LKSB 4A6YH 2YXMA 3E6FA 1LK2B 2CMRH 2Q76A 3F12A 3P4OB 4P23C 3O45B 1XGQA 4GUPB 4KROD 3GK8L 3BIKA 5H8DA 5IWLA 4DGYH 3PL6D 1KPVB 1AGEB 3O8XB 3H6JA 2LABA 3P9MA 1FFQA 3MNWB 3F5WA 2XNAA 1QSEB 3C60D 3H3PL 3UTTE 5ENWA 1YEGL 3V52L 2CKBA 2JJUA 4Q6IB 3B8SA 5CGYC 3RWGB 5TDOA 4UILH 4PY7B 1FG9C 2NY2D 4TUOA 4JRXB 1B2WL 1OGTB 4JB9L 1RJYB 5MERA 5FUOL 3FRUB 3KR3L 4KDTA 3ULVH 4GRWE 1FFPB 2CDEA 3CVIL 2DN7A 3LZFL 4GH7B 4NN7B 3KYOA 5H37H 3C6LC 5CP3A 2YC1B 4HQQL 4MA8L 1DQJA 4LGPB 1T7YA 2NW3A 5L7XH 5EBWB 5IVZA 3GMMA 2CRYA 4DOHB 3GMQA 2IBBA 4YK4B 3WFCH 4X80H 1YECH 2ICEB 2J5LC 2Y07L 3KDMB 4TSBH 2IANB 4NO0D 4JFQA 3HRZA 5ALCL 2D9QB 2DM7A 3HAEG 3CU1A 3QQ9C 3LCYA 1F8TH 2OBGA 2NNAA 4Y16C 1MHEA 1CE1H 1JWMA 1R3IH 1F2QA 1A4JA 4E42B 2RB8A 4QRPB 3VMOA 2HA1A 3S96A 2HTKD 1D5MB 1NGXB 4NO3B 4FQ2L 1CDYA 2NX5A 3C8KB 3VRIB 1AHWC 1NMBL 1A7QH 1K8IB 3VW3L 2P46B 2B39A 1UCBH 4RWYH 4YPGB 2CLVB 3U4EA 5JNYB 5GSVA 1CXHA 4PGBA 2VTFA 3QHFL 3BPCA 2FIKB 1AFVL 4HC1H 3VFWA 2MOVA 3HNTH 3SOBL 3CDFA 3PP4L 5DGRA 1SJHA 3ROLB 2DQEL 1RIUH 4Z7WA 4W4OC 5TF0A 4X0KB 1DE4B 3TA3D 2HT3D 3WIHA 2NY6B 4KK9D 4N0YL 4A2MA 3AUVA 4EEEA 5IQ7H 3MR9A 1UC6A 4JVPA 4KVNL 4R2GC 2KQNA 1CFTA 4XVJH 5AUMA 3ZT6A 3OKLA 2WNGA 4APQB 3RNQA 4NQEB 3VW3H 4G6ML 5J11C 5T5NG 2E9JA 1MRFH 1A6PA 4G8EA 1GGBH 2PW1A 4J4PD 3FRPG 4PGEB 1HQ4B 5F7FA 1AFVH 3C5SA 4M7JL 3O9WA 1LEKB 2AQ1A 1JTOA 4Q7DA 4XBGA 2VKXA 1V3KA 4ZUUA 3U82B 3UJIL 4HC1A 1KB9J 1OGAB 3FFCB 4KKNA 3ILQC 3HR6A 1X6NA 4YNYB 3VFPB 4U6YB 4LASH 4PG9A 3ORJA 2AJUH 2FEEL 3P9LB 4IRZL 4XP5H 3SDAD 3S97C 2BDNL 2Q76B 3P4OA 5IVXA 3WS3B 5J1AA 4P9ML 1U95B 2BOCA 4FXKA 2ORBL 2ICWI 3FQTA 4HS6A 3MRRB 4HCRH 3KPOA 4D3CH 4K3JH 4YAQB 5ICZB 1HQRB 1DZBA 4Y19B 4MNQE 2IPTH 4QF1B 4D94A 3BN9D 4QHMA 5TE6L 5F7NC 3SGKC 1URLA 4KJQC 3O81A 3F6LA 4PJIA 5D7LD 2DJSA 1I1AC 4XPTL 1OLZA 5C09B 4N9OB 4K7PX 1FV1B 5CWSA 2XACC 3OWEA 1XCQA 3GJFB 4PLNC 3MJGX 2BRRH 3UTTA 5E2VH 1KV3A 4OJFL 3JUZA 3MLVH 5TDNB 4NOBA 3IKKA 3RVTC 5FF6A 4KHXH 4NCC2 1LO0L 2Y5TA 5TF1H 4JZOA 3HE7C 4OF6A 1F6LL 1HCVA 2EDOA 4D3CL 4GAGH 5J3HD 1DEEB 2VDKL 2X7LB 5DQDH 2XG5A 5A16A 3O3DA 1T2QH 1HNGA 1B4JL 1WC7B 5I71C 3EOTL 4Z6AT 1XIWD 1FGVH 5E8PB 3BEWA 1CGVA 1CLZL 1GAFL 4GS7B 2IGFL 4QTHA 2QR0B 4HIIA 3OG6B 4EDXA 4P5TA 1S7UB 1T5XB 3IDIA 4OCWL 5F7LB 1A1NB 5D5MB 1K8DA 3JWOH 3BDBA 5HHMB 4NO3A 4DFHA 4OJFH 5E8EB 4UQ3A 4QHUA 5EPMA 3MRGB 2YPLB 5I8OH 3CLEL 3I75B 3QJHB 5DMKB 2EC8A 3KWWB 4R97B 2IAMA 4RMWA 3SE4A 4MB4A 4QO1A 5EUOB 5GRJH 1E4XL 1S9YB 1SJHB 4GMSH 5CKAA 1LWRA 2ADFL 4FQJL 3BHBA 5GRVK 4DOHE 4LSRL 1H3WM 5TQ0L 1JJUA 1FG2B 4PJXA 4JG1L 3UBXG 5J1AB 3KPRA 3VXQB 2CUHA 5KVGH 1X5FA 1UM6L 1PDKA 2GAZB 8FABA 4WU5A 3EYOA 3DWTA 3TIDA 1AI1L 3RI5F 3HZVA 3UTSD 5ICZA 1KN4L 5CJBA 3RWFA 1DQQB 5I1KL 5DQJB 4JFPA 3O8XD 5IFAH 5IHUH 3MRHB 3DUSB 1JNHA 1D5IL 1WJ3A 3VG0L 4Z5RA 1G9MH 4G42A 1CTNA 3QIBC 2GTWA 2EIZA 2WBJD 3AREB 3GB7A 4CVXA 5K9KB 3BD4A 3MLWL 4TPRH 1XF3A 3MSPA 2EYRB 1KPUA 4S11A 1FNGB 4LLQB 3ZDXE 5DHVA 2GQHA 2IPUK 3C2SA 4N9GB 4RDQG 3ZSTA 2CDFA 5ICXB 4X6CE 1IEAA 4JFED 4X9GA 4PP2B 1FRGL 4PUBL 1MF2H 2UWEA 3NH7H 1UKSA 2CIIA 3SDYH 4KQ3L 1FFRA 4GBXC 1OTTC 2CR6A 4XBEH 1JV5A 1YMME 2A77H 4LSDA 5LGJA 3MRIA 4RAUA 4UIMA 4YC2B 4IHOB 2BZDA 4NQUA 1OPGH 2J88L 5FF6B 1NAKL 1EO8L 2QL1A 3QEQD 4JAMA 3CMGA 5F89A 4WEMB 5F9DC 5FYLL 1FYTA 2UZIL 2RQ8A 1MELA 2VLJA 5DI8A 5MEOA 3IFLH 5MEQA 3K1KC 1WC7A 3FO0L 3KJ6H 4CW1B 5LAXA 2YK1L 3KPTA 3FB7A 3RZWA 1HCFX 3F65A 1QG3A 4ZYKA 3HFMH 3IRZA 4WRLA 3K4ZA 4YR6B 4Y89A 1FSKB 3OJVC 2AJVL 3T0XA 1A2YA 1QYGH 4PGCA 4ZUVB 4WJ5A 4PJGE 1A6ZA 3QRGH 5IW1B 1PG7L 4JVWA 3PL6B 2FNBA 3Q2CA 2FATL 2P5ED 1V3MA 1MCEA 4KV5E 5I1AA 5IMKB 1VGEL 1S9WB 4OF3A 4G8FA 3CZJA 1B9ZA 4U1HA 4OLYH 1FZOB 1EEUA 2R0ZL 3BJ91 3KPLA 3WSQH 3U4BH 3TO2A 5H94B 3C5ZA 2HRPL 1AKJA 3DHMA 1JRHH 3VXRB 2AJYH 2E7LC 2DMKA 4OUOA 5EZLA 1FVDB 3W2DL 3RRQA 2ADIA 5F8QC 2Z4QA 2VAAA 1ZVSB 2EIZB 4NBXB 4HUWA 2BSSB 4Y1AE 2NY5H 2BVTA 5D7SL 3RVXC 3MBXH 3QZWG 4GKZB 1S7QB 4AEFA 3ARTA 1MWAL 4G8IA 3DURB 3U9PL 2IALB 4D9QE 4PJ8D 4RIRA 3BH9A 5D2LF 5F97E 2Y5EA 4YHNA 4JO3H 2NYYD 3LB6C 1GGYA 2EO9A 4XWOC 3I6KB 4P5TD 1QR1A 4GG6B 3RPKA 3TC9A 4HD9A 5E8NA 1RVFL 3QEQA 1YN7B 4LSUH 4YFLF 3LDBC 1XMWA 4X7FC 3RKPA 5H35B 1A8JH 1MRDL 5EOQL 2HFFA 4WW2A 3T4YB 4H88H 4WHYG 3IS1X 5KZCD 3CVHH 2H32B 3ZO0A 1FNFA 5DC4B 4EI5B 4X98B 4Y2OA 4LOUC 4PJHA 4JO4H 1SBBA 1U3ZA 3SQBA 1X5XA 2E27L 3FB7B 1LEGB 5E9DD 4PRID 3TFKD 2J8UA 3EYQC 5TGBA 4FTVB 1JZ8A 4HJJH 5CZVL 2ATPA 4HUVA 2V17L 5EC2B 3KPQA 5MP6H 1PLGL 1INQB 1GAFH 1GVIA 1AGDB 4ODVL