3QCUH

Crystal structure of the lt3015 antibody fab fragment in complex with lysophosphatidic acid (14:0)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
223
structure length
219
Chain Sequence
EVQLVQSGAEVKKPGESLKISCQAFGYGFINYLIEWIRQMPGQGLEWIGLINPGSDYTNYNENFKGQATLSADKSSSTAYLQWSSLKASDTAMYFCARRFGYYGSGNYFDYWGQGTMVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural characterization of lysophosphatidic Acid binding by a humanized monoclonal antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords LT3015 antibody Fab fragment, heavy chain
total genus 40
structure length 219
sequence length 223
chains with identical sequence I
ec nomenclature
pdb deposition date 2011-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qcuH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qcuH01
3KYMA 3S3JA 2OTUA 1FV1A 4DZ8B 4EIGB 1I1FA 2AK4E 3MRCB 1HHKA 4MNGB 2VJXA 2GQHA 3QEUB 3HS0A 3VWJB 4M8VA 4GXVH 4X6FB 5FO7A 1DN0B 4W81A 5E00A 2YD1A 1JYWA 43C9B 4EDWH 3G6DL 3AU1A 3S6CA 1FYHB 3TBVA 1NCAH 1E6OH 5ITFB 4CU7A 1JV5A 3EZJB 3OJVC 1J1XL 2FX7L 3AAZB 5ILTL 4HBCL 1CFVH 3CU7A 5EU4A 2IADA 2NY2D 4IEFB 4DN4H 3OXRB 4U1LA 4D2NA 4EEEA 2YZ1A 3NOIA 1GCFA 3MNZA 2YKLH 4EI5A 3EFFB 4Y89A 1WBYA 5BVPH 2XOTA 4PJAE 2Q8BH 3OKOB 3V79C 1Y0LA 1MIEL 1F58L 1QSEB 5IFJB 1FZOA 3PV7A 3VWJD 1CBVH 1WQVT 5JQ6L 4CN1A 1WIOA 1T2XA 1DUZB 1ONQB 4IRSC 1CDHA 3CSBA 3MJ9A 4QXGL 4I0PC 1OM3L 5IB5B 1K8DB 3QIWB 3E3QC 3QWOA 4E5XA 5I9QB 1CD9B 4U1JA 5C9JB 1D5BB 1IC5H 3RKDC 1JI2A 2EYSB 3CFIC 4M7ZC 4XH2B 5HBBA 4MNQE 3FRPA 5F7UA 4Z7WA 2GCYB 1FL3B 3DMMB 2EDBA 5EO0B 5MHSE 1T1XB 3SQOL 5TPWH 1A6VL 4JFDA 5FKAA 5HHOB 3RA7H 4MB3A 4KTEL 3WJLC 4XCEA 2JCCA 5DJXB 3BT2L 4K23H 2FO4A 5C07D 1NLDH 5IQ9A 4Y5YB 4WHYH 5ANMA 5BW7A 5IQ7L 4HCRH 4F37F 2NW2B 1E27B 2WK2A 4MAYC 5E8EA 3FFDB 2JB6A 1BGXL 3HZMB 4K3HA 5JPMA 3QI9D 1MFEL 2G9HA 3MLXL 1NEUA 3QDJB 3TV3L 4GW1A 2V9RA 4N0UE 3TWCL 3GBML 3VD9A 1MRCH 2VXSH 3KVQA 4H8WC 3CZFB 4MJ6A 3WYRA 2FLRT 3OJDA 4LNRA 2VDPL 1X7QA 4FXGA 2FGZA 1CK0L 3FB8A 1A7PH 3O2VH 1IC4H 4OCSL 3FQNB 1XH3A 3CXDL 1IGTA 2ZUYA 2JB5H 4OUOA 2A6KA 1CDCA 4WUKL 5IF0B 4RFNB 5L2KA 1VENA 2WWKO 3VG0L 3IFNH 3T0DA 5K59E 1KEGL 3GJFA 3B6SB 3CK0L 5T1DH 4NCC2 3KPRE 1FG2B 4MZ3A 3WFHB 3CSPA 1F3DH 1T5XB 3SDXB 4JG1H 2GYSA 3DROA 5F96L 1INQB 4KVCL 5F9WC 1NC2A 2DS4A 3L3DB 4LQFH 4MAYA 1TTFA 4KROB 2AXGB 1X7QB 5L0QB 3SDDA 1Z5LA 1OAQH 3BGAA 4EUPA 1G84A 3VRLF 4LSQH 4P59H 1CXLA 4HFUH 2P45B 4U1KA 4U6HB 4JY4A 2VDQH 3BH8A 3JUZA 1Q94B 4WEBL 5ILTH 4QRSB 5DQDH 5E6IB 5F7YC 2AXJA 3T77A 3MRFA 1K4CA 4JN1H 2EDFA 3UBXI 4OLEA 2PUQT 1YQ2A 2YK1L 3P77B 4PJ7E 3RU8L 4NRZB 2YKLL 2VO5A 4G3YH 4QHNA 2W0KA 1C7TA 2X4NA 2ZWLT 1TZHB 4JZNA 1AXIB 2DF3A 4L5FL 2JJVA 4N8VB 3SDAD 4U1HA 3TA3B 2H6PB 4KKBC 3RTQD 1A47A 1NC4B 3CMOL 5JW5B 1EHAA 3B9KC 4KVNH 3L3DA 4UOW1 4K3DL 5DQJB 5A2FA 5M7QA 1KLGA 3EFDH 4NO0D 4ERSL 2MOVA 3RVUC 1OP9A 5I8KH 1JPFA 1RHFA 3MRCA 4XAKE 3NAAL 4WHCA 2XN9A 4G8GE 5F7KC 1TLKA 5JO5B 5E6ID 2J88L 3WLWC 1T89C 3KPPA 5T1DL 3RUGE 3DPBA 1EVUA 3C5JB 4TUKH 4OZ4B 3QHFL 2I9LA 4KK8D 4RFOL 1I3VA 3MRJA 4YHLH 4N5ED 4G7YL 4YUEH 1F4YL 3MLPA 4Y4HB 3ILQC 2CJUH 4H25B 3OAUL 2R1XA 3P9LA 3RTQB 3ULVE 1CDBA 4WUUB 3NTCL 1YEJL 5TFSH 4X99B 1CFQB 3ZTJG 1P4BH 4APQA 4NO2B 1PLGL 1SM3L 3L1OH 3QCUL 3BISA 1M71B 4YAQA 1KLGB 1S5HA 2DQJL 4WTWA 4NKDB 1I9IH 2V9QA 3D39D 1CIDA 5D2NC 3FB5B 5FYLL 2A1WL 3SE3A 1UQSA 1ZANL 4JFDE 4OD3L 5CHNB 4BFIA 3EAKA 2EYRB 2X4SB 2ADGB 4MA1B 2EE6A 3CC5B 3U79A 4F7TB 5ICZA 2AV7A 4JPKL 5T5NF 3C08H 3WDIA 1REIA 3X3GH 1FCCA 4XCFL 3UTTE 2P8MB 4J3UA 1A21A 1T7VA 3GSUB 1NLBL 1GPOH 2HT2C 1LE9B 1EAPA 3CDCA 4S1QH 1JF1B 5J11B 1KYOJ 4OIBA 3UBXB 1QACA 1KJ3H 3D25B 3FOLB 5KSAD 3PE9A 1CXIA 2A9MH 4E41A 4UDUA 3TH3T 2X4NB 4AH2A 1DVFC 2XZZA 1FQ9C 5GSVB 4QRRD 4Z7UF 1HI6A 3CFKB 3EOBA 3IKCB 1IRAY 3FFDA 2K7PA 3QIWD 4OT1L 5IM7B 3S34H 3SGKC 3KS0H 3T2NL 3UJJH 3VD4A 1GGCH 4XP1H 3VFWB 5IT2L 4NUJB 3KXFD 1R0AL 4PGCA 3ESVF 4PJDB 4I3GA 5EU6A 3N1GC 2WLYA 4YK4B 1FC1A 3EDKA 5C0AE 2ZSWA 5KSVA 2QSQA 2VOTA 4WCYH 4MJ2A 2P44B 4PJCB 3WD5H 3RWFB 1ORSB 3CFJA 2PW1B 1OARL 2VZUA 4OD2A 1PG7H 1FSKB 3D25A 5B39A 5JHLH 1PKQB 2P8LA 3ES6B 4DQOL 1WZKA 2X1PA 3MLUH 3CFCL 3N9GL 4W6XB 1C8PA 4TNVK 3GJFH 3GSXA 4LASH 1JP5A 5LQBH 2Q7YA 4TSAL 4X4YA 5H37H 3DV6A 1L9NA 5B3JF 4PJHF 1NFIB 2O93L 2WM0A 3TBWB 3WIHH 3KYOB 2PCPA 3NFSL 1WVZA 3B8YA 5DTFA 1S8DA 5EU6B 1IGJB 3MOQA 5GJSL 5DDHA 1CLCA 4KHTH 1G1CA 3IT8D 5IMMB 2Q86A 1RZ7H 3OV6A 4OI9A 2BNQE 3TO4D 5KN5A 4F7TA 3LQZA 5BV7H 1WZ1H 4LAJH 4U0RC 1QRNE 1U8LA 2V2TB 4CN6A 3AB0B 4KI5D 1VADB 3BN9C 4GAGL 4G3YL 1YN7A 2B39A 4J3XA 3JWDH 5ALBH 2D7TL 1QTYT 4JM4H 5C2BH 4OFYA 4X4YB 1S9XA 3U36A 4G6JL 4PPTA 1L7TH 1NC2D 2FJFB 5D2NE 1A3RL 4TSCH 4LRIC 3EOAB 4JG0L 4GAJH 1FP5A 1ES0A 5EUOE 1U2CA 4AEEA 2B8OT 2EH8H 4HEPG 5DA4A 1R5IA 4OF8A 2XI9A 4WI8A 2AJ3B 3NABH 1B0RA 1EDQA 3SPVB 4PJHA 1LO2L 3HPJA 1CGSL 2EDOA 3BMVA 5F7NC 4WEUD 5D5MA 1WFOA 4BFGA 5HYQB 4PJDA 2K1MA 3I2CH 4G7YH 3BYTA 2P7TB 3MLWL 1EO5A 1F5WA 5FUOH 2Z8SA 4M43H 4MGXA 4NZRH 5ITBH 5IMKA 3PDOA 2VLJE 4O5LH 1QSVA 1AJ7H 1PX4A 4MZ2A 4RMTA 5DYOB 2F54D 3C8KA 3UC0H 3QFJA 4J3VA 5JOFA 3DVIA 1NBYB 1N5YH 4OBSA 3GSNH 1JZ5A 3D39E 1SJHA 4TNWK 3IB4A 2VLJB 1GGCL 1TVDA 1DLHB 4ORGA 3S9DB 4BSWB 2DM7A 2L7JA 4Y2OA 3SKJL 1KB5B 4MJID 1DQDH 1XR8A 5IG7A 2HVKA 5BRZA 5I0DA 1RUPH 4Z7UA 5TQ2L 4ZAKD 4JFFA 5B21A 1NFDA 2J8OA 4N0YL 4WV1A 3MV8A 5EPMB 4N0CD 2PYED 2VLME 1U91B 3RNKA 5J8OA 5I1GL 1OP5K 1U8OA 4ELMA 3L7EA 4OQTH 4KY1H 2V7HB 3BUYA 3MLVL 3TIEA 5DDHB 1EO8L 4KZDL 3FB8B 3UO1H 1ZVYA 3PP3K 4X8XA 1I7TA 2D9QB 3HLAA 3BO8B 3OKMB 4BFEA 2AK4B 3BW9B 3RIAK 3TC9A 4HBCH 1CG9A 1R24B 3DETD 2I60L 4X6DF 5GISL 5K33A 3WHE0 4ALAH 3HZYA 3MV9E 1MHPL 4F58L 1NAKL 4HIJA 5E8PB 5GGQL 5D8JL 1FZKB 3BKMH 1QRKA 4PRPA 1PG7X 4M7LL 3GSOA 4CMMA 4P2CG 2KKQA 2H2SC 1ZVSA 4GMTL 3U4AA 1KIRB 4PR5B 5I73B 3HTLX 3I2CL 5IT2H 1E4KA 2OBGA 4F7PA 3HZKA 3HUJF 3KLAB 5MEOB 4TQEL 5GGSB 4EUPB 4HAFA 4HUXB 1LP9E 4OJFL 5JDJA 1ZMYA 2NX5E 3BZ4A 4WCYL 4M1GH 4Y2DA 5CJOL 3TJHC 3CVHB 5C6PB 3TPKA 1WTGT 4HEME 4Q9RH 5DJZB 1PW3A 1J11A 2P43B 4Z77A 2Z4QB 3SCMA 4BH7B 4ZFGL 2Y36L 3SJVB 5K9QI 1GXEA 1FYTE 1YPZF 1QO3B 1OM3H 5IMKB 3QG6A 1MVUB 1IM3B 3CXDH 3NFNA 5I17B 1FPTH 5GGTH 4JY5H 2WQRA 1DDHA 4QRQA 1C1EL 3B5TA 5GIRA 1T5WA 3RVVC 1XF4A 3QXVA 3VXQA 4Z5RB 3VCLA 2YWYA 3VXSD 1MJ8L 3LN4B 4L3AA 4YPGA 2OL3H 4BA8A 4OZIA 4C56A 2C3GA 5DTFB 2HJFB 3RI5F 5E5RB 1UCBL 3QXAA 3C2SA 4FFWC 5DUBA 4I77H 5FK9A 3Q6GL 4F15C 5F44A 1W8OA 4WW2B 2HT2D 3MACH 3UMTA 1CL7L 4JAMA 4NZUH 1ZLVH 1FVDB 3FN9A 5IESH 4PGEA 3BXNA 4W70A 2BNQA 3TT1L 3ARFB 4UBDC 3G04A 1XZ0B 1VFBA 5KVFH 3HZYB 1YPZA 4PP1D 1T83A 1IL1A 1TENA 3BP5B 3DGGA 2XPGB 1LNUB 1HSAB 1FNSL 1I8LC 2VB5A 1GOHA 1ZA6B 3MGOB 1OY3B 3NABL 2PTTB 3A6OA 2JJTC 5E1HB 2A77L 1EBPA 5FIEA 4L3CB 4V2BA 4Z0XA 2V2XB 1DN0A 4MA8H 4OFVA 5E00B 3HFML 3OKDB 4HXAH 5FECA 3I6KA 2MSPA 2ZUSA 2EDQA 5CBAB 3RZCA 1X5AA 3RWIB 4EI6A 3HNTH 1NAKH 2VIRA 3D2UD 4X4XA 2BRRL 4LP4A 3WS6A 3A67H 5HYJE 5KJRH 5FUZH 1QBBA 3QZWG 3JTSA 1KBGH 3UTOA 2CGRH 2VXQL 3G6JF 4H20H 4EQ3A 3O2WL 5EOCL 3SDXE 3OAYK 3WNNA 1G6RH 1XCTA 3I50L 2I26N 5CMAA 2ADFH 3RU8H 2PW2B 3AVEA 3LQMA 5TQ0H 1J88A 1SM3H 2XTJB 4KVCH 1MQKH 5JO5A 1UKTA 2IANE 4OM1L 4PJ5D 5CJ5A 3QBTB 1P1ZA 3PP4L 3GO1L 4HGKC 4FQXB 1D5BA 4JHAH 5IB4A 3RWIA 1YJDH 2XZQH 2VLJD 4QRPA 4U3HA 3M1BB 4K2UH 4LCWA 1A9EA 1OCWL 4Y88A 5D7SH 3HI6H 4I0CC 4IIQA 3MSPA 4JFED 1KOAA 4K71C 2HFEA 4Y4HA 3ROOA 1JMZA 2XWBB 2WBJD 1EUTA 5F70A 5KSAA 4PGBA 1T1ZA 3BKML 3OB0K 3GMOB 1BD2E 2E7HA 1UEMA 2DJSA 5EC2B 3TA3D 4JO1L 2AQ3A 4H0GA 5CUSH 1A6WH 2YZ8A 1SYSA 3D9AH 5KVEH 3HR5A 5LGHH 1U3HC 3WXVL 3LN9A 4KVNL 4NO3B 2A2QT 2X9WA 4PGDB 4G7VL 3LEXB 3P4LA 4BFIB 2Z91A 2BXZA 3VXMD 1UB6B 4J3WA 1AQKL 1J8HB 1I8KB 2QR0B 3H9SB 2Y06L 3Q0HA 5JXED 3GB7B 3S8WA 2XV6B 3F7PC 1GJIA 1EJOH 1H3TA 1PQZA 4MA7L 3CPLA 4UMGA 4B53A 1NCTA 3H7LA 3T1FB 3IFOA 1GGIH 1TETH 3S36L 4XNQB 4KJYB 1VEOA 3UXFA 3I75A 4I13B 4MXQD 2E6PA 1U42A 1ROWA 3SJVE 1AC6A 1F11A 2OR7A 3BDBA 2ZG2A 2DLHA 1AXSB 1FAKT 4QRQB 4UINH 2V17L 2P48B 3S34L 3U1SL 1QSED 1SJEA 1P7QD 1F4HA 1NAMB 3O41A 1BLNB 4RGNC 3BD4A 1HINL 1NANI 4OCXL 4LASL 3HMWL 2OL3A 1AE6L 5KTEH 4IOIB 5C9JA 1UJTA 5DS8B 1F3DJ 2PYFA 3AS0A 4OD3H 4P23A 3AY4A 3O3BA 5IW1B 4HULB 1KPRB 5D2LE 2KL6A 1TZGL 3G9VA 2CLRB 1I8IA 4G6KH 5JTWA 4HSQA 5CJXC 2ERJB 3RX8A 3PWVB 5JQ6H 4F7EA 5D7IE 5ANMB 1ZT4B 4X8JA 1LDPL 1LQSR 3BSZL 3V52H 2CKBH 4RAUB 5TDOB 1M05B 3LD8C 4JQXC 4ODSL 2D0HA 2EEDA 4XXDB 2LE9A 1S3KL 2H2SD 4Y7MA 1CR9L 1XR9B 2GI7A 5EZJB 1SJXA 4X83A 3LEYL 4FN0A 3I6LE 2X70A 3OPZL 3EHBD 3MXVL 3OKOA 1L7TL 2PTTA 4RISL 2DN7A 3T2NH 2KQMA 5J6GA 2HJLB 3MYJA 3ARFD 5D1ZA 3SDDD 1J8HD 2R69L 2EDYA 2PXYA 1D5IH 1I9JL 4Z0XB 3MV7E 3LQZB 2WZPD 4HW6A 1C7SA 5D7KD 3WMSA 2X4QB 3MBEC 1J87A 3JZ7A 4D0CA 2VAAA 3B9DA 3ZT6A 4P2RD 2F9BT 1BGXH 2HYMA 2P46B 4X8JB 1MWAA 2RCSL 1FG2A 1UWXK 3A67L 3I3EA 5HVGB 5HY9A 4TOYL 3EO1A 5DA0B 4HIXL 4K55A 1AGEB 4JR9H 5H35A 3BPNC 3EOAA 2RFXB 5DFVC 1HXMB 4X7FC 1INQA 4HV8A 3QDJD 4M6NL 3BIAX 1JN6B 4HK0A 4OV5B 4YR6A 4X5XB 4HDIA 3SDDB 1BFOA 1P9MA 3GMLB 1FZMB 4BKLB 2BSED 4X6FA 5DK0A 1WWBX 4X5WB 1KLFA 2PW2A 4K94H 2GIYA 4V2CB 4JFPB 4YXLH 5TH2A 4M9PA 4MA7H 1HCFX 4WJ5B 4ZOCA 2VYRE 1RZ8B 2VUOA 1HK6A 3RUGF 2BSSB 5T1KA 1QP1A 5EBWB 3DBXA 3BHBA 4FG6C 5CP3A 1A6TA 4RRPG 3RY6A 2OX5A 2OZ4H 4FZ8H 4DEPC 3EO1B 1BAFH 1G7MA 3OXRA 1JPTH 4Y4KA 3K0WA 2A73A 3P9MB 2B4CC 1UC6A 2X4TB 4EOWH 4NM4L 3CVIH 1AXTH 5DVLA 2D7QA 1KPVB 3ARBB 2X4PA 3BDXA 3HRPA 4ODXA 4QHLB 4PLKD 2R2EA 4OCSH 1YEGL 4B0MM 1TDQA 5D96C 3TEUA 3FT3A 1IBGH 4ISVB 3HMXL 4EBQH 4WJ5A 1HIMH 3RNKB 5L8LB 2Q87A 3KPLB 2BVTA 4OQTL 4X9IA 2HJFA 3LHPH 4YHIB 4NKIH 1KJ2L 5AD0A 4Q9QL 1V3LA 2CIIA 5DD5L 4IDJH 1OGTB 3KS0J 4RMWA 1HHHA 4HK3J 2FO4B 3RWHB 3L3IA 1X5KA 1QFWL 1RUPL 5JR1H 3P4MB 3SGDI 1UCTA 3OR7B 4PGEB 1NDGB 1MCJA 1HQRA 5AWNH 3VI4E 1OGAD 5F6IB 4Q6IC 5DMKA 3C60C 5ESVA 1EO8H 5JPMB 3INUL 4GRLD 1U8JB 3FFCB 5KSBE 5IWLC 3KXFB 2V5TA 1KENL 3RJQB 2X40A 4FQIL 1C5BH 4R9HA 1FIEA 4QHUA 1ZGLP 4NC2B 1FZOB 5INCA 5ADPH 4CVWA 5KANG 1G7JA 5I76B 1LK2A 4ENEC 4L8DB 2GSIA 4MD5B 5EN2B 5IB5A 3KYNA 2E7LC 5AZ2L 3KPPB 4XTRD 1UVQB 3ULUC 2CK0H 5FKPB 1XGQB 1I8IB 5DGRA 2FATH 4U1IA 4GQ9H 1LMKA 1I1AD 2VC2L 3LB6D 5C0AB 1FJ1B 5INDB 5KVDH 2WWMD 4RAUA 5D72L 3ARXA 2FX9L 1NCCL 1EEUA 4WWID 2XWTA 2DTSA 5KW9H 1QHPA 3AREB 4KTYA 3V0VA 1XGPA 5IJVA 1OP3H 5ADOH 2FEDD 3CFBA 4IMLB 4MQSB 5F3BB 2LU3A 1KTRL 3SGEI 1UZ8B 4YX2H 3FAXA 3OTTA 2J8UB 4EQ2A 1JVKA 5FM5O 2YD2A 5KZCB 3WS3A 1RIHL 3H9HA 1JIBA 4AG4L 1DLFL 3MRFB 1MIML 4QXWA 1FNEB 2ZOLB 3IDJA 4NQEA 4NO5B 1KCLA 1XF3B 4J4PC 3RNQA 5ITFA 3VXTB 3QUKB 4GRWB 4H5SA 5K93A 1YNKL 1QLFA 5JOFB 2OI9C 5FYLH 4L1HA 2VDKL 4DAGH 4DN4L 4OLUH 2IGFL 1S7WA 4RMQA 1DEEB 4JRYE 1T3FB 4YDJA 4M5YL 2MQCA 3UTTA 3IU3A 2BMKA 5I8OH 3EFFA 4TUOB 1G7HA 2ED8A 3C2AH 5JZ7C 5FOBA 1LGVA 3N85L 3BE1L 1D5XA 1FRGH 4NT6B 1L6ZA 3D3VA 5GRJL 1KJ2H 1CBVL 4G6AC 4PJBE 2ORBH 4MA8L 1P69B 3VFWA 2PKDA 5KVDL 2PXYD 4KK6D 2NZ9D 4OTXL 1RV6X 2DM2A 3CLFL 3WIIH 2W91A 1MAML 3PWJB 4OUUA 2NTFA 4KHXH 1IGFH 2XZCL 5DO2C 2FLBT 5B8CB 3DBXB 4DEPB 1NKRA 3MNWA 4FQLH 3ULSB 1S7SA 4I77L 4RDQG 4WDIA 4JHWL 4OF7A 1YC8A 3T1FA 4KTEH 5B39G 5IB3A 3IJHA 4OZGB 4TULH 1G7LB 4LSUH 5F9AC 1Y18B 5C0AA 2JJSC 2WIIB 4PGJA 3O2WH 5EOCH 1JK8B 1YEEL 2YD7A 1AO7D 4PR5A 3ARBA 4HIHA 5FYJD 3PHOA 3T2QA 1CZ8H 3EOTH 5DC4B 5ETUA 3O3DB 1U93B 4IMLA 3FT3B 4RAVB 1QYGH 1OARH 1WEJH 2RBLA 5GS0L 2DQIH 5F9OL 4X7SH 1RFDH 1SBSH 3NCJL 1DQML 4LCIH 2AK1H 3B9VA 4P2OD 3I50H 3GGWB 4WO4A 3VXPB 4LGSB 2VLKB 1KCVL 2WNGA 2Z4QA 3C6LA 3U2SA 2LTQB 1HH9A 2FJGB 3NCCB 4TSAH 3IDGA 2APBA 3VRIA 4NPYB 1T03H 2IBZX 1MHHB 1U8LB 1DP0A 3MUHL 4XCYA 2MCG1 5MERB 4ONGH 5GRUH 2ORBL 4HFWB 1QLFB 1B0WA 4NFCA 4JO1H 3BT2H 4K23L 1Q1JL 4HS8L 3T4YB 4MYWB 2CPCA 2CKBA 4LLQB 4P3DB 4HPYL 2QKIB 3ARWA 4U05A 1ES0B 1I7ZA 4P9ML 2D7PA 4AJ0A 1QSFE 3SGJA 3JWOC 1AP2A 5DVNA 1KB9K 3ZMRA 4J4PA 2F74B 1NJ9A 3BP4B 1MQKL 1MLCB 1PVHA 2ADGA 1GIGH 3EO0A 3FT4B 4JFXB 2AK4A 1MJUH 1JGUH 2DI8A 3O4OC 2E27L 4JFOB 1N6QH 1HDMB 4QRRB 5SX4I 1CDGA 3VWKC 4Y2DC 4HUMB 3ECBB 4DGVL 2J4WH 3T4YA 4PTTA 5DLML 5I1GH 5MP6H 1JPSH 4WY7H 1E4XH 4ZTOL 1SBSL 2DL9A 3BYYA 3KYOA 2NLJA 4R4ND 2PN5A 4UIMB 1PSKH 2CKBL 3C9NA 3KPOA 2VQ1B 4JFFE 1U36A 2WBKA 4FMFA 4NWTH 4IHOA 1HYSD 5IM7A 1SMAA 2F74A 5D1XB 2X4UA 3QHTC 4XMPL 1PKOA 4Y8DC 5JW4M 2R29H 4FA8A 2BHUA 1AHWB 5MENE 3Q5TA 3H9HB 4JO2L 2AK4D 2EYSA 3S4SA 4N9GA 3VXNB 4MCYB 4HFUL 2PYEE 3L9RB 3MLSH 4MD0A 1CT8B 1EJOL 4OI8A 4BSVB 1ZEAH 5ESQA 1F4YH 1QBMH 5I17A 4MJIE 2BVQA 1G7IA 1KJVB 2EXWC 2NLJB 4ZSOB 1CFTA 4J3OC 1U92A 4NUGL 4P4RA 1J0ZA 1R5IB 1ACYH 2VITB 3DX8A 3QH3B 2AJ3A 5A2JH 4L5FH 2FHCA 2JJWA 2X70B 2GITA 1AKJD 2R9HC 1OQOA 4ZNCD 1SBBA 4M6ML 1Y6NR 2IFFH 3O6FD 4F15B 1G9MH 2R69H 2H1PH 1DQQB 3O11A 4M6NH 1MH5B 1A7QH 4WO4D 3DVGA 4EIZC 3MRGA 1AR1C 4KHXL 5GS2H 2WUCH 3SDCC 2UY7A 1YN6B 3G9AB 4PJGA 5LXGH 5C7XH 3OZ9H 3P73B 3BP4A 3GHEH 5D7JC 2J2ZA 1G9NH 3R4DA 4PJ9D 5JDSA 5E6YA 4P3WA 1BP3B 4UNVA 2DQGL 4NHUB 1GGTA 3DOSA 4YFEA 4OZGA 4QEGA 4QCIA 4RBPK 1G0YR 4CVZA 1WV7T 4M6AA 3K81A 2CJUL 5ESVB 1KCRH 1IC1A 2GITB 5FXCH 1NBQA 5SV3A 2H32B 5HYJB 5D9SB 3T0BA 5D1XC 3VCLB 3O11B 5IESL 3I6GA 3C5SB 4IRJB 4MA3B 1RI8A 4ZOAA 4GMSL 2QR0A 2VN7A 5C0JA 4NSKA 5DEFA 2NR6D 3OX8A 4ACPA 4IOSD 2AK1L 5HGAB 1MFDL 3MR9A 1PBYA 1D5IL 1I9JH 4PP1C 3EFDL 1A6ZA 1FVCA 5KS9B 5I75C 5CIPB 4F9PA 2PW1A 5CS7A 2EKSB 3VXSA 4XPFL 2DTMH 4YJZL 1NMAH 1UENA 3LKNA 3QUXD 3NCYP 1EAJA 3M8OH 5F21B 1MRDL 4K8RC 1MFAH 1KYOK 4Y1AB 5E1AB 3DTXA 5E0QA 3GRWH 2XTLA 1G7IB 1PAMA 4MQTB 4BZ1H 1I1AB 2ZUTA 3RY5A 1GZQB 3IDXL 3AGVA 2NXZB 5LWYL 4ODHH 4OGAC 1J8HE 5AWNL 5DQJA 3E6HA 1D6EA 5KVGH 1DTUA 2OL3B 1RPQA 5AZEL 3K1KC 2RIKA 1VHPA 4QRPB 4C57C 3SGKA 4NM4H 1NCAL 1CGUA 1NQBA 4ETYA 2IANA 1B0GB 2ICES 1JGDA 4D9RD 1RD6A 4FQ1L 3IETB 5CLTA 3VI4F 1S78D 5CP3H 2P5EE 3QZWB 2ZKHH 3T2OA 4LLMA 1OTTC 2QQNL 3WFDL 5MEND 4DN3H 5IKCA 4HMDA 4M7ZB 1EVTC 3TT3L 2I07B 4GMSH 2A74B 3NH7H 3G6DH 3OKKA 1IKFL 4P5TC 5I73C 1DBAH 1KNOA 2I25N 2DLEA 5D1QB 4XAWH 4FQCL 1B4RA 4E0RA 1NLBH 2IPKB 3FQRA 3L3GA 4NCC1 2XTJD 2EO1A 4O58L 4QLRA 5LQBL 2J5LB 5I19L 3BH9A 3UZEA 3BZEB 1OAXH 4HX1A 3MRMA 5GS0D 1BVLA 2BRRH 3GSQA 5EA0L 1U6AH 5CGYD 1R3LB 5B38B 1S7RA 4WW2A 3LSOB 4DKEH 4PS4H 4JFFD 2R0LH 1Q9WA 4NKIL 4YEEA 1T2QL 1BVKB 2XG5A 4JPIA 3QYCA 2CDFB 3MR9B 2IG2H 2P7TA 1Q0YL 2G75B 3EKCA 2VC2H 4GG8A 1A3QA 4YHMH 1PZ5B 3DUUA 3CXHK 4U1LB 1R5WA 3ROOB 2WIMA 1YEHH 1VEMA 1WCBA 6FABH 4IRZL 1JWUB 1HXMA 2VE6A 1CI5A 1BJ1H 2VABB 4P23C 5F89A 2VDQL 3MRQA 2DBLL 4P5MA 4Z7QE 3MRRA 3TCLA 5HHPB 1R3HB 4X80H 3UTQA 5LAXB 3G6AB 5EU6E 1FL5B 4JVWA 5SWQA 2A6IB 3FQXB 3PWLA 1CU4H 3MA9H 2HTKC 3QHZH 4HKJB 2A6DA 4YE4L 5C0ND 3RVWD 2VAJA 3S98A 4RAVA 4QT5B 3K1DA 1WT5A 5KANI 3NH7L 2Y9RT 3V5KA 3P73A 5BS0D 1H15A 4BZ1L 3N1QC 4Z7WE 5TDNB 3QUYB 2UUDH 4X4MA 1ZT7A 2IMNA 4F58H 4OZHF 5EZJA 5HPMA 2EDTA 4YDJB 3STLA 4O5LL 5FYKH 4TPRH 3NZ8B 3NACH 1ZLVK 4CMMB 1MAKA 1W72H 5FYJU 3QPXH 1JGEA 3O45A 5DJ2A 3U9UA 3MYJB 5GRJH 3G6JA 4JEGB 4XP4H 2GTWA 1WF5A 4WEBH 4XI5D 3RA7L 5F6IC 1RZJH 2ICCA 1VFUA 3M45A 2AV7B 2VDPH 2H45A 1ADQL 1C08A 4OB5H 5C0GB 1B9ZA 1RURL 1IAIM 4M5YH 5HVFB 1IKNA 3WJJA 2PR4L 4NCDA 2YRZA 3TZVA 3AAZA 2VDLL 4PY8J 2X9XA 3L3IB 4CW1A 2FHFA 3QO0B 3WL9A 1Q9WB 1DBAL 3MXVH 2MMXA 2IWGA 4DGIL 4K8RD 3ZE1E 1L6XA 3EJZD 4F7CA 3WKML 1WISA 5EUOA 1J0YA 3KR3L 1CDJA 1BOGA 1L7IH 1PZ5A 3SDDC 35C8L 4QWWD 2FBJH 4I3SL 4NC0B 1NAML 3O3AB 1NGYA 2ICWA 3ABZA 5I1HL 1RZIB 4HCRA 5IIEB 4OCWH 5IFHL 4F3FB 5ERWA 3U4EB 1FL6B 4Z76B 4PBVC 4ZUSA 2R2BB 1OF2A 4XCFH 5FM4A 3C9NB 3KPOB 2DYPD 4RQQB 3KYMB 3R0MA 4TUKL 1YY9D 4K7PH 3D0VB 4N0FA 1XF2A 3TO2B 2DDQL 5EDXA 1N8ZA 3LKQB 5GS0H 5HYSG 1SEQL 5HGHB 1GOGA 5EBWA 3LEVL 2ITCB 4KRPC 2HLFD 4Y4FD 4PJCA 5JMRA 3MLYH 5HYQA 4JN1L 2JCCB 5DJXA 3DRQB 1KCVH 3V5HA 4HKZA 2APXA 3P11L 1P7QB 1KCUL 1Z3GL 2YXMA 1NCDL 1ZHNB 2QJDA 4PP2A 1CD0A 4RGND 1I1RA 2FIKA 4KPHL 5D93B 4WU7A 1RJYB 6CGTA 4WW1B 4ZUVB 3UP1A 1QFPA 4I0PB 4HH8A 1FFRA 2V7NB 4FXKB 4ODXB 4RISH 3NIDE 3S37X 4ZSOA 3WHE1 1OWWA 2DYPB 2APTA 4P0DA 4TRPH 4G5ZH 4LGPB 4XNXH 5E5MA 1YY8B 2EDXA 3V8CA 4AEIL 1T6WA 4TSBH 4OZFA 1JN6A 4HK0B 1KJMA 2D31A 3KHQA 3LB6C 3EOTL 5BW7C 3DV4B 5BJTA 3QJFB 1EGJA 2ENSA 1QFWM 2BZDA 5FECB 3VGDA 2D4FA 2Z9TA 3OHXB 2I9TA 4U6XA 2VXVL 3TO4C 5IK3A 2XY1A 5IOPB 4ZUVA 4LKXA 2NY6D 4H8WL 4BSJA 3BMWA 3P2TA 2YSSA 5JIIA 4ZUUA 3MXWH 5GRXG 3WFHA 5I15H 5TDPB 1JPSL 2VKWA 1A0QH 2XA8L 4WU5B 3DMMC 4UU9B 4EUPH 5FDWA 4JKWA 1WFNA 4LPTA 3WDHA 2RJMA 4D3CL 1WT5C 3D2UB 4OZFB 5ALCL 2CK2A 1HHKB 4HC1L 5E8DH 5BQ7A 3OJ2C 1GC1L 4R7NB 2F53B 2HMIC 4XPBL 4RQQA 3CDYA 4C55A 2IPUG 4FNLH 4ISVA 3NTCH 3VGEA 1ZT1A 5E6IA 4XC3H 3ARGA 4BUGA 5J6HB 1L0QA 1NCWL 2ERJC 4HUVB 4H0HB 1EX0A 2XRAH 3GBNH 2UZYB 1I4FB 3HNSH 2QHRH 3UX9B 1PDKA 1EEZA 2P5WE 4W4OC 1FBIH 2EO9A 3T0EA 4UV4L 4POUB 4IJ3B 1JFQH 1I7UA 4NO0B 2GAZA 4XNYL 1I3GL 4HV8B 3HC3L 4HWNA 3SDAA 3BVNA 3NACL 3TJEH 2NNAB 4MDJB 4JFHD 3EOBB 1A64A 4NYLB 4O9HH 4YO0A 1VESA 4CU8A 2Z31D 3QJHB 5DRWB 1KFAL 4UUJB 3AC0A 4MNHA 4YNYB 4HWBH 4OFKA 3L3JA 4QHKI 1OSZA 4U1NB 3S4SG 2GTWB 1E6JH 5GS1B 5T33H 1OAKH 2R56H 1M4KA 3MUGA 5EOQH 4URTB 5D7IB 5ANME 5ICXB 1T1XA 3ARBD 2DM3A 3QJFA 2DMKA 3GB7A 3X12B 4A6YB 1I1YB 4GKNA 4U4BA 2XFXB 3BH8B 3SQOH 2NY6B 4JM4L 3V4VL 5IHZB 1M7DA 3OHXA 4FQXC 5IBLC 3CPLB 1A22B 3IAQA 1A1MA 5EULV 1PKQE 3CZJA 4EN3D 5CILL 1CFQA 4OQ1A 3S36H 1FE8H 3HFMH 4B50A 1RZ7L 3CFCH 3N9GH 5I0ZA 3H2WA 1DBJL 3MNVB 4PLJC 4NYLA 1D9KA 4YO0B 2OYPA 4N0YH 3MRBA 5EU4B 3G04B 2C1OA 3WHXB 3V4UL 1SMOA 1DLFH 5JOEA 4PJFB 4PRIA 1NEZB 4UNTA 4P4KD 4JRYA 1AGDB 2LV4A 4UU9A 4L8SC 3GBLA 4EI5B 4AIXA 3L3HB 3T08A 1MFBH 5IMLB 3HRZA 4YFLI 1B6DA 2HTKD 3B3IA 4LNVA 3MCG1 1A7NL 1U58A 4DW2L 1QSEA 4KGLA 3RJDA 5HSFA 1VFAB 2EYTB 4LHQB 5TF0A 1D6VH 4OZIE 4PJ5B 1JPFB 4JCMA 4YH6A 2AS5M 3CDGA 1IGTB 4Y2DB 5BV7L 5IHUL 3RGHA 1IC4L 5JIHA 5JA9A 5DJAB 1HHHB 3RWHA 1KXTB 1WAAE 1MUJA 5DEGA 5FYJH 3C2AL 3JV4B 5T3XL 2H9GA 5J89A 3U0TA 1GHFL 3P0VL 4LVEA 3MCKA 3K4AA 2NY1B 5CZVH 1DEDA 4EVNA 2AXFA 3QXDA 5C0IB 2XTJE 1EMTH 1CVSC 1ZT4A 2GEEA 1MRDH 3WHXA 4B5EA 4QXTB 5SX5H 1UZ6F 5F8RC 1E6JL 1OCWH 1QVOA 5D71L 3IGAA 3WIIL 3TBYA 4K9EH 4R90H 2ZUXA 2WANA 2XNAB 2EH8L 4X9BA 4PLOB 1NCBL 4M4PA 4JLRB 15C8H 1KPVA 4R97C 2DQUL 4J1UA 1NGPH 4IHOB 1DL7H 1GGBH 2DTML 1RUQH 1FGNL 4PYHA 2EEBA 4O2FB 2YPKB 4NNXB 5I66B 3W9EA 3HI5L 1C5DB 1FBIL 1C12B 4PB9H 4JO3L 3QQ3B 5IUSA 2VLLA 3MOAL 2DQCL 2F58L 4XPAL 5GGQH 1ZLWK 2OS7A 3IDMB 1FVDA 1AJ7L 5E5UB 3TJEL 4KI5C 5IKCB 5DSCB 3GSUA 4J3TA 3QFJB 3GSXB 3GI9H 3GMRB 2H6PA 5JW5A 1XIWC 3CVHL 1QRND 5CLWA 3AREA 3V0VB 1LO2H 1II4E 3WUWB 2FH8A 3QPQD 3VMPA 3HE6A 1G1YA 3LN5A 5L2JB 4HKXA 2LVEA 4S2SA 3MA7A 5BZWB 5GISH 4LPXA 3BEVB 4XP5L 4ONHA 3WNKA 4HX1B 4M43L 5IMLA 3P0VH 3W9EB 4JKPL 4LAQL 4GBXD 2P24A 1F8TH 3I02A 3MCLH 2VERN 1VKXA 5E2VL 1FNEA 4DTGL 4S11A 1WK0A 2ITDB 5FOJA 1T4KA 1MCOH 2UY6A 2QHRL 1UM4L 3TN0D 1FL3A 2R1XB 3P9LB 4FQ1H 1ZSDA 4X99A 1XAUA 4RNRA 4RWHA 3TGXA 1HHJA 3LIZL 4P9MH 3T77B 5MENB 3ILQD 3MBEA 4YHKL 3KJ4C 2CRIA 3HC4H 5C08E 2PETA 1H3XA 1U0QA 4NWUH 2R1WA 4GT7A 1DQJA 1AKJB 2Q3ZA 1C16B 4G43B 2VDOH 3EYSL 4KJPC 2XY2A 2OSLA 4HFWA 4O2CA 2E27H 5BO1L 5F1OB 1CE6A 5LAXA 4P46B 2BVUA 5CEYA 2NZIA 1CFNB 4F7PB 1UH4A 1YMHB 2BP3A 2Z35B 3EYFA 3ZTNL 4GW1B 4FXLA 5D5MB 5HI4D 3D0VA 4N0FB 5IVXE 3MLZH 5FUZL 4LNRB 1CR9H 2FSEA 4H26B 2DB8A 4IBLT 1CT8A 2X41A 1HNFA 4E9LA 1FVEA 3V4VH 1S7QB 1T2JA 1ULVA 5EZIL 2ZOLA 2PYEA 2VTFA 4OCNC 2ZCKL 1O0VA 3FKUS 3GSWA 1XIWD 4Y4KD 5IV2A 1NDGA 4X7TB 3K8MA 4LARL 4MJIA 5DSCA 4EXPX 4RSVA 3BP6A 4FXKA 5DVMA 1NMBL 5GIRB 2OXHA 1LILA 1CL7H 2YUXA 1HOCB 4O02H 3WUZA 4M5ZL 5D7SL 5ICYB 3KDMA 2DBLH 4G9DB 5H94A 1A7NH 2AXHA 2HJKB 4G42A 3HAEB 4X6CE 3NZHH 4HKXB 4S2SB 1FIGL 5I1KH 3STZB 1KPUB 1N4XH 5JHDE 2E5EA 4WI2A 2RHEA 3GI8H 1B0RB 3SPVA 3HLAB 4YE4H 2UZIH 5E8NB 2PR4H 5DR5H 3IFPA 3SOBL 2P5WD 4JGMA 5EO9A 2DAVA 3HPLA 5E70A 3IRZA 1AI1H 1JZ4A 1A6WL 2MPAL 3X3GL 5JORA 2ZPKH 3QEQE 4LSTH 3SE4C 2Q8AL 3L5WB 1BECA 2C3WA 2BSRA 1V5JA 4U7KA 4FMKA 1ADQH 5B3JE 2J3SA 1RZGA 3HE7B 4K9EL 3F7YA 3BKYL 5H35B 3S37H 1DFBH 3JUYA 1OGAA 4BYHA 3EDFA 4KJQC 2EC9U 2UWEA 4NQCE 3ZE2E 4G42B 4DUWA 3QDHA 3UZQA 4LAQH 4I18B 1XFPA 1UWGL 3O41B 3O6FB 4GRLC 5HHMD 1U8PA 4OD1L 4R0LB 4D9LL 3OAZK 4G8IB 2PYFB 1F6AB 1UM4H 7FABL 2NQCA 2X1OA 3WLBB 2Q76B 2D03L 3ZKNC 1QBML 4Q97A 3WFEL 1MHCA 4U0RB 1XGRA 2A9NH 3STBA 1FN4B 4FFWD 2AKRB 1ADQA 1NMCB 4PJGB 1HQ4B 4UINL 2EZ0D 3WD5L 3VFPB 3ESUF 2X09A 1WJ3A 1S7QA 3V6FB 1MVUA 4ZTPH 3FHQA 5KZCD 3VFSA 1TQCC 2J6EA 4K3EL 3VD7A 1TNMA 1OGAB 2BY1A 4WUUD 1AE6H 5KTEL 1PKQA 2FD6H 5HYJD 5DD0H 12E8L 2JJSA 5HHQB 4H88L 2HH0H 4H1LG 4XPHH 3EYOB 1BZ9A 2CUIA 3VXRD 1QFWI 3ARBC 5BRZD 1Z9SA 5ID0A 4I3RH 3PWLB 2BRQA 1NFIA 2MPAH 3DV4A 5TPWL 5GS1A 5J3HC 1CWVA 2Y7QB 4S1DD 5IBTL 2QSCL 1EXUB 2BNRB 3VGAC 2X4QA 1RK0A 5MEOA 4HLJA 3PJSB 3UJIL 1NKOA 4XX1G 3WXVH 3OKNA 3JV5A 2F54A 1JNHB 3PGCA 5HGAA 4NN6B 4XNXL 5F7WC 1SEBB 2IQ9H 3OG6B 2BVQB 2YD9A 3PQYE 4G9FE 5T3XD 4LCWE 1MF2H 1S7XB 1HCVA 3REWA 4S1RL 4PJ8A 1VCAA 1P2CA 3JSSA 4P4RB 3FOLA 3JWOL 3ARZA 1A6AB 4ELME 3TWCH 4GUPB 3RWJA 1ZLUK 3H42L 2FR4B 2ZUUA 2AJYL 2VDKH 4HDIB 4N90D 1N4XL 4D0DA 4E41D 3BN3B 1JFQL 3HI6L 5EORL 1W72A 5TQ2H 2BY3A 4RGOL 3VG9B 5DC0A 2WINB 1U58B 4FABL 1Z5LB 4M62H 3R1GH 4C59B 3U82B 4QY8A 4XCNB 4RA0C 1IFHL 2FEEI 3CMOH 3EJYD 3U4BL 3V4PL 2XA3A 3BHBB 5I6XC 1AC0A 3OF6D 4N90E 4OLZL 1DR9A 3HMWH 5IHBA 1P7HL 4Z78B 3T09A 1N5AA 4Y5VB 4DFIA 1S3KH 2X4OB 4HUWB 4F7MB 4NRZA 5FUOL 5IGXL 5GZNC 5MHSD 1V7ML 2NR6C 3EO9L 4ZPTB 3QDGB 1AD9A 2DOCA 1TZGH 2BOBA 1DBMH 2Y06H 1LO0L 4HJJL 4ONFH 4WFFD 5HGBA 2WP3O 1UACL 4M5ZH 4L8BB 4LLDB 3NCMA 1G7QB 1T2QH 3FQXA 4FQQB 4G8EB 3W81A 3KNBB 5CZXC 3FO2B 5DEFB 3WLWD 1BFVL 1GGIL 4DUXA 1T22B 5AYQA 5GRVL 1NGWB 4MLSA 5FA3B 4P23B 1A9EB 3PGDA 1BPVA 1KELH 5C07B 1TPXB 3LS4H 2NY5L 1HSBB 3LQAL 1GGYA 5HGDB 1C12A 2V5RA 1P7KB 5IMOB 1HILB 3LEYH 1MCQA 1WEJL 2D0FA 2XQYK 3P3YA 2IH3B 1JUFA 3BX7C 1OB1A 4WU7B 3C8DA 1ETZA 3ZKSD 4KC3B 4KROD 2FO1A 1ZANH 3G5VB 1CF8H 4MD4B 1SY6H 4JPIB 4P46D 2M2DA 1B6UA 4ODSH 3EIFA 3BGFB 2CUMA 3C08L 4CL7A 5KVMC 4YPGB 3GDBA 4R2GC 4QNPF 1RHHA 1P5VA 2J88H 3KXFA 4U49A 3UTSA 1YUHA 3BZFB 4JDTL 1JBJA 1R3IH 2VZVA 4BK4A 2WWMC 4HS8H 5FGBC 3PGDB 2GJZA 1N59B 2MTPA 5SWQB 4XMPH 1LD9B 3X13B 3X3FL 1NC4D 1F90H 2VAAB 5FYKL 1S7TB 1OPGH 2CDGA 4LLAA 5A43C 3IFOB 1P4BL 1A5FL 1QLEL 3MV7A 2JJTA 1HYSC 3DETC 1KIUA 4GLRI 3QUYD 4KK5D 4PB0L 1KTLA 5FHBL 3FAWA 3FB6B 5INDA 2FX7H 5TDPA 1BOGB 3QT2A 1H15B 1UB5B 3LDBC 2B0SL 3MRIA 1JNJA 1HXYB 4HUWA 3LKNB 1MREL 3IGAB 1PGRB 2WIIA 2Y07H 5C0FB 5F7FA 1U92B 4YBQD 1DQJB 1B90A 4RIRB 3ZHKA 4BQ9A 2W60B 5F3BA 1U3HD 3R1GL 3AROA 4AT6B 1OT2A 1N8ZB 3LKQA 1DUZA 2O26U 2J8UA 3RY6C 3OXSA 4C56D 1KT2A 3PIQB 1CXEA 1KC5L 3Q3GA 3VGHA 1G9ML 4PGCB 4JRWA 3BUYB 1ORQA 3F58H 3MOBH 4WFHE 1I4FA 4JZJA 1LP9A 5FO8B 3BUTA 3GSNB 2AJVH 1OQXA 2MKWA 3W5MA 3JTSB 2FB4L 3U46A 2D2OA 5IMOA 3MLTA 4HWEH 4NQCA 1TTGA 2MQ0A 4J4PD 3H3BC 4HHAA 4M7LT 1Q72H 5E9DB 4P5TB 4P2RE 3WUWA 4HIJB 5E8PA 2DQHL 1UXSA 3BP6B 1S7VA 2Z8RA 3GSOB 4QXUH 2FYYA 3DX9A 3PNWB 1K6QH 5CKAA 4XPAH 2A6IA 5E95B 4NQDD 1MNUL 3RWCA 1BX2B 4QRRE 4Y1AE 4U1SA 5FUCE 4AIOA 1A4KA 3O6KL 3HE6C 4YIQA 3SDYH 4MWFA 3BQUD 3PV6A 1IAIH 2BXYA 3S5LB 4PJIB 2JELH 3CVHH 1JNLH 4R26H 3RBSA 2JIXA 5ICXA 5C0BB 3CJJA 1BVLB 3BZ4B 5E2TH 2DQFA 5E99L 5K9OA 4WO4C 3H7BA 3B9AA 1JL8A 1TQBC 4HMEA 3H9SE 1QSZA 2R2CA 4XRCA 3GSVB 3QG7H 5FF6B 4NJ9H 1HQRB 3VG0H 1ZHNA 3VXRB 5L8JB 2H8PB 1HEZA 4E41B 3QDJE 3HG1E 3JBG7 1NBVH 3U36B 1DBML 2XZAH 1Y0LB 5IFJA 2V7NA 3FFCE 1J0JA 1D5MA 3ULVC 4S10A 5BO1H 2AVGA 1AO7A 5HGBB 5HYSA 4LSVH 3DX6A 2P4AB 1RUMH 2FL5A 2CKNA 4JFPA 4HS6A 1M6OB 3NMEA 4XXCA 5C0BD 1KN4H 1CD8A 4E42A 4OKDA 4PJEE 3ARFC 4MQ7B 2OJEB 1NCDH 1MJ7L 3ISWA 3MLZL 5D1XA 3B5GA 3HPJB 5EZLA 1TPXC 1X4YA 5BVPL 5DT1H 3BKJH 4ZFFA 4OAWB 4IRJC 4CW1B 3MFGB 1BIIA 2PO6D 3BKCL 3O2DA 3VJ6A 1YNTA 5JIPA 1V3JA 3RWFA 3LRSA 1QR1A 2B0SH 1NANH 2FIRT 1TCRA 1JUFB 1X5ZA 5DRNB 4M00A 4UILL 1MCWM 1UM5L 4X6EA 4JPVH 2IBZY 1A7QL 1CD1B 3O3AA 5K9JL 3SY0B 1B4JH 3MFFB 2FWOB 5HDLA 1CGWA 2EC8A 1XGPB 2R2BA 4ZPVA 4Q2ZA 4BK5A 3ARTA 3NZ8A 1BZ9B 2HJKA 1XCQB 5E99H 3TCXA 3MGOA 5C0RL 2PO6A 4XMKH 3SO3C 4H8WH 1NFDB 4N5UA 4WV1B 4XHQA 5EPMA 3FQNA 5D1XD 1MCNA 4OZIF 1R5VB 4Z8FH 3V5HB 1A4JA 1OPGL 3ZHDA 4W6YB 1A1OA 4JHWH 3TIEB 1ZTXL 3IJYB 2JIXB 4Y5YC 1AI1L 2QL1A 3F12A 1IT9H 4UQ3A 5EC1B 4I5BA 1KFAH 2YEZA 2VIRB 1INDH 4OZFH 1FNFA 4ZOBA 2WBJC 4Z0BL 2AGJH 4F8TA 4HGMA 4JFYA 3V5DA 1KG0B 4U7MA 5EZIH 1DQDL 1EFXD 1R6VA 1K6QL 1OAKL 5F88B 5JXAH 4LVOC 2YUVA 3L5IA 3TZVC 5KBNC 3RVXD 2A0LD 1XCQA 4AYFA 1I1CA 1BD2A 5HHNA 3OGOE 4KY1L 1I9EA 1OVZA 4UQ2A 4YHPB 4XVJH 3PP3H 2OI9B 3ET9F 3NCJH 1PZUB 1I7RB 2JLLA 3VWKA 1A4JB 4EXKA 3FCTB 1Q94A 4Z6AT 4FRWA 5DMJB 4F9LA 2JIXD 4CUCA 2ZG3A 5AUMB 3SGJC 4P9HC 2CR3A 1QA9B 3BKYH 4WWKA 3V4UH 5DUPL 3K2UL 5DHYB 2BFVH 2YK1H 5BOZG 1TVBB 2P8MA 1CZ8L 5TE4H 3RI5K 3BPNB 4JFZH 5AAMA 4D94A 3V5KB 3FONA 4RNRB 4L29A 5GS3A 5I1IH 3DSFL 5DD3H 3ARGC 1KJ3L 2IAMB 4NM8H 2A38A 3UCRA 1LDPH 2VR4A 4Z7VE 3WFEH 3UTZA 1LO4H 1IEBA 3A0OA 5ESAA 5T3ZD 3WEXA 1G7QA 1MCRA 4GBXB 4PJFA 1VPOL 2CLVB 2X7LB 3R06A 3DYOA 4NO3A 4DGYL 3QWOB 4E5XB 3BKJL 1MEXH 8FABB 1EK3A 3SGEH 2OTWB 4JFEE 5DK3A 4QHUB 1R0AH 4R4FH 4J7RA 5EO0A 5CSGA 2HN7A 3KPQA 1DE4B 3BO8A 3OKMA 3MRPA 4PRDA 3PWUA 4HPYH 3WO3B 5DGQA 1AR1D 4JO4L 4NN7C 1YQVH 1RJZB 5IVNA 1WICA 3L5XH 5BZDA 4Y4FB 1ETZB 4DK6A 5C0EA 4LLMB 4I5BB 3GSWB 4Z95H 5I8CB 4XCYB 2BC4A 5CJ8A 5EA0H 2QQLL 4UAOB 1QFUL 4UT6L 4ZAKB 3QHFH 1F4XH 2Q7YB 2I07A 3GM0A 3BI9X 4OCLC 3K3QA 5T3ZL 2Z8WC 1BREA 4E0RB 1RU9H 3LZFH 1RUKH 4LLWA 2CMRL 4MA1C 5D1QD 5IHLB 1YC7A 1A9BA 1J05A 2J8HA 1BLNA 4WEMB 1M6OA 2DIAA 4AIZA 4ELKB 2KBGA 4ZQKB 1RK1B 4IRZH 4QKXB 2EE3A 1VACA 4XWGH 1QQDA 4L9DA 4LEOB 5I1JL 3QUYC 1BFSA 2RB8A 1NJ9B 1RULL 1RZFH 5IVXF 1AH1A 2EE9A 3LPGA 3D39A 3LKRB 2XKNA 4D0BA 1FVCB 2QSCH 4WW2F 5GHWH 3QUMA 2BC4B 4FFZL 4HUVA 1LHZA 1KN2L 1XT5A 1S5IL 1Y18A 4GRWF 4KPHH 2C1OB 1PJ9A 1V7MH 4YBLC 3LV3B 3W5NA 3MV9B 1HI6B 3CFKA 4P5KB 5IR1A 2B1HH 5C08A 3QUZC 1JWUA 4P46A 4X6BB 4ESKA 4GKSB 2H1PL 2FGWL 2B2XH 5E8EB 3TLRA 1EBAA 3FZUC 4LBEB 4OGAD 1AGFA 2QHLA 3VXOB 3LIZH 4OI7A 3CSYA 5I76A 2JK5B 4GBXA 4NNPH 4MXVE 5KSVB 3B2VL 4RA3A 1U3HB 3D3VB 4PJAB 4JZOA 4KI1A 3M8OL 5FYJE 1ACYL 4KK9C 5I1IL 1BWMA 3OJDB 4NC1E 1MJJA 3QA3B 3ROLA 3QCTL 1MHHA 1QPXA 3NA9H 1ZS8B 1Q8MA 3MO1B 2BNQB 3RHWK 3M17B 1DQLL 4YHYC 2JJUA 5HY9B 1T20A 1S9WA 3VFRB 4L3EA 3OZ9L 4NKMB 5LCVL 3LQAH 3QEQB 4PRNA 1VGKA 5F3HB 3AY4C 5IW3A 4LBEA 3ARDC 5F7EH 4JDTH 3HG1A 1WIUA 3IXTB 4QHMB 1EHLL 1IGJA 4G43A 2R0WL 3HR5B 4R4NC 5DK2A 1GC1H 1EIBA 5I18H 4G6FB 3OKEA 1JF6A 5CGTA 3DRTA 1T7XA 1I8MA 3NIGF 3RWGB 3MRGB 3QEHA 1QQDB 2JCCE 1T7ZA 4NN5B 1SVZA 5TJWK 2BHZA 1U8QB 1HKLH 2HP4A 1Z0MA 3M17A 5C0CD 4OF5A 3F6IA 4OKVB 5AZ2H 3DIFA 2VDOL 4PTTB 3E3QE 2LFGA 4ZFOA 2HFFB 3ZL4H 2IJ0C 3JWDC 2HLFC 4Y4FC 4LKCB 1T3FA 3VG9C 4X5LA 1UWEH 5CIPH 4XP9L 5J3HD 1OD9A 4NNPL 4MX7B 3P30L 4BZYA 4APQD 5B3NA 1H3PL 2W0PA 5DR5L 1IQWH 2FB4H 4N8VA 1MCBA 4D8PB 1OTUC 5DD6A 4CDHA 2ICEA 5SX5K 1BWWA 5TGBA 3DV6B 3GKZA 3NFSH 3FO0H 3U7AA 1DN2A 3WFCL 3V7AG 4Z9KB 2LAAA 1I7ZB 2HRLA 4X0KB 5IVZA 3W0WA 3OGCB 5EG6C 2VLRD 1K3IA 2QQNH 3WFDH 4PV9B 4X6DA 5ESQB 2AJVL 1IEHA 1YEDA 5JHDD 3QQ3A 1WSST 1NMAL 4ZO7A 2VUYA 3W2DH 4ZXBA 4D9RE 1HDMA 1Z0NA 3GJFB 1S9VB 5EO1A 3RTQA 3UPAA 1QHOA 3O6MH 1HINH 5C09E 2NY1D 1JWMB 4JY5L 4F9PC 1JHLH 4ELMF 3TBTA 2VLKD 4KMTH 3RWCB 2MNUA 1FFPB 4M8QA 5KSBB 5I8OL 3FFCD 1U91A 2VZSA 4HWEL 5EU3B 4X98A 1KLUA 4TUJB 5GGTA 4LCYB 1JGLL 2IANB 3VWJA 3BAEH 4OIIH 5IW6B 2Y72A 4EDXA 4UBDD 4FQCH 5FB8B 4LCIL 1YEDB 3L7FA 5D6DC 5MEQB 5DD0L 3LKRA 4D0BB 3P30H 5EIQA 4EI5D 4W4OA 3VFOA 1CS6A 2R56L 3X14B 5LWYH 5F7HA 5CSZA 4FQJH 1RZKL 3O6KH 3SDYL 3FOMB 2O5YH 2B1AL 2IALA 1X4ZA 3PQYA 1V3MA 1IQDB 4KRPD 2JELL 2HFFA 4Y5XC 1IGYA 4N0UA 4KU1A 2R0LL 1MCCA 2CD0A 3LVEA 1LNUA 5CEZH 5D71H 1UJ3C 4P9HL 4XNMA 4L4VB 4L8SB 4F80A 3FQWB 1KIPA 3SKJH 4NBXB 3VXUA 2SEBB 4RMRA 3MUJA 3JV6A 2BNRD 1AY1H 4X5WA 2AW2A 2J6EH 3CVHA 3FCTA 1YY9C 4PD4K 1YMMA 5TH2B 3LSOA 1P4IH 2ESVE 4LMQE 3FQTB 4MXQC 3HI5H 1WWCA 5B4MC 4KDVA 4H26A 1BVKA 5DZLA 1EGJL 3V6OE 4K3JH 2YUWA 4LSVL 4HQQH 25C8L 5IB1B 3DVFA 5ISZB 1CE1H 2PTVA 3F5WA 2P8PB 3R8BB 4Z8FL 1YEFL 1DSFH 3QR2A 1A6UH 1YEHL 4PJDF 1S9WB 3VFRA 1OP5H 1F97A 5D2LB 2R8SL 2J1KA 2BDNL 1U8KB 4XNZC 2W92A 3K4ZA 5EUKB 4UB0L 2OXGA 3UAJC 1FE8L 4TVPD 1KIRA 1MFCL 1UM5H 4KDTA 4BM7A 3HS0B 1TMCB 4IRSA 4M6OL 4NQDB 2Y4SA 2F53D 3FMGL 5AEAA 1OP3K 1MF2L 5F6HI 1BJMA 4JFHE 3U6RB 2E7CA 3RL2A 3W2DL 4JRXA 1NSNH 3F12B 2OL3L 4FTVD 4M1CC 3B83A 4P48A 4ZUUB 1N3NB 1CFVL 3U30B 1QNZH 5ADPL 4S1DC 2E8YA 2XPGA 5FDWB 4G80A 1FNSH 5I8EB 3IU4L 4NQEE 4P2YA 4NN6C 1IM3A 2J8UE 2O61B 3QPXL 4J6RH 5J13B 3HR6A 4G8FB 4GXUN 4QHKJ 4I2XE 3MRMB 3LEXA 3V4PH 3SE4A 2AGJL 5A2KH 1F45A 1KB9J 4HXAL 2YHGA 3EYUL 3ARQA 3KNBA 3PWNA 2EDDA 4G8IA 2FECL 3K2UH 2X4UB 3O9WD 4N1CA 2FEEL 3DX7B 1YMMB 3DMMA 2DQUH 4RGNB 4LSPH 3MCLL 4OZHA 2UV3A 3K46A 4H1LH 3OAZH 4XAKD 5DFVD 1W72L 4B41A 5ALCH 4I0PD 2YPLB 2VLKE 2OR9H 1WCBB 1INDL 1KENH 3AMKA 2MWCA 3BGMB 2F5BL 3ARED 4X7TA 3F6LA 1QSFD 5EBMA 2W9DL 4YGAB 5TF1H 4L4TB 4JM2A 3WEXB 1CFTB 4U0QB 2D4DA 1QLEH 2G9HB 2XTJC 4JLRA 3JWDL 5ALBL 1K2DB 4XCCL 5C0JB 2UUDK 3KPLA 3ZYZA 2OTWA 3FO9A 2ZCHH 1BD2D 4PJAF 4QRUB 2ARJA 4P2QE 5GXBB 4KRPB 4P3CL 2KQNA 1YJDC 1N2RA 1SY6L 2G5BB 2W9EL 1BIIB 4DKFL 3PWUB 1DQQA 4L4VE 3EZ8A 2R23B 3U46B 2PF6A 4E41E 1BZ7B 2EECA 1TCRB 4PP2B 3OKNB 5I8CA 4OV6F 4U7SA 2FBOJ 4H25A 4HIEA 2QQQA 5LG1A 1RUAL 4WHYG 1KC5H 2BSRB 2IAND 2VMFA 2AABH 3IDYC 5E8DL 2VL5B 4ZAKA 3VD5A 2XWJB 4JM2B 2P5WB 3RL1A 4GOSA 3LCYA 5HHVL 3ZE0E 3NIFF 5DFWH 4Z7VB 4PRPB 5I1EH 3PV6B 3NCEB 5JPNB 4N1EA 3CUPA 1H3VA 2NXYC 2XIDA 1WZLA 5D5ME 5IVXB 1VPOH 1XGYL 1XF5A 4ZFZA 4GAYA 2IEPA 4R7DA 1WLHA 3DRTB 5CJQL 1I8MB 1YYLL 3OXSB 5HHME 5K9OB 4D3CH 1WITA 3QUXA 1EEYB 1X6LA 3DUSB 3QDGD 4OLUL 5GHWL 2LAGB 2LQRA 2NW3B 5HHMB 3FB7B 2EIDA 4XZUB 5GGRA 1LE9A 1HHJB 3IFLL 4MNGE 1JTPA 1R3JB 2BNUB 5E94B 4K8RH 2V17H 2KDGA 5HDQL 4PY8I 4NN5C 5E2TL 5FFLA 3GM8A 5D7LA 1MWAH 4UB0H 4EN3A 1FORH 1KEMH 4JN2B 1TZIA 2R0ZH 1XMWA 3IDXH 5T3ZH 3DX9B 4KJQD 2V2XA 3QG7L 2GFBA 3QULB 1JZ7A 4M7JH 3GFUA 3GMQB 5A16B 4JZOB 4UOJA 3O0RH 3CGTA 3L7EB 4NOFA 1NCWH 2UZXB 1T83C 4WTZA 2OR9L 1Q1JH 1Q0XL 1J1PL 1QG3A 2FIKB 4HWZA 4HC1A 5CWSB 7FABH 5F97E 2GSGB 4P99A 1NFDE 3ULUF 5I1KL 5CEXA 2OCFD 1M05A 4G6FD 3RAJH 3LD8B 3SY0A 4A2LA 5JLZA 2ZKHL 1G6RA 3ZDXE 5JHDB 1DEEA 4NP4L 4GFTB 4OGYL 4XC3L 1JE6A 4Y19D 4AQ1B 3MRLA 5F9OH 4FTVB 3HAEH 3TVMD 3BQUA 5KG9A 2D31B 5C07E 3QXWA 1J1OL 4M61B 4IJ3C 3H0TB 4MSWB 3RVWC 3ALWA 5CBEA 3DVNB 5D7IA 4GRWH 1KXQE 3HN3A 3JVGC 1CN4A 1JV5B 2VH5L 4NRYB 4JFXA 1ZAGA 4O51B 3G08B 2Q20A 2VDNL 3PWPB 2MFNA 1KPRA 1LWRA 1MWAL 2C3VB 4N0CC 5CSZB 3MROA 2YPLE 3B6SA 1QFWH 4YPJA 5GRYA 1IC7L 1NL0H 4POZC 1RUML 1T1WB 1UWEL 1BMGA 1N6UA 2UWEE 1IGCH 2C3XA 3PGFL 3QG6B 1P4LA 2VKXA 4YR6B 3O9WB 4PJFE 5TF1L 1F2QA 4EDWL 1GGBL 3QWRA 3ULVF 4JRYB 1BX2A 6FABL 3GRWA 3W11D 3FO1A 5CEYB 4Q9RL 4XP6L 2EXYC 2NXZD 3IF1B 2VQ1A 1H3GA 2KUTA 4G8EA 3CFDA 4OZIB 5C8JA 4HWBA 2ARJQ 4KWUA 4K94C 2L0DA 1T0MA 2E7BA 4LQ1A 1BQLL 3CDGB 1LK2B 1MVFA 4JPVL 5J6GB 5E9DD 4RGOH 2AJZA 5GGTL 5KOMC 3L3KB 4FQHB 4JB9H 5T3XH 4WY7L 3VE0A 3TFKD 2V2WA 1AD0B 4G9FB 5IBUB 1M7XA 3TYFA 2AP2A 3BJLA 5KSUA 4ZXBB 4ZUTB 4K71B 2RCSH 2R0KH 4JM2F 3V6FA 4LHUA 4QXTA 3NCBB 3KR3H 2P42B 2IAMD 4J3SA 3GSRA 3MGAA 5HI5C 2ARWA 5IIEA 3TBSB 5ESAB 4P5TA 4CMHC 5J56B 2WUCL 2C5DC 1UG9A 5F88A 1NAMA 1RZKH 5HTSA 5DHVH 3MTRA 2NX5D 1OTSD 15C8L 2R9HD 4PJ7F 4Q7DA 5F93C 5D5MF 3EYOA 1QKZH 4X9GA 2W59A 4Y16A 1HKFA 5JPNA 2ZJSH 1AP2B 2H2PD 1MCDA 1EMTL 3BDYL 3H42H 1J10A 5FGRA 3QIUC 3X13A 1CVRA 3PL6B 1I3RB 1X5FA 2X4RB 5IF0A 3DURB 4EJ1C 2YC1A 3T0XA 2VXTL 1T6VN 3DUSA 4LSRH 3QXUA 4M93B 1DQTA 1Q9LB 1YN7B 3ZDZE 2BVPA 2XQBH 5JDSB 4OGYH 4PB0H 3GMRA 4MCZA 1NGPL 1R24A 3GJEA 1JCKA 3D0LA 1T5XA 3K8KA 5E2VH 3SDXA 1EEZB 1F58H 4CKVX 4EOWL 1EO7A 1XR9A 5E94A 3MRIB 1FZKA 2ADIA 4NO0A 2X4TA 2NZ9C 2IAMA 3IDUA 3DXAB 1FGVH 1KIPB 2WWKT 4I9WE 5F89B 1QBLH 2H32A 5HYJA 3X11B 3IVKA 1DBBH 2VLMD 1KGCD 3MV11 4ONHB 1BQUA 4XPFH 4WENB 2ZPKL 4JY6B 4LLVB 1R5VA 3EO9H 2XKNB 2Z31B 3RDTA 3RQ3A 2YA0A 1MSPA 3OKLB 1Z9MA 1BJ1J 5EFIB 3MJ6A 4YX2L 5TE7L 2Q1EA 2AKRA 1A3LL 4Q74A 3MCKB 1WBXA 3MX0A 1JI1A 5F96H 2YS4A 5CAYB 5LKNA 2IADB 3MLYL 4LSSH 2LTQC 5DJ8A 4P49A 3QAZB 4TVPE 1IGIL 4PRPE 3JTTA 1A1MB 2WBWB 1SJHB 2XN9E 4G8GA 2DQTH 4YDIL 4HG4K 3S7GA 4OV5A 3GBMH 2APFA 3QDGA 5HHQA 1U8NA 5FCSH 4PYGA 5I30H 2ESVD 4R4FL 3TN0B 1P9MC 2FWOA 3AXLB 3MV01 4L4TA 4R7NA 2NXYD 1CGXA 4DUVA 2ZCKH 3S96A 5C3TA 4LLUA 2UVEA 2AJXH 3BJ91 4M61A 4LARH 2VQUA 4FNLL 3UTPD 2HMID 5SWZD 3BEWA 2FSEB 3K8LA 4AIZB 5D1ZB 3LS5L 3ALXA 3IDIB 2FD6L 3N1FC 1T04B 1MFAL 5FK9B 2CK0L 4ZYKB 1CG9B 3QO1B 2ICWJ 3MRDA 4GQ9L 4EZMA 3ZKQD 4APQB 4YDKL 43CAB 3GI8L 3PGFH 4RFEB 1T1WA 3GK8H 4F57L 4JFYB 1A6UL 3MGTA 5IB2B 1XZ0A 4DKEL 4FP8H 2LABA 2CKBB 2CLVA 3L3JB 4LU5L 3MNZB 3VFTA 3H9YA 3MRKB 1J9CT 4HGWA 2W65B 3L3GB 3HAEA 4O00A 3NZHL 5GZND 3IF1A 2RGSA 4YHML 4HZAA 3QDMB 4MAUL 3EYVA 3BIBX 1D5ZB 5A40E 1MJ7H 1QPPA 5EU7E 5CJOH 1OGTA 1ITCA 4NN7B 2HT3C 1RJZA 4AENA 5CP7B 5SWSD 1ZSDB 4WDIB 3H3KA 2DIBA 3NCFB 4I2XB 1AD0A 3U48A 1IKNC 3WJJC 1N7MH 4UILH 3F7VA 2CSPA 2YD5A 3VXTA 2F5BH 4I0PA 5D96B 4J12A 1PY4A 3SE3C 3S97C 2J4WL 5FHAL 4KAQL 5F9JA 2JKXA 1OTSC 3SHSA 1CE6B 4HK3N 5HYEA 2UZIL 4CJ1A 1NC2B 4I48A 5KSBF 3MRRB 1I3UA 1QRNB 3E6HB 1OHQA 3QEGH 3SE9L 1VGKB 4HJ0C 3ULVD 1U3JA 4HWUA 4UUJA 2JE8A 2VL4A 4KDWA 4HKJA 5F7MC 4BZ2H 3CSGA 4Q58C 1RVFH 2DLFH 1JWSB 3OAUH 2EYRA 2QTEA 3GMNB 3U2SB 3QNXB 5BS0B 4APQC 1MCIA 1P5UA 4ZS7H 5C70A 1F6FB 2P1YA 3QEHB 3BQUC 4S0SD 4XBEL 3H6JA 4UQ3B 4KRLB 4ORZC 2X5PA 1T04A 4NZDA 5C9KA 4XP1L 4XP4L 3AS3A 3ZO0A 5E7BA 2AABL 2WSKA 1FLRL 4X6BA 2P5WA 3MC0A 4WI3A 1TIUA 2ZCLH 12E8H 3O4LE 5J57B 3UROR 4KUZL 4XTRC 4CJ0A 4DKFH 1G7LA 5FV2A 5HI3D 2RR3A 2M1KA 2C26A 1JHKL 1S8DB 2F19L 1YPZE 4S1RH 4Z7UB 4D8PA 5DJ2B 3KPSD 4OLVL 3GSQB 1JWSA 4I0KA 3JWOH 1U8HB 4R7DB 2Q6WA 3HRZB 3SKMB 3VDAA 5DMGC 4FFVD 5EO9B 2DKMA 2HLAB 4GSDL 4YBQC 2N7BA 3AUVA 4ZNEE 3UJIH 5SWSB 2DRUA 2V5MA 4HMCA 2H41A 3D48R 4HPOL 4PUBH 3BW9A 3MUZ1 4R8WH 2XKUA 4U1MA 2OJZL 1ORSA 3CFJB 3ILPB 1TVHB 3PWPD 5C0FA 3SEPA 3B9KD 2AEPH 3A6CH 3BEVA 2ATPA 5F9JB 5C08B 3MLRH 5I1AB 2HFGL 1AO7B 5HYSB 3UYPA 3LRHA 3QDJA 1BIHA 1LEGA 1OSZB 1CTNA 5DRZA 4HLZH 3O0RL 2FJHA 4PV8A 2PCPB 4MQ7A 4MCYA 1KLUB 3EGSA 3A6BL 5DUMH 3ARVA 3T0VA 1A1NB 4NNXA 4BSVA 5A2LH 2E9BA 2QBWA 1JF1A 2FX8H 4JQIL 1N0LA 1X4XA 3U83A 4U31A 2ZUVA 1ZGLB 3BOVA 5KSUB 1ZA3A 5HDOA 3Q6FB 2V2TA 4ODBD 3P4MA 1JPST 5JORB 4F57H 4ODTH 1EFXB 4Y1AA 5E1AA 5E6ZA 1UXSB 5JW3L 1U8KA 3D87B 5EC2A 4BQ6A 3DI2B 4DKDC 4ENED 1X5LA 3O6LH 4J8RA 5D1ZD 1QLRB 3DSFH 4P4KA 3T0WA 5DD1H 3VXUE 1NEZA 2C9AA 4L8CA 5B4MD 4DQOH 3M07A 1LO5B 5T1MB 3X17A 3RAJL 4R4BA 5GJTL 5JOPD 4XWGL 1W0YT 5IGXH 4R0LA 3RPKA 3WFBL 2NY1C 3L95A 2AQ2A 2VLKA 2OQJB 2YPLD 3SBWA 4PLKC 3I02B 3OWEA 4YHNA 5LGJA 5EU5B 5J11C 2FEDC 1X5YA 2DWEB 3VRJB 1G9NC 3FJTA 4ETQB 5BVJB 1NCUA 2YUZA 2DM4A 3ES6A 4TVPL 2NY7H 3GSVA 2D7OA 4XNUH 5F1KC 1U8QA 1B88A 5HI5D 2CR6A 4YXHH 1ZEAL 4L4TE 4G80B 1PG7W 1JPGB 3VFMB 1YQVL 1TZHA 3BIKA 4JZNB 4P23D 3TYGH 1WFTA 3C5ZB 3GMPB 3NPSC 2BY0A 4G8FA 4KZDH 2B1HL 1JNNH 1MY7A 5E2WL 2HVJA 3QIBB 2P49B 3HI1B 1A7BA 4FS0A 4G9FD 4O02L 4LIQE 2W38A 1BD2B 5HHNB 3MMEA 4M3KB 4RMUA 3W0WD 4JHZA 1MRCL 3DX8B 4KXZH 3W9DA 5EB9A 4DZBA 5IVXA 5DURB 1N59A 5I1CL 1HYRC 3BZEA 3QEQD 2NY6C 3WKNA 2G2RB 4HF5L 3MREA 4UTAL 3L95B 3MLWH 3U0PA 4WI5A 5ID1A 1IGCL 4ZS6D 4XNYH 4C83B 8CGTA 1C5CL 3MXWL 1DSFL 5DVKA 3CFEA 1G7PA 1KJ2B 3MRNB 4JHBA 5DHYA 2PTUA 4KXZI 4HBQA 1RK0B 2VLLB 2X89A 1JHTA 4PBXA 3RL2B 4XZUA 3CK0H 2X89D 4U6VL 3EDDA 2ILLA 1G7MB 3NIDF 5F1NB 2NPLX 3P9WB 3PDDA 4PRAB 4RDQF 4Y0GA 1ZA3B 5GJTH 1NL0L 1NBZA 3SDCB 3FRUA 1YDPB 5HI3C 5IFAH 1O7VA 2B20A 4DN3L 1Z9LA 1U3YA 5E7FA 2NNAA 1KXVC 1YYML 3QEQA 2P5ED 4FQLL 2BMKB 1CFSA 4UIKL 4L9LC 4LSPL 2EEAA 4X6CA 3BWAB 1F02I 4OLVH 4OD1H 4F33A 2IH1B 3H9ZA 4OLXL 2NY7L 3WFZA 4GRMA 3DI3B 1ZLSL 1ZK9A 5FO7B 4FQXA 5IB4B 2D0GA 2EDWA 1FGVL 2A0LC 3I6GB 1HH6A 1T21B 1E28B 2I60H 5MEPB 3L9RA 1D9KD 1A7PL 3O2VL 4JAMB 1LK3H 2DQDL 5IK3B 2VZ3A 4PUBL 2J12B 4AL8L 4BH8B 4L4VD 4MLIA 3KPSB 4PS4L 2R4RH 1T1YA 1ND0A 4PJ9B 3CDFA 3SE8H 2UYLB 3GMOA 3K2MC 4R26L 3ILPA 2VLJA 4PJGF 1R3KA 1HNGA 3DWTA 4P2QD 5C3LD 2CH8A 3WXWH 4LGRB 3I3BA 3QUML 4QTHA 4WI4A 3ZYIA 2YA2A 5CINL 2GJZB 4GAYB 1WWWX 3RGVA 4UT9L 4YZFF 3MMEB 1UWXH 2Z31A 3RDTB 1JNLL 3W9DB 1D6EB 1GAFH 1RUAH 3EYVB 3WFCH 2OK0H 1QEWB 2Y36H 3BWUC 3L6FA 5IEKA 3DXAE 3WLBA 2BY2A 1Q0YH 3BDYH 3FB7A 4YEFA 3H7BB 4RWYH 5C08D 4AM0B 2VNCA 3UPRA 1HSBA 3SO5A 4PJBF 4XCEB 4GW4A 4P57B 1P2CB 4NJ9L 2YXFA 3JWNC 3ULUE 4ZO8A 3T4AB 4KK9D 3G5ZA 1JF5A 2VSDA 3WKMH 3EBAA 3TVMB 3U7YH 1QYGL 5FGCB 3KPRA 3ZL4L 1UXWB 4LIQL 4ODUA 3UO1L 2BOCA 1T7WA 2V6HA 5SWZE 2B5IC 2R2EB 5ENWA 4KTDL 4KFZC 4NQXB 4U2ZA 5JXEA 5FYLD 4TPRL 4GRWE 4HUXA 5C0CA 1NGQL 4PRBA 4R6UA 1A14H 1KBGL 3SE8L 1YEIL 2CIKB 4MVBC 5IMMA 2DQEL 4KKCD 3S88L 3MRPB 4PIRF 4PRDB 1I1YA 1U8OB 2VXUL 1FLTX 3GMNA 1VSCA 3S3SA 3LDBB 3OR6B 3QQ4B 2R2HB 3LKPB 4F7MA 3LY6A 1V7NL 3CLEH 4RGMB 4FG6D 1QO3A 3QHZL 3EYQC 3QXTA 1PD6A 5IFAL 3MV8E 5HHOE 4U6YB 1JZ2A 4H1LB 4YXKH 2OZ4L 4PJBB 2G75A 1B4JL 1BBJB 1DUYA 4TTGA 1FGNH 1K9TA 5C86A 3HE7A 1U95A 1CDIA 4NZUL 1XGTA 3UJJL 1MLBB 3MLSL 3ARPA 3QIBA 4KRMB 1WFUA 2IF7A 1CICA 1RZJL 5ECJE 5C0RH 5GGVY 1NMCC 3U7WH 2XXCB 1RZJC 4LEOA 4PJ5A 5FGSA 3VW3H 4U1KB 4U6HA 3HC4L 3MBXH 1A7OH 5IROA 1MFNA 3OB8A 2G60L 5I2IA 4GXUM 3CAFA 2YD3A 4QF1B 5GGVH 3PWJA 5EC1A 1FNAA 4XCNA 5IOPA 2DD8L 5MI0C 3NBNA 2N1KA 2GT9A 3ZSTA 3QFDA 5H8DA 5F1SA 5DURD 5ISZA 3HB3C 3F7VB 2Y5EA 4CBPA 3LH2H 2CMRH 5LVEA 3JV0A 1A2YB 3CMGA 5DHVB 1K8IB 3WO4B 5C0DB 4P5KA 5IR1B 2H2PC 3ULUD 3MJ9H 4F3FA 3SKOA 1UYWL 2FL5B 3D2UA 4ZUWB 3TVMA 3AMLA 3CFBB 3GO1H 2YPVH 4UOW0 3MACL 1GAFL 4ZAKC 5I1AA 1LO0H 5DD6B 5MI0B 5FA4B 2H26A 2FYYB 5ETUB 4L3CA 4UAOC 2HWZH 2ZCLL 1J1XH 5BRZB 1L7IL 4FQIH 1LEGB 3L3OA 5C71A 2YPKA 1FDLH 1UH3A 1ZT1B 4JO4H 4PJIF 4U1JB 4ELMB 1MIMH 5K9QG 3R0NA 1RIVL 4OLWH 4ODWB 1MI5E 2Y6SD 2ZSWB 4XBGA 4NWUL 3NFPA 4KQ4H 1ZWIB 3QRFM 1WAAF 3B9KA 3DUUB 3GBNL 5FKAB 3UJTL 4U1GC 2EDNA 4OBRA 1XIWB 3IETA 5EUOF 4KK5C 4WTZG 4QGYA 4LIQH 4M7KH 1HHIB 3S36X 1TJHL 4G6JH 1NDMB 1HZHL 1QSEE 5GRVK 1S7WB 4ZUWA 1CFBA 4NO2A 4G5ZL 2BK8A 1PX3A 1S5HB 2HKHL 3RIAF 2X4PB 4DZ8A 4X7CC 1NCCH 3GMMA 3DHJA 1AQKH 4MXWL 3RL1B 4G6KL 4XBEH 4YHZH 1WBZB 1IL1B 5GGVL 3GHEL 4LLQA 2ICWB 4P3DA 5CEZE 3WN5B 3T0EE 2R8SH 2ADJA 4XNZB 3ZT5A 4XPGL 2MHAB 2KZ1B 5JA8B 1I3RA 4MB4A 1ZGLM 3AB0C 32C2A 1NLDL 2E7MA 5C8JB 4NSKB 4WFGE 2ITDA 1OTUD 3QFJD 4JG1L 4FHBD 4KKNA 2R15A 2X2YA 4NGHH 2NYYD 5B22A 1QZ1A 1SYVB 3E8UL 1UKQA 5IW1A 1YEKH 3SJVD 4ZS7L 1BM3H 4P46C 4P2OC 3OPZH 5C0NC 3IJHB 4GAGH 1X5JA 4V1DB 1ZOXA 5CKGA 3ZHLA 3NPZB 4OFDA 1YNKH 3H3PH 1A2YA 1FIGH 4AZ8A 3DUHA 4WI7A 3GSRB 3U9UB 1CK0H 4ODUB 5GSRA 1T66C 3O2DL 4HIIB 1GZQA 4U1SB 5IWLA 4OCRL 1KACB 5SWZB 4UDTA 1A9BB 1J05B 4P2RA 4POYA 3IU4H 1C08B 4XXCC 3VH8G 32C2B 3C6SA 5C0BA 5C09D 5EFIA 3I85A 2DD8H 3OKYA 3QNZA 4JPWH 4JY4B 1D6VL 4NBYB 2OMBA 4FQ2H 4OFYD 1G0DA 5DJDB 4ZDHA 1CXFA 2AEQH 1N64H 1BQHA 2AEIT 4L29B 4WW2C 3EYQD 3MRNA 4OSUH 4JQIH 1CXKA 4LF3A 2HFGH 4V1DA 4IS6B 3I75B 1DFBL 4NPYA 1ZWIA 4NNYA 1U8MB 1EA9C 1Q9LA 2WMPA 5HVWA 3RPIA 1D5MB 3DJ9A 4D9LH 3RDTD 3UDWC 1GL4B 5DHXB 2YN3A 4XNUL 1U95B 3TFKC 3NA9L 2B2XL 1CL7I 1RHHB 3STLB 3EUUA 3AM8C 1X5XA 1UZ8A 1KN4L 3CSYB 1JPTL 3Q1SH 4TUJA 3KJ4B 3TH4T 3CUPB 2C1PB 4BUHA 4NJAH 4NQDA 1YNTB 1I7RA 2ZNWA 3OJMB 2CLRA 3TN0C 2OQJA 4PY7A 1LD9A 4N1HB 4Y4KC 4UV7H 1W0WB 5CBEB 3H3PL 3VRJA 4DVRH 3PJSA 1DVFD 2A1WH 3GKWH 3H9SA 5J1TC 3ARGB 3RNQB 3RZWA 2NY3B 3T65B 1ZHLA 3MV7B 1CD1A 3FOMA 4N68A 5I18L 1E0OB 1D9KB 4XB7A 4O2EB 5IJKC 1FPTL 1T20B 3O9WC 4N8PA 3VI3E 4MXVF 5K9JH 3MROB 5FF6A 4EKXA 1K3ZA 1F00I 3MJ8B 3IAPA 5IQ9B 4YGVB 1IAKA 2R1YB 3PL6D 4NKDA 1KB5L 3SDAB 1KUMA 1YMME 1NBVL 3FQWA 3ULVH 4I18A 1EHLH 2J5LC 1ZVSB 4IDJL 2WQ8A 3VXUB 4QYOA 1IEBB 2JTDA 1ZHKA 5HHVH 1XGUA 1MELA 1FL5A 4FQJL 5SWZA 3PWPE 2R29L 5BRZE 3CCHB 3CH1B 5CP7A 1DVFB 4F9LC 3E8UH 2OR8A 4QRSA 2Y6SC 5TFSL 3HUJA 3Q6GH 5D6CB 1IZKA 1T4KB 4FP8L 5HGHA 2NY0B 4I2XA 5DS8A 1PLGH 3M1BA 1GHFH 5D70H 1CDUA 4U1IB 2DQTL 4YDIH 3WSQL 1FYTA 3HA0A 4KV5E 4KJPD 5DQ9B 3O3UN 4MCZB 2QSTA 3TT1H 3FO0L 4M7KL 4HZLA 5E4EB 1PYWB 3QNYB 4OZGE 5CILH 3RHWF 1HHIA 3Q48A 4U1HB 3TA3A 1FNGB 5TE6L 4XP9H 5E9DA 3QUYA 3T2PA 4KMTL 4F7EB 3WNPA 4FFVC 3H8NA 1ZVHA 5D2LA 1BQSA 1CQKA 5CJBA 3DTXB 2VITA 1Q9KB 2NY5H 2WAHA 2WBJA 4RFEA 1BAFL 1P4IL 2ATPB 4YK4C 1KB5A 3IKKA 1MIEH 3GMMB 4YBHA 3J7HA 4JRXE 4DGIH 1U8JA 2GTZB 3WN5A 5FV1L 3KJ6H 4LCWD 1AGBB 2DLTA 4HS3B 1RY7B 1TJIH 4OSUL 4QRUA 4L9LA 4OLYL 3SGDH 5C1MB 2Y25A 3MUY1 4UTAH 5I1EL 2YRLA 4KJWC 4XP5H 3QEUA 1YECH 3RTQC 3KGRA 3C6LB 2RAMA 4OD2B 2E6QA 5FYJL 4PJHE 2F5AH 2QLVB 5KJRL 3LKOA 3GI9L 1I7UB 2DI7A 1ND0B 4PJ9A 4ZXBC 3P0YL 2O5XH 5JUEH 2ZOKB 2H9GB 1J0IA 4MDJA 2BVPB 5C09B 3PHQA 2JCCF 4RWYL 1GGUA 3RWJB 5ISZE 2VLRB 2V5YA 3OL2A 4GQPH 4WGVB 3D85D 3N50A 4U6TA 5J1AA 4KUCF 1MRFH 2J6EL 1IAKB 2R1YA 3FZUD 4KI5F 4GG6E 3CC5A 1OAZH 4UT9H 3F7RA 3L5HA 4OZHE 4JHAL 3PWNB 3OX8B 4K3JL 3C6LD 5MEQA 4P9HH 4UTBL 4NHCH 4U1GB 1C5BL 3QIWA 2GUOB 3O6ML 3RY4A 4U1MB 5I66A 3KAAA 4WUKH 3MOAH 4QRRA 3DO3A 4R2GD 4LF3B