3QCUH

Crystal structure of the lt3015 antibody fab fragment in complex with lysophosphatidic acid (14:0)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
223
structure length
219
Chain Sequence
EVQLVQSGAEVKKPGESLKISCQAFGYGFINYLIEWIRQMPGQGLEWIGLINPGSDYTNYNENFKGQATLSADKSSSTAYLQWSSLKASDTAMYFCARRFGYYGSGNYFDYWGQGTMVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords LT3015 antibody Fab fragment, heavy chain
publication title Biochemical and structural characterization of lysophosphatidic Acid binding by a humanized monoclonal antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 219
sequence length 223
chains with identical sequence I
ec nomenclature
pdb deposition date 2011-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qcuH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qcuH01
5D2LB 3ILPB 4HF5L 1ROWA 3MOQA 3Q6GH 3GI8H 3MLPA 2XXCB 1DSFL 3IRPX 1N3NA 1M7XA 5D1XD 3EJZD 4M3KB 2XZZA 3FT2A 4LK4A 5HGHA 4OD2B 1GGIL 1NLDH 4NPYA 1IZKA 2DQEL 1FFPA 2V7NA 3O11B 2ZKHL 5JXAL 1NGXA 3DSNA 3OAUH 2O5YH 1AY1H 4XNZC 1DQLH 5GJTL 4RZCA 5IFAH 5HYQA 4RRPG 4JM4L 3SGEI 4D0DB 3BVNA 2YA2A 35C8L 2FGWH 1TZHA 3ZO0A 4OFDA 4ALAH 5D2NC 3RDTB 4C56D 3H7BB 4UAOB 1JZ6A 4NBXB 3MV9B 2H6PA 4TTDC 4BQ9A 1XH3A 4JFZL 2V2XA 3H3KA 1MCDA 4R7NB 4WEBL 2Y07H 3C60B 4QEGA 4HJGB 1U8IB 5D7IE 5E99L 4OV5A 3SDCD 4CJ1A 2IPTL 4YAQA 1S7UB 5FYJD 4JB9H 5IEKB 4HBQA 3ZLQC 4XB8A 3P9WB 5EO9B 2GYSA 5BMFH 1DQDL 1EZVX 3C9NB 3CAFA 3AU1B 4NZRH 4WI6A 4HULB 4GRLB 2X42A 1KGCE 3GGWB 4PLNC 3V79C 4OFYA 1FZOA 2VXTH 4PJGE 1KLGB 1AR1C 3C6SB 5D7IA 4K3JL 4WNQA 4QTHA 2X1XR 5J6HB 3L95A 4HUNB 5C70A 3KDMB 4RAHA 3VFTA 5DHYB 1EO5A 5ICXB 4U1JB 3D18A 1N5YL 4JKWA 2C5DC 1A9EB 4JR9H 3ARFC 3RGHA 3FB8B 1C8PA 5B39A 4PJGA 3LH2H 5J13B 3QUZA 2R56H 3GSXB 1BM3L 1W0YT 5ITFB 3VXUE 2DN7A 4V1DB 4MA3B 1MFAL 4X9IA 3S35H 4JN1H 4ONHA 2R8SL 1IAKA 4FQXD 1IGTA 4FQJH 4HJJH 1RUAH 3QYCA 4W68A 3DGCR 2V5RA 3WNNA 4OF6A 3KGRA 2FCBA 2YSSB 1MSPA 1SEQL 3QNXB 4DAGL 3TVMA 4NUJB 5HXMA 3V4PL 5J6GB 1G9ML 4E42B 5M95B 4JPIB 3BZFA 3VXUA 5JQ6L 2GKIA 1GPOH 5ENWB 2BOCB 5IW6B 5JORA 3DSFL 1KJ3H 3TA3A 5EIVA 4XVSL 2FEDC 1XGUB 4NIKB 5HI4C 1FZKB 5E94B 1DBAL 5GGTL 3P30H 3JUYA 2DTMH 3AGVA 5DD0L 3LN5A 1ZHLA 1LQSR 5FHAL 3LQAH 2VXUH 1RJYA 1CD1B 2FLRT 2AXFB 2FJFA 1P4BL 4XNUH 1E27B 1KCUL 5MP6L 4KZEH 4HUWB 2I26N 4HS8L 2X89A 4JANA 2ESVE 1WC7B 3VFMB 5A3IC 3G5YB 4ZTPH 4ODUA 3MV7E 3SE8L 3WHXA 43C9A 4I48A 3V5HA 4U31A 5D71H 4I2XB 5F7EL 3BH9A 4MQXC 3OZ9L 4OCYL 2BVYA 1ACYH 2V5MA 1DQQB 3RVTC 4AMKL 2D3VA 1O7SA 5D1ZC 3UTTD 1K2DB 3UMTA 3ZHKA 2A6DA 1B0GB 4H26A 1AGCA 2ESVA 1Q72H 3FONB 3HZYA 4XBEH 3UO1H 3RZCC 5I1KH 5MEND 4OM1L 4PRPE 3MV7A 1TJHL 2HLFC 3NACL 4PPTA 3B9DA 3WDHA 1CL7I 1RZJH 1OHQA 3PABB 1UEYA 1JTOA 3L3JA 3V6ZA 3WMSA 4ZFZA 1ERNA 3QJHA 1JHTA 2EEAA 4O00A 4E5XB 3GI9H 4KRLB 3RVUD 3MLSL 2P7TA 4I77L 4K71C 4TSCH 5E2VH 2O61B 3VWKC 4LDLB 2E7HA 5IVOA 1J11A 4LLDA 5I1LB 3EO9L 3A6CH 2EXYC 2WK2A 4H1LB 1PEZA 2HTLC 4GFTB 4ERSH 4NN6B 3VD9A 3O9WB 4X9HA 4HS6A 3HR5B 3KXFE 3WNKA 3SKNB 3ZL4L 4PGBA 2E5EA 3I3EA 1PG7L 3GBML 4YGVB 1YEFH 3MLYL 4TPRH 3CXHK 4HH9B 4RFEB 3MLVH 3PXJA 2YBRA 1R5WB 4KRPC 1FGNH 4HCRA 1EO8H 5CINH 4IEFB 2HFFA 1T4KA 5EDXA 3FO1B 4JDVB 2AEPH 4M7JH 2BC4A 1UM4H 5AYUH 1MCSA 3KXFA 4YDKH 3HAEG 5EOTB 4YHML 4OGXH 4M00A 1QBLH 2OBGA 5DJAB 5EU6E 2UY7A 4Y4HD 4WFFD 4ODXB 4ZPTA 4K23H 1JNHA 3SDCB 2Y25A 1S7TB 3K8KA 5D8JH 4JZOA 1I9IL 1DEEB 4Z0XB 2NNAB 1EA9C 4RMTA 5HVFB 1U2CA 4JLRA 1J0JA 5IBTH 4EVNA 1YJDH 5E03A 1UGNA 4MVBD 4RIRB 1BOYA 3TO2A 5EC1A 4OJFL 3MNZA 5I8EA 1I9EA 1BFOA 5IF0A 1JPSL 4QRSA 4MXWH 5A16A 2ADJA 4Q6IC 2EDHA 1R3KB 1JGVH 5TPWH 3U48A 4LSQL 2VDPH 1FLRH 5HYJB 4TVPD 5IR1B 4BFBD 3WFCH 2V2TA 1NGYB 4H25B 4OQTH 4K94L 2AK1H 2R1YB 3W0WA 2XTJC 1LWRA 1GL4B 3D9AL 4F7EB 4KKCD 3D87B 3QIBC 2JK5B 4R4ND 4ZD3L 2UYLB 1IEAB 1UVQB 2J8UF 3NGBC 2YKLL 4MXVE 4MXQC 2Q8AH 1MUJA 1BZ9B 3TZVA 1KXQE 1KIRB 1JNNH 1X3DA 4P2OB 4P2QD 5CEYA 2DQFA 1RIVH 5DS8A 5CUSL 1S7QA 5IESH 5J12B 1A6ZA 4TVPH 3L3OB 1Z0NA 4YDVB 3RX8A 4FQCL 32C2A 1BWWA 2VDLL 3DTXA 3U1SL 3U46B 4DGIL 5T3ZE 3KHQA 1QBAA 2XG4A 1G7LB 2UWEE 5TE4L 3N85L 3S9DB 1FBIH 5SWQA 4F33B 4X9GA 3FRUA 1T21B 1JMXA 2D7TL 3IJHA 2JCCE 1CD0A 3H42H 2EDXA 3HNSH 1WLHA 2NY7L 5F7UA 1CGYA 4Z76A 1GHFH 1UKQA 1NC2A 3GKWL 2W1NA 1MOEA 2MKLC 2WAHA 4KPHH 4IRSB 1MAKA 4QNPF 1TJIH 3VI4F 3HRZB 2VYRE 1ZGLB 1R3JB 4ZFOB 2UWEA 1JZ8A 4U1LA 3F7YB 5ESQB 4PLJC 3G6AB 5E5UB 2N1KA 4WU5B 2BNQD 4QT5A 1QD0A 1DLHB 2JCCA 5ALBL 4OIIL 2HJKA 3JV6B 3T4AB 5J4MA 1A7PH 3BUTA 3Q1SH 2E8ZA 2G60L 3H2WA 5C08B 3VXNA 1S7SA 2AK4E 2F58L 2VZTA 5GS1C 3TJEH 4D0CB 1JPGA 1Q1JL 1U3YA 3SDDA 4K7FA 3RAJL 2Q6WA 3IDMA 5F9AC 4J3OC 4GKNB 2VDMH 4JFHD 4YHOH 1I9RL 1WFOA 2X4PA 1JGDA 3U7WH 2OL3A 1FIEA 1HDMA 1I1AC 3RA7H 5C6TL 4OLZH 3L5HA 3QUXC 5ID0A 3UAJD 5J56B 3KJ6H 4N8VB 1FIGL 3QDJB 3TBVB 4KZDH 5DVOA 3IXTA 3M17A 5CS7A 2E6QA 5HHME 5TE7H 1TPXC 1U9KA 5SWSB 5HHXH 3EOBB 3QWRA 2FX9L 1MCOL 1OQXA 2IBZY 4NDMB 1DUZB 4J8RB 4O5LL 4AIZA 4CADB 1C1EL 3SKJL 2YN5A 1A6UH 5CD5C 5JOFB 2A83B 4Z7WE 1UJ3B 5EZLB 2VZUA 3DMMD 3WFBH 2PYEB 5I8KH 4FA8A 3OKOB 3BGAA 3WFDL 1XIWD 4KTEH 2NXZC 3VFGL 3KLAA 4ZFGH 4RGOL 5ACLA 4HWZB 1T7VA 2IGFH 4KH2A 1BP3B 1BX2A 4EOWH 2ZUVA 2R15A 2ATPB 1T2QL 2DJUA 4JQIH 4UDTB 2DF3A 4Z7WA 2F19H 1VPOH 2NYYC 3LEXA 4YC2B 3QHZH 4I0PA 1JYNA 4Y4KC 5KJRL 1WWWX 4NQDE 3P9MA 4YDJA 1MCNA 5HJ3B 1R5IB 1CDGA 1H15B 1XGQA 1QVOB 1MJUL 3W9DA 2ZG2A 1YNTB 3TWCH 1A6WL 3HB3D 4FQ2L 2VLJB 3MRPA 2MFNA 4DOHE 3T77B 4PJBE 5L7XH 4NYLB 2QR0B 1OY3B 1C5CL 4IRJA 3MBED 1U8KA 3L3DA 4APQD 1KTDB 4CVXB 4M1DL 2ILLA 5JIHA 1CGSL 2CIKB 3BKYH 1H0DA 4NQDA 4S10A 1T1ZA 4PJEB 3ARZA 1F3JB 4LHUG 5T1DL 1RHHA 4N8CH 4TUOA 3KYNA 5C0FB 2CRYA 3DVIA 3RWJB 2ERJB 5EBLA 3QH3B 3FCTA 2X10A 4WHYH 2AS5M 4P59L 5HGAB 1I3UA 5IVXB 5B8CA 1BJ8A 1AD0A 5TDPB 1N2RA 2IBBA 1H3PH 2I25N 2K3TA 5K9JL 3BD4A 3UTOA 5GS0L 1CFQA 4MD5A 1OCWL 1LEKB 1L0QA 4GG6B 5I0DA 4AYFA 1FN4A 1NFDF 5C0JB 3FB5A 4YHPB 3L5WA 5EO1B 4OLXH 4M93C 3BW9B 4X80L 4YHKH 2WQRA 1MHEA 4Y16B 1ZLSL 5A43C 1CS6A 4MJ6A 3ARRA 1A4KA 1TFHA 4YWGH 3STLB 2DQGL 3Q6FA 4NC2B 4X6EB 5JW3H 3QR2A 2DL9A 2QL1A 3BPOC 4XZUA 2EDKA 5C0AE 4W6YB 4LGPB 3ZYOA 2G2RB 3O4LD 3MMEB 5ISZE 2YK1L 3WN5A 4WIQA 3DI3B 5E1AA 3VRJB 1DP0A 2WWKO 3OAZH 4ZFFB 5EU4A 2DKUA 1IC4L 3K1DA 3CUPB 1FO0H 1T66D 2FIRT 2X4RA 1ZE3C 1SYSB 5DJCA 3SE3C 4PJ7B 4YXLL 2BJMH 2FDBP 8FABB 2PR4H 5C86A 3UTZA 3RWDB 1CXKA 2WBJB 4NO5A 4C56E 4OIAA 1J0IA 1RZ7H 5C0AA 5FGCE 4LIQL 1K8DB 1NCBL 5ISZA 3U4BH 4U6HB 4WI5A 5FYJE 4HWUA 1J7VR 4X99B 1CCZA 4LAQH 4U0RC 1IM9B 4PJXA 1JE6A 3NIFF 1R5VB 1WIUA 5CJXC 4C56A 2YRZA 4N0FB 2BRQA 3AREC 4WUUE 5CGMA 1CBVL 3EFFA 1XGRA 4HGMA 4XC1H 1K5NA 3UYOD 3BWAA 1B4JL 3GMPA 3RFZC 4XTRC 4GW1A 4R9HA 5GRJH 3D85B 1WZMA 5HBBA 4QCIA 5BV7B 4ZUTA 3L3IA 3MRLA 4G6ML 3SN6N 2DM2A 1NGQL 2DYPD 3HMWL 1N5AA 2YD3A 2H45A 5IP4A 1CFVL 5KVEL 5GGSB 1I1RA 1U8JA 1K4DB 4Y8DC 2AQ3A 4KK5C 1LEGB 2Z8WC 5DRNB 2RFXB 3I2CL 4JO1L 4WUUA 3ZKQD 2GTZA 4PY7A 4CJ0A 4XP6L 1AHWA 1KIPB 1G0YR 2ZOLA 5K93A 5CP7A 4M8QA 1FH5H 1OAXH 3EDEA 1QQDA 3PDGA 3ARSA 5E7FA 3GSQA 1A0QL 3LHPL 1I85C 1RZGA 2OZ4H 1XGTA 3HE6D 4LEXH 3W81A 5AZ2L 4ELKA 4UAOC 2ZUQB 3OL2A 3U0PB 3H8NA 3KPNA 4C4KT 3VRIB 3RBGA 1HEZB 4FFZL 4K8RL 2ITDB 1LEIB 3CFCH 2NY0D 3JWDC 25C8H 3FO0L 3QPXH 4AQOA 2AJVL 1NFIA 1UM5L 5DLML 4OCNC 3C6LB 4KXZI 1N59B 5DJ2B 1FV1A 3BOVA 1YEHH 3SPVB 1PKQB 2P49B 1KLUA 2G9HB 5DFVD 2YPVL 3NAAH 4AG4L 4WHCA 2PCPA 1V3MA 1MCFA 1RIUL 4K3HA 4ZYKB 1OTTC 4YHLH 5IBLC 2FB4H 4QHKI 1KBGL 3VWJD 5F7MC 2YOCA 5LXGL 1SY6L 1JV5B 3OKKB 4P23D 2HLAB 4ZAKD 2XQYK 1S9XA 4I1NB 5EUKB 1X5ZA 1DVFA 1IRAY 4Z78B 4UNUA 4GMTL 4EN3D 3ARBA 1KEGH 4BJLA 1U8MB 3BAEH 4XNMB 5D96C 2QKIA 2H3NB 4XX1G 3WO4B 1LDPL 2IJ0C 5J13C 4YZFE 4KK8C 3ULVF 1N3NB 1C12B 1C5DA 4MA8L 2F53D 3WSQH 4ZS7L 4M5ZH 1JZ7A 1HCVA 4F8QA 1AKJD 1CL7L 5L6YL 2V7NB 1RURH 4M4RA 1NGXB 3J8F7 4OIBA 4RZCB 4JPKL 4Z5RA 1JFQH 3HI6H 1KCSL 4G6KH 5DVKA 3BVNB 1VESA 1OSZA 1UM6H 3OR7B 3HNVL 5GHWL 4TSBH 1RULL 4XPGH 2CO6B 2ZJSH 5DJXA 1LVEA 1AO7D 1OP3H 3D48R 1UKSA 3GIZH 1XH3B 3LKSA 2V2XB 3MJ9L 4NC1C 5I74B 5IHUL 2E9WA 4JFDD 4FQLH 4OV5B 4PJHE 4OZHE 4YAQB 2D31A 1RUMH 1E4KA 3AB0B 3B2UC 4OZIE 5ITBH 5CD3B 1F4YH 5GRYA 1IL1A 5KN5A 4BH7A 3MLZH 3EKCA 3QXWA 3SCMD 4R8WL 5C0RH 3GM8A 3K0WA 3F62A 3EHBC 3LKRA 3VW3H 1NCWH 4KUCF 1INEH 4PJHA 2P5WE 2XY1A 4MJIB 4OZHA 4QTHB 1S8DB 1U2HA 3BXNA 4XNXL 3O2VH 3L95B 4OZIA 3VFTB 3GB7A 3D18B 1T83C 4KQ3L 5EZOL 3I84A 3U0WL 1MNUH 2IADA 1E4WL 1JZ2A 3TBTA 5EORH 2QHRH 4PJGB 2XACC 1X5YA 4JZNA 1GAFL 2P5WA 4R7DB 3W82A 1N7MH 4WFFE 1J1XH 5KZCD 1DL7H 3P9LA 5LBSH 4HZAA 3SGKC 4PRID 1HSAA 5ECJE 2V17H 2VR9A 1B0RB 3B9KD 3PQYD 4ONHB 4UTAL 1IAKB 5D1QA 5EO0A 2EH8H 4HMDA 5C3LD 1IGTB 2M1KA 1B0WA 4MYWB 4NN5B 1ZLUH 2AI0L 1QLFB 5JPMA 3U36A 2A77H 5CKAA 2W0KA 3CSYB 4WUKL 1U3JA 1NQBA 3LRGA 3MOBH 1QFPA 4OTXH 4CN6A 2EZ0D 3HLAA 1MQKH 4U1SA 1U92A 3MLWH 3BP4A 3BZFB 4PGDA 3VXUB 4Z7QE 3WV0A 4JQVC 1CU4H 1P84J 1FL5B 1XCQA 3O9WC 5JORB 2QQKL 3GMNB 1ZLWK 4PB9L 4O9HL 5T5NG 2HAZA 4TVPE 2NR6C 1R24A 3W11D 3WS6C 2CKBL 4IBLT 4IOSD 2XOTA 5LG1A 5DUML 1JGUL 3WNLA 4NHUB 1D5IL 4X7TA 4G42A 5K9QG 1ZHLB 4WDIB 5DSCA 3H0TA 2FL5B 1ZHKB 1RJYB 3ZSSA 1P9MC 2GK0B 4YQXH 2DQCL 2QQNL 4IDJL 1VENA 5I73B 1RJCA 1Z3GL 4JANB 4P2QE 6FABL 5JZ7C 4X5XB 1NCAL 1Z2KA 4KK6C 3HS0B 3T2NL 4DN3L 3PL6B 1KJ2A 3WHXB 43C9B 4I48B 5KG9B 3BEVA 4U3CA 1NSNL 3QIUD 3ZDZF 4P5TC 5HYEA 4QRQB 4HIXH 1NAML 4CW1A 3MV8B 4DFIA 5F44A 2A6DB 4H26B 1AGCB 3WHE1 5FUZL 4P2QA 2KL6A 4LLVA 3X3FH 3HZYB 4EZMA 4MD4A 1F8TH 3CH1A 4N5ED 4D9LH 1OW0C 4TUJA 2R0KH 2L0DA 4F80A 3TPUB 5ALCH 5LQBL 3WJJA 1KCRH 1L9NA 1YMHB 1JPFA 2XNAB 3GBNL 2BNQE 1JHTB 5GGQL 4PJFE 1FC2D 1I3RA 1OTUC 2CIIA 3H7LA 2QQLH 3AS2A 5E8PA 4WJ5A 1FVEA 2QSQA 1EEUA 1Q38A 5EBMA 3OHXA 4K07A 4XMKL 5F7HA 4BSVA 2Z91A 4KKAD 1A7OH 4P2OC 1L0YA 1KB5L 4HWBH 4HS6B 2BNQA 3T0DA 4PJFA 1RIHL 4PGBB 5D5MA 5J12C 3KWWA 1V05A 3V8CA 1X5KA 5I9QB 1JZ4A 1UCBH 1X5AA 3SQOH 1Z9SA 2HFFB 1T4KB 3CVIL 5FO9A 5BW7C 2YD1A 2VE6A 2BC4B 2A0LC 1FFNA 3LS4L 1R3LB 3SO3B 2Q76A 4LLUA 3L3HA 1HQRB 2VDQL 1CICD 2WINA 4S0SD 4OSUL 3OAZK 2HVKA 4WW2F 3EJYC 4UT7H 4IRSC 2NW2A 5IK3B 4XH2A 2WUCH 3TBYA 1FYTE 2OTWB 2D9QB 4ZPTB 3IFLL 2Y06L 1LNUA 4NKOA 2VXSH 1WGOA 4HG4K 5I17A 4KJWD 1T5XA 4JG0L 4JZOB 4C59B 1T04B 3DUHA 2AABL 3KPPB 1YY9D 2DLGA 4JLRB 2FX7H 1WAAE 5KW9L 2P8LA 4WCYH 4EVNB 2BSTA 3HZVA 3TO2B 5CJOH 3MNZB 3P73A 1KJMA 5I8EB 1FL6A 1BFOB 1FYTA 5IF0B 1REIA 3DMMA 3VXOA 2ADJB 4LOUD 4KAQL 15C8H 1KNOB 1HILB 4PJCB 5C2UB 3LKPA 2HN7A 2A74B 3WJLA 4P57A 1XIWA 5JOEA 1KTLA 1WAAA 4G8IA 2NLJB 2V2TB 1A1OA 1AGFA 2LAAA 4LDOB 1RZFH 3W0WB 4YLQT 4XAWL 2R29L 5AYQA 2AJSL 5L88L 1KFAH 4JPWL 5I0ZA 4S1QL 3RWFB 3LDBB 1MFBL 2JJTC 2A6JA 3P2TA 5CEYB 2DQFB 4OCXH 4LSUL 1E4XI 1IFHH 4PRIB 5GRVL 4MQSB 1TDQA 5FDWA 1S7QB 2BY0A 2GW5A 5DD5H 2CLVB 3QFJE 4PD4K 3V7MA 2Q7YA 3LY6A 32C2B 1X4ZA 1A7NL 1PBYA 4PS4L 3DTXB 1UJ3C 2DQJH 4KJQC 1L7IH 4WTXA 5SWQB 1QZ1A 5DZNA 4WFEE 1VSCA 4APQA 1MWAH 1A3RH 3IJHB 3KPSD 5IW3A 3D3VD 3HI5L 4M7ZB 4Z76B 4ZSOE 1DQMH 1NC2B 1W8OA 3GMQA 5C09B 4HWEL 3QFJA 3T3MF 4L4JA 1Z9LA 2ZCLL 2CDFA 2AEWA 1WEJL 3CX5K 4DWHA 2Z0BA 1KYOJ 5I1EH 4BK4A 1X5LA 5DEZA 4YC2C 4LF3B 2PN5A 3FN0H 1BQSA 2FWOA 4JO4H 4LCUA 2JCCB 2CR6A 1EFQA 4ZSOA 4FQQA 3TNMA 1SYVA 2E7LA 3K81A 3DBXA 4KY1L 1S7SB 2EC8A 1W2KT 3FKUS 1ZEAH 3LN4B 4XPAH 3WIFA 1J8KA 1PLGH 2APFA 2XQBL 1JPGB 3O4LE 1K6QH 4MAUL 3RWEA 4K7FB 4LLWB 1ZWIA 2APWA 3IDMB 2VAJA 4KKBC 3DX9A 3LPGA 2XTLA 2QSCL 3VGBA 1CR9L 2X4PB 1ZHNA 1JGDB 3RTQC 2OL3B 5FIEA 1HDMB 2ERJC 3JWNC 5C2BL 4P5KA 2FH6A 5T1KA 1FC1A 1XFPA 4JFFD 1INDH 5L2KB 1AE6L 4XNYL 1AXTL 2Y7QB 2NY3C 1QPXA 3M17B 3O4LA 1R3IH 4GG8A 5F9WB 3IVKA 4QRTA 5E8DH 4AIZB 4U6XA 3MACL 2H9GA 1OAYL 3MGOA 2UV3A 2A38A 4M7LH 4MGXA 4AM0B 5B4MD 2E8YA 4EI6B 1O5DT 2WIMA 4K2UH 3UYPA 2C3VA 5BXFA 1F11A 3T8XA 3BKCL 1K8IA 4FTVB 3KLAB 2PO6C 3S5LA 3SJVD 5HGBA 2ICWA 3C8DA 4XVJL 5EU3B 2X9YA 2Y6SC 3M45A 2VMFA 3CXDH 3CDCA 5TH2A 1AJ7L 4EEEA 1VFAA 3DETD 3MCKA 4EXPX 5HI3D 5DUPH 4NKMB 1LK3L 5EZIH 3NFPA 3ULVD 1UWEH 3LEXB 2ZG1A 4I0PB 1EHLH 4LRNL 5T3XL 3P9MB 4LVHB 4PP1D 1XGQB 1P84K 1DR9A 3W9DB 1G7HA 4M62L 1MFCL 5JIIA 2R4RL 2F5BL 3IF1A 3UTSD 3LS5H 3GO1H 5GIRA 2DYPA 1E6OH 2DL2A 2WBJC 2VTFA 3UCRA 1P2CB 1IKFL 3FL7A 3L3DB 3ULVH 1CFSA 5DMGC 1XZ0B 2NY4B 2FHBA 1AQKL 1H0DB 3GRWL 1PDKA 3BN3B 1ZGLM 4HF5H 4P9HC 2XIDA 1MQ8A 1RHHB 2GCYB 1DSFH 1EVUA 4TUOB 5FYKU 3HHRB 2D0FA 3U6RA 1GGIH 1YNKL 3HE6A 4PG2A 2J4WL 3T0VA 2DQEH 4JHWL 5F1NA 2L7UA 1S9VA 4Z7UF 5JXEA 2ZKHH 5JXAH 2X4QA 4KJYA 1KTKE 5B8CB 1AD0B 2FJGA 3T0EC 5GJTH 5BV7C 3DJ9A 3EOTL 2VDRL 1MH5A 1N2RB 4JM4H 1RZ8A 2GJZA 5DVNA 3QT2A 1IAOB 35C8H 4MD5B 1SJEA 4JZJA 4KUCD 5H2BA 5JTWA 1FN4B 4FXGB 3FB5B 1INQA 2XFXA 4JFZH 3TT1L 4WEBH 1NUFA 1A4KB 5E99H 5JDSB 1MEXL 2IPTH 3ARGD 3ZYJA 2I9TA 4FFWC 2BVEA 2I5YL 1P69B 3H3PL 2FATL 1NDMB 5FKPA 5A2LH 4WHDA 1QTYT 3VWJA 2I27N 1DQDH 2W91A 2ZUQC 1A6TA 4HQQL 4QTIL 4PRHD 1CK0L 4WGVB 3HC0A 4QOKD 2BK8A 4EN3A 5E1AB 2DIBA 2XRAL 3KPTA 3MUGA 5FECA 2AERT 5EU4B 3MYJA 4K3JH 3BJ91 1F2XK 5FKAA 4CVWA 4QHLA 1I8KA 3D3VB 3CFJB 1EEYA 1VEOA 3T04D 1Q8MA 3UTZB 4NO5B 1EK3A 1ZA6B 5HVGB 1N5YH 5C0AB 3K7UA 2VKXA 1VA9A 1RMFL 3FQNA 1AIFA 2EE9A 3P0VL 4JO2L 4J3UA 3EW3B 4P4KD 3T1FB 1T0MA 1B2WL 5F7KC 1BM3H 3F5WA 4G3YL 5DGQA 1YPZF 5C0IB 5BQ7A 1MFAH 2ADIA 1FNHA 3GSVB 4PJXB 3OJMB 4RGND 2R8SH 3PHQB 4FQ1L 2X6MA 4Q9QL 3OKDB 3MRKA 4LKXB 1DJSA 3EFFB 1XGRB 1K5NB 2YRPA 4GW1B 1NMAL 3RJDA 4ZUTB 1SEQH 4DAGH 4OKVA 5CILL 3WO4C 3L3IB 3V4PH 1MCIA 3FB7A 1G9MH 3MRBB 1DFBL 4HC1A 1QFOA 3JWDL 3EGSB 3RJQB 4OD3L 5JQ6H 2JKXA 4IMKA 1U8JB 4XCFL 3T2OA 3TFKD 5JUEL 4S1DC 3DSFH 1U3HD 4WUUB 3SCMA 4XVSH 2GTZB 4PY7B 5F3BA 3CSBA 1KN4L 2IQAA 2ZOLB 1CT8B 5CP7B 1DBAH 4M8QB 5GGTH 5BRZB 1QQDB 4UUJB 1FNGA 1OARL 3CK0L 5DD0H 4DTGL 1KPVB 4MJ5A 5FHAH 1QO3A 3QP3A 2FRGP 5D7JD 3T0XA 1RZGB 3QPQC 1P4BH 5F89A 3PQYE 1KCUH 1F3DH 4LKCA 5MP6H 3FRPA 5KSAD 5GJSL 3VI4E 4HS8H 3VXPA 2Z31D 3DI2B 5D7KD 3MFFA 5I74C 4S11A 4L4TD 3SE8H 2VLKD 1Z6JT 4JFQB 5C07A 3JVGA 5F7EH 4KMTL 3OZ9H 2O5XL 1NFIB 5J1SC 4OCYH 3AMKA 3AXLB 3I85A 4HUVB 4AMKH 1FV1B 1NMBL 3H9ZA 3R0MA 4BK5A 2G75A 1CZ8L 1KLUB 1QA9B 2PCPB 3NMEA 2N7AA 3B9EA 4OM1H 4HFUL 5K59E 1TJHH 3NFNB 3NACH 4YFDB 1D6EB 4YBQD 4F7MA 3RWIA 4D8PA 1W72L 3T2QA 1JWUA 3ZTJG 3KPQB 1S9XB 1DVFB 3S4SG 3UTSB 3ARBB 5C0CD 1NBZA 1JNJA 3MLSH 2MHAA 4I77H 3V7AE 2QKIB 4PLKD 5ELIA 4QO1A 5ICYA 4HIHA 1WICA 1ZK9A 1J1PL 2J2ZA 3EO9H 1XF4A 1F3DJ 2W9LA 4H1LG 1MI5E 5KSUA 1Q9LA 4PJ5D 3QAZB 3O3DB 3WE6A 4JRXD 5CJ5A 5T1LA 1AXSA 3CCHA 3ZL4H 5HGGS 5KANI 4RMUA 2ENSA 1PG7H 5FA3B 3MLYH 3ULSA 4Z5RB 3TVMC 4PGJA 1MFDL 1OSZB 3BT2L 1MI5A 5FB8A 3OXSB 4G7VL 5JNYB 1PSKL 3FB6B 1DQTA 2EICA 1JNLL 3LKSB 1WWAX 4LVNB 1M7DB 3RVWC 2DWEA 4WEMB 3I75A 2IF7A 5I71B 4YHMH 1I1FA 4PTTB 5EUOE 3M1BA 2YMXL 2D7MA 2R2CA 3BDBA 1DE4A 1BJ1H 4I0KA 3PP4L 5IMMB 1IM3A 4AEEA 2EC9T 2OI9B 3OJ2C 5DJ0B 1ITBB 5AUMA 2NPLX 2IMMA 1I9IH 3GI8L 1IL1B 1JF1A 1Z5LB 5I73C 3V52L 3PDOA 3V0VA 2PW2A 2LVCA 3UZEA 4PJHB 2NXYB 5EUOA 1T7ZA 3QUYB 4YHYB 1S7XA 4OJFH 5I1DB 3N1QC 2APBA 2V9RA 3BXNB 4JKKA 2ED7A 1FL3B 5L8LB 5C8JA 4V2BA 1VB9A 1JPSH 5I18L 1S7RA 3TO4D 1JGLL 3GB7B 3DVGA 3MROA 3QUMA 3X3GL 2FYYA 4LSQH 3QWQB 1HHJB 1BJMA 3RHWK 2H26A 3ZSTA 4CAGA 4LASL 2JJVA 4NBYB 4K94H 4X98A 3D9AH 2P5WB 4PBXA 3H9SA 4OV6F 4JM2B 4QHNA 4ZD3H 4RCAA 1TNMA 2OXHA 1U36A 4AENA 1QSFD 1HSAB 2YKLH 3GJEB 4NNXA 5KVDL 3O2DL 5D1QB 5EA0L 5EO0B 5CBAA 4FMKA 5F6HI 3L6FA 2P45B 3QI9D 1S9KC 2A6KB 1BJ1J 1NFDE 5CUSH 4C4KO 1GYAA 3IS0X 3I6LD 1GIGL 4FQCH 2DQIH 3VDCA 3WFHB 4RA0C 3F7VA 2NY2B 5E6ID 2VDLH 3HLAB 3U1SH 2NY6C 5D93B 4DGIH 3HAEH 4U1SB 1VERA 1RY7B 2X4OB 1U92B 4PGDB 5TE4H 3N85H 2HTKD 4LP5A 4MNQA 4JQXA 3Q5TA 1XCQB 2D7TH 4MMZC 3RNQA 3RY5A 4ORGB 2NY7H 3MLTA 1R24B 2HRPL 4TRPL 3GKWH 5KS9E 1OF2A 4JFPB 1AD9A 1E4XL 3V9FA 5I9QC 4X7TB 4G42B 3WLBB 3VFSB 4FFVC 1CGXA 4BZ2L 1JYVA 3BUYA 3DURA 3O6ML 3TIEB 1DBBL 2VIRB 2XA3A 3SO3C 1LP9F 1AGDA 4Y2DB 4MB5A 4ENEC 5ALBH 4OIIH 4ONGL 1T1YB 2B0SL 1HXYB 2MTPA 5FM4A 2VNCA 4RAUA 4HJJL 2G60H 3PWJA 4L4VA 2W38A 5KS9A 2F58H 3ARXA 2LAGB 1GZQA 4F15B 5GSRA 1ADQL 1NJ9A 1Q1JH 3GK8L 4Y1AE 3SKMA 3TH3T 5CGYD 3RAJH 2EC9U 4O51A 4CW1B 3WLWC 3LIZL 3NIFE 1JK8B 4LLVB 4Y5VA 1I9RH 3BEWA 1TENA 3HPJA 3CH1B 1TIUA 4N1CA 3FO9B 4TUJB 1VGKA 4N8VG 2YD6A 2GY5A 4OZFA 3WUZA 5GGUA 4P2RD 1FIGH 5EU7E 2YRLA 1JPFB 4Y1AA 2DTML 2FX9H 1I3RB 1MCOH 1IQWL 4O5LH 2CIIB 4PGEA 1C1EH 1Y6MR 3E3QE 4LSVH 5CIPH 3O3EA 3AROA 3SKJH 2LABA 3D39E 1FORL 4PP2A 2DWDA 3BO8A 3B5HA 5EBMB 3F6IA 1JBJA 5T5NF 1P7QD 3LDBC 1WITA 4ZUSA 1HHKA 5F7YC 5DTFB 3TZVC 2BNRB 3K1KC 3WFDH 3SO5A 3VFGH 3P40A 4RGOH 3PJSA 4OT1L 4PJFB 5D5MB 2H2PD 3IFPA 4IJ3B 4PYGA 4GRWF 3KWWB 3D39A 1IVLA 1UYWL 1T2QH 2B39A 2X09A 4JFFE 2JIXA 1JWMB 4OLWL 5DHVH 5FO9B 1OGTA 2P4AB 4M1CD 2FR4A 3ZKNC 4NQEA 3C09B 3AY4A 5KJRH 2UUDH 2Q76B 3WDJA 1JRHI 4LLUB 3KR3L 1MJUH 4M7ZC 3AC0A 1IGCL 1UZ6E 2ZWLT 2ENYA 4FQ2H 2HVKB 4BUHA 3LRSA 2NW2B 3TN0D 4XH2B 3TBYB 1K85A 4YEFA 2R0ZL 4AK1A 1LO5A 1J5OL 4G9FA 1C5CH 4NKOB 1LNUB 3OBAA 3ARDA 4JFFA 2H2SC 1BWMA 5IB4B 3LB6D 1T5XB 5E00A 1LHZA 4M1DH 1C08B 1HYSC 1CGSH 1ZS8B 3QDMA 4LGSB 3V6OE 1A02N 3LN9A 3SJVE 1CDJA 2Z8SA 4JGJA 5LAXA 5FYKL 5T1DH 4EDXA 1YN6B 2CRIA 4E41D 4UV7L 4JE4B 4O02L 1C7TA 1VKXA 1KJMB 4NSKB 4X8JA 3GZKA 1FYTB 4TPRL 2DQUL 5EPMA 3ULVE 3VXOB 4P59H 3F12A 3SDDC 4HK3J 3LKPB 2HN7B 4P57B 3WUWA 5ESVA 3V6OA 1KTLB 5K9JH 4G8IB 2X40A 3SJVA 1GOHA 5GS0H 1A1OB 3ABZA 1AGFB 1OCWH 3QNYA 1T89A 3O8XD 4ELMF 3PF2A 5HYSG 3QJFB 1EEZA 4HBCL 3CPLA 2IFFL 1A64A 1ZLSH 4UIKL 2JE8A 2A6JB 2DQGH 5F9WC 2BNUA 4X6CA 1XGPB 5FDWB 1FNAA 5E8EA 3QBTB 4LHUD 3K4ZA 4P9ML 4HUUB 4HK0A 3SGEH 2PXYD 2J88L 2YK1H 4BSJA 5BO1L 2APTA 3O4OB 1ONQA 5TF0A 5M94B 2MMXA 4Y19D 4WO4B 5MEOA 1IC4H 4CN1A 4FNLL 5TDOB 1IZJA 1U8PA 4TNVF 3QFJB 4YXLH 3CMOL 1EO7A 2CDFB 3V5DA 2NX5B 3FQRA 1MRDL 3UBXG 3DRTA 1QNZL 2AJYL 5TE6L 1V7NL 5DEFA 5GSVB 2V6HA 4LIQH 1NGZB 1NCBH 3V8OA 4I0PC 5LJYH 2FWOB 4Q7DA 3Q5OA 1G0XA 4ZS6C 1SYVB 3DBXB 2ID5A 1ACZA 4H0IA 5C71A 1OAQL 4XCYA 4HKBA 4PRAA 5BS0E 4IRJC 3WIFB 4PRHE 2VWEE 1CBVH 3NCEB 4QOKE 4XGZB 2YPLD 1B4JH 2IMNA 2W0LA 1ZWIB 3ZDXE 2NY4C 5IV2A 1HH6A 3DUSA 3BE1L 3DX9B 3BD5A 4F7CB 2DD8L 1CTNA 2DM4A 4KKLD 4G6MH 1B4RA 5I6XC 4WTZG 1BGXL 1NGQH 1PAMA 4HUXA 3TIDB 5JHDD 3G5ZB 3HMWH 4NRXA 4Z77A 3GMLA 5CIPB 1CFVH 3IFNL 4P5KB 3BP7A 3OR6A 5T1KB 5C0EA 1U8NA 2CMRL 2FO4A 4KPHL 5BS0A 1S78D 4PRHA 4K8RD 3OKLA 3MJGX 4JO1H 4KRMB 3TH2T 5B8CC 4NRYA 4ETQB 4XP6H 4GG8B 1M6OB 3IVKB 4OI8A 2YXMA 4QRTB 3GHEL 4U6XB 5I66A 2E7BA 3ZT7A 1UG9A 2H9GB 4WHTA 5E6YA 1A0QH 2YUXA 5JW5A 1FZMA 3QQ3B 4HKXA 3IDNA 3TBSA 3CVHA 3LHPH 2BSED 2CD0A 5AZ2H 4RGNE 3NBNA 1A5FL 1A7RL 4JFEB 2C3VB 4FFZH 5BXFB 2NTSP 5LCVL 3T8XB 5I1IL 4K8RH 5CBEA 3S5LB 2ICWB 3HA0A 4N5UA 3NN8A 2BVUA 4PJAE 3UJTL 3MRRA 4JHBA 4ODWA 4P4KA 2AJVH 4P9HL 1UM5H 5DLMH 2ICEB 2R1XA 3P77B 2GQHA 1WZ1L 5CLTA 3MCKB 4YHOL 3STZA 1OT1A 4TTDD 3NFPB 3MUZ1 3ZDZE 2BXYA 2YPVH 3WN5C 3RUGF 4ZTOL 3PIQA 4AG4H 4YHIA 2P8MA 5HHOB 1RIUH 4HHAA 1G7HB 4Y4FA 5BV7L 1F13A 3SDAB 1CE6A 4PJAA 1KBGH 3IF1B 3SDYL 1QR1A 5LXGH 1SY6H 5GIRB 1V3JA 4OZ4A 1N64L 2ADGA 3QEQB 3S96A 3MRQA 2BCKA 3BSZL 4GMTH 5BZWA 3VH8A 4NZDA 4PJDB 5DYOA 1JTTA 5HGDB 4N0UE 5D7KE 3OG6B 4X5LA 4L4TE 1HI6A 1LDPH 3EYQC 4ONFL 1I75A 1MVFA 4NN7B 1Q0YL 1GGBL 4WY7L 3U83A 1T5WA 3IGAA 4MA8H 4YFLI 4GAFB 5DJ6A 4ZS7H 5D7JA 1U6AL 3U6RB 1CL7H 3O6FA 5L6YH 5F1NB 1CF8L 1S9VB 2JTDA 2X4QB 3EYVA 2ZUXA 2FJGB 1T2XA 2ARJQ 3ARFD 4N0UA 4JPKH 4Z0BL 3S8WA 2VL5A 3D69A 4PV8B 1MH5B 4L4TA 1KCSH 1RZ8B 1LE9A 1CI5A 4EI5D 3HNVH 3MRIA 5GHWH 4K7PY 1ND0A 1RULH 3KJ4B 1L0XA 2GAZB 3TNNA 1INQB 1UEMA 2XFXB 5C0CE 3MJ9H 1IAMA 4ZPVA 3GSUA 5IHUH 2DIAA 2I9TB 1D5MB 2HFTA 3QG6A 4GSDL 1MCEA 3NCMA 5C0ND 2MWCA 4NO2A 5FKPB 5J11B 2VLRA 1WBXA 4PJ5E 2KKQA 3TLRA 3FZUD 4UMGA 3V5KA 1A6TB 3U79A 4R4BB 4PJ8A 4HIIB 4R8WH 3EOAA 3P4MA 1BQUA 2FEDD 5HI4D 1FE8L 2BVOA 3QXAA 3SOBL 5FECB 3MYJB 1EFXA 1OP5H 4X5WA 1H5BA 5FKAB 5CSZB 5GRUL 2LU7A 4QHLB 4XNXH 1BEYL 5TGBA 3BH8A 1EEYB 5D2LF 2VQ1A 5IJVA 4WW2A 3CC5B 4KQ3H 5EZOH 1A47A 3N06B 1S3KH 3U0WH 5A3ID 2SEBA 1E4WH 3QCTL 2OCFD 4JY6B 1LO0L 1I1YA 3Q48A 1GAFH 4QY8B 3QDAA 4MQXD 2AVGA 3QUKA 3F5WB 4NKDA 3IKCA 3FFCE 5BQ7B 2ZUTA 1FFOB 1OPGL 4Y8AA 4UTAH 4PB0L 1DVFC 5GGRY 1KC5L 2AI0H 3ARBC 3MRKB 2YA1A 2PETA 4HXBL 5D6CA 4WUKH 4GBXB 4U05A 5BZDB 2VITA 1IEBA 1ES0A 1XEDA 2AKRB 4OKVB 2HLFD 3VGGA 3FB7B 2HFEA 5J8OA 2XN9E 4HEME 4ZMAT 3FFCA 4XI5C 3TV3L 5IG7A 5FF6A 3W39B 1ZLVH 3RVXC 4PB9H 4O9HH 2EECA 2FX8L 4TNWK 5JPNA 2YPKB 3PWPE 4CDHA 1NCTA 2CKBH 3VWKD 1RV6X 4XC3L 5DUMH 1JGUH 4N1HB 2VLMD 1D5IH 5I16B 2YA0A 4MJ5B 3RIAK 3U4BL 3IETA 2XN9A 3FT3A 2HTLD 5LVEA 2HJLA 4U33A 2DQCH 2QQNH 4GW4A 4IDJH 5F89B 3TO4A 3T3ME 4LKCB 3WFEL 1Z3GH 1F6FB 3IAQA 3QXVA 1NCAH 3MFFB 5I71C 3T2NH 1MJ8L 3PWPA 4DN3H 3OKNA 3I6LE 1V3LA 3ULUL 1NSNH 5FM8A 3LAFA 5C07B 4LPVA 2OI9C 1E4KC 4KRPD 2JJUA 2FO1A 4F57L 1NAMH 3QDGA 3H9HB 1KPUA 4LCYA 2VZ1A 4HJ0C 3EO1A 3E2HB 2P8PB 5FUZH 4I9WD 5D2NB 2R2HA 3G6JA 3GSNA 4I3SL 2DDQL 4WI4A 4Y2OA 2NXYC 3QUYC 4YHYC 1SVZA 2BFVL 2F15A 3DHJA 5F8QC 4GXVL 2W0FB 3RWIB 3GJFH 3D25B 1JWUB 4U2ZA 2YWYA 3GBNH 5GGQH 4J3TA 5FYJU 2F54D 4URTB 1NBZB 2MHAB 3BN9C 4Q6YA 4HIHB 3MGTA 1DDHA 4JM2C 5KSUB 1Q9LB 4A6YA 2HWZL 3B4NA 1IMHC 2LE9A 3P4OA 4XMKH 3UTPD 3WE6B 5CZXC 3SGJA 5D1QC 1PGRB 4HX1A 1IARB 1MCCA 4TSAL 1KB5H 2W9EL 4GRWH 4O4YL 5T1LB 2ZUSA 3CCHB 1JHLL 1RIHH 4LQFL 2EH7L 4WFGD 2VOTA 2R23A 4LCCB 5FO8A 3MLXL 4TOYL 2XTJD 4UZGA 4OLEA 5D93C 4BYHA 3JV5A 3MZGB 1MI5B 5DD3L 4X4YA 3CVIH 4HS3B 4MXQD 4P2RE 1PX3A 4HGWA 5IQ7L 5L2JA 2RQ8A 3LS4H 3ZE2E 3AM8A 2VDOL 3AS3A 1UWXH 4QXUL 3BHBA 2VDQH 3I75B 4OSUH 1I1FB 4ZNEA 4IOIA 3OJDA 5ACZB 4PG9A 4J3XA 4S1RL 1IM3B 2N4IA 5DI8A 1ORSA 2ZNXA 3IFLH 2Y06H 5DDHA 2H32H 3BQUA 5AUMB 1F6AA 3Q5YA 4JG0H 4P2RA 2AABH 4RMSA 5KVFL 1IEHA 1I3GL 4Y2DC 2DQHL 3PDOB 5KW9H 1FAIL 3QXDA 2PW2B 2F9BT 2OTUB 3VGFA 5DZLA 3K3QA 3X11A 1VFBB 1JRHL 1S7XB 4R0LA 3VFOA 2WUBL 3QULA 2BSRA 1LMKA 2ORBL 5C8JB 4F15C 4PYHA 1S7RB 2HRLA 3MROB 3QUMB 4KAQH 4PLJD 2RCSL 3ARYA 3RZWA 2FYYB 2JJWA 3A0OA 4X6DB 4LCIL 3F7RA 1BVKA 3VXRE 4G8FA 4D9RD 1YMMD 3ALWA 3KYOA 2VAAA 3VMOA 3WNPA 4X98B 3VDAA 3H9SB 4XAWH 2R29H 1IGYA 1RK1B 3UP1A 3VFRA 5JA9A 4XPTL 4KDWA 2AJSH 3LKOB 5L88H 4JPWH 3WJJC 1E28A 4S1QH 4HCRL 4L8DA 4NQXB 3RNKA 4DKDC 1MFBH 2IANB 5DK0A 4QRRD 5FA4A 4LSUH 4N8PA 2VZSA 4FQHB 2E7CA 4WU7A 5D1ZB 5E8NA 3VFWB 1T22A 3VXRA 1QSVA 3U9UB 3F7VB 1I1AD 1A7NH 4PS4H 2OR9L 3QUXD 1TQCB 1H3WM 3RZCB 5DO2C 3JXAA 4MSWA 4QGYA 4MNQB 2AV1A 3RNQB 3X14B 4AY0A 4L3CA 3G9AB 3HI5H 4TVSa 4XCNB 4BFEA 3MLTB 2ZUYA 1BD2D 4CBPA 5B3NA 4IJ3C 2IH1A 4HWEH 1OM3L 5SX5H 2ZCLH 3UDWA 5AAWA 1OF2B 4L3EA 2QADD 1AD9B 1WEJH 1YN7A 4Z95L 1QOKA 3QXUA 4K71B 4HAGA 2X4TA 2Z93A 2GUOA 1U8QB 2Q86A 3K4DA 5C1MB 3C09C 3BUYB 3H6JA 4NM8L 4WFHE 2XWJA 2NXZD 4YNYA 4YPGB 1BFVL 3V95A 3PG2A 3GMRB 3KPOA 4Y89A 2AJZA 1YQVL 4OAWA 2DI9A 4KY1H 3PWJB 4L4VB 3HPLA 4RNRA 4KQ4L 5KS9B 4ZOCA 4G80A 3O8XA 1GZQB 2XQBH 3SKMB 1SM3L 4MAUH 2O5ZL 2IQ9L 1X7QA 4LU5L 3ZE0F 1YPZE 4MCZA 4OF3A 4PR5A 1HN1A 1U93B 2QSCH 1RPQA 1WFNA 2Y4SA 4Y5VB 3LPFA 1CR9H 3HPJB 4QWWC 5L0QB 5FFLA 4Z8FL 5C2BH 4UILL 5AD0A 1J0YA 3O0RL 2Y5EA 4LLMA 4OZFB 1AE6H 3BZDA 4XNYH 1AXTH 4ZOBA 1AC6A 4ZXBA 4OF7A 4IRZL 4Y1AB 1KULA 3WJLC 4U1MA 3S98A 1I8MA 2VISB 5KOVC 3MACH 2ICCA 4QRPD 4W70A 4KI1A 3VG9B 4U3XA 5KSBE 3O3EB 2L7JA 1OAYH 4G6FD 3OAYK 5E2UL 1MHPL 5GGRA 3KLDA 1MCRA 1ZT7A 4PP2B 2DWDB 3BO8B 3OF6A 5T3XD 3L3GB 5T3ZL 4ZUSB 1HHKB 2YPLE 3BKCH 1HKLL 5ADOL 4HH8A 3NCJL 3B2VL 4XVJH 4Q6IB 3R06A 4L8SA 1TNNA 1G6RA 1NDGB 4OCLC 3IFPB 2RAMA 5JHDE 3HB3C 4AEFA 5KSBA 1AJ7H 3D39B 2J8HA 4UINL 2WLZA 4JRYD 3T65B 1MF2L 4MD0A 4N0CD 1LK3H 2AXGA 2JIXB 3NZ8B 1NKOA 1OGTB 2FR4B 1JIBA 1H3TA 1CXEA 2CGRL 4NWTL 5D7LD 2H32B 4NQEB 4APQC 5TFSL 3NH7L 3SKOA 2BVQB 3QIBB 5T3XH 2YPLA 1NC4B 4WO4C 3WBDA 1ODAA 5HHQA 2DAVA 4M62H 1MFCH 1HE7A 5CEXA 2R4RH 3FQXA 2F5BH 3DVNA 1N8ZB 4DGYL 5JO5B 2VRAA 3LRSB 5JHDA 2AP2A 1FSKB 4JAMA 2OL3L 5HHNA 1LO5B 4G9FB 4J3SA 1G9NC 3ARDB 7FABL 1IKFH 1QHOA 4LLYB 3DIFA 3QO1A 3QDMB 4JHAL 5I1GL 1AQKH 3GRWH 4OFKA 1YQ2A 2R2BB 2OQJA 5LAXB 4EDXB 3MJ8A 1KCVL 5C9KA 2EDNA 1XF2B 2E7LC 3KYKL 5FCSH 3JZ7A 4POYA 1H3XA 4M5YL 4UI2A 2ZOKB 3HUJB 4NQSA 4B53A 2ZSVA 3ECBA 1YNKH 4MB4A 4X8JB 2J4WH 2EEDA 4MAYA 1EGJL 1WCBB 4J3WA 4JHWH 5GQBA 1LE5B 2HVJA 4NGHL 5E2WL 3MV01 3EOTH 2VDRH 1MIML 3PXHA 5ESVB 3E6HB 4J2XA 1PY9A 3V6BR 4Z9KB 1SY6A 4LDEB 4KTDL 1MHCA 3AUVA 5B22A 1QRND 4G8EB 3CPLB 5EU5A 2LQRA 3ALXA 3ARED 3TT1H 3V2AR 3KPRD 5IB3A 1MEXH 2BNUB 3SBWA 2I5YH 4X6CB 2GFBB 3BIKA 4U1GB 4JREC 1XF5B 1YUHA 3I6KA 3H3PH 2FATH 5J1AA 1G1YA 4CL7A 4OGAD 1T66C 2UY6A 2NW3A 4WCYL 4HK0B 4HQQH 4KK5D 4QTIH 1CK0H 4OCWL 2XRAH 1ONQB 3BPCA 3EO0A 5SX4I 1D9KA 4L9LA 2W65B 1SVCP 5F3HB 1JVKA 1CDIA 1PZUB 5DK2A 1U8PB 5CMAA 1EHAA 3CSGA 3TGXA 2ZCHL 3V5DB 4K3EL 3RDTD 3FQRB 3LRHA 4PJEF 1CIDA 3DRTB 2FEEL 3MV9D 3O3BB 3P11L 3I9GL 3C60D 1RMFH 1T6VN 3P0VH 1KFAL 4JO2H 5GZNC 1WBZA 5C0GA 5DVMA 1B2WH 3FJTA 4LNVA 2GJ6A 5IVXF 2OM5A 3G08B 4OZGB 2V7HA 4EI5A 2HKFL 4HKBB 3QRFM 4PRAB 1WWCA 3C2SA 3GJFK 4FQ1H 3CDFA 1P53A 4Q9QH 2P44B 5F7LB 2E9BA 4TULL 2DKMA 5F9OL 4QKXB 5F88A 4GG6F 5IV2B 3TT3L 1OGAE 3DUSB 5CILH 1OTTD 4MLSA 3MCLL 5IB1A 4Y4KB 5IBLD 4NN7C 3K46A 1WZLA 1DFBH 2F5AL 4NRXB 3JWDH 4NQUA 3B8SA 4OD3H 3UJJL 4Z77B 4DFHA 4LEOA 1QSEE 4XCFH 1U8NB 5C0EB 3HE6C 4P99A 4PG2C 3EOYG 4M43L 5JUEH 5BS0B 5JXEC 3GHBL 2CRZA 4W81A 1P1ZB 3M8OL 1PX4A 4ODHL 1VADA 3OWEA 5L9DL 1A6VL 1KN4H 3QEGL 1RZIA 1S9WA 1OGAA 4ZQKB 3C8KB 1FNEB 4KI5D 4KK8D 1OARH 2DLEA 3CK0H 3ESVF 4DTGH 4EUPA 4WHTB 2VERN 1P5VA 4M6AA 5C0DA 5JW5B 4V1DD 3L3KA 3CVHB 3KJ4C 4JZJC 1H8SA 1IJ9A 2YZ1A 1QSEA 4XBPA 5GJSH 3V4UL 3GMMA 4J3VA 4PJ7F 1C16A 5DFVC 4P48A 5CBEB 1B90A 2ZPKL 3CXHJ 3NN8B 2EDFA 1KIQB 2I24N 4ODWB 4KMTH 4FXKA 1QEWA 5J11C 3VWJC 2R1XB 1NMBH 3DLQR 5DRXB 3STZB 1KT2A 4LSSL 1CZ8H 1UB5B 5E9DA 3PGDA 1NCDL 1U3ZA 5I8CA 4EN3C 4YHIB 5DQ9B 1M7IA 2P8MB 4HFUH 3HZKA 1D3CA 3JTTB 4Y4FB 1X44A 1GGCL 4RMVA 4PJAB 1M05B 4JY4A 3B2UD 1QR1B 4OZ4B 4PJ9B 2ADGB 1W72H 5FYJL 3MRQB 2BCKB 5IB5A 3CMGA 4KTYA 3U82B 3AAZA 5IVZA 3EHBD 4M03A 4KV5F 2WZPD 2H8PB 1J1PH 3FQTA 3PWVB 2B4CC 2D4FA 2XZAL 1T5WB 3IGAB 4BA8A 2VN7A 1J1OL 5DJ6B 3A6BL 4N9GA 5EN2A 4R97B 3T4YA 3O6FB 4Z7NE 3EYVB 1OD9A 4I9WE 4N0UB 3MA9L 1WF5A 2EXWC 3D69B 3NABL 4L1HA 4DW2H 1RFDL 3WIHA 1MLBA 4KMQA 1MFDH 1LE9B 1GC1C 4HLJA 3BT2H 3MRIB 1CE1L 1ND0B 4G7VH 3HCVA 1PSKH 3TNNB 3MRNA 4GRWE 1BIIA 4OLUL 1JNLH 3TJHC 2OJZL 3FTGA 3O6LL 5TQ0L 4ZUUA 2YMXH 2I60L 4UOJA 3CSPA 5IHZB 3PP4H 2V5TA 4Q97A 5GRXG 1OAUL 2VR5A 4HDIA 4DZ8A 2D9CA 1G7QB 2VLRB 2GI7A 1KF9B 3O9WD 3V5KB 3IDUA 3EAKA 3O45A 2X4UB 4M3JA 4PJ8B 3UZQA 5HDBF 3V52H 3L1OL 4LP4A 2NCMA 2HJFA 2NR6D 3P4MB 1OLLA 1BFTA 5EC2A 3ZTJH 4WFGE 3QXAB 1R0AL 1EFXB 2XTJE 2Y36L 4X5WB 3JVGC 2D03L 1JJUA 3BRDA 3L7FB 1MFNA 5I18H 5J0BA 3W9EA 1JGLH 3BH8B 4CGTA 3HE7A 4GQPH 3X3GH 4H1LH 2VQ1B 4F7PA 1KENL 3E2HC 5JZ7D 2SEBB 4KK6D 1BBJA 3U4AA 4LASH 3PWNA 1E6JL 3VGDA 3HKFA 4WV1A 1HHHA 1FFQA 2ARWA 1BOGB 2A73A 2EDYA 3HC4L 3QUKB 4NKDB 5TDNA 4WWKA 5ANME 4B7LA 5IJKA 3G6DL 5KVDH 3O2DH 2V5YA 2EKSA 4U1IA 2DJ4A 5EA0H 1MCQA 3K74B 2KPNA 4RMWA 4PIRF 3ET9F 4RWHA 4CU6A 1IEBB 3VFNA 4HIJA 1GIGH 2XKNB 4MDJA 3W11C 2FD6L 2HFEB 3VD3A 3REVA 2RBLA 5ANMA 3FFCB 5IG7B 3CZJA 2YUZA 3R4DA 1OWWA 5HYJD 1FAKT 3S34L 1OTUD 1RUKL 5JPNB 2HRPH 1II4E 5ID1B 4TRPH 3EYOA 2WW8A 4D9RE 1YMME 4JHZA 2DQDL 4LCCC 1O0VA 4HKJB 5FGBA 1P5UA 1E4XH 3NIDF 4IIQA 5D96B 3IETB 2XN9B 5IMKA 2EYRA 2HJLB 5D7IF 4BZ2H 5I15H 3O6MH 1DBBH 4S2SA 4P2OD 3LKQA 1JI1A 4ONGH 1NBYA 2B0SH 3PWPB 3OKNB 4I18A 2O93L 4XP4L 2CUMA 1YMMA 5E4EC 4GKSA 5AG8A 2HT3C 4ODVL 3TM6A 5FOBA 4NO0A 5JOPD 3ULUF 2FNBA 1CQKA 2P24A 1ADQH 3QDGB 3EDFA 3GK8H 5FCUL 3U30C 4W6XB 3CDYA 4PJGF 2A0LD 3ZE1F 1KPUB 1B3JA 2R1WB 4LCYB 1W72B 1R3HA 3LIZH 1DN0A 4G7YL 1A1MA 3G6JB 3GSNB 3EJYD 4IRSD 1IGFL 3D2UB 3U0TA 4B41A 1MCLA 2NZ9C 5IOPB 3EDKA 1CLZL 2IPUK 2XXMB 4IHOA 5IQ9A 1F97A 4NNYA 3GMOB 1IQWH 4RX4D 4F37K 3QWOB 2GSIA 1QG3A 4RAVB 3MGTB 4CMMB 1FORH 5I76B 5C08D 2YD5A 1BVLA 3DXAE 2QLVB 3FAXA 2OR7A 4HX1B 4DEPC 5GZOC 1A9BA 5FHBL 2VSCA 1JN6A 4OT1H 2VH5L 1MHHB 2VN4A 2Y5TA 2R23B 1CGWA 5ABDE 5FO8B 4K9EC 1KJ2L 5E95B 1UYWH 1WZKA 4P3DB 1TQCC 4OLWH 3D0VB 3QDJD 4X4YB 3CFDA 4FRWA 3LMJL 4MJ4A 3DXAA 2FZ3A 3VJ6A 4TUKL 4JQXC 1PYWA 4RMQA 5SWSD 2P5EB 3KYMB 2BMKA 2BVPB 3KR3H 5BJTA 1Y0LA 5HI5C 1IGCH 1TCRA 5SWZE 4QRPE 3DYMA 2X9XA 1WT5A 3MRDA 3NCFB 4IOIB 3U4EA 3RUGE 5MEQB 2CUHA 2DRUA 1AGEA 3S4SB 2R0ZH 1J5OH 5FGSA 1WIPA 2PYED 3BQUB 3MA7B 1F6AB 4PRPA 3RWGA 2ATKB 3QSKB 4MZ3A 5HTSA 5ADPL 4XMPH 5D7SL 1OQOA 5E56A 3KPMB 5FYKH 3RPIA 1NEZA 3VCLA 5SWZA 3X11B 4UV7H 1NLBL 4O02H 4R0LB 4OBSA 3G5XB 3OKYA 1CG9B 1OL0A 2BSRB 2B2XL 1PY4A 1NFKA 4JDZA 2DQUH 2E7MA 4DVBA 1MRFL 5D7LE 5IB2A 3CLEL 2OX5A 1JWSA 4Y5VC 3KG5A 4QF1A 2VLJD 5IVNA 2RGSA 3N9GL 4YHZL 2AV7A 3GIVA 5DJDB 5L0QC 3PP3H 3R1GL 3VFRB 4KDTA 4HBCH 2AJ3A 1J8HB 2IFFH 2F8XC 2K9UA 4UIKH 3RWCA 4P5TB 2UVEA 3FOLB 4ISVB 4MNGE 5D7LA 1BLNB 4I13B 5FA4B 4KKBD 4OD1L 3OJVC 5DURB 4YE4L 3VG9C 5E8NB 1UADC 3OXRA 3GUTA 3VXRB 3WEXA 2C7UB 2W60A 1GCFA 4P9MH 2VLLA 3I50L 1TZGL 2J88H 2PYFA 4Y5XA 3DROB 5FAAA 5EU6A 3RL2B 5EU7C 1DEDA 2HT2C 5BO1H 3LZFL 4FXLA 4MNGA 4L3CB 3JUZA 3GSWA 3OKEA 4OM0L 2A9ML 4FNLH 4PJIB 3VXMB 4NHCL 2IH1B 3TP4A 3CMOH 3P0GB 3N0PB 4L3EB 1YN7B 1D5XA 1MRDH 1QNZH 2AJYH 5TE6H 4FZ8L 1V7NH 4CVUA 2BX5A 5MERA 2C9AA 1T1XB 4ZOEA 4Y16D 2GUOB 2Q86B 3AY4C 2XWJB 4YO0A 1QFUH 4H5SA 4YNYB 3ZZ1A 2Y6SD 4P3CL 3KPOB 4PREA 2RJMA 2AJZB 4P46A 5F7DA 2OP4L 5AAMA 3HMXA 3DRQA 4PJCF 3WYRA 3HPLB 1FSKC 1OAQH 4RNRB 2EDQA 5FUOL 5B3JE 4G80B 4RDQG 2VJXA 1AR2A 3VXSB 2YZ8A 3ARDC 2DQIL 3AS0A 3VFUA 1HWGB 1X7QB 4XCEA 5JR1L 3BIBX 4MCZB 1JZ5A 1AQDA 1JF5A 3BE1H 3VGEA 5LGJA 4JN2A 2DD8H 3IRZA 3MRHB 1BGXH 4HV8A 4X4XA 2R0LL 1X5IA 2W07A 3IFNH 2R0WL 2WBJD 2CMRH 3BWUC 1F4XL 3MV9E 4OD2A 3RIFK 5EIIA 5AG9A 2OTPA 4ZXBB 4X6FB 2WWMC 2KBGA 3O41B 4U1MB 3V6OC 1I8MB 1FGVH 3U9PL 3GHEH 4W6WB 1EHXA 4YFEA 2Z35B 4D0DA 3WFZA 1DLFL 4MXVF 4MQ7A 1KJVA 5GGRB 1ZT7B 1T89C 2VQUA 4M7LT 1IM9D 1VACB 1QBML 5K9OB 4UQ2A 3RDTA 1A5FH 3DV6B 4M9PA 3MV9A 1A7RH 1G9NL 2EE3A 1MCJA 3S5LG 1BQHA 1IGML 3T0ED 3D85D 3C60A 3TYGL 5LCVH 4D94A 5I1IH 1T0NA 1U8IA 1WBYB 1X5JA 4PP1C 3IDGB 1UH3A 3UJTH 1G6RB 4U1GC 2UWEF 3P4LA 4P9HH 3GSRB 1SJVA 3HG1B 5MHSD 1WZ1H 2JCCF 2HMIC 4MD0B 1WFUA 4NUGL 4Q2ZA 4OF8A 3AU1A 4GRLA 5C9JA 4WI8A 4ZTOH 5K9QI 3SKOB 2AK4A 1WWBX 4RA3A 3FQUA 4FFWD 3ROLB 5HHQB 1HSBA 2EKJA 3C6SA 4H20L 5BV7H 5CEXB 4F3FB 2WIIA 4KI5E 3FQXB 4JY5L 1W0VA 3DVNB 3SDYH 2D7PA 1N64H 4V1DE 2IAMA 4JAMB 3WXVL 3KDMA 4OGYL 4PY8I 4LSVL 3RU8L 1VCAA 5DHYA 1KTRL 3BSZH 5ICXA 3MV11 1A9EA 3ES6A 3QO1B 4ZOAA 3QFDB 4R2GB 1YEIL 1ZV5A 4TQEL 3IDIA 3FFDA 4ONFH 1ZLWH 3RPKA 3MJ8B 4UQ3B 1Q0YH 1GGBH 1JGEA 2R39A 4WY7H 3FT4A 3GSXA 2KZ1B 3C6LD 1TVBA 3SDXB 5E2TL 4V1DA 7CGTA 1U6AH 2ZSVB 4MAYB 3HFML 3ARUA 4JVUA 1CF8H 2HVJB 4G9DB 4GRMA 4Z0BH 4BUGA 4AIOA 3QNXA 1SJHA 1UKTA 1U42A 4X6BA 1S5IL 1MHCB 3VGAB 2BOCA 3C5ZB 1CVSC 3IB4A 4XMLL 1JI2A 2WSKA 2EDRA 1XGUA 4GSDH 4XCCL 3SQBA 4YFLF 4EIZC 1YUHB 2BOBA 5J1AB 4WWID 2NW3B 5F1IA 2NY1B 1CD1A 1MY7A 1GGTA 1SEBA 1UH4A 4S1DD 1QSZA 3RTQB 4UIMA 4JCMA 4PJBA 2VABA 5ETUA 3QQ9C 2YD7A 3G5YA 5C0BE 1FE8H 4HUMB 3SOBH 3RVVD 1A6AB 4CMHB 2NY3B 1D9KB 1LO2L 5GRUH 5DK2B 3SE9L 4P4KC 1BEYH 5CMAB 1MCBA 1JYWA 3I3DA 3JV4A 4JFOA 3QPQD 4OF0A 3ZT6A 3UJIL 4RGNC 5IUSA 1K2DA 1T83A 4UBDC 3BP6A 3QCTH 2IEPA 3BDXA 4FZEL 4NFCA 3VD5A 1OT2A 5C0BA 1LO0H 2XV6B 3FONA 1WBZB 3T08A 4Y4FC 2BRRL 1I7RA 5HYSB 4B7IA 5C0GB 4D9QD 3LSOA 1T3FA 2GJ6B 2X1OA 4LCWE 2V7HB 4PJ9C 4UV4L 2PO6B 2Q3ZA 5K9KA 1NH6A 1RJLB 1OPGH 4YK4B 3PABA 5KBNC 4M6OL 4PB0H 2F74A 1KC5H 4J23A 3TFKC 3QIWA 4HXAL 1G0DA 4HXBH 4E5XA 4Z7VE 4AL8L 4MA7L 4MJID 1EZVY 1DTUA 3RGVA 5IB1B 3G5VA 4KHTL 2A2QT 2GTWA 1FHGA 3CZFA 4LCWA 5DC4B 3QRGL 3TV3H 4Q9BA 4R97C 4RSVA 1HOCB 2FHCA 3O6FC 4LPTA 4ZG1A 1A3LL 1IT9L 2FX8H 5D1XA 3ULUD 3HR5A 1VADB 4Z7VA 3FAWA 4L3AA 1ED3A 2HYMA 2J5LC 1RZIB 1S9WB 1OGAB 4XC3H 1A3QA 3BKJL 3UBXB 4J6RL 4EUPB 1YEJL 4RFEA 2X4NA 5C0DB 1R5WA 2AJUL 3L3KB 3MLUL 3FRPG 43CAB 2B7DT 2D0HA 3WFEH 4E0RA 3QQ4B 1VFMA 3D6GA 1CLOL 1QSEB 4JDVA 3KLHC 1S9YB 2FSEA 1FQ9C 4NQCB 1T7WA 5K33A 4BFIB 1ZTXL 1C16B 1MJ8H 1TLKA 5IMLB 3CLFL 3ULUH 5F1KC 4R26L 4LSRL 5CEZL 3T0EB 4PFEA 3VXUD 4FXKB 1V8HA 4F57H 2B4CL 3SDCA 5IIEA 3TF7C 1ZXQA 1FLTX 3IDJB 4F58L 3RHWF 4G8GB 3FO2A 5F97E 4PJ8C 1DEEA 5E9DB 3PGDB 4Z0XA 5HYJE 5I8CB 3BGMB 1A6PA 1HH9A 1M7IB 4I3SH 4PJXF 2DDQH 1DN2A 1T2JA 4JDTL 4PLKC 4CN4A 3ZE0E 2BFVH 3SE4A 1VEPA 4GXVH 4GS7B 4JY4B 1GC1L 4HC1L 4KJPC 4HG4J 3PWLA 12E8L 1N6VA 1ORQA 4WW2C 1K3IA 1R3KA 5IB5B 5F6HJ 2R9HC 1DZBA 3AAZB 1UB6B 5HYJA 1N0XL 3OX8B 3PL6D 2OJEB 2OSLA 1XGYL 2OMBA 5BVPL 3MNWA 3FQTB 4H25A 3PGCB 2CDEA 4F2MA 4CUCA 3PDDA 4GMSL 4EBQL 4X9BA 3NZHL 2XA8L 3PP3K 3Q2CA 2HWZH 5JOPE 3PNWA 1IEAA 1UVQA 4QGTA 1ZT4B 4JJ5B 3WIIL 4U7MA 5EN2B 1A4JB 2GSGA 3B9AA 4TSAH 2UZYB 3T4YB 1BZ9A 5DVLA 2W9EH 3MV8D 4O4YH 4YXHL 3V7AG 1JHLH 4LQFH 2EH7H 4DQOL 4M61A 3L3OA 3MLXH 4Y5YB 4FQXA 4TOYH 2EDBA 4RFNC 1L4IA 1MLBB 2GJJA 3P0YL 5DD3H 4IM8A 1PD6A 1ZSDA 5IQ7H 3HCVB 4AT6A 4KWUA 2CXGA 4L8CB 1HHIA 4QYOB 1BIIB 2VDOH 5DJYB 4QXUH 3FTGB 4BSWB 3BD3A 1CXLA 3VFPA 3IT8D 2BHYA 3B6SA 4AJ0A 2DM3A 4PD4J 5C08E 4S1RH 4DUXA 5CZVL 5FV1L 4R96B 5IT2L 4GH7B 4QRUA 2FBJL 4DZ8B 4XXCA 1ZGLA 5EOQL 4ZFOA 5A2FA 3TO4C 2LV4A 3O45B 5KVFH 3G6AA 1I3GH 2GIYA 1L9MA 2DQHH 1FAIH 3FT2B 1DLHA 1S7WA 3K4AA 1OTSC 1YEKL 4X0KA 5EC2B 4DGVH 5HGHB 3UTTE 1I9JL 4NPYB 3JV6A 3T4AA 1IGJA 1FFPB 3MRJA 1JRHH 2WUBH 3ZT5A 5C08A 4GKZA 1JHKH 2ORBH 3CX5J 1RAMA 1O7VA 5E0QA 5KVGL 3W9EB 5HYQB 5MENE 1ULVA 3IFOA 4FFVD 2RCSH 3HE7B 4F7PB 4JKPL 4LCIH 1TZHB 5SWSE 5BOPA 4LVOB 1F00I 1KG0A 1BBJB 4GKNA 4YIQA 3RY6A 2H6PB 3DV4A 3UTTA 3V6FA 4OCSL 4XPTH 1HHHB 4HT1L 4XPFH 4ZUWA 5TDNB 4WWKB 1DBML 1QLRA 2NY5C 4HCRH 3OGOE 5MENA 2CDGA 4XWGL 1LILA 2DLHA 3BPLB 3WLWD 4FG6C 1PZ5A 2PTTA 1DUZA 2CPCA 3VFNB 1RZKC 3VG0L 3K2MC 5CFHA 4O2CA 2OR9H 3INUH 3L9RA 2V9TA 1FZOB 4KROC 3A67L 2A83A 5I1CL 3REVB 5D7IB 5EZLA 4WNQB 3WCYA 4XVUC 1IBGL 4WW1A 4MHHI 3MSPA 1U8OA 3X12A 3MRGA 2HKHL 2NQCA 4UOW1 3EYOB 2OLDA 2R2EA 2VLJE 4X4ZA 4NP4L 4HWZA 1OM3H 1S3KL 3W0WD 5DJ8A 3NVQA 4Z95H 2ATPA 2CLRA 5B39B 4P49A 5IMKB 1H8OA 4UDTA 2EYRB 4PJHF 3QUZB 4NM8H 3AM8C 3QUML 4IOFC 2R69H 1BFVH 1J05A 1ZANL 3JSSA 4HZLA 4PJEE 1QKZL 2EDLA 1H15A 4NJAL 5JW4N 1YQVH 3ALPA 2VLJA 3T77A 3OB0K 4KQ4H 3T0AA 5FOBB 2ZUWA 4NO0B 4KMLB 1A7BA 3BQUC 4JJHA 5F9JA 3TVMB 4PRDA 1SM3H 2O5ZH 2IQ9H 5AWNL 1KTDA 4LU5H 4CVXA 4Y4HA 1R3HB 3DOSA 4JM2F 4N0YL 4EQ2A 1NC2D 4PJEA 5C09D 2YS4A 3LOWA 1RUQL 4OZFG 4R0LC 4Z8FH 3U0TB 4UILH 3TA3B 4GG6E 3O0RH 4KGJA 1TITA 5T3ZD 3B8YA 4OQTA 2X7LA 1W0WA 2H2SD 1JYXA 4IRZH 1HYSD 2VKWA 4IHOB 5IQ9B 3LN5B 3CH8A 3DYOA 1T7XA 5F96H 4P4RA 4NNYB 4EDWL 3V4VL 2FJFB 3O2WL 4XHQA 1ITCA 5HY9A 5A2IH 5E2UH 4RGMB 1MHPH 4FFYL 3ARWA 4GG6A 4U1HA 4ODUB 1BVLB 4JKMA 3RKDC 4ESKA 2V9QA 3V5HB 5T3ZH 5D9SA 2CLZA 4Y16A 5ADOH 1HKLH 3BH9B 3LPWA 3NCJH 4YX2L 3B2VH 2W92A 1JN6B 3ZKSD 4Z7QF 2Y5TB 2Z9TA 4AZ8A 1C5BL 4PJ7E 1D5BA 4UINH 2ESVB 1MF2H 2QQQA 5L2KD 3CFDB 3MV7B 3DXAB 2G2RA 4NWTH 3VJ6B 2CGRH 1PYWB 5TFSH 3NH7H 4KRNA 1SBSL 2BMKB 5BJTB 3QWRD 1Y0LB 3L3JB 3V6ZB 4LRIC 4ZFZB 5E08L 1Z0MA 4GT7A 3U4EB 4BELD 3QJHB 4DGYH 4B5EA 1GGUA 3UDWC 1SYSA 2B1AL 4PJ7A 1S7VA 2OL3H 1AH1A 2P7TB 4XNQA 2DS4A 1D5ZA 7FABH 2MQ0A 2WBJA 4JN2B 4E9LA 3B83A 4U6VL 2X05A 4PRPB 4LLDB 3RX7A 3RWGB 4AQ1B 3DVFA 2NY6B 4JHAH 1IGIL 2MCPL 5I1GH 4FTVD 3EUUA 2EDJA 5CHNA 1KCVH 3RPIB 1NEZB 5DQJA 1FG9C 1X5GA 4H0HB 5SWZB 3VCLB 3KYKH 2CRMA 4K3DL 2ADFH 4M5YH 4JFHE 2EDEA 3O8XC 1IM9A 1EGJH 3MO1A 1L7TL 2X9WA 4KVCL 4I0PD 4NGHH 4L8BA 4B0MM 2YBRB 5E2WH 4JO3L 3E0GA 4G5ZL 4NOFA 1A14L 1MIMH 3OPZL 4Q9RL 1JWSB 1FJ1A 4ZS6D 1GOFA 3EYSL 3DARA 4U7SA 2AV7B 5IBUB 1X4YA 4KTDH 5GS3A 1U41A 2X5PA 2EDOA 3KXFB 4AEHL 4DVRH 2MCG1 5GGSA 1PQZA 2AJ3B 4PJFF 5D5MF 1K4DA 3ILQC 4ZXBC 4DUVA 3RWCB 1XR9A 2NY4D 4ODTL 1JNHB 2CKNA 2IBZX 2W0PA 4MDIA 5J57B 2PF6A 3OXRB 2EDWA 3GUTB 3WEXB 4CVZA 1IILE 2W60B 1JCKA 2HH0L 1XR8A 5E6ZA 3HNTL 1IAII 3GBLA 3VI3F 3U0PA 5EC1B 1KPRA 5EU6B 2Q8BL 4OCWH 4PBWD 1DBKL 1UZ8A 4MNGB 1HEZA 4JEGB 4QRSB 5A16B 3OKEB 4L8SC 5J3HC 1T20A 1J86A 2ZCHH 3BYTA 4K3EH 3R8BB 3C6LA 5DJ2A 4KUZL 5BOZG 5MERB 1HINL 4NQTA 3T3PF 5B38A 3P11H 3I9GH 4MNHA 4NCC2 5FM5O 5JLZA 2D7QA 4YO0B 2IPKA 1ZAGA 3BX7C 1BAFL 1MUJB 4PREB 3TZVB 4BFGA 4P46B 1F3RB 4G6AC 4X7DC 5DD1L 3DRQB 5DS8B 1Q9WA 2HKFH 3S88L 1UQSA 3BMWA 5KAQG 1A6ZB 3S7GA 1WAAF 1AFVL 5B21A 4TULH 2OR8A 3VFUB 3DX7A 5FEBA 3WNMA 5F9OH 3VXTA 4R2GC 2AGJL 3TT3H 1U8MA 4XP9L 5CJQL 1P4IH 5LGJB 2Q87A 3MBEA 3FRUB 3MCLH 4PLOB 2F5AH 4HV8B 1E4JA 3N1PC 1HK6A 4X4XB 1VHPA 3UJJH 2KDGA 1C12A 2OK0L 1UWGL 4MAYC 4M43H 5C0AD 2MJWA 5EIIB 1UXWA 5ISZD 3GHBH 4MLIA 5DK3A 3M8OH 4ODHH 3UX9B 5L9DH 2Z8VC 1A6VH 3QEGH 2E27L 3EYQD 3RI5K 2UWEB 4U1LB 5HDQL 4OBRA 1IAIM 4D9QE 4QT5B 3MZTA 5KSVA 4MQ7B 1KJVB 3BZEA 3OR7A 2HJKB 1CDUA 3VGAC 4UQ2B 2EE2A 4MX7A 3C5ZC 3STBA 3V4UH 3NIDE 3VXNB 5IMOA 2DIJA 4UNTA 5I30L 1BQHB 3TBWA 4M6NL 3EYUL 1OP9A 3C08L 1T0NB 5T33L 3SBWC 1CDCA 2ZPKH 4MJIE 4LPCA 3SDDB 5A2JH 1GXEA 4QLRA 2Q6WB 1NPUA 1RI8A 2XPGA 2NY1C 2VZOA 5CD3A 5C92A 1FO0A 4Q2ZB 4LSSH 2V5SA 4NZTL 4D3CL 1NCDH 5C9JB 4WUUD 2AK4B 1KEMH 3JWOC 3KS0H 5ID0B 3ULUE 3FQUB 4CMHC 1MAJA 3ZE1E 1D9KC 1HSBB 4L9LC 5BRZD 3IXTB 1GGCH 2WIIB 4MJIA 4RDQF 4XBGA 5EBWA 1S8DA 1W0VB 4ZDHA 4LHQB 5FYJH 1EUTA 4X4ME 2IAMB 3VH8G 4KK9D 2IPUG 3FHQA 1NCUA 1B6UA 2VR4A 4FN0A 1YEEL 3TYFA 1YC8A 3ES6B 3B9VA 5JQHC 2VUYA 4I8DA 3IDIB 3FFDB 5IROA 3MRMA 5HHMB 4R7DA 1JGEB 1FRGL 2XZAH 3FT4B 3DX6A 1TVBB 1J1OH 4EI5C 3A6BH 4YK4C 4X4MA 1PG7X 3CVHL 2C4XA 4TNWF 1B0RA 3NTCL 1BX2B 2ED8A 2J1KA 1QLFA 4GRMB 5JW4M 3R0NA 4Z7WB 3CSYA 3MA9H 3NABH 5DA4A 1YNLL 2WLYA 2D7NA 3RIAF 1RFDH 1SJHB 2XZCL 4X6BB 5CJ8A 4BZ1L 5C0NC 4YDJB 1CE1H 1SMOA 4GJTB 3KS0J 3U7YL 3MRPB 1DVFD 1FL5A 3GM0A 3FZUC 4OLUH 3ARBD 4DKFL 4KVNL 3BFOA 3GMNA 2OZ4A 2OJZH 2NMSA 3O6LH 5TQ0H 5F6IB 1EAPA 4IRJB 2I60H 1U8KB 2MKWA 1OAUH 1YEGL 3CDGA 2BOBB 4NHUA 1A2YA 2B5IB 4NQDB 3W5NA 4WDIA 1T1ZB 5CP3H 2FL5A 4XI5D 1ZHKA 5F1IB 1OAZL 4J4PD 2GK0A 1SEBB 5I6XB 3PUCA 3RVXD 3KYNB 4DOHB 1HNFA 4UIMB 1B88A 3MV8E 3L1OH 1FVCA 4PJBB 5EBLB 1EERB 2VABB 5ETUB 4X5XA 3FCTB 3HS0A 1R0AH 3PL6A 1ZHBA 2Y36H 5DMIL 1V7ML 5KG9A 4PJDF 2D03H 5DR5L 3P4NA 4QRQA 1LO4L 3JV4B 4JFOB 2MPAH 1XF3A 2APVA 1CFQB 1KENH 4MHHG 1FCCA 3CFIC 4HAFA 1P4LA 3MV8A 3TPKA 5CWSA 3BP6B 3QZWA 1E6JH 3L5WB 5C0BB 1HNGA 3MCG1 1MHEB 1I7RB 4MJ6B 3LSOB 1T3FB 5ESAA 3OSKA 3HC4H 4GS7C 1ZA3A 3TPUA 4LHJB 3Q6FB 2ZSWA 3G6DH 5K9KB 1GZPA 5FDYA 1J10A 1YMHA 1RSFA 2F74B 4HJ0D 2XNAA 4YDLC 3QIWB 4XZUB 3ZYZA 2F53E 4P23A 4ZAKA 2NXYD 4QHMA 3QUYD 2FD6H 3WN5B 5IFHL 3RGVB 3G5VB 1WSST 1EVTC 4U6YA 2GTWB 2CR3A 2BP3A 3CZFB 4LCWB 4R4FL 5DUBA 4U1KA 3ZKMC 1TVDA 1JPTL 2LTQC 2X4RB 5DJCB 3S34H 4XAKD 1RUKH 5D1XB 1EHNA 3OMZA 4OLVL 4Z7VB 3BN9D 2F53A 1AO7E 2DQDH 1ED3B 5C3TA 2HFGL 4Y5YC 2P5WD 1AKJA 4FMFA 5JIKA 5ISZB 4JM2D 1EV2E 3C87A 3KHOA 2X4NB 2N56A 4JFDE 5CZXD 5D1QD 4E0RB 3NPSB 1G7JA 2FSEB 1R3LA 3GDBA 2VSDA 4NO3A 1HQRA 1FG2A 4C56B 4XP4H 2BDNL 1AO7A 2NY2D 5FGCB 4ODVH 5IK3A 3BWAB 3GMPB 1MVUA 2J8UE 4QCIB 2OTWA 1KB9J 1WVZA 4JFDA 5FCUH 3BKML 3MRCA 3MRLB 4F9PA 5IIEB 1WISA 3FO2B 1QLEL 1T04A 4PJCE 1N5AB 2X4SA 3KPPA 3ISWA 2CK2A 3UBXI 4G7YH 4IMLA 3BDYL 2RIKA 1HH9B 5HD8C 4CNIA 1IGFH 3W0WE 2FHFA 1G9EA 1NMCC 4LMQI 1AHWB 2J8UA 1CLZH 3MOAL 3GNML 3NCYP 3HE7C 3PWLB 1ORQB 3GKZA 1KNOA 3GSQB 1HILA 4Y2DD 3SY0A 4PJCA 3WKML 4LVOC 2A74A 1DQJA 1XGTB 4PRIE 4ELKB 2J7LA 3ZTNL 4QNPE 2OSLB 4OCRH 4OB5L 2NLJA 3KPNB 1T6WA 3GEWB 3MNWB 2CDEB 4F2MB 4WV1C 5FYLL 1NAKL 4ORZC 4M1GL 4WWKC 3HR6A 5IJKC 3PNWB 4P3WA 3J7HA 4BQ6A 4NM4L 5C7XH 5I1AA 3RWFA 2GSGB 1PKOA 3BPLC 5FHBH 3U2SA 1J0HA 2VH5H 4DN4L 1RUPL 3C5SA 4PRIA 3UPRA 3B9KA 3PQYA 5C09E 2CLVA 4M61B 5GGVL 3RX5A 1TQBB 4FQXB 1DBJL 1KJ2H 1QFWH 2XKUA 5DQDL 4RBPK 1P6AB 1ZSDB 3LMJH 1IC7L 4AT6B 4TUKH 1HHIB 3HZMA 4I3RL 4XHJC 1F58L 4WGWB 5D72L 3ME0A 3VFPB 2EIBA 3B6SB 1BFSA 5C09A 3GSNL 5FGBC 4IIQC 2JLLA 4QRUB 5DO2D 4NQVA 5L8JB 4NKIL 3QUZC 3VU2A 2BNRD 4LF3A 5ADPH 2NY5L 1T1WA 5D7SH 1NGWA 4L29A 4GLRH 1C5DB 4M7KL 1S7WB 4POUB 4F9LA 4X0KB 3SEPA 4FP8L 3WD5L 1JUFA 1YECL 4I18C 1IGJB 1NLBH 3MRJB 4OUUA 1RZKL 3QCUL 3SKUD 1YDPA 5LKNA 2B2XH 4GKZB 4RFOL 4XWOC 5L2KE 4LSTH 3LN4A 5F72S 3IFOB 1UH2A 1MRFH 5EH1A 4A6YL 4DW2L 4YBHA 5K59F 2PW1A 3QIUA 4X83A 3CLEH 1Q0XL 4OUOA 4LLWA 1KG0B 4RISL 4PRBA 2D2OA 5DJXB 4YIQB 5F70A 3N9GH 3DV4B 4YHZH 3UTTB 2ZG3A 5DC0A 1EEQA 3V6FB 5JA8B 4WTWA 2KQMA 1M1SA 3TA3C 3R1GH 5HVWA 3NCCB 3MX0A 4ZUWB 1UXSA 4GAJL 5L2KA 2D31B 1QLRB 2Y7QA 5MENB 2CDGB 4BQCA 2P46B 4POZC 4FTVE 4OD1H 1YYLL 1PZ5B 4YE4H 3ARPA 2PTTB 5KN5B 4BH7B 4HWBA 4QWWD 4RGMC 4O2CB 5ACMA 1M4KA 1BZ7A 3L9RB 3MUHL 3KPLA 4NFBA 3I50H 4ZUVA 3LKRB 1EGJA 2QADC 1FYTD 4AM0A 4BM7A 1CGVA 4PTUA 1TZGH 4OZHB 4EI6A 3NFSL 4H8WC 3LZFH 4WW1B 3L5XL 2FECL 1WJ3A 1G7MA 4YXKL 1IC5L 1U8OB 4FTVA 3X12B 4OZIB 4OM0H 2A9MH 4FS0A 3MRGB 4NHCH 1AGBA 5EU3A 1XAUA 2R2EB 3C8HA 3KNBA 1SHMA 2R4SL 1I8IA 5DJ8B 2B20A 1A1NA 2IADB 1D6VH 3TBTB 1BIHA 4MA1C 4FZ8H 2CLRB 4F7TA 4NKMA 2K7PA 4JZNB 5EUOF 4YH6A 2D0GA 3P9LB 1IAIL 3TCXA 2UZIL 4FABL 1J05B 2OXGA 4HZLB 4P3CH 1TMCB 1WT5C 2OP4H 1G7IA 5JPMB 4X6DF 3U36B 5FUOH 1BHGA 5SX4H 4AEIL 1EJOL 1CICA 5F9JB 4O58L 4PRDB 1P2C