4XXWC

Crystal structure of mouse cadherin-23 ec1-2 and protocadherin-15 ec1-2 splice variant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
204
structure length
204
Chain Sequence
QVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tuning Inner-Ear Tip-Link Affinity Through Alternatively Spliced Variants of Protocadherin-15.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Protocadherin-15
total genus 45
structure length 204
sequence length 204
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4xxwC01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4xxwC02
4ZMVA 5DZVA 3LNHA 1FF5A 4AQAB 4ZMTA 2WCPA 4APXB 4AK1A 4ZI8A 2OMWB 3LNFA 4QD2E 4AQ8A 1NCIA 4AQEB 3QRBA 4AQ8C 1WYJA 3UBHA 2YQGA 4XXWC 2WHVA 1EDHA 2OMXB 1Q1PA 2OMZB 5CO1A 1ZVNA 1L3WA 1WUZA 5JYLA 3UBGA 2QVIA 2WBXA 2OMVB 3K6IA 3MVSA 4AXWA 5KJ4A 4AQAA 4NUQA 4ZMZA 3LNIA 4ZMYA 4APXA 3Q2LA 4XXWA 1NCGA 2V37A 1NCJA 4ZMOA 2WD0A 3K5RA 3FF8A 4ZMXA 2A4EA 3LNGA 5JYMA 3Q2VA 4ZMWA 3UBFA 2OMUB 4ZMPA 3K6FA 4ZMNA 2YSTA 1O6SB 1ZXKA 2OMYB 3FF7A 3LNDA 1NCHA 4NUPA 3K6DA 3Q2WA 3K5SA 1OP4A 4ZT1A 4AQEA 2QVFB 3Q2NA 2EE0A 2OMTB 4NQQA 5CZRA 2X2UA 3LNEA 4ZTEA 4ZMLA 4AXWB 1SUHA 3PPEA 4NUMA 2A4CA 2O72A 4OY9A 4ZMQA
chains in the Genus database with same CATH superfamily
3VYPA 1Z9SA 4YWGL 1QTSA 4LQFL 5LBSH 1AQDA 1WD9A 4PJDF 4U4IA 4D7BA 4KK9D 1RZIA 2E9BA 4JZOA 1M05B 1CYGA 3P9LA 4AQAB 1YY8B 4JHWH 2D2CC 4X6DE 3K2MC 1OP3K 2W0KA 4QRRB 2H6OA 5L2JB 3WFBH 3KHQA 3BZFA 3D50A 1R4XA 3WFHA 4JM4L 4EDWH 1IGMH 5F7DB 3T8XB 3O11A 4WRLA 3IRZA 1NAML 2EO9A 4I0CC 4KXDA 4AVHA 4FJ6A 2BP0A 5D7IA 1OW0A 1MHCB 1G84A 4HKBB 4WNQB 3F7YA 3AROA 1G7MA 1CXFA 1RULH 2EXWD 1P6FA 5L8JB 2F1BA 4BGLA 4Y2DC 1F90L 2E3VA 1VENA 1JJUA 1KTLB 1UFGA 2HTLD 3SGEI 3CHXA 3MQIA 4M5SA 1J8KA 4IMKA 5J1SC 1SJEA 4P4RB 1U8KA 4P9HH 3A6BL 5C0DB 2JJSC 2VLRE 2DV6A 3GSWB 2FHCA 4CMMB 5I18L 5I23A 4ZW6A 1NM9A 2BNQD 4HFUL 3SKOB 1I8LC 4P2CG 5IBLC 3HS8A 5L2JA 1NCGA 2KMWA 3WELA 3MFGB 1VADA 2FSEA 3FQNA 1WZAA 3ETBJ 3CFIC 2F6AA 3I84A 3ETTA 1OHZA 2GB2A 4PLNC 1ZIBA 2R29H 4H26A 1Z9SB 2WXHA 1X9UA 4A2LA 1MJJA 1ZLEA 2D7TL 4JDTL 3BGFB 4M93B 4R2GC 3PWVA 3OAZK 1GOFA 2MEJB 1JUFB 3ECUA 4BFNA 4XMTA 3S4SA 5L4IA 4TYUA 1CD1A 5EF2A 4PTUB 1NEZB 4U3SA 3MV11 1BA9A 4JQIL 3T65A 3HMXA 4OBSA 3EXJA 3EHBC 3QIWD 4OCSH 4PAZA 1K8DB 1JPST 3FPXA 3OKYA 1FL6B 2P8PA 3BP5B 4GW5A 1YNTB 1AJ7H 2BVPB 2XZAL 3RU8L 4OGZA 2O61A 3UROR 1FFQA 2M26A 4NUPA 2AQSA 2PLTA 4A6YL 2UX7A 1TVBA 3CN3A 3FULA 5I1DB 1GGIH 1B3JA 1NIEA 5IB3A 4WUKH 2GSGB 5HHOD 4DEPB 4B96A 5G55A 3BWUF 1SEBA 1VEOA 1YMHB 1BWMA 5CEXB 1KZQA 2WINB 4PJBE 3CGTA 4IJ3B 4JY6A 1UM6H 5C6WH 1YVLA 1X3DA 3AMLA 1OO2A 2IVFC 2WXQA 5IHZB 2QLVB 2N1KA 1UEMA 3QWRA 4ICXA 1KIUA 1SMDA 3FT2A 4QTHB 1E5BA 1T03H 3HFML 2YGQA 43C9A 5KVMC 1MVUB 4PRAB 1NANH 4LPWA 4MJ5B 4E9RA 5I18H 1G7QA 4FLSA 3I2CL 2DJ4A 4RMVA 5C09D 1P53A 3AWEA 4ODVH 1TZ8A 2Z34A 3ZDXF 3S88L 4BM7A 1TVDA 3ULUD 2X4TA 3OHMB 3RI5K 2NYZA 1ZLSH 4FFWD 3VSVA 5KUKA 4QKXB 4KRPD 1F90H 3MGTB 4LCUB 1OSEA 1K5WA 4LT7A 4PJEE 5C0RL 2K7QA 4LIQH 4K07A 3FCSA 1RULL 2E6QA 1RHFA 4XO4A 5F6IB 4WSKA 1N3NB 3GBNH 2ZXCA 1COBA 1IU1A 2BP8B 1BGXL 2CUHA 5GRZA 3C8HA 2BS9A 4NQSA 3U1SL 1S8DA 1ZE3H 3IBEA 1WP6A 4OZ4A 2J8UF 3GMMA 2ZXGA 4OJFL 5KOVC 2GK2A 3RGVC 4U2YA 2WWNA 5D7LA 3PDGA 2KLTA 3BLKA 3M7FB 1GA2A 1S7TA 2X6CA 1LP9A 3N06B 4JHWL 3Q6GH 4N0FB 5F7UA 4ILDA 4FTVB 1Y07A 4OM1L 4S1RH 5EDXA 3L1EA 4JEGB 1XCWA 2NW3B 3KBEA 5ISZB 4FFVD 1LWJA 1CDIA 1QO3B 5JDSA 4WAFA 2VLRD 1RL1A 2FJHB 3REVB 1BVOA 4G43A 5D2LB 1IC1A 4Q9RH 2Z31B 4BKLA 1FZMB 2VO5A 5ICZA 3MLTB 1WFOA 4G8EB 4KRPC 1F13A 2NOYA 3MJ8B 3BPOC 3UERA 6CGTA 3VXRB 1SY6H 1SXSA 4FQHB 3A6CH 3SPHA 3BAKA 5GRJH 1I3GL 3HS0A 3A23A 5I15H 1IKNA 5DJZB 5HDBF 1CB4A 4NO0A 1MQKH 2CHDA 4W9IC 2ITFA 4X4XB 3FB8B 3HC2A 5TE4H 3MCLL 1V7ML 4XMKH 3ULUL 5DJXB 4NAJA 6FABL 4Y2OB 1HXYA 4I9XA 1CK0H 3LZNA 2IFFH 4M7KL 4LRIC 4PJ9D 1PIFA 5LG1A 3EOBA 4PRPA 3ZDZB 1NCHA 2WC7A 1MI5D 4QOKB 1DBAH 2KZBA 3GO1H 1P5VB 4KHTH 5AVSB 2IALB 5GRXG 4F3FB 3K8LA 3TPKA 5CR8A 2H6PA 2Z31C 2BHFA 4KX8A 2XBTA 1YPZE 1RCYA 3QHZL 4RNRB 4ZMLA 4AXWB 4MDRA 3D3VA 4RDBA 2H6UA 2B16A 3Q5YA 2FX7H 4QHMB 3E7JA 1R75A 2Y7LA 2YD6A 4LSUL 4X4MA 5D1QD 4R90H 4U6HA 5K93A 5CCKL 5AB1A 3FB8A 2ZJSL 4R7DA 2Y7NA 2DQGH 1GGBL 1BBJA 3MNDA 3DETD 3PDDA 3SBWC 3EH4B 5M95B 5C6PB 1E4XL 5FO8A 1RJLA 1RLWA 4WUUE 1B0GA 1LL1A 4G6JL 3NRFA 1L9SA 4UDTA 5B38B 1NCIA 4KTDH 3RTQB 5AZEL 4ORGA 5HHPA 1ZVSA 4U6YA 3WKNA 1K72A 1VCAA 3MODH 1YO4A 3P69A 5JHDB 1Z9LA 4AC4A 4QJ4B 3QXAB 4YVNA 1YNKL 2OYKA 2GITA 3AM8C 3GSVB 3QEGL 1TF4A 1WDAA 3W9DA 3DIFA 1NMBL 1WT5A 2IAMD 1EZUA 4NNPL 3WBDA 3G08A 4W6YB 3RFZA 4YLQT 2WW8A 3DJ9A 3DDFA 5HYQA 4FFZH 3WO4B 4FQIL 2MIZA 2KQMA 4DO6A 5KAQG 5INCB 2NXYB 1ZEAL 1PJWA 3VQ2C 2D03L 3X11A 4L4JA 3OJMB 2YGNA 2VB5A 4MJ6A 2EYTB 1RJYB 4UQCA 1GGYA 2WQVA 2G60H 3WSQH 4EOWH 3EDFA 4FTDA 3E6FA 3K2UL 4NZUH 3DIDA 3OF6D 4Z6AT 1SGKA 2OR9L 4L0YA 4NQCA 4MKMA 2YD5A 2YA2A 3H8NA 3O2DA 4GG8A 3ATBA 4N2GA 4WEBL 5TQ0L 3QIUA 4NPKA 2ZUUA 5C3LD 1B4JH 3CFKB 4WSJA 1T4KB 5LQBL 2B3IA 1O5DT 1SZNA 1KJ3L 5IV2B 1OGAD 4U1JB 1AR2A 5T1MA 1A9EA 4PJAF 5EU5B 4PI2A 3QAZB 4J4PC 5DGQA 3BYTA 4M03A 3GIVA 4OIIH 4ZAKD 4DAGH 4NNYB 3OAWA 1G94A 4L9LB 1F18A 2X12A 3UC2A 5DZJA 4DGUA 4FOMA 4IHBA 2WWMD 4XNYH 5C2BL 2XWEA 5HP5A 5IHZA 4JO2H 4DTGL 1K2DA 4KJWC 1QLEB 3STLA 4R7XA 1FNGB 2YRLA 3QHFL 2J56A 2PW2A 2XNAB 3K6DA 3Q2WA 3SBWA 5MEOA 1EGJH 1RJYA 2GSIA 2WLLA 3MMEB 2QSTA 4XOAA 1KBGL 3PHQA 5C3IA 4N86A 1NGYA 4MS8C 2G3NA 4IRSA 5ANHA 2P8LA 2Q3ZA 2M1KA 4HUXB 5KSVA 1MXGA 4H2CA 4LSPH 4KV5F 5D7LB 5J13C 1SBSH 5EU7C 1KXTA 4YL9A 3G08B 4GAGL 2HRGA 3WL9B 2GTQA 5LO7A 3OLIA 3P2TA 4NQUA 3BGMA 3TN0D 2YMTA 1SLVA 3AREC 4MJID 4C83A 4AV5A 4FGMA 3V7AE 5F7AA 1EEZA 2LHAA 4TXVB 4HJIA 2X4UA 3WO3B 2VQUA 2CLZB 1FFRA 4WO4C 1JWSA 1SF3A 4HT1H 4N2IA 5E7BA 4E68A 1C16B 2IPTL 4NO0B 4PWKA 3ZTDC 5E1QA 1WT5C 1U4EA 4DKEH 3MYZA 4DUXA 3H7LA 2BNRE 4X6CE 4Y0GA 2X0VA 2UZYB 2VCOA 2OMBA 3IFLH 4PYGA 4U6VH 1XMEB 5EZJB 3UX9B 3VM7A 4Z7WB 2NY5C 2PR9A 4HBCH 3LAFA 1JL8A 3N41B 4Y7MA 3L1OH 2DICA 1R24A 4P2OD 4X4KA 3P2DA 3IPEA 3AABA 1NBZB 5ENWA 3LKSB 4FLQA 4GT7A 4PJBA 4YDLB 3ARPA 1Q1PA 1E8ZA 4O2EA 3UO1H 5C71A 1JMZA 4NKIL 2OK0H 4PGEA 1JNLL 2EAEA 2G5RA 2J6EA 2X28A 3QORD 5I1GH 1YQVL 2O5NA 3MRQB 1H5BB 5IWLC 3VXPA 2CBOA 2FX9H 3FAWA 3MVSA 1AKJD 1MRDL 3TU6A 1GTNA 4K3JH 1BBDH 4X9BA 3MRNB 5DWUH 1E4WL 1INQA 3G5VB 2VITA 4KRLB 1DQQB 4PB9H 2ZSWA 4WJ5B 2ATAA 3KH4A 2PNDA 1A6UH 4DGIL 1EFXD 1Q94B 3GK8L 4GQRA 3SO3C 3N1MC 4X4YA 4M7ZB 1A6ZA 4MAUL 4NWTL 1BPVA 1ET7A 4KVNL 3MUY1 3QHFH 2N01B 3NCYP 5EU7E 3L7FB 5IP4A 2WLZA 3B8SA 3DLQR 1D5RA 5AOZA 2BIOA 2ZCZA 4KNQA 4AUUA 3L3DA 3QI9C 2OSLA 4L3FA 4JMNA 1S6NA 4OIIL 2P24B 1OP5H 5E4AA 1NGXA 2J44A 5IEHA 2Y7OA 2DJUA 2XWZA 2YXFA 5DS8A 1JSYA 2C9QA 1UWGH 3O3EB 4XVJH 4K0OA 1JYNA 5CJ5A 3VM5A 4N2BA 2ZX6A 1KGJA 3LZRA 2GFBA 4KZDL 2LR4A 4GW1B 4JRYA 5B3SB 5I1EH 2ADFH 3ISRA 3CBJB 4PUBH 1FGNH 2QSCH 4XMXA 1MJ8H 4FZ8L 3RVXC 1O6TA 3WSQL 4KHXL 4UB0H 4QO1B 4Z76B 5SWQB 3VFSB 3T8VA 1CICD 3CIAA 3HI1A 2H47C 1HL4A 5DRXB 1TQBB 5C07B 1G7JA 1JV2A 4XGZB 4GBXD 4WWOA 1S8DB 1ORQA 5L4MA 1OP5K 4HOXA 5IMKA 5HVGB 4PVLA 2OTWB 4MS8D 4FFZL 4GG6F 5H35A 4FI7A 1ZSHA 3FSZA 3HA0A 5FV2A 5HGAB 5TPWH 3FW6A 1NMBH 4XH2B 4Y4HD 5TE7H 4Z3JA 3WKPA 1IZKA 2VN7A 4LEOB 1I9IH 4FQPA 5DFTA 3QHTC 2V9UA 5GSVA 1XGZA 2HRHA 1N64L 3HE7B 2WP3O 5IB1A 1F3DH 4MJ5A 1CFQA 4U6XB 1ORSB 2VLJB 3M45A 4M61B 1D6VH 4XVSL 4YJZL 5JOPD 2P5ED 2HJLA 3QS3A 2H1LM 4PY7A 1JGUL 2CGZA 2YZ8A 3ZVVA 1OE2A 3QEQA 3IGUA 2RHEA 5ETUA 1BCIA 3CE1A 4OCMC 3U6RB 2A5UA 3DROB 4MMXC 2QQNL 3QUXC 3D3VE 2NY6D 4L9LC 4BZ2H 2YD2A 3NK4A 5KSAA 4ZRGA 3CXHK 4YDIL 1HH6A 1EAPB 3KJ6L 3PS6A 2NNRA 4HIIB 4JZNA 1RIHH 3SY6A 1RUQH 2PCPA 4X6DB 3AU1A 5E8EA 5C08D 3LXCA 4GKLA 4FYTA 4XNZC 3L4XA 3LN9A 2P52A 3ILQC 5JIKA 5L9DH 3RZCD 3FTWA 5CZXC 3DMMB 1E7UA 3VQMA 4PJXB 5A3ID 3I85A 3D09A 4GXFA 4X6DA 2WYTA 2I07A 2CDFA 4UV7L 4K9EH 5IMMB 3CFQA 3FH7A 2WD0A 3GO1L 2EADA 4RWYH 2UWEA 1RUAL 2YBRB 3PDOA 4OVUA 3VRJA 3GMNA 4X5WB 4XTRC 3WFHB 3S35L 2WWKT 2FEDC 4MQTB 1CK0L 1NJ9A 5FYJU 3O8XB 2DMCA 4R7LA 3TFKC 1ZVHA 1AKJB 2H32B 1A3QA 1RPKA 1OARH 3B2DC 4ZD3H 1DVQA 1MQKL 4H5SA 4WKZB 5F7KC 5J57B 1OP9A 2UZXB 1HQRA 1CMOA 4FNRA 3NIGF 1WBYB 3C8DA 3BT0A 2E76C 1XR8B 3SKOA 3QPQC 3I50H 3C5SA 4FNLH 4JG0L 4JFPA 3TO4B 1G1KA 3IFNL 3NYKA 5EU6E 2AABH 3AQDA 5J6GB 4APQD 2D7OA 4HEPG 4P2OB 3QJUB 4GSRA 3H42H 3FO1B 5MEND 4G11A 5JLZA 3TZVD 2AP2A 3SDCD 5HBBA 5ESVB 1EWHA 5D71L 4JFDA 4POZC 5F1SA 2IAMC 3H54A 4NOBA 4OM1H 1BWWA 3VD1A 1YEGL 4OKDA 4PS7A 2CDEA 3CDFA 5E1IA 1SDDA 2N7SA 5KJRH 4RA0C 5F7HA 3VVVA 3F83A 4BBWA 1ZWIA 1J8HD 3OPZL 1ITCA 1QEWB 2JCCF 3TEUA 2DYPD 3GUFA 3LKOB 4GXUM 1BGXH 4PJIF 4X9FA 2B9BA 1KELL 4XBMA 4I9WD 4Q9CA 2AXWA 3RX9A 3S3CB 4GP5B 1R5WB 1ACYL 1NA8A 4AMWA 2IV9A 5I76B 1AQMA 4P9HC 5TDOB 4YSUA 3KPSB 3NEEA 4MD5B 2YQGA 1GC1C 4PRDA 2F8IA 2WHVA 5BS0A 4H0IA 2EDWA 1NCTA 1BYNA 5IQ7L 4AVJA 5AOIA 3S88H 3ROOA 4ZX6A 3DO7A 2IXQB 1V3MA 2OX5A 4XX5A 1X7QB 1Q94A 1A14H 3NIDE 4A1RA 4XP5L 1JGIA 1T03L 2BXZA 5HYJA 1MFDL 2NX5A 2QFPA 4PBDA 3VFGL 4AKQA 4G8FB 4LLQA 3GXTA 3ALWA 2AEQH 4L0PB 1SHSA 5JDJA 4ZXBA 4M4RA 5GZOC 4CNIB 1FAIH 1UM6L 2ZWYA 3OKMA 4KJQD 4HOWA 1I1FB 3DGGA 4JO4H 4CC0A 1CLOL 3KCPB 5AG9A 1AIZA 2XXFA 1Y6NR 2F53D 5IHLB 1NIDA 5AUMA 1X5IA 3QJVB 4UV4H 1GOHA 2OYPA 3MLYH 5E6RB 1KB9J 4LVOC 3WFEL 5E1AA 5ID1B 1RURL 4WENB 4U1LA 4NM8L 1H3PL 5TH2B 4MAYD 4WEMB 1LYQA 2R1YA 3RQ3A 3RB5A 2CM5A 2DBLL 3X3FL 1VKXA 1ZSDA 2PMZA 3OR6B 1XGUB 3QJFA 3CHOA 1QNIA 2UZIL 3AW5A 3R1GH 1JZ5A 4UAHA 1FZOB 1IL1B 4G2AA 3BHBA 1SYSB 3F7VB 4HXAL 4PY7B 1ZA3A 4JFXA 5GS3A 3CFCH 3WIIH 4ORZC 3H7BA 4V1DD 1JS4A 3QVAA 4ZTPL 1HHIB 2KS0A 3BMWA 3PIQB 4X7EC 3NZUA 1A25A 1AKPA 5I24A 3MLRH 4DP2X 1HL8A 3SJVA 4OFYD 4QNPE 5I5JA 3I6LD 2GSMB 3VYOA 2V2XB 1VHPA 1R5IA 5JORA 3JUYA 3LOWA 2XIIA 3QDGB 3NJFA 1DJHA 1MI5E 4Y4HA 5C8JA 2Z92B 1DVFC 2QGCA 4PJGF 4WFGE 4HH9B 3D0LA 1FN4B 4CU6A 3DI3B 4OZFB 5AKSA 3EH2A 1N2RB 1GC1L 3L95B 3S3JA 1IGJA 2FO4B 2P8LB 5GISH 4TSBL 4P9HL 1W6LA 2WK2A 4F37F 3IF1B 1CDGA 4OGXL 3SDAC 2XWTB 4NP4L 1XV8A 1HE7A 2R0KH 4JQVA 4KRNA 4HIEB 2DH2A 1AO7B 1L6ZA 4QRSA 4KDTC 2Y1ZA 2HLFC 2NXZB 4PRPD 4OTXH 1IIKA 1NUDA 4TUKH 3UTSB 2EE2A 4N87A 2H0PA 3GSNH 3FB6B 1EDQA 1J8HE 3CVBA 2H8PB 2CCVA 4AQ8A 2V7NB 4FFTA 4FXKB 4Y1AA 1FE8L 3DSNA 3GMRA 4W9LC 1HHGA 3HCVA 3C5JB 3FB5B 4LCCB 5KVDH 1KGCE 3DX6B 1KC5L 3EFOA 3OKOB 4ZDHB 2X4OB 3TASA 3FQTA 4NN6B 3D3VD 4U1SB 4O00A 4X98B 1U6AL 4ODXB 5DHVH 1R3IL 4Y4FD 5AW0B 3KR3H 2YLKA 4L23A 1OAXH 4ZUVB 3EGXA 4OD1H 1ZHLB 3HAEB 4IIQB 4NO2A 3TCXA 2AGJL 4Y19D 2WXKA 3LXAA 2VABB 1FNSH 1PEZA 2FX8H 5D7SL 3TWCH 5EZOL 1TTRA 3LH8A 2RJMA 1PF3A 3EZ8A 2W0FA 3GSNA 5F0PB 4NXKA 2XTSA 3CSGA 1CGSH 5KSBB 1OLLA 1GMIA 5FIEA 4X8XA 2DQUL 4URTB 2NTFA 2I60L 4MCYA 1SMOA 3B5HA 5DUJA 5LBGA 3W9DB 5GZOD 4UIMA 2ZP9A 4WF7A 2VDLL 3RIFF 3NZ8B 5C07E 3GM0A 3EFDH 4BFIB 1GGCH 1B2WL 3NPSB 3V4PA 4R97C 2OXGA 1THAA 1QI3A 4KXZH 4Y4HC 3UZQB 1PX4A 3DO3A 1LGVA 4RQQB 3I3EA 4TQEH 2Q3AA 3HEIB 3VTTA 5EO0B 1HHHA 2VR3A 2A4ZA 3RI5F 2WVTA 4KKPA 4R4FL 4FQXC 4R8WH 2APWA 4FQCH 2X1QA 3B7RL 4XN2A 4HIQA 5IB4A 4FQ1H 2FJFB 3LSOB 2Q9OA 4PV9A 2H2PC 4HWUA 4FHKA 4Y5VA 3TVMC 1DO5A 3TJHD 2MKLC 1M7XA 1IQWL 4JFOA 2E0PA 2WWMC 1K4DA 2WMPA 3GPSA 1N6VA 4KK6C 3O3AA 5DC9B 1JK8B 3IMBA 3RWJB 1RIVH 2WZ6A 9CGTA 3C08L 3MRDB 3H3KA 1S2EA 3VXQB 5KTEL 3WJJC 2E59A 1TJHL 3KLQA 3LS4H 3CCHB 4PS8A 4ZODA 4XHJD 3MRNA 2NY5H 2GTZB 4Z7OB 1T6WA 3W81A 5I75B 4XVOA 2UXFA 5B8CC 4HLZH 2P7TA 2IPKB 2BERA 2X2IA 3HE7C 2KBGA 3IDNA 4OF7A 2BO0A 5LBVA 3POHA 3VXQA 1DEEB 3P77A 1BAFL 2J1YA 1TR7A 3NAAH 4HJ0C 4OH2A 1TUPA 4ONGL 1NPNA 4AKOA 3VCLB 1FZJA 3SGDI 4PJ8C 2EEAA 2CKNA 1JZEA 3R19A 3TCLB 4QT5B 3SBQA 3LHAA 1B6UA 3DSFL 4JN2A 1JFHA 4UT9A 1FG9C 2X2HA 5HHOB 4PLKD 2BNUA 3AG2B 1VA9A 5TTRA 2J72A 2CIIB 1AGCB 1BVLA 4MD0A 1SRDA 1XCTA 4HPOH 3CU7A 4ANWA 5IV2A 5EIIA 1JNHB 1QFWL 3DURA 1U8MA 3UG5A 1FDLH 1AHWC 4P2OC 1CBJA 2PYFA 2COVD 1OT1A 1RFDH 3HZ3A 1E2VA 2BNUB 3GHEL 4E5XA 2ZUWA 2VDML 4E41A 4YSEA 3CK0L 5GRUL 3TWYA 1D9KB 1DR9A 1BAGA 3HB3D 1FV1A 1KIRA 1QRNA 3X12A 2F0CA 2DPKA 2J2ZA 3V6ZA 1IGYA 1G0YR 3EYSL 1TJIH 1TZGL 3A6OA 2WGNB 1JFQL 3GMQA 2WZAA 1NAMA 3ARDB 3C2AH 4HVBA 4IOIA 1DBMH 2ZQKA 4QYAA 4Z7QF 5FUZL 3ZHFA 4LLUB 4B9JA 1HCYA 4CBPA 4KMTH 4Z7UB 4ZX5A 3CK0H 3ESUF 1BYPA 3WV0A 4KXCA 5J7CC 3WNKA 1U8CB 4JGMA 4KK8D 4LBEA 3T6WA 32C2A 3GHEH 4H20H 4HJ1A 4AC2A 3IAGC 3NIGE 2OJEA 3TO2B 4ODSH 1HWHB 2C3VA 1IBHA 1QFWH 3VDBA 1WWWX 5EOTA 4JJHA 4HETA 1Y0LA 3KWVA 4BGDA 5BMFL 1UB5A 3EH1A 2ZYHA 2W07B 1ZT4B 1GZHA 2N0KA 4JDZB 1MOEA 3B2XA 1KTKE 4QRRE 3C60A 5JHAA 3DSNB 1TKWA 3GMRB 5I0ZA 3H3BC 1PIGA 5KBKA 1NMCB 3OZLA 3FU0A 2R2EB 4PG9B 4OR1A 5KBPA 3INOA 1S46A 3X1EA 2J3SA 4MA3B 5J11B 1W15A 4F5CA 4GKZA 2VYRE 2YMXH 2L8AA 3N3EA 5DR5L 2XA8H 2QMKA 3NSJA 4I1NB 2WIIA 4PHXA 3NFNA 3II3A 4RFNC 3UDWA 1BFVL 3TVMB 1G9EA 3KG5A 3ZRSA 2VGLM 2W65A 2Y9RT 3ZSSA 4DN4H 2NY5L 2ERJB 4B7LA 1DLFH 4HA1A 4WTQA 3G9AB 1BP3B 1BQHB 2NZ9C 3EJJX 4A6YB 3VWJD 1CU4H 2K9FB 2CO1A 1WICA 4FQXB 4JPQA 3DRQA 1I1FA 1U3JA 3L16A 4RX4A 5DEJA 3HR6A 4AGQA 3EOBB 3GLAA 5J9PA 4KKNA 5LNEA 5CEYB 5CLWA 5BVJA 1MJUL 3MRDA 4G8GE 1HT6A 3Q6FB 3MHZA 3QG6A 1DP0A 4R5XA 3FFCB 3H6AA 4WW2C 2D7QA 4LEBA 3UBXB 5CU9A 2XBZA 3GJFB 2BX5A 3PWPD 2FJFA 3S4SB 4BZ2A 1MZYA 3W39A 1AQHA 3VQ1C 4R8WL 3BDYL 2A74B 1A6WL 1UOKA 2E74C 3MV7A 5H8DA 4YFEA 2MTAA 5HHQB 4WGVB 2B2XH 1KG0A 2OPCA 1ZVNA 2WB7A 2ZNXA 4OGYL 1PMYA 2CRZA 4HHWA 3UG4A 1BVKB 1FYTD 1Q9LA 4NB7A 1WIOA 2J8UA 4TUJA 4Z78B 1Z9OA 5CGMA 3ULVF 4JKPH 3EFDL 1BV8A 2YUXA 1VESA 1GZPA 4XO8A 1F11A 2F5BL 1IBDA 2VDLH 1QEWA 3EXLA 5DZPA 2GUOB 1NIFA 4UTBH 5GQBA 2H4EA 2QR0A 2NYYD 2R15A 4MQ7A 1I9RH 4E9WA 4ZPTA 3FO2B 1YEDA 2IMMA 3NH7H 1D5BB 5SX4I 4YGAB 1LQSR 4BHUA 3MYJB 4TQIA 1HS6A 5D7EA 3RE0A 5CEZL 5BW7C 1HZHH 1CLCA 4YVUA 4IKIA 1EJFA 5IMLB 1V5JA 3MUGB 3I6KB 4KH9A 1IGJB 4UUJA 3GTTA 1KZYA 5B39G 1TJGH 3UJIL 5A16A 2L7QA 4IU3A 4QHPA 3MA9L 3OKEB 3TNNA 1OAXL 1FIEA 3RWFA 3UMTA 1EDYA 2PXYC 3KR3L 4HSAC 4NQSB 1SXBA 3WTVA 3SKJH 1VJSA 3ARGA 3QDGA 5D7HA 4NO3A 1BPLB 5D1QB 3P9LB 5K9JL 1RZJL 3G9VA 4RAVB 1AO7E 5I19L 1JDAA 5D72H 4D0CB 1WC7B 4ZFQA 3CDGA 1MAMH 4RFOH 1IM3A 1QLEL 1W9XA 1U8QA 4G1MA 4FQHA 4LLMB 3V9CA 4HUUA 1S7WB 4ODHH 5K9OB 1OGTA 2I5YH 1AKJA 4XO9A 4YDLC 2P28B 4Y7OC 3V7AG 2BPBA 1HILA 3GBDA 3FU9A 1TO4A 2OMTB 2WWOA 3F00A 4LEXH 5E4IA 3U7YL 1FSKC 4PRAA 4XBEH 5JZ7D 3U2IA 3EOTH 1T83C 4S1SH 2MFNA 4K8RD 1M56B 3UTSA 3EOAA 1MRCH 3N9GH 1NL0L 2HB0A 1YEFL 4JANA 3MOAH 3P4NB 3P0GB 2GQHA 4KO9A 4U33A 3P4MA 4XP4H 1GC1H 3S37X 4GKNB 1TOXA 3NJIA 4MB4A 1A8ZA 4K7PL 3NSFA 4ZX4A 3FB7A 1K5NB 3ZTJH 2KLRA 3BYYA 5A2CA 5KS9B 5HGHA 3WNIA 3RWEB 1QTPA 1CGWA 5E5UB 1IGFL 3WTYA 3VD7A 3JWOL 4N2OA 3ZDXE 5IBLD 3SDDC 1QSVA 5I28A 1V7NL 1XB8A 1XGQB 4IRJA 1WPCA 2QQKL 1XF3B 1VRSA 1AANA 1Z5LA 3SDXE 1MCHA 3MLRL 1T2QH 1DBJL 3VXMB 1ML0A 4DQAA 3NCYS 2GK0B 1JWMA 2Q7YA 2X9YA 2YKLL 1EEQA 3MNZA 2IOIA 3LX9A 2QPDB 3M86A 4U49A 3ROLA 5FECA 4PLKC 1TETL 1WBYA 3WIIL 4XP6L 3X1BA 3WYRA 5IW1B 4HXAH 3IVKB 1NBVL 1KLFB 3R1GL 4PGBB 1CIUA 3O9WA 1JWMB 4YEEA 4PRHA 4YMPA 5I76A 1QPKA 1F6AB 2B59A 1I75A 5T3ZL 4PV8A 4WI0A 2HXAA 5BZWB 5TF1H 4NM8H 2IAAC 3D06A 5G4NA 4YDKH 4UYQA 2NW2A 4RGOL 4Y16C 3KVQA 2PN5A 4TUUA 5CZVL 2VMDA 2W92A 1JYXA 2GEEA 2Y36L 4QF1B 5FYKH 4EO5A 2WBJA 5D55A 2AANA 2B08A 2JJVA 1U30A 1EK3A 2YHGA 3JQOB 3IS1X 2YEQA 5IUSA 1TCRA 2ZUYA 2Z91B 1VDGA 1RUKH 5ALBL 1N6QL 4J2QA 2FB4H 2VZOA 4KKLD 2AEQL 3NJGA 3UZVB 3DRTA 2QKIA 2NNXA 1MFDH 1OP3H 5ES4B 4NPYB 4XP5H 1ES0A 4W9GC 1A14L 5JHLH 2WZ5A 2FYVA 3OL2A 3TEYA 3FQXB 4CC1A 4G8FA 1JMXA 3QEUA 3DO7B 3NQKA 3DX9B 4ODWA 4JREB 3GHBH 2L7EA 2VDKB 3FF7A 3RGVA 5C0FA 1H19A 2JJWA 4L8DB 4TLTA 4NYLA 2AI0H 1V3KA 2XN1A 1ACYH 4R7NB 5EMYA 2IBZX 3FOLB 1E5AA 3T0EC 4PG2A 1SOXA 5E6IB 3K91A 5GS2H 5LVEA 1HZLA 4ZS7L 2EDEA 3LKOA 1JP5A 3OPZH 1NDGB 2D9QB 1LEKA 4HX1A 5GGQH 3SDDA 1R6VA 1AS7A 3LN4B 1PGRB 5GGRB 1MKFA 4WFGD 4RMRA 3QIWB 4OFIA 4F7MA 2DB8A 4NBYB 3W9EA 2A9AA 3EO1B 4FD0A 3I9IA 4NHUB 5DQJB 1DQQA 5EN3A 4PGJA 4EJ1C 1T6BX 3WHE1 2ICES 4APQB 1H8SA 4XNUL 4AK1A 2CJUH 2D9CA 5C0CA 3W2DH 4Z77A 5HYFA 5I0VA 2YEVB 1NCDH 2FLMA 3ARRA 4KJQC 5I0YA 5BNXD 3U7WL 4D9RE 3PL6D 4FNLL 5ESAB 4LKCB 1EJOL 4NENA 5KSAB 2GABA 2ZCKL 3WHE0 2VWEC 1JNJA 1UENA 1P4LA 2JI2A 5E8OA 5DHVA 5HYJD 2XWBB 2F7IA 3VH8A 3NFSH 4JFED 4A7UA 2Y3NA 4MWFA 4BFGA 2J88L 1WS7A 1FO0A 5C0BB 4Z7NB 3UG3A 1B9KA 1L0PA 5L2KA 3N42F 3WEMA 1TLMA 1IC7L 3AGVA 4Y19E 5E5LA 3CX5J 3BEVB 4DVRL 3BAWA 2JCCB 1Q0XH 5I71C 5T3ZH 3K4DA 2CLZA 4RSVA 4PJIB 4ZFGH 2WZPD 5MENB 4KC3B 5IW6A 1AP2A 3H2QA 2A9NH 1EHAA 2VLJD 3T0EE 2WGXA 4BZ1A 1U92B 3ARGD 5HGAA 1TG8A 2B7DT 1U21A 4Y1AE 3WL9A 2OYMA 3ZTNH 3T0EA 2CK0H 4B5ZA 3VXNB 2M8XA 4P57B 4ZS6D 5KSVB 3KW7A 3VW3H 1HDMB 3WGUB 1T2QL 4KDWA 4I87A 2QQNH 1ZDSA 4GRWE 4HIIA 3DVIA 3L3IB 3ARBD 4O2EB 4Z3FA 3ORJA 1MUJB 4FYRA 3BZEA 2GAZB 1JERA 2A9BA 4L3CA 1CG9B 4EEEA 1G6RA 4GIAA 1KN2L 4CGUB 3ME0B 4KKBC 5ETUB 4UINH 2ROXA 4XP4L 1E9QB 1PSKH 2QQQA 3OZ9L 1LEGA 3D25A 4W68A 1AQ8A 5FA4A 3KZ8A 3UPCA 2AS5M 4PTTA 2V7HB 1RK1A 4QHNA 1I9IL 4WI6A 3TT3H 1Q0EA 5IHUH 3L6FA 4N0CD 2PPFA 1A4JB 2VN3A 5TE7L 1FLRL 4HH8A 1OGAB 1P9MC 2YUZA 4LEXL 4HZLB 1BFOA 5C0CE 1ZV9A 1KMGA 1HNFA 2DY2A 4OFKA 4L8SC 3EFFA 5IJVA 3B2MA 3OXSA 3LQZB 4ODHL 1SEQL 2HFFB 1J5OL 5IFJA 4XNXH 1IE4A 4UANA 3T4YA 3THML 1WHPA 4WK2B 4Q0XH 2AITA 1G7JB 2AV1B 1QLEH 5D2NA 5I1JH 5L0QC 2MQ3A 4JS7A 2K7PA 3O3BB 5CIPA 5J06A 4D9QE 1GJWA 1DQVA 5BUPA 4W6WB 1OB0A 1LMKA 3R0NA 4LHUB 4PLJC 2QTEA 3JTTA 4U1GC 3HNVH 5I8EB 5C97A 1HJBC 2OW6A 3DIFB 4HSQA 4YSCA 1U4FA 1QW8A 1YSOA 2YRPA 4MNGB 3OKDA 5K1JA 3SKUD 5IVNA 2Z35A 3Q3GA 4H13C 4FNPA 4YHML 5AAWC 2XV3A 4PJGB 2A99A 3AMKA 2HKAA 1AZCA 2QVMA 4JB9L 3N1QC 1TTBA 2DQDL 2RMNA 4QJ3B 3BRDA 4YZWA 2YQ3A 1AHKA 1BDYA 2LFGA 4X6BA 3SE6A 1ZJAA 2NRDA 3GIVB 2OQJB 3F85A 2G75A 3RDJA 3MNWA 3GT6A 2ERJC 3JWDL 2CBTA 3OPUA 5FDWA 1A7QL 2XY1A 1HKLH 3CDGB 4NUQA 4NWTH 4UTBL 2MKWA 5F0JB 5ICXA 5HHMB 2O93L 4YXHL 3VNYA 1JD9A 3MDJA 4IRZH 5E51A 3K6SB 3CC5B 1JDDA 1VPOL 4I2XA 4YDJA 2DKUA 2VH5L 4FG0A 1E4WH 1PX3A 3MKKA 1A6VL 4H8QA 4HPHA 4OCNC 3NVQA 2P26A 3FTYA 4Q4EA 1PFCA 3LNGA 2FRGP 2RB8A 3H6JA 1QABA 3KYNB 2VE6A 4L5FH 1AFVH 4NM4H 1OV8A 2GTZA 4K94C 4PMEA 2H0EA 3SSGA 2GJJA 2P7TB 3GSXA 4M7LH 1KF9B 4MJIB 4UF7C 2SODB 3WY2A 3MRPB 1ZXKA 1AZRA 3K46A 3O3UN 2WMPB 3ZN6A 3WIHL 3GIZH 3BE1H 4JFDE 5KSBF 2EO1A 4KI1A 3VFTB 3Q06A 2E9JA 2PW1B 2V2TA 1U58A 5SWZB 2ZOTA 3PV6B 4JFYA 1E43A 1MFVA 4WWNA 4Y2DB 3GJFH 4GO8A 3VI3F 3WNOA 3L4VA 3V4VB 5CM1A 2O5ZL 3MOBL 3VGBA 1PD0A 1BFVH 1IFRA 3LD8B 1T89C 2ZWNA 4LBAA 4FEIA 2F7OA 4ZTEA 4CDHA 2FJUB 4PJEB 2YMXL 1U8JB 1CLYH 3KAAA 3DJRA 3NCBB 4I48B 3GMPA 3NMEA 1FFPA 2LT9A 3B5GA 4ETQA 5E5MB 1N5AA 5B4MD 3ESMA 4LMQE 3V2AR 4ZMTA 1SBSL 4C83B 1FJ1A 2OJZL 3ULSB 4ETYA 5D7JC 5L6YH 43CAA 3NIDB 4GAJL 3HE6C 3LQMA 4H8PA 2XXMB 1VFAB 4O51B 5EEUA 5J12C 1KBGH 2VAJA 3MRMB 2WVUA 2UWEE 4I9WE 3NZSA 5ISZE 4MNQA 3IGFA 1CYXA 4OLEA 3VFOA 2KERA 5C2BH 2VABA 5DA4A 3SE3A 3SE9H 2BSRB 1RZ8B 3QZWG 5F93C 4U1IA 3F5WB 1HQ4A 4KMTL 1K2DB 2WTRA 1BVZA 4TOYL 1XSIA 3UCQA 3NJVA 4JFFB 1AGBB 1LVEA 2KZKA 3QFGA 3NP4A 4F7TB 1EANA 3FMGH 4GQPH 4U3HA 1PTZA 2QADD 1FVDA 1XGYL 3HZYA 5D1QE 1XB6A 1AGBA 5G4MA 3TBYA 3HUJB 3KVPA 2H8PA 1HSBB 12E8L 2NY2B 4H8UA 4ONOA 5BVPH 4CILA 4L1SA 3KDMA 3OKNA 3B43A 4RFEA 4AL8H 2XFGB 4QOKD 4UDUB 3TO2A 1W0YT 2D03H 4BQ6A 3LEVL 4Q2ZA 5IGXL 3DHUA 3TL5A 2EC8A 3ZZSA 3VFOB 4L1TA 1UURA 2QT6A 3D3VB 4U7SA 3WN5B 1N26A 1QP1A 1YEIL 3FPYA 4NNPH 5DHYA 5FW6A 2X40A 4J39A 1ONQB 1FBIL 5E9DA 4R26L 5C0EA 35C8L 3AT9A 3PGDA 1PZUB 4RMTA 4B50A 3BWZA 3QEGH 4DZ8B 4YBLB 1ZV5A 3GSVA 2XT1B 3BZ4A 1A2YB 5FYJD 5EB9A 5DFVC 5JA8B 5GS0C 3IU4L 1BAFH 1MLCA 2B4CC 4ZW7A 5SWSA 1ZS8A 4KTDL 3ZIMA 2WV3A 4N26A 2RAMA 4G6JH 2EDMA 1FG2A 5D7JA 5FM5O 1HCFX 3TBTA 4ZAKC 4UAOB 4MNHB 3DX0A 3U83A 1V8HA 5H94A 1ODUA 1QSFA 1TJHH 3PHAA 4F2EA 3RWDA 2C1PB 1BLIA 1JXKA 3B7SA 4OY9A 4O58L 2RH0A 3MLZL 3FT1A 3KS0H 3EJSA 5EOCL 3EADA 4R84A 5SWZA 4Y16D 1IQWH 1ASQA 2OZ4L 1N5YH 1BXAA 5GIRA 3H9HB 5BV7B 3BRFA 4MAZA 5IOPA 1D5ZB 2ICWI 3R06A 3MRRA 2NZ9D 4MX7A 4R0LA 2BCKB 4FQ1L 3VGAB 2Y1VA 1I82A 1I7ZB 3VXSD 4NSKA 3BPNC 3ZRCC 1XCXA 3WFCH 4OW6A 3TNMA 5T3ZD 1NGWA 4HLJA 2GSGA 2VE6B 1REIA 4HS3A 3IFPB 1X5ZA 5IVXF 4XODA 4TQEL 4NQEE 2WN3A 5HVHB 4YSQA 2IFFL 4LLQB 3GZPA 1RZQA 3LD8C 1IBYA 1BXUA 4GAFB 1B2WH 4J3TA 1FVEA 1JCKA 3C6LB 3MRGA 3ULUH 4AYSA 4HIHA 1ETZB 3FL7A 1CS6A 3CZNA 1D5MA 3O2DL 3BPLC 4OLWL 3WO4C 3ALXA 2P1YA 2Y4SA 3FCSB 1UYWL 3PWVB 2IAMA 3HS9A 2CO6A 2A6JA 4MA1C 5I30L 4HLZG 4I0PC 5D2NE 5DFAA 4PN6A 1ZHKB 1BOGB 1UD4A 2VM4A 3UTTE 1A47A 1ZANH 2AXFB 5LBSA 5I8CB 5HHVH 4EIBA 1KULA 4PBWD 1IV8A 4CU7A 2QQLL 5A2LH 4CA4A 3F05A 3IDJB 5L7XL 5FO7B 5E56A 1INEH 1HSAB 1KPVA 1BD2E 2W9EH 4JKMA 1R3IH 3II1A 3EG9B 3ZO9A 4F9LA 1U6AH 3QIUD 2O6DA 3VFPB 3IJYA 1QO3A 4GRWF 3SGJA 5JDSB 1NLDH 2PPAA 3G5ZB 1MSPA 5C0CB 2A6IA 2EVJA 4Y2NA 5L88L 3CH1B 4PD4J 4U6TA 1YN7A 3D0LB 2AERT 5HHXH 5FYJE 5C0RH 4EF3A 3CPUA 4YHZH 4C4UA 1HL5A 3RL1B 1SUJA 3GJFK 3BKCL 1Q0YH 4R0LC 1WRFA 3EGXB 3EGSB 2BY2A 3QJOA 2Y1YA 3FQRB 1LMIA 2VDRH 4B5EA 3AITA 2XOTA 4ODXA 3P54A 4OT1H 3CLFH 3FTXA 4PRHB 2JKSA 3RY4A 3SPJA 1ZK9A 4BJLA 4AYBA 1C12A 4DW2H 5IW1A 1OCZB 3BPNB 3E0GA 3ATAA 1NDMA 4G6ML 1T1XA 3O6KL 3L5JA 3MV9E 3LZLA 1MUJA 2DEYX 3HBPA 4IMKC 5HDBE 5DSCB 4ZFOA 3LXBA 4CN1A 1FL3B 1S7SB 3FQXA 3PDOB 5IQNA 4ATTA 1YC7A 5CWSB 1FFOB 2LVCA 4TVUA 4PQXA 4X8JB 3UTZB 5KVDE 5B21A 4F20A 1OT4A 5E1AB 4YLBA 5CCGE 3F7LA 4A6YH 4PJAE 4M8QA 5DD3L 2Y5TA 4QDGA 3C09B 2OCCB 1OF0A 2QDVA 2SEBB 1IBFA 1E4XI 1SHMA 2F58L 1OCWH 1P2CA 3CLWA 3P11H 2FL5B 2QGDA 5E4EB 4CNIA 2H26A 5F89A 3ZLQC 2XPZA 1TT6A 1CN4A 3U9PL 5DRWB 3L2NA 2WTOA 4M8QB 3G5YA 3QUZA 4LSSH 4AMKL 4XRCB 2CDGA 3L5HA 3EF7A 3IJSB 1NFIB 4N2CA 3GRBA 3AUVA 4AGNA 5HY9B 4UILH 2R7EA 4HD5A 1BLNA 3QZNA 3UTSD 4CJ0A 1QQDA 4H25B 3M6DA 5AB0A 3ULUC 1FAIL 1N68A 3TURA 5DEGB 3PU7A 3CMOL 1U8OA 3QUXD 4HQQH 3SE4C 5CEZE 4J3UA 3W0WB 3DGDA 4R2GD 5ANMB 4GQ9H 1TTAA 2XTJD 2X89A 3RX7A 4PJFA 1MHPL 3S97C 1JZJA 2VDLB 4FNUA 5C0ND 1V54B 4FS0A 4F7EA 1RKRA 3RWIB 2B77A 3CLEL 1RAMA 1CL7L 3Q2VA 3N1PC 5DHVB 4NHCL 1PNDA 4KXZI 3V5HB 1I8MB 2EKSA 2EDLA 4WVRA 4DIXA 3HW7A 3DXAE 1JF1B 2D0FA 1BD2D 3HAEH 3IXAB 4XMLH 4RESB 1U91A 3CX5K 3L4WA 4Y9BA 3IE4A 4Z3HA 1MDAA 5I2IB 4S1DD 3EJZD 3IDMA 1TYJA 4OJDH 1QSFD 2VISA 4XGZA 1NLBH 2OXHB 1WFTA 5C08E 2IQAA 2UXGA 3QIWA 1AIFB 4NZDA 1E7VA 3MJGX 5AAMC 5D6CA 4WI3A 3OXRA 5F88A 4TVPL 4FNSA 5J56B 5HI3C 1JD7A 4EI6A 4RVBA 1RUML 1VGKB 3O3DA 2RD0A 4E41E 5FFOA 3FUFA 4N20A 1QQDB 4H25A 5BO1L 3HKFA 1MCNA 4BK5A 5J13B 3VD2A 4LNVA 4LSQL 3F58L 3PE9A 2F53B 4N8VA 5FUOL 2VQTA 4JG0H 1IGIL 3I50L 4CW1B 1PBYA 1E30A 2EZ0D 3CHQA 3GXPA 1PY9A 2R2HB 4L8SB 4QRPA 5DD0L 4HUWA 3QFJB 1Z2KA 4OQTH 3RZCB 4QWWC 3BN9C 1S7RA 4Y4KA 1YY9D 2IOOA 3RGVD 1KCVL 2Z91A 5E5RB 3AZUA 4Y5XB 2X1OA 1QUNA 2WNWA 2VR8A 1QFUL 3HPLB 2WXNA 3BAEH 4WWPA 3ULVC 2WAHA 4CSZA 1I8IA 4G42A 3SYQA 4ONHB 3UBGA 1CDYA 3DWTA 4RWYL 4WW2B 4M5TA 1OLZA 1XTLA 3GKWH 2BDNL 2V3DA 2BOCA 3D39D 4QF1A 5BCAA 3MJ7B 1RK0A 3WJJA 5B7FA 5DJCB 2BINA 1WFUA 3F2LA 5E08L 2AJUL 1NGZA 5DD5H 2HX9A 2N59A 1NBZA 1T1YA 5DZ9A 2Q6WB 1NDMB 4IOFD 1IEAB 2YPVH 4Z7WA 5EZJA 4TLSA 4GG6A 4NQXA 4Z3TA 2HLFD 3DTXA 3PY9A 3CBKB 3QDJE 4KQ3L 2KKQA 1PCXA 3KJ6H 1F8TH 3H3PL 1YMMA 1CO1A 2Q8BH 3Q8FA 2FATL 4GLRI 3GWJA 2DIEA 5DEFA 5I1CH 5DVMA 2Z8RA 2CO7B 2ZPKH 1NPUA 3N2JA 3P2BA 2VKWA 3MLVH 4WK0B 3BX7C 5AZ2L 4L4TD 3US9A 3RL1A 3QUYB 1JG9A 3F12A 3GXFA 3QIBB 1GS8A 1X44A 4LL4A 2JH2A 5DZNA 5LGKA 2X2YA 3VXOB 2H26B 5F89B 3TJEH 1P69B 4KK5D 5IREA 4YL4A 5C1MB 2JNZA 1S9YA 1TCMA 2IH3A 4KUCF 1N64H 4FN0A 1DEDA 1EZSA 1N59B 5C0EB 3L4TA 1BG1A 2EIMB 1UEYA 1DUYB 1Q38A 3NN8B 2XYCA 4MMZC 4EN3D 3IGAB 4OLVL 5F71A 3QCUH 3EYUL 1Z3RA 1CLZH 4KQ4H 1EAOA 5DJDA 5CBEA 4NP9A 5C0JA 4XVUD 4FXGB 4PR5B 5T3XL 4UQEA 3D1MC 4PJ5D 3VFWB 2AK4A 2NMSA 3CJJA 4HC1H 1AGEA 2NY4C 3D4YA 2NY1B 3QZWA 1R34A 3TBWB 4JKLA 2JQZA 3TZVA 2Z7ZA 4H1LB 2EC9U 4B9GA 2XWCA 3VXTB 2XDHA 2YPLB 1NFAA 2F8VA 5ACMA 1FHNA 1UGKA 1NGXB 3CU1A 4JRXB 5BXFB 3UPRA 1MG3C 3GSRA 4UB0L 3L3GA 3HUJA 3K0WA 1LO3H 1ORSA 3II2A 3VXME 3TBBA 4MMYB 2MH4A 1J05B 5EU5A 3QJSB 4OKVB 3IETB 3RFZC 3LRSA 1OSYA 4RIRB 4N9OB 5DMGD 1T5WB 5AG8A 3L7EB 3W3BA 1UWGL 4G9DB 4H8HA 2F19L 1MFBH 5TF0A 3Q1SL 4JFWA 1OQOA 2FT6A 2X4QA 5IM7A 3HI5L 4HD9A 2OP4L 5J6HA 4D0DB 3CFBB 2R1WB 1EO8L 1A7NH 3KWUA 3RTQC 3FCTB 4PD4K 1Q9KA 1JGLL 5D8JH 2VLRA 1AD0A 1MELA 5M7QA 5IJCC 2JTDA 1MPAH 4HS3B 4AT6B 2FWSA 4DERA 2MOVA 3DVNA 4J28A 1BEYH 3NSXA 4MAUH 3V0AC 4BZ1L 2NY0C 1I85C 3VWKD 2XSKA 3B7UX 4MA1B 4N25A 1ADQL 3S37H 1O9WA 5E5MA 5HJ3B 1A6UL 2X70A 3KWWB 3CAFA 3CVHA 4PP1C 4DGIH 1YMME 5IOPB 1I3RA 4KFZC 2EIDA 3CSBA 4HUNB 4UT6H 5CJBA 4LASL 4M1DL 3ZDZE 2QZ5A 3ULVH 2ESVE 4LKXB 1CLVA 2MHAB 7PAZA 4OUOA 2HWZH 4G8GA 1EQWA 4B3VA 3SD5A 2EXSA 2N7AA 3HC4L 3C6LD 1LD9B 1YQVH 1WHOA 3RUGE 5EG6C 3T2PA 1JNLH 5I1GL 4LPTA 1YEEL 4U1NB 4IEFB 2KPWA 3INUH 4WU7B 3FO9A 1F3DJ 2I9TB 3EJYC 2Z4TA 4UWQB 2PTUA 2FLBT 5IFHL 3RWCA 1J12A 5LN4A 2NQ3A 2P5WD 2UYLA 1XBRA 2GT9A 4PJHF 1JGVL 1FZJB 1OAJA 2MNJB 4L48A 5BV7L 3HZKA 1HNYA 1OZUA 4M00A 5BV7H 4PVMA 4U6VL 4CC4A 4LLWA 5FGSA 1MF2H 2MCAA 3CPLB 2F54B 3VI4A 4ENZA 1HL9A 1BW8A 1P6WA 3DX7A 1KXTB 4JM0A 2PO6D 4Y2LA 3FBQA 3TT1H 3OAYH 3QO1A 2ATKB 3KGUA 2J4WH 4TPRL 1U33A 3MACH 2B0SL 1GTFA 5DHYB 4OFYA 2R69L 5KBNC 3SDYH 4O5LL 1EHLH 4QR7A 2PW2B 2IPUK 2XPGB 1YA5A 2C9SA 2VTFA 2XKUA 1KJVA 3DYPA 2QTVA 2WAQA 3PWPB 4DUVA 5T3XE 5FYJH 5T1LA 4BDVB 4ELMF 4JO1H 3EBGA 3QC5X 4DPAX 3TM6A 3QPXH 3BO8B 3KPRB 3UDWC 4LEEA 3DUSA 4Y5VB 4HFWB 3DXAA 4HXBH 4AUYA 4MVBC 2XV0A 4Y4KD 3SD2A 3KM1A 5FO9B 4G1EA 2HJKB 4L18A 2FO8A 1F02I 3AU0A 3OJ2C 1AD9A 1OD7A 1BFSA 2LU7A 1ZT4A 1JTTA 4UTAH 1S7XA 4XPAL 4QMEA 4AV0A 3DARA 1XCQB 3APMA 5DJ0B 5FGRA 5AOJA 1LK2A 2FUTA 2Y7MA 4WV1A 4L8CA 1I7UB 5D7JD 1TITA 5I1HL 3F5WA 4LVHC 4PRIE 4B9CA 1W72B 1G0DA 4LIQE 4YNYB 4A2DA 3LTVA 3REVA 2JTYA 1FSKB 1R3HB 4O02L 1MFBL 1RK7A 1QLFA 2F19H 4ONFH 1KJ3H 1EBAA 3NPZB 3WE6A 4GI6A 3EYQC 3FFOA 1B4JL 3ZR6A 4AVKA 4KJPC 2WQAA 2Z93A 2ETWA 4WEBH 4JZJC 3S96A 3F6JA 1GIGH 2NCMA 3OSKA 4HISA 4ZNEE 4JFEE 2Q7NA 1MZZA 4NC2B 3NJXA 3O0RL 4WCYH 5FK9A 4FQJL 1YNLH 2F7QA 3HLKA 2YUWA 4FKKA 1ITBB 2Z7UA 4WW1A 2MPVA 5EBLA 2XKSA 5D4HA 3CD4A 2I9LA 1ANUA 1OWRM 3QORA 2OW7A 4FQIH 2PXYD 5EOQH 4QXUH 2FBJL 1BM7A 3LIZH 1S7VA 4M6ML 2X6AA 1J5IA 2PPDA 2APVA 3QK0A 5D1ZD 1NWOA 2F8OA 3QNXB 1B2YA 1MLBB 4FKHA 2UY6A 3IDIB 4QRFA 2C1OB 5CILH 5HDQH 1NGPH 2GBVA 2YOCA 4HS6B 1FCCA 3L1GA 3V95A 1QYGL 1XSOA 1E8YA 2DL2A 3SQBA 4AGLA 3K7UA 1KENL 43C9B 1Y6KR 2BVTA 4M6NH 1U8IB 5CJOL 5DJYA 2GVYA 5GRVL 5CEXA 4AG4L 25C8H 1X5JA 1SJHB 1W8OA 4WHYG 3S9DB 3M07A 3JYBA 3OWRA 3QUMH 4CAGA 3UXFA 3ZW3A 4LRNL 2ICWJ 2WLNA 1VFBB 4J6RH 3VFVB 4JRXE 2JKXA 3MRHB 2CBMA 3IDNB 1P4BL 3CCHA 4X9YA 4W4OC 3MBWB 5KSAD 3EAKA 4RRPM 1KFGA 2R23A 3TJPA 2Q10A 4ZO6A 5IIEA 1ZHBB 5T5NG 4NNXA 1QBML 1PCSA 4Y4FB 1YDPA 2FWLB 4ZQKA 5E03A 8PAZA 5DVNA 3SIKA 1KB5L 2MNWA 5E94B 1DFBL 3FT4A 3Q05A 1ACZA 1E9OB 1LLAA 4FABH 2AJUH 5DD5L 4CU8A 1MAJA 1M9SA 4ZW8A 2X4SA 4BIKA 1OALA 1ASPA 1J1OL 1IGTB 3H9YA 4M6OL 5FYLE 1AAJA 1KFAL 2ESVA 3FO9B 5BQ7B 2EDQA 4HKZB 2VDKH 1OSZA 1FORL 4URKA 4DSYA 4HUVB 1DQDH 3FH8A 3WTWA 5GZNC 4Z3IA 5GS1B 1QFUH 4LOUD 2DI7A 1QFWI 2EH7H 2E56A 2G2RB 1TNMA 3AG4B 5E95B 3K6OA 3I74A 5BZZA 4Z7IA 1EUTA 3MRCA 1LO0H 4K7FA 3U4KA 2OMXB 5I15L 5GRJL 5IG7A 3ZHLA 3PWNA 3WEXA 1PY4A 1X6NA 1LE9A 4PG2C 3MRJA 2CQVA 3FC8A 4GRLA 1IGIH 3L13A 4YPJA 2IJ0C 4YXKL 2AJSH 5JXAH 4PJBF 2JELL 1SOKA 1G7MB 2CNYA 1QUNB 1T21B 4GO6B 4KJWD 1KWKA 4ZO8A 3V0WL 1U3HB 2VOTA 1T4WA 4RGMB 2DLTA 4TNVK 2BP0B 5D7IB 1MCRA 2PCFB 3UZEA 4PRPB 4XCEB 2XETA 3ET9F 4IKKA 2JIXA 5I6XB 3PL6C 5G5DB 1RIUH 3UYOD 1KTBA 5KANI 4BCYA 4NZTL 2MJWA 3LPPA 3CXFA 3B2UD 3FXIC 1ZE3C 3L3JA 1KPRB 1J1PL 2WOBA 4YDVB 2JWYA 3EIFA 3T1FB 4EZMA 2UV3A 2X4OA 4WZ9A 4R7VA 4PJEF 4U3XA 1SJMA 1T0OA 1NLBL 2PO6A 3ARDC 3ETSA 1E9QA 2ZX7A 5E2VL 2V0AA 3KYKH 1HCZA 4HPYL 4RCAA 2CMRH 2WVSA 3RDTA 2BNRD 4JRXA 5BXFA 4OF0A 3E38A 5E6UB 4X5QA 4XZUA 4NERA 3FRUA 1P4IH 1E5CA 2DTML 1FNEA 2VW7A 1FFNA 1IAKB 5AYUH 4C47A 3FUKA 5D9SB 1ADWA 3VFWA 1WJ3A 4CUCA 4NKMA 4ODVL 4NHCH 2A9ML 3E2HB 4UQ2B 4O2FB 4LHUA 4B6ZA 1AO7A 3WDJA 3R0MA 1JE6A 2AQ3A 3K71A 1FA4A 1AXIB 4TNFA 1S9YB 2BOBB 2APSA 1AC6A 2NX5D 3LKNA 1DFXA 3DO4A 4JBSA 3Q8AA 5DD1H 4M43L 5IVXA 1RERA 4NKQB 2NLJA 2ZCHH 3OHXC 2AQTA 5EA0L 4ZNEA 1EO5A 1ETB1 1KXVC 5JLZB 1J0IA 2VXSL 4HALA 4I3RH 3KWTA 4F7CB 5ABDE 1S4IA 4M7LT 5DFVD 2HT3D 1NEZA 3SO3B 5C0AE 4GKOA 3HG3A 2QPEB 5CLZA 2FBRA 5GGSY 4MNQE 3Q8BA 4LSSL 4AMKH 4G8IA 5ANMA 3GDCA 4N8CL 1JPSL 3E8UH 5EUKB 2WSPA 5E99L 3U9PH 1Q8MA 2YAHA 4DPBX 5DEGA 2HN7B 4YX2L 4NO5A 4ENEC 1T2XA 2G30A 3PIQA 2J21A 4S0SD 2F58H 3Q2CA 4LDEB 5B8CB 5FWQA 1LE5A 5DI8A 4JQIH 2E4TA 1OPGL 3QUXB 1NUNB 2QFRA 5DK2B 1EDHA 3F6IA 2DLFH 2GJZB 3VGDA 1ETJA 3O6ML 5JW4Q 4JY6B 3VMOA 4OLZL 4OSUH 1T0NA 1NEUA 1UJ3C 2D7TH 4LHQB 3JWNC 4KK6D 3KXFE 4AYEC 1CD8A 4JR9L 3H0TA 2R56H 4J12A 1UADC 4X6FA 4YXLL 2R29L 4DGVL 2O6PA 5AUMB 1TQVA 4AJWA 4DO4A 4AJ0A 3BP7B 3EZJB 3FFDB 1YPZF 2FR4B 1MCCA 3O6KH 4I1RA 1WZLA 4NIYE 4BUQA 4LQ1A 1WFNA 2DDQH 3EJQA 3H0TB 2FJSA 5EEZA 4DW2L 2VMEA 1SQ2N 4WO4D 4ZMYA 5F96H 1MDTA 1W80A 4L8SA 2YXMA 2NY4D 3KPTA 3P30H 3KL3A 3LQAL 4XMZA 2BSCA 3BFWA 3S3PA 1S7RB 2A9MH 3A4AA 3HG1D 3ZUCA 4F15C 1NFDA 1PLCA 5F7NC 2DJMA 3QUHA 2OULB 1ULVA 3BZFB 2VWEE 4N2LA 4P2RB 1B4TA 1JHKL 4UQBA 5JW3L 5AALA 1H6UA 5HHXL 3FYIB 1RMFL 2IMNA 5PAZA 3F7KA 1NMAH 1U3HD 4DNLA 4XI5C 4AQ1A 3IXTB 2MOGA 3OHXA 4XCFL 3KBFA 2E7LA 4QHLA 4UYPA 4NC0B 1UJ3B 3B7TA 4DFHA 3CQFA 5CP3H 3PAVA 5DLMH 4Y1SA 3PABB 3O6LH 1DCEA 2VR7A 2JIXB 1CTOA 3BH8A 3ARXA 3GSWA 2W9EL 2AC0A 3SE8H 3MR9A 1RIUL 3SGKA 7TAAA 1B88A 1ICTA 1TZOA 3QFJD 1PQZB 1H3UA 5JQHC 1CFNB 5DYOB 4KNUA 2AQPA 4WWKD 4BK8A 5D9SA 2AJSL 3GRWH 3CVIH 1XEUA 4WO0A 4XB3A 4J1UB 3SYAA 1HHKB 2B1AH 3D48R 1UG9A 2FAUA 3FCBA 4XZUB 4C54A 5E6YA 4JDVB 4TUOB 1FC1A 5CGTA 4ZXBD 1H3XA 2I32A 2ZF8A 5HXMA 3IDYC 3B9KC 2ENQA 2OI9B 4CVXB 4GUQA 2FYYB 5D2NC 1RZIB 4JZOB 2A74A 1NCOA 1J0JA 4YHPB 5DU7A 1VACA 2G4GA 3G6JE 1DBKH 1IGCL 3Q48A 3RVXD 4I18A 2CU9A 4W9HC 1OF2B 3BFOA 4QWWD 3OSVA 4XRCA 3QA3B 3WTTA 3VRIA 3V4PL 1ZT1A 3WS6C 1P1ZB 3P3YA 4JRLA 3WFCL 3ZX1A 1FH5L 1TJXA 3CVHL 5CN2A 1RP9A 4Y16B 2BNRB 4FYQA 2WQ8A 5J9PB 3U9UA 1WAAF 3I3BA 1T3FA 4FABL 2X1WL 2XVLA 4IBSA 2G5BB 1YRKA 1DZ0A 3TC9A 4IW4C 3ZE2E 2HFEA 1BOYA 2DQIL 3MLXH 4HYTB 2BOBA 5H37G 2RACA 2GC4C 3L08A 3MLZH 3UADA 5IKCB 1VFBA 1O7DE 3P0YL 2YAQA 1YMMD 1W0WA 4TF4A 5CWSA 3WJLC 4ZOBA 3CZFB 1G9NC 3P1VA 5IQLA 4Y19A 2WKOA 3BP4B 1RU9H 2JSFA 2A6DB 3K5RA 4Y5VC 3TVMA 3SYCA 5DHMC 4L4TA 1WO2A 3AXLA 4JREC 3ZDYF 2FWUA 5DK2A 2X4RA 1CXIA 3C60B 1BM3L 5C0AA 1BVNT 1UA3A 2AJ3A 3ATDA 3IU4H 1U8LB 1WGVA 2QZQA 4PWEA 1NCBL 3BFQG 2YPVA 2D4FA 1IGTA 3HC3H 5H94B 5KVGE 2UY6B 2BY1A 4MJHA 3M8OH 2KH2B 2IGFL 2ZCLL 3E6HB 4JPIA 2H5UA 3LPFA 2IDUA 4FA8A 3HE7A 4R26H 5ICYA 3GEFA 4AW4A 4QYOB 4BH8B 3DK2A 2I9LB 4K3DL 2IV8A 1E28A 3MBEB 4B41A 1AZNA 1JF5A 1H6EA 2ZOUA 3M17B 1W72L 3C5ZD 3MBXH 5EOQL 4JO3H 3HNSH 1HIML 4HC1A 2CHWA 1HH9B 1CL7I 1PAMA 4BSVB 2FWOB 4YR6A 3KYOA 2A6KB 3MUGA 3QJHA 3GMQB 5BVPL 4WCYL 4HUXA 1UUNA 1YAZA 1GIGL 1QMUA 5C07A 3WKYA 3MMEA 1P84J 1CI5A 1NINA 3N42B 1FLTX 3QWOB 4JFZH 2H45A 5ECJE 2BJMH 4Z95L 1TQWA 3FMGL 4L4VB 3QGVA 4OZIF 4JW3A 1KIRB 4Z1PA 4GEIA 2NNFA 4APXB 2WNXA 4M1CD 1NFDE 4HUKB 4MDJA 1O7DC 4KNSA 1ZHKA 4TUJB 4Z78A 4E5XB 3X14B 1PNCA 2E7MA 1DCLA 1U8JA 1OGAE 1A9EB 3BD4A 1QBLL 3HMXL 4M8RA 4AX3A 2EVFA 4GO9A 5DJ8A 4HFWA 4BUGA 1MFCL 4GP4B 4N0CC 4HK0B 4M48L 5FFLA 5DUPL 1DVFB 1UWEH 2FQGA 5MENE 5F9DC 2BCMA 1IAIL 2OMZB 4UU9B 5HPMB 1IE5A 4HG4K 3HLAA 2E75C 4LPUA 4F8TA 5L6YL 4WI5A 3ARTA 2WBXA 2D4DA 1TPXC 4JO1L 1KYDA 2QV4A 2X09A 3RIAF 4I85A 2ZXQA 2R83A 3U48A 1MIEH 4NKDA 1WQVT 3TYFA 5IBTL 3FRPG 1INDL 5F3HA 4O5LH 1BQHA 3GF8A 1EHLL 3BPOB 4TULH 1VFAA 2BSBA 4M5ZL 2OMNA 3D85A 3I75A 3TIDB 1QRKA 3GS7A 4GMTL 1G9ML 3VXPB 4WUUD 5K33A 3EJTA 4GNKB 1MF2L 4K7FB 5B7EA 1CDCA 1HXYB 1UM4L 4KJYA 1PYWA 5D7LD 3VWKB 3C6LC 2GHWB 3D87B 4C56A 1JGVH 1CDUA 5EHFA 1MFEL 2ED7A 3PUUA 3WIHH 2A9DA 2WVVA 4LLDA 1QKZL 5CSGA 2EZ0C 4HUVA 3IDXH 1MCBA 2CRYA 3GSUB 2JF1A 2R8SH 4L3AA 2G2NA 3Q01A 4GRWH 4ZFFB 3U4AA 2G75B 3UTTB 1WD8A 4UOQA 4ZOAA 3R8QA 2LFEA 3PF2A 1OCRB 2BZ7A 5L8LB 3D85B 1CGTA 3J2PA 4M8UA 3TA3D 5BRQA 3ULVL 1CFTB 4EN2A 2AMGA 3ARDD 3S3DB 5H4ZA 2F53E 5F1IB 2XRAH 4YZFE 3ARFA 1YEWA 1VPOH 2GG1A 2FH8A 3VI3A 2MQCA 2P5WB 4NUMA 1AD0B 2C3XA 4IRZL 1AI1H 4LB8A 4Q74A 1O9VA 3A67H 1H0DB 4TNWF 4DQOH 1E3FA 3CQQA 3F7RA 4OGQC 3O2WH 5TDNB 4J7RA 1M6OB 4WEUD 2V5MA 2DYRB 5F0LB 5B1JC 1Q72L 3NZHL 2WIIB 5F7EH 5E8DH 1GZQB 4PW9A 3WHXB 2WXOA 3SGJC 2X9XA 4AY0A 1O75A 5J6HB 1KLGA 5KVFL 1U8IA 2QHLA 3HI5H 1DYZA 1XZWA 3JSSA 4FQQB 4H7VA 3U6XA 3K6SA 1AG0A 2Z8WC 3HMWH 4U1HB 5I5RA 4KUZL 1W16A 3TPUA 4D8OA 1ZGLA 1MCQA 1NTDA 3E6HA 4JPIB 1M1XA 1CTMA 2IAND 4RBPH 1D7CA 4RISL 5TE6L 2X4TB 2F8XC 4P04A 1Q1JH 4K9EC 3BAIA 3QNXA 4I7ZC 4F8OA 4MXVE 4OIAA 4XWGH 1LNUA 5JO5B 5EF3A 2AJ3B 1L9TA 2BIQA 5HHOA 2E4FA 3LEYH 4QTHA 1M2VB 3CDYA 3UYRL 3KLAB 2EVHA 3MV9B 2WCGA 2FECI 3AADB 5TK4A 1I8AA 4XNXL 1WZ1H 2FZ3B 2Z9TA 3THMH 4Z7VA 2ZUVA 1TQUA 4K3EL 4X99A 2CLVA 5EBGA 4D9LH 1GZQA 4QRUA 1E6JH 2XWTA 2QPSA 3DVNB 4K15A 4FXGA 4G7YH 4MGXA 2VR6A 2FWOA 1YNTF 4YR6B 5AW9B 1KJ2L 3JXAA 2HVBA 2AXGA 4FFVC 4PJ6A 3EYUH 4QPEA 3VI3B 1TLKA 4MCMA 1T04A 4RBPK 5LNGA 1FJ1B 4GIPD 3VSUA 2O61B 1GOGA 1U2YA 2V17H 1GMEA 3WD5L 4YHOL 3AQYA 2FEJA 1FUNA 4ACPA 4OZIA 1OAQH 4RGNB 2V2XA 4ZFOL 5IW6B 3M17A 3BLBA 3RWHA 3KLHC 5KN5B 2Q0ZX 3D4CA 1ZXQA 1JZ4A 2QSQA 2XQ0A 5FS5A 4BUHA 4DOHB 2XX0A 4YBLC 2LAAA 2JB6B 2L7UA 2IDQA 2UZPA 4P2QD 4GAAA 2GJ6A 5A1AA 1GYWA 1UXSA 4OVVA 1B90A 3HNTL 4K3HA 4B7IA 2X4NB 2Q8BL 3BH4A 4RGMC 5CD5C 2CUAA 1FNAA 4KU1A 1F8TL 1SFHA 1LJMA 1Z66A 3H3PH 4AZ8B 4HP5A 3FBKA 1PYWB 2CK0L 1IC5L 5I66B 3IRCA 2CE6A 2F74A 3RVVC 4BDVA 1SBBA 2W8CA 5B1BB 3RX8A 1NGZB 3N43F 1T20B 3D69B 5B22A 2Q5BA 4IRJC 3FTVA 2D3JA 1I1YA 4C4KT 4IOSD 2VN4A 2XYBA 4F7PB 3L3IA 4HGWA 2LLGA 3S8FB 1CQKA 2E27L 1UOLA 1EXUB 1TZIA 2JMRA 3V8CA 4I77H 1F58H 1CFNA 2Q8AL 1R5VB 1V10A 3ZSTA 1KV3A 3PJSB 5KVEE 2CXKA 3N04A 1KCSL 5GHWH 3TH4T 2KDYA 5FDYA 2NY1C 1YQ2A 1TYRA 3RWJA 4NN7C 3MV8A 1ZHNA 2VJXA 1T22A 1S9VB 3ROOB 1P1ZA 4PJ5B 2JK5B 4RGNC 5GJTL 4LSVH 1MY5A 2AKRA 5DD0H 3RHWK 4IBUA 5D96C 4G9FB 2YFOA 3KPRE 1YMMB 2CNZA 4PJ9A 3BXNB 2PYED 4AQ1B 1LDPL 1BQHG 2D31A 4MMYA 4E9QA 4P5KA 4EI0A 4GFTB 3W2DL 1I7TB 3NCWA 2CG9X 4K55A 2B15A 3KPMA 2NXZD 3GZKA 4XCNA 4YSDA 2QKIC 1IEHA 3QUZC 4M1GH 4QRRD 1KGWA 5F3BA 2AEPH 1R3LA 1I8LA 4QIRA 3GMOA 1JPEA 4AQZA 3CZSA 4BFIA 4BRJA 4M3HA 4WFFE 1Y1DA 1ZLUH 4C58B 4IHOB 1R0AH 2RIKA 3A0OA 1SJEB 3O2VH 4KTEL 1IVTA 1KTDA 2G9KA 4HU8A 4QRPE 1QSEE 2OZNA 3O8XC 1R3KB 5GGQL 4PJ8D 1IT9H 3GSOB 4RDQG 2DQCH 4N2DA 4ZS7H 2G5UA 4RMUA 3FFDA 3T1WA 3F7YB 2FUQA 2WYZA 3VXOA 2O26U 2X53A 1G9MC 2F2HA 1UD6A 4ABUA 2ADYA 2FJGB 2KYIA 3R4RA 5CN1A 3GNMH 4NBXB 3FQ1A 4R5TA 4ZXBC 1AE6L 1XGTA 1I1RA 2PETA 3QNFA 3NACH 1UH3A 5DZLA 3W0WA 5FHBL 3GMLA 3VTMA 4AM0A 1BQKA 3IETA 2CUMA 2P5WE 2R1XB 3CLEH 1JXGA 3ZU8A 4YQXL 1FCGA 2BVOB 2PWFA 1SF5A 1X7TA 2B39A 4LSVL 4X80L 4IIZA 4LVNC 1NJ9B 3QG7L 1IBGH 3D30A 3RG1C 1G7QB 2DI8A 4F2MB 4HQQL 4CJ1A 1RUKL 3F3HA 1AY1H 4K8RH 3EGDB 4BFJA 3O8XD 5GHWL 2HFGH 3N55A 1M7DA 1JGDA 1F56A 4TRPL 3U4BH 4IKJA 3DX8A 2EIKB 3H2PA 3S36L 5IUCA 2IO5A 4M56A 4YDKL 2VISB 1L4IA 2YGVA 3JTSA 5TF1L 3OQRA 4JFHE 4NQCD 4PJ9C 4N90E 1U95B 3QUYD 5L2KE 2W1NA 3ZMNA 4Q6KA 4NQEB 4DCQB 3AU1B 3TLRA 3G7TA 4N1HB 1T0NB 3EF4A 1NBVH 3IRPX 5EZIL 4XP6H 3HZMA 3FQUA 2NX5B 1UQSA 1EAPA 5J4MA 5FCUL 1M71A 2B1HH 2YKLH 3JV4B 4MFHA 2E7CA 5EFIA 4XE5B 3UJTL 4BXVA 2EH8H 3BVNB 2VR4A 4Y4KC 5KSBE 1M57B 5GGUA 2CXGA 2QQKH 5EEVA 1TIUA 1A66A 1J10A 3QQDA 4ZOCA 2HJLB 2R1XA 3GI8L 5JNYA 5JYLA 1PZSA 1J8HB 1IM3B 3IKCA 4L8BB 1W8NA 4NOFA 2ZOKA 1D5XB 1HVXA 1MWAH 2CPUA 4G8AC 1O5PA 1JN6A 3AUWB 1X9RA 3PWLB 3WXWH 3ABKB 2BVQB 4PCSA 4X6CB 3WD5H 4F33A 1NL0H 1TPXB 5HJDA 5JHDE 2ZKHL 5CLYA 3F8UB 5LGYA 3L5XH 3RA7L 3QO0A 4RLDA 4MQSB 4MDIB 4YHZL 3IBOA 4XBEL 3NCMA 4G7YL 5FKAA 3T0DA 5EEWA 4P2QA 1UKQA 2IWKA 4K8RC 1CJYA 4UNIA 5ADOH 2WOYA 3EDJA 2UWEF 4PRPE 3QDGE 1BJMA 1S78C 1I1AA 2WZPA 3PWPE 4PSRA 5ERWA 4L1HA 4P07A 4BINA 3NCXA 4HIPA 1J11A 3GTNA 5E8NA 2FQFA 3E9TA 4H88H 4PPTA 5ILTL 5C0BD 4F8PA 5CJQH 3CN4A 3SYOA 3S8GB 1ID5I 4NFCA 1YPZB 3SKJL 4UCFA 2ZUTA 4EPSA 3GMOB 4ZTOL 5AD0B 4B0MB 4DK6A 2IWEA 2P24A 2WTPA 2ARJB 3BAYA 4FQLL 3CV5A 2Y2YA 4P4KB 2JV6A 3DV4A 5MI0C 3B5TA 3C8KB 3EJRA 4ECNA 1NANI 4KTGA 1VGEH 1QA9B 1MFAH 2BVUA 2ICEA 1WTLA 2DWXA 4OBRA 3ARBA 3RGVB 4B60A 4WSGA 3UTSE 3AQZA 1WA2X 4XP1L 2ZX5A 1M3JA 3ARGB 1Q9OA 3NH7L 4L05A 3SGDH 3UACA 3PPEA 1I9RL 2DQHL 1UACH 1BG9A 6PCYA 2PCYA 1A6ZB 3SPVA 1A7PL 4FZEH 1JHTA 1NQBA 2VLKB 4OJYA 2R2BA 3I6KA 1PLGL 2GUYA 1CE6B 5EH1A 5FKAB 2F1EA 1TTGA 2C3GA 2WCPA 2GBAA 4XN1A 3CN0A 1F00I 1YEHH 1QR1A 4R9HA 3U4EA 1ECZA 1F42A 4ALAC 1MWAA 1ND0B 1HYRC 2CKBB 3T77B 5C7XL 2YC1B 4LL9A 3HG1B 4IBYA 1I8MA 1XIWB 2JXMA 2WXLA 5DS1A 1DQKA 1TQTA 5KYWB 4E0RB 3M46A 4JFDD 3BGAA 3F7PC 3JUZA 2R8SL 4F9PC 1MCOL 1N5YL 3HG0A 2DD8H 1SYVB 4PEEA 4CVUA 1QKZH 4HS6A 5CXPA 1MFEH 4OLUH 4WU5B 3KPPA 4N9GB 1TZAA 4O58H 2DKMA 4NGHL 5I16B 4H0GA 3S5LB 4XBGB 1UM4H 1CU4L 2CSPA 3PFUA 3GMLB 2Z0BA 4GBXA 2DYSB 4QTIH 5E94A 1QZNA 1DLFL 3WEAA 2ICWA 3JBG7 3MREA 3TBTB 3RPIA 2JJTA 4JKWA 2X3AA 1TVHA 4JE4B 3W57A 1ZHBA 2E47A 4EI5A 5K9QG 2H9GA 3CN2A 1N0XL 1G7PB 4TULL 3MKGA 4ZQKB 3QIUC 3RWHB 2XWDA 1ZTMA 1DE4A 5IBTH 4OZHE 2X87A 1B6DA 1G1OA 5I8KL 1ZD6A 1AHWA 1KB5B 5HTSA 5AENA 2A6IB 3CDZB 4DKTA 4AGPA 4KVCH 5FXCH 4JQXC 3ESNA 3UH8A 3OMIB 4I5BA 1FNGA 3R06B 2J2ZB 3QQNA 4M5YH 1JTPA 2HLAB 5BMFH 2OI9C 3DUUB 2ADIA 2WSKA 4Z7VB 3L45A 1FNLA 1JGDB 1UCBL 3K3QA 2DZEA 2F74B 3BSGA 1ACCA 4HHAB 2HZHA 4WHTB 3V0DA 3VGHA 1D2PA 3IMRA 1P5UA 3AB0B 3MA7B 4FG4A 4JZJB 4BA8A 1RZFH 4CVZB 4BK4A 1O0VA 1C12B 3FQWB 2MQGA 2V2WA 4CADB 3BXNA 1DBML 4GH7B 1U8QB 1F4XH 4G1MB 1SHWA 4MZRA 5MHSE 4OF6A 2HH0L 2L3BA 3BD5A 3MRFA 4JFZL 4C56D 2HH0H 2FD6H 4HIXH 4HKJA 4JG1H 1TDQA 3ESOA 1XAUA 2X1PA 1XH3A 1I4FB 3FOMB 4TOYH 2YD4A 3H56A 3CTTA 3KJ4B 4JM2A 1HK6A 2X3CA 4YHKH 5GRUH 4I4WA 5CHNB 3F65A 3L4UA 2EEBA 4FX5A 5DT1H 3BP6B 3ULUF 4LFHG 4IOIB 1RFDL 5DO2D 1JV2B 1IJNA 2XZQH 1HIMH 4QXTB 5J8OA 1GR7A 4AJVA 2C7UA 2C9PA 3SOBH 2EUZA 5DRZB 3V9EA 5IVOA 4K3DH 3CSYA 3S5ZA 3B6SA 2LOEA 1MCLA 3KS0J 4QUOA 4CGTA 4CMHC 3SODB 4GEJA 1S7UB 1E5ZA 2IANE 2W5PA 4HAGA 5F3BB 4MXQD 2WKGA 1HSBA 3ZYJA 4WV1B 3ZUNC 1F11B 1HAUA 1R24B 1K3IA 1BZEA 4RGNE 4DEPC 4NZ8A 4D8PB 3HZYB 1DQMH 1S7XB 2YEZB 4LCVA 1WA1X 3GM8A 4UOW0 4MB3A 1DQIA 4H0HB 4TLUA 5EU6D 1PL3A 3UAJC 2XN0A 4ADGA 1UVQB 4N4YB 5KJ4A 1FL5B 3ZE0B 5IY5B 1XVSA 2WTRB 3B3BA 5D7JB 2D3NA 3BUDA 4XXWA 1KLGB 2DQMA 3G3LA 5FHAL 3S34H 4WUUA 1C1EH 3PV7A 1L0QA 4RNRA 5BOPA 2DLEA 2F68X 1C08B 4NGHH 4AYFB 1R1CA 3GGWA 4OD2A 3MLXL 4I8DA 5BVJB 1CFBA 2QPFA 3GSXB 5SWZD 3MC0A 3LPOA 3ILPB 4Y4FA 5A43C 4AM0Q 3W5MA 2YQBA 4GXUN 3CFDB 5C0BE 2KPNA 1F3RB 1RZKC 5HI4C 2NY1D 3BD3A 5E24E 2RQEA 4S0HA 5F1IA 3QPKA 1T0MB 1UASA 2VSKB 4L5FL 15C8L 2FSDA 1H3TA 3BUYB 3PAYA 4R4FH 1A6TA 2ZG3A 4IKLA 4GRLC 1MCIA 3PAUA 2GC7C 3CZJA 3SQBB 3JV0A 3TA3A 1IQDA 1E6OH 4J3OD 4NNYA 3SPIA 1MREL 5JHMA 2K3HA 3OLGA 2VH5H 3CN1A 5D5MB 1L9OA 1TXKA 2C1PA 2GY5A 3ZKXC 1N7ML 4MRCA 1EHNA 1XGRA 1JZ6A 5EU4B 1AZZC 2Q86A 5CFHA 3IFOB 1A6AB 1NDTA 3ZL4L 1QBAA 3BUPA 1ZJBA 1FHGA 4G8GB 3KXFA 2B1AL 4PJDE 5CCHE 3HHSA 4L9DA 5KVEL 4WHTA 3QDMA 2A77L 4PJHA 4JRFA 3IJ9A 2CKBL 3MN8A 4Y89A 4X6DF 1W0VA 1YECL 4MJIA 3B83A 2X70B 3BGMB 3Q5TA 4JL2A 4XBPA 5DEZA 2VLRB 4I5BB 1UB6B 3HBQA 4XO3A 5AL8A 5F3HB 1CVSC 4CSTA 2Y07L 5B1CA 1CGVA 1DJGA 2QHRH 3ARZA 3CWGA 3MCG1 2WO2B 5KANG 5MERB 3ULSA 2MCMA 2RTTA 5FFGA 4XXWC 5B3NA 1PU0A 4HK3N 1KBKA 2DW5A 4BSVA 3NEOA 1N5AB 4L4VE 1J5OH 4XPBL 4OCXL 1D9KA 3DC0A 1JV5A 4WFED 3B9KD 3WXVH 4NLAA 4PJHB 4Q9BA 4P5MB 1BZ8A 3ZDXB 2V7HA 5C0NC 3SJVB 1A6PA 4IOFC 4BH8A 4HCIA 4N24A 1KEML 3QJXA 3LIUA 4NZRL 5TFSL 1W91A 1A4JA 1YUHB 3ARFD 5IQ9A 2XI9A 2ZAGA 1OAZL 4FFWC 4I2XE 1A4KA 3R7RA 2PWGA 4KOCA 5JOFA 3BO8A 4RFNB 2VKXA 1XGRB 1IEBA 2ZKHH 1G6RB 3HG2A 4JFXB 2OL3B 2YWYA 1S7QA 3TBVB 3F6LA 3IPBA 2F54D 2A1WL 3LV3B 5IT2L 2FGWL 3JV5A 3ALPA 2CO4A 2ZWZA 3ZQWA 1WIUA 2DBJA 5E2WL 4K23L 5EC2B 2DDQL 2VRQA 5F7FA 1OSPH 3KPSD 4CVWA 3U46A 1A7OL 4D9QD 4F24A 3GBEA 4HIEA 2ATKA 1U8PA 3S35X 4P3CH 3LEXB 4GFXA 5DF0A 1NGQL 2BNQB 2EH8L 2QADB 3QQ4A 3DX2A 4M1CC 3VW3L 1N2RA 2ARJQ 3O6MH 5D96B 3T0EB 2DLFL 2LLLA 4EBQH 1AXSA 1CF8L 1WTGT 4Y16A 4DKFH 3ZTNL 1LK3L 1CFTA 4P48A 5ISZD 1IUZA 3D9AH 4J3OF 1MCJA 4G7RB 5DJ2A 5DJXA 2BY0A 4JO5A 3L6FB 1QX1A 2CHNA 3BIBX 4BQ8A 5GJSL 5E99H 5JXEC 2DBLH 3X3FH 2ZYRA 4H26B 2J43A 2X10A 5TDPA 4PV9B 1RQ5A 1T7ZA 4EDXA 5KYNA 4QTFA 3ZMEA 1WFIA 3S36H 3C8KA 2X88A 5CEZD 1IC7H 2QLYA 1RUPL 4M9OA 4EE2A 2BC4B 1MFUA 4TRPH 3U4BL 3UEZA 3X17A 1RK0B 4A55A 4ELKB 1E40A 2HFGL 4PRNB 5DA0B 1ZA6A 2P44B 2IPUG 3A4FA 4LP5A 2DQJL 1K6QH 1KXVA 2VXSH 4JO4L 3VFTA 1U8NA 5EO0A 2XWXA 2DQFA 3ZDZF 2EO7A 4JGNA 1VADB 4YOKA 1GHFH 3BKYH 2OXGB 2ZOOA 3VFGH 1EZVY 4L37B 3ZQ9A 4FQ2H 4MD4A