4XXWC

Crystal structure of mouse cadherin-23 ec1-2 and protocadherin-15 ec1-2 splice variant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
204
structure length
204
Chain Sequence
QVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protocadherin-15
publication title Tuning Inner-Ear Tip-Link Affinity Through Alternatively Spliced Variants of Protocadherin-15.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 45
structure length 204
sequence length 204
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4xxwC01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4xxwC02
4AQEB 4ZMTA 2YQGA 4ZMQA 3Q2NA 4ZMNA 4NUPA 4ZMOA 4AQEA 2WHVA 3LNFA 3Q2LA 1EDHA 3UBGA 3UBHA 2YSTA 3FF8A 1ZVNA 2OMVB 1NCJA 3K5RA 4AQ8C 1OP4A 4ZI8A 1ZXKA 4OY9A 4NQQA 4NUQA 1O6SB 4AQAB 3K6DA 5CZRA 4AQAA 2WBXA 2OMUB 4AK1A 2OMWB 2WCPA 4XXWA 2QVFB 5JYLA 2EE0A 3Q2WA 5KJ4A 4QD2E 1NCHA 4ZMYA 3LNDA 4AXWB 3LNEA 3K6FA 2X2UA 4ZMLA 4ZMVA 4AXWA 1WUZA 3FF7A 1NCIA 4ZMZA 4ZMWA 3LNIA 2A4EA 3K6IA 3UBFA 5DZVA 1Q1PA 2OMTB 1WYJA 2V37A 3QRBA 4NUMA 1SUHA 4XXWC 4ZT1A 3LNGA 2QVIA 2O72A 2OMZB 4ZMPA 2OMYB 2WD0A 4APXB 3PPEA 2A4CA 1FF5A 3Q2VA 3LNHA 5JYMA 4APXA 4ZTEA 3MVSA 1NCGA 1L3WA 5CO1A 4ZMXA 3K5SA 4AQ8A 2OMXB
chains in the Genus database with same CATH superfamily
3BWSA 3VFVB 1A6UH 1AGDB 1KTLA 3QQDB 3CBRA 4TSBL 2HMIC 4K7FA 3ROLB 2BP0A 4AGLA 3Q1SH 1KYAA 5J3HD 4BKSC 1FLRL 4F9LC 1CXKA 3IYLW 4LNRB 5FC9A 1CFQB 1SJMA 1M3JA 4UOJA 2W0LA 2F53E 4OUUB 3OAZK 1JPFA 1CFNB 2N56A 2ICES 2YFNA 2B1AH 1FZOA 1E4WH 3I6LD 4LVOB 4KKAD 4R9HA 4DK6A 5B39G 3U83A 4JPIA 1ICTA 4RZCA 1RULL 3WD5H 5CN1A 4HJJL 2BFVL 3T8XA 3RL2A 3KAAA 5HGBB 3FQXB 1MJ7L 3RWCB 2MNUA 4WTXA 1AXSA 1B4RA 5EF3A 2ESVB 3L4VA 3PABA 4BUGA 1OCWH 1UT1A 4R7DB 3J7HA 1U3YA 4P46B 2FECI 5EU7C 1ZRUA 3QQ9C 3V5KA 4MQTB 4M1GL 5AZUA 4AYFB 1MCSA 3GTNA 4J3OH 1ZA6A 4UILH 2R8SL 3E1ZA 3PDOB 3UYPA 4RFNC 4OJAA 2ZOLB 1G9EA 3UPRA 1GC1L 3VX0A 1F2QA 3EOBB 4KK5C 4NQCE 3GLAA 3LXBA 2X89A 1MJJA 3NJNA 1S5HA 2J6EA 1OXYA 4YWGH 3WFCH 3W5MA 1GW0A 1CFMA 2AEIT 1XGUB 2ZD0A 4XPAH 3SJVB 3BYYA 5J12C 4KMQA 4BZ2H 2ICEB 2DYPD 5C08D 1JNJA 4JKNA 4KJQC 1TQVA 3REVA 3VMOA 2VDLL 4H2AA 4NJ9H 4Z7OF 1MFBL 1OSEA 4OGXH 3FTGB 4HUXA 4EZLA 4NQDD 3MRPB 3KGTA 1ZV2A 2P8PA 3A23A 3K72B 4QRBA 2QADC 1IAIH 2YPLA 3ZDXF 1IM9B 2OS7A 3S3JA 1XSIA 4NQSA 4NWTL 2EUZA 2CUMA 5D9SB 5AZ2H 2E7MA 4P57B 4EZKA 1ZHNA 3QWNA 4K07A 4IIZA 5T1MB 4UQCA 3EFOA 3NFSL 2NY2C 5FUCE 1GGBL 3WMSA 4HCIA 5SWZB 3ZTEA 4L37A 1NLBH 2ZQKA 4R4BB 4LBEA 4KJWD 3OZKA 1T3FA 3F58L 5LGJA 1G7PA 1CGUA 1ZAGA 3QG7H 1EA9C 3M1OA 5I1JL 3FQWA 4DK5A 4KHTH 2C3HA 1DBAL 3TBBA 3IRZA 2FX7L 4GQ9H 3QISA 2L7UA 2QQNL 2OQJA 5FKAB 3QIBC 4WFFE 1OGAA 4XMKH 1EZVX 4GIOA 5EZJA 2PCPB 1CCZA 2EH7H 4MXVF 3NOIA 3CBKB 3F64A 3GSXA 3ZTDC 4GKSA 2BIHA 1CQYA 4PN6A 2ICWJ 2JFCA 4XP6H 3GLZA 3EGSA 1WZ1L 4HZLB 5F3BA 1E28B 2WXGA 3BE1H 1ACYL 3M1BA 3CQQA 1V10A 2YOCA 1NCCH 1Y18B 4OFDA 4HDIB 2G2RB 4Z3GA 2NSMA 3RTQD 1NAKH 3DETD 3QIUC 3LSOB 1IAKA 4AKOA 2XTJE 3ZE2B 4TVUA 2XN0A 5DD3L 2VUYA 4I3GA 3MCKB 3BAJA 5EB9A 5LAXB 1F90L 1UD3A 1YYML 2LW3A 1S3KH 5I6LA 4PGDB 1JGVL 4QXWA 2VSMB 4JN1H 1WG3A 4XXWA 3V4VB 3EYUH 4R7NA 4TMPA 3W9EA 1OIOA 4MB4A 4M7KL 4XGZB 5K59F 3EF4A 4FD0A 2CO4A 3T09A 4AIXA 4U1IB 3V4VH 1U8MA 3DC0A 1ADQH 1L9SA 3AY4A 1R3HB 4MVBC 3G6DL 4FTVB 5A43C 2OL3A 1JNHB 3BH9B 1ETZA 3MRRA 3NABL 2Q8BH 2NNCA 3TOPA 4WWID 5AL8A 1D7CA 2B59B 2VE6A 2IDTA 4NQXA 4D3CL 1R33A 4I3SH 2ETWA 3NBNA 3NIDB 4U0RC 2ZICA 4XWOC 3V9EA 3NZHL 4FABL 1H0DB 1FFNB 3P54A 1XAUA 4X7EC 1JWMB 3FQYA 1BM7A 2JK5A 4KJPD 3O3DA 4KXAA 4LCIL 5IG7A 5F71A 4GG6E 1W9XA 2Q87A 3WU1A 1ZTXL 2IXQB 5FF6B 2UWEF 3QH3A 1KIQB 2DQUH 4HV8B 3TIEA 3U2SB 1G5AA 3IGKA 3ETSA 3GIZH 5CO1A 5D7JC 1K9TA 1A5FL 3U30C 1HHGB 1FUNA 2UY7A 1A7OL 4YHML 1OF2B 2KKQA 3STLA 1T83A 2X53A 3C5ZB 3TNNB 1FPTH 1NFDE 3VE0B 1HEZA 1G9ML 1OKEA 3NEEA 5J56B 4WK4B 4XPFL 1OHQA 1RKRA 2PYEE 3DOSA 1WAEA 3B2UD 4E9VA 2JXMB 1WIOA 3O8XD 3RA7L 4JFEB 1WD9A 3BGAA 4N9GA 1H15A 3S3BB 2XV0A 2J73A 3LEXB 4PTUA 4TTDC 1P4BL 3SKNA 3VO0A 1JZ5A 3TF4A 2QLYA 1TVHB 3G6JB 2AVGA 2DV6A 4M6NH 3CZFB 4E2OA 1QTSA 5EN2B 4JFFB 4AL8L 5FEBA 4OB5L 1G7LA 3KPRA 3TFKC 5IMOB 4Q6IC 2DL2A 3AU0A 4G1EA 5TF1L 5HYSA 5L4FA 4HT1H 2PR9A 2AVFA 4R5VA 4AGNA 3KWXA 3PNRB 5HYJA 2VRQA 4LCCA 5ESQB 2R15A 1FYTB 2ED8A 3S34L 2GI7A 3KPSB 5ACLA 3ILQC 1KTRL 1QBMH 3L1GA 3FFDB 1ORSB 4CVZA 2HZHA 3F7RA 5ADPL 3KS0H 1MEXH 3JWNC 1LO3H 1U8LB 2BY2A 2WCPA 4MHHG 4QRRE 3EYVB 5CEYA 4XO5A 3GBLA 3CHQA 4PJCB 4PRHA 3Q6FB 4XBGB 1FCCA 3QUKA 5CP3A 3DVNA 2P24A 5F9OL 5KSAB 4NQEA 1V7NL 2DQEL 5HHQB 5E6YA 3RZCB 3OLIA 1TQBB 4YFLI 4B9PA 2WLLA 4UBDD 3EH3B 3RHWK 3P30H 3U9WA 4DESA 4TUJB 4FE9A 4WV1A 4F7MB 3MSPA 3FS9A 4JO3H 2CCWA 2CSPA 4FNUA 2MQGA 2DWEA 4CMMB 2Z1KA 1WAAE 3W0WB 4NRYA 2X1OA 3BAIA 4OKVA 1KIRA 2OZ4H 3HI6L 1MFCH 4C56A 4MD4A 1DBKL 1PL3A 2OSWA 3I6SA 1BX2B 1MFAL 3B37A 4ODVH 2DPKA 3A5VA 4AUJA 3IJSB 3U7WL 2RBLA 3NGBB 4FI7A 4L4VA 1A65A 1EERB 1KYOK 1T66D 4LNVA 4Y19B 1FFPA 2ZAHA 3O3EA 3QEQB 4WU5B 5FYKL 4Z78B 4GG8A 4KITB 4FHJA 1OAXL 5A7BA 2MNJB 4GIPD 1UC6A 2WIMA 5CMAB 2BSCA 5F93C 5CKAA 1E3FA 5FDWA 4PJ5E 1T1WB 3NSDA 2C8NA 5JIMA 2OL3L 4NM4L 2QQQA 5GZOC 3HOGA 2H2PC 5KVGL 1PZ5A 1F97A 1K8DA 2KZKA 1B2WH 2ZTBA 1NDMB 3QJUB 3ULUF 3ABZA 1YMMB 5IB3B 4GBXB 1CGYA 3VFUB 1IMHC 2BO0A 2ZXGA 4HIIA 3KJ4C 3OKKA 4OZGE 4PBXA 1S78D 1IFRA 4LCUA 1BCIA 2ADJB 1YEIH 2RFXA 2DQHH 3OLEA 2G4EA 1CLCA 5HHXH 3FMGH 4PJHB 4N2HA 4NN5C 2AJUH 3OGOE 5DJCA 3BO8A 4MD5A 2WQAA 2BY3A 3RJDA 5HGDA 4PRIE 4XC3H 4GAYB 1INEH 5F3HB 1EGJH 4B27A 4NNPL 5KSBA 3V7AG 2CDGB 3HE6C 1I7RB 1OO2A 4GRLB 1A6VH 1HSBA 4KZCA 3AADB 3LD8C 4F7PA 1Z0NA 1JGUH 2FJHB 4M3HA 1KJ3L 1UZ6F 2GHWB 2CUHA 3IBEA 1RK1B 3DUUA 3VWKB 1I3GH 3WKQA 4AT6A 4LFHD 3VXRB 1T89C 1BOGA 3PAZA 3UG5A 5I18L 2KC0A 3OG4B 3BAEH 4MZ2A 4NNYA 2JJTA 2EE6A 3AROA 3CIAA 4JFHD 1J05A 2AK1L 3ZQ9A 3UTZA 3Q2WA 2VXQA 1S2EA 4BSWB 2IANA 5D6CA 2CGRH 3GIVB 4FI6A 2XYCA 3JQOB 3JVGA 1ZA3A 1NGWA 2VZUA 1PNDA 1KXQE 1PJWA 1WV7T 1HZKA 5KEZA 1HQRA 3AWGA 4MHHI 2HX7A 4GXVL 2AQRA 5H94B 1BAWA 1HIMH 2DH3A 2Z0BA 3ISRA 5IW1A 1MVFA 3KJ6H 3X1FA 3JT2A 1V05A 4ENEC 2J1KA 3IGAB 1G1KA 3VFWA 1RVFL 2X4NA 3BKCH 4GKZA 2OP4L 4B9YA 2DYSB 2OJZH 3ZQXA 1UJ3C 4DK3A 4QXTB 5AB9A 3K71A 1HEJC 5F6IC 3SQBA 3STZB 4IM8A 1C16B 1DTUA 4CVXA 1JRHL 3HG1B 2GAZA 4L05A 5IREA 5C7ZA 2VABA 3CLEH 3G9VA 1KTKE 2BIQA 4JPSA 1N0LB 1U3HB 2BNQA 3IFPB 2MCMA 4HKJA 5HHOD 3AWEA 5ISZE 4MSWA 4HPHA 3CVBA 4TXVB 2Y25A 3SE6A 2ITCA 1URIA 2BNRD 1ZLEA 2VMFA 2YHGA 3E3QC 4P2RE 4QHLB 1BIIA 1U92A 3UTTB 4A7SA 5CR1A 4ZPVA 3CHSA 3Q3GA 1DSFL 1UTDA 3RL1B 2YKLH 5GGTA 2ZCLL 3S3PA 1EHXA 4OD3L 2P48B 4O2CB 1WA0X 4G8GA 1MLCB 3TH2T 3QK0A 5HYSG 1MHEB 1WC7B 2FYVA 3IS0X 2FQGA 5DDHA 4OQ1A 3GKWL 4YHIB 4D9LH 5KS9F 3N44F 5LXGL 4DGVL 4U4BA 3TTYA 2PO6A 3BWAA 4JDEA 4ONGL 2YGVA 1KGUA 2EDFA 1JGLL 1P9MC 2AW2A 5AW6B 2D7PA 4HPOH 4Y9CA 1LE5B 3VFPA 2IOIA 1NH6A 4CU7A 3ZE1F 3D3VE 5F1NB 7PAZA 3U4EB 3RU8H 2X41A 5AW2B 3RILA 4YDVB 5JIIA 3D25B 2HVKA 4PB9L 5JOPE 2CJUL 5HYIA 4B3VA 4K5LA 4X9HA 3D0AA 4ES9A 4GMSL 2H9GB 3GS0A 2YD9A 3V9FA 1E8WA 4HS6A 4JFQB 3VGAC 3II3A 1RERA 4BK5A 4JZJA 5DJDA 4XPBH 3BFWA 4XNMB 2X12A 3BPNB 5DEJA 1I1FA 2WKOF 5JOFA 4A2MA 3D85A 3NRPA 2HUEA 4Z6AT 4PJ7E 3V5HA 1AS6A 1WFNA 1XMEB 2FBJL 3LIZL 4Z0XB 2EH8L 5GS2D 5DZPA 4M1CC 3UG4A 2WXIA 1CL7I 5DQ9A 4FFYA 4RBPH 4OIIL 4OBSA 4MA1C 1SQMA 1QZ1A 1MHPL 2XNAB 1F2XK 3OAWA 2XZCL 1LM8V 5LBSA 3NPSC 1IBGL 3OHMB 4OZHA 4NCC1 4KVCH 4JFDE 1QSEB 3QHZL 1U95A 2VSDA 4QOKE 2AFNA 4PP2A 4MQ7B 4XI5D 3EZ8A 3VQ2C 5B38G 3IEAA 5A16A 4F24A 4X4XA 3QZWB 1YNTF 4CADA 4I1PA 3T0AA 3NIGE 1DSWA 1XSKA 4HWZA 4LSQL 2Q76A 3H3PH 3D7PA 3HI1A 3WHE0 4RDQG 1T0PB 2IPKA 3IPFA 1M05B 1N70A 2L7QA 1HKFA 5AVZB 4GFXA 4IIQB 1MNUL 1BD2E 2VXQL 4WSKA 1UKQA 3FN0H 2W9LA 3HNSH 2W0FA 3MLTB 3MRHB 3L3JA 4C58B 1XTMA 3U7AA 4L0YA 4FULA 3F5WB 4LRIA 2HRGA 4QRPE 1XV8A 1IO4C 5DJ0B 1IQWH 2KMWA 4KDTC 5EG6C 4YXLL 5MEQA 4ZXBD 4K15A 1XH0A 4L8SA 4JY6A 1QUPA 2EICA 3C87A 2WOBA 3AB0C 1U41A 3GI9L 4G83A 1C12B 1RUPH 4ZDHA 5C2BH 2WQRA 3SDXE 1AACA 1DN0A 2C3VA 1KJ2B 1CU4H 4LHQB 2GBTA 3D06A 5BS0D 1H6UA 3P3RA 3QQ3B 4M1DH 5DEFB 4WKZB 4ODBD 1NMAH 2Q86B 4FADA 1KJ2H 2OXHA 3MV8E 4HC1A 3G5YB 5DHVA 3T2PA 1NEUA 4AH2A 1JV5A 1NGPH 4L3FA 4HIHA 4UT7H 3LB6D 3DXAA 1ZGLB 2XA8H 4HX1A 4CJ0A 2JKIS 2EIDA 1ZANL 5BZDB 3DBXB 3AW5A 3Q43A 4YZFF 3HVDA 2P52A 1JRHI 3VSVA 3BZEA 4M4PA 4WFGD 3ZSTA 1RUAH 2DS4A 4JQVC 1G87A 1WZKA 3KD4A 1X7QB 4HEMA 2B4CH 5GGTL 1PZCA 4L5FE 4XP1L 3O9WC 3VFSA 4CMHC 2V2WB 4U7KA 4X7FC 2Q6WA 2F1BA 1PD1A 4KHXH 5I66B 4R8WH 2W60B 1P5VB 2DF3A 1E6JH 4NAJA 3X13B 3GTTA 1AZNA 4ZW3A 1F4YH 3I3DA 3U4AA 3PWPA 2AJ3B 2P8MB 3MNWA 3WKMH 3SYAA 5EEWA 5KVDH 5D96C 5TE7H 2FAUA 1HL5A 4NBZB 2ZWLT 3O6FC 3OF6A 4KRMB 5J11C 2IPTH 1JD7A 1KN2L 3GSQA 3OR7B 4LVEA 1N6UA 5KWYC 1ZOXA 3ARGC 1UWFA 1FZJB 5TQ0H 2ZWSA 3OKLB 2YRLA 4ANVA 4EBQH 4ERSH 2P46B 4XH2B 5C08B 1J88A 2HT4C 3MRQB 4PRPA 2Y7QB 1PPIA 2NY4C 3GB7B 1QNZL 5L0QC 4NQDB 3SDCD 4XCCH 3N0PB 4JGMA 3CJJA 2GTZB 1AZVA 1PZDA 2A6JB 2LT9A 3MACL 2PW1A 3S5LB 5J6GA 4FFYL 3C2SA 1TZGH 3OLDA 4XPTL 3L1FA 5B1JC 2ENJA 3S8WA 4WJKB 4A67A 4DKFH 1P1ZB 3T3PB 5I30L 4UDTB 2JKXA 5LBSL 2NY7L 2UX7A 5DK0B 2I24N 4JRYE 1EAJA 3DURA 4LRNH 4LU5H 4E0RA 2EYSA 4KXCA 5FYJL 5IJDC 3WTWA 3B9KC 7FABH 1AGBB 3U25A 2K6ZA 2WIIA 1TZ8A 1A6TA 1H5BA 2XPGB 1K8IA 4JM2F 2XIDA 4AEFA 2B7DT 1SOXA 4KRLB 5HVHC 1IGYA 4NDMB 2A0LD 1JPEA 1ETJA 3FFCA 4H20H 4AM0A 3NACH 4JHWH 2BK8A 3BKYL 4K71B 2YUZA 1ZXKA 2GK0A 3NA9L 1WFTA 1FDLH 3WDHA 2OTUB 32C2A 5AW4B 1A9BA 1X4XA 4JY5H 3IF1B 5JQHC 5D1ZB 2CCVA 1ILUA 3S35H 3HZMA 1LK3H 2ZT9C 1IE4A 5CJQL 4FOMA 2R39A 1Z5YD 1QSZA 3MLWH 3STBA 3KG5A 3VGHA 1JTTA 2WUBL 2W92A 3GEFA 1C5DA 4U7SA 3KPQA 1C1EH 3RAJL 1NWOA 3PUUA 2WYIA 3RTQB 3RDTD 5E4AA 2FWSA 4ETQB 1ED3A 5IW3A 2C1OB 3TA3D 1OP9A 1IKOP 4EPSA 4P4KA 3S7GA 4Z7WF 43CAB 1OOAA 5K5YA 3FUJA 2HT3C 1T1XB 4MNQA 3SQRA 3K7UA 4WRLA 3B56A 1B0GB 1CYGA 1TTUA 1YEEL 2NUPB 1OHZA 4M3JA 1TQTA 1TYEB 2APTA 2YEZA 5CILH 1BBDL 3DK2A 2R1XA 3DPDA 3QUXD 3SO3C 4WIQA 1TPXC 3SE9H 3RWJB 1UJ3A 4FQ2L 2ZG2A 4N8CH 2ZCKH 4XMPH 4YGVA 4QAMB 2WB1A 1JXDA 2A9MH 5SX4H 3SGEH 1H6TA 1I3UA 3L3KA 4G7QB 1FL5B 1MCDA 2F1EA 1EDQA 1XGZA 3CFDB 5I8EA 4E42A 4G9FE 5EZIH 5BUAA 5DD0L 3BP7A 2XWBA 4EI6A 4A7QA 3CFKB 3HRZC 5CSZB 1EK3A 2JJVA 2Z93A 3KLQA 3NCYS 3UPCA 1PDKA 1X9LA 2ZYRA 4E41A 2FJFA 4IRZA 3NSJA 2OW7A 2OJ1A 3M07A 1G7IA 3MGOA 1XDTT 1KB5B 5IUCA 3FO1B 2V7HB 1PZBA 4ZAKA 4ODUA 1BEYL 3AXIA 3RWIB 5I1IL 1J0ZA 4OFYD 4J3BA 1KB5H 1MLBB 1YHPA 1AR2A 4P9HC 4PI2A 4XX5A 4EOWL 1Z3GH 5EOTA 4QR7A 5JR1L 4Y5VB 4IJTA 5E4EC 1AKJA 4XMLH 2XN1A 5ACZB 5HYQB 2V2XB 2X89D 1DJIA 3A67H 3W39B 3N85L 5ALBL 3WL9B 1QLEB 1NGXB 1PS3A 2ZSWB 2QTEA 3IFLH 3MRIB 3ZDZE 4ZPTB 1T7ZA 4JKWA 3MA7A 3FSOA 1H3PL 2AJVH 3EYFA 3JUYA 3FU7B 1L6ZA 3BXNB 3T0EC 1P9MA 3C6EA 4PJGF 4UQDA 5I82A 1PYWB 3EUUA 5DRNA 4OGYH 1PG7H 2CHZA 3KYAA 4L29B 1CGTA 4N20A 4NO0D 3KPOB 1E27B 2OK0L 4E36A 4YBLC 1SJHA 3JWNG 3X3FL 4BFOA 3EYOA 1GGCL 3R1GH 3P0GB 3EH4B 3UJTH 1MCNA 2YPLD 3N9GH 1UZ8A 5DJYA 1P7KB 4ZS7H 1FO0B 4PBWD 2NYYD 4PRNB 2J21A 2ZWYA 3I6GA 4JO8A 1S7RB 2UY6B 4APQD 4GRWF 1JWUB 4RQQA 1FO0H 4NUJB 4NGHL 3TX4A 3BQUA 2WVTA 3QDJA 3UACA 3FXIC 3WO3B 4RA0C 1N7ML 4X4KA 1GAFH 1MI5E 5TE4H 2PETA 1OGTB 4Q7DA 3RGHA 3QEGL 2EIJB 1ND0B 3QEUA 2R59A 3VD4A 1LE5A 4WO4C 5ANMA 3T4AB 2VDKB 1AHWA 1VFUA 1SLVA 5HPMB 5IGXL 2IPUK 5BMFH 3D9AL 4OLWL 5LXVA 3TO4A 4I77H 4UINH 4F80A 5SWQA 4FQLL 1VCAA 2HTLD 4KOCA 3ETBJ 4CNIB 1L9OA 2L4OA 2IBZY 1RZKC 2JQMA 2ROYA 2W88A 4YSOA 3HB3D 3OAUH 3HS0B 5C9KA 3D4CA 2H26A 1H8LA 4X7TB 4G42B 1U33A 5BQDA 5E8EB 2XPYA 3U4BH 4TVPD 4F7EB 4Z7QB 3ILPB 2O6EA 2AZAA 4JPWL 1NBVH 5JW4Q 4WGWB 4OJDH 4LSVH 2JJSA 6PAZA 2EE9A 2O93L 3QUZA 2PWHA 1L7IH 4NSKB 2EE2A 3O2DA 2E4FA 3CFQA 2CKBA 3L1OL 3C08L 3CXDL 3P69A 3BVVA 5HGHB 4P2CG 4OFVA 5KOMC 4OZ4B 4S1RL 3SD2A 4A2DA 1Q9OA 1UB5A 3MOBH 4AQ1C 4HS3B 1FI8C 1OW0A 3KW8A 4JPVL 4XRCB 5I73C 3TBTA 1DVZA 3N06B 4JFPB 2K1MA 3GK8L 3CCHB 1UT2A 4FG0A 4K8RL 4P5MB 3OPUA 3EDJA 4OVUA 1UH3A 5F7WC 1JPGB 3Q2CA 2C9UA 3H2QA 3PHOA 1OD7A 4PLKD 2LAGB 2AHIA 1DUZA 1F58L 3VW3H 3EFFB 1IU1A 3QIWC 3PV6A 2CMRH 4I13B 3GUTB 1S9WB 2CO3A 4LEOB 2AQ3A 1AQKH 2DQFA 2DRUA 4AIEA 5E8NA 5TTRA 5JORB 2FQEA 1KBKA 5JMRA 1MVUB 5C07A 3KWTA 1FG2B 2GC4C 4PR5B 1XGPA 3T6ZA 1FFRA 2IG2H 2H2SD 3KLHC 2ZE0A 1TT6A 3EOAA 2YC1B 4G11A 4IRZL 4S1QL 3TC9A 3WS6A 5FB8A 3UFIA 4WEUD 3HC0A 4P59L 3H54A 4ELMA 5GZNC 2EE3A 1KENH 1K5NA 2F74A 3CK0H 3MCG1 5L2KE 5C09D 5EEUA 3HCVA 3CXHK 1FRGL 5E8DL 1EJ8A 4P2QD 5CZRA 5FO8B 3QO1A 4YK4B 4JDZB 4JHAH 3JV5A 5EN3A 1MQKL 3QRLA 3SBWA 5F9DC 3H2WA 4UI2A 4FQQA 3UTOA 1QLFA 4I9WE 5TGBA 3QWRA 1E4XI 1ZD6A 1DQDL 3A24A 3VH8A 1QYGH 4MDJB 2D03H 1OP5H 2XN9D 5HYFA 1FVCA 1U8IA 2C9AA 5EU6A 3QVAA 1UOLA 3KXFA 1T7VA 4AXWA 3GTVA 3V2AR 1K5WA 3P73A 1A7PH 3MJ8B 1UUSA 1AG6A 1W0VB 1GZQB 2A6DB 2QPFA 3E38A 5DJZB 2YJQA 4NUGL 3L7EB 3KPRD 3PYCA 3PPSA 5EA0H 3WN6A 4Z7VB 1S8DA 4EJ1C 1TTRA 2X6BA 5DWUH 3FCGA 2Z8RA 3H42H 4LL1A 1RFDH 2BPBA 1KPVB 2E7HA 2G3MA 3ETBF 4UB0L 3I75A 4BWTA 5HYJD 3ORJA 4PCTA 3SPJA 3EFDL 4L4JA 2I5YL 3QXVA 5A2LH 5G4NA 4NFDA 4DKEH 4P2OC 3QJRB 2UZPA 2FCBA 2DY2A 5KG9B 2QVTA 1E40A 2DD8L 2FLRT 3PP4H 1B4JH 1TJIL 4XAKD 1IKNC 2QHRH 3MNZA 1ROCA 4ONHA 4ORZC 4PJBA 5BUPA 2IPUG 3U2IA 2WQWA 4OM0L 1DO5A 2LOEA 2GW5A 2AXGB 1MCWM 2GT9A 2NW2A 2VLKE 5HHOB 1GOFA 2AKRB 1QKZL 2DQMA 5I9QB 4KUCD 3IDJA 2HRHA 4MCYA 2BNRB 4HAKA 3WENA 2CR0A 4ETYA 5B3JE 4O2EA 2CKBL 4D8PA 4KZEH 1HNFA 3QUYD 4JJ5B 1J0JA 5AAPA 3U6RB 1HNYA 4GSRA 1S7TA 1C5CL 3QWOA 1IV8A 1A8ZA 4XNZC 4DVRH 3FTYA 1GPOL 1U8OA 1AQDB 1CPUA 4XMUA 1IILE 3QORC 5J13B 3NZSA 2WC7A 1ZKAA 1NKGA 3FFOA 4KDWA 2EYRA 4GKOA 4L4VD 4BFIB 4URKA 3K6DA 5FR3A 4J3WA 5TDPA 5CIPH 1NC4D 1U8HB 1RU9H 2R1YA 2X1PA 3S8GB 1TSHA 4HK0B 1OVZA 4P0DA 3K0YA 4M62L 3IAGC 3OGCB 3FOLB 3CHRA 5DVNA 4LQ1A 3SKJL 5C9JB 5IUSA 4JR9L 4NPYA 4PV9A 5JNYA 3R0NA 2HMID 4L1SA 1X5AA 2J3SA 1E9OA 2Y7SA 4HH9A 5EV7A 4DP4X 2WYZA 5E08H 2QMJA 4IHOB 3KLAB 4AK2A 5IBLC 4OLXH 1E3XA 3L08A 4LSSH 3EGXB 1RSYA 3H3BC 5I8CB 4XX1G 4ZFFB 1SDDA 1FNGB 3FDWA 2GSGB 1MSPA 4RGOH 5DLML 3V0AC 1F1DA 1OZUA 4ZMZA 2R2EB 2JH2A 3ENEA 2VIRB 3V0HA 4TLTA 4BJLA 5E2UH 2YEVB 5D5MB 3VXPB 5AYQA 2G30A 4U6YA 3MUZ1 1S6NA 4U3SB 1ZLVH 1JD9A 4RMRA 5GS2H 2WN3A 4ADIA 2IOOA 4MJIA 1ASQA 4RFEA 2VDPB 3VG9C 1TQCB 1HKLL 2UXGA 3K6OA 1VERA 3GHEH 1MJ8H 3QQ9D 5KVEH 5GQBA 5C0RH 3ALWA 1S9YA 5B1KA 2VDPH 4MKMA 5I26A 1G7QB 1WFIA 4FQXC 4LSDA 4JX0A 3HLKA 3IDMA 1PKQE 4RCAA 3CH8A 1RY7B 1RP9A 1WCBA 4OD1L 3RWHB 4EN3A 5AAMA 3GSOB 3LYRA 5DO2C 1ZT1A 5CN3A 5TJWK 4F7TB 3DA0A 1PFCA 5DC0A 4GO6B 1FP5A 1IEBA 4FYQA 4O00A 5EIIA 1CXFA 3IDNB 4GW1B 3MBXH 2JB5H 4YXKL 3VXNB 3TJEH 1HSAA 4IMLB 1AXTH 3TEXA 3MOAL 3VXMA 4HJSA 4P3CH 4U1GC 3E7JA 1E67A 1V3MA 3V4PH 1EDHA 5DQDH 4JFZH 3UBHA 4DN3H 4EO5A 3ARDC 1KXVC 2F7PA 4PJEA 3UZVB 3NSXA 1S5IL 5BW7C 2NZ9C 5D4JA 2QADD 1I9JL 1P5UC 5DF0A 1OARH 3TWCH 4WI2A 4NENB 1LDPL 1FE8L 3JWOH 5CN2A 1R5WB 3GJEB 5BV7C 2G4GA 1YN6A 3H9SE 3E9TA 5IHUH 1A7QH 3U4KA 3P11L 1AS8A 1M1XB 4X99B 2NY2D 2W5PA 1QO3B 5GRXG 5IVXF 2A74B 2DLHA 2X3BA 3VYPA 5BS0B 5JPNA 1O5PA 2WZ5A 3D39E 5FW7A 1QSFA 1AGEB 2BNQD 3B9VA 4Q0XH 4TSBH 3T6VA 1NL0L 4F2MB 1HS6A 3ILEA 8FABA 4F93B 1FLRH 3GM0A 4GS7C 4KTYA 2ED6A 1D6VH 3BSGA 2KUTA 2OI9B 4EDXA 3IBOA 1JZDC 3PHSA 4GMTL 4IRJA 1KTJA 1E5BA 1MXDA 1VADB 3F12B 5EO9B 1WWAX 3TO2B 2C3GA 4LSPL 3WJJC 3BJLA 1UWYA 3WN5B 4CKQA 2FD6L 1I7ZA 3QIBD 3R19A 5MERB 4PG9A 1SHWA 3SE3C 4NERA 1RULH 3WIFA 1DJGA 3FU9A 1T20B 2PTUA 4QHMB 2Y6TE 2XBTA 5TK2A 4HWEL 2MTPA 3MLYL 3PWJA 1OALA 5DHMC 3FTWA 5I1DA 1AY1H 2APWA 4G5ZL 3WNLA 2H0JA 1G9NC 4ZUUA 1GIGH 4XPHL 1U9KA 4M6OH 4OLUH 3ME0A 4U6VL 3T0XA 1VEOA 2V37A 1MCLA 3QIUD 1QFWI 2XYBA 4DVBB 4UQ3B 4OTXL 1GC1H 2IC2A 3G08B 3FOMB 4J3TA 1SHSA 2VN4A 2P5WA 4FXGB 4M7ZC 2D8KA 2O5YL 4FG6C 2OMZA 2BP8A 2XWTA 5T1KA 1YSOA 1PBYA 3VQLA 1NCBH 3DKHA 2V5SA 1P6WA 2OYLA 3D85D 3FN3A 3BIBX 5DMKA 3O3UN 2LLNA 1VACA 3TNMB 5D1QC 5C0BD 1BQUA 5EO0A 5JA9A 5E9AA 3UAEA 1NUNB 2Q3AA 3PXLA 4MVBD 1MFBH 3CNKA 4N2DA 3SPIA 1OAYL 1AG0A 4KO5A 4QTHA 4FQIL 5KANG 3NG5A 1RK0A 3IB4A 3QHFL 4DP0X 4PCSA 5I17A 3SDCB 2P45B 3FQNA 2K8QA 3EHBB 4Y4KC 1AE6L 4Z3HA 3ARQA 1XGRB 4NYLB 3R0MA 1JHLH 1OAJA 4XWOD 3B6SB 1JGEB 1GGBH 3BEWA 4FZ8L 3VFNB 1X5ZA 4PJFB 3PAVA 3W2DL 4DQOL 4I5BA 1A2YA 3EJRA 3RIAK 1T6WA 3ES6A 2E7BA 3HI5L 1Q38A 1VB9A 4HHAA 1N5AB 1R6VA 4JVUA 4KVPA 1DBAH 4X9GA 3WEXB 5D7JD 4U1KB 1IGTA 2FX7H 2QQNH 2FJGB 4XCYB 1OT1A 2JMRA 3E6HB 4HD9A 4C57C 1EBAA 1CYWA 3NESA 3POHA 2NQ3A 2YUVA 1E6OL 1XCTA 2EIBA 1QW9A 3I02B 5LCVH 1KLUA 1OB1B 4FLQA 5C0CE 1WITA 2WSPA 4KX9A 5IJVA 3QDME 3WXWL 1BXVA 3LN5B 2GCYB 4QHNA 4QRTA 1WZ1H 2NW3A 1AFVL 1L6XA 1RUML 3L3DB 1XR8A 2XTLA 1ACYH 1JOIA 1K4DA 3D2UB 3FJTA 4KC3B 4O5LL 5HDWA 3D07A 3FONA 5AOLA 1AQ8A 3FAXA 4GSQA 4W9CC 4TTDD 4J7RA 4GSXA 3ZDWA 3CFCH 3OAZH 4O51A 1PZAA 5H8DA 2EDHA 3RDTB 3BGMA 1VGKA 5I1HH 3BT0A 1JDCA 3MUUA 1Q9KB 3MJ7A 4GKNB 3TFKD 3TA3B 4HD5A 5BRZE 3HS9A 3UAJA 1JXFA 1YYMH 1NCUA 2XX0A 1OF0A 4YDKL 3CN2A 2TAAA 4D9QD 4EE2A 1JGVH 1NBZA 5AVYB 5EIIG 2Q9OA 1HC1A 2GABA 4OFKA 1NQBA 4ZSOB 2GTQA 3QUXB 3MU3A 4HWBA 1OSPL 4PTTA 1FZOB 4M7KH 3ILQD 2ZUSA 2CQVA 2J88L 4HG4J 2QR0A 4P2OA 3WY4A 4ORGB 1KBWA 2WINA 5GS1B 1M7DB 2WQXA 4YSCA 4X0NA 1NKRA 3TASA 3TIDA 3VYOA 3G6DH 5HPOA 2FZ3A 3KEDA 5IMLB 1WIPA 4N0UE 1ZHKB 3IMTA 3APCA 3C60C 4Z7OE 1ZJBA 1N8ZA 2WXFA 3VX1A 2LVEA 1EHAA 1HZLA 3PWVB 3PXJA 5F8QC 4LGPB 4D3CH 1PLCA 3QBTB 2YXMA 3ZDXE 3OAYH 1RJYA 2OA9A 3HLAB 5E8PA 3PWPD 3IJEB 3NZHH 1T4KB 3LNFA 3QRFM 2CXKA 4HIEB 2D7TL 5KW9L 1IBFA 3GHPA 1D6EB 5IOPB 3B2MA 4HFWA 1AZRA 2O6DA 1AQMA 5C7XH 2J8OA 3BVNA 3BIAX 3S2CA 4Z7AA 5MI0C 3GBDA 1MCHA 5LN4A 4J3UA 1KYOJ 1NIFA 3SGJA 5JHDD 5I6KA 5KANI 3VCLA 3AZUA 4NWUL 3RWFA 2UXTA 5ITFA 4JREB 3QPQC 1JVOA 2AK4D 1Q72H 3VFOA 4X8JB 2YAHA 5AZEL 1TVBA 2X6UA 1QATA 1QEWA 4PRPD 1DQJA 1XFPA 4YHMH 4XN5A 3V7MA 1QRND 3V9CA 2CK0H 3D4ZA 2FIKB 4NO0B 1G9MH 2BNUB 3AU1B 1C9SA 1O7VA 3VXQB 4AENB 1E5YA 1HHHA 3KYOB 1AD9A 3DPBA 4MXVE 5KSUA 3ARBA 3A0OA 5HDLA 5GZOD 4PJDB 2H2PD 4X6CA 3U36A 4APQB 3BEVA 5D2NE 2J20A 2R69A 2VDQL 1P4BH 3X12B 5BUGA 2YBRB 2J55A 1CK0L 5E99L 4AL8H 3QWQB 4BQ6A 4DOHE 2P8LB 1BG9A 1NBCA 3UTPE 1HU8A 3ABKB 3EH1A 4MLSA 4PWEA 4UM8A 5TF1H 3CMOL 2R23A 3WNKA 3MMEA 2PTTA 2BERA 1SQ2N 3U6XS 2BCKB 3CX5J 3FQWB 1W6LA 1BIHA 2ZSVA 4GW5A 1E9PB 3MROB 1OK8A 4L9LB 3EDDA 2BOBA 1I1CA 1HNGA 1L9MA 5IVZB 3NTCL 5I2IA 2OQJB 2KERA 2Y4SA 4ANUA 2F58L 3HE6D 5TF0A 2IAAC 1HH9B 5JMOC 2JCCA 2R4SL 3HB3B 3L3OB 5HDBB 4HOXA 4YBHA 5K59E 5SWSD 2QVKA 2VLLB 2DEWX 1SEBA 4JZNB 2M83A 3FBQA 1KCRL 3EGSB 2QSVA 2OMYA 5F9OH 3GMNB 5DJXB 1RHHA 3MVSA 2EACA 3P9LB 3H9YA 2AJZA 4IJ3B 4NKMA 3ECBB 1ZDSA 1YAIA 2NXYC 2WZPA 1IGIH 1K72A 2HCZX 5EH1A 1VAHA 3THML 4QPEA 2BWIA 2CBOA 4HWNA 1NZRA 5D7EA 5FUCC 3FT4A 2EO1A 5SV4A 1YPZB 2KZBA 1PX4A 1A8JH 1LL1A 4U05A 4UTAL 1QSVA 2MCG1 4P4KD 1KFAL 5MENB 2O6PA 5J6HB 3HI6H 4B9JA 1BVLB 1TKWA 3DX2A 5AAWC 1JPSH 5D2LE 3CZKA 4Z7NF 1D5BB 1TETL 1SXBA 2VW6A 3ARDA 5T3XL 3EKCA 3ZYZA 1OCCB 3OKMB 1MFAH 5AD0B 4F8OA 2WYTA 3MV9D 2UWEE 4QO1A 5BOZG 3LRLA 3HUJB 1ZHLA 2D2CC 3RPKA 2QELA 2F5BH 1AZBA 3BUBA 5HI4C 4HQQL 5FYKH 4HWBL 3CFTA 1MAJA 3RHWF 3ZRFC 4UV4L 1OAXH 1ML0A 1NMCB 1DBML 2OL3B 1RH8A 4R4FL 4TNVF 3LQAL 4Y2LA 4E41D 1Q0YL 2VE6B 2OL3H 5EO1B 3V0GA 3GHBH 3LPWA 4NRXA 1D3CA 5KVGH 5DUML 2W65A 3DX3A 2OMUB 3BFOA 4MX7B 2XTJC 5AVRB 3ULVL 1RXLA 2PXYA 4BDVA 3ARFA 1RZPA 1A7NH 1D9KC 4U6XA 3O3DB 4MMXC 5FS5A 1G6RA 5JLZA 5E1QA 4N28A 4H44C 4I18C 5C09B 1TQSA 5LHDA 4P2QB 1IC0A 5I16B 3NZ8A 4DGIL 1CLYL 1G4MA 4OSUH 3L4CA 4Y1AA 2WZ6A 1SUJA 4TUOB 1IRAY 4TULH 4D0BA 2EIEA 4NNPH 5DD5H 5GIRB 5A3IC 1KY7A 3J8F7 4Y8DC 2Y69B 4HUWB 4MNGA 4N5UA 1KIUA 3QCTH 2ZCZA 2XC8A 4XBEL 1MZZA 4E9YA 5FM4A 1KJ3H 4M8RA 1TENA 4N90E 3V4UL 1R3IH 3IMVA 4I0PC 4B6ZA 2Z92A 4G6FD 1AZCA 4PIBA 2XN9B 3I3BA 1CXEA 3FUEA 3MJGX 4MCZA 1UADC 5IHHA 1HCYA 3ASWA 3FHEA 3KBHE 5FKPB 2AK1H 2BVOB 2V33A 5A40E 1CE1L 4NBXB 2P42B 3NJMA 3QDJD 3RGVC 3TM6A 1HINL 4AC2A 4ZUSB 3Q7JA 3QDGD 1CICC 2OJEB 2R69L 1D7FA 4BSJA 2VQ4A 3H7BA 1LNUA 2IH3A 4FFZA 1ZVHA 4RDQF 1CXLA 2GJ6E 3BVWA 4CSZA 1LWRA 3LH2H 4M1CD 5K9KA 2WLJA 3W11C 3OHXC 4BCYA 2VSCA 1Z5LA 1LQSR 2NTFA 5GPRA 1RVFH 1YMHB 2B2XL 4PJ9C 3ZTCC 2OP4H 4IBVA 2EC9U 4FQPA 3SE4C 1T21A 2X5PA 3CG8A 4WHYG 3FQUA 1NUDA 3O4LD 4JDVB 5T1LA 1FJ1A 4HKZB 3B5GA 3UTSE 3X1GA 4FQJH 1JRHH 2WLYA 5D1XE 1QQDA 4JMNA 4A7TA 4ZQKB 5KSBF 4BGDA 1QPPA 5FOBB 1X5MA 2CDEB 3QO0A 4YSUA 4MJJA 5KYWA 2UZXB 3I50L 3HG4A 5E1HB 3VFMB 3VRJA 1T2QL 3I9GL 1JVKA 2YD0A 4YIQA 4PYGA 1KBGL 3FT0A 1HHKB 3L6FA 1JWSA 4QRUB 2GITB 1DSFH 1OQOA 2V9UA 3MRKB 3HJEA 4J4PC 4AJVA 4R0LB 2X2HA 4N8VA 4OD3H 4L18A 4ACPA 2H0PA 4NI6A 2IH1B 2O5XL 2WXMA 3DGGB 3QUYB 4FC3E 3GKWH 4DKAA 4G7YH 1BMGA 5LXGH 4FP8L 5FLUA 2QSQA 5JQIB 1TCRB 2WXJA 4DP9X 4ONGH 2Q20A 3DHMA 3KYNA 4KNUA 5IK3B 3NYKA 1JGLH 4RAVA 2YQ2A 5T3ZE 3N42F 2JKWA 2ZXCA 3FB5B 1NC4B 3FQ2A 5I74C 3AQDA 5C70A 4GG8B 4L4TE 3BSZA 4G80B 1JZ2A 2F8IA 1I3VA 4HCFA 4PB9H 2X1WL 5BV7L 2CJUH 3P4MA 5B38B 5FDWB 2H32A 2IQ9L 3WIIL 3D5OF 5KSAC 1CT8A 2G5RA 4JUSA 4U1LB 3FF7A 1HILA 3B8SA 1UZ6E 1RZIA 1UM5L 4IDJL 4JCWA 5L2JB 5BRQA 2W95A 2ZUUA 5FX3A 3WY3A 2JKSA 1WE5A 4JL2A 5EUOA 5F7KC 1QBLL 5DRWB 4C4BA 4D0DB 1R3JB 3CFBA 1A3LL 4NOBA 3HVNA 1P4LA 1MFUA 4JGUA 2DYRB 3OKKB 2BJML 4JHBA 4HKXA 3QRGH 4WDIB 1QR1A 4HGWB 4H4NA 3LIZH 1ZLUK 2EH8H 3RNQB 2K3HA 1NPUA 3O9WD 2VH5L 3MRLA 2VLRB 2WNXA 4XVTL 1IB5A 3IS1X 1G6RL 1KLFB 3ZHFA 3MRJA 4FZEL 3ARYA 3D18A 4F8LA 3C60A 5D71L 3QT2A 2P5EA 1X5IA 1BFVL 1F4HA 4J8QA 2XZCH 2PYFB 4V2BA 1IBGH 4UDUB 2VUOA 4B0MB 5D6DC 1YEKL 4X98B 1HSBB 3QHZH 1G9NL 4Z0BH 3VFVA 1AGDA 3LS4L 3DSNB 2DEXX 3DUUB 3P9WB 2G2PA 4X7SH 3QQDA 4RFNB 1TUPA 5LGHL 1WK0A 3P3SA 2CKNA 3GSUB 3O6FD 3M7FB 4YHZL 2F1AA 1YEHL 4LPXA 4J1UB 4XXCC 4LNRA 1UWXH 5IZ7A 1CFQA 1V3KA 5IFHL 3FB7B 1AD0B 4S0TD 2EDOA 4ADJA 1RLWA 4AVKA 1FVEB 4YDIL 4ANWA 4XB3A 4OUUA 3ARGD 1CFNA 4YJZL 5J12B 3HMXH 5KYNA 1U8NB 1MNUH 2V9RA 3UBXA 1NCJA 4GAGL 5HI5C 2HT4D 2DWYA 1HI6B 2L0DA 4EIBA 2ZP9A 5FHBL 1U93B 4GQZA 2NY4D 5HGBA 1XSJA 3FQXA 3OBAA 5F7LB 4QJ3B 1J5CA 1MW3A 3RWCA 1SBBA 1JNNL 2VR9A 3F7VB 5E7BA 5KS9E 2ESVA 5IESL 4GKZB 5I8OH 5J89A 1JHKL 4R7DA 3KLSA 4WTQA 3HRPA 2GC7C 2HRLA 3DVIA 3QR1A 3GI9H 4P46A 4JY4B 4GRLC 3TT1L 2WW8A 2QSCL 4YN3A 2G0KA 2EDMA 3FH8A 3ZE1E 2GAZB 3VWKC 2NY2B 1BF8A 4JDTH 1LP9B 2ZOLA 3V0VB 2MNWA 2FL5B 5HDQH 4PPTA 1RK7A 3B9KD 2UZYB 5FHAL 3EOBA 4PS4H 4NKDB 3W56A 4NQCA 4IBSA 4QYAA 1KGCE 1XGUA 3RQ3A 4LPCA 3SJVA 4BFGA 5CJXA 1AOZA 1N6QL 2JKJA 1WUZA 1XH2A 3IN0A 1ZANH 1H8SA 5ITBL 2ICEA 4GI8A 3RWGB 2F8XC 1A3QA 1U3JA 1WWCA 3QIBB 4M03A 3BQVA 2CLVB 4JG0L 5DZVA 2NX5E 4HEPA 5DDHB 4TQPA 5DWPA 4O4YH 1HAUA 2FO4B 5GGTH 3FTGA 3QXDB 1BQKA 4ZT1A 4QY8B 3GXMA 2R2HB 3MRPA 1R9FA 2QVIA 3K72A 2VQ1B 1XGYL 2WXPA 1JZ8A 3LZRA 4BA0A 5DEZA 3ERXA 1DQML 1MCQA 4PY8I 4Y88A 3VFPB 4NQTA 4OF7A 2Y3NA 1CXIA 3VI3A 1I8IB 5D9SA 3UABA 1OCRB 4P57A 4OF8A 4YL4A 1CBVH 4OUOA 5T1MA 2MKWA 5CR8A 1OT4A 4UWQB 5HY9B 3QIUB 5SWZA 4BFEA 1FWXA 4R4BA 1II4E 4LZKA 3BSZL 2MIZA 4MBOA 4W9IC 4HS6B 1GSMA 2VJ8A 2HT3D 4JB9L 4YMPA 1KN2H 3T6WA 1TO5A 4DKTA 3MCYA 5KVDE 4F57L 4H8QA 5B8CC 5JOFB 1IFHL 4NM8L 5FKAA 2OX5A 4XR8C 4N1EA 4A2FA 5I15L 2PCPA 3RI5K 4FAAB 5C0BB 1BYOA 4GUPB 1HZHL 5IEHB 3EBIA 1CTMA 2E59A 5D72L 2VAAB 1QNZH 2LR4A 4Z7UB 1IAOB 5GISH 3CU7A 5KOVC 3H56A 1IZJA 3HG5A 4HZLA 1E28A 3MACH 2TRYA 2I07B 5JXAL 4FFYH 4XPTH 3IGLA 3ATFA 1Y18A 2OPCA 4RISL 2G2RA 4JRXE 4I1RA 3G5XB 4U0RB 2NY7H 3LSOA 1A6UL 4LOVA 4KUZH 2DQIL 1JF6A 1OK0A 2IGTA 2YMXH 3FO9B 5DUJA 3MCKA 2Y1ZA 1D9KA 4BWUA 3Q1SL 1CZ8H 4XCEB 4MWFA 5LAXA 3EXLA 5CLWA 1NIAA 3ARXA 3V0FA 3VM5A 2Q76B 4MFHA 3LEVL 4PGDA 4WZ9A 1GYCA 5GGVY 2XFXB 3D0LB 3OVUB 4LLQB 5KBPA 1T04B 3ISWA 1FNFA 3V4VA 4WNJA 3T0ED 1ADQA 2E5EA 3DMMC 5D7JB 1F86A 4BIKA 3EJTA 4XGZA 4P23C 3V6ZB 3U30B 4BELD 2XFGB 4U1IA 2FNBA 3MYZA 1EXHA 3NJKA 2D7OA 2A5UA 1R3HA 4WEEA 4ZW5A 4YZFE 5I0DA 4FTVA 3PL6C 1HOEA 1RHFA 4A7UA 4Y4HC 3BH9A 5CJQH 4I0PA 5ICUA 3KYKH 2WTOA 2DMBA 4HCRH 3FTXA 2WUBH 3L2MA 3W9DB 3DOHA 4UMSA 1XBRA 3CN4A 4HYTB 2MHAB 1ZVYA 2C3VB 1BV8A 1MCOL 4UILL 4IKJA 1H0DA 1LO0H 1FFNA 2VL5B 3GJFB 3TONA 2WBJC 4RRPG 4N25A 5FXCH 2JIXD 4DPAX 1JWMA 5I1LB 3EJJX 4Q6IB 4Q2ZB 2FH6A 5AKTA 3VI4B 4WO4D 4GG6A 1U2CA 1L3WA 2IXQA 5FF6A 4YSPA 1KIQA 4HV8A 1X6NA 2FEEL 1Q0XH 4XPAL 3U2SA 1ZIBA 4H1LG 1YEEH 4LARL 1EDYA 2L7EA 3AAZB 4I2XB 2ADYA 4FRWA 3TEWA 4LP4A 4AWJC 3NUKA 1HHGA 3RJQB 3UBXG 4FQ2H 4AYBA 4P07A 3BZEB 1OF2A 3LAFA 1BXUA 4JMXA 4NJ9L 3TNNA 3C5ZA 2XQBL 4TS6A 5FUOL 3VE0A 3N1PC 4OGXL 4UAOB 5LNGA 2QZQA 3UGEA 5I28A 3W3BA 4BUHA 3OZLA 1G5GA 3NAAH 2MEJB 4MS6A 2TSBA 3Q2LA 1TNMA 1ZTMA 3JWDL 1IAIL 4MZIA 4YHPB 3JWNH 5DD0H 5JW4R 1WGOA 2JXMA 2O4EA 4JFEA 5D7IB 5ADOL 1GGUA 1BVKB 2J8UF 4NQVB 3LEXA 5FGCB 5DC2A 4F2EA 1DDHB 1CFBA 1TEFA 1TVHA 3G6JA 5D7LD 3PWPB 3CZFA 1BEYH 5EN2A 4JFFA 4QXUL 2X05A 5I1IH 1NLBL 4IMKA 5IMOA 4KGLA 4RMWA 1BZEA 4X42A 5BVJB 2GJZB 3BKJH 5BCAA 4Z5RB 3QZLA 5E9DD 3U0WH 4IEFA 4B9CA 3N85H 5ALBH 4ZK8A 3QG7L 5JHDB 4HUCA 4MDIB 3VJ6B 1H3PH 2J1WA 5K9QG 4H8PA 1ZT7B 5ESQA 2AK4B 3KVDD 1SHXA 1NFDF 1UOKA 3SEPA 3X14B 3KPSA 3ARZA 4S1DC 2B8OT 2M1KA 4IRSC 4XMKL 3FFDA 1G0XA 1ORSA 4NPJA 4MAUL 4ISVB 1W6WA 3BLPX 1CLVA 2FGZA 4HEPG 1QRNB 1UXMA 1ZK5A 2EVIA 4LL4A 3X3FH 1A22B 1QHPA 3EYVA 5E24E 1GGCH 3BD3A 4GQPH 4PJCA 3Q6FA 3QNXB 4H88L 4LESA 4XBGA 5IHBA 5KSAA 3BE1L 3MJ9A 4G71B 5HHQA 2CAKA 1DVSA 3RZCA 2W9EL 3HPLB 4KKLC 1NCCL 1AR1B 3VWJC 2E0PA 3UCRA 2JWYA 2RQEA 1TJGL 4TUJA 3ZUCA 3KLHD 4F7MA 1J0YA 3LV3B 2OZ4A 4WFEE 2B5IC 4NI3A 1JCVA 2FT7A 3QJQB 3P77B 4CMMA 1QFOA 1GJIA 3KJ4B 3KLLA 3W0WA 4L48A 4TPRH 4XZ4A 3VVWA 3QEGH 1RUKL 1JNLH 2EC9T 2CJSA 3WEOA 1J8HD 1ZDQA 1S3KL 4ZMPA 5HJDA 2CJTA 3O81A 5IGXH 3D9AH 5F89A 1I3RB 3EJSA 1BX2A 3QEHB 1IGYB 1TU2B 4JN1L 4NN5B 3GMOB 4LCWE 4Z7WB 3EYUL 4JQXC 3IJSA 2BW4A 1CO1A 2NY3B 4Y19A 3QEQA 2QGDA 3HE6B 3GSNA 4QRQB 2HYMA 2WTRB 32C2B 4Z78A 3WY1A 3I6KA 3N5AA 2ZKYA 4PFEA 2G5BB 4WNQB 3EO0B 3LD8B 2C1PB 5CMAA 3IWVA 2ITEA 3UADA 1BBJB 5SWSB 2X4TB 4ZMQA 4JANB 3F2LA 4JPWH 4XT1C 1T1WA 2APSA 1M7IB 4H7VA 3KVQA 2BVUA 3OKNB 1T6VN 2VJXA 4I3SL 2Y5TB 2F7RA 1CDYA 1NDMA 1YMMA 5IB3A 2VWEE 4GBXA 4QXGH 1HJCA 1LK2A 4R5TA 2VMJA 4A6YB 3EF7A 4S1RH 3RDJA 1PIFA 3T3MF 3I3EA 4OZGA 2ADJA 4IOIB 3MLSH 1IIIA 3SKUD 1TLKA 3ZHKA 4JPVH 4A6YH 4GSDL 1CDGA 2PCYA 2YXWA 4FJ6A 1TZOA 3GK8H 5HXMA 1EGJA 1GTFA 1N2RB 4JHVA 3GIZL 1A4CA 4LDEB 3F01A 4GAYA 3GXUB 4HXAL 3DX0A 3MV9B 4P2OD 1XEUA 1KZYA 1LO4H 2DZEA 4K71C 4YGVB 2CDGA 3KE0A 5F6IB 1TEYA 1F58H 1I7RA 4GRLA 5EUKB 4PJGE 1H3WM 3BDXA 4QLRA 5D1ZC 2FJHA 5ICZB 5DC9B 1RK1A 3VWKA 3GZQA 5IJKA 1A4KB 3BP7B 1BVZA 3VXRA 3WFHB 5LQBH 2QQKH 3MUHL 4E41B 1LGVA 1I7UB 3MBEB 4HSCX 1Z5HA 3U82B 4OV6F 3T9WA 3OR6B 5LBVA 1AZZC 5K1JA 1EPFA 2MOGA 4KI5F 4S1QH 4YSQA 4BSWA 1JXKA 4IRZH 3F6IA 1ZS2A 5TPWL 4IBTA 1N26A 3BOVA 4NC1E 4YGAB 3K6NA 4CC4C 4GRWE 2NUTB 1T0MA 3IFOB 1NCIA 2HKAA 4UQBA 1SM3L 5H94A 4RGND 2BW5A 4RGMC 1FRGH 3QUMB 2GJRA 3RY6C 3IGAA 3V0JA 1AO7B 4R97C 3V6OE 3QORD 4CSPA 2IFGA 4LLDB 3GMQB 3QUMH 1MQKH 4GXFA 3ESUF 1QBML 4Y16B 3HR5B 4AMKH 3OMZA 1URZA 4F7KA 1C16A 4CN1A 1S9XB 4N0YL 1DQDH 3OQ3B 5CEXB 3DGCR 1N0LA 3IFPA 4WU7B 5HTSA 5KAQG 3I6GB 3LN4B 5F7DB 4AGPA 5ISZA 1HESA 5CP7B 3IKKA 4DGYL 1UCBH 1RZ8B 3P30L 1HDMB 3MJ9L 2EXWC 2KZWA 2F7OA 5DVPA 5IBLD 4QHLA 3UTTA 4JO3L 3Q8EA 3FQTB 5IEKB 4NUGH 5E95B 3RL1A 3VXUD 1MCIA 2VLJD 3QDGB 4O2CA 1SVZA 2DWXA 2OZ4L 1GOGA 1MLCA 1NANH 3BZFB 2HT2C 1I4FB 1MHEA 1WC7A 1MFVA 4X4ZA 1MFCL 5GGVL 2CNYA 2H5UA 1Q1JL 2LFGA 4YHIA 1NIBA 2MCPL 2AP2A 4NN6C 3VG0L 4UB0H 4EUPB 5E94B 5CF3A 4ELMF 3SZKC 2AXHA 3M88A 3VB8A 4C4KT 5F9JB 3TBVB 3EFDH 3PCYA 1PQZB 4C54A 3D4YA 3K5RA 4CSSA 3QNFA 5F1NA 3U4EA 1MKFA 3NPSB 2NDFA 3O4LB 3TV3H 4YDVA 4L3ED 3VVVA 4PW3A 3WHE1 1EJ6A 2R27A 3D25A 4KROC 1QBAA 4JFOB 3SDAB 3QFJE 4FQXD 3GSNL 5DFAA 2H9GA 5I6PA 2WQUA 5GRWA 2F54D 5DO2D 4LKXB 4JFQA 1BQRA 1UOWA 1X9UA 1QKZH 2CKBB 3DJRA 1ITBB 3OTTA 4XTRC 4XNMA 1FHGA 3ELAT 3V8OA 3EADA 3OJVC 3PFUA 1MPAH 4PJAB 2CKBH 4OGAC 4H8HA 1Q9OB 3D50A 1YEIL 1Z7JA 2BVPB 2XWXA 5HHXL 4Z0XA 5AW5B 1AHMA 3ZDYF 1VKXB 1KOAA 1M6UA 1C5CH 3ARDD 4ZD3H 2AJUL 2CHXA 1QFUH 4N6RB 1GPOH 2NZ9D 5E4IA 1GYVA 1X9QA 4OF0A 3BIKB 1U8QB 1INEL 1EGJL 2XNAA 1UA3A 2RCSL 4RMBA 2BWDA 4KK9D 3AB0B 2ZF9A 4ZX3A 1QNIA 1A6VL 4MAYC 1QSEA 3LPOA 3TN0C 2PTVA 3MREB 3LKQB 4PJXB 4JCLA 5GGRY 4MQ7A 4DWHA 4M62H 4WW2C 4U3XA 4F1SA 3SKJH 4RBPK 3QPXH 1UATA 5FM8A 3QZWA 2BZ7A 3NRQA 4W4NA 3U48A 1O0VA 2X9WA 2WLHA 4M5ZL 4F20A 1J1XL 4JFYB 4LLWB 1M05A 3JVFC 1RZJC 3RUGB 2CGRL 4IIQA 5DK2B 5JIPA 4BHUA 3ARFD 3WNPA 3SO5A 3MLTA 3MRHA 4PWIA 3VXSD 1QUNB 5DLMH 2XBDA 4LO9A 4H40A 4UZSA 2ZXWB 1H3TA 2XT1B 4A04A 2A38A 5DJ0A 3T1WA 3O9WB 1U42A 5GRZA 1GGIL 4N3TA 4CU6A 4AJWA 1C12A 1HKLH 1EMTL 4B3EA 3ZVVA 4P9MH 1P53A 2ENYA 1KJ2A 4KJYB 1ACXA 1PCSA 2RH0A 1PX8A 3CLEL 3QQ3A 1A1OB 5DEFA 5DGQA 2C7UA 2Q86A 4R5XA 1SJVA 3FUFA 5D96B 1ZT4B 3GMLB 3G5YA 2FR4B 4PBVC 3O6FB 1A9EB 4MA3B 3N1GC 4PJIB 4FG6D 2X70B 2NNFA 5CINL 3K1DA 3NPZB 4PUBH 5J11B 1ZGLA 2N1TE 3LDBC 3GXNA 3RPBA 2ZCHH 1GJUA 5BZDA 3DBXA 3E1F1 2YKLL 3ARGB 4K23L 1JFQL 4YC2C 5D1QD 3MOAH 2FWUA 3VXOB 1OTTC 1UT9A 1X7QA 1S7UB 4DN4L 4PLJC 3M45A 3OJDA 4MZRA 5L0QB 1S5IH 2CO7B 2V2WA 3RJOA 4Z18A 1I9JH 3SGKC 1SNRA 1SXSA 3ISYA 1LDPH 4FI8A 2FDBP 4D9RD 5I66A 2CU9A 2FQDA 4Y4KD 2W60A 4OI7A 4HLEA 3ZXAC 3PAYA 5CAYB 3P11H 3X13A 4WJG3 3CSGA 2J2ZB 2AJ3A 2P8MA 1KGXA 2Z31C 3DROB 4WSJA 3K2MC 4MCMA 2YPVA 2IMNA 3OXSB 3SOBL 3B9KB 2IO5A 3AXLB 5F70A 2CPCA 1C7TA 5DJ6B 3MV7E 3OR7A 4DP6X 1SMOA 3IU4L 3BKML 4FNSA 1D5XB 2R4RL 1BGXL 5HVHB 3CZLA 1FZJA 3OKLA 4JQXA 4HH8A 4NZTL 4LSPH 1QI4A 4XH2A 3J07A 2EYTA 3MRQA 2G3ZA 2Y7QA 2Z35B 5ABDE 4JE0A 2GEQA 5PAZA 4UUJB 2DWDA 3GB7A 3CSPA 1QABA 1MW2A 4NQDA 2APBA 4RMQA 1A6ZB 3P4OB 2F7IA 4HWEH 4BSVA 3MLYH 5LVEA 2GTZA 2A6JA 4P5TC 3S5LA 3FB8B 2EYRB 4G5ZH 4ZJ9A 1MUJB 2OMNA 3ABLB 2NNAB 1LWHA 1P1ZA 3DARA 4PJEF 4UDTA 3CDGB 2X2IA 4U6VH 5DK0A 1NGQL 3KLKA 2GB2A 5E2TL 1FH2A 4JNXA 5K69A 2WAHA 4RRPM 2NR6C 1EO5A 4OTXH 5EBMB 2LLLA 1JE6A 1WISA 4X6DF 3SDYH 4OT1L 3A4DA 2XPGA 1E9OB 1FL3B 4RMVA 3MR9B 4ES8A 3NVQA 1VFOA 2O5YH 5IWLA 3DO7B 4L8DB 4G82A 4HA1A 2FB4L 4FXKC 4NDMA 3REWB 4M29A 4JAMB 2EUVA 4NFBA 3LH9A 3SO3B 1M2VB 1WBZB 3N3EA 4UV7L 5IB2B 4NZDA 4L2YA 1YECL 2OTUA 3OZ9H 5CSGA 3C8HA 2P80A 1BFTA 3BX7C 3IF1A 2QKIC 1IQWL 1A4JB 3GKZA 3GLEA 2ZKHL 5D1ZA 4FQIH 3LKPA 5IHLB 4U6YB 5JO5A 1D5ZB 1JSYA 4LEBA 3QHFH 5JW4M 3QZOA 3C60D 2YZ1A 1HQ4B 3WFBH 2P5ED 3V95A 2ADIB 3HRZB 1GY2A 4GAJL 4X5XB 5C2BL 4XOEA 3HHMA 2R7EA 1D5RA 5HVWA 1CU4L 3WYRA 1V3LA 3RTQA 4G43B 3L7FB 3LPPA 3QQ4B 1A1NB 4ETQA 2C1OA 3GPSA 1TTAA 4QI3A 5F21B 2X2UA 3QZWG 2OSLB 2IADB 2XVGA 3QG6B 1UENA 4LQFH 1KDIA 5E4EB 1NGPL 2Z64C 5IVXE 43CAA 5I6OA 1ZT1B 2M26A 4BE6A 4RMSA 1T1XA 2UX6A 4P9HH 5E00B 5LGYA 5IQ7L 4WHTB 1B0GA 2NUPA 3HI5H 3AT9A 2F53D 1IEBB 3QPQD 2CO6B 1IGCL 4Z1PA 5E2WH 4YDJB 4KXZI 1DE4B 3T0EB 4IS6B 3RWJA 5CU5A 1EFXB 1V8HA 5ID0B 4NUMA 3P9MB 1FL5A 2ZOWA 1IGFH 5FGSA 1E6OH 2B4CL 4PG2A 1U8PB 5KUMA 1IAIM 43C9B 3CFDA 4OF5A 4YBLB 3SY6A 1JHTB 2VDRB 3WXWH 3L13A 4L5FL 3CFKA 4U6HB 5CSZA 1UUNA 1AFVH 4FFTA 1RUMH 4PGZA 4PJ6A 4KHXL 2WV3A 4O5LH 4G6KL 4TNGA 4AV0A 5JW5B 4YSAA 4HSQA 3MBWB 4S10A 1ZEAH 1KB5A 4KTEL 3FO1A 3QI9B 1F4YL 1A64A 3NP4A 2XHNA 4PB0L 3RWIA 3WKML 3QE5A 2MKLC 1MLBA 3VXTB 1R3KB 1TEGA 3GZPA 2HLAB 4Y5VA 2JIXB 3PHQB 3AITA 1KPUB 5ACZA 5HYQA 4K5PA 4KX8A 4NQCD 2V2XA 2KS0A 4FDWA 5DHYB 1ZVSB 2IPTL 4TLKA 4WO4B 3W39A 3WL9A 3MRIA 1NGXA 3BZ4A 2ZSWA 1QWUA 2YPVL 5TK4A 3SJVD 4ZPTA 2A99A 4YDKH 2HPTA 1RMFL 4PJ8C 3FU7A 4EI5C 4JHUA 3BXNA 1OSYA 2OULB 1FFQA 1UD6A 3Q5TA 1GGTA 3C8KB 3J27A 3S98A 4EBQL 3LZNA 3AY2A 4L3CB 1OSPH 1PYWA 3D52A 5F7NC 5SX5K 1SYVB 4L29A 4O02B 2YN3A 5J6SA 1ZPLA 3KPOA 1E27A 5I0VA 3ARRA 2B77A 3TZVC 2OYKA 1CD0A 3CHPA 4XCCL 1GZHC 1TTCA 1P7KA 1X7TA 1FO0A 2D4FA 2EIZA 4I7ZC 3T2NL 4PRNA 2H3NB 1MFEH 4XAWH 1S7RA 2UY6A 1JWUA 4F92B 3AG1B 2NXYD 2H4EA 2VKWA 2ZUVA 1MRDL 3FU0A 4NUJA 4Y4FC 5FO2A 2XCMC 3WELA 2YAFA 4M4RB 2L7JA 5D7LB 4LU5L 2JI3A 2VZSA 4ZFZA 4IBLT 3VACA 1S4IA 2X44D 4ELKB 1B0WA 1OGTA 1ND0A 1I85C 2Q3XA 4AQ1B 3T4AA 5HPMA 5I73B 3OX8B 3HZKB 5E9DB 2BP8B 4NWUH 2Q8AL 3ALPA 5HDOA 1XTLA 2EIMB 2BOCB 1TLMA 4CNIA 5T5NG 2Q10A 4WFFD 5AZEH 1MCEA 3FUHA 3MODL 1ZTXE 3RKPA 3WSQL 4F3FB 1FDLL 5HI4D 2X9ZA 1MAKA 2O5NA 3H55A 1MZYA 3HS0A 4WHDA 1OE1A 4FX5A 5GSRB 3VA2C 3QIWB 4X7TA 1KCUH 3IMRA 5E8EA 4F7EA 3ILPA 1CN4A 3KHOA 3N41F 5I17B 3GC3A 3MLWL 1WTLA 3IU3B 2DTML 5C97A 4F37F 2ZG3A 2QPDB 3LZLA 2VM9A 2OXGB 1AXIB 3DX8B 1EO8L 4UF7C 5CSBA 3DX1A 2HN7B 1FG9C 9CGTA 2HX8A 2XTJD 4CGUB 4HK3N 4OZ4A 4P3DB 1CK0H 5E99H 2X88A 5CCHE 1ID5I 1JZIA 4YPGB 1TR7A 1D9KD 2YPLE 3PQYE 4FXGC 4ZTPL 4HS3A 3ULVF 4XRCA 3CMOH 1HE8A 3FRUB 3GMMB 4J3OC 4JFPA 3VGGA 1J8HB 2WLZA 3B9AA 3CCHA 3FSWA 4P5MA 3FRPB 2Z3FA 5M94B 2XZQL 4YUEL 2VB5A 1JPGA 5A2AA 2XV2A 4N87A 3SIKA 3F05A 3T8VA 3SE9L 4N8CL 4XMPL 3TP4A 4DP2X 2W80C 3NTCH 3S9DB 1JK8B 1I8UA 3AXHA 2HJKB 1DVXA 4UANA 5A3ID 2F58H 3EFFA 4EMZA 4XO4A 4TNWF 3C2AH 3B3IB 4FTVD 4ILDA 3H53A 1S9WA 3GUTA 2Y2WA 3UDWC 2F2HA 4LEOA 2COVD 5DYOB 3MJ6A 3AREC 4I0PD 1KCRH 4QRTB 5JORA 3GXPA 4LSUL 3EHBC 2OR7A 2XQ0A 3FUNA 1HN1A 1MVUA 4HUKB 1FG2A 1NA8A 3JV4A 4PR5A 5F6HJ 5L4IA 2VKXA 2EAEA 5IIEB 1OGAE 5F97E 2YC1A 1FHNA 1VEPA 3RGVD 5I0YA 3PGCB 5A6MA 4I89A 3VD2A 3SZ6A 1CICD 4PM1A 3S36H 1UVQB 3TYFB 2WXNA 4X6CF 4UTAH 1LEKB 1YAZA 1GVIA 4TLSA 1KFAH 2XKSA 4XMLL 1IX2A 3FB6A 3A67L 4GI9A 5L2KA 3WE6B 3V0EA 3IFLL 1TG8A 4DW2H 2WJ7A 3W11D 4Y5XC 5FO8A 1TETH 4JDZA 4NQUA 4ANXA 1QLEL 3ZN6A 3SGKA 4PJ9D 3N6YA 5KJ4A 2NXZC 4ZUWB 1UKTA 4W9KC 1YC8A 5DHXB 2ZOKB 4P2OB 4RZKA 5F7MC 2DJMA 1X4ZA 2GHZA 4HQQH 1RUQH 1QRKA 1A1MB 3R1GL 3RWEB 1DVYA 2CGYA 4UV4H 4U6TA 4MDJA 1DBMH 4DTGH 2FZ3B 3N9GL 4ZS7L 2PYED 3BLKA 2X9XA 4IGBB 2JCCF 1Q0YH 2VNCA 5FYKE 1OD9A 2D4DA 1QAWA 4PGBB 4I0CC 4RNRB 3V7AE 3BUPA 2CLZB 4UMGA 5FFLA 3NIFF 4OZIB 3CN1A 3MJ8A 2KT6A 4WW1B 5DUMH 1P84K 1W0VA 1GZQA 2A6DA 5DJZA 1R24B 3L3GB 1JFHA 3VGBA 3L7EA 2WXLA 3DI3B 1IEAB 2ITDB 2FGWH 3BISA 4J4PD 4OLVH 3WFEL 4CAGA 4Z7VA 1ETA1 2BSBA 3MRDB 5KVGE 4ONFL 4FHBD 3C5SB 3T0BA 3NN8B 5T1DH 5BMFL 1KPVA 4Z77B 4BYHA 4UINL 5KBLA 2BP3A 2VDKL 1S7XB 4XNZB 1Z2KA 3SYQA 4G2AA 3QORB 3S3CB 1JYNA 1OM3L 4ALAL 3VDBA 3TFBA 5C0NC 1AP2B 1TVBB 3QFDB 2XWJB 2AAAA 5KG9A 2WUCL 3OAUL 4QRRD 4XMVA 3QULB 4XBEH 3MRNB 4WHYH 1MG3C 5KSAD 2R9HC 1CTNA 1Z66A 3QSKB 2OTWB 2VC2B 3T04D 1WHPA 3O0LA 2AXGA 3O2VH 4HALA 2YJLA 4LSVL 4FQHB 2WNGA 3KGRA 4K5NA 1OY3B 4G6ML 5HHOA 2AKRA 4N3UA 5G4MA 2ATPB 2VC2H 2ZX8A 2BNRA 1CE1H 4L8CB 2K6YA 1SOKA 3ZY7A 4A66A 4HISA 5F0PB 3VXUB 2VLJB 3GNMH 3FH7A 4JJ5A 2W91A 3U6RA 4X6BA 4GO9A 1QW8A 2QKIA 1X4YA 1AQDA 4FF9A 5AVTB 2B2XH 3WKYA 5F9WC 3S5ZA 2Z7YA 4BFIA 4Z7NE 1M6OA 5JIHA 1NUFA 3KPRE 3TBYB 4W9ZA 1U8HA 3VG9B 3VW3L 2EUWA 4WUUB 5IJCC 4HK0A 2CMRL 3BWUF 4L3EB 3OGCA 3FOLA 3QA3B 1AQKL 4XB7A 5C9JA 5I1CH 4PJ5D 2ZYIA 4FQXB 1MG2C 4HAFA 2WWMC 5DXWA 5HYJE 5EEXA 4QDGA 4W9LC 2HUHA 5LGKA 2AJZB 5B3JF 2F54B 2H45A 3GI8L 4IHOA 3KLAA 4AKQA 1FLTX 5D2NC 3I50H 1YNKL 1B6UA 2DKUA 1T2QH 1NOAA 3EGXA 1KBGH 2CZNA 2NSXA 4KRNA 2PW2B 3B7RL 2EDRA 5I8CA 4ZFFA 1F3DH 4HCGA 5HI5D 4PRHE 1FNGA 1B9KA 1KENL 1RIHL 2QTVA 4NQEE 2R2EA 2VIRA 4FP8H 3VXPA 5D5MA 5AOIA 3ARDB 4YHNB 4L9LC 3HG3A 4U3SA 4OKDA 4PRID 5DHEA 1P5UB 4MJ6B 5MHSE 2OCFD 1U4EA 1ZHLB 5EU3B 5F7FA 7TAAA 4GRLD 5BV7B 2VLME 2AXFB 3L4ZA 4GUQA 1WF5A 2QJDA 2YRPA 1CDBA 1G7QA 3VWKD 4C56E 4R2GC 2D03L 5BV7H 3VXRD 4FNRA 5D7SL 1ZLVK 2H6UA 3GDBA 1J9CT 3GSOA 2WLNA 1KTDB 1UM5H 4IDJH 1G4RA 4L4VE 4PAZA 4ZMOA 4F7TA 3HE7C 1XIWC 1A7PL 4GS7B 3I85A 3IJYB 4EF3A 1BEXA 4B9IA 2AV1B 1QBLH 3IDNA 4GW1A 3SYOA 4PJ8A 5EBLB 1A3LH 2J12B 1TXKA 1OL0A 3VXNA 1EXUB 4IMLA 5J57B 2J71A 1PD0A 3VXSB 4BBWA 2WWKT 3X1EA 2XWZA 1I8LC 3DVFA 1KNOA 2VH5H 3MKGA 4XVTH 3UZVA 3PE9A 4NENA 4FZEH 4FERA 4ZUVB 3NZ8B 4I87A 1QX1A 1HH6B 1DCLA 1CLZH 4IKLA 3ZO0A 5D71H 3WTXA 5AKRA 1R5WA 1N6VA 1XL6A 1L6PA 3GJEA 3L5XL 4TSAL 1QR4A 1HK6A 1XF3B 2IFFL 1PSKL 1G7MB 3TVMC 1KIUB 2P7TB 3PP4L 5D4IA 1B4JL 1M1XA 1NMCC 4FG2A 4N2CA 2VXTH 1GL4B 2QPUA 2YBGA 4X99A 4YO0B 1QO3A 1G9NH 5DYFA 2A74A 4JUTA 3ZR6A 5BS0A 1ET5A 3LS4H 4MTMA 5KJRL 5IR1B 1AGEA 3NJFA 5LGHH 4LFHG 1XZ0B 2X38A 4F2MA 2Y7LA 5ISZD 2NY6C 1B4TA 4YHZH 4YOKA 3L54A 1YEHH 1L0YA 3R06A 1HCFX 4M7ZB 5EOCL 5KSBE 2N1KA 1TMQA 2R0ZL 3UTTD 4P2RD 5IFHH 5DFVC 1G6VK 5K93A 3F12A 1VADA 5EO9A 3TO2A 3BWZA 2Z7WA 2FECL 4WWPA 3DX4A 4HJ1A 3QNYA 2Z91B 1I9RL 4GAGH 3NDZE 5MERA 4CSTA 4N86A 4P2YA 5D1QB 5F3FA 4E9SA 5EUOF 3KL3A 3L4TA 1T20A 1U8CB 4QHMA 3U7YH 4AEHH 3NCCB 4AVIA 2GY7B 1F1GA 3IMSA 3SPHA 3MRMB 2DBLL 5IESH 2IANE 2Q0ZX 2ZAIA 1JHKH 2ZUTA 4DFIA 4IBYA 1T21B 1GMIA 4Z3TA 1A66A 4UQ9A 3BFQG 1DLHB 4Y4KB 3ZE0B 5I0XA 3AGWA 4RH4A 3KGSA 5JHAA 1H3XA 5ERWB 2HKHL 5JOPD 4XNAA 5DMJB 2KDYA 3FO0L 3NJLA 1W2KT 4UQ3A 1ZIAA 3RIFK 3G08A 3FOMA 4HJGA 3UIYA 5FA3B 2ADFL 1JK9B 2BC4B 5FHAH 4FXGA 3Q5YA 2H3XC 2WP3T 1JIBA 3EJYC 4JO4L 5H37A 1BWMA 4LSSL 4YIQB 2XX1A 3C5XA 2CXGA 8PAZA 3DMMD 1SVBA 3FC8A 3TNMA 4P23D 3HN5A 4RGOL 2BVQB 4UAHA 1XBDA 2BNQE 3M8OL 1DP0A 4ENZA 3D69B 5ECGA 3PL6D 3DNKA 5IM7B 4Y4HD 1XGYH 1UM4H 3SDCA 3F6LA 1B0RB 2R0KL 1HVXA 1DQMH 1S3RA 2CHDA 2OLDA 4GFTB 1GW6A 1IJ9A 3GHEL 4G8GE 2YPKB 5C0GB 4AKPA 1BJ1J 1XGRA 4JEGB 1MCFA 4NYLA 2OMVB 4NRZB 2CLRB 3GSRB 3TEZA 3B6SA 1JGEA 2BIOA 5D1XC 3WIHH 2WBJD 5HJ3B 3TA4D 3PWNA 1G0YR 3VFNA 4PJFA 2D3NA 4IBUA 4LASH 1ZLUH 1JG9A 4LEEA 2H32H 4LIQE 3GBML 2J5WA 3W1ZA 1ZGLM 4GT7A 1DEEB 1NCNA 4Z9KB 1N5AA 4ZOAA 4E9RA 1KSRA 4F91B 3WEXA 3ZRCC 1A3RH 4M8QA 1O7DE 3FCTB 4U1KA 3A6CL 4F57H 5LCVA 4E9QA 2FJGA 1AXTL 1IFHH 4XCYA 4NM8H 3ULUC 1WFMA 1H9VA 3I02A 5DQDL 2CG9X 1OB1A 4QRPD 2YGPA 5LNEA 3CFIC 5D72H 5AVQB 1FCGA 3CDZB 4S2SA 2WM0A 3LN5A 2GCYA 4DETA 1PZSA 2E47A 3O11B 3D18B 3JWOL 3L3DA 2N7AA 3B2XA 2X2YA 5I1GH 3D2UA 5JXAH 1LDSA 3BPOC 3BVXA 4RISH 4PV8B 1KWGA 4QT5B 4XN2A 2Y0SA 3AWFA 3RDTA 4FQCH 1W0WB 2DQIH 4GKNA 1Q9KA 1M4KA 4Q0XL 3TA3A 3LNGA 3MV8D 1FFOB 4K7PX 1UA6L 5FO7B 2VXVL 5MI0B 3GBNL 3QP3A 3SSGA 4Q9CA 1D6VL 3LEVH 4OZHE 3WIAA 4H1LB 4PCYA 1MXGA 2V2TB 1R5VB 2XQYK 2F53B 5KBKA 5FYJE 3VU1A 2AABH 4ZSOA 3QUXA 4S1DD 4IKKA 4QTIH 5FYLE 4H1LH 3UBXB 3EGDB 4IRSD 5BPPA 4ORGA 5DC4B 3LRMA 5GS1A 1M7DA 5HDRA 2YEQA 1H3VA 2FLMA 3TLRA 1I1AC 3ATDA 1PY9A 2NPLX 5IMLA 5CHNB 1KT2B 1ZHKA 1J5DA 3KS0J 4FFVC 1AY1L 1ZY9A 1EH9A 3EOTH 3MJWA 5I75C 3UERA 5A2FA 2X40A 1GIGL 2V8MA 3PWVA 4KKLD 5DURD 1HXYB 4M6OL 4P5RA 3VWJD 4OLUL 3VYNA 2FHFA 3HLAA 4ZX5A 4KKNA 3IJEA 1MCOH 3PF2A 3GO1L 1T4KA 3BW9B 1BLIA 4HIEA 1QFHA 1P7HL 2P49B 1D6EA 4OFYA 1Q9LA 2VR4A 5C0JA 3B3BA 5IOPA 1E8YA 4XOCA 1AH1A 3ZHNA 2A83B 3UIZA 5F7UA 2WXHA 4NQCB 2FH8A 3DHUA 1ZHBB 1NCBL 3OAYK 3LQZB 4EIUA 3PU7A 3FCBA 4LARH 4X8JA 2IDCA 3AG4B 2QMKA 3BHBB 1J0IA 3M17B 4X9FA 4EQ3A 2ALAA 1DBJH 2ZG1A 5KZCD 4NO0A 2FIKA 5FUOH 2XQBH 1J18A 1EVUA 3SGDH 1SXZA 2XOTA 1PEWA 2BNUA 3AU1A 4FLRA 3DXAE 3TV8A 4HJTA 3VXQA 4AENA 3JWDH 3KYOA 4D7PA 2BHZA 3AVEA 5CUSH 3MHZA 5DZOA 4H26B 1E2WA 4XZUB 1MHHB 3LKOB 4OI9A 4PMFA 3SDDC 1FA4A 1PJ9A 5ADOH 4PJDA 5J06A 1FC1A 3VI3B 4APQA 1JHLL 2DMKA 2G3XA 2NXYB 3X12A 4HEME 5BZXA 1OAQL 2YBRA 3DDGA 4TSCH 4U1MB 3C6LB 3JUZA 4QXUH 2EVFA 5TDOA 2P8LA 3HFML 3V8CA 4A39A 1IC4L 3OG6B 2DQ6A 3NIDF 5KTEL 1GCFA 3HTLX 2GI0A 3LXAA 3KDMB 1JZ7A 4B96A 2BCKA 2PPFA 1F41A 4U33A 4K7PL 5H37G 3KPNB 1E9PA 3MROA 1UQSB 4L9LA 1KJMB 3UP1A 2MFNA 5IVZA 4KAQH 3L3IB 2OX5B 5EC2B 1XD1A 5C0DB 3NFPB 3HZYB 4O2FB 4MAUH 1HH9A 3ESPA 2P80D 5LCVL 3L3OA 3COOA 4F9PA 5D1ZD 3VFTB 2VLLA 4JZNA 4ODWB 4Z3IA 4H88H 3QXUA 3WNMA 4QF1B 1T5KA 1PZUB 5EEZA 3GMNA 5DJXA 3P9LA 3L5WB 3QCUL 1I53A 4AQZA 1WWBX 2W9EH 1X5LA 2NQDA 2ENSA 1CGSH 2K6WA 3ECBA 3WNJA 4PRPE 4EVNB 1JXGA 1TJGH 3CFCL 3O6MH 3IWUA 2VR5A 1YPZA 1L9PA 2X1XR 1HYSD 4Y7MA 5I1HL 2XTJB 3ZKSD 1PF3A 1NIEA 5MENA 1D9KB 3HFFA 5J6HA 1RUKH 1CFVH 1W15A 4MMXB 1BVLA 4MWFB 4UM9D 2VERN 4QWWC 3G6JF 4X9IA 3T77B 2XG5B 5IQ9B 2EDJA 3U6XA 1LLAA 4I18B 1D5BA 1UFGA 1AGCB 5MEPB 3CDFA 5JHLL 3BRGC 3WLWC 1VFAB 3IDGB 3OKMA 1BZ7B 2N0KA 5AD0A 3LEYH 1WRFA 5EMYA 1KG0B 2UWEA 3HUJA 4B5ZA 4NKQB 4YVNA 2G60L 1JPST 3UAFA 1KWKA 2EJ1A 2Y22A 2CPUA 1EFQA 2E4TA 4G9FD 3QR2A 3FZUC 1F1AA 4JKPL 3TCLB 1ODUA 1BJ1H 1OCZB 2XA3A 1NLDL 3EG9A 2YLKA 5DS2A 4I0PB 4F8QA 3NMEA 3FFCE 3H0TB 1XB3A 2XQYG 2VM3A 5EO1A 4NO5B 1ONQB 9PCYA 1DUYB 2EXWD 3BC9A 4PJCF 2H1PL 1W72B 4Y2DB 1XCQB 2OMUA 3M1CA 5DJAA 4KKPA 4MX7A 4LPVA 1O7SA 2EC8A 4YDLC 4RLDA 3RGVB 1DQQB 2J8UE 1CICB 5D2LF 1W72H 4BEIA 3FBKA 2AF2A 5AOMA 5C7XL 1MRCL 1SVCP 2HT2D 1RP8A 4CRPA 4GG6B 4GSDH 5C09A 1JBJA 1TTGA 4P2QA 3OHXB 1Q72L 5HHME 1S7SB 3LHPL 5KJ7E 1MIEL 1FSKC 5I16A 1JZ3A 4CA4A 2DLFL 1U21A 4PJ9B 4TUOA 3K2IA 4HXAH 3KL5A 2LE9A 4XBMA 5IT2H 3MLPA 4FL4B 1YYLL 5GIRA 2MTAA 1AMXA 2VR6A 5EF0A 5FM5M 4B9GA 2CK0L 4UOQA 1LQBC 4HUWA 3INOA 4KJWC 1WZLA 3B83A 3FQRB 4LOFA 1NFDB 1KELH 5M7QA 1XB6A 2GUYA 1F13A 4KROD 3ABGA 2IWKA 4MNQE 3S3DB 4PWFA 3C75A 4FMFA 3WDIA 2PYEB 1UD5A 3TJHC 2XN9A 1EAPB 1COBA 4PV1C 1B9ZA 2Y6SD 5KUKA 2VYRE 1MDTA 3N04A 5EC1A 4K3HA 5FKPA 3MV11 2A1WL 2BVOA 1NCOA 3CVDA 5I71C 1ZLSH 3CC1A 4XTRD 4KQ3H 3INUL 2YUWA 5TPWH 4ZUSA 4AQ8A 2X4OB 1FVDB 2OJEA 5KYXB 1KGWA 4OGAD 1MI5D 4JQIL 4OCSL