4XXWC

Crystal structure of mouse cadherin-23 ec1-2 and protocadherin-15 ec1-2 splice variant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
204
structure length
204
Chain Sequence
QVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protocadherin-15
publication title Tuning Inner-Ear Tip-Link Affinity Through Alternatively Spliced Variants of Protocadherin-15.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 45
structure length 204
sequence length 204
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4xxwC01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4xxwC02
3Q2LA 3MVSA 3LNFA 2YSTA 2OMXB 2QVIA 4AQAA 4ZMYA 3LNHA 4AXWA 4ZMNA 4ZMLA 5CO1A 4AQ8A 2A4CA 1NCGA 2OMYB 4QD2E 4ZMZA 4NQQA 3K6FA 5DZVA 3FF8A 4ZI8A 3K6DA 2OMVB 1O6SB 4AQAB 4XXWA 4NUPA 5JYLA 4AQ8C 5KJ4A 4ZTEA 4AXWB 3Q2NA 4ZMQA 2WHVA 2OMZB 4ZT1A 1L3WA 2A4EA 2YQGA 3K5SA 3K6IA 2O72A 4AK1A 3Q2VA 2OMTB 3Q2WA 3LNEA 3LNGA 3UBFA 1ZVNA 4XXWC 4APXA 1FF5A 4ZMVA 2WCPA 2WBXA 5CZRA 2WD0A 4NUQA 1OP4A 3K5RA 5JYMA 2EE0A 4AQEA 1NCHA 3FF7A 3UBGA 4OY9A 3QRBA 2OMWB 1WYJA 4ZMWA 1SUHA 2V37A 3LNDA 2QVFB 4APXB 1Q1PA 1WUZA 4ZMOA 4NUMA 4ZMXA 3UBHA 1EDHA 2OMUB 4AQEB 4ZMPA 4ZMTA 2X2UA 3LNIA 3PPEA 1NCJA 1NCIA 1ZXKA
chains in the Genus database with same CATH superfamily
4OQTH 1OV8A 4DGYH 1M05A 1B6UA 1PX8A 4KZ0A 5JW3L 1SN0A 1QR4A 4AL8H 4ZAKA 1JYWA 4D8PB 2KLRA 1NLDL 1ZE3H 4NZTL 4D7BA 3QI9C 2AK1H 1Q72L 5I5JA 4ZRGA 3D0AA 2DM3A 3WFBH 2BNUA 4PU2A 4BCYA 3IFPA 5IFAL 4Z7VB 3TLRA 1N6QL 3SE8L 2F8XC 1YPZF 1RZIB 2EYTB 4NWUH 4FFZH 1I7ZB 3NCCB 1GAFL 5GJSL 4UQ9A 3D25A 1WAEA 5IQNA 2IPTL 1WUNT 2OTWB 1MJUH 1QBMH 2NY3B 2GB2A 4CBPA 3IFLL 3L4TA 5KYXB 2WZPD 5E5LA 2YKLL 4BKTC 2OYLA 1IEAA 5D55A 1U3NA 4M6AA 4MQTB 4XPHH 4G8GB 5B39G 5BUPA 4KUZL 1TETH 4NOBA 4OGZA 2NPLX 1Q94B 1OOAA 2X6CA 4EUPG 1IC5L 3DIVA 2JB6A 3QDHA 1NMCB 2F5AL 3HAEG 4QO1A 5DVOA 4WUKL 2I27N 5SX4I 1P4UA 3UEZA 1E3FA 1CD0A 4D0DB 5CBAB 3I3EA 4JKMA 1DQQA 3NIFE 5CEZH 2YS4A 3LN4A 4NN5B 3SJVD 2F5BH 5A43C 5AALA 5B3JF 4V1DB 3EYSH 1I1FB 4U0QB 3UIYA 4JFYA 1SJVA 3VVWA 1W0VA 2P8PA 4RGNB 4FA6A 2A9CA 2QDVA 1FL3A 2DRUA 3ZMRA 4UQ2A 5C0NC 2BOBB 4BK5C 3QI9A 1Q1JL 4PFEA 5A2BA 5GSVB 4DQAA 4G7SB 1MCWW 1MRCL 2VDPH 2WAHA 3DMMB 1E4WH 3GIVB 4X80L 2C7FA 3KPPB 3Q5YA 1HHIA 4PYHA 4P5MA 3CLFH 1RULL 5LBSA 2J57A 3KCPA 3MA7B 3CXDH 3G6JE 4G8EB 4ACTA 4WRLA 2EECA 4GSUA 1XCWA 2YA1A 3SOTA 3DGGA 4GH7B 4GUOA 2PW1A 3CFKA 4RISL 2V9RA 3PFUA 1VGKB 4NSKB 2PXYD 1IGCL 2XA8H 1SRDA 4WTQA 5GZOC 4OFDA 3S7GA 3V0HA 5BCAA 5ANHA 2W88A 2YPKA 4JFDD 4OM1L 1TEGA 4P2RB 3SYPA 4Q8BA 4HCRH 1P4BL 4HK0A 1BVNP 4PWJA 1T03L 3VQLA 3FQWA 4FQLH 2AS5M 4WENB 1OLZA 1V3KA 1YYLL 1JIBA 5D72H 1EAOA 5FYLH 3VXME 1JK8B 4B9GA 2X1OA 5AW0B 4YXKL 5DZNA 3FTSA 4FCHA 2JCCA 2E7LC 2PCFB 4HPYL 5SWQA 4A7QA 1RXLA 5I8OL 3TCLB 2WJ7A 5BXFB 3GGWB 4UYQA 3VXSB 1B2WL 4TSCH 1U8LB 2WBJA 1HKLH 1P84K 4FABH 1T2XA 2A0LC 1NCGA 5AZEH 3D30A 5EBLA 4BK5A 3HE7A 1OAXH 4JEGB 5ADPH 1J9TA 3U7WH 2ZZUT 1I8UA 1E8WA 4A2GA 3S5ZA 3L2MA 4LRIC 3TL5A 5EOQL 3EYQD 4Y2LA 3LKQA 4JFXA 4YPGB 4KV5F 1F11A 1SJHB 2N4IA 1FFPA 4GAGL 1TQUA 1Q0EA 4M8QA 2XIDA 2XQ0A 1PDKB 4ODHH 3MJ9H 4XXWA 3NJFA 4RQQA 5D96C 3QO1B 1UWEL 5GZOA 1A7OH 4J3OH 2WLLA 3P9LA 3D39E 4AYID 1ES0A 4KK6C 2GCYB 4Z3IA 1IC7L 4BA8A 3FTYA 3MX0A 2FZ3B 1NQBA 1WZ1H 3I3BA 5F7KC 4FADA 1TLKA 2ILLA 3IE4A 1F6FB 3NIGF 1RP9A 2GW5A 2L7QA 2NRDA 4XAWL 1IAOB 5EZIL 4AZ8A 1CLOL 5CCHE 5JR1H 1IVLA 1NGQL 1EQWA 4HIHA 2DYRB 3N6YA 4JKPH 1JDDA 2WKOF 2ZF8A 3INUL 5EH1A 3ULUE 5ICYA 1UXSA 1Q9OB 1HXMA 3VFTB 3NN8B 3KHQA 2IAMA 3KG5A 3IU3B 1BOGB 2NCMA 3WTYA 4AI7A 2X4PB 4K3EH 1E40A 3TU6A 3SY0A 2QKIB 5AW2B 2EUVA 3IDYC 1ASOA 2Y7NA 1KCSH 3EGXB 3U9PH 2ICES 5DYOA 5JHLL 3BVNA 2NY7H 3KBPA 3MO1A 1KMGA 1T7WA 4IW4C 4WHTA 1BQRA 2J8OA 4OBRA 4CW1A 1KXTB 3CC5A 2X38A 1EZVY 2MHAB 3CDZA 1FVCA 4OZGF 1FFNB 1AVAA 1SHXA 2CIKB 5DD1L 3SZ6A 3KWUA 1CXIA 4YHZL 1A0QH 1VESA 4GKNB 1GCYA 3F7YB 2DYPB 1X6LA 2PYEB 3QO0A 5KSUA 3ESNA 2QELA 4MNHB 2CUAA 5LHDA 4R7NA 3I02A 3PL6D 5J11C 4N2CA 3II3A 5I8EB 4BQ6A 4AM0Q 1U8KA 1O7SA 4JJ5A 4B0MM 2COQA 1XGRB 1JCKA 3IEAA 1IFGA 2MPAL 3SKUD 3RNKA 3EFFA 3VWJA 5BMFH 1MVFA 1YNKH 1BFSA 1IAIH 3OKDA 3BPNB 4LARL 3O3EA 4L8SB 4NZUH 1UEMA 4BKLB 3DRTA 4PLKC 5CEXA 4LVNC 5KVGE 5DS8B 3BO8A 4GAJL 5EU4B 4PB0L 1DO6A 5DS2A 4Y2NA 4NQTA 5TE6L 1UVQA 1DQVA 5IT2H 3ZDXB 4OZ4B 2K78A 2A1WL 2AJSH 3ZQ9A 1BPVA 5BS0E 3CFIC 2P1YA 3VMPA 2F58L 3CZNA 3TWYA 5DUMH 2ZWZA 1QLRA 1U58A 1K4CA 3ZE1E 3IU4L 1QTSA 1VIWA 3IN2A 3ZMEA 5J7CC 1MREL 4RWHA 5SWZB 4Z7AA 3QPKA 4HX1A 4HUNB 2DH3A 2GVYA 3FSOA 5TQ2H 4PJXB 2PWGA 3FFDB 3H2PA 5FK9A 2MH4A 4XH2A 2RQEA 1JHLL 2J56A 2YMTA 2FJHA 3C60C 3L2LA 4N86A 4MMYA 4X6EB 4GS7B 5DK0B 2ZUYA 1OALA 3V79C 1KEGH 3M17A 3QJUB 4U6YB 4WJ5B 2YQGA 4N90E 4K7PL 4GBXB 4GI8A 1E67A 4N6RA 4PTUB 1OW0A 2EACA 1T5XA 3BAJA 3CHSA 3F6IA 1MFEH 4NQXB 1CI5A 3HJEA 4A68A 4YVUA 3O2WH 1JPSL 2M83A 5IY5B 3L4ZA 4XN9A 2O6FA 4QRTA 2MCAA 2PW2A 4WTWA 4Y1AE 3U1SL 2BINA 3I50L 3WUWB 3QIWC 1WFTA 3K46A 2R2BA 3TVMD 3B1TA 4IRSA 3FB7A 4FERA 1M56B 5C7XL 1BX2B 2R1WA 3HLAB 5IWLA 4ONGH 4U7MA 3RP1A 3SDXB 3Q01A 1G6RA 1G9ML 2F7IA 3Q1EA 2DPKA 4NPKA 2CLRB 4P4KB 1JZFA 1FAKT 3IDXL 1OGAE 3O0LA 3SKOA 1QFWI 4G9FB 5JW3H 1YNLL 3QRBA 4RDQF 3NSJA 3E1ZA 1JZIA 4PJ7E 4A7VA 4LHUG 1NC2B 4I85A 4MNGB 4IBWA 4IJ3B 1NLDH 4G6ML 5H2BB 4PRIB 4NZTH 4J27A 3FTWA 3VXRB 1FO0A 4RFEA 3PHQA 3QNXB 1Q72H 5F9WC 5HGBB 4DEPC 4HGMA 3VI4A 1OE3A 3F7PC 4O2EB 3UCQA 1OTSD 1T21B 4F7CB 5IFAH 4FLQA 2OMNA 1N6QH 3SE8H 4FQCL 3W9EA 3C60A 3IWUA 3CDGB 5GJSH 1GAFH 1L9MA 2GTWB 3C5ZB 5B7EA 1U8OB 4S1SL 5EEXA 3HHSB 1AG6A 2IPTH 3EJTA 3T2LA 1KLFA 1WD8A 4U6HB 5EUKB 1DLFL 3IFLH 3WS3A 4TVUA 1OSZA 5I8CB 4LHQB 2YKLH 1DJZA 2LR4A 4RMWA 2WKLA 2X4SB 4YJZL 5ERWA 3K3QA 3UEQA 1KFAL 3CVBA 2X70B 4K3HA 4KUZH 2X9YA 2YPLD 3GMLB 4P2OB 1AC0A 4F3FB 1IC5H 3B5HA 2F5AH 4FTDA 4WUKH 5JDSA 4JM4L 2ZE0A 3H4FA 3WN5A 3TV3L 2IH1A 4ZX4A 3Q8FA 1ROCA 4RRPG 4JZJA 3TPUA 2DLTA 3RUGF 4CBZA 5DJ6B 1DUYA 1KN4L 2OL3A 3F6LA 5TFSL 1N10A 12E8L 3C09B 3UTZA 4A7TA 1QFWM 4E9QA 3O41A 5D6CA 1Q1JH 1JYXA 2EJ1A 3BGMA 1X5GA 1MRCH 3APFA 3HPLA 4GUPA 4X80H 1GZHA 3K2IA 3QQDA 1PMYA 1NDGA 1VCAA 1RULH 2XBTA 3MUGA 4E5XB 2Z31D 2UX6A 5EN3A 2ICEC 3NZ8A 4Z95L 3CSGA 1G7HA 3MFFA 1H0DA 4GOSA 4FI7A 3W9DB 3TO2B 4LESA 4OD3H 4RISH 2ZG3A 3JZ7A 2DH2A 3JQOB 5DRNB 2MOVA 1IGCH 3BPOB 2HRHA 4OM1H 4N28A 2XPZA 4OZHF 3PHOB 5DEGB 5A40E 2NNAB 4FZ8L 1SYVA 3WIAA 4YSUA 5A16A 1P4BH 3G6JB 2DV6A 5I1GL 2VJ8A 2QSCL 1T03H 2YD6A 1U8JA 3QAZB 1H3VA 1WA2X 1YYLH 2XWRA 1YA5A 1ZRUA 1ET7A 2J1ZA 3RVUC 2HJKA 3KXFE 3NABL 4YXKH 5AAPA 1NCHA 5D5MA 4HPYH 5F1OB 5I8OH 1RV6X 1YECL 3PQYD 2N7BA 1B2WH 3W57A 3TA3A 3FPXA 2J6EA 2QSVA 3K0YA 3QNYA 5DRZB 5IB4B 4L18A 2J1WA 4KTYA 3V2AR 2JJTA 4G6AC 5ETUA 5F7YC 4D0BB 5FFLA 3I75B 4APXB 1QLFB 3VXMB 3RILA 3IKCB 3L5HA 1KELL 4PP2A 2AW2A 4H20L 5LBVA 4HK3J 2BC4B 4HUMB 4UM8B 3CZKA 1ZS8B 1EVUA 3APCA 4N8VG 5EOQH 1MELA 2J5LC 2YD0A 1KIUA 4GAGH 3PF2A 2QFRA 5CP3H 4BFIA 1HOEA 4LVHB 3B3IB 2R1YA 2WQRA 2ZP8A 5KJ7E 3MGTB 1NGXB 1UWEH 4QXWA 4R97C 1QBBA 1BECA 3QXAA 1RZ8B 3BVWA 2CM6A 2D4FA 2E76C 2IFGA 1TTBA 4FL4C 4NC1E 1IC7H 4E2OA 1DUZB 3RHWK 1WGOA 2Q8BL 3O0RL 4ODBD 1OSEA 2OR8A 2WNWA 3TO4A 3U6RA 2B39A 1FWXA 2VUYA 4NKDA 2R7EA 2BHYA 3QCVL 4XAWH 3ZL4L 3D39B 5EZIH 1CLOH 2WLJA 2NXYB 3WEOA 2WZ6A 5C8JB 3BD4A 1NGQH 4BUGA 3A67L 2ZUVA 1EFXA 3INUH 4IMKA 3FO0L 2P47B 3L54A 3OX8A 4Z18A 4LOEA 4J12A 4A55A 3I6SA 1GHFL 3V0IA 3O6FB 2F74B 3VX0A 4AQAB 1JXGA 1A6UL 3ETBF 1KCBA 3ZBMA 2VQ1A 2P5EA 4G42A 2IALA 4Z0XB 3AAZA 1ZHLA 4JKNA 3S5LA 3WEXA 5FFGA 3MRPB 3UYOD 3NAAH 5KW9L 2ICWB 3WNJA 5JHLH 3MODL 2MPVA 3U46B 5JMOC 2Q76A 3D33A 3G9AB 3DX4A 3NCJL 5C97A 1J8KA 3QUYD 5A6IA 5JW4Q 3BIBX 2KQNA 3JZYA 4JRYA 4M62L 5DC0A 2VLRD 4GAAA 3DVGA 5DD1H 3UROR 2YAHA 4YC2C 4YHZH 3FCBA 4I5BA 4Z9KB 1WV7T 4ENED 5IVXE 1M7IB 3GMMB 4JG1L 2FL5B 3BCDA 1JZ7A 3GI8H 3BUYB 1YN6A 2VL5A 3K71B 4JGNA 4UQEA 1VHPA 1F56A 3DSNA 1OANA 2BHZA 3GRGA 1AO7B 5E7FA 3KAAA 1HHGA 3MRQB 1C5DA 2MPAH 4N2EA 5FEBA 3NSXA 2DL9A 3PPSA 3U2SA 1WIPA 2H47C 3UBGA 3X14A 5IMLB 4LARH 1G7PA 4MB4A 3CVIL 4GAJH 4BFGA 4PB0H 4JPQA 3D09A 4UMGA 4AK2A 3WO3B 4NN5C 5J1SC 1P69B 1HEHC 1P84J 2F8VA 3QZWG 2P9RA 2A1WH 3GSUA 3MV9E 5JMRA 4D8PA 5E94B 2F58H 1U8IA 2DEWX 4KO5A 4QKXB 3MGOB 4XI5D 4F9LC 4HHAB 3JV4B 1WGVA 5T5NG 3QDJD 3IU4H 2OW7A 3TGXA 4X7SL 4Z3TA 2ORBL 1K2DB 3DMMC 3ZDZF 2CRIA 4PRHD 4ESKA 3VFMA 4EMZA 1NUNB 1S7SB 3UZEA 2A38A 5ENWB 3RX8A 3U7YL 1INEL 3V5HB 4O2FB 4LOFA 2J55A 1UD2A 3FO1B 1DDTA 1JHLH 3ZE1B 3RVTD 2E9GA 1WE5A 5CZXC 2BIQA 4GQ9L 3NPZB 4K7PH 2NTSP 1I3UA 2WOBA 3CK0L 4AQ8A 1J48A 3MNVA 2VZSA 2QPUA 5C0RL 4Q0XL 4ABUA 5FYKU 1JPSH 3ZU8A 2EICA 1MLBA 1XXFC 1TVDA 4MHHI 3AT0A 4EXPX 4OT1L 3U1SH 3I50H 2WQ8A 4D0DA 5CBAA 3TNMB 4OIAA 1MY5A 3SE3C 5F0MB 5C7XH 4ALAL 4HH8A 2J1KA 1FCCA 4FAAB 1I1FA 1FG9C 3UPRB 3GPEA 4ZOEA 3TBYB 1G9MH 2ATPB 4HBQA 1KTRL 1RJZA 1TU2B 3LPWA 2VN5A 3IDXH 2XXMB 2UY6B 1LE9A 1YNLH 4Y1AB 5BJTA 1SJMA 1DFBL 4KHTL 3F2LA 5L2JA 3GIVA 4G6MH 1B4RA 3KPPA 2VLMD 4MSWA 1QW9A 1OTTD 3LY6A 3MLSL 3QXDB 2BP5M 3OMNB 3VXTA 5I23A 3IVKA 1VPOL 2BMKB 2WYTA 3CVHL 2B4CL 4NSKA 1OGAB 4Y2DD 4ABVA 5DJDA 4FQCH 2CGYA 1I3VA 5CZRA 1VEOA 4PJ7B 1AQDB 2BSTB 4PVMA 1GSMA 2VTFA 4S1SH 5HYJD 5C6WH 4NKOB 3V0GA 3FYEB 1DLFH 4OD2B 3UTQA 5C0BE 2VAAA 4HH9B 4Y2OB 3KYNB 3ABGA 3T5WA 1KFAH 3V6OA 3MRRB 3O4LE 4EKJA 3UERA 1KT2A 1D5BA 3DURB 4ZQTA 2W0PA 3WHE1 4UZGA 4HEPA 1CYWA 1SUHA 1EZSA 2X28A 4JM4H 4KXZH 2PCFA 4Q74A 5LN4A 2EO7A 3TV3H 5BXFA 2W59A 3HVNA 3OXRA 3HKFA 2WQXA 3M45A 4NEHB 5IBUG 1GGUA 2QVTA 1AGDB 2WTRB 4I0PB 3V7AE 4W9EC 5HD8C 3ILPA 1KN4H 4G6FD 5TFSH 3MJ8B 12E8H 2DI8A 4NGHL 1B88A 3VD5A 1T20B 2QKIC 1KJMB 3LN5A 1WAPA 2SEBB 1NJ9B 1JDCA 1Z5LA 4CSTA 5I24A 1SZNA 4CU8A 1YEWA 4JHAL 4EOWL 1HAUA 2IG2L 4WI8A 4ZPVA 1CE6A 4ZW8A 4W6XB 4JGJA 1PDKA 4MMXA 4XTRC 4Z95H 4PGBB 3F01A 1D9KB 5CXPA 4RMUA 1ADQA 3N44F 4L1DA 3X3GL 2BW5A 4N2LA 1I85C 1ERNA 2LAGB 3E80A 1J8HE 4S1DC 4FZ8H 3TURA 2X2JA 4XPFH 4YHPB 5I1GH 2QSCH 2NYYC 2WP3O 5HYQA 3RY5A 2B0SL 1KUMA 3AY4A 5E70A 3K74B 1IAOA 2RQ8A 2XKUA 3K6DA 4HUWA 2OYKA 4QT5B 1C7TA 4NUPA 4PBWD 3W2DL 3NABH 4QJ5B 4H8WL 4KITB 3QVAA 3NN8A 2ZUTA 2ZQKA 4JPVL 1CFVL 1RZQA 3MV7A 3QSKB 1BOGA 1MCNA 2PCXA 1YECH 1ZE3C 2NY2D 5JPNB 2GFBB 2VERA 1L3WA 1OGPA 3C08L 4XVUC 1D2OA 4L29A 4PGZA 3VDAA 1JV5B 1F97A 3ZZLA 1YMMD 1QPXA 2FT6A 3LH2L 3SDAB 2EDXA 3GSXB 1KELH 4H20H 3BT2L 3KXFB 1WA0X 3L9EA 5DHMC 4FQJL 1KXTA 2Z93B 3LXBA 1A65A 2VJ0A 2CIKA 5J8OA 4GKNA 3B2UC 2PYEA 3C8HA 4Q14A 4GS7C 4ZOBA 1ZLSL 3S3BB 3BUQA 1MFBL 3L1GA 2F54D 3P9MB 1TCRA 2EQDA 2IGFL 3LDBB 1XGRA 3T6XA 2FQGA 4X42A 2Y1AA 1HL8A 2ROYA 4WAFA 2Q8BH 4H7VA 4ODWB 4N8PA 4TS6A 2XVBA 4KAQL 4L8SA 2Z91B 3IAPA 1BPLB 1WAAE 4XNUL 4HWBA 3U4EB 3CLWA 4HJUA 2RD0A 1HJCA 2F9BT 2YMOA 2FEDD 3RWDB 3QCVH 4AUJA 3ZL4H 2BIIA 5PAZA 4OZ4A 4YR6B 3FCGA 2B9BA 5DK3A 3D52A 3PV6B 3A67H 1TTCA 4P4KC 3GXTA 4GRWF 2EVIA 4F8NA 1E8ZA 3EBHA 3FO0H 1J5CA 5EEVA 1IC4L 1GHFH 5GHWL 2ERJB 1A6UH 2ZYIA 2AJUL 3WLWC 3HHRB 4U2YA 2CE6A 5KW9H 2OCFD 5IMKB 4I9WD 3MODH 4LCWD 1A6WL 3FFDA 3TBTB 5GRZA 1GIGL 3R0MA 4XPAL 3LXUX 3NCJH 3M1CA 4ZUSB 3BYYA 3MREA 3MACL 4IOFD 1CQYA 3C5ZC 5DK0A 2A9ML 1T2JA 2O5NA 3TBVA 4HIEB 3L5XL 4M62H 4WJ5A 3D18A 4GRLA 4P57A 1NEUA 4W9ZA 4GBXA 3WSQH 4PJBF 2BOLA 3Q8BA 4ONOA 3UP6A 2E6QA 2W9EL 4WDIB 3QG7L 3WKML 1U8HB 3BZEB 4JG1H 1HIML 2YSSB 4P2OC 2BOCA 5F0JB 1JS4A 4FTVD 3WUWA 2YBGA 4LLMA 1JGLL 1G43A 4ANXA 1FDLL 5I16B 2E5EA 4AXWB 1BX2A 4XN4A 3NSYA 3HBPA 2Z6FA 4FFYA 1KPRB 4PBVC 3CVIH 3E7JA 3FT3B 3SDXA 1CS6A 3BN9D 2D0GA 2J1YA 4FEMA 4PI2A 4P4KA 4ZOCA 5IVXB 2RALA 3CQPA 1XCTB 4NLAA 2D0HA 4GXUN 4KO9A 4BH7B 1HS6A 4K7PX 3C09C 4WJG3 4MNGA 4EXKA 3UMTA 4K9EL 4HAGA 4PRIA 1CF1A 1MZZA 4XP4L 4UDTB 1MFVA 4AGPA 2ZUXA 5T3XL 1NC4A 3ARFC 4UIKL 4X7SH 2ORBH 4P2QD 1BF5A 4O2EA 4BGDA 3WJLC 1NFDE 2WIIA 2HFTA 1ORQB 4JG9A 3GB7B 5BV7B 3S34L 2XKNB 2XV6B 2EDYA 3R4RA 4YE4L 4D7PA 3C5ZA 4GKZB 1U8OA 3U7YH 3HHSA 3MV9B 1FVEB 1INEH 2HX9A 3FKUS 3UTTE 1WT5A 4HBCL 1GRWA 3ZUNC 3R06B 2F19L 5E4IA 3U0PB 1CMOA 3BP4A 3K2MC 5CS7A 3WENA 3BPOC 3OVUB 2OMWB 4R96B 4GQ9H 1DYZA 2QMKA 3CK0H 3WNIA 3BOVA 1BZ7B 2X70A 2X40A 4OZIF 3CTTA 3GMLA 2Y1YA 3HE6D 1UC6A 2F53E 2VWEC 5LGJA 4F3FA 5C0RH 4Q0XH 4AH2A 2DL2A 3CAFA 5I76A 2ZXQA 4F7EA 4OT1H 1MCDA 1DVZA 1KTJA 2Q8AL 1YUHA 3L3OB 5MEQB 2MNUA 4LGRB 4ALAH 4PB9L 5DJ6A 1EEZA 1SXAA 5IOPA 3VM7A 4ADJA 4ZS7L 5E8PA 3AABA 5C0FB 1MHCB 4I18B 4L3CB 4LFHG 2VUKA 3ESPA 3QJVB 1UURA 2WSDA 2CK0L 3UADA 3UJIL 6PAZA 4QYOA 4KHTH 1DFBH 4FMVA 4Z7OE 1T5KA 5MERB 4CU7A 1ZK5A 3WJLA 1E5UI 3U83A 2APBA 5HHMD 2XN2A 2H9GB 5IB1A 1DSFL 1TFHA 4L9LA 3MLSH 3C5JB 5HDWA 3W9DA 3TO2A 1VPOH 4U7KA 1T0OA 2CO6A 3CVHH 5J13B 2FNBA 4LVHC 2B4CH 4CVUA 3G5VB 4UTAA 5CP7B 3CU7A 5IKCB 1XEUA 1YEIL 3WJJC 1FNEB 3FF8A 3PRZA 4PR5B 5DEGA 4FGMA 2MQGA 5HJDA 4LCCB 3G6JA 2DWXA 3GJFK 3D06A 3WFZA 5IEHA 1KPVB 1JNLL 2AF2A 1J88A 2AHIA 3BWSA 1JZJA 3DJSA 4HCGA 2IV8A 1CG9A 4LCYB 5F3FA 5ISZD 3C9NB 4X6CE 4MDRA 1Z5YD 5I1EL 1T6BX 1Z9SA 4W9LC 1E27B 1ONQB 2NXYC 2XFXB 4NQED 4OFYD 4IOIA 2J1XA 3MRCB 4IYKA 4QHNB 5C0BB 4YLBA 5KS9E 3T04D 5LUMA 1A6TB 3UJTH 3O6FC 3O4LB 3I75A 4APXA 4M7JL 4DERA 3VXMA 2CLZB 4GO6B 1F4YL 2ZUUA 4NGHH 3B7YA 5F9OL 3VGGA 3MRBB 4UM8A 8FABB 4P3DB 2A5UA 2EIJB 3STBA 3MYZA 5DTFB 5FW6A 4JHAH 3GSWA 1ANUA 3W56A 4EOWH 2IG2H 5FO9B 2YUZA 4J3SA 5ID0B 3DXAB 2WMPB 3CZFA 5E51A 1XD1A 3X11A 1NGXA 3ABZA 3V4PL 1QVOA 3RNQB 4OF0A 1S7QB 4CKVX 1N0XL 2IQ9L 2E8ZA 3GBNL 1EO8L 3O3BB 1Y07A 4WI5A 3X3GH 5I71B 1DUZA 3BLPX 1A3ZA 2GJ6E 3AG1B 4JHWL 4PRDB 1OGTA 4GAFB 1GS8A 2PPAA 4BWWA 1P6WA 3PIQB 3ILQD 4Q58C 3KE0A 2B0SH 2YA2A 4PJCE 3QGVA 5D7EA 2QJDA 3D39A 3EG9A 3DLQR 3CX5K 1OE1A 3W39A 3W2DH 4J28A 1A21A 1JGVL 1I9JL 3QE5A 2AAVA 1NPNA 1X4ZA 4H8WH 4BFFA 4KJWD 3MVSA 3O9WB 4ZUWB 2D7MA 1IL1A 4JPVH 1CFVH 2VDRB 3O6FA 4XNMB 3ULAB 4AQAA 1AQ8A 1HT6A 2E9BA 5HDRA 4R5VA 3EFDL 3T2QA 3C08H 4JM2F 3KVQA 5B7MA 2VR9A 3R7QA 1CI3M 3LH2H 4ATWA 4E9LA 3U46A 5G4NA 2QQQA 5EN2A 1UD5A 3OJVC 3BT2H 4X4XA 2EE9A 3S96B 4H0HB 1NANH 2VQUA 4FQJH 2R2EB 1UKTA 4M9PA 1KTKE 4OLUL 5EZJB 3KPSD 4XC1L 1S3KL 4E5XG 4IU2A 3AWFA 3ZY7A 5T5FL 5E6RB 4J3OG 3K4DA 3DHJA 3IJEB 1ZLSH 3KYMA 2DOCA 2ZOTA 3EF7A 4HDIB 2YD5A 1MFBH 4TLSA 3RBGA 5FC9A 3TWCL 1M7IA 3GMMA 5F7FA 2FL5A 4Y9FA 3DYPA 3K71A 4LBEB 4M61B 4Z7UE 1GGCL 2IGFH 4AITA 5TGBB 2XBZA 1MCPL 4RX4D 3QPQD 4Z7NF 1F4XL 4ZYKA 3MN8A 1B0WA 5DVKA 5B1AB 4BH8A 5IMLA 5I5IA 5HI4C 2VDMB 4KAQH 4PWHA 3QDMA 4BE6A 4AW4A 4XNUH 2IBZX 2R4SL 5FGRA 1TUPA 3U79A 4DUVA 4P2CG 5FB8B 1NGWB 3WNPA 5HJGA 4PWGA 3STLA 2VL4A 2IBZY 1TITA 3EZJB 3U9WA 1FG2B 2Z0UA 2EDJA 1WQVT 3EDKA 5E94A 3N5AA 4AW7A 1XF4A 2X7LB 1Z66A 4HHAA 2Z7UA 2BXYA 4HAFA 1OEZW 1IC4H 1R5IA 4D9LL 4ELKB 5GHWH 3QWOB 4OV6F 1D6EB 3EFOB 4ZZKA 2Q10A 1M1XB 2AJUH 5F8QC 2NUTB 3SBWA 1T2QL 4R7VA 1RPUA 4MNQE 4WNQB 3ISWA 1E2VA 2C4FU 1A6WH 2JCCF 3KGTA 4FHBD 4G43B 1GIGH 1E6OL 4XPAH 5BS0A 5IF0B 1T22B 4MS6A 1MCEA 3FO1A 3NJGA 1PTZA 1BG9A 1H3PL 1T5WA 3L3JB 5JHDE 2OSYA 3MACH 5AOLA 2A9MH 1FL5B 4POUB 3L5XH 1J87A 4HG4K 1P4LB 5D7JC 4PW3A 4L4TE 3P3TA 5BVPL 4IBLT 2W9EH 3QG7H 1E28A 3H9YA 3WKMH 5EA0L 1P7KB 1HIMH 2FWLB 3IGAA 1QWNA 4ZUTA 1CZ8L 5GGSY 5E1QA 1JGLH 4UT6A 2FWUA 2BVYA 4OM0H 1IUZA 1FDLH 4JMNA 3CQFA 3LRKA 3O3AA 3QC6X 1V3MA 3IJYA 1X5AA 1YG9A 4GSDL 4RZKA 3JWOC 4RESB 1YMHA 3I9PA 2ATPA 2OMBA 4W9FC 1HYRC 2DIAA 2JF1A 4P2YA 4AGLA 4C4BA 3M6DA 4I0PC 2UY6A 2A4CA 5LBGA 4IJTA 5DMIL 2KZ1B 4R7XA 4Y1AA 4TN9A 1K4DB 4K9EH 1FRGL 1N0LB 3FRPG 1KJ2B 4KMLB 4WQOA 3MZTA 4XP4H 3CBJB 2ZX6A 5T3XH 4UIKH 3MSPA 2PTTA 4C58B 3UZQA 4Q2ZA 1CXLA 1GOGA 5AW3B 3RGHA 3S34H 3W81A 4EN3D 5HHQA 1L9SA 4PV8A 3NIDF 1HNYA 3UBXG 4YE4H 1N59B 4XMLL 4NP4L 5JPMA 1DANU 1U2YA 1AQDA 2BSTA 1D9KC 3CUPB 4TVPE 4ZK8A 2EADA 2CPUA 4NKOA 3AXIA 2QGCA 4HBCH 1DVFD 3A6OA 2F19H 4L0PB 1IFHL 2VDQL 4OD2A 2RIKA 5F70A 1WCBB 1K5NB 2VYRE 4Y2OA 4JLRB 4N22A 3ECBA 3WFHA 1NFDB 2VN6A 4NX0A 2F8IA 4TSBL 3MRRA 1BSIA 3K6IA 1J10A 4L1SA 3KBHE 1XGPA 3T2PA 4DNLA 5MENE 1JGIA 3B8SA 1MVYA 4QUOA 3L8QA 2AEQL 1X7QB 1OKEA 1OF0A 3WIHL 5L2KD 3S6CA 3QFJE 1NMBL 3UTTB 3WTXA 3FYIB 5IB5B 4NNYB 2Q8AH 4F8OA 2HP4A 4X4ZA 3ZOAA 4FQQA 3NDZE 5DMKB 2WTRA 1TZHB 4AUYA 4I1PA 4JK0D 4PB9H 3QUZB 5JPNC 1YPZE 2F53B 3T0DA 1A9VA 4ZS7H 3V4VB 1EJFA 2AERT 2HKFL 1T20A 4Z0BL 1KJMA 3FFCE 1S7RB 4FS0A 1NJ9A 1AP2A 2CK0H 3SDAC 3HTLX 3UJIH 2GUOB 3EDDA 4AE1A 3DTXB 4X7TB 5A6MA 3JTBA 2A83B 3D8MA 4NT6B 3SDCB 2EXWD 4RRPM 4WO4B 5DC4B 1F1AA 1DSFH 2IWFA 3CHQA 3RWCA 3GSVB 4NQCE 3D34A 1M2VB 4B7LA 3HR5B 1NUFA 1YN7A 2CO7B 3M1BB 4RMRA 1YEIH 3N1QC 4NO0B 4Z7OB 2PO6B 3ATBA 4KOBA 5BZDB 5J6GA 4ZMTA 3OJDA 2IDCA 3Q3GA 1IBBA 3LDBC 1MCFA 4MZ3A 5FUCE 1FA4A 1PLCA 1JNLH 1UCTA 2EC8A 4BSWB 2A3TA 1PD6A 1BYPA 1CT8B 1HK6A 2AP2A 1ZGLP 4QT5A 5I1EH 5KG9B 4PJ9A 3N1FC 5C0AD 4HOZA 5LNGA 1BYOA 3CFMA 4HGWB 5LNDA 1KXVC 4WFFE 4NC1C 4XMXA 1I8MA 3L6FB 5JPNA 4R84A 2V2XB 1P6AB 1EV2E 4GAYA 5DJ2B 4AGMA 1L7IL 4FDWA 4MJID 2BZCA 1AD9B 1IZJA 4PG2A 4M7JH 2FO8A 5AWNL 4ZFZB 3ARDB 4EAEA 1F4YH 3GSXA 3WCYA 5F9OH 1IMHC 4FLSA 3HZMB 4Y16A 1QFHA 3RL2B 2D0FA 1SN5A 1VKXA 4GP5B 3PGDB 3GBLA 2Z1PA 4F7PA 1KTLA 4N4YB 1ZJBA 5IBLD 1F2XK 5KS9B 4YFLI 5JIHA 1X7SA 1H3XA 3V4PH 5CJBA 2EH8H 3T3MF 5DHDA 4ONFL 1N0XH 2IQ9H 3ULVF 2WXKA 4JR9L 4OLEA 3GBNH 1EO8H 1BQUA 2MNJB 4OCRL 4ODWA 3HG3A 3QXVA 5AVWB 4FP8L 4JHWH 2QEJA 3VI4F 3SYQA 2Z91A 4FNUA 4JFPB 2XWCA 5GGUB 4YSDA 3N50A 3L3IB 5CEYA 1AIZA 3BH9A 1WFNA 4DP6X 3RWDA 3WMQA 1S9WA 1KXVA 2XY1A 2H6PB 5E24E 3WHE0 5HGDB 1OF2B 4XR8C 1JGVH 1I9JH 2IPKB 3VDCA 1FZKB 3ZHDA 3IM1A 1LQSR 1DHKA 1AY1L 1MEXL 2GJ6B 2JKNA 5IV2B 1NCWL 2PETA 4MJ2A 1R3IL 2W80C 3EFDH 2TSAA 1E8YA 4JY4A 3OB0K 4PJCB 3GBML 1AKPA 4YGVB 1KG0B 1BZQK 2K70A 1NIFA 3FW6A 3TBTA 5BV7C 2J8UE 4ZUSA 1NA8A 1I1AA 2Y36L 5CKGA 4OLUH 1XF2A 4HIEA 4YFLF 4XC1H 3KJ6L 1S3KH 3S3JA 4AQEB 4UNVA 1FFOB 4GXVL 4LDEB 5T5FH 3F04A 2WANA 3NIGE 4WDIA 4JAMB 2FR4B 3TWCH 1WFIA 5DURD 3TN0D 2YSSA 1GGCH 4GFTB 4MZIA 3TT1L 4J1UB 1MCPH 3FQUB 2IADB 2A6DB 1P5UB 2OZNA 4IU3A 4JQIL 1F4XH 2D3NA 2W60B 4PRPE 4TUJB 3SJVE 5I16A 4AXWA 4NIYE 2UXTA 2CCWA 4KKNA 3FT3A 1IU1A 4W6WB 5T33L 3B9EA 2R4SH 5CIPB 5AW4B 1TMQA 4J8RA 4LNRB 5T1JA 2F6AA 4MD4B 3MYJB 3S36L 3QUMA 1KB3A 1XCTA 5IG7B 5SX4H 3ZKXB 5CJ5A 4GO8A 4Z7UB 4BH7A 5K9KB 2VLJB 2XOTA 1JF1B 1I3GL 1ZVSA 2FIRT 3GSOB 3GSNA 2MSPA 1RVFL 4V2BA 2E7MA 1JHTB 2GBUA 4I18C 1U2HA 3KNBB 4HU8A 2I69A 1REIA 5K9QI 2QMJA 4HFUL 4YHNA 1CICA 1SQ2N 2V6HA 4D9LH 1X4XA 1O9ZA 1HHHA 4R2GD 3T4YB 3KLDA 4JFTA 4F8QA 3DBXA 4N68A 4DPCX 3MRNB 2Y3NA 2X6AA 4Z6AT 2QPDB 4MXQC 3C8KA 1T2QH 3KPOB 4JPIB 3FT4A 5J3HC 3KPRA 4GKZA 3ZVVA 4AUUA 5C0IB 1E6OH 4JRXA 2XQYG 3PWVB 3U0PA 1KGXA 2IAND 1ED3A 4H8QA 4ZD3L 4LLWA 4L3EA 3DX7B 4GPVA 4UM9B 4EEEA 1HZLA 3NCYS 5BVPH 1BZ7A 3ATDA 3LXAA 1T66C 3DOSB 2WQWA 5I30L 3DRQB 4G7VL 4LCCC 4YL4A 2GT9B 3TA4D 1WEJL 1J9QA 4MNQB 5EA0H 4NUQA 5MI0B 1XGQB 2J8HA 2VUOA 1UB5B 4PAZA 4S11A 1CZ8H 2XSKA 1O9WA 4XN7A 5JHDB 2Y6TE 4WK4B 2BLFA 1K6QL 1Z32X 1I7RB 3L3OA 3LMJL 4K15A 1XR8B 5GGQL 2OXGA 3Q0HA 4L4TB 1ZHBB 4GSDH 2Z34A 3KVPA 3KHOA 4RBPK 2APVA 2P5WD 5FGBC 3IRZA 1PX3A 4FXKB 1MHCA 4A2HA 2NR6A 3E8VA 4I18A 5CLYA 4NZDA 5DMIH 1F6AA 3NACL 2FLBT 2TRHA 1PCSA 1FRGH 2E75C 5IB2B 3AT9A 4FQHA 1BWMA 4QRFA 2H9GA 4CNIA 4DSYA 2XWJB 4XX5A 3D85D 4GG6E 5CEXB 1L9OA 1A9BB 5B1JC 4F8TA 3UPAA 1VA9A 4UQ3B 1OT4A 4XMLH 4NP4H 4RZCB 3RVWC 3D12B 2ADJB 3O3DA 2M26A 2VISB 3IETB 4DEUA 2MFNA 1IFHH 2VDQH 2WN3A 2YC1B 3VYNA 5I71C 3QIBA 1WBXB 4LCCA 1N5AA 1UH3A 2CUHA 3G04B 4LE8A 3V9CA 3EGDB 3HG1D 1XSOA 3FJTA 3JV5A 4OFIA 4TSBH 4ADIA 4LCYA 4KPHL 3SGKA 2AEQH 3PWPE 5CFAA 3WIHH 1MQKL 1CCZA 2NY1B 1JZ3A 1B4TA 4AVHA 3QHFL 5DEFB 5FHBL 5GGRY 2C4FT 1NMBH 2Z4QB 3RLSA 1QP1A 2WSKA 3MRCA 2ITFA 4PD4K 1U0QA 5C0BA 1Y6KR 1W9XA 2BSRB 2QR0A 3D5OF 1NBCA 3EO1A 1HSBB 3O9WC 1N6VA 3POCA 5CBEB 2GEEA 3K7UA 3VFUB 3O4LA 4KK5C 3NESA 3LZNA 5MENB 1HL5A 2CLZA 5FO8B 4AQZA 2FECI 2W81C 2X2HA 1MIML 3NRPA 2HKFH 1IM9A 5DO2C 4Z0BH 2WZAA 3T77B 4JFVA 2V2WB 2DWDB 3MRBA 1U91B 1XGYL 3FRUA 4P3DA 1FYHB 3AQXA 4F7MB 2H3NA 4QHMB 4ZQKB 5HPOA 3IGFA 4K5LA 3TJEL 1U3JA 5I82A 3TM6A 1XGTB 5CD5C 1KCVL 1YY8A 1YPZB 3IFOB 3RNQA 1I8IB 5D6DC 1GSKA 4PJ8B 3ZGIA 1JWMB 1UADC 5KVDL 1JAEA 4X8JB 1E5AA 4L1LA 3MR9B 4XNXL 1SXSA 2CIIB 3B37A 3Q44A 3OG4B 2Q6WA 4PRDA 8PAZA 5HGHB 5F88B 5ACMA 4NYLB 5C9JB 5D7KE 3PWJA 2IDSA 4M1DL 4Z7VF 5L8LB 1S9YB 1GYWA 3MRJB 4FA7B 3AQYA 3CDYA 2OFQA 3CGTA 1GS7A 2GJPA 1WP6A 4NQCB 2DJ4A 4BFJA 4M4RA 4OZFB 3B83A 3C6LD 2HLFC 2HUHA 1FC2D 1J8HA 5JOEA 1DANT 3KGSA 5KOVC 4QNPE 3IXAA 2KI6A 4P2AA 1NOLA 4XNYL 4TPRL 3QZPA 4JS7A 1DN0B 1IGYA 1L7IH 2H5UA 3HBZA 4XCEA 3MV8D 1HH6B 5EOCL 4Y4FD 4M1CD 1E3ZA 5AWNH 1BDYA 4U6XA 1TQTA 3QORB 4MD5B 5AUMA 4OZHE 3ZKQD 2JE8A 1OCRB 5EZJA 3B1UA 4M00A 4U3SB 1URZA 3RY6C 1NCIA 2AJVL 1Z9LA 3U0WL 4TQHA 2HMIC 2A6JB 4GJTB 1RZPA 3GMRA 1PAMA 4WCYL 4AT6A 2OSLB 3DJ9A 5AZUA 4ONFH 3QPXL 4LBEA 3CDCA 4FQXD 3HMXA 5CZVL 4JR9H 1TYJA 4JHUA 2HFEB 3H3PL 3BWUF 4PG9B 4OCRH 1M71A 3BE1L 3E9UA 2CA4A 3CVCA 4FP8H 4QTIL 1EHXA 4NI6A 4WFED 5C07E 4XAKD 1PY9A 2F1EA 2HN7A 2WIMA 3HHMA 5B1BB 3ZE2F 1BJMA 4OCLC 2DICA 1YEEL 2J44A 3TYFB 1NGWA 2GUYA 1SLXA 5DSCB 3ELAT 2E7HA 1GOFA 2BIHA 4HFWA 1UCBL 4LASL 1FG2A 4V11A 3TIDA 4ILDA 3S4SA 1TG8A 1VF5C 4C56B 1AY1H 1QSEE 4P5SA 3OKKB 3KPLB 5FAAA 3VFRB 3EFOA 1NCWH 1WAAA 1MWAA 2E56A 3LKOB 1R3IH 3HS0A 4W81A 1XGZA 1H9DA 2NUTA 5MEOB 2DIEA 5IQLA 2G5BA 4XT1C 4IBSA 2ZOOA 2ZKMX 3GBMH 4PVLA 4ATTA 2O72A 4I89A 2GJRA 1MI5D 1XTLA 3VQ2C 4G43A 3GZPA 4XO3A 5IF0A 3QFGA 5EDXA 1LJMA 5EU6B 2Y36H 3L3JA 5D7IE 3Q6FA 2YAEA 1FL5A 4IGBD 2UUDK 3DYMA 1CGUA 3KJ6H 5I1DB 1LM8V 1YEHL 1HHJB 4GXVH 5K9JL 4MA3A 3CIAA 1QG3A 3NCFB 5F21B 7TAAA 3FQ1A 4XHQA 4N0UA 4WV1A 1UOLA 3H7BB 3HOGA 1P7KA 3W0WD 1HYSD 3FTUA 3AW5A 4K8RC 3TT1H 1OXYA 2J8UB 4PTTA 1XIWA 3WMPA 5DJAB 3GKZA 4JQIH 3KYKL 4NHUA 3B9AA 2ODHA 1ODAA 3RKDC 4E42A 1YEJL 2FSDA 1CLCA 3VFOB 5EOCJ 3NIGB 5CSZB 5T33H 4GSRA 4Q9RL 4PMEA 3L5WB 1KDJA 3OKEB 2WZ5A 4N85A 1BBJA 4FYRA 3S36H 1OARL 2IH9A 1ETZB 3QUZC 2X9ZA 1MCKA 3ORJA 2Z64C 2Z35B 1I3GH 5F1NA 5HYEA 2ZG1A 1ZAGA 4FG2A 1RVFH 1E2ZA 5CWSB 2IDFA 1KJ2A 4PRPB 4OD1L 3FOLB 2R4RL 4BSJA 1AS7A 1INDL 3BIKB 5M94B 5E9DD 3FUHA 3RFRA 3K80A 3REVA 3SDCC 4WO4C 4WUUE 4G83A 1CLZL 1FZJB 1N67A 3QXTA 1ZIBA 4B5ZA 1N59A 5GS2D 2XPYA 5DFVD 3CPUA 1NCNA 2DBJA 3OKMA 3LNHA 2HX7A 1UYWL 2VDQB 4LEEA 4QHKJ 4UOQA 1AXSB 4RWYL 5JQHC 1RKRA 4XOEA 1IZKA 1WCBA 1K5NA 4ZD3H 4Y88A 4LLQA 5ABAA 1HN1A 3RB5A 4DESA 5D1XD 1NFDA 3CFBB 4GY4A 3SDDD 1P5VB 1L6XA 5AZ2L 5I30H 4G7VH 3O81A 1IBZA 1WEJH 4ES8A 2EO9A 3EH2A 1BVLB 1RUQL 1X5HA 35C8L 1EEYB 3EJPA 3BRGC 2ZWLT 3RDTD 5KBPA 4UWQB 5IB5A 1J1OL 1K6QH 1QSFA 3BQVA 4KUCF 4H44C 3LMJH 5DMKA 4OKDA 5GGQH 3T1FA 4DKTA 3UAJC 1H6EA 3QUZA 3DUSB 1GVIA 5IGXL 4GKLA 2F53A 1DBJL 4N5ED 3IPFA 3U4KA 1TYRA 1QRNA 4P46B 3H9SA 4U1MA 4AVKA 4NHCL 1LDSA 5HHNA 2R8SL 3NACH 2NY4D 4JFUA 3ARDC 2GUOA 1X9UA 1SPDA 1ZT4B 3EZ8A 3QHTC 4X7TA 1CFNB 5BQ7B 3P73B 4NT6A 4BHUI 1FZMB 4NP9A 1MCIA 5J0BA 5HGAA 4JFFA 4WSJA 1DQML 3ZDXF 3QS3A 3GSVA 3T8VA 3DHPA 3HG2A 5D1QD 5DFAA 5EO0B 2AK4D 3HR5A 2NY6D 3QQ3A 3ARGA 4UV7L 3M1BA 5FFOA 1B90A 3PXJA 1GS6X 1U8QB 1FIGL 2PO6A 4X9HA 3PAUA 5BZDA 1LD9B 5C1MB 5EBWB 5I15L 1MHHB 3FAWA 3PABB 2BNRD 3UTPE 2XTSA 1WBZB 2X87A 1OB1B 2ZJSH 3VMOA 5J12B 1GJIA 4FQ2L 3HB3B 5LGHH 3TCTA 2E46A 4BSWA 4ZXBA 3KLLA 2W9LA 1CT8A 2O61A 4KPHH 1KY6A 2WXLA 5D9SB 5C3TA 4NO5B 4RAVB 2OSXA 4K5PA 3GTNA 1MQKH 3NZSA 3ZSSA 1YCSA 2XWZA 3MTRA 5D7LA 4PMFA 5JZ7C 3CFJB 2A6IB 2G0LA 1X9LA 3QHFH 5FHBH 4DK5A 4AQ1B 3H6AA 1U30A 4RMSA 3BAEL 3BGAA 2V9TA 1N64L 3T0EE 4JB9L 4E0RB 4XBPB 4LPYA 3QDGE 4X6CA 3WN6A 2DBLL 2QDWA 1FAIL 3PWPB 1MIMH 2R9HD 5ESVA 3PDOA 1SQMA 2R0KL 3BKCL 3SPJA 1XGYH 1VGEL 1OWWA 3RL2A 3US1A 4AGOA 3B6SA 3PGDA 1R17A 3T08A 1KFGA 3DIFB 3SCMA 2C1OA 4W93A 1XEDA 4Y4HA 3SDXF 5KS9A 2PYFB 3TJEH 3BRDA 4NKMB 3TZVA 2OMYB 1KCVH 2G60L 3IDMB 5KVDH 2EEBA 3G3LA 3M7FB 1T1YB 2AAAA 4XNXH 4WGKA 5M95B 3PFQA 3MNZB 1EFQA 5TDPB 4W9HC 4HAKA 2VLKE 1RD6A 4C54A 4FLHA 4DQOL 2DQTL 3VXUD 4JFPA 2BHFA 5D70L 1TJHL 2AEPL 2CO2A 1P5UC 1QQDA 3L3IA 4M1DH 3IJ9A 1HWWA 1H15A 5D71L 4KQ4L 3DTUB 3QT2A 4MDIA 5LGHL 1DBBL 4QY8B 1J5IA 1O9VA 2K3TA 3EKCA 3ML9A 2EH7L 3RL1A 2C9XA 3VD1A 1S7VB 5HGDA 1QASA 2HUEA 1CYXA 2C9RA 3B9DA 3D4CA 1P53A 3VAEA 3WTUA 1DVQA 3ZKXC 3QYMA 2CGRL 4PCYA 4K9EC 5LO7A 1A66A 3D4GA 1S78D 3QEGL 3S88L 4JFSA 1YQ2A 1QBLL 2CPCA 4XNYH 4TPRH 1BQSA 5L4IA 1JGEA 3DHUA 4PJCA 1T89C 5EOCH 5C09D 3TONA 3FOMB 3H85A 1MW1A 3RZCD 5B38B 2ZP0T 1EZLA 1Z0MA 2EE0A 3ZT7A 2TRYA 1KN2L 4AQEA 4QRPA 1L9RA 1FFOA 2I9LB 4TUOB 5E23A 4OH2A 2AJVH 3U0WH 1JWSA 3QZLA 3MXWL 4MAYD 5SWSA 4GP4B 3FUEA 1RH8A 4KWUA 3B9KB 3QPXH 4APQD 3JUYA 5CZVH 4YHLL 4NC2B 1ITCA 1RIVL 4OZHB 3H3PH 1P5UA 3NIFF 2EXTA 5MI0C 2ZT9C 3BE1H 3NPSB 2BDNL 4O02L 4QTIH 4FG6D 3A22A 3A6BL 3LRHA 5GS2H 4PV9A 5CIPA 2YQBA 2DLFL 1CGTA 3OZLA 1DBML 1YEEH 1T0NB 3WS6C 1UEYA 3FB5B 5K9KA 1JF1A 4DO6A 3D07A 1UCBH 3GSOA 4ZX6A 1JXDA 2VLME 4FXKC 3WY1A 1A1OB 1JHTA 2JFCA 1EEQA 1DJWA 1ZXKA 3L13A 3RJQB 1ZA6B 3G6JF 3ARBA 3U6XA 4OCSL 5IW6A 1T89A 4C59B 5C07B 4JFED 4UYPA 3BZ4B 3NJXA 4QMEA 2JV6A 3MRNA 4J4PD 1GOHA 4YH6A 1P1VA 3FUJA 3LIZA 5T1KB 4UDUB 4H88L 4KOCA 4ZUVB 3AREB 4OJDH 4NZRL 3QJSB 5C0IA 3PWVA 3TJHD 2ROXA 1JZ5A 3OB0H 3VFSA 3NP4A 1QSEB 2Z8WC 2P5PA 1NCAL 1VZGA 3Q9QA 4HHWA 3S36X 4DZ8B 3PNWB 3DX7A 4UTBA 1YEHH 3TFKC 4U1JB 5K9JH 1G1OA 2MTAA 2LLGA 1U3HD 3DOSA 3LZPA 1BXAA 3DRQA 3U82B 3VX1A 4XPBL 1ZPUA 3U9UB 2JKJA 4HOXA 2AGJL 2OMVA 2ICWI 3HKZA 1X5MA 4GRWE 4BFOA 3PV7A 2PWDA 3JTSB 3J8F7 4ZMQA 2XNAB 5JHDA 4PLOB 3D3VD 5D7IB 2WQSA 4JFHD 1HH9A 2OMZB 1UUSA 2NY1C 3CU1A 5BOPA 2PABA 5KTEL 3KYKH 1XR8A 4PJGE 3F00A 2DWSA 4CMMB 1YEJH 4H25B 4L4TA 4N1EA 1ZHBA 3WS6A 1JG9A 4XE5B 5I6LA 8CGTA 2G3NA 3VFNB 3GXFA 1UJ3B 1WO2A 4R0LC 3WKNA 1VZIA 1QRKA 3NP3A 1OARH 3O2VL 5CJXC 5T1MB 2ZWSA 4FI8A 2EYSB 3ZPDA 3P0YL 1BXXA 1PCXA 1IAIM 1B9ZA 1FE8L 1UD8A 1GTNA 3KWWB 4OD1H 3T0AA 2R4RH 5KSAB 1AAJA 3H42L 1INDH 2WNGA 1D5XA 4IRJB 4G9DB 4M3JA 1SEQL 4I0KA 2NW2B 4OJFL 2RFXB 1A1MB 4JY5L 4ZX3A 1CLZH 1CU4L 1QBAA 3KDPB 4UQ3A 3OXSB 3V0EA 3GINA 3F8UB 5D93B 3VGBA 4KGJA 1VDGA 4PJ8C 4RZCA 5J1AB 2CDFB 1UYWH 4RWYH 2VISA 3AM8C 1U8NB 4Z3HA 2YOAA 1WBXA 2YN3A 3G04A 3LEXA 2H26B 2Q2LA 4U49A 5FCUL 4ZTOL 5INCB 4RDBA 4UOW1 3MJ7A 3RVVC 1U8MB 1Z9MA 5AZ2H 4WUUB 3FO2A 5AVSB 4XN1A 5IJCC 3D2UB 3UMNA 3ULUF 4MLSA 2IMMA 1SUJA 1K8IA 1PAZA 1RUQH 4TLTA 5DEFA 2Z4QA 1AZNA 1DEEA 35C8H 4BE5A 3CZJA 2WVSA 2WWKT 4ZPTA 1K5WA 4FFVC 5LBSL 1J1OH 4LIQE 3DHMA 2BSRA 4KK9C 4A37A 2DQFA 4YGAB 1CWVA 3VFUA 3UL4A 1MY7A 4R90L 2WTPA 5IGXH 5FO8A 4AIEA 1DBJH 1ZV5A 3FB8A 1JNHA 4IKJA 3UTOA 2R2HA 5FUCC 2R15A 4S1RL 5EORL 3QFJA 1P6FA 2K4AA 2ED7A 2FGZA 5FW7A 1CXFA 2R8SH 1A4AA 3C8DA 5D4IA 4F7MA 4RBPH 4I2XB 4B9ZA 2IFFL 4YS4A 3QORC 1NIBA 2VT0A 3BD5A 2FEEI 1P1ZB 1I8AA 3VE0B 4PS3A 1JXFA 3VB9A 1XGTA 4HCRA 1UT9A 3V0VB 2C3WA 3IFOA 5H4ZA 1I8IA 2BW4A 4PJ8A 4LKXB 1JWMA 3TS8A 1I75A 1S7TB 4Y9GA 4HUUA 1A7PL 3AM8A 3FFCA 3L5JA 3LRSB 3FTVA 3MR9A 4LPUA 4UV7H 5CLTA 1T4KA 1AANA 2WSPA 2XZZA 4KDVA 2UXVA 5DHYB 2LAAA 3KH4A 4KQ3L 4ZUUB 1FIGH 3ECVA 5KJ4A 1IM3B 4WZ9A 5F88A 2EVGA 5C9JA 3SQBA 5I15H 1NOAA 1N8ZA 3ZQXA 1CFSB 2YD2A 1UJTA 3MRJA 4FQ2H 5FM4A 3NCEB 3HLKA 2W65B 3INOA 3MRDA 4TL5A 1M6UA 2CDGB 4NQCA 3HN8A 2G30A 1W8OA 2YGPA 2AXFB 5ACLA 4OUOA 3VDBA 1EDQA 1G5GA 3GS0A 4JM2D 4AMKL 4A04A 1B0IA 3CLEL 1KGJA 1NFIA 3BAEH 5F7WC 5CSGA 3RDJA 1N64H 4RNRB 4JB9H 3WI9A 3GEFA 3H9HB 4CVZB 2EUXA 1A8ZA 3U4AA 2LW3A 2UY7A 3HC2A 4I9WE 5EG6C 1HH6A 3FO9B 5A7EA 1U93B 4AIXA 3HNTL 2W1NA 2DBLH 1FAIH 3MJ9A 3O11A 4QWWC 4MD5A 2R0KH 3DNKA 3BKCH 3PJSB 1HNFA 4OTXL 5F89B 1VGEH 2AJZA 2DLHA 4L1TA 5AAWC 4EI5B 1NGZA 2VDNL 2PKDA 3QI9D 3T0EB 5T1DL 4W6YB 3A23A 3STZB 5M7QA 2VMDA 1S5IL 4E36A 5B7FA 3QDGB 2A6JA 4FNSA 2G60H 1MIEL 1J86A 2OSLA 1M1SA 4ZFFB 4FTVE 3S8GB 3LKPB 1O0VA 4L5FL 3AGVA 4AENB 5D4QA 4LKCB 4ANKA 3GC3A 2OK0L 4DQOH 2DQTH 1GXEA 1YO4A 1TJHH 2AEPH 2FEJA 4TNWK 5D70H 3CFUA 4HS3A 1ZLDA 4HKJB 4KQ4H 5D71H 5IIEB 3ZMNA 1QUNB 2Z9TA 3EUUA 1AG0A 1DBBH 1TT6A 1ZV9A 5DRWB 2EH7H 3CNKA 3DO3A 5I18L 2JKSA 3QP3A 1UB6B 1ESOA 1TNNA 2CGRH 2VLKB 3JWNE 4ZMLA 3EOBB 3A47A 1FFRA 3ALPA 1BAWA 3QRGL 4WFHD 3U7AA 3VFRA 3VRJA 3QEGH 3S88H 4H8PA 3KZ8A 3LKOA 2BS9A 2JKRM 1PL3A 4N20A 3FUMA 2K0RA 5MEOA 5T1LB 1SVCP 5AW8B 5C6PB 3GO1L 4LEXL 4XCFL 1JTOA 3HAEH 4KNUA 2J4WH 5BOZG 1PSKL 4AJWA 5C0ND 1T1WA 4P59L 3FUIA 3HI1A 4F9PC 2DB8A 1KN2H 5DI8B 3VH8A 5DHVB 5GZNC 2X3CA 1HHJA 4ZTEA 2BRRL 1BJ1J 4DGVH 4JN1L 2FBOJ 1DCEA 3MXWH 4M7KL 4Z23A 2BNQE 5ECGA 3N44B 3GSRB 4YHLH 5AAMC 1JUFB 2J8UA 5GZOD 1RIVH 2WZPA 5DJAA 2X4QB 2ZAIA 3Q8EA 4KTDL 1IIKA 4O02H 2BDNH 5HJ3A 3GXNA 5I0WA 3NEEA 2QFPA 3A6BH 5GGVL 2A9DA 1KCUL 3VFOA 3P3SA 5IB3B 3WXWL 1P9MC 3X12B 4AEFA 3BQUB 3GMQB 2DLFH 5K59E 3OKEA 4KFZC 4L48A 1DBMH 3GWJA 4O5LL 1ETZA 5KVEE 1PVHA 4LNVA 5ANMA 2F7RA 3HIZA 3L4YA 1SOQA 4HEMA 4P46C 4PRPA 3SJVA 3FOLA 4H8HA 4OCSH 3SYOA 3CFDA 1IQDB 4Q6IA 4GO9A 3RWFA 3HC3L 3MU3A 2A0LD 2GSMB 4UANA 2XZAL 3K6SA 3EO0A 4F2MA 5IEKA 4TQIA 4F9PA 2TSBA 4XMTA 5EV7A 4NZRH 2ZXEB 1ZLUK 3AWGA 1AXSA 4PJ5D 4CKQA 2ADIB 1J5DA 3F7KA 2CJ3A 4GQZA 3V6ZA 3B4NA 1HSAB 1NCAH 3OPZH 1FLRL 3UTSD 1QEWB 3CFBA 1G6RL 1SOKA 1P5VA 5ACZA 5HYFA 5ISZE 1E0OB 3I9AA 2EE3A 5KSBE 4WTZG 2AJ3B 4XPBH 2AGJH 5J12C 3HB3C 2X4UB 4GRMB 7PAZA 4JFDA 2UUDH 4KK6D 1HXKA 2VCOA 5TE7L 4NJAL 1RK0A 5BZZA 4JREB 2CHWA 3LNFA 5E56A 3B7UX 1S7XA 2QSTA 5KTEH 2CJUL 1H9VA 2XXGA 4AQ1C 1OO2A 2XTJE 4KDWA 5JDJA 3ZL1A 4G1EB 4QD2E 2X1WL 3CXFA 4KXBA 3O2VH 4OAWB 3KS0J 4GRWB 4CDHA 2GBVA 3DJRA 5BUGA 2CCVA 5JTWA 1ZT4A 3P0YH 3UABA 4NUGH 1FE8H 5BQ7A 2V5RA 4PJGB 3QH3A 3H42H 3U36B 1SEQH 2EE6A 3BAXA 3L7EB 1KOAA 2YD9A 4OJFH 1KV7A 4BCXA 2H32H 1KBGL 4NM8L 2ESVE 2Y5QA 4JY5H 1CU4H 4C83B 3RE0A 4G7YL 1ZK9A 5DJYB 3FUDA 3DC0A 3AGWA 1LWJA 2E47A 4TNEA 2L3BA 3D05A 1DZBA 3ELQA 1JHKL 1CVRA 1JN6B 1MHHA 5E6IB 3PABA 4QXVA 5BQDA 4CSPA 1L5GA 1WBZA 5FCUH 5C08E 4ZTOH 1KWKA 2K6ZA 2OL3L 5DZAA 4GG6A 1L9TA 4J39A 4U4BA 2FH6A 5D9SA 4NO5A 4RAVA 2D7NA 4OI7A 3PE9A 2MKLC 5G55A 3J07A 4NQDB 5F7BA 3ZN6A 1ITBB 2A6IA 1NBQA 4WW2A 2OS7A 5LG6A 1KYFA 2Y2TA 2NW3B 3OZKA 4YQXL 4X5XA 5LBSH 5JIQA 2CBOA 3ABLB 4Y5YB 3SO5A 4E0RA 3DX6A 4JO8A 4PLKD 4XBPA 1DJHA 1KIPB 4R90H 5FYJL 1D7FA 2YRBA 1W72B 3THML 3HNVL 2G4GA 2DDQL 1MDAA 1UTDA 3ENEA 3PWPA 4JPWL 2W0FB 3DX8A 2PPEA 4S1RH 2V7HB 5EORH 2QQLL 3K91A 3VNYA 1IKOP 4HPHA 2GI7A 3GK8L 3MBEC 4PGJA 3DIFA 3ZKSD 2IFFH 1W2KT 3F5WA 3LD8B 4BSVB 3AACA 4R26L 2CO4A 3BPLB 3QEHB 3RU8L 5F7UA 3GI9L 1A7PH 1T1YA 2R1XB 4WWNA 2VSMB 3UGUA 3L7FB 3ARXA 2H2SC 3MNZA 4KQ3H 5I66B 2KZKA 3B9KC 3WY4A 1CDHA 3C60D 3IS0X 3U0TB 2ZYRA 32C2B 2J6EL 3QQXA 4RCAA 1BVNT 1QLEB 3W82A 2E7DA 3PL6A 2HRPL 1DVYA 1BJ1H 2VERN 3EJCA 2VSDA 4QY8A 4ENZA 1FNHA 3VXNB 5DZ9A 1S7VA 4OGYL 3VFVA 5A2IH 4XNZC 2NSXA 2MWCA 5F9JB 3EOAA 4RGMB 4S0TD 2AV7A 4R83A 4ZMZA 3QIWD 2V7NB 3APMA 2ADYA 4M9OA 1B0GA 3CLEH 1XQ4A 1J9SA 1EA9C 4XBMA 2GY7B 3NYKA 5DVNA 5C3IA 3IJHB 1XF1A 2P80D 5MHSE 1TMCB 3HNTH 2ZUQB 1BM7A 3ZKNC 4LQFL 4MQ7A 4TVSa 3VGHA 3C75A 3IDIB 3Q06A 4F91B 4OTXH 2ZTBA 3M88A 4XVJL 3ZO9A 2K45A 3AREC 3WDHA 3VRLF 2VDNH 1QOKA 3PREA 4YK4B 5TK2A 1RZKC 4TUOA 2VITB 5T1DH 2D03L 2R51A 1PEWA 1XH3B 3B2PA 3H7LA 1S5IH 4CDGC 3HCVA 1MIEH 3BH8A 1MCSA 1AKJD 5CGYC 2B2XL 4L5FH 1NBZA 4W9GC 1IIIA 3UBFA 4OQ1A 2HG5A 3QYCA 5FYJD 2OK0H 2ZCZA 4DP0X 5F7DB 3IMUA 3O6KL 4WK0B 1A2YA 3F12A 2YJQA 5HPMB 2WGNB 5EBMA 1JCVA 3MNMA 3OHXA 3N2JA 1T0NA 1UACL 3FB5A 5KUKA 4MCNA 3VUAA 5I18H 2Q7YA 1XR9B 1AZZC 1BV8A 5JHLA 2Y5TA 3FQRA 2AJYL 4TLUA 4F2FA 4HUXB 1UOVA 1BVKA 1UHVA 1V05A 3QRGH 3QEUB 5FDWB 4XNQB 3X3FL 1GGIL 1IAMA 1ZTXE 1GY1A 2DLIA 3BZ4A 4X4KA 3OF6A 2WUBL 3K0WA 4HVBA 2LFEA 2GSGB 4W9CC 2H6UA 1KACB 4MXWL 5T1KA 3T3ME 5KSAC 5K1NA 4JZOA 2ZOWA 4IIQB 4IRJC 4DP2X 4RDQG 3GO1H 4LEXH 4XCFH 3ULVE 5DT1L 3GUTB 1PSKH 2BHUA 5KBDA 5TPWL 4P59H 3KS0H 5HYSB 2L7EA 5DJCB 2OXHB 1QSEA 2V8LA 2VMEA 3VI4E 1MG3C 3MFGB 5KVFE 1UKQA 1Z2KA 3CZLA 2OW6A 4NQSB 1V5JA 5F3BB 1KLUA 2BRRH 1Y18A 4NZFA 4AV0A 4JN1H 5L2KE 3F7QA 2MCG1 4M7KH 2UWEA 3FUFA 4KH9A 4BQ8A 1SFDA 3FZUC 2RH0A 4UQDA 1PW3A 2APSA 5D7IA 2FLMA 2FLRT 4KTDH 5BOJA 2BNUB 3IFPB 3PAZA 3TIEA 2YPLA 1LK2A 4CMMA 5GGVH 1KCUH 2H3KA 3WXWH 2EDBA 1GYAA 3GYRA 1IAKA 1V10A 1UJ3A 2BNQB 3D25B 5I75C 4GB9A 4O5LH 4PS7A 1FNSL 2LHAA 2N0KA 3RVUD 4G8FA 1D3CA 1FL6A 5HJBA 1KWGA 1CTOA 3JUZA 3L3GB 3Q48A 1IEAB 3KWWA 3BAWA 4NO3A 4F92B 1ACZA 2FECL 2EDMA 1NBVL 3HC3H 2JB6B 2XZAH 4QO1B 1A1MA 4G6AD 1FNFA 1I8KA 3OZ9L 1JERA 1JRHI 2LVEA 3ZE0E 1YJDC 2AQQA 4KJQC 5TF0A 1DQQB 5D1ZC 5B38G 2Y72A 3CH8A 2YXWA 2Z31A 4XPGH 1DZ0A 4C47A 4X9IA 3ROOA 1F3JA 1FLRH 3MLRL 2GG1A 2IH8A 5INCA 1W0VB 4F7TB 1G6RH 2DEXX 4I88A 4QEGA 4FNLL 4W9JC 4MTMA 4UQ2B 4WUUA 2EIZA 4IDJL 4HJTA 2QV2A 3FUNA 4YSTA 1MHEB 3C6SB 5TE7H 3BLKA 1QI5A 1HHIB 4NJAH 4GQRA 4P5MB 1HC1A 3CC1A 1I8LA 3KCPB 1HEZB 3JVGC 1JZ6A 4DPAX 1TKWA 2CJUH 3T8MA 5HDLA 2PW1B 3RWIB 3P4OB 2DM7A 3JV0A 1X5FA 2VIRB 5D5ME 1Q1PA 1IJ9A 3ZHKA 2MQCA 4OLVL 2YLKA 3KL0A 3WTTA 4ODXA 3PQYA 3Q5TA 4HK0B 2WK2A 5J57B 3VD2A 4UBDC 1T3FA 2XUWA 3FQWB 4WVRA 5FV2A 1CTMA 1P1ZA 3OSKA 3TTSA 4EI5C 1BQHB 4BCZA 5I6NA 4LAJH 3FULA 4I87A 5KYNA 2XTJB 5D2NE 2X2UA 3V0VA 1QKZL 2A74B 3L3HA 1A64A 3KEDA 1ASQA 1VFBA 4LKXA 4M8VA 3T0EC 4NM8H 1KBGH 2GC4C 2AKRA 4NWTH 3LRSA 3RBSA 5SWQB 4WF7A 3QFDA 4G7YH 4X7EC 3UAAA 1NEZB 4F20A 4FFTA 4J8QA 4ZUUA 1UWXK 1R3LB 1YYML 3GFUA 3DV6B 1SDAB 5EEWA 1IM3A 2JWYA 1WAAF 4JY6A 2OAAA 1JHKH 1K3IA 5EBLB 4GKSB 4HSQA 1IKNA 2YXFA 3HE7B 5KYWA 2QHLA 2OL3H 1EH9A 1R6VA 2I5YL 3IGKA 2GEQA 3KM1A 2W65A 3VCLB 2CDGA 2ESVB 1X5ZA 2QGEA 3GBEA 4G8GD 1W0WB 4H1LB 1F13A 1F11B 1FFPB 3BD3A 5AVTB 5IQOA 1B0RB 4UUJB 3NUKA 4YQXH 5GGRB 5C08B 3H9HA 4AG4L 4CVZA 4YHYB 2H4EA 2ZONA 3P9LB 2QHRL 1M7UA 1BZEA 1U93A 5FYJH 3O8XC 3THMH 4DT2A 4OR1A 5DHXB 2XN1A 3HNVH 4HKXB 4RFOL 5E1HB 4JPWH 4KRPC 4Y5XB 3IF1A 4PGEB 4V1DD 3PJSA 4LGPB 2QQLH 5FKPB 3RY4A 3CN4A 1EMTL 2XWTB 3GK8H 3ZDYE 3L17A 3AXHA 3QK0A 1VFAA 2JJSC 2YD7A 4JHBA 1AGFA 3CBRA 3DTDA 4LLAA 3DMMD 4AZ8B 2CHZA 3G08B 3MROA 5FGCE 4R26H 5J9PB 4AJVA 2LLLA 4HIHB 1XXDC 1FVDA 1R3KA 3RU8H 3RPIB 3GI9H 1OP4A 3QUYA 1Q9WA 2VZTA 4TQ8A 2IAMB 4JRYE 4QR7A 1OD7A 1CDYA 3SY0B 2J6EH 4JUSA 4KY1L 1R0AL 5CZXD 3H4HA 4AMWA 2NYKA 4P2RD 3BI9X 3BPCB 1CVSC 1QUNA 1XD0A 2HRPH 4WHTB 4CW1B 3CC5B 4OGYH 1W91A 3BQUC 1FVCB 3EYVA 3RIFK 1JFHA 2LOEA 4M1GL 1ML0A 5L6YL 3EOBA 2D7TL 5K1VA 1NFDF 4L4VE 5EIIG 5FM5O 4XVTL 1QEXA 4WLCA 4HD5A 4R7NB 4OJYA 2YFNA 3I02B 3VXSD 1R9FA 4PWIA 3FSAA 4JJ5B 2Z65C 1EHNA 4LQFH 4NNPL 3AS1A 4JDEB 5LNEA 4AKOA 3EFFB 3VWJB 2CLVB 3OKDB 3QDJA 2QSQA 4PJDA 3O3EB 2QT6A 3N41F 1JZGA 3DRTB 3L4XA 4NI3A 4WFGD 4XVJH 1G7JB 2OMXA 3BFQG 3OC8A 3BO8B 4L37B 5DI8A 1FH5L 5IR1A 4HWBL 1XSKA 4E41D 1B3JA 2D03H 5IK3B 2WWOA 1UVQB 1FC1A 2KDGA 4X0KA 3AITA 2B2XH 2ED6A 1IT9L 4KKAC 1MFUA 1QLRB 1E43A 4NQQA 1AYOA 3VWKC 5GISL 4KTGA 4F15B 4XP5L 4PVNA 4WEMB 4PLJC 1PZDA 3SYAA 4JREC 1A4CA 4AKPA 1OCOB 5FCSH 2ZCKL 3KCWA 4XMPL 4HX1B 1NSNL 3O6KH 5IB3A 2HFFA 3BMWA 3K1KC 2KL6A 3X12A 5DQ9A 1N8OE 5FK9B 2K9UA 2D7PA 4XH2B 3VVVA 4AQOA 1UACH 4KKPA 1BIHA 4EDXB 7CGTA 4Z7OF 2BP3A 2FJHB 2YRZA 4M6OL 4BFRA 2JIXB 5DFTA 2BWQA 2AJYH 4HJIA 4MMZA 4N6QA 4UF7C 1T5XB 1SOSA 1GGIH 2EUWA 4BZYA 3HG4A 4DP4X 2N0MA 3T09A 3SODB 2WUBH 3LPGA 5IHLB 4MXWH 5HD8D 3NQKA 3EGSB 2JI2A 4XN5A 1E4JA 1EAQA 4I0CC 5DT1H 4YLCA 1DQJB 2WBXA 3FB7B 4IRSB 4HU2A 5TPWH 3ZTDC 2ADIA 2V5YA 5JO5B 4HWZA 2R1WB 4MKMA 3HG1E 1S2EA 1G1CA 4ZDHB 1KGWA 4B41A 4FFYL 3PXLA 1BEYL 1ROWA 5GGVY 1CFQA 4NAMA 4QRBA 3ZE2E 1XV8A 3C2AL 4Y2DA 2IPUG 4X6CF 3SKOB 5E6IC 4PVBA 4XTRD 3T3MB 3BYTA 1RUML 5HYJA 3E6HA 4EIUA 2DYPD 2PYED 4AYGA 3UC0L 4X4YB 4AKQA 1FO0B 1HKFA 2HH0L 3PHQB 3VI4B 1CR9L 5EF3A 3OKOB 5GGSA 5KS9F 4OKVA 4S1DD 4XZ4A 1Q0YL 4MHHG 2JXMB 3LKRB 1NCOA 3W9EB 5CJQL 2NYYD 4Y5YC 1C12B 4PQXA 2B3RA 3OMZA 1D7CA 2XHNA 4G1EA 1A9EA 4FXGA 2RCSL 4LT7A 4YHML 4OAWA 1FNSH 2A9BA 4HUVB 2FYVA 2V17L 1OSZB 1WZAA 4JANB 3OSVA 2Q87A 3RWJB 2H0JA 2YOCA 5D8JL 4QKTA 3L3KB 5CF3A 5E9AA 1UOKA 2X3BA 5I19L 1NBVH 4XVUD 1BVZA 1AZCA 3L1OL 5JDSB 2X2YA 4C83A 3OZ9H 1I1YA 3LD8C 3WN5B 2IH1B 4Y89A 5DJYA 1RK1A 5SWZD 4DTGL 3BPLC 4JZJB 4PEEA 3TPUB 4E68A 3ZX1A 1YEKL 1JN6A 4DH2A 1XT5A 1OTUC 4M03A 2A2QT 3MLRH 2YLHA 1WICA 4PJCF 3B2UD 2BVOA 1NBYA 1O7DE 2YXVA 2Q7NA 1Q9KA 2W95A 5C71A 4FNLH 3O41B 5F0LB 3BZFA 4IDJH 3BGMB 3HPLB 3F3HA 2XIBA 2FQEA 3SD2A 4WI7A 3UAEA 4NIKB 3ZTJH 1G84A 4N2NA 4G5AA 5FECA 3MUGB 4ACPA 3P3RA 3GTVA 3P2DA 1G7HB 1H0DB 4RGMC 1T83C 1N6UA 4IM8A 4CVXB 4B96A 4O9HL 1IC0A 4O58L 5CU5A 2W0FA 4UTAL 5F0PB 1RZGA 3CVHA 1CXEA 4OLVH 4U33A 3MV7E 4GW1B 5IMMA 2ZUQC 3GF8A 3FQTA 4P4KD 1J0ZA 5A16B 4WTXA 5FOBB 4G9FD 1MXGA 1AMXA 4PY7A 5AB9A 3GHEL 1YDPB 3CZGA 2K8QA 3EJZC 1AXIB 1YMMA 1NC2D 2VR3A 4PRID 4XBEL 4C55A 3MRFA 4YK4C 3EBAA 1QKZH 1E9PB 2HJKB 3QEHA 3BVVA 3VXRD 3WLWD 4A66A 2DQJH 1J1XL 2NT0A 5D5MB 1PU0A 2R1XA 1E42A 4P06A 2ZXAA 3L7FA 1GKEA 5JXEA 5I66A 3K72A 4AZUA 1YYMH 4B0MB 1VAHA 4WFEE 3U0TA 5E1IA 4PBDA 3C5ZD 2VDOB 5DMGC 2DKUA 3V4UL 5ETUB 4YN3A 3OMIB 1WFUA 2IVFC 1R5VA 2XQYK 5F71A 5D2NB 2YD1A 2HT3C 2I5YH 2PWEA 3VXNA 2ENSA 2ZXWB 4MAZA 4XODA 1I9EA 3BGFB 3QJQB 4P2OD 3UBHA 1KIUB 2C9PA 2YPVL 4FQIL 5F9JA 5KVDE 1MCWM 2V7NA 2VZ3A 3O6LL 4LGSB 4PM1A 4BFIB 5AG9A 3GJEA 4KX9A 3H9ZA 4AG4H 1DFXA 3V4LA 4U2ZA 3QXAB 1H3UA 2QHRH 3IJHA 5L7XL 1O7VA 5DFWH 3EDJA 3ESUF 4XMWA 4RFOH 1F3RB 3DWTA 4F33B 4P4RB 2ISDA 2BO0A 5DD0L 1JV2B 2IWEA 2R59A 5DDHA 2DQCL 4L1HA 1IKFL 3JSSA 1F00I 5L0QC 1DE4B 1EMTH 4ELMA 3U6RB 2QKSA 1NPUA 4NAQA 2VITA 4MRCA 1A7RL 3RA7L 4NKDB 2PLTA 3JWNC 3ARFD 2R7EB 4LCWA 5DWUL 5IFJA 5F93C 3U2JA 4AEHL 4FJZA 1EFXB 2YHGA 5IHZA 4FLOA 3OX8B 3OGCB 3IJSA 2VXUL 5E2UL 2B59B 2ZXDA 1LMIA 2NOYA 4ZAKC 4M3KB 2VQ1B 3KLSA 4JRWA 3GJFB 2P5EB 4G42B 3ZDYB 4A2DA 5BO0D 3AAZB 1KEML 3WEXB 3MC0A 1BHGA 3NJLA 3S5LB 3LN9A 1GW6A 3VYOA 4KY1H 1R0AH 1KXHA 5CJOL 4OSUL 2ZX5A 3K6OA 4QAMB 4FTVA 4CMHC 4N1HB 1UD4A 1G7LA 3VD3A 4P07A 3ULUL 2YD4A 4NENA 1G9NC 3K8LA 3POHA 2O26U 3ILDA 4JRYB 4Q97A 2EVFA 3U4BL 2G5UA 3L16A 1GZQA 4LL4A 2W07A 2VXSL 4HUXA 2NXZB 1VACA 4PRBA 3DDFA 3QEUA 1MUJB 4I5BB 2D7TH 4XNQA 5JOPD 3S8FB 1PZ5A 4FE9A 4XVTH 2WLZA 4DK3A 3WNNA 1YN6B 2VL5B 3CN1A 4Y7MA 3FU3A 2LV4A 4IIQA 1ZWIB 2PP9A 3DSNB 4AY0A 4WNSA 3R7RA 1HHGB 1UD6A 2F0CA 1C5DB 4NNPH 4ZNEA 3S8WA 1ZA3A 4XP1L 1M57B 3KEHA 5DJCA 1RCYA 1SHWA 3VNZA 4R2GB 3RGVB 2VN7A 1HX0A 5D1XE 4DOHE 1FH5H 2KQMA 3MMEA 1FFQA 4HWBH 4L4VB 4NQSA 1MG2C 3I9GL 1ACYL 5F3BA 5J89A 3BN3B 3JV6B 4MBOA 2ZCLL 3VGFA 1QA9A 3GSUB 1NFAA 2QTEA 3KPQA 4LB8A 1U8IB 1IT9H 4UAOB 1X4YA 5GISH 2OQJA 4XP5H 5F6HJ 5IHBA 4EDWL 3H2WA 2O30A 1EZUA 4KI5F 4UINL 3SQOL 4K07A 1CGXA 3VFMB 5KVGL 2ZCKH 1RZ7L 4XMPH 1NSNH 2C7UB 5I0VA 1V8HA 2BNQA 4NBZB 1L6ZA 1ORSA 4H8VA 2GC7C 4EVNB 1L4IA 4M6OH 4NXSA 1YUKB 4BQCA 2P26A 1RIUL 1V7ML 4HZAA 4WEBL 4XO5A 3L3GA 1Q90A 2NXYD 5E2JA 2ED8A 3UXFA 2HZHA 3MNVB 1A5FL 3HMWL 4F5CE 2ZYHA 2A73B 1MLBB 4YHKL 2AK4E 3O6FD 4KBPA 3S35X 2Y7LA 1EXGA 1XX9C 5BPPA 2WV3A 4CN4A 2XTJC 4TRPL 4Q6KA 5E8EA 2A74C 2VKWA 4YHIB 4UT6L 1I9IL 1OOWA 4OF8A 4CVWA 4YDVA 4L0YA 2FEEL 4J7RA 1RJLA 2PCPA 5DUBB 4FFYH 3ULUD 1BEYH 3IDGB 4W9KC 1RJZB 2WBJC 2I32A 4F7TA 2ICWJ 3BKML 3C2AH 4KZEL 5FO2A 3UG4A 1LE9B 2HTLC 2ZPKL 1RUMH 3HE7C 5BJTB 4RMQA 1MHEA 1XH1A 1LO0L 3C6SA 4M5SA 1CDCA 2OTPA 5L2JB 4NUJA 4BKSC 1CYGA 1QHQA 3QBTB 3UC0H 4MSWB 5A3IC 5CD3A 3GLAA 3II1A 4B97A 2FUQA 1KXQA 1HEZA 2HH0H 3N42F 4A2LA 3X17A 1E4KA 3CV5A 1CR9H 2R0LL 3VXTB 1J8SA 2AJXL 3EJYC 1CK0L 3FT0A 4MA7L 3ZYOA 1Q0YH 5JHMA 3IVKB 1AO7D 3MOBL 1KGCE 1IGJB 2DQGL 5ISZA 2OBGA 3ASWA 3P4OA 3RWIA 3ZE2B 2XRAL 4YBQC 3T1WA 5DJDB 1IGTB 5CJQH 5EF1A 3GRWA 4XXWC 2VIRA 5KSBA 2X9XA 3OJMB 3WV0A 4TTGA 1J1PL 3NJHA 2RCSH 4OW6A 4YHMH 3CFEB 2E59A 4NQEA 4OFYA 2V17H 4B53A 4HJEA 1EWHA 3UTQB 4Y5XC 1HQ4B 2VAAB 3RI5K 3SN6N 1S9VB 5D8JH 3L08A 4ECNA 1BQHA 2W0KA 4IQHA 2CNZA 2YBRA 3NG5A 4G7QB 3ABKB 1KT2B 1MFMA 1KYAA 1D5BB 2A74A 2FH8A 4YXLL 5I19H 3REWB 3L1OH 2X4TA 3MV11 1Q0XL 1NEZA 2WINA 4HP5A 4DTGH 1MHPL 3OXRB 1KB5A 4WI6A 5HYSG 1R3LA 3LAFA 3DV6A 3JWOL 2ZICA 1L0PA 2JKLA 3BFOA 1YEKH 2IAMC 1ZLEA 2B1AL 3JVFC 3ILPB 3QZNA 2J7LA 4GKSA 1MCJA 2JH2A 3QISA 4X4ME 3BSZL 3VCLA 3IPEA 1E50A 1EIBA 1PQZA 2ESVA 3LN5B 2DQIL 3MPCA 4JJHA 5F7MC 5JQIB 1Z5LB 4A7UA 3M8OL 1W0WA 2J2ZA 1NCJA 1ZMYA 4H1LA 3X13B 1NH6A 1TTAA 1UKSA 5B21A 4IDLA 4LU5L 1B0RA 4U6VL 1CE6B 4UUJA 4ZPVB 2OSWA 1XB6A 2Q20A 5CLXA 5CU9A 4MMXB 5GGRA 5C08A 1WZLA 5HI4D 3M86A 1AGEA 3NEXA 1KULA 2AQSA 2NY0B 4O9HH 4UILL 1U4FA 4HKXA 4O58H 4N90D 5I1CL 4Y5XA 4UTAH 4YHOL 2J8UF 3Q7JA 4PGEA 5E0QA 1NFKA 2XVGA 5FKPA 1K8DB 3D2TA 3CZSA 4PGDB 1SNRA 3DK2A 2XWTA 3MKGA 1W6LA 1T0MA 3GXDA 3GHEH 1QYGL 4X5RA 3VWJC 5BW7A 5HYQB 4GXUM 2ZKWA 4Y4FB 1BCIA 4EQ2A 5BZWB 3G08A 4LDLB 4BELD 2CO1A 5J9PA 4HUWB 4P9HL 4JCWA 3QXWA 2P45B 3RPIA 1J1XH 3CSYA 2C9VA 4YDNA 3MV7B 4GFXA 4BA0A 3KPSA 2DLEA 4JFZL 1OGAD 2B15A 5F9DC 5F3HA 5KAQF 3QA3A 4L29B 3V4UH 4F15C 1QMUA 5D7JD 5BRQA 2X6VA 3BPCA 1D5RA 1UWXH 2EDTA 4R8WL 3BHBA 4O4YL 5IFHL 4Q52A 4N0YL 1G7MB 2P46B 4AOFA 1N5YL 4FQIH 2YPVH 3FU6A 1X5IA 3S3DB 1RJCA 5FV1L 3AS3A 3QDME 4G7RB 3QJFB 5IROC 3NFPB 1UT2A 2IAAC 2FCBA 1SHSA 1TCRB 1JMXA 1GPOL 1OW0C 5H4YA 5L7XH 1AS6A 1RL1A 2BH0A 1TJIL 3CHRA 3FN3A 4I0PD