4XXWC

Crystal structure of mouse cadherin-23 ec1-2 and protocadherin-15 ec1-2 splice variant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
204
structure length
204
Chain Sequence
b'QVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protocadherin-15
publication title Tuning Inner-Ear Tip-Link Affinity Through Alternatively Spliced Variants of Protocadherin-15.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 45
structure length 204
sequence length 204
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4xxwC01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4xxwC02
3LNHA 4NUPA 3LNIA 4QD2E 2WCPA 1Q1PA 5JYMA 1WYJA 4AXWA 3K6FA 4AXWB 4NQQA 3FF7A 1NCIA 3K6DA 4NUMA 4ZMXA 3UBHA 5CO1A 3K5RA 2OMXB 2OMVB 2O72A 2OMUB 4ZMOA 3LNDA 5CZRA 1ZXKA 3PPEA 4AQEA 4AQEB 4XXWA 4ZMVA 2WHVA 1EDHA 2X2UA 1SUHA 3FF8A 1NCJA 1NCHA 3UBFA 2OMZB 4AQ8A 3LNEA 2EE0A 1OP4A 4ZMQA 4XXWC 2A4CA 4ZMZA 2V37A 4ZT1A 3Q2LA 1L3WA 2OMWB 4APXA 3Q2VA 1ZVNA 2OMTB 3QRBA 5JYLA 2OMYB 4APXB 4ZMTA 4ZMLA 2WD0A 5KJ4A 3Q2NA 2QVIA 1NCGA 3K5SA 4AQAA 2A4EA 4AK1A 3Q2WA 4AQAB 2QVFB 4OY9A 1WUZA 4ZMPA 3MVSA 4ZMNA 2WBXA 2YSTA 4ZI8A 4NUQA 4ZMWA 4AQ8C 4ZMYA 1FF5A 5DZVA 3UBGA 3K6IA 1O6SB 2YQGA 4ZTEA 3LNGA 3LNFA
chains in the Genus database with same CATH superfamily
1DVFD 4B3EA 2NNXA 5BJTB 2WCPA 7CGTA 4LLVA 3WFEL 4Q9RL 2NW2A 3RNKA 1PZBA 2WIMA 2DTSA 3L95A 4PRIA 2FGWH 4QR7A 3MLZH 4PU2A 1HU8A 2UVEA 3FFDA 4O02A 2Z92A 4OFYA 2X41A 1PY0A 5CCKL 2HUHA 3EW3B 5IQNA 4NFBA 1CXEA 4N0CC 1LO4H 4OLVH 2IGTA 1MVFA 4QRUB 1HHIB 4GUQA 5KJRH 1BECA 3BVVA 1N0XL 2DEWX 3U2SA 4GRWE 4JFQA 3VXUD 2NUTB 2DWDA 5FFLA 5I1AA 4LKXB 5FV1L 4UANA 4M5YH 4CMMA 4YHYC 3S8WA 3I6LE 1U8HA 4UNTA 1DUYA 1R3HB 1WFUA 1PBYA 3KVPA 5CR8A 4ZD3L 2G2RB 1NGPH 2HRPH 1NAMA 1G7IA 2C5DC 2GAZB 3MCYA 3M88A 4AQEB 4ANKA 2NUPA 3TWCH 1S3KL 2VH5H 5T3XE 3SE4C 3JWDL 3V6OA 3ETBJ 3PDGA 3VXMA 4DK3A 1I3VA 5D1XA 4NQTA 1J5DA 3LRSB 4UB0L 1MFAH 1NGZB 4CILA 4B5EA 1G7MB 1OT2A 3FH8A 4JRWA 1JWSB 2Y07H 3EBHA 3WE6B 1ZA6A 1KCUH 1HHHB 2DTMH 2XKSA 3WUWG 1VZIA 4HKJB 2PWFA 3AXIA 5B22A 2NY5H 1BFOB 1OP4A 2ALAA 2G3ZA 4M3JA 3W0WB 4ENZA 1M2VB 3C6LA 1W0WB 3B9DA 2BSBA 2YZ8A 4OZ4A 2ITCB 2OMWA 4TQEH 5I0VA 2A6KB 1DVQA 2CZNA 4BZ2A 2OMYA 1IILE 2KPWA 2YRPA 4N2CA 3CHXA 3NVQA 5KTEH 4K8RH 5FHBL 2GSMB 3QJFA 2DQHH 1SF5A 5EU5A 3S8FB 2VMFA 2XWTA 4LSRL 3CLEH 4FHBD 1QPPA 3GKWL 4RGMB 5GGTL 3RIFK 1X5LA 4V1DA 5F8RC 3WOVA 3SSGA 4IQHA 3W9EB 3BWSA 5AVQB 4EI5A 3QDGE 4EQ2A 4PYGA 4WWID 4R97C 4QRQA 2MNJB 5T3ZH 4NPYA 1XWVA 1VFMA 5TE4H 2YGPA 4UQ2B 4UZGA 3U9PL 3WDHA 4I0PC 3QO0B 3KYMB 4KROB 4N8VB 3MRDB 1E5ZA 4PJ9C 4Z7VF 5E95B 2EUZA 2Y1AA 2X9XA 4IU2B 2G9HA 4AM0Q 1J87A 1BYPA 2YSTA 1QNIA 2YS4A 5AWNL 1T0NA 4HU8A 5MENB 5E24E 3UABA 4EMZA 2GABA 3DXAD 4ANWA 3LKSB 3O0RL 5F0LB 1JF1A 3HZMA 2ED9A 1KLFA 4H88L 1GR7A 4DCQB 4N2OA 4HEMA 2Y23A 3DPBB 3IJ7A 2Z4QA 3O3DA 4PGEB 4ZFZA 5GGSA 1J05A 4NNXA 3SBQA 2FYYB 2ZUYA 1FG2A 2OXGB 5I6NA 4N2NA 2MOQA 4X4XA 4FQQB 1WJ3A 2MMXA 3I9AA 4IRJA 2Z35A 3FKUS 2HFGL 3RY6C 1W72B 4V2CB 4M3HA 4WNSA 1P4BH 2Z1PA 5CHNA 5A2KH 3D87B 4M6AA 4HT1L 4K7PH 3QHTC 3FQNA 2BS71 5E2TL 4A2HA 3SPVA 4O02H 3FO9A 1PY4A 4XXWA 3JQOB 5CIPA 4YEEA 4DVRL 3K46A 4XHJC 1QHQA 1CG9A 4PVNA 5F9OL 1AGEB 2NNCA 3Q3GA 4MRCA 1UURA 3VM5A 3CFEA 1XCXA 4LHJB 4PBXA 4QYAA 1RFDL 3PWVA 4XXCC 4RGOL 1A6TA 2RCSL 5FO9A 3HVDA 4HCFA 2DIEA 3QULA 4HDIA 4JRFA 2WVVA 2ERJB 3B56A 4LSQL 1VCAA 3UDWC 4NQVB 5JHDA 4UOJA 1KTJA 3ZRCC 4M4RA 4JO3H 5J89A 3O3BA 4R2GB 3WAJA 1TCRB 4ZYKA 2ZJSL 2BSCA 5B8CB 4LEXL 2NSXA 5C86A 4P48A 3GM0A 1GGBL 1MELA 2AQ1A 2HMIC 3A67L 1AGBB 4G8EB 4PW9A 3MKKA 3BAWA 4PJXF 3VCLA 4KZDL 4PMEA 4YHOL 4GRMB 4C83B 4BQ6A 4ZZFA 4RRPA 3T0ED 3VXRD 1SLVA 1AHWC 1U41A 2WQVA 2V9UA 2W91A 2DQJL 2NXYD 4YHNA 3DV6A 1HIMH 1TZGH 4JPKL 3N44B 3SDCA 3VWJD 3HAEA 4QO1A 5AVXB 3CDZA 1MSPA 2WYIA 1MY7A 3GSUA 1IBHA 3TEYA 4J5VA 1N9PA 3UPAA 1A7RH 3CZJA 3FQ4A 4JCWA 3O6FD 2CR3A 4P2RA 1NGXB 2LGNA 2P8LB 2WB1A 1NCAH 3K6OA 2FLRT 4V2BA 5LGHH 3KW7A 2NX5E 3ULSA 1JZJA 3F83A 4UTBL 1TVBB 3I6KB 1NCNA 4U1IB 3DX7A 5F88A 1MG3C 4A6YH 1BF2A 1R33A 5F6HJ 4EZLA 4PJ8B 1CL7L 2NLJA 3F8UB 1JDAA 4RQQB 3E3QC 2X4NB 2AXGA 2H32A 3F5WB 1T22B 4Q14A 4HC1L 5JA9A 2ZSWA 3BPOB 4PRDA 2LHAA 2DEXX 2JELH 4N28A 4J1UB 4G8AC 4NT6B 4YH6A 5E6ID 4MAYA 2IAMA 2BLFA 4DW2H 4U1KA 4YAQA 2CNYA 1NA8A 4Z3FA 3ATAA 5IEHA 2HKHH 2X6MA 3N1GC 4U1LB 4NIKB 4HKXB 5CZRA 3SPIA 1MPAH 2A6JB 3C08H 4ONFL 1IAIH 5HHMB 1DL7L 4MMYA 3U4BL 1LE5B 2PWGA 2MH4A 5C09D 4MQXD 4ES9A 2VM9A 4WI0A 3QUZA 5I82A 3CZGA 3WJJC 2WVTA 1KEGH 1A7NL 3MOBL 1MDTA 5LXGH 2VXUH 5GJTH 2K6WA 2RFXB 2LAGB 2WJ7A 4WI9A 3PABB 1U58A 4KRLB 5E94A 4Y7MA 5LXVA 1A7QL 1ZLVH 3ILDA 4LCUA 5H2BB 4ZUVB 2A99A 2C9SA 1MCPH 4FKEA 5DEFB 3BT2H 4N9OB 5DJYA 1FSKC 5EZLA 2YLHA 1A4JB 5IBTL 4P5RA 3THML 3FCSB 1JRHH 1JZIA 2KC0A 5CIPH 3EO9L 2EDEA 2R0ZL 3LZQA 1J9SA 1E5BA 1K3IA 2A83A 4KQ4L 5FF6A 1U36A 4UCFA 2GSGB 5IF0B 3EDJA 5LAXB 4JRYD 2BP8A 4PMFA 5C2BL 1P7KA 1CO1A 5JIQA 2CGRH 2R1WA 1BG9A 1EZLA 1TO4A 3K2IA 1RJYB 2AV1B 3LKOB 1T2JA 3MRNA 3PFQA 4Z76B 3ZE2B 4KOCA 5DQDL 1GSMA 5SWQA 3BGFC 3MLSH 2QKIA 1X5YA 3N5AA 2AQSA 5JW4N 1RZIB 2FX7H 3CFUA 2FLBT 2IWGA 5D7JD 1VEMA 5DYFA 5AL8A 4DGYH 1MFDH 4U6HB 2DMGA 4HCRH 1SOSA 2QGDA 4YPGA 5ISZD 5F7YC 1EVTC 4F7CA 5BV7L 1TQTA 1EAPB 1KB5L 4WWKA 2BVPB 4CKQA 3I9GH 5CEZH 2I07B 4KDVA 2NMSA 2JIXA 1QFWL 3EYOA 3PF2A 3WGVB 3UL4A 3O4LB 1XIWB 3HS0C 1QTPA 4FXTA 3UTSE 2C34A 1CURA 2D4DA 4M1CC 1KC5L 2CRIA 2PP7A 5CILL 5KVGH 1ONQA 4NUPA 4PFEA 3GPSA 4GSXA 2WOBA 2RR3A 2XG5A 2Z0UA 1DEDA 1XH1A 4XZUA 4IKJA 2N59A 1D5BB 5T5NG 4N2BA 5BVPL 3ABKB 2Z93B 3H0TA 1GCYA 2FWUA 1MJJB 5KVEL 3RZCD 1ML0A 1GAFL 3AWFA 3PP3H 4GRLA 2KYIA 4PRNA 3VXQB 3G6AB 3ABLB 1S7RA 3LB6C 3V4UL 3IDIA 1KGJA 4AYFA 3BAYA 4NSKA 2EUVA 1I7TA 2E9JA 2OLDA 2F8XC 1S7VB 3IK2A 2H6PB 3RWCB 1HHJA 5DFTA 3S36X 5HYSG 1REIA 5KOMC 2NOYA 5CSGA 4ZPVA 2VDQH 2CHDA 3CN4A 4IGBD 1ADQA 1QFPA 3PUCA 2OR7A 1BM3L 5DUBA 5I1KL 2ED8A 2HCZX 2VB5A 3PRZA 5C0BB 3QUXA 3EJRA 4G6JH 2VRKA 3IDNA 4ORGA 1R34A 1NM9A 3FO0L 1U3YA 2ZYHA 3TFKC 4G42A 3ABZA 1X7TA 3HE7D 5HVWA 1J8HB 1B0RB 4LSVH 5ALBL 4LASL 1BBDL 2LLLA 2NY4D 2G60H 3UYOD 5ANME 3X13B 1G6VK 1G6RB 4ZFGL 3S35X 1MXDA 1J11A 1SLWA 2HTKC 2NZ9C 2ODHA 1MNUH 1H15B 1JK8A 4MJ6B 4NYLB 4WW1B 1XF3A 4GLRH 3QAZC 3UYRH 1SXNA 3MMEB 5BOPA 4XN4A 2DJUA 2DQFB 5CINH 5MP6H 1R3LA 3S3BB 3CXHK 3CFMA 2QBWA 2A6DB 1AFVL 2XIDA 1NL0L 1G1KA 4L8SC 5GGQL 4CU6A 2YOCA 4C58B 3QW9A 2HYMA 3VFRB 1FCCA 1HWWA 3C8DA 3HC2A 3Q43A 1WF5A 4GRWB 4TSBL 4UAOB 4H40A 3VH8G 3US1A 5H8DA 4BK8A 2YIHA 1MHEB 3D4GA 4LDEB 3EOAA 4I9WE 3HZVB 4JY6B 4O2EB 4OLZH 3REWB 3O6KH 1ZLUK 5IJVA 1NKGA 2YOAA 3LN4A 4A2DA 1A4KB 3DX6B 2VC2B 5DJDA 2FUQA 4S1SL 2VABB 3VD4A 1R6VA 5AYTA 5BW7A 4GSUA 1I9EA 2D3VA 3KCPA 3OJDB 5FFGA 4AYDC 4HX1A 2DBJA 3PAVA 5CLXA 2FQEA 2B59A 4HHAB 4YFLI 4K3JL 5JPMA 1HXKA 4ZTEA 1YJDH 4JDZB 1F2XK 2EYSA 1HEZA 2BVQB 2F58L 2XXFA 4JHZA 4XBEH 4G82A 2WB7A 4NDMB 4PJCA 3VG9C 1MF2H 1VEOA 5KYWA 2MSPA 5E2WH 3LTVA 3VFGL 4KDWA 2WTRA 1PYWA 1DTUA 4C56D 5TDPB 5FA3A 3W39A 1QABA 3K6FA 1HN1A 2FWLB 3B9EA 5ENWB 3QIBC 3QZMA 2JF1A 4TNFA 3C60C 2WBJB 3TV8A 3TBVB 1J1OL 2E7MA 2B14A 1I4FB 3INOA 4HGMA 2DWEA 1TEGA 4WHTA 3H7BA 4FABL 3QDGB 2E6QA 4MJJA 1B4LA 3BW9B 4LSSH 1E5CA 1N26A 3L3KB 1MFNA 5IESH 1SXBA 3F05A 1RPQA 3F6JA 2IALA 2A6IB 5FECB 2R1YA 5IOKA 2NTFA 2Z34A 3DX9A 1TU2A 5FGBC 1BAGA 1FO0L 1YQVL 2CDFB 5KN5B 1Z9OA 3SDDB 4QTIH 1VCBC 2BOCA 4KY2A 3C2SA 3DX0A 3P73B 3PL6C 2XQYA 4Y9FA 4UUJA 4XPBL 4AM0A 1OLLA 4Z0XA 4HIEB 1UWEH 1A47A 3UP1A 3L1GA 4ELKA 5F7NC 1ECZA 1I8LA 1UM4H 2H9GB 4JNXA 1FL5A 3ZKMD 5BS0D 3MTXA 4P59L 1UVQB 5E1AA 1D6VH 5H37A 3EH4B 1UD4A 4C4KT 5DXWA 3ASOB 1QUNB 1OE1A 4KRPB 5EZJB 3ZE2F 3HE6B 5LCVL 3VGEA 2A9BA 5DMKB 4X8XA 4E42A 3MRJB 2FR4A 2J44A 3S3CB 1RZJH 3HRZB 3BT0A 1OHQA 3QHZH 4QRFA 1JUFB 1T04A 2XRAL 2JVUA 5D96B 3GMLB 1XGTA 4K5LA 3FUEA 3WIIL 4APXB 4IKKA 4GG6E 3TN0B 3IMBA 3O2DL 2Y7QB 4P5KB 4PV9B 3POCA 5FO2A 3L5WA 4I3RH 5F9WC 5A40E 1I8UA 1MVUB 1E42A 3FU9A 3NAAL 4QOKE 2Z8VC 2JKTM 2NYYC 1UM5H 1NBZB 5TGBB 2CLRB 2MCPH 3GXUB 1RUAL 2X88A 3JV4A 1YN6A 1WD8A 1JNNL 1DQDL 2F08A 1NUFA 3ABMB 2AK1H 2HT2C 2HLFC 1F1DA 2FD6H 1PZUB 1SN0A 3GUFA 5D1QC 4YHLH 3SDYL 1BZDA 2Y22A 1QSFE 3WO4C 5AW1B 3O6FA 3FTVA 4ZS7H 2EADA 2Y25A 3M6DA 4WEBH 1MFBL 1FNSH 1XGYL 3UAFA 5I8KH 4NZ8A 3V5DB 1E5YA 3MX0A 1RZGA 2P9RA 3QCUL 2ENYA 3J2PA 4KI5C 4OD2B 2YN5A 1NMBL 5LO7A 4WKXA 1R47A 3BSHA 2KERA 1GTNA 3TVMB 3ZQXA 4FZEL 5E6IA 2YPVH 5AD0B 3ROOB 2DZEA 3ENEA 5K39B 5CGYC 1L0YA 2FT8A 4HUKB 2BIPA 4LPTA 5EBLA 3F01A 2OTPA 3GXMA 4N0FA 5H35B 1WAEA 1AC6A 1BWWA 5IFJA 1ZXKA 3NGBC 2OP4L 1U6AL 4PLJD 5F8QC 2M8XA 5C09A 4NKOB 2GITA 4EDXB 3UIZA 4R7LA 1U9KA 3QAQA 4JEGB 4OGYL 2ZWKA 5K9JH 4FI8A 3WL9A 4LLQA 5DJ8A 5E4IA 1UM6H 3VGAC 5ES4B 1NFKA 3SCMA 2O5NA 5K9KB 4N2HA 3BQUB 4H8UA 4WSKA 3H9SD 3GLAA 2NX5B 2BP0A 3NFPA 1B6UA 2WP3T 5F1NA 1IU1A 1C5CH 1BVLB 3KPRE 1H3UA 3DJTA 1F8TL 4FNQA 4GRWF 3RWEA 2VSCA 3ZTEA 5K5YA 3MODL 1TJHH 4UQEA 2VO8A 3H4FA 3JTSA 3MJ7A 3O41A 4XPAL 3V52L 5EUKA 3S5ZA 4IS6B 2D3NA 1DBBH 1COBA 5E0QA 2BSRB 2YEVB 4KX7A 2KLRA 2PXYA 1HDMB 4X4MA 1FUNA 5JLZA 2PPAA 4Y4FA 3Q1SL 3RGVC 5IM7A 3MRRB 4D9QD 5BMFH 3BUDA 4K4KA 3V79C 2W81C 3HI6H 2O6EA 2W07B 3ZKND 5EULV 2Z31D 1GGCH 1U91A 4GQQA 3LCYA 3RURA 3QQ3A 5GS0H 5ITFA 5H37H 2G5BA 1J9TA 4MAUH 3OHXC 3H9HB 2WXLA 1JPEA 4Z9KB 2UZPA 1QEWB 1XBDA 2QADB 3ROLA 4PWJA 4MDIB 4I3SH 1AXSA 5G55A 3BUPA 1U8LA 3IU4H 1XF5A 1SY6A 3QZWA 4HFUH 4NN7C 5ISZA 2I60L 4O2FB 5FCUL 1CT8A 4OB5H 3HPJA 1XXFC 1CXKA 2O6FA 4RWHA 2X4SB 4RA3A 4MX7B 4YHIB 1F4AA 3BKML 4A68A 1WAAE 3JWOC 1L9QA 4F7TA 1K4CA 3VRIB 3LJ3A 5G2NA 4E41D 4I48B 2CLVA 1NAKH 2BM3A 3OV6A 1PLBA 1CWVA 1KXTB 1VHPA 5E9AA 1JXDA 5HYQB 4EN3D 3WNLA 4OI9A 2CGZA 3ZPDA 3VYPA 1LK2B 5LNGA 1KJVB 1IM3B 1UD6A 5IQ9B 1TCMA 1AZBA 3O6LL 3F04A 1M53A 3MDJA 3EGXB 4FXLA 1PNCA 2R2CA 3RZCA 1WP6A 2GK0B 4OGXL 4XCNB 3L1FA 5HJBA 1HILB 3GI8L 4L1SA 2V7NA 3GSOB 3F58L 3AU1B 4PIBA 4HWBL 1NFIA 3VFMA 3T2OA 3PPEA 5ABZA 3WMPA 1F3JB 4XE0A 1K8IA 4G6AC 3CVBA 2E7LA 3RB5A 4IGBA 2VDPB 4XWOC 2YARA 4P5MB 1MNNA 2BY1A 3DROB 4N8CH 3FB6B 2XTLA 2EAEA 1J5IA 1LYQA 1ZHKA 3F84A 1B4JH 4MKTA 4FQXC 3VG0H 4HSAC 3UTSB 4ENEC 4ZW3A 3JXAA 4MD5A 5EU3B 3WFDL 1Y7VA 3ZE1E 3V7AE 2ICWJ 1FGVH 2LW3A 5IB5A 4GNKB 3EYFB 1JMZA 3MLTB 4XTRD 4KKNA 5TQ0L 1WC7A 5BZDB 2BJML 1T20A 3QT2A 4EKXA 5JOFB 2R29L 2FO4B 2EXTA 2GTQA 3X2QB 4UM9D 4ELDA 4P46C 1FFOA 1GMIA 2D3JA 1J1PL 3WSQH 1C1EL 2D7QA 2WUCL 5HHVH 4TKWA 3RG1C 3B8SA 3OKLB 1KXQE 3RWDB 2FUTA 2V6HA 5B38B 3GIVA 2QV2A 5HI4C 1NBVL 2XVLA 3TA3B 1B0IA 4NUGL 4IBLT 5GHWL 3O81A 3LH9A 3V4VL 4DNLA 2BNRE 4NO0B 2E3VA 4TVPH 3KJ4B 3LEVH 3C6SA 4NN6C 2E4TA 3S34L 3PFUA 2C7UA 4K2UL 1E27B 3ES6B 4U3HA 1U3JA 2D73A 4QHKI 5CR1A 3A3YB 1KLUB 2Q2EB 3FMGH 1SOKA 1BIIA 3FT4A 1FF5A 3W56A 3OKKB 1RHHA 2A9NL 1TZIB 1T7ZA 3Q8CA 1R19A 4JN1H 4PGDB 5ANMB 1EJOH 4WK0B 2XTJD 1KFAH 3ZDYE 1S7XA 1PG7H 1I8KA 3F64A 5J6SA 4UNVA 4KVCH 4ORZC 4LLUB 1NCDL 1MQ8A 2IXQB 1KPUA 4CNIB 5A6IA 3KWUA 1Y6MR 2DYSB 4C56A 3QH3A 4ETQA 4PLKC 1BIHA 4Z3GA 5LGJB 1XHHA 2D0FA 1DFBL 4GAYA 4O00A 1G7JB 3T0BA 4XMTA 5J3HC 5I30H 1IGFH 3MA7B 1ZV5A 3GSXB 2EDMA 5DJZB 1YEIH 2KUTA 1OT1A 3B9KC 4WNQA 4E9SA 1H19A 1WIPA 3DOSB 4L29A 1ICTA 1UWGL 4QHLB 4YVUA 5DLML 5AUMB 3UJJL 5CXPA 3DMMD 3ETSA 1OWWA 4NNYA 4A7SA 3B9AA 2VWEC 3CVCA 3GS7A 5ICYA 4J27A 3ILPA 3DVFA 3DKHA 4QXVA 4W9HC 1SLXA 3P0GB 1OAYH 3U4AA 5A7BA 3SN6N 3T0VA 1AZVA 3FQUB 3FTYA 3KLLA 1YA5A 1TLMA 5FM5O 2XNAA 1S7WA 2GY7B 3KL3A 2AZAA 5DQ9A 3QJHB 5IB4A 1IFHL 4JFXA 5I1EH 5GS1A 3IPBA 1H6EA 3U0WH 1BGXH 3EYQC 2XV3A 4TNWK 1TJXA 1X9RA 2H26B 4JFWA 5J57B 1X9QA 5DR5H 4X0NA 5EOCJ 3PHOB 4R26L 4HPYH 5KSVA 4A37A 5I5RA 4PUBL 1W6LA 1J5OL 4OCYH 1GY1A 1TITA 1WA1X 2PW2A 4TL5A 5J11C 1SHMA 1D5XB 2Q7NA 5GRVL 1GCFA 2X1WL 4PYHA 3FU7A 1AAJA 4OM0H 1N7MH 2XPGB 1PAMA 2X9WA 5B1BB 4NJ9H 4QRTB 4F24A 4FXKB 3WTUA 2WN2A 1CDUA 4LNRB 2GI0A 3ISWA 1TDQA 1YMMD 2UX6A 4X7EC 3FO2A 3LXUX 3AROA 2V17H 1BEYL 2NY5C 4DVBB 5I66A 3TYFA 1NEZG 4JUSA 1GW6A 3ULUD 4HJ1A 4AQ1B 2X40A 2X4OA 4WTQA 4F92B 1JFQL 3RNQA 2WQWA 5FYKL 3DHPA 5AB0A 1N2RA 3BGMA 2X4UA 5GISH 3S88H 1S8DA 1ZA3B 2LU5A 2YXFA 3HB3D 4HF5L 4WU5B 3P2TA 3H9YA 4PRPE 1CGTA 1TQCC 4HK3J 1XGPA 3FBQA 5DHYA 2GTZB 4DHLA 3PV7A 4UAHA 5DO2C 3VB8A 2ITDB 4N0UE 4DO4A 3HG3A 1KV7A 1BREA 2AJYH 2HG5B 1EZVY 2YRZA 5IWLA 1EMTH 2YK1H 5TH2B 1D5IH 4H2CA 4LGSB 4QXWA 2DDQL 4QIRA 5BRQA 4F3FA 4PREA 1BD2A 1XDTT 1IAKB 4GG6B 4IOFC 2J4WL 3BRGC 1W8EA 2K9UA 1R46A 3SKOA 2OFQA 4YC2B 5F7EL 4I7ZC 5F7LB 4I0CC 3FT3B 4TUKL 3IU3A 4QOKB 2DWSA 2P4AB 2AXFB 1S9WA 4G2AA 3NDYE 5ERWA 3DURA 2WWKT 4U3SA 1VB9A 4X7TB 3VFWB 1FV1A 3IJEB 4RAUA 3CG8A 2X3AA 2I24N 2YAFA 3BVWA 4MMZA 2H0EA 1UT9A 2NR6C 3R06B 4I9XA 4NFDA 2JK5B 2WZ5A 3HC3L 4MZ2A 2PWDA 2YWYA 2PPFA 5TFSL 3X1BA 1CE6A 4X6BA 1JV5B 2PCYA 1QSFB 2VCOA 2DYPA 3CX5K 4CUCA 5J13B 2DQDH 3NPZB 2KMWA 4CADB 1CIDA 2WAHA 4OZFH 3O9WB 1N5YH 2YC1B 3Q1EA 1S3RA 4JDVB 4HWZB 4I88A 3LKPB 4UTAA 5D2NE 1TUPA 1QLRA 1UJ3A 3QG6B 2N1KA 4GW1B 1OM9A 1IJ9A 4QTHB 4LVOC 5C6PB 2FYVA 4LXFA 5DK2A 2EDXA 4YWGL 4EAEA 5HVFB 3APMA 4HIHB 5FYJU 3QI9A 1TJGH 2UXVA 3T1WA 4GRWH 4O4YL 1OB1A 2C1OB 3QA3A 2I5YH 1I7ZA 3IJHA 3TPKA 2AJSL 1HNFA 1KJ2L 5IEKA 3FOMB 5I1DB 1V05A 2NTSP 2N7AA 1YNKH 3D50A 4F5CA 4Q6IB 2CO6B 4BSVA 2O61B 1JZ4A 5K1VA 5T3XH 4R7NB 3ARQA 2Y6SC 4KX9A 3T3ME 1JHLH 3V6OC 1BPLB 1TENA 2RMNA 3Q7JA 1RUPL 5BUAA 1R24A 2WXPA 3AWGA 3CZLA 5D1XC 1MEXL 3FUJA 4LCIH 2LVCA 4XNUH 2H8PA 3QXTA 3EUUA 4Y4HB 5TDOA 1CFBA 3V4PL 4IK6A 4EIGB 4R0LB 2C3WA 3KPRB 4DGIL 1T1WA 3I6SA 3OJVC 4DPBX 4J3BA 4LVHB 3QIWD 3C6LC 1QBAA 3CVHB 1WH0A 5IB3A 1A6VH 2W5PA 3IE4A 3M8OH 3AM8A 4U1HB 4YHMH 1WSST 3HNSH 2FJFB 3MO1B 2Y5TA 1SFDA 1HX0A 4QRSA 4TRPL 4DGUA 4UQ9A 3RI5F 5C3IA 4OZHA 2YBRB 3MJ9A 4HZ1A 1YQ2A 2H4EA 4D9RD 5DT1H 5JW5B 1X5GA 1LO3L 3OLIA 4L8BA 3TEUA 4A2MA 4J6RL 4EN3A 3US0A 3QG7H 4L1LA 1BVZA 5FV2A 2ZCKH 1YDPB 4EI5C 2QFRA 3JZYA 2OMVB 5IIEB 2XQBL 3OKNA 4XN1A 4YEFA 2JKXA 3QUHA 4XO4A 3F00A 1U92B 2X2YA 2OJEB 3JWOL 2EE9A 4FP8L 4X6EA 2NY0B 4ODXB 5B1KA 5IOPA 3AABA 4NZUH 5FHAL 5FYJH 1ZGLA 2OSLA 2X4RB 2GKIA 3BMVA 3M46A 5HHOB 2AK4D 1F58H 1HE7A 3E1ZA 3LY6A 5HHQA 4DAGL 3BO8A 1X5AA 3MLXH 1TIUA 3WXWH 1JNLH 1L7TL 1SEBB 1IC0A 1J9CT 5DU7A 1IC7H 3LNEA 2VN6A 2Y7NA 3OKMA 3RDTD 3HTLX 3ULVL 1TZHB 4WTZG 4ZMQA 2NY3C 4ES8A 4AMKH 1I1CA 2N01B 3FTXA 2BOBB 4MA1B 4L4VD 4NENA 3DVNA 3BXNB 1T5WA 1N67A 3D3VD 2E27L 2Z1KA 4JO4H 3B2XA 4UM9A 3UTQB 3KAAA 1RVFL 1GZHA 3WEAA 3EH1A 3DHUA 1RULH 1KYOJ 3BFWA 3N91A 4U1SA 4JKPH 5FW6A 3WJMB 5DD5L 4CVXB 4YFLF 1NBQA 1DBMH 5INCB 3JTTA 2DH3A 5F89B 1VFAA 5EDXA 2V5SA 2FL5A 3QFJD 1KMGA 4CMHB 1KENH 3V0HA 1LQSR 2H0FA 3BYYA 1CICC 1RIHH 2XFXB 3N43B 1MY5A 2QQKH 3C5ZB 5FC9A 2V3FA 3LZNA 3Q2WA 5HHPA 3N40F 1BQRA 1ZSDB 1XF1A 1M7DA 4TLUA 4M61B 4MCYB 4UT9A 1SZNA 3L1OL 3OKDA 5FM8A 3KR3L 4DKDC 4Y9BA 3I6GA 4GG6F 3OZ9L 4JQIL 2B16A 3KPSA 1HXMA 3SE9H 5CP3H 2VKXA 4P4KD 2MPAH 2Q8AL 1ZJBA 4N6RB 4AEHL 4DOHE 3AAZB 2QEJA 2OMNA 3FPXA 4K3GA 4YE0A 3ZE1B 4AUJA 1NMAL 3BZ4A 2ZNWA 4M8QA 4R7DB 3B6SB 3BPNB 4H8WH 3KLHD 4WLCA 5I9QC 3MOAL 3B2MA 5ETUB 1N0LB 6PCYA 5D4QA 2IGLA 3QNFA 4AXWA 3BPLC 3QJUB 4PJFF 1RUQH 1NBYB 1K6QH 3MRKB 1J18A 4HALA 1GJWA 4HJJH 3ARVA 2P8PB 1BBJB 4B0MM 4H0IA 4UTCA 3JT2A 2YWZA 3NEOA 3QXAA 1OP3H 4OV5A 1B88A 1QFWI 2DM2A 5TF0A 1HEJC 4OCWL 4R4ND 4N22A 1KGWA 3DMMA 3QCTH 1AJ7L 2BNRB 1INDL 2P48B 2ATAA 3HN8A 2PCPA 3D9AH 5EBMA 4KHTL 4LHUG 4WUUE 2XZCH 1EHLH 3MJ9H 5D72L 5FA4A 2BIIA 4GKNA 4G5ZL 3VJ6B 2ILLA 2BHFA 1AE6H 4M8VA 5EPMA 1HAWA 3CSYA 2WZPA 4LOFA 1G9MC 2WQSA 1THAA 4Y1TA 1KCSL 3RHWK 1PX8A 1WZAA 3ARFD 5CZKA 1DLFL 1PD1A 5DS8B 5BOJA 2V9QA 5JDSA 1FHGA 3EFOA 3IETA 3MCG1 2K6ZA 1BZ8A 2XBDA 1U8NB 2JJUA 5DEJA 3ZDYB 1TLKA 1DBJL 1NC2B 2V5MA 1A7OL 4P8QA 2YQBA 3ECQA 2C9AA 3MFGB 3P0VH 5K93A 1CQKA 4UDTB 4ZT1A 4MDJA 1UATA 4MAYC 2IAMC 1NJ9A 4Z0BH 5C0IB 2FGWL 1ZVNA 3MLZL 4E9YA 3GSNB 2Z7YA 4NHUB 4N9GA 1CD0A 1BJ1J 3GXDA 3SE3A 1QRNE 5ID1B 3MRIB 4M7LH 4BRVA 3ZIYA 4YNYA 1LO4L 2VR3A 4OLVL 3S5LA 3VXSD 1E50A 2ZWSA 1SF3A 1CD1B 4Z23A 5KJRL 5KSBA 2COVD 4OD1H 2HX8A 1Z3GH 1QA9B 2D03H 4NRYB 4OLYH 3DDFA 3QUZC 3MLRH 4PJDA 1LEKA 3TIDA 1XL6A 4M5YL 1ORSB 1WWBX 1YO4A 1N10A 3T2QA 1NGPL 2HRPL 5C0NC 3FFCD 3TASA 4E0RA 4HKZB 3TWCL 4FYRA 4H25A 2VH5L 3BKCH 3IWUA 4X0KA 4CVWA 3K4ZA 2C7FA 5I15H 1NSNH 3VX0A 3GHPA 4JJ5B 1C9SA 1TVHA 1SDDA 4PWKA 2Z6FA 1MFAL 2JCCE 5DZ9A 4F2EA 5KVEE 2Y07L 1T1XB 1L9TA 1S7UA 1KCUL 4QHMA 2DTML 5TJWK 1SXZA 1YZZA 2GEEA 1JTPA 3RWJB 1OEZW 1OAZH 2NY5L 4OBRA 5EBWB 3ZHDA 4F7MA 3EHBC 4RFNB 3T4AB 3HZKA 2LTQB 2Y3AA 1JWMA 5EC2B 2DB8A 2QSCH 4TQEL 1OKEA 3D2TA 4RSVA 4Z5RA 1XMEB 3KBFA 2R56H 2VLRD 3T8VA 5HGDA 2CQVA 5KTEL 4K8RL 4ZQTA 5JQ6H 2DQHL 1YJDC 2XCMC 2HA1A 3ZHFA 4AYGA 1VGEH 4YO0A 3D39A 3CLEL 3FQWB 2E86A 4ZFOL 3VFTA 2QKIC 4FFYH 1EZUA 2XVBA 2R39A 3SBWA 1XH3A 5FOBB 2XN2A 1WAAF 4YIQB 4I5BB 1IV8A 5D5ME 4X9FA 2VDPH 1PEWA 2GCYA 3KLAB 3VI3E 4YK4C 4DKEL 1OE2A 1C5DA 4UT6A 2OV0A 4K3DH 5T3ZL 3B2DC 1C5BH 3H9ZA 3K72B 1MQKH 5TE4L 2C4XA 4U6TA 5KG9B 3P2DA 3D06A 5GS3A 3IMTA 1MCSA 2FQDA 4ZMVA 1IGJA 8FABB 1XAUA 1XGQB 1JPGB 1UEYA 1JGVH 3RL1B 4PRPB 4F7EA 4PLOB 1ET7A 3GS4A 3UG3A 3GM8A 4WHDA 1S9VA 5B1CA 4N0UB 4UDUA 5DCCA 4L18A 2ZKMX 1E90A 5HDLA 1BVOA 1CB4A 3N43F 2EINB 2HT4D 3HMXH 4M62H 1YEFH 3IDUA 3OPUA 2QQNH 3QWOA 2R51A 2CKNA 2XWDA 3D30A 5DJXB 3KVQA 4HUVA 4Z7WE 3BZFB 3ECUA 4G7SB 4GRLC 3QSKB 5EA0H 3DSFH 1CI3M 3HC4H 3RVTD 4U0RC 4Y2DB 3MUZ1 1FFNB 4OF8A 3AB0B 3NCJH 3DYPA 4P23B 4EBQH 4F1ZA 5AL0A 3WMSA 2X0UA 3ZOAA 4U6YA 5IK3B 4GIOA 3W0WD 1T6WA 4AYMC 1N3NB 2TSAA 4TVUA 5DLLA 1P4BL 3ZE1F 2UWEA 4ZUWA 4K7PL 2NQ3A 1RZJC 4RMVA 4F2FA 3QUXC 3T8XB 1Y0LA 1C8PA 3F7QA 4JM4H 4LARH 2JLLA 2WKGA 3RFZB 3VGBA 1W0VB 4YXHH 2CLZB 3HJ0A 4H0HB 1SOXA 4O02L 4KNUA 5KSUB 4WJKB 3SQBA 1P5VB 4OZIA 1OSYA 3STLA 3FPYA 4O9HH 5CBEA 3ARBC 4JKKA 4ZW5A 2WGNB 4A39A 5DTFA 2NXZB 1KOAA 5EIIB 3CN1A 4GQ9H 1RZ7H 4HJ0C 4LP8A 4DKEH 2BMKA 5E5MA 5D2NB 5LJYH 2P5WD 5AVVB 3KPOB 1IGML 4ZQKA 4KROD 1HXYA 4FCHA 4Z3JA 2BNQE 1GGUA 4X8GA 3EADA 1RPUA 3ZTDC 1KYDA 3LPGA 4FTVE 4X99A 4JO3L 4LF3A 4EI6B 4WVRA 5ESQB 2RIKA 1KCVH 1DVXA 4MNQA 5L2KA 5MEND 3D25B 3JVFC 2OJZH 3BPCA 4NZTH 5C9JA 3EJZD 2H1LM 3HI1A 5FYLE 3MNZA 4XNZC 1MH5B 1XGUA 1DJWA 2ENQA 4G8GE 4FG6C 4MNHA 4PBVC 3ZDYF 2F6AA 1PLGH 5EF3A 1FJ1A 1A21A 2WZAA 3NBNA 3T3MB 1P9MA 1TZAA 5BW7C 1AGFB 1I8IB 1BQHB 5CN1A 5IG7A 3EH3B 1HIML 1TZGL 1FI8C 3BIKA 4AGNA 1KFGA 4OD3H 1IAOA 3RGBA 2HWZH 2B4CH 1MCWW 4DKAA 5JPMC 4PR5A 2C8NA 3MNWA 5I73B 3MI6A 3OBAA 4WEMB 1A7RL 3PHQA 4Y5XA 3QQ9D 3AACA 5LGHL 4J2XA 4G1MA 2EEAA 1NCAL 4M7LT 1OGSA 2FVNA 3HG1E 3N55A 2EE0A 4LLDB 1KELH 2GJ6E 2ZICA 3QIUA 4ANUA 4OAWB 3TNMB 3U2JA 3UYPB 5JHBA 3RDTA 1MN4A 1WWCA 2Y5QA 3E2HB 4KKBD 1O75A 5CZVL 1P7BA 2EP6A 2CK0H 5EOTB 2VSKB 4L4VA 4JO2H 3D3VA 4D8PB 2RQ8A 3HAEG 3WEBA 4JL1A 5C9KA 2JELL 3WTWA 1DCEA 2XXGA 5T5FH 4FMKA 5F3BA 1TKWA 2WZ0A 3D05A 4MJ4A 4DW2L 4J8RB 2VO5A 3PIQB 3U9UA 3E80A 2Q8BH 4N90D 3SQOH 3D2UB 4I18A 1OSEA 2HKHL 4KJWD 2ADJB 3QFJA 1XTMA 4MRBA 3L3JB 1GS6X 4R2GD 1MPAL 3C08L 1IAIL 1QLFB 3SY6A 2DQIH 5EG6C 1AP2A 3NFNB 1V3MA 1BA9A 3UTPD 5MHSE 4NQDE 5J9PB 32C2B 4RDQG 4NKMA 5CJ5A 1T0MB 3IJ9A 3SB3A 3QK0A 1I8LC 3UOAB 1KEGL 3X14B 1ORQA 1NANH 1YNLH 4HJGB 3U25A 2P43B 1MI5D 3A4AA 1CXIA 2OW6A 5GJTL 5GS0C 4KQ3H 2I7OA 4ZK8A 4BDVA 4DK5A 3KPMA 4K5NA 5D7SH 4IDJH 4JFUA 4P4KA 2PCFB 2YEZB 1WT5A 1OPGH 5TK2A 3WIAA 3KNBB 1KCRH 3QXDA 5I26A 1P4UA 4U6XB 3PE9A 3MROB 4PWEA 4I1PA 1KCKA 3WY1A 3VD3A 4CW1B 4KXBA 1MCPL 2ESVE 3BT2L 3QDME 1CN4A 2EICA 3WTTA 2ALWA 4HK0A 2UYLB 1JRHL 3KHQA 1XBRA 1FFTB 4MWFA 4BFIB 2HTLD 3NZ8B 4KZ0A 1DVZA 3E3QE 4F33A 5MERA 4F2ME 3DWTA 5EHFA 1AD9A 4GUPB 1MHPL 2G4GA 2A0LC 1BQUA 4GQRA 2CCWA 2CGRL 3ARTA 4PJ8D 4K7FB 4NOFA 4B9FA 1RMFH 5GSRA 1EZVX 1TPXC 4IIQA 1XF2A 3MLSL 1SNRA 3O4OC 3V5KB 1F6AB 2X10A 1JF5A 2FX7L 4LP5A 4LSDA 2VLMD 5DD1H 1LMKA 1MFDL 4HCRL 1VADB 5HDBE 5AW0B 3X11B 5FKAA 2GT9B 2WHVA 3O6FC 5HHNA 4S11A 1H3TA 3I9GL 1S78C 3NK4A 3IS1X 5CEZL 2VXVH 4GUCA 4DOHB 5HHMD 2YRBA 2YD5A 3GSRB 4UIMB 5JIMA 1DE4B 1KIQB 1O5DT 43CAA 4JB9H 4OZGE 4WCYH 3I2CH 1I9RH 4R4FH 5AEAA 5KVGL 4PRBB 2J2ZB 2WWMD 5C08E 4PWIA 3T2NH 1TTFA 4O2CB 4M1DH 4CKVX 1PZ3A 1QI3A 3FCGA 2CRMA 1QOKA 5E6IC 3CUPA 3HCVA 3CVIH 4XWGH 3WTXA 5A2BA 1DJGA 3LRGA 1R75A 1RK0A 1B2YA 5E8PA 1NCWH 2ADGB 5LBGA 2W0FA 2LLGA 3MJ8B 4P5SA 2CUMA 3SPJA 2FNBA 2J5LB 3DUUB 1IB5A 4XVJL 3VXSA 3SGJA 5HGHA 5C70A 5LBSH 4QRPA 4WUUB 1WCBB 1ZLWK 4E68A 4OU3A 1SEQH 2VDQL 4GKSB 3MUY1 1ZVYA 3SCMC 3ZSSA 4LIQE 1LEGA 3RE0A 5K69A 2QSTA 4AH2B 3SJVA 4G6JL 3VRJA 2PR4H 2A74B 5ECGA 4HSQA 1ED3A 2FO1A 1PTZA 3IJSB 3IGLA 3L9RA 3IKCA 4DP4X 1FN4A 2WZ6A 1WWWX 3W11D 4AIZB 4DP6X 4POZC 3VD5A 4DJMA 4ZXBB 2FT6A 4ATTA 1UT2A 2EIBA 4LSVL 4WFEE 3LNHA 1KY6A 3WJLA 2G60L 2CBPA 1R5WA 2PXYC 3RWFB 3D18A 4YXLH 3FT2A 2APVA 2XJLA 4Y4FC 3MJ6A 3T3MF 1UQSB 3X12B 4ZPTA 3HBGA 2FDBP 1X7QB 1Q72H 1MNUL 4GAFB 1S9XA 3UYRL 5BV7B 3TEZA 2YJQA 1KB5B 1QRNB 3O4LD 2DV6A 1XIWD 2LFEA 4JG5A 5CINL 3TO4B 5KZCD 5MP6L 1NC4B 2PO6B 2VLRA 4GEJA 2A73B 4DWHA 5FUCC 2ENSA 1KDJA 4OCSH 5HI3D 1U8QA 4CU8A 4XH2A 5IMOA 4EVNA 5C0DB 1BZEA 1DEEB 1IEBA 1VFBB 2DI7A 2YD4A 3DVIA 5DRWA 1BJ8A 5BJTA 2YUZA 1FNEB 2K1MA 2KDGA 3WIHA 5E1QA 2XWEA 5BUGA 4KHXH 1WTLA 1GPOH 2HLEB 1PZ5B 1IQWH 1K4DB 5IR1B 3H1ZA 4KTGA 4D0BA 4OLZL 3O6KL 1H0DA 3CSFA 4P07A 4KXZI 3UIYA 2NYKA 2OZ4A 1XMWA 4PIRF 4Y2LA 2LU3A 4QRUA 3GHBH 2JCCB 4JM2A 4DSYA 1Q4NX 3T77A 3UMNA 1P5UB 1YJDL 2Y6TE 3GYRA 4JANA 4FEIA 4XBEL 4EXKA 4J39A 2Q3XA 1FZMB 1F0LA 3BP4A 5C0BD 1MF2L 3OR7B 4JG1H 3LKRB 4J3OF 3DUSA 1AVAA 1E9PA 1UWFA 1PDKB 3FB5B 2WKOF 2WLHA 3MBEA 2EH8H 3GJFA 2VT0A 3MRLB 4I87A 1IEHA 1J8HD 4CSZA 1NGZA 4QYOB 2EKSB 1MAMH 3L2MA 4A63A 4RBPH 4B0MB 3RHWF 5C92A 1XZ0A 1ECYA 1RSYA 2CK2A 4GBXC 4HIIA 1BFOA 4BKTC 5D5MB 1I1FA 4KRNA 5E8OB 3VI3B 1W0WA 3FU0A 2HVKA 3HR6A 1L9RA 1P2CA 4LSSL 2E7LC 3UAJD 1I3UA 2FJHB 2P8MA 3FTWA 4IGBC 1YG9A 4MJ5B 2JXMB 1KGIA 3T0AA 2JWYA 4GXUN 2ZG3A 1VZHA 2HX9A 4YHYB 4QTIL 2C3VA 3UZEC 1GC1C 3SOTA 1K8DA 1J1XH 5JHLH 2AJVH 2N4IA 2Z7ZA 3RUGA 2VE6B 1UWEL 3K81A 4WWOA 2P5ED 1UM4L 2NY4C 1EBAA 2JTDA 1HS6A 1O7VA 2WINB 4PRAB 4AENB 5KBKA 5DD3H 3G3LA 1HHKB 3PJSB 1D6VL 3GDCA 2P5WA 2IQAB 2HJLA 4UQ2A 4H1LB 4N8VA 1A2YB 4G8FA 1QQDB 1RZJL 4Z7WB 4RMTA 3SGEH 1T1YA 2ZUTA 2BY3A 2QZQA 3QHZL 2DI8A 2XQYG 3GB7B 4JVPA 1FCGA 3EO0B 3UBXA 2QVTA 3NIGE 3LKSA 5CJOH 5I0ZA 3NZHH 1P1ZB 3DTXB 4I3RL 2P5PA 1RXLA 3BUYB 4GSRA 2VR9A 2R2BB 3NIDE 1UM5L 1WBZA 2F5AH 2MCPL 3G6JA 4XOBA 4URKA 4LP4A 1ACCA 4YVNA 5MEQB 2FATH 3VU2A 4BXSV 4R97B 2WBJD 2VAAA 4FQQA 2AK1L 4FHJA 1TOXA 4XRCB 2QSQA 1EQWA 1QMUA 2P52A 4I0PB 4E5XA 4FFTA 3V0VB 4PJ9B 1HJBC 2E8ZA 3QDGD 2IWFA 4YHLL 4PRHE 5HYJD 4CVZB 4P3DB 4LDLB 2WO2B 4ZS7L 2QQLH 4XMUA 1O9WA 4UT7H 1BFVH 1EZSA 4WEBL 3VYOA 3SDDD 2BNQB 1FNSL 4NLAA 3GQFA 5IW3A 2D7TH 3OD3A 4CRPA 5C71A 1LMIA 5I8KL 4FTVB 3GI9H 3PNWB 5DYOA 1W2KT 1N8ZA 2V37A 1FO0B 2OZ4H 3SIKA 3HMWH 1CFTB 5ICZA 5D71H 2XICA 3W81A 1O0VA 4MFHA 4PGBB 1UZGA 4JKMA 2Y36H 1FL6B 5FYKE 5J6GB 2AJXH 4KRPD 4G8GB 2YPVL 4NN5B 3HE6D 2XXCB 1YNTB 1Q0XH 4OW6A 2YN3A 3KLQA 4JO5A 3TPUB 1NICA 4YSUA 4NQVA 3PHAA 1GSKA 1N4XH 2BSSA 5AALA 4ZUSA 1U8MA 3MRGA 2IV8A 3BOVA 1UXSB 3V2AR 4DZBB 5CFAA 5GZOD 1EFXA 3MFFB 5HPOA 1WO2A 4XXDA 4B7LA 3GJFH 1N6VA 4BHUI 1DQKA 3HFFA 5GS1C 3TN0D 5I71C 5B39B 1AGBA 5K9JL 5SX5K 3P9LB 4Q4IA 2EXSA 4R3SA 4UYPA 4MKMA 1MI5A 1CGWA 2K3TA 4FGMA 4P2QE 3HG1B 4C83A 4J28A 5I1HH 5IHZB 2ODIA 1C5CL 2GJ6B 3BWUF 2V2XA 2ARWA 2AEQH 2ZPKH 5BQDA 5HPMB 5BZWA 3FCTA 3FUDA 1TJHL 3C8KA 5FUZH 1PZSA 4ZJ9A 1CDJA 1DBBL 4AG4H 2C1PA 1WDAA 2HUEA 3TT1H 3FRPB 3GBNH 1I8MB 1KGYE 1E6JH 1OAKH 4WFFD 2ICEA 5BMFL 4KI5E 3HI6L 3L7FB 1GGCL 3BESR 4U1IA 3RA7H 1U2YA 2JCCF 1NGYA 4IMLB 4YFEA 5CD5D 5GS0L 3WFEH 2WPGA 4MAUL 5AKTA 2H1PH 4WZ9A 1T4KB 3F5WA 3MRPB 1T22A 5DWPA 5GIRB 3L2NA 1A6WH 4NQDB 1YN7B 4RIRA 2EABA 35C8H 3Q44A 5D6DA 4I3SL 4NI3A 5GRVK 5MEPB 1AHWB 1ZV9A 3TVMD 4K23L 2EJ1A 5SWSA 2WLLA 4HFUL 3IU4L 3CX5J 1UC6A 4M03A 4DUXA 4X5WA 3WUWA 1Z5YD 4HFWA 2VMEA 4U1LA 1WV7T 2ARJB 3K6NA 1PJWA 1UYWH 4BSWB 2IANA 5IWLC 3C6EA 1LE5A 4NPJA 2HN7B 1XR8B 1XT5A 5D5MF 1CFNA 5LN4A 2ESVB 3WN5A 1GS7A 4QHUB 3GMRA 4HIJB 3VFUB 1F45A 5F96H 3GJEA 4IU3B 1VENA 4BZYA 4YSSA 1NAKL 2AJUH 2CR6A 2X4TA 3BQUD 4F8LA 1IM9B 2NX5D 4RFEA 3QORA 4F2MB 2BERA 2PTTB 3D7PA 1D2PA 1EWHA 2E59A 3IDJA 1M4KA 1M7IA 4AX3A 5DHDA 4HIQA 5F3FA 3U36B 1I9IH 2B77A 2VUYA 4MMZC 5DJAB 2UY7B 1QI4A 3PDOB 4PLJC 3GT6A 3LIZA 4C59B 2I26N 3HJEA 2VLKD 4ODTH 5AFAA 5KUKA 2DJMA 1FVCA 1RLWA 2V33A 4RGNC 2CJTA 4HQQH 5HDBB 4ERSL 1OD9A 4NQXA 3FOLA 2GSGA 4WKZB 4EXPX 5A1AA 1VRSA 1DCLA 1L9OA 4AITA 4Z7WF 5GGTH 1VERA 5LAXA 4PW3A 1IJNA 4W9FC 1A7PL 1NDMA 3OKYA 5IFAH 3LQMA 4N8CL 3KYKH 4GFTB 4GO9A 3QBTB 1RJYA 3ELAT 2XWJB 5HJDA 3RX8A 3SD2A 1PLAA 1B4JL 2OPCA 1UJ3C 3VG0L 1E8XA 3E7JA 2BW5A 5L2JA 1RZIA 5I2IA 4LKCB 4OZGB 1KTKE 5AG8A 5INDA 3SEPA 5C08B 2YA1A 4WAFA 5EF2A 1FGVL 2IH1A 3EBIA 3QI9C 1EAPA 4Z8FH 3WEXB 1LD9B 1Q9OA 4FJYA 5DD6A 1SGKA 1FSKB 3KVDD 5J4MA 3CFDA 2FQGA 4FULA 3CN3A 3GF8A 1HTYA 4XBMA 1GZPB 2E7HA 4FC3E 3EH2A 3W38A 4QXUH 4JE0A 2IO5A 5HHVL 3QXWA 1F4WH 4B97A 3ECBB 1JGEB 4LRNH 3A6CH 4H8WC 4XR8C 1B3JA 4F27A 3NCMA 1BMWA 1NIDA 4BUHA 4HV8B 2JMRA 3QEQE 1BZ9A 2QVMA 1HL4A 4IW4C 1NUNB 2FTAA 2OS7A 5FIEA 2J1KA 4TVPL 2VZTA 3LEVL 1M1XB 4Z18A 4TUJB 1IC5H 3QFGA 3BGFB 1D5BA 3MCKB 3DRTB 1IM3D 4LOVA 1SYSA 2BZ7A 3N42B 4ZW6A 4I89A 1D3CA 1XR9A 2XZQH 2I9TA 3CC5B 2OYMA 3FMGL 1BEXA 3G6AA 4N2MA 3VXQA 3UBFA 3OJMB 4HT1H 2N56A 1XVSA 4WIQA 5EOCH 2P47B 4YZFF 1HOCA 1YNTF 3AM8C 5BRZE 1NCUA 4JN1L 3NT0A 1EJOL 4ONGH 3CDGA 4DP2X 1KFAL 3HS0B 1PG7L 2GSIA 4KXAA 3ALPA 3NMEA 4KVCL 12E8H 3LH8A 4N1CA 5KYYB 3QDHA 5FEBA 4FDWA 4HUXB 1EO8H 5I30L 4ZUTA 1AY1H 1IGFL 3P4OA 1B0RA 4QF1A 4WFGD 3RWHB 1VLXA 3KPLB 1YEHH 1ND0A 1YEIL 4NHCL 1XSOA 4YDIH 5T33H 1B2WH 1MCBA 1OGAE 3FAWA 3KGTA 1IT9H 4J3OH 6PAZA 1SMDA 4KJQD 7FABH 3WHXB 1AIZA 1H15A 2PYEE 4MJ6A 1U93A 4NYLA 4HS6B 4WW1A 5JO5B 2WXQA 3UAJA 2CKBA 1OAYL 5F7BA 1XSIA 1R1CA 3OVUB 1ZXQA 3AT9A 2HKFH 5LDSA 3Q5OA 2KL6A 2A6DA 1BLNA 1CTNA 3IFPB 2P28B 1G7PB 3TA3D 2FNWA 4N8UA 3VFRA 5I1EL 5I76A 3MV01 2ZSVA 4NC2B 4UI2A 3WD5H 1QPXA 2ADIA 1OWRM 1HCZA 2P5EA 4NO0D 5DJCB 3LIZH 3VGGA 5DR5L 5EEZA 1MCIA 4O2EA 4JY6A 3REWA 4HPYL 3TV3H 1NUDA 5DMIH 2BSTB 3V4VB 4Q8BA 4X7CC 5EB9A 4CSPA 1PKQE 5ABAA 3DX6A 1DDTA 3QNZB 4OCYL 5FOJA 4TTDD 2XWXA 1DQQA 1GZHC 3UTZA 3T4YB 3OJDA 1U30A 2J6EA 2LFGA 4OM0L 3UMTA 1N7ML 3TT3H 4FA8A 2VOTA 4JDZA 4NJ9L 3QAZB 3ZJAA 4XOEA 4JZJA 4PJAA 4RWYH 4NDMA 3IXAB 1Q0EA 2GY5A 2V17L 4L8SB 4Q89A 3RBSA 4FG2A 2L7EA 1MWAA 3L5HA 4Z78A 3OB0K 1XCTB 1JPTH 3CZEA 3NP3A 1SYVA 3N06B 4HAGA 2VWEE 4JFFE 4JLRB 4DP7X 5GSVA 4MLIA 3KBHE 3GEFA 2J73A 2HPTA 4G9DA 4LLAA 4MMXA 5B4MD 3ILQC 2WBJA 3ZHLA 3TBVA 4HOWA 4GIAA 3MR9A 4NC0B 2KDYA 1AQDB 3DO3A 5GISL 1A22B 3L9YA 5JW4M 3S88L 3FN3A 5LN8A 2J71A 5I19H 1CFVH 4YHKH 1VKXA 1BLIA 5HYJA 3IDMA 4TL4A 1YUHB 4WU7A 2A6IA 4HMEA 1DJIA 3O3AB 1KULA 1WFOA 1JAEA 4PCTA 4PY8I 5KN5A 3PPSA 2AJYL 3SDDA 4PH8A 4U1MB 1EMTL 2YK1L 2YPLE 5DFVC 1G7LA 4PTTB 5K9QI 1KXVA 1JWUB 1D5IL 3CPLB 1RZFH 2GFBA 3RPIB 3FO1B 4EJ1C 4DO5A 1PSKH 3VG9B 3KM2A 2Q6WB 4GAAA 3GRWH 4HIEA 5TF1H 1A6ZB 2XZAH 5MEOA 2GEQA 2QR0A 4NCDA 4FL4C 2UZYA 3NIGB 1BZOA 4LLMB 3DMMC 4RMQA 3ZQ9A 1UVQA 1B90A 4IRSD 2SODB 4Z3HA 3QIBB 3NABH 3VGFA 1NGWA 1QUNA 1SN5A 2ZX9A 4Z95H 3HE6A 1DJZA 1JV2B 1NUGA 2VQUA 3C60B 2OSWA 4OQTH 1A9EB 4KAQH 4EO5A 1WGVA 5DMKA 3NIDB 2EIJB 4OZGF 5IJDC 2IDSA 1JBJA 1AGDB 1N68A 1E6OH 1IGYB 4A04A 3W9DB 4AQAB 4OY9A 5GZOA 5AOJA 1MCQA 1A1NB 2FIKB 3TBYA 3K4AA 1I31A 2EEDA 1DDHA 4ZMYA 2GTWB 2NW3B 2AMUA 4NQEE 4OCRH 4PRHB 3PL6B 3HNVH 2DQDL 1QVOA 3IPEA 5DRNB 4BSJA 5DJ6B 5FAAA 3EGDA 1N5YL 2CLRA 2GUOA 4MA3B 3LNIA 4DKTA 3FXIC 4PG9A 1F90L 3APNA 1B4RA 2CKBH 3QZBA 5EO1B 1CXHA 5AW7B 4KNQA 4MB5A 4WHCA 4FYQA 3MXWH 1FYTE 2J43A 3L17A 3SE3C 3VFPB 4Z3EA 5T3ZE 2Y7SA 3ARDD 4N2AA 4HOXA 4BEIA 4OF0A 2VXSL 3K8MA 1E28A 4GXVH 2EVJA 4Z7UE 1TJGL 3N42F 4JFOB 3DTUB 4JRXA 2I5YL 2R83A 2NNAA 3WIFB 3P4MA 5HXMA 2R2EA 2FJUB 5HYSA 1YNKL 2MRYA 2B5IC 3BH9B 4HUUB 4X7DC 3PXLA 5T3XL 1E43A 1DQMH 5F9WB 4ZX3A 4NO3B 1OV8A 3F6LA 5DGRA 3B7RL 3R18A 2CM5A 1JHLL 4P9MH 3KL0A 3PU7A 2J6EH 1D7FA 4G9FE 5KVEH 1YHPA 4OI7A 4LCIL 4XNUL 5AD0A 3V4UH 4P2QB 4QOKD 5E08H 4JGUA 2VERA 2J21A 1XSJA 5I1IH 4RFOH 3BIBX 1TEYA 4S2SB 2WXGA 4IRZA 4G59C 1G0YR 1CGVA 4PLNC 2P3YA 1RERA 1UB6A 1MWAH 3WO4B 4WO4A 2YPKA 4I1NB 2VN7A 2O5XH 3MZGB 2X89D 2ZWZA 1IAIM 2IBZY 4XN2A 1A6VL 1W9XA 3M8OL 4HK3N 4W9KC 1SPDA 4YHML 1MCFA 2B4CC 3HNSL 3K3QA 3FU8A 1QSFD 4RNRB 2FWSA 5FM5M 1LE9B 2WGXA 4PRIE 3UGUA 5DT1L 5EU4A 3VH8A 2BDNH 3LS5H 3O9WD 3SBWC 4L9LA 3QG7L 4G6MH 3TC9A 1M9SA 2ZCKL 2NDGA 2H3KA 4HJSA 4EIUA 3LD8C 2OBGA 4ZSOE 3ARGD 1EAJA 3AG4B 1E9OA 3K5SA 3V6ZA 4PP1D 3UADA 2CR0A 2Z0BA 2VLKA 2J88H 3AC0A 4BZ1A 1XSKA 4APQB 3QWNA 2CBMA 4HH9B 3VA6A 4XNDA 3QUYC 4ZMNA 3NGBB 3N85H 3AGWA 3WY4A 4NZUL 5FYJL 2PW1B 1O6SA 3KPPA 5DFWH 4CN4A 2R2HB 4HXBH 3V6OE 1F58L 1I85A 3D51A 3VXME 2E9BA 2H3NB 5D1XE 3MLXL 3NCYS 3VGAB 4JHWH 3WXWL 1JNLL 1XAKA 1OF0A 1MLCB 1F42A 1FC2D 4L2YA 3X3GH 1IC7L 3WY3A 5D7LD 2WLKA 2VMCA 4QXTA 2VR7A 3U1QA 2IOIA 1C8QA 5GRXG 3NEXA 1Q1PA 1IAII 5I6XC 3IAPA 4Y16A 4AMKL 2DQEL 4Y4HD 3C87A 2F53A 2J8OA 2B7DT 5HD8C 4JO4L 3KPRD 1IIKA 3WE1A 4UQAA 5B7FA 3MNMA 4HWEH 3CQFA 4N24A 4U1JB 1RULL 2ZWLT 4YHIA 3RGVB 3Q0HA 4JKPL 2G75B 4GJTB 4LEBA 4FNTA 4JFEE 3WNIA 3PWUB 1DBML 2R27A 3O8XA 4V1DE 3VRIA 4RRPM 1BHGA 1KENL 3GMMB 3GBMH 5IJBC 4XZ4A 5EEVA 1BQ5A 1RIHL 2CU9A 2QQKL 2YGQA 3OHXB 4X8CA 2YMOA 1Q8MA 3VI4E 5F21B 1JRHI 1LK2A 1KJVA 1IM3A 4ZO8A 3KG5A 3L3GB 3EGXA 1JGDB 4GS7C 5F7HA 4NN7B 4Y89A 4XMXA 4ZBJA 3NIGF 4D0DA 3SE9L 2BRQA 1HILA 4OM1H 2CIKB 1FIEA 4FTDA 1QBLH 4JG0H 4NQCE 5ICUA 4AKOA 2ATPB 2NY0D 2WLNA 1S4IA 3P9MB 4QCIA 5EOQH 3GUTB 3D0LA 4OCXH 2FZ3B 4H8WL 3NIDF 4PBWD 4HU2A 1F1AA 1KTLA 1LJMA 3LXAA 3K6SA 3IMUA 4HEME 1L9SA 4PB0H 5DS2A 5HHOD 4IBWA 5FYLH 3O45A 2ZNXA 3DROA 1KB9K 3FB6A 2FX8H 2G2PA 1TG8A 1BJ1H 3RPKA 1K6QL 2JFCA 1MUJB 4XPFH 3RVXD 3SBRA 1RURH 5L4MA 3MRBA 4HJJL 2O26U 1I1AC 1LO0H 1KTDB 5EU3A 1KN2L 1U8CA 1P9MC 3U7YH 3EYFA 5TTRA 1LO5A 3QEQB 2R1XA 2BO0A 2TSBA 3QCTL 4BUGA 2YFOA 2P7TB 5KVDE 1P6FA 4PGZA 5L88H 5JOFA 1M05B 4NO5A 4LLWA 3D9AL 4BKLB 4KK9D 4AJ0A 3BP7B 1N59B 2XZCL 1QYGH 3MJ9L 2Q86A 1J86A 3D09A 4D7PA 5EN2B 3BQVA 1DVUA 4Y5XC 1A66A 3ZYZA 2PF6A 5F71A 1AE6L 3GWJA 5B38A 1P4LB 2G5RA 3UGEA 2EYRA 1AZNA 2ZE0A 5DHVA 1V7NH 3QIUC 3I3EA 2YGOA 1XF4A 4P04A 3RDTC 5BRZB 3IXTB 3C5ZD 2ISDA 2D7OA 2Y7LA 5T1LB 1PLCA 3LEXB 4FQXB 4F8QA 3GXNA 3PQYA 2BCKA 4BZ1H 1S6NA 3TA4D 3HUJA 4FCAA 4YXKH 4NS0A 1J0JA 3ES6A 3P0VL 5JHDE 3CCHB 1H6UA 4R90L 2ZIDA 3P3TA 1BDYA 2DM3A 3LZLA 5ILTH 4RMBA 3V6FB 3ZX1A 4Z0BL 3OMNB 5ACLA 3B9VA 3L5IA 4FMVA 3G7TA 5IW6B 2OMUA 2WYTA 4I18C 3D0VA 4P46B 1JERA 2A1WH 1CYWA 1QHPA 1OGAB 4M7LL 4G6KH 2DQUL 3U0PA 5H94B 3PWLB 4GG8B 4OD1L 1RUMH 4J4PC 4IHOA 4MJIA 1Z3GL 5E99H 4CGTA 3U48A 2D03L 2IXQA 4OLYL 2PYEB 3MLRL 3QXUA 1XGRB 4WY7H 4QKTA 3CQQA 2D9QB 5DVNA 5LGJA 5KVGE 1IFRA 3EOBB 4FQLH 1X4XA 1DSYA 3TCXA 3EJJX 1H3WM 1MRCH 3GSXA 4GLRI 3BWAB 2DN7A 4PJ6A 3CZFA 4NN6B 3DOSA 3MOQA 4P4KC 3BKCL 3TCTA 4X42A 2AV7A 2CGYA 5I15L 1HHGA 1NSNL 2BNRD 1TF4A 3BKJH 4P2RE 4G5AA 2HB0A 2JKJA 4OIFA 2HJFB 3S5LG 4OGQC 4OFKA 2Y7MA 5AB1A 1M6UA 4XBGB 1PKQB 2F74A 1G9EA 3DX8B 3AMLA 3UZVA 1OAZL 2EDHA 3D12B 2NQCA 1FL3A 3QUKA 3GSVB 1ZE3H 1PZDA 2YSSB 5GRYA 4AVIA 1QG3A 1OTUC 2EEFA 3IFLH 3UX9B 3PWJB 1EVUA 2QSCL 2DMBA 3S0PA 4JGNA 1NDGB 2LABA 2R56L 43C9A 3U9WA 3Q8FA 4R4NC 5JQ6L 3STZA 1NC2D 1W80A 4KRMB 3L4VA 3S3SA 3Q2NA 3K0WA 4IRSA 2CJUH 2VDKH 3B9KB 4RISH 4U33A 4P2OC 5LG6A 2W9DH 1WZKA 3F3HA 3Q6GH 2QHRH 5BVJB 2WUBH 3V0AC 1CYGA 1K2DB 1QASA 3DGGB 1P84J 2V4LA 2HSIA 4JFFB 4K3DL 4L0PB 1C5BL 1KGCE 3D85D 3GTNA 5IBUG 4QRTA 4WGVB 3IRZA 1PVHA 2FJGA 1MREH 5FXCH 1X4YA 3FU3A 2XA8H 1UACH 5DEGB 5C8JB 1JGVL 1A1OA 2FH6A 4AT6B 4AW4A 3DETD 1ZPUA 4PGCA 1EXUA 3ZRFC 4WI6A 5KBDA 3WELA 1T5KA 1AYOA 5C07E 2OK0H 3A22A 5HBBA 2FE0A 2PTUA 2YPLB 1YRKA 3ML8A 4P5TD 1J0HA 4X6DA 1Q9LB 3HMXL 2XSKA 4M62L 1YEFL 3ZZLA 4JGMA 3CSBA 2ZXDA 3NIFE 1MG2C 1JZHA 2JKRM 2QQNL 4WU5A 3FB8B 2LE9A 3ARDA 4YLBA 5J11B 3BYTA 5EA0L 4H44C 5DHVH 4ODWA 3DSFL 4LEOA 3HC4L 1ZT4A 3BH8B 4UZSA 4HBCH 3SGJC 3TM6A 3V0WH 2F8OA 4BWTA 2AXHA 3NCJL 1UHVA 4N68A 4EBQL 3ESPA 1KLGA 5I6LA 4AE1A 1KGXA 2QT6A 4LIQH 4WF7A 5IP4A 1WA2X 1ZD6A 2G2NA 3JV5A 3BVUA 3B4NA 1X5HA 5GRWA 1J8RA 3I9PA 5HP5A 1IVLA 2VERN 3VNZA 1RLBA 3TURA 3ARXA 4ZNCD 4F7KA 3WLBB 4LARL 4JM4L 1AC0A 1JK9A 3EZ8A 4YXHL 1XTLA 5H4ZA 1R5IB 2P26A 1BZ7B 4NQEB 4C4BA 4KK8D 4HWUA 3MGTB 4KGLA 4GW5B 3FT3A 4O9HL 1UEMA 3WJLC 4KMLB 4X4YA 4N2IA 3GSWB 3PP3K 4X7TA 1RZPA 2AKRA 4GQ9L 4JX0A 1RZ7L 4ZFOB 3VFSB 1R9FA 1XH0A 3EXLA 3MNVA 1SJEB 2WO4A 3AWEA 2RA1A 3BSGA 5DD0H 2EXYC 3VGHA 4AV0A 1TQCB 5F93C 4YDZA 3R06A 5A3IC 1WA0X 3B7TA 3S4SB 1FYTB 4PJFA 1NMCC 5D70H 2Q87A 2IEPA 2VXQA 4E9QA 3HG5A 4PRPD 4XPTH 1KPVB 4UINH 2IFFH 4Z7UB 4Y9CA 2ZX6A 1TNMA 1KCVL 1YEDA 3H54A 5CCHE 3LV3B 2OJZL 4NZTL 4CADA 3GRBA 3OKEB 3VXNB 2EDDA 4NRXB 3WHE0 4HWZA 1JJUA 2WK2A 4KKLC 3WI9A 5DI8B 4DP5X 4GW1A 3H2PA 4PJGF 3P11H 4QTHA 1PLGL 3ARGA 3NJFA 4A7GF 5JZ7D 1ZT7A 3NCXA 5L8JB 4MHHG 5KSAD 2F9BT 4U1GC 4FXGA 3L13A 1U8KB 4HIHA 4G9FB 3C9NA 2C1OA 2PTVA 4FFWD 5DRZA 1I9JH 4OD3L 4P23D 2HWZL 2B4CL 4JM2C 1G43A 4LPCA 1HZLA 3G04A 4R5TA 2CO6A 4KTYA 3HZYA 4MBRA 2O61A 2OA9A 3GS0A 1R3JB 1HH9A 3G5XA 4UQCA 5G4MA 4F8TA 4ZZKA 2KT6A 3LQZA 3TFBA 3C75A 1KELL 4R5VA 3Q06A 2NY1B 1RCYA 2X53A 5D7LA 4HPHA 3VSUA 4OJDH 5DA0B 4ANXA 3MBEC 1IZJA 1CU4H 3A0OA 4LLVB 4F91B 3HS9A 2CK0L 1UB5A 1HNYA 2NW2B 4X5QA 3RNKB 3RJOA 3L95B 4PRIB 3RVTC 4JO2L 2WKLA 2L7QA 3FFDB 3ATEA 4O02B 3M45A 4ZX5A 2NXZD 2J1WA 2Z92B 1OGPA 4LVOB 4EIBA 5EUOE 2E56A 4NUJB 5T5FL 3INUH 3FSOA 4LHUD 3HHMA 3TBSB 5I23A 4ABQA 5A2CA 3V8OA 1ETB1 4ZSOB 4HKBA 2Q8BL 3SQOL 3VWKB 5IGXH 1VGKA 2MQ3A 4JFQB 5E9DE 5GJSH 4BH7A 1WG3A 1EHKB 2Q3ZA 5I1AB 4DP1X 3N1QC 1LILA 2G3NA 2OQJA 4CMMB 1U8HB 1DUYB 2DQIL 3GSQA 3ZIMA 3TTYA 3UPRA 3II1A 1HZHH 5JW5A 4BUQA 1EEUA 2NUPB 2CRYA 3ISYA 2J3SA 4NC1E 1S5HA 2D2OA 4LAJH 5KYXA 1UOKA 3SYOA 3VXMB 2NQDA 3U1PA 1YNLL 5D1XB 5IIEA 1KXHA 1IFGA 4U2YA 4KQ3L 4Z3IA 4IDJL 1ZA6B 1OPGL 5AKSA 3BN3B 1KCRL 2OJEA 2Q20A 5TQ2H 4NWTH 4ODXA 3BJLA 3RTQC 3NJMA 2L4OA 3N9GH 5AVTB 3SDXF 4CA4A 1V3LA 5EO9A 4BXVA 3C6LB 2BK8A 3U0TB 2VN3A 4OZ4B 3K71B 4MVBC 2OMWB 5HHOA 3X1GA 3EIFA 4JMNA 2R15A 2OMYB 4QUOA 1DVSA 2WXJA 1SEBA 2JKLA 3QJFB 4QRRE 2YEQA 5EU5B 4JFEB 2XWTB 1NEZA 4F7PA 4V1DB 4U6VH 4XMPH 5IQOA 2V2WA 3OAWA 4PJ7E 3OGCA 3ESUF 2WIIA 1RMFL 4EI5B 4OCMC 1A9BB 1FFPA 4QRQB 3BXNA 4NPYB 2E8YA 4MB3A 1EUTA 2ZOKA 3VI4B 3UTQA 3VD1A 4ZOEA 4LL1A 4N3TA 3WJMA 2C9XA 2RALA 4CVXA 2G9HB 2J56A 3D8MA 4JFDE 3ESVF 3QQ9C 5CBAA 1QX1A 3D2UD 4FJZA 1T0NB 2VXVL 4NQCB 4XMWA 2Z8WC 5I17B 2Q7YA 2XFXA 4KKBC 1PIFA 1A6UH 1JF1B 3HZMB 2EIDA 3NACH 1DO6A 1GYUA 1KLFB 4JB9L 3J7HA 4WCYL 3I2CL 1I9RL 3HHSB 4R4FL 4DT2A 2GJPA 3V10A 1KNOA 2Z4QB 3O3DB 1J05B 4FYTA 4Z7OE 3T2NL 1CJYA 3DJZA 1QW9A 1ZTXH 4M1DL 5D7KD 1FG2B 2NY3B 5LG1A 3TGXA 1H9VA 1QPKA 3CVIL 4GOSA 4L8CA 1BVKB 4LESA 4XWGL 4X4XB 1LVEA 2Z35B 2O72A 4LCCA 1NCWL 5LAPA 1N6UA 4R7DA 2X3BA 2VLLB 1OAQH 1Z9PA 3E8VA 5ETUA 1JXKA 3MREA 2EXWC 1N0LA 3QARA 5BOZG 3M1OA 3NG5A 5LBSL 4J7RA 2RH0A 2TRYA 4KFZC 3OAZH 3SPVB 1PD0A 2ZTBA 4JKWA 5G5DB 1E4XH 1CICB 1SEQL 3FO9B 4KKCD 2P8PA 1LDSA 5CIPB 2XPZA 4Z7UF 1OTTC 5CSZB 1G9NH 1KTRL 1CG9B 2PR4L 5AVRB 4HHGA 1QZ1A 2XT1B 3BH4A 4Z77A 3VQ1C 1AKJD 3BHBA 3MXVH 2PKDA 1A6TB 4R6UA 5FO9B 3L3IA 3CH1A 4HDIB 5IMKA 5D9SB 1BFTA 2WVVB 4XI5C 2WNXA 3AJ7A 5LUMA 2UXFA 4FLRA 4YXLL 1E30A 1JZ2A 5JHDB 3OAYH 2BVYA 2X1PA 2ICEC 3Q8AA 1JG9A 1M9WA 4M4RB 1IKOP 4YGVA 3U30C 3O3BB 5I9QB 3TONA 5JXED 1G84A 1AGCA 1Q72L 4OFDA 1WZ1H 1ZK9A 4ZYKB 3OPZH 3EF7A 3DSNA 2ROXA 4PVBA 3BPLB 5DS8A 1AXTH 3I02A 4KTDH 4GW4B 4AGMA 3ZKSD 1QAWA 1JZ3A 4Y5VC 1RUKH 4OCSL 3S3PA 4Y2OA 3LPFA 3HBPA 2JV6A 4WGWB 3FDWA 2QGBA 4S1RH 1UTDA 5D6DC 2IBZX 2NCEA 4KHXL 4UDTA 1GPOL 2VJXA 4YSTA 4YHNB 1IQWL 4KKAD 2GC4C 3DV6B 4ZW8A 1QHOA 3M17A 4WEUD 5C0RH 3GSNA 1AO7A 4MQ7A 2F1BA 2AJSH 5I8CB 4L3CA 3RB7A 4QO1B 3D85A 1T21A 3CDZB 1NFDA 3GSUB 4X2UA 1VZGA 2DLFH 1MLBA 3VXOB 1CD1A 4P2RB 1SJVA 3TJHD 3GHBL 5IUSA 1WK0A 3UZQA 4NRYA 4WUUD 3ULSB 3WN5C 4UQ3A 4V33A 4PAZA 2NYZA 2EYTA 2I25N 1ORSA 3DX7B 4WW2A 2FB4H 5F88B 5AVUB 2VMJA 4F80A 3NJIA 3CD4A 3L16A 4XCFH 3GK8H 4G83A 1FLTX 4JGJA 3VFVA 2NLJB 3GMNB 4POUB 4JG1L 4U31A 2AXGB 3QORC 2H32B 1UXMA 4P5TA 3FUIA 4TVPE 2VDQB 5FK9B 4PRDB 4X4ME 4MTMA 2EH8L 4UOW0 3B2PA 4F58H 3WKYA 4ZXBD 2SEBA 4MAYB 4MS8D 1MAML 2IAMB 3HN5A 1GOHA 2OMXB 4YAQB 4U1KB 3CBJB 3N04A 1WAPA 1QWUA 1QNZL 5IEHB 4QPEA 5C0GB 5HTSA 3TF7C 3L1EA 3NN8A 5EBWA 1JNHB 3BUIA 5CJXA 3WBDA 3EAKA 3EJPA 3S48A 4NNPH 2HKAA 1QRND 3QUZB 3TO4D 1H3PH 4N6QA 4XNMB 2PO6D 3QDJD 4KO9A 2GJJA 2HT3D 1KTCA 1MCEA 1J1XL 1C7SA 1ZWIA 2JSFA 4NZDA 4R83A 3FQWA 3W11C 1RL1A 2AJVL 2FSDA 5JHLL 5J0BA 2A9DA 4I5BA 1U58B 3OZKA 1HESA 5E94B 3CZSA 2DEYX 5DD3L 1HSBA 5C07B 4LCUB 3R7RA 4N5EC 3T5WA 2Y06H 5E1HB 2F54B 3X1EA 3K72A 3BSZH 5T8IA 1XQ4A 5DJYB 5DF0A 4M29A 1EO7A 3C5JA 3NIFB 2XC8A 5ESVA 3VI4F 3MV9E 2M1KA 4GFXA 3QFDA 3EHBB 4PRPA 4QAWA 5FFOA 4IKLA 4OGAD 4Y19A 1EUUA 1D9KA 1PG7W 5HI3C 4KKQA 5GS2H 1JPSH 2IH8A 4DP9X 1UASA 2BP8B 4R84A 1P7KB 3T1FA 1S9KC 2OL3A 2R1WB 5CJOL 1YEJH 3NZHL 3MRNB 1J5HA 2AQRA 5DO2D 5SWQB 5BPPA 2QKIB 5I8OH 5BO0D 3B7YA 4MBOA 3RVWD 5D1ZC 5JUEH 2F5AL 5DJXA 4D8OA 3FUFA 4N8VG 5GGVH 5KSAA 2APXA 3OKOA 4GMTH 4YPGB 1IBFA 3BVXA 5F7KC 4MDRA 4YBQC 4YK4B 4F7CB 2OXHA 3ZUNC 3MUHL 1JZDC 1U2HA 5DMYA 5I6OA 2M83A 3KYNB 4FFZA 1DQTA 2EO7A 2CDEA 5C0JA 5IK3A 2MNWA 4IBZA 2C3HA 5E03A 4A55A 4N0CD 2JIXB 1N3NA 5EU6A 4BCXA 4HCIA 2KZ1B 4ODHH 3FL7A 3HNTH 5BUPA 2X0WA 3NA9H 2QQLL 5B3JE 2VDMH 1SJXA 4JY5H 4UT7L 1BFVL 2ZX7A 4M3KB 1N18A 2H41A 1ONQB 5K1JA 4NAMA 3IAGC 2D7TL 1MCKA 2Y4SA 1DUZA 1W0VA 3ZKXC 4F9PC 1QLEH 4ODVH 5KAQG 1AH1A 2ZX8A 3GI9L 4MD4A 5C3TA 2XG5B 5H4YA 3AREC 2OZ4L 4XZUB 2ZG2A 3HMWL 2DLHA 2W9EH 4ZAKA 3IBEA 5D71L 2NPLX 1E7UA 5JTWA 3KDPB 1JCKA 4I2XA 2Y36L 3H0TB 2D9CA 1NMAH 1BFSA 2Z4TA 1J7VR 1EEZA 4GRLB 4HD9A 4PRNB 2AJXL 5D2NA 4LHUA 1S7RB 3ME0A 4U0RB 3IDIB 2PPCA 4AYFB 4NSKB 5I1LB 1IE5A 2DJSA 4L1HA 4GO8A 4P3CH 2H1XA 1N4XL 2CHNA 4PI0A 3MUJA 4ZPVB 5ESQA 1IGIH 5CP7A 3WNOA 1O6VA 3PY9A 3ZBMA 1E0OB 5DUBB 3D25A 3COOA 1QEXA 3WYRA 2MNUA 4Y8DC 3QUXB 5HGAA 1NTDA 3IDNB 1MH5A 4ORGB 1X5KA 4G42B 1PMYA 2Q0ZX 2QTEA 4C55A 5I1HL 1A9VA 4A7UA 2OMBA 2AVFA 5IBLC 3ARBB 1XXDC 2BSED 4MQSB 2BZDA 3QRFM 2AEQL 1I8IA 2ZPKL 1F41A 4FNSA 1WLHA 3S97C 5CN2A 3TZVD 5FUZL 4LB8A 2AEIT 1NQBA 1H8SA 4AG4L 4I0PD 1JK8B 3TT1L 3V9EA 3GBNL 5EUOB 3GKZA 1HYRC 1E6JL 4JZJC 1OAKL 1R3LB 1IQDA 1J0IA 2VDNH 1TMCB 5IQMA 3WCYA 3IDGB 3RA7L 4LBAA 4ODSH 1DSWA 1CFQA 3WGUB 4EQ3A 4WO0A 4MXQC 5E9DB 1XEDA 5A2LH 4XNZB 3FJTA 5BZXA 3JWNG 2BC4A 4YBLC 1QACA 2H1PL 3FUKA 4NCC2 2Y2WA 5GGRY 2IADA 2KLSA 2XI9A 3EOAB 4MMXC 1A6WL 1IC1A 3MGAA 5EV7A 1DJYA 1BCIA 3GIZH 5IJVB 35C8L 3LN4B 5DJDB 4PCYA 1T5XA 3KBEA 2QPUA 5CJ8A 1V10A 2GIXA 1IBZA 3KCPB 4HX1B 5E4AA 5EZPA 4BRJA 4J8RA 3CMOH 2B59B 2G0LA 2ED6A 3L3HB 5JPMB 2OL3H 2EQDA 3NPSC 3R4DA 1J12A 1WPCA 2EYSB 2GBUA 1HEZB 1UYWL 3TJEH 1CF1A 4L9DA 3UP6A 1KXVC 2Z8SA 2YXMA 1LL1A 5B1JA 5J9PA 5F7MC 5KYWB 2WKOA 2R69H 2FH8A 3SQRA 5F96L 3VW3H 2WTRB 4EF3A 5FA3B 2AEWA 3X14A 1A0QH 3NCFB 3C2AH 2AJUL 4K9EC 1VPOH 2CPCA 3W39B 1KY7A 4TOYH 6CGTA 4FFZH 4KTEH 4XHJD 5IZ7A 2YHGA 1S7SA 4QRRB 4PW4A 1G1YA 1G0XA 1CFSA 2GJ6D 2XYBA 4JG9A 2YEZA 1A1MA 3AQDA 1AMYA 3LX9A 4DK6A 1IL1A 1SMOA 1ZHNA 3BRFA 4PJ7B 2DWEB 1OGTA 1CLZH 1I9IL 4H13C 5IVXA 2XHNA 1D7BA 3H7BB 1CDGA 3QJXA 4KFMA 3IF1A 4QJ5B 5GZOC 5AAMA 3Q13A 2MKLC 2X05A 1ACZA 2IALB 2UYLA 3Q2CA 2R1YB 3AY2A 4ODTL 2NTFB 3DX9B 4BFIA 4XB8A 3NIFF 1M42A 4ZNEA 1UADC 4HQQL 1OW0C 2AXWA 4JFDB 3QYNA 4UUJB 2CCLA 5CWSA 4AM0B 2HMID 5C7XH 3GEWB 4Z0XB 5IFAL 4ELKB 3KYKL 4K7FA 5C0AE 1JPST 1WITA 2W60A 4DN4H 1AKJA 4NLHA 3CFJA 4ZOBA 4NQDD 1OQXA 5E1AB 3V5KA 3DJRA 1EDYA 1F6AA 5MHSD 4GP4B 4PY7A 3WLWD 1UFUA 2WYZA 1INQB 1F00I 4LGPB 3EXJA 4Z7OB 2FR4B 3SO3C 3MV11 4AI7A 5D4JA 4Z8FL 4YBHA 5EH1A 4QRBA 4LLYB 2GPZA 4ZMAT 4JFPA 1W91A 4C47A 1BD2E 1YPZA 4G6FD 3ZT7A 1BZQK 1RU9H 1XGTB 5FYJE 2ZAHA 1FAKT 4QXUL 3GSRA 4NKDA 2ESVD 1F4WL 3I3DA 3RKDD 3C09C 3L5WB 4BBWA 4LRNL 3A6CL 1CK0H 4PRBA 5E7FA 4QAMB 3FU6A 4KX8A 1FVEA 4O2CA 2W80C 5J7CC 2JH2A 3JV4B 3GBDA 1TPXB 1YN6B 3KPQA 4AW7A 1IC5L 3O4OB 1ZGLM 4J2QA 4P4RA 2QMKA 4LVEA 4X9BA 4U3XA 2ADGA 3R4RA 4HAKA 1Q9KA 2XZQL 3MJ8A 5AYQA 4RGNE 3DUUA 1MDAA 4U7SA 3O6FB 4WO4C 1GH7A 1ROCA 1S7TA 5EOCL 3GO1H 2AW2A 1CFMA 3MRQA 3P4NA 4PJ5D 3U7WH 4CU7A 5J8OA 4ONGL 5J6HA 4X6CA 5EN3A 4K3HA 5CSBA 3GZPA 3Q05A 5C3LD 1C7TA 4NERA 5E4EC 1TSRA 12E8L 3BAEH 1RK1A 4L9LC 4ZRGA 3BVDB 1EO8L 1AY1L 4MS6A 4DFHA 4YL4A 4D9QE 5E6IB 1JE6A 1YEHL 1IGMH 3RWGB 3WEOA 5C08D 4YDIL 1TO5A 4YDJA 1B2WL 5T33L 4WWPA 1IT9L 1NAMH 5EBLB 4KVPA 2WNKA 3DRQA 4F5CE 4N0FB 3CFIC 3FT9A 4HOMA 1YC7A 4K7PY 1L4IA 7FABL 5IFJB 2FX9H 4EUPA 1L0PA 2EUWA 4UBDC 3GXFA 3FQYA 4M43H 4BFOA 3MSPA 4UOQA 1E2ZA 4XP4H 2GITB 1ASPA 1EFQA 3LQAH 2HKFL 2PO6A 2A73A 3GMPA 2HFFA 3QDJA 1K3ZA 3WL9B 4LLQB 5DJ8B 1CYXA 1B9ZA 5EUOF