5D7EA

Crystal structure of taf14 yeats domain in complex with h3k9ac
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
140
structure length
140
Chain Sequence
LGSMVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQIPLNKPLLTEELAKSGST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords Transcription initiation factor TFIID subunit 14
publication title Association of Taf14 with acetylated histone H3 directs gene transcription and the DNA damage response.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 30
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5d7eA00
2NDGA 5IQLA 2L7EA 4TMPA 3QRLA 5IOKA 5HJBA 5D7EA 5HJDA 3FK3A 3RLSA 2NDFA
chains in the Genus database with same CATH superfamily
3HE6D 1KLUB 3PV6A 1SDYA 3LS4L 5F7EH 3TNNB 3VSUA 4CGTA 1ZHKA 3DLQR 5TPWH 3IMSA 2MQ3A 1CQYA 4KPHL 3DMMA 3MFGB 2XQYA 3PHAA 4WJ5A 4QNPF 3L3DA 5L4MA 3TESA 4QRSB 4CVXA 1FCCA 1A66A 1JGEA 2HCZX 4M7LH 5L0QB 3V0WH 1A6PA 4XVOA 5JHDE 1J0YA 4JEGB 1L7TL 1NJ9A 1RULH 3O9WA 3KZ8A 2HKHH 1AQMA 5GJSL 2AC0A 1W0VB 5HHNB 5K93A 1D6VL 4EEEA 5BNXD 4XN2A 2OX5A 3T2OA 4E42A 4WW2A 1JVKA 5EHFA 3KCPA 3WNLA 4WLCA 2BRQA 35C8L 5F0MB 2Y06H 2ZCHH 4XP4L 2ZCZA 2IJ0C 2CGYA 1ZCRA 2Z93A 3P54A 2BHUA 5IB4A 4APQA 3WD5L 1Q72H 3VYOA 4AUYA 1CC3A 3RJDA 2YLHA 4JHWL 1TJXA 2OSXA 3UCQA 4MRCA 2R9HD 5I9QC 3GLDA 1EBPA 1ZVSA 4X6FB 3T3PE 2NX5B 1J8HE 1UA7A 2IAND 5EOCL 4IMKC 1DQLH 1XAKA 2O6PA 5LAPA 1GZPA 1Z9MA 5CZXC 5BZZA 1DQDH 4XNAA 4DGYH 3OZLA 1KOAA 1UM4H 5D1ZC 5H37G 3RFRA 3BQUA 3SO5A 1DBBH 3SDDD 5I6LA 2OI9C 3NSCA 4Z3FA 1WIOA 4UILL 5KAQF 5TE4L 4WK4B 2MHAB 4PJDB 3SGDH 3QUZB 3CMGA 5B1JA 1A8JH 2JELL 2C1OA 2DZEA 1L6XA 2QPEB 3PWUA 1T1WB 4FTVE 4M48L 5I74B 5KVFE 4MDIB 4OT1L 2H1XA 3WY4A 4ZMLA 5DRXB 1N26A 4ERSL 4YDVB 1F90H 3LEXB 4FQXC 1ZY9A 4XNXH 4XO8A 3ZKMC 1I3UA 1XZ0B 1X5AA 2FBRA 3GDCA 5C07B 5DQJA 3TBBA 2AK4B 4HFWB 2NY6B 5IWLC 1A0QL 4FLSA 1YC7A 3EYVA 3POCA 3N3EA 5BVJA 1GS7A 4NQEB 2CHNA 4P4KC 5HHMB 2EC8A 5D2LE 3LTVA 4KV5E 1EV2E 2ED6A 4KY2A 3V0JA 4PRPB 3NSJA 4DN4L 1YMHB 3N44F 3KD4A 2XWXA 4O2CB 2QELA 4P5TB 1DBML 1RZKC 2MOGA 4LPUA 2VSDA 2J8UE 5CN1A 2EXSA 2HRLA 5BCAA 4ZUSB 5ISZD 5FGCB 1NAML 5IVXF 3HAEB 4ZO7A 1WLHA 3FHQA 2IQ9L 2YUWA 3RVXC 4PJIA 3SSGA 2YPLD 2PMZA 2NQDA 4YZFE 5E1HB 4HH8A 4DPCX 1ZE3C 5IMOA 1WQVT 2X70A 2LHAA 1F0LA 1WISA 1A7BA 1KWKA 3VWKD 4D0CA 1YY8B 4JMNA 1BEYH 1JFHA 2YMOA 4JCLA 2DI9A 4I1PA 3T2NL 3TH2T 1MCWM 1G43A 5TE6H 1T22A 4U0QB 5BW7C 4APXA 2O6FA 4EXKA 4JAMA 1E27A 1IBDA 1AGEA 1KPUB 1ZSDA 2EO7A 2GTZB 5F7EL 2WVSA 1CWVA 3I6KA 2AMGA 1SVBA 1P5VB 1B88A 3F00A 4EPSA 5AEAA 4V11A 4PGZA 5JNYB 2QPDB 2OJZH 4BYHA 3KL3A 3S3JA 1OY3B 1PX4A 3D4GA 4Y5XB 4M7LL 5CEZE 2EEDA 3V0WL 1COBA 1DQTA 3HLAA 3LVEA 2FT6A 2WLLA 3G04A 3G6JA 1MI5D 2ED7A 1U0QA 3HNTH 5B21A 1RULL 5B3JF 2HKHL 2B16A 4XXDB 5EUOE 4P2OC 1JZ8A 3I3EA 3Q3GA 1NL0H 5FF6B 3GSVA 5ITFB 1WVZA 1OTTC 3JVGC 2EUWA 2V5SA 3UBXG 3SJVB 1EMTH 4AQAA 4L1BA 2Y7SA 1KXTA 2Y06L 2ZCHL 3VU2A 2VDNB 3C5SA 1QO3B 1G1OA 1AYRA 4AXWB 5TJWK 2FB4H 3QUMA 1VADB 3L81A 1QW9A 1Q72L 1KN4H 2KLRA 5CGBA 3PDOB 1X7QB 1BZ9B 4KKBD 4B9JA 4HLZG 4Z7OB 4F7PB 5DQ9A 4BXSV 3DUSA 1B6UA 4JPIB 2DQ6A 1DQLL 2KT6A 3QAZC 3B1TA 4D9LH 5ICYB 1C5CH 4MB5A 2Y36H 3CDGB 5E08H 4DGYL 1DQDL 4K55A 1UM4L 4LU5H 5JXEA 4JANA 1UT9A 1OF2A 4OF5A 1JYXA 1DBBL 5CLZA 2Q2LA 2V6HA 5B1KA 4JQVA 5ISZB 2BXYA 2OR8A 3S9DB 4HOZA 1LE9A 5DHYA 4LLQB 4LQFH 3MV8E 5MERA 3CDYA 4IKIA 4IYKA 4U1LB 4YJZL 2DAVA 2PYEE 4Q9RH 1F90L 4V2BA 4XNXL 1PU0A 4E0RB 4CBZA 3VJ6B 5CJ8A 4RFOH 4XN7A 2CBPA 4JRXD 5FB8A 3G5ZA 3L3KB 2BC4A 4Z95H 2ICEA 3ARDB 1J5OH 1F6FB 2VDQH 2WLJA 4X5LA 4NUGH 2WSDA 1OIOA 1Q94B 4XAWH 4HXBH 4Y1AA 4WNSA 3L3GB 4NO2A 4DNLA 1JVLA 1J05A 1DQMH 1I1YA 5CEYA 3WEOA 3HTLX 4JY5L 2ZJSH 2MJWA 4Q6YA 2NRDA 2E4FA 2F54E 4FADA 2ZYIA 1T03H 3ZHLA 1IM9B 4X4YB 1IFGA 2ZX9A 1VB9A 2VLMD 3NFPB 2NY3B 2N56A 5KYWB 3X1FA 1NFKA 2Y5QA 2EC9T 4H1LH 1NPNA 2BVPA 3P3RA 5ANHA 2RA1A 2V5TA 1BFOB 1UXWB 1U3HD 4XHJC 5DS8A 4C58B 1ACZA 5L0QC 3QORA 4X4MA 2YGQA 3QWNA 3ABZA 4KUCD 4AEFA 3U79A 4ZMPA 1NC4A 1BEYL 2K8QA 4KXAA 2E46A 2X7LB 2FHBA 4K7FA 3L16A 2ICCA 3MX0B 2BOLA 1MCHA 3GXNA 2YEVB 5TE6L 1WFMA 1XR8B 5A1AA 5DURD 2E7LA 2DIEA 1I8MA 2C3HA 1S9VB 4QXUH 1G84A 4ZQKA 5CS7A 1VCAA 4B96A 4UT6H 3DX4A 4KH2A 3SE4A 2FO4A 1IZKA 3RX9A 5FM4A 1OANA 1KGYE 4XBEH 1TLKA 2XIBA 2OJZL 2Z4QB 3P4NB 4F27A 1VA9A 5I66B 2H9GA 3QQ3B 5ITBH 4GXVH 2CCWA 2YQ3A 3ESPA 1SBBA 3PWPB 4FYQA 3HNTL 5JOFB 3BE1H 2YPVA 2QJDA 4KJWD 1KXVC 1K85A 4ZNCD 2F7OA 3BEVB 5BMFH 1NL0L 1YEFH 5GRYA 4EJ1C 3CZFB 2XNAA 4F9LC 5I6MA 2ICWA 4LQ1A 1EMTL 5I2IB 4HWEH 2CUHA 3C60B 3QUZC 3IFLH 3ZY7A 1U95A 1JERA 2BY1A 4H0LC 3P0GB 1OSYA 5AVXB 3ZMNA 2XSKA 4RBPK 2LU7A 3EF7A 4ZPTB 1QSFB 2FB4L 5EOTA 4G9FB 4F2ME 1KN4L 1RIVH 5IW3A 3G5WA 1AXTH 4FQLH 1KB3A 1V05A 3DVNA 4LIQH 4MD0B 5GZOC 3FBQA 3HR5A 4D9LL 2NY6C 5LB1A 2ITEA 2WQRA 5TK2A 1QI5A 1F02I 1L9QA 2Y36L 5DUJA 5E08L 3SPVA 2CM6A 1IJNA 2J8HA 2KQNA 2H7WA 3LPWA 4LU5L 3PHQB 4L05A 4PJBF 4HHAB 1X6LA 3NJKA 3KS0H 3STBA 2YD1A 3HE6C 1XAUA 1HHIA 1RHHB 1E43A 4LSSH 1OAKH 1HEHC 4P5TC 3GRWH 4LQFL 4Z6AT 2KL6A 5JORA 4HJSA 3SOTA 1NICA 5A2CA 2V9TA 3ZRFC 4BUQA 3CZEA 1NIAA 2IMNA 3VD5A 4Q9RL 1WRFA 3QJFA 4L3FA 5SWZB 5F3BA 1LO3H 1KG0B 5HDOA 1X4XA 3H7BB 4FLRA 3PAVA 2DM3A 4RFOL 4IMLA 1A1OA 4AMWA 2ZWZA 5I8CB 3EXJA 3BAYA 3ZVVA 1N6VA 3APMA 1QACA 4HIPA 4Z95L 1M56B 4QXVA 3AABA 4KMLB 4WHTB 3W1ZA 4HULB 1J5OL 3DYPA 2VDOB 1QR4A 2VDQL 2D0HA 3KPOA 4KU1A 4NUGL 4XAWL 6PCYA 2A9DA 2WQ8A 4HEMA 2WQUA 4HXBL 3RVWC 5FYLE 3VFGH 4Q9CA 1DQML 2X4RB 1TZOA 4KZ0A 4L8SA 1FO0H 2VJ8A 2GVYA 1JF1A 1VF5C 2ZJSL 3EFOA 9CGTA 1FFNB 3S4SB 1T03L 4W9HC 4GEIA 1UACH 3OJDA 2RFXB 3BZDA 1TLMA 1WWAX 4PJ7E 2ED8A 3MRDA 4ENED 3B2UC 2R9HC 1G4RA 2FHFA 4EI6A 2W0FB 5IIEB 4XXWA 2DLHA 4RFNC 5GPRA 4RAVB 4ENZA 2YZ1A 1SXSA 4Z76B 3QAQA 1NAMB 1R6VA 1Q9WA 4EBQH 5D7IB 4Y5XC 1TXKA 1WS8A 1AG6A 3ARRA 1W6LA 3NIGB 5I15H 3VFOA 3IJHB 2YWZA 3GMQA 1IC4H 4EN3B 1E4JA 2XKSA 4TVPH 2CG9X 3TV8A 2CIKA 4Y88A 2YUXA 3B8SA 4WHYH 4QHKJ 5F6HI 3NMEA 3D7PA 3MLWH 2DQFB 5JQ6H 5I5MA 4ZDHB 2IBBA 4G6AD 4QXUL 5IFJA 5K39B 5K1NA 3BVDB 3KPRB 5EFIA 2CRMA 4W68A 1NZRA 3BDBA 4UT6L 3TN0D 4CSTA 3JSSA 4P2QE 1TSRA 4X99B 4XBEL 3EKCA 2Z0UA 4H0HB 3MRQB 3DDGA 4JQIH 4KJPD 3CFUA 5ITBL 4GXVL 3TL5A 2ZKYA 5FFOA 3NK4A 3BE1L 1RK0B 2N4IA 4JDVA 4ZOCA 4FYTA 4FLQA 4I87A 3S5LB 3B3IB 1SQ2N 5BMFL 3MHZA 1YEFL 4QRTA 4JFUA 1SN5A 4XCYA 3UPRA 5KSUA 4HWEL 2PW1A 3WN5B 3IFLL 3S96A 3T1WA 2Z3FA 1GC1H 1HFUA 3QNXB 5CCHE 3FB5B 5CBAB 1LP9B 2NPLX 3FTWA 2AXGB 4MJ6A 2Q76A 1YDPA 1EUTA 1QX1A 2PETA 1RIVL 1SXBA 4GW1B 1AXTL 2F7QA 4FQQB 4G1MA 4FQLL 4LIQL 1LILA 3IGAB 2ORBH 2JB6A 5AWNH 5F1NB 1ZGLB 1M6OB 3ARDC 2XFXB 5CJXC 4UTBA 1P2CB 3FSOA 3AT9A 2V2TA 4DP5X 3UEZA 4AQ1C 1PG7H 3ROLB 5DHVH 3TCLA 3KXFA 3UXFA 1IT9H 3EXLA 4LSUH 1PVHA 2CUIA 3RVUD 1ZTMA 4LSSL 1OAKL 3RWEA 2ZX8A 3GRWL 2PCFB 4OFYD 4UOQA 4TN9A 3EO1A 3HR6A 2OMBA 4Q6IB 3NJIA 1UB6A 3MRGB 2NY3C 1F5WA 3X14B 3NJVA 2X9XA 3MRNA 4G43B 4RAHA 1LO3L 1CL7H 5I17B 1UADC 4NO0B 1IGIH 2ATPB 4L8BB 5LCVA 1H5BB 2UZPA 3T2PA 1OSEA 4FXKB 2NT0A 4JCWA 4H0IA 4QF1A 4IKKA 3O6FB 4LHJB 3VFGL 2BSRA 3RUGE 4MZRA 1FO0L 5D96C 3VFPB 3FCSB 4FFVD 1S7SB 5D72H 4GQZA 3BW9A 3MBWB 2YFNA 1P7KA 3SDXB 2IPKB 1YPZF 2V33A 2YXFA 1FNSH 3EOBB 3JWOH 2KS0A 1EHKB 1EX0A 3T3MB 2UYLA 2QQKH 2UZYA 4KKAD 1R24B 1UACL 1UM5H 5IMKA 3K46A 4GPVA 3FL7A 3KYMB 1WFTA 5GGSA 4NP9A 4XAKD 3FO2A 2PO6D 2C26A 1OAZL 1XGZA 3NDZE 1IFHH 3V4VA 3V9CA 3EOYG 4EBQL 1J12A 5C08A 3IETB 3FQXB 3ILQC 1Y6MR 4AIOA 1IC4L 1CDYA 4TVPL 2CCLA 3S5YA 2ZP8A 2X87A 2VZOA 3HZKB 3O4LD 3TBVB 1GIGH 4KQ3H 1A47A 1BBJA 4MZ2A 2YC1B 2IALB 3LKOA 3MLWL 4GO8A 3L08A 5E6IA 1F3DJ 4ODXB 4ODSH 4QTIH 5JQ6L 1NCAH 1TFHA 2EH7H 3BD5A 3R4DA 4E9RA 5IUCA 1DDHA 1LWHA 1HHHB 5K1VA 2NX5E 2WTPA 1S2EA 3X12B 3CX5K 3DJZA 1OCWL 2MIZA 3FOMB 1HQRA 4U6YA 4JHBA 4JQIL 5CAYB 2GFBA 4XC3H 1UD2A 1MVUA 2VR3A 1N5YH 4N2LA 2XZZA 1DQQB 1MCPH 4WI7A 4K3DH 4J4PC 5DEFB 4BBWA 1JHTB 1XL4A 5A6MA 2OQJA 3QCTH 3BPLB 3FTGB 4JFFD 2GHWB 1GMEA 4PV1C 4UAHA 5HYJE 1GC1L 4TNWF 3FYEB 3VXOB 1NIEA 5F71A 4C56A 1B90A 1OHQA 1IBHA 2R1XA 5DEJA 4QGTA 4XZUB 2J57A 1UGNA 1SYVB 4X5PA 2KH2B 1EBAA 4FXTA 3WN6A 1D9KD 1ERNA 1SHMA 4LNRA 2H6UA 4LPVA 4MSWA 1BJ1H 2CLRA 2WINA 3BD4A 4UV7H 3IMWA 5B3NA 5AWNL 2ORBL 32C2B 4N8VB 1PZ5A 1FIEA 4BH7B 2FJGB 4PRPE 1WG3A 3ATEA 3O45A 4TPRH 4JFPB 3VW3H 2X6AA 3JYCA 1S4IA 4RQQA 4UDTA 2AF2A 1PG7L 4KBPA 3PUUA 3EJTA 3KDPB 1QLFB 2AQPA 1IT9L 4WQOA 5FGCE 4LSUL 3BWSA 4BWTA 2GTQA 4QT5B 3SGEI 4ODTH 3D4YA 4Y16A 1ADQA 4RMVA 2VLRD 2ROYA 5I0VA 3CSPA 4ZTEA 1X4YA 5F72S 2QL1A 3WFHA 2Y22A 4LF3B 1E4XH 4ZS7H 2D7TH 5CHNB 4NN5B 5ID0A 1CL7L 3PQYA 1F2QA 2VXQA 3AWFA 1IGIL 1KXQE 4Q56A 4JFVA 5I0ZA 5F6IB 1CU4H 1S7VB 4IOSD 3MR9B 4I3GA 1ONQB 4MQSB 4KJWC 4GBXD 2XN9D 2Y69B 3TIDA 5FWRA 3U0PA 1XVSA 1XB8A 2X4OA 4RMSA 3HPLB 1Q9LA 3UZVA 4EN3C 1MIMH 2MCG1 1ORSA 3U1SH 5D72L 1KJMB 2CDEA 2YMTA 2BCKA 2JK5A 1FNSL 3JWOL 2VDQB 2QQKL 3VDCA 5DZOA 1UM5L 2F74B 3SD2A 4CC4C 1RVFH 2EO1A 1RUQH 2DD8H 2IG2H 4OUUA 4D0DA 4YE4H 2JJSC 3KBEA 3ZE2B 1HSAB 1A21A 5HTSA 1HZLA 1CXHA 1SXZA 1TMCB 1U8QB 1IFHL 2NNXA 4XBMA 1WO2A 1IEHA 3HI6H 1L0XA 2Q5BA 1IM3A 4H1LB 1ZHBA 3SJVE 1JGDA 4Y19D 1JNJA 1YMMD 2AVGA 5SX4H 1FORH 4YSTA 5AAWC 3FJTA 4HW6A 1T1XA 1GIGL 4KQ3L 2O5YH 4WWNA 2XQBH 1G5GA 3F7QA 3WN5C 3P77A 3AQDA 4ODSL 4QTIL 4KQ4H 1NCAL 1EO8H 4FMFA 1MCEA 4GKLA 1MCJA 2A74A 1DVFB 5C0AB 1GYAA 1XR9A 2EH7L 3NSXA 2G3NA 3D0VA 1QD0A 1UATA 4Z7OE 1TQBB 3IJSA 3T71A 3FHEA 4DZBB 3RWFB 3OKMA 3AITA 3G5XA 1QA9A 4B97A 4JKLA 1XDTT 4XC3L 4HCRH 5EDSA 3HG1B 3OMIB 5DJCA 2QGCA 3UDWC 1N5YL 4GW4B 1EPFA 5DFVC 3QORD 1MCPL 3UC2A 4K3DL 2V7NA 1RZFH 5K9OA 5FM8A 2OMXA 5L2JB 3QCTL 2XA8H 2WXIA 3F58H 5FEBA 4CMHB 1MQ8A 1P7BA 4GAJH 1BVNP 4FAAB 5B39A 5BRZD 4CVZA 2CO3A 2OMZA 3MUJA 2CHXA 5K9KA 3BFOA 2DWDA 3QG6A 2BHYA 5TDPA 3KPTA 4Q6IC 3L3IA 1M7DA 1OP5H 5D5MA 2N1KA 4TVPD 2AZUA 2ZWLT 5T1MB 3MA7A 3D0AA 4R7DB 4K3JH 3ZW3A 5F2FA 2JMRA 1BVNT 3WAKA 5JIPA 4UV7L 4LLUA 2PPFA 5JPNB 2OZ4H 2EDJA 4X2UA 1NDGB 1KTDA 4TPRL 3VW3L 5ECJE 1G0YR 3PCYA 4RZCB 4TUKH 1VFAA 4E9TA 1W72A 1JWMB 1SM3L 2RAMA 2OSYA 3ZIYA 3US9A 4OFDA 1PW3A 1YN6A 4LHUG 2NQ3A 3DROB 2ATKA 1HOCB 2CJTA 4X6BB 1BZDA 4PR5B 3ZE1E 2HFEA 4ODTL 4Y9EA 3KPSD 4PJEF 4H40A 4Y4KD 4YAQB 1HESA 1ZV2A 5CWSA 1E4XL 4ZS7L 1AD0A 2D7TL 1ZOXA 4ZS6D 5F97E 1H6FA 5GRVL 4S0SD 1A4CA 3VVVA 2HZHA 1AS6A 1A9VA 2Q20A 1XH3B 4JFOB 4YR6A 3ULVF 4U6HB 2JCCB 1CU4L 1GKEA 2DMGA 5J5EA 4NJ9H 1WCQA 4CSPA 1UWXH 3L48A 2R2BA 3RYMA 3JTSB 5D7LD 4ZNEE 4ISVB 1MFDH 1HOEA 5ECGA 4N2MA 4BZYA 3BP6B 4NNYA 1MIML 3K74B 3U1SL 4WFHE 3QRBA 2PWGA 4HFUH 4DCQA 3BZ4A 2IWFA 4M62L 1G7MB 5LBVA 2EDQA 5D7JB 1NCUA 3ALXA 1YEDA 4P57A 1RVFL 1FO0B 4WNQB 5KOMC 1RUQL 2DD8L 1UZ6E 2GJPA 2IG2L 3OLEA 5EBLB 2R0KH 4YE4L 1RERA 4U1JA 2K6WA 5H37H 1QSEE 3KLQA 1AGCA 1PDKB 3FU8A 4CU6A 4QHMA 2BWIA 1V55B 3ECBA 5DK3A 2W60A 3HUJF 2VXVH 1U91A 2C9SA 2ENYA 3HI6L 4I4WA 2ZSWA 1ZJAA 5DFTA 4X50A 3WO4C 1YNTA 2AV7A 2WWNA 3MNMA 4JO3H 4R0LA 4PVBA 4JG9A 3WE6A 1NC2B 1FZKB 4M8QA 3GWJA 1FORL 3ESVF 2I25N 4OCNC 1L9NA 2P42B 3BPLC 5C3IA 2O5YL 5BOJA 1QSFE 2W38A 2OMVA 1TZIA 2XQBL 4N2OA 4R7NA 5CEXB 5ELIA 4YXKH 2AEQH 3A21A 3KLDA 4KQ4L 1EO8L 2IOMA 1A22B 5A2LH 1HKFA 3RBSA 3K6SB 4YPGA 3WTXA 1MCFA 4UWQB 2G3ZA 1ZS8B 4Y2OA 2DJMA 4J3OG 3MV7A 5AVTB 3VM5A 3RPBA 1NCWH 3B7RL 3DOSB 5C71A 4MQTB 4X4ZA 1N67A 5E2VH 3VXMD 4U1SB 2IPUK 4XNUH 4Z0XA 4HCRL 5H2BA 1T7WA 4LGPB 1FYHB 5C0BD 4HAGA 1T4KB 1RZFL 1HWWA 1BDYA 1N5AA 3NUKA 1BQLH 1RURH 2JJUA 3QNYB 2BP8A 4NN6C 4O58H 2CO7A 3BIKB 3BI9X 3F58L 4MWFB 5EC2A 4LL4A 5MEOB 1L7IH 4YHKH 4YGVB 4Q14A 5CBEA 4GAJL 4M5YH 4E5XB 2DQEH 4O51A 3H9HB 3K6OA 2R2EA 3MNVA 4KWUA 5SWZE 2WP3T 3BESR 2X41A 3BZEA 3WNMA 1HH9A 1DQVA 3ME0B 3MLPA 3TTSA 1CE1H 2DWXA 1NGZA 4ZAKD 4NN5C 4K3JL 5DC4B 3CK0H 2BOBA 1F3JA 4L8CB 1PYWA 2OZ4L 1WBZA 3MMEB 5E99H 5JZ7D 3MLRH 1BHGA 1L6PA 1XCQA 5FK9B 1U8KA 3NBNA 4TUKL 4GUOA 4AVKA 1OT4A 5HI5D 5CXPA 1Z6JT 4GJTB 4XH2A 4B53A 5IOPB 2DKSA 3J8F7 5DTFB 1TZGH 2QSTA 3GKZA 3S88H 1LE5A 1EEZB 3H7LA 2F8VA 1TEYA 3FT0A 1OTSC 2WLIB 5IG7B 3VU1A 5DHVB 4PGEA 5JHLA 5E6ZA 5GGRB 4L1HA 3M1BA 1S7QB 1ECZA 3MYJB 4BCZA 5D7IE 1BGXL 3IJ8A 3L7FA 4RFEA 1T20A 4WW2F 3PJSA 1O6SA 4OJCA 5C9JB 4C57C 2MOQA 2P8LA 1AR1B 4NJ9L 5I8EA 2ZAHA 4I89A 2HLEB 1E28B 3CFJB 4BA0A 5JW4Q 4B50A 1MFDL 1EAPA 1JK8A 2Y2TA 4JR9H 4NAMA 3FU6A 5IEHB 3MNWB 3MCG1 1WT5C 4N2CA 4HFUL 2F8IA 4G11A 4PGCB 3D3VB 3KPRE 5IW6B 3O81A 4U7KA 4HLZH 5F9OH 4ADJA 2GITB 4HX1B 3IMRA 2FR4B 1IC7H 2QKIB 2A3TA 1DVFC 2WLYA 3ABMB 3NCMA 4MHHI 4P23B 3CCHB 4A04A 1X7TA 3GI8H 1BYOA 3L3JA 2R0KL 5DR5H 1D9KC 1TQBC 3Q01A 2G4GA 2YN5A 3N44B 2X4QB 4ZMNA 4YHPB 3GXDA 2VXVL 4BKSC 4HJUA 1P4LB 4N1HB 1N6UA 3ULAB 5IVXB 4JO3L 3T0WA 3LQZB 2DKMA 4P8QA 2PPAA 1N6QH 1J9TA 5E0QA 1SMOA 2GJ6E 4IRJD 4CMHC 1SY6A 3FXIC 3AREB 3VCLA 1Q1PA 5ADOH 3M45A 3QEHB 1HHGB 3DYOA 2BY3A 4YXKL 2AEQL 2E56A 2F1EA 3FRUA 4I7ZC 1M1XA 1OD9A 3GHEH 4KI5D 2WSPA 4DOHE 3BH8A 4UU9B 1ZT4B 2BJML 3UTSE 3IRCA 4UZSA 1R3KB 3PHOA 4EXPX 3F5WA 4L0YA 2RJMA 4LOEA 1B9ZA 1NCWL 2F0CA 5E2VL 1YEIH 1NTDA 1P4BH 2CDFA 4XNUL 2YD7A 2QADB 4N0YH 2F54A 2PWDA 4RGNE 3UEQA 3EZ8A 1D6EB 1WA1X 5CIPH 1E6OH 2Z92A 3P9WB 2H4EA 4A38A 1BQLL 1RURL 4PJIF 4WFFD 5IREA 1JCKA 2ZIDA 3CFEB 4G8GB 4O58L 3RWJA 2PYFB 1L7IL 4YHKL 4ZUWB 4B5EA 4M5YL 2J6WA 2DQEL 2QBWA 4P06A 5F44A 4YHLH 4JHUA 3NP3A 2R2CA 5D1QB 3ZSTA 2R0LH 1UD3A 4Q0XH 4ZMXA 3H9SE 3CBJB 1CE1L 1L9PA 3T04D 5JDSA 1VFUA 4FX5A 4IJ3C 4CMMA 3CK0L 2DH2A 1EGJH 1R47A 4OFKA 3WNOA 1E7VA 3FFCD 2HPTA 4JKNA 3E8VA 3WKNA 2EIZB 5E99L 3MLRL 3BOVA 5F7FA 4LLYB 4QRRD 3QHFH 3VXSE 2KBGA 1JNHA 1I9JH 1EZSA 3D85D 4AQOA 2JE8A 1VJSA 4PTTB 3HRZA 3L2MA 4I3RH 5CGMA 5FPIA 1TZGL 2K8MA 5A43C 4JZNA 1ZS2A 3S88L 2G4EA 5EZJB 4YPJA 2YUVA 3G6JF 3P3TA 3WUZA 1X5YA 3D0LB 4PJ8D 2EDNA 5FUCE 3QZOA 4OF3A 4AY0A 2JV6A 3I50H 2FEDD 2VTFA 4TSBH 4NUJA 3V52H 5C09A 4ZI8A 5DZJA 2YAOA 3ARBB 5KUMA 3GXFA 3X17A 1BV8A 1Z0NA 1Z3GH 4I5BB 4S1RH 2EIMB 2Q7YB 1XH0A 2P46B 3HC0B 3ILPA 1UOWA 3GRGA 2WP3O 1PY0A 4JR9L 5DJAA 5GIRB 2CMRH 4W1TA 4XRCB 4F2MA 1YA5A 4AYDC 3MRCB 1CGTA 1MJJB 1FV1A 1LD9B 5F9OL 4R8WH 2B3IA 1IC7L 3AU1B 4EN2A 2UZXA 3GI8L 3ZZLA 3FSWA 5DR5L 5SWSD 3TCTA 3U6RB 1YRKA 5HYFA 4OI7A 1E9PB 1AZUA 1OKEA 4TVSa 1HZKA 2JKIS 2H2PC 2LU4A 2WTOA 2XX1A 1FCGA 5IB3A 3BPCA 4GQRA 2JLLA 4C83A 2VQ1A 4DP0X 3VD3A 5BQ7B 5CR8A 4LVEA 1BMGA 1NGYA 1N6QL 2OPCA 5D1XB 5C7XH 3QQDB 2OMWB 1I82A 5CSGA 4CUCA 1JZJA 1D5MB 3VRIA 3WGUB 1HHJB 5ADOL 1OGSA 5DZ9A 4IS6A 1M3JA 3GHEL 4N5ED 3D69B 3UGEA 2CAKA 2Y07H 4LFHG 4Y2DD 4E9LA 1TT6A 4BUGA 3MJ9H 1CGYA 2VZ3A 1NGWB 1LXMA 3KWVA 1PZ2A 2J72A 3QUXB 4YIQA 1YEIL 1GC1C 1P4BL 4AW4A 1TZAA 3O2VH 1DEDA 2VYRE 1CPUA 4N0YL 1NFDE 1EZLA 3S36X 5EUKB 3US0A 4ODVH 5EH1A 2X1PA 3BVWA 3U46B 3MVSA 4UTAA 5ABDE 1QFHA 1I7ZA 1R3HA 2NNAB 1E6OL 5JA8B 4U1IB 1IARB 1ETA1 4GQ9H 1MFCH 3HC2A 4OFPA 2W92A 2ZPKH 4PRAA 1KLGA 2NYZA 4NLHA 2QLVB 4XNYH 4YHLL 4XBPB 3HJ0A 1PNDA 3W11D 1VKXA 1XMEB 1XB3A 3QDGA 2R0LL 3VRLF 2ENPA 1R17A 4Q0XL 1MCNA 1MLBB 2ALWA 2JIXA 3GSWB 5GGVY 1N8ZA 1XSJA 1ZMYA 3KPLB 1EGJL 2XPYA 5DJDB 1CTNA 3LZLA 3CG8A 3HA0A 2H41A 1AR1C 4I13B 4HK3J 4LGSB 5GS1B 3QHFL 4FQCH 3WMQA 1ZT7B 3CN0A 4MJ4A 1OQXA 1I9JL 4V1DD 4DZ8B 1ZHLA 1UOKA 3E6HA 4PGDB 1JZHA 1CIUA 4GP8B 1VEOA 4P2QA 4I3RL 3BO8B 2AAVA 4M1GH 4DUXA 1RZ8B 1P5UA 3LY6A 3VXQA 2P5WB 5B38G 3ZE2E 1TTRA 3SGDI 2QKIC 4P23C 4R90H 3TBSB 3U0TA 3I50L 2E76C 3J07A 4QWWD 4TSBL 1DFBH 3I9PA 3QHZH 4K9EH 3V52L 1WH0A 5DD5H 5IBUG 4RIRB 3IAPA 3CXFA 4KK6D 3WHXB 4YHIB 4DVBB 5EIIA 2VIRA 4PI0A 2G5BB 3QUGA 3VGDA 5FO9B 4N0UB 2WXNA 1Z3GL 1BZEA 4PP1D 3S0PA 2CJUH 3CIAA 3GPEA 4G42A 4S1RL 4LPTA 4U1KB 3D25A 5GGTA 3VXUD 4PY7A 1J86A 2R7EA 4NO3B 3EJUA 1X9LA 2CMRL 2LLLA 2Q6WA 2PN5A 3UC0H 4RNRB 5I73B 1T83C 2CHDA 2ZUWA 5C0AE 4S0HA 5F3HA 2CLVB 3FO9B 5HHOE 5HSFA 3KLKA 3GSNH 4R8WL 2IQAA 3G7TA 3FONB 3GJFA 4X7DC 5F7AA 2Q2EB 1B0GB 1EHNA 1A25A 2KPNA 4WZ9A 1AFVH 3DX7A 2AQ2A 1U3JA 3IFNH 4YL4A 5AB2A 2X3CA 3QEQD 3IE4A 3L95A 5I6XB 2HRGA 5CGYD 5KBMA 4KTYA 2NZ1A 4WU7A 4P99A 2FX9H 2NY4D 2ZWYA 3QZPA 2W8CA 4I1RA 4X8XA 5BZDA 2UX7A 3L17A 5IQ7H 4MD4B 1VSCA 5C7XL 5F21B 4OZFG 4X9YA 3ZZ1A 4YSSA 1ZXKA 4KX8A 4GINA 5GS2D 1AP2A 1FG9C 2ESVD 1T66D 2FX7H 5A16B 2Y07L 5MENE 4O9HH 4P48A 2IGFH 3MJ9L 4Y9BA 3II1A 1RXLA 5TH2B 3QPXH 3RUGA 5E1GA 4FXGA 3FTZA 4J8QA 3V5KB 5DEZA 5KW9H 3SO3B 3MGOB 3O2VL 4GLRI 1TCMA 4BK4A 2H5UA 1H0DB 1KTCA 2X28A 4ODVL 1VACB 3GBEA 5DD6A 5DFWH 2F68X 4JDZB 4E36A 1DQIA 4XBGB 3JUZA 2C7FA 1KV7A 1D5ZA 3GMMB 3REVB 3RGVB 2KDYA 5HGBB 4DN3H 4GQ9L 1F3RB 1MFCL 3FYIB 3RIAK 3T6ZA 2X0WA 4XNBA 2ZPKL 1OAYH 1N59A 4LLMA 4XNYL 1XF3B 3OWRA 3VRJA 3QQ9D 4U05A 1JN6A 3O2DA 5TF1H 5JIDA 4ANWA 3QDJA 1MHCB 4KX7A 3WS6A 4PRHA 1CG9A 3L7EA 3O8XD 4YNYA 1LYQA 2CJSA 3FHAA 1FG2B 4PAZA 3ML8A 5FO7B 1I1AA 4HK0A 3ARBC 4P2RB 5AL8A 1AOHA 4PY8I 5FUZH 3T65A 3TO4A 3ESNA 4CJ0A 1J0KA 2ZXDA 1DUYA 3W0WD 1S9WA 2WV3A 4FQCL 2WXMA 2R1WA 3FFDA 1CDIA 4N22A 3UTOA 1PQZA 3PWVB 4GAFB 4CVWA 2L4OA 2W07B 1X5KA 4M1GL 3N43F 4HMEA 4F58H 2XLLA 4N9GB 1SQMA 5FXCH 3UX9B 5KYXB 5DJ6B 5T1LB 4R90L 2DN7A 5DGQA 1DFBL 1IQDB 1PZSA 3QHZL 4K9EL 1PJWA 3UAJA 5DD5L 1LQSR 1T7XA 4EUPB 2ZXQA 4I2XB 2YKKA 1I8LC 2B39A 2PCPA 2WZ0A 4J3UA 5DI8A 5E6RB 3ZO9A 1O7VA 3OLDA 2P8MB 2EXTA 3IFPB 2CJUL 5HYJA 2V3EA 1OGTA 4NX0A 4LCWB 1RIUH 4NYLB 2ADJB 1EO5A 4D2NA 1AZCA 1JYNA 5I1LA 1S7UA 1BVLB 5D1XC 3UC0L 2O6CA 4WUUA 1M7IA 2YFOA 5J9PB 1T0PB 3ETSA 3RAJH 1QFOA 1BF5A 1A02N 4Z7NE 3CVHB 2ZOKA 3DTXB 3NJLA 3T1FB 4KNTA 3GSNL 1AQDB 2B1OA 3BSGA 1KJVA 4IW4C 1WD9A 4YDJB 1S7RB 2CM5A 4KTDH 2YWYA 2C7UA 1EVTC 2DWTA 3IDNA 4UQCA 5B3SB 2GT9B 3VM7A 4F7EA 4JM2B 3LD8B 3IFNL 3I02A 3ECQA 3QUXC 1HINH 1WK0A 2GTWB 1MCKA 1DANT 2N01B 4QNPE 2XU9A 2FX9L 1I3GL 1IZJA 3LEVH 5KBPA 2WQXA 3RNKB 4OGXH 3QO0A 4KO9A 4QTHA 3HBZA 1YUHB 3CDCA 5IQ7L 4RDQG 4Y2NA 1GZHA 1ZLUK 4BELD 4IHOB 1QFPA 2CDGB 3MLTB 4PJ8C 1KXQA 3FCTA 1JIBA 1QVOA 2A6DB 2FEDC 4U1NB 4RGOH 2FX7L 4WTZG 1ZA3A 1T1ZB 3LPGA 3MRIA 4WIQA 4O9HL 4PBDA 2IGFL 1E2VA 3CFBB 4FQHA 3F85A 3QPXL 1A6TB 4FNQA 3N40P 4FFWC 2DICA 4P46A 5KW9L 1F58H 2Z34A 1H19A 3QPQD 1SPDA 2DYPD 3FAXA 4H25B 1NUGA 1LMKA 4ZTPH 1YN7B 3GMLA 1ETZB 4GKZA 3OKOB 3L4WA 5TFSH 4C4KT 1KB5A 5GS1C 3AACA 4HU8A 2NXZD 3HI1B 1B4LA 3E8UH 1KY6A 4JFDB 4DN3L 5AD0B 1RUAH 2YQBA 4JBSA 3AGVA 2WCSA 5E2WH 1OAYL 3C08H 3LEYH 4BGLA 4F7CB 2IAMA 3G9VA 3QXUA 1D5BB 3IJEB 4TOYH 1P7QA 3PYCA 1KENH 4X9GA 5TF1L 3MJ8A 3UFIA 4ORGA 3VXRB 1VFBB 4TUJA 4AC4A 4JDEB 5T1KB 3VFRB 1L9MA 2G9KA 4WSKA 5DJ8A 5CSZB 5FUZL 2VABA 1F11A 1K4DB 4L0ZA 2BZ7A 4P49A 2IH1A 5J6GA 4PJXA 2CUAA 5DHXB 4J39A 3F6IA 1NH6A 2EE2A 4H26B 2MCMA 5D4IA 1NM4A 3D08A 5HHXH 2OTUB 3QDMB 3RB5A 3M86A 3ZE0F 4PHXA 1M2VB 3T4AB 5HD8C 5CP3A 2NUTB 5C0CA 5I73C 1G6VK 3UAEA 3IDGA 4F58L 4K5MA 2JF1A 3L3OA 4NQDB 5IHUH 2FGZA 1OO2A 1TIUA 5L4JA 5AUMB 1UXSB 3CLWA 2WWMD 3AXHA 3ULUH 4TYUA 2COVD 4WWKA 1X4ZA 4GAGH 3RB7A 4X6CB 3M8OH 4ABQA 3I9IA 2WJ5A 2FVNA 2IADA 3AS2A 5H94B 3ZDZF 1VEPA 3BH9A 5IJCC 1LO4H 4MCZA 5HVFB 4W4NA 1RIUL 2VSKB 5DZLA 3QUMH 3H42H 2EXWC 3U9PH 5LAXB 5HDRA 4GRWF 3RAJL 1X5XA 1S7XA 3W11C 2DEXX 4WSJA 3CSYA 4LEOB 4AYMC 3AS0A 1RJLA 2F2HA 4RMRA 4U1HB 1H8OA 4KTDL 4MKTA 2VH5H 3QEGH 1DVUA 2V3FA 5C6TH 4JB9H 3LVTA 4QOKB 4XOCA 1LLAA 2GUYA 1I7TA 1USQA 4IBSA 5IMLB 2RQ8A 4L4VE 3U48A 3LRSB 2WXLA 3FUFA 4X6DE 3ZRSA 4LT7A 4OW6A 2ZAIA 4WO0A 4Q4EA 1SJEA 1NCGA 5IROC 3OLIA 4OFVA 4LXFA 4WO4B 3LEVL 3TV3H 3ZMRA 2HB0A 1UVQA 3QR0A 3WY2A 4K5NA 4OGXL 1N3NA 3RFZB 4GG8B 3RGVC 1OE3A 3J27A 5D1QE 2P80A 5DVNA 4KKCC 1O9ZA 4O2FB 1IGYB 1U8CA 2BMKB 3CIQA 4MNGB 5KYUA 4DGVH 4NI3A 1OCZB 4W9ZA 2XWBA 5FM5O 5HI4D 3REWA 4BCYA 1TNNA 5AKSA 4QWWC 4RGOL 1Y1UA 1XIWB 1GKOA 4ONFH 3C6LA 4AM0B 4PJ9D 4KK6C 4XB8A 3FO1B 4LPWA 2Y1ZA 4X0KB 3T0BA 1AKJA 4MDRA 4K2UH 3V0IA 3FULA 5FR3A 1HL5A 4UNTA 3R8BB 3LPFA 3WL9A 4RRPA 1F58L 2JKLA 3WYRA 4ZTPL 3U9UA 3W57A 4DEPC 4N2FA 2HTKC 2J71A 2ZONA 5TFSL 4HKZA 4D9QE 1U58B 2XHNA 1GCYA 1MHHB 4L0PB 4XO9A 4W6YB 3E8UL 4MJHA 1FGVH 2WQWA 1FI8C 1RUAL 1W2KT 3MRFA 4ZZFA 5FWQA 5IP4A 5LXGH 1MW3A 4XNZB 5E2WL 3CN4A 1JTTA 1QSEA 3ZKSD 2OL3H 3C08L 3LEYL 1LMIA 3LN5A 4U3SB 4Y4FB 4TOYL 5DS2A 3RY5A 5DZPA 3ZQ9A 1KENL 4GXUN 2VL5B 3CFKB 4JMXA 1F1AA 4F20A 3D48R 3DV4B 3K1DA 2P43B 3MBEA 1NIFA 1PZUB 4XMTA 1AG0A 4MJ5B 5J57B 3RPKA 1YY9D 1ZLVK 3Q6FA 4JFQA 3QH3A 1BLNA 5D2NC 5E4AA 2X09A 4MJIE 3QVAA 1HDMA 3PIQB 1J8RA 3BVNB 3JZ7A 1LO5B 1HC1A 1DLFH 3MNZA 1DLHB 5HHXL 4D9RD 4U2ZA 5L8LB 1O9VA 2XN1A 3D2UD 1QFWH 3JVFC 2A6JB 4L3EA 3MRPA 2HMID 1KIQB 3EBAA 3NT0A 5IHUL 5J89A 4PREA 3ES6A 3BUQA 4R4NC 3WUWG 3H9ZA 3ULUL 4XVTH 5H8DA 2YPVH 4UNUA 4GAGL 2P45B 3ECWA 4C4KO 2OP4H 2JIXD 3M8OL 2EYSA 2LABA 3OMAB 1XX9C 4JM2C 3DRTA 3HFFA 3ARQA 3DWTA 4NQCD 5HGHA 4CC0A 2FJHB 2I9TB 2FWOB 1INQB 2BSEA 3D39D 4PJEB 3UTQB 4RAUA 1DR9A 1LO4L 1BYPA 4B0MB 4E9XA 1D3CA 3PWNB 4RMQA 5D5MF 3QUML 3H42L 3ET9F 3U9PL 1K8IA 4AIZB 2X9ZA 1OGAD 4PD4K 4PJ5E 3QQ9C 4Z78A 1D7DA 2VWEC 4QYAA 3U4EB 4CSSA 5MP6H 3H0TA 1RFDH 4PJ9B 4XZ4A 3BAIA 1F8TH 3GJFK 2VH5L 3QEGL 2VN3A 4YX2H 5C6TL 3QJXA 3AUWB 4JB9L 3TA3B 5C0EB 2QVKA 3EYOB 1OHZA 1R5VA 4AJ0A 3K2UH 5C0GA 3KJ4C 3OKNB 5J13C 3GMRB 3UBHA 2Y1YA 5FO2A 3EUUA 2C4FT 3DX0A 3BP4B 1UFGA 3TEYA 5A6IA 1TZHA 4A68A 2BNQA 1UB5A 3TV3L 5E6YA 5D7KD 3TF4A 5DK0B 2RBLA 5AW8B 1S9YB 3QI9A 4UM9D 5TE7H 7PAZA 3SY6A 3D4ZA 1R5IB 1UJTA 1NBQA 3E9UA 4XP5H 5DJZB 1N4XH 2LVEA 2P47B 1BW8A 1G7QA 4DGVL 3QZWA 3OX8A 5BS0E 3HUJB 4S0TD 2AJ3B 4X83A 3MCKA 4OGAC 1OE1A 2E59A 3GIVA 5K1JA 4ONFL 3GBMH 2IWKA 1KIUA 1UD4A 2KZWA 2K78A 1MJUH 4K2UL 5C7ZA 5A7EA 4PJCE 5HDQH 2V3DA 3QIBD 5F7NC 5C0DA 3ZOAA 3PGDA 1FN4B 3EH1A 4OB5H 5FFGA 4C4UA 2HWZH 4OJDH 3KG5A 4X4XB 4EI5A 2DF3A 3APCA 1QRNA 3SGKC 1E30A 1KSRA 5I26A 3TWCH 2WBKA 4MMYA 1RP9A 1ZVNA 1FGVL 2XXGA 2JJTA 1BREA 2P5WE 2ZNXA 3BRGC 5LXGL 4XMKH 3T4AC 2Q3AA 2OL3L 1EO7A 3FTSA 2ENQA 4PJBE 3KCWA 5FOBA 1YNTF 2J12B 3HG3A 3EJYC 4MAYA 4YO0A 4BA8A 3HRPA 3RIKA 1IE5A 2CRYA 5JMRA 4DKDC 3VFTA 2XTJB 2A4ZA 1AZRA 2V2XB 3GMNB 4JFYB 3FQWA 5DJ0A 3DI3B 3G08B 3D39B 2VERN 1V10A 2NYKA 3TJEH 3KHOA 1RIHH 4OKVA 1XQ4A 1QQDB 3VSVA 3ZDXF 1CDJA 5C8JB 2VAJA 3CC5B 2Z65C 3DBSA 5EORH 4ZW5A 2B5IB 2H1PL 1DHKA 2F53A 1DLFL 2O1AA 3BHBA 2FATH 2OMUB 5SWQA 1U8HB 4C59B 3JTTB 4ZMTA 4WI2A 1QFWL 2VJ0A 2WUBH 4KRLB 3VD7A 2F6AA 1MFEH 2O72A 5AAMC 5LN8A 3NFNB 4ZXBA 3OPZH 4WRLA 3KVPA 3ZDWA 2FIRT 2BS71 2YRPA 1XSIA 3BP5B 1ZHKB 2R23A 3V55A 3DMMB 1CFTB 4XVTL 1TTUA 2VM4A 4BE6A 2YPVL 2FT8A 4PIRF 4RZKA 4DKAA 1T89A 4W9LC 2OP4L 2X0VA 1Z9SA 3F7LA 4QXTA 4CVXB 3QPQC 2ZUVA 3QPKA 4KFMA 1OK8A 1JGEB 4YZFF 3S8WA 5KBDA 1WZ1H 1EAJA 2A6KA 2X5PA 2HVKA 2NXZC 1NJ9B 3O9WB 2YLKA 2IGLA 4OZ4A 4WO4C 2H32A 4M5SA 1WD8A 5J1SC 2D2OA 3HW7A 3SQRA 1NSNH 2IV8A 3WIFA 3RFZC 1TTAA 2DMCA 2X38A 4WW2B 3H9SA 3L4XA 2BSSA 3KCPB 5TGBA 5LWYH 4IU2B 4IGBA 2BW5A 4IK7A 1MCQA 5E9DD 5MP6L 1RFDL 2Z93B 4FYRA 2QVMA 1TU2A 4OAWA 5EEXA 3PL6A 1F8TL 4APQB 4YX2L 1XIWC 3CUPB 4Y2LA 2GIMA 3P2BA 2JKTM 3VXSA 5C0IA 2V5YA 1AZBA 3WEXA 5FYJD 1ZVSB 3K2UL 2CRIA 3GLAA 3V2AR 2P5EE 1P7HL 2NR6D 4KY1H 4KKQA 1GJWA 1FFQA 1NQBA 3BQUB 1UA6H 3ULUD 3L3HA 3EJCA 5TE7L 3BPNB 2YEZA 4L29A 1SEBA 4QRQA 4XP5L 3VGHA 1TENA 2H47C 4XNZC 1WC7A 2C1OB 3QJUB 4GUPA 1N4XL 4P4RA 4LSDA 5E7FA 4BUHA 2WWMC 4FFYH 5LCVH 5SX4I 4NBZB 3PWUB 4Y4FC 3WJLC 2G75A 4JPVH 1L0YA 1TJGH 3WXWH 1NCJA 1UOVA 3GBML 1BXAA 3QC5X 3NN8B 5AW4B 4J6IA 5FKAA 2NY1B 3L4CA 3A6OA 1MJUL 2NY2B 1EA9C 3AG2B 4R96B 4A7GA 3RKDD 3BIBX 5HDQL 2X2YA 5DQJB 1JPTH 4CJ1A 3DX1A 4K0OA 4OB5L 2HWZL 5BVJB 1E4HA 3RL1A 4KUZH 4NIKB 3TH3T 1MFUA 3CX5J 3TWCL 1BQKA 3FT1A 3MZTA 2E7DA 4YOKA 3BKYH 5K33A 1PFCA 5EU6E 4XMKL 2BIHA 3UH8A 3O2WH 3C5JB 4GT0A 3E38A 4GRLA 5TK4A 4LHUD 1FLTX 3VI4A 3AT8A 1IAIM 2IANE 3C5ZD 3VWJA 2L7EA 1YC8A 2NYYD 4NHUA 1UFUA 1CYGA 4PJIB 4X7FC 2VR9A 5DMKA 4J8RA 3LYRA 4F5CE 2G0LA 3ABLB 1H6TA 3TJEL 1RIHL 2X70B 4HS3A 4FQ1H 5IMOB 1SLWA 2DEWX 4MXVF 3BAEH 2VR4A 4H8PA 4LSRH 5EORL 2OR7A 4HGKC 4BFJA 3PS6A 1LWJA 2DQUH 3LZNA 4K9EC 3DXAD 5ABZA 1PG7X 4M7ZB 2FATL 3VQ2C 2PXYA 2QLYA 1WFNA 3M1CA 4UT9H 2WUBL 5J1AA 2L0DA 1CBVH 5A2JH 1MFEL 2ZX7A 1NEPA 1V3JA 4HS6A 4JFED 5HI4C 1L9SA 3OPZL 3SKUD 4P2CG 4APXB 4A2HA 4AZ8A 4JAMB 4TTDC 1E27B 4N2GA 1AHMA 1AGEB 2GJJA 4TNVK 2BIMA 4PJ9C 2E9BA 1B3IA 4PVLA 5FGSA 1NFDA 3CFDB 1OB1A 1T2JA 1EAOA 1WAAE 3I6KB 4UQ2A 1OGPA 1YPZE 4L2LA 4TSAH 1QI4A 4I18A 3AMKA 3HVDA 3IM1A 1M05A 3OF6A 3UBFA 2AQTA 1K4CA 3NIFF 2CPUA 2IDFA 1WZ1L 2UXGA 5KANG 2WLLB 2AITA 3G04B 4L1LA 3G6JB 2ETWA 1NANH 3MRJA 4RVBA 2KLSA 1KYDA 3KS0J 4PQXA 2ZXWB 1G7HA 3Q3GB 1NSNL 1NA8A 3P40A 4PJFF 4AQAB 1CXFA 2H45A 5AKRA 4U7SA 4NKMA 5LWYL 1KXTB 5C0CD 3QJOA 3O11A 5LHDA 3C5SB 2APWA 1JSYA 3QUMB 3ALPA 3MLXH 4UOW0 3X1EA 1YY9C 2VDLB 4PBVC 4DFIA 4MCYB 3OAZH 4LVNB 3UMNA 4J3OD 5DQ9B 3AQYA 2ZOLA 3DUSB 43C9A 3NP4A 3HAEG 4KY1L 5CKAA 4JFDE 4I9XA 1BWMA 2XBZA 3FUJA 1F13A 4JANB 2BCMA 1UA6L 2WZPA 1AHWB 1A6WH 2GIYA 1PX8A 2JVUA 2HMIC 1IEAA 5IJKC 1LE9B 4XOAA 3OR6A 4GAAA 1MOEA 5EIVA 4FFYL 1J9RA 4JQXC 4XNQA 5LCVL 5MERB 3GFUA 2FDBP 4HLJA 3EDEA 4JPVL 1T5XA 1TJGL 3WXWL 1VFOA 1FUNA 3T0ED 1BQUA 1CFQA 5A2IH 1MI5E 3V0DA 2DQDH 4IOIB 1FH5H 4PS4H 5FB8B 5CFAA 1OCRB 3G5ZB 1JPTL 2BC4B 4XVUD 3MRHA 2ICEB 3QA3A 1QEXA 2CCVA 4CNIA 5HHOA 4KK8D 3L5IA 4KUZL 4NO2B 1XEUA 2B5IC 4Y1AB 3SN6N 1J05B 5CEYB 1I1YB 1T1YA 3V9EA 4I0PD 4PRIA 5JMOC 5TQ0H 3RTQD 3BKYL 2B7DT 3EYFA 4AQ8C 4E9YA 4NC1C 1V54B 3NSYA 3O2WL 3P4MB 4G80B 3V6OE 4KKLC 1WEJH 1A3LH 1R34A 2WTRA 3HS0A 2C9PA 3S7GA 2EDDA 4MYPA 3NRQA 4AWJC 1ESOA 4ODHH 3DMMC 2BVPB 4PW9A 3HCVA 5DXWA 1V5JA 2OL3B 3DVFA 4Z7QF 3WKPA 5DS8B 1BECA 3KPNA 4Z3EA 4FQ1L 4JZJA 4OZFH 3BAEL 3PG2A 1P6WA 4LSRL 1H3UA 1NC4B 3BWAA 1W16A 2DQUL 4ZFOA 2WYIA 4K7FB 4BKLB 1B4JH 4ZSOA 4ILDA 4UT9L 5MENA 4PS3A 5ACZA 1CBVL 1R4XA 3IT8D 4WW2C 4GB9A 1KIRB 3VD2A 1I8MB 5CKGA 1XGUB 2XWJA 3EF4A 4X5XA 4JRXE 3FUKA 4JO2L 4MLIA 4ZQKB 3A6BH 3CFTA 4N8UA 4APQC 2EDYA 2G2RA 1CLOH 4N9OB 2FO4B 4TSAL 3RZCD 3V7MA 3UTTD 3AWEA 1TKWB 1DEEA 3MBED 5EF1A 1NOAA 4KK5C 5DJYA 1N68A 1SNRA 2H9GB 3ZHFA 1U8NB 4QJ3B 1AS8A 1WSST 1MY5A 4AYEC 4XB7A 4MNQA 1A6ZA 1DJWA 2YJQA 5CR1A 1OP9A 3UBXI 5JPMC 2E6JA 4GSRA 3V0VA 4E9SA 1RV6X 4MNGE 4YK4B 1BOYA 3PDGA 2XNAB 1QWUA 3BPNC 2ICWB 3MYZA 3GF8A 4OIIH 1UCBH 1A8ZA 1CGSH 4MXQC 5LDSA 1U95B 1Z5LA 4L3ED 3T0EB 1XGRB 1MLCB 1Z5HA 2HX8A 3ORJA 5GHWH 5EBWA 1KBPA 4B9ZA 4L1TA 5EOTB 5T5NG 3MLXL 4OZGE 4N2EA 2B9AA 5C6PB 1OE2A 5C0ND 1W72H 2A73A 2OR9H 3DECA 3GZPA 1LNUA 5EULV 3DVNB 4ZYKA 2NCEA 3N1GC 1TEGA 5JW4R 2W0LA 3HR5B 2CBOA 3N1FC 1G5AA 3SPVB 4LOUC 3V10A 1FYTD 1V8HA 1LQBC 4NWUH 5EDXA 1H3WM 1A6WL 1G7PA 4WHCA 5I5JA 5DYOA 2CBQA 2CO1A 1HHIB 2VXQL 2XUWA 3HE7A 1ODUA 2L04A 3OJMB 4WFED 5JORB 2B14A 5FC9A 3BCDA 5EO0A 3L6FA 3ZQXA 5F3BB 3LZOA 2FUTA 3VI3B 2DQDL 1FH5L 4IMLB 3ROOA 1A1OB 4PS4L 3S34H 1FZMA 1VERA 2QFRA 4O2EA 4DO5A 1GS8A 3RL2A 4U4IA 3KPOB 2FJFA 3P0VH 1MCCA 5F1IA 2VISA 3STZA 2AK1H 1T6BX 4L8SB 1JUFA 4M7ZC 3N04A 5TQ0L 1JF1B 3EFOB 2XETA 5I0WA 5HYEA 1F2XK 2F8XC 1NBZA 4YUEH 3RY6C 3KR3H 1A2YA 4R4BA 4OCXH 4ANKA 2JJVA 1WEJL 1XF5A 3OJDB 1A3LL 1R3JA 1ZPLA 3MJ7A 4MNHA 3MRDB 3BLKA 4LL1A 3C09B 4ODHL 3FUIA 4EI6B 1L0QA 4JK0D 3L45A 5KVFH 1BOGB 4PJEE 1TQCC 4DK5A 2NR6C 5DDHA 1Q9WB 3ZKXB 3U6XA 3ZTCC 2VB5A 1JZ4A 3IBEA 3MDJA 3PUCA 5CN3A 1S5IH 3V0AC 3TYFA 3ULUC 2IAAC 3VFOB 3VH8G 3QYMA 2Y2YA 3GMQB 2Q8AH 1GYCA 1SHSA 1B4JL 2CIKB 4L9LA 3NA4A 3ULVE 1L0PA 3NQIA 4ES9A 4HS8H 5E70A 3IAQA 2X2HA 4OQ1A 1GGUA 3U36A 4YSOA 4YH6A 4AL8H 8PAZA 3CBKB 1FZJA 1WFOA 1BQHG 2NNRA 1U8JA 5EFIB 3ARGD 3A6BL 1GW0A 1W9XA 1CLOL 3FB8A 3RKDC 5J6SA 5FAAA 1DO5A 5HI3C 4M9PA 1EFXA 2W9DH 3K6FA 1IVTA 1CDBA 1MEXH 4Y89A 3V7AE 3MUUA 3N43B 1PY9A 3G9AB 1I3RA 3U2JA 5AQ0A 1F4AA 1E5AA 4RRPM 4FTDA 1C1EH 4JDVB 5IKCA 4NGHH 4JRYA 3BLBA 1ZAGA 3CLFH 1AHWC 4QRTB 2RHEA 1G6RA 1UKSA 4OIIL 3MJWA 1UCBL 4JQVC 5KSUB 2PW1B 3LKRA 1CGSL 4HV8B 1S46A 3S96B 1H3VA 3DBXA 2FT7A 4W4OC 1PD1A 2VE6A 5GHWL 5LNEA 4UF7C 4MJ6B 2Q76B 1FJ1A 4A7SA 4JKWA 5IZ7A 5FHAH 3A47A 2NNCA 4F1SA 3KPMA 2C9XA 1W72L 1WIUA 3C9NB 3S4SG 3BVXA 2OR9L 4LFHD 4AMKH 3SCMA 4G1MB 4H5SA 4OM0H 4MA8H 4GRMA 4NOBA 3OC5A 2ICEC 3BUIA 2MOVA 2V2TB 1A3ZA 1E5UI 3FMGH 5CEZH 1T6VN 4NWUL 4JPSA 3TCLB 3KXFB 5GS0D 1EWHA 3SQBA 2ZP9A 3RWEB 4LEXH 1GXEA 2CR3A 1G7JA 5CD3A 2XTJE 2M8XA 4IQHA 1DJZA 1IGFH 1PKQA 2EICA 2OMYA 3TFKC 1UA3A 4FI8A 5E8EA 3RIFK 3MRNB 3HB3B 2Y5EA 4NHCH 1A4KA 3WE1A 5M94B 4ANVA 4HIIA 5LGKA 2AZAA 4XXCC 1I7UA 3S34L 1AACA 1X5GA 3VXTA 1N8OE 3P2DA 2ZCLH 3A23A 4NO5A 3UGXA 5G2NA 4FFZH 2BLFA 2Y7QA 3F7YA 2TSBA 3P0VL 4N87A 2BNUA 3GSOB 5IJVA 2BSRB 1CYXA 2AK1L 3CPLA 5CO1A 3BW9B 4QYOA 3RWDA 1P7KB 4GW5A 3WIIH 4NZTH 2X6UA 4IMKA 5LVEA 4YUEL 3KR3L 1QFUH 2UYLB 3DC0A 4OCXL 4YBLB 2E7LC 2UZYB 4W9CC 4L4VA 1N70A 3DURA 4N85A 4X6DA 3S5LG 5D1ZA 2MQ0A 3DPBB 3LPPA 4QCIA 2BNRA 5GGSB 3RDTD 3IPEA 1K2DA 3IJ7A 3FO2B 1J8SA 1XD1A 5KVFL 5E5RB 1NPJA 3H8NA 1AGBA 1RSFA 3INUH 4Q97A 3CXDH 3S3BB 3SE3C 1GYUA 5HHVH 1Y1DA 1DE4B 5C08B 4NM4H 3TBCA 4FQXA 2MKLC 3O3BA 2APFA 1MKFA 1LK2A 2Q8AL 5D4QA 5F7DA 4HS8L 4YK4C 4NERA 1BBJB 2WXRA 1JRHH 3LKOB 4FMVA 5IWLA 5E6IB 3S97C 4AL8L 3MGTA 4QXGH 1PX3A 3BT2H 3T0EC 4P4KA 2OXHA 2VN6A 3IBOA 1DDHB 2LV4A 4EOWH 4FKEA 1R19A 3L4VA 1ICTA 4LCVA 1CF1A 4R9HA 1HQRB 4U6YB 3FN9A 2R15A 3EFFA 2WPGA 2W9DL 4XVUC 3ZE0B 1MEXL 1FVDA 4QLWA 2WXJA 4W9DC 1ZJBA 2NOYA 1C1EL 4I0PC 3RTQC 4NGHL 3WS3A 1QBBA 2KZ1B 2OQJB 4HBCH 3SDCD 3CLFL 3OV6A 2HXAA 3C6EA 4HWZA 5D6DC 2DBLH 1O6VA 4XAKE 4PJXF 3RWIB 1V3KA 3EJZD 4UM8A 3I74A 3ZDZB 2ITCA 4MJIA 1K8DA 1LL1A 5ESVA 4C56B 2VLJD 2R1XB 1RK1B 5JW4M 3WKMH 5FHAL 2NY0D 4LAJH 4UQEA 3QJHA 3WLBA 4AMKL 4LNRB 4MSWB 4PLKD 5BW7A 2CLRB 2WINB 4OM0L 4MA8L 3RPIA 4GRWB 3QFJD 4NI6A 1H15B 1PZ5B 2JH2A 3O4LE 4TNVF 1WHOA 4K5PA 3O45B 3RJQB 1SDDA 2MRYA 4PYHA 1T4WA 1XGQA 4OCYH 1BMZA 4RQQB 2XN2A 4UDTB 3FMGL 2AKRA 2G3MA 5CEZL 4HJJH 4J3OF 4BZ2H 2BPBA 1JXKA 4PVNA 4E41B 3P11H 1EJ6A 2E9JA 1CXIA 1Z1WA 1E9QA 3OZKA 5I1CH 2HT2D 2MTPA 4LEXL 3K72A 2VL4A 4Y16B 2IH3A 2HFFA 1ZLEA 1F41A 4U3CA 3QR1A 1IGFL 5SV4A 3UYPA 2NT1A 1P1VA 4Z77B 4N6QA 1YEGH 4P2OA 3T09A 2G0KA 4NHCL 1M1SA 4Y4HD 5AOLA 1RY7B 5ID0B 3BVVA 3PQYB 1BZ8A 2Y4SA 4FGMA 4XXWC 3DHMA 3MGAA 3QJTB 2OCFD 2AFNA 3KMDA 2W9EL 5I19H 2X1WL 2ZCLL 5T1JA 3E9TA 4FFZL 3P9LA 4JFFE 4XPGH 3OLGA 1ZD6A 3QUYA 3U0PB 2K3TA 5D8JH 1X9RA 3UBGA 2X4OB 2ODHA 1Q9LB 2Z8VC 5TF0A 1KYAA 2AQ3A 2VLKD 3UZVB 1ORSB 2CD0A 5KSAD 3WIIL 1BF2A 4NZTL 2JK5B 2BCKB 2ZQKA 1YO4A 2VZSA 1QFUL 3NGBB 3ZE1F 1MAJA 1HWHB 4AC2A 4H4NA 5GSRA 5J1TC 4TRPH 4HOWA 3MKKA 1S9KC 4K7PX 4AKQA 1S78D 4OUUB 3D30A 4NENA 1MCRA 4KZDH 4OJAA 4HQQH 2WMPB 1SVCP 3KGTA 3G6JE 2RTTA 3INUL 5CLTA 3CXDL 4U1GB 5CNHA 3MCYA 5HHVL 2ZZUT 1Q9OA 5CJ5A 1IM3B 1L4IA 1XL6A 1CICA 1ZHBB 5BS0A 2GSGA 1JGDB 2LOEA 5FDYA 4Z7VE 3B5GA 3H85A 1J1OH 4ZX4A 1AAJA 3P02A 2HH0H 1ZWIA 3L9RA 4A7VA 1T1XB 3VGAB 1X9UA 5FM5M 1JRHL 3EGXB 4N8VG 4M7LT 1X9QA 5FYLH 3DX9A 3BRDA 4DPBX 2DWSA 4P5KA 1ACCA 2VLJB 5DVPA 4QXGL 3OG4B 4PJCA 3BT2L 2A74B 1KJ2A 1XR9B 1J0IA 1KCKA 1BXUA 1ZGLP 3D0VB 2YEQA 3BSZA 1J8HD 3IJSB 2XN9E 1E8WA 1RZQA 5GZND 5EZOH 4EOWL 5E5MA 3OZ9H 3DV6A 1VZIA 3OKMB 3G5XB 3B9KD 2IDQA 1QA9B 3TWYA 2GAZA 4BQ8A 3RGBA 3VFSA 5DJCB 3R4RA 3QIWD 3K2MC 2GCYA 2V7NB 1Q8MA 3Q48A 1A9EA 5ESAA 2OMXB 5K9OB 5ESQA 4GEJA 4JHZA 4HBCL 4AVHA 1IAII 4FTVD 2DBLL 1N10A 3A4FA 3QNFA 4G8FA 4DP7X 3DUHA 5B39B 4OCWH 4CVZB 5AVQB 2OMZB 2VMJA 2XKNA 4HBQA 5K9KB 1M57B 5JHBA 2DWDB 3QG6B 3LV3A 5A3IC 2CA4A 1IJ9A 3NZHH 3L3IB 3WKML 3HB3C 4NRYA 2YQGA 4DPAX 3WFEH 4J3TA 3IMUA 5L2KD 1BF8A 2X4UA 1AHKA 3FQYA 3MA7B 3QWRA 1AO7A 3CFQA 3AC0A 3AFLA 1YEKH 4LLUB 1RH8A 1UTDA 5INDA 4ANUA 1B4TA 1MCIA 2ZAGA 5CGTA 4UIMA 5F9DC 1JZ6A 3H2QA 4XPBH 3VACA 2EIJB 4OCYL 4XN8A 1W72B 4MNQD 3BXNB 4HJJL 3F84A 4BZ2L 4KKPA 3T8XA 1YN6B 3P11L 2ATKB 4L9DA 1IV8A 4WI6A 2HFEB 3QC6X 5I1CL 1H3XA 3ARGC 4NP4H 1KXVA 5J12B 4G6FB 2YRLA 6PAZA 3F04A 1YEGL 2YA2A 5JHDB 5CWSB 1AD0B 4F9LA 4U0RC 3IMTA 2MHAA 2GEEA 3ARXA 2OW6A 3GM8A 4GKSA 4PJDA 4AYFB 5HYSA 1AR2A 1OALA 1CTMA 2BRRH 2D7OA 5I19L 1TPXB 3IDIA 3K2KA 4LKXA 4XPGL 1A6VH 2R2BB 2HKFH 4MDIA 2G5RA 1NCDH 5D8JL 5BRZE 3NJHA 4NNYB 5L9DH 4FOMA 1DZ0A 2WXFA 2CKBA 1F18A 3Q9PA 3BZ4B 5DUPH 4GO6B 2AK4A 5T5FH 1J1XH 1YECH 3BWZA 4KQ0A 5E6IC 1YEDB 4P57B 1TTFA 1SLVA 4R83A 1MVYA 4TRPL 3S3DB 2ATAA 4CL7A 4QUOA 2CIIA 1CGXA 3Q44A 3W39A 5CEZD 1LVEA 4KZDL 1JL8A 3HE6A 2XRAH 4O2CA 4HQQL 3DX6A 2XWTB 3FQ4A 4JL2A 5IF0A 4D7BA 4LKCA 4OVUA 3KWWB 1QZNA 4I4WB 2ZSWB 1YNTB 3S35X 3DETC 3SYQA 2AV7B 3RWCA 3RDJA 3SOBH 2QR0B 3KPSE 4G83A 4R0LB 3WE6B 3WIAA 3DJTA 2XYCA 1J1OL 4YHYB 1EXGA 2HH0L 4ONHA 5EO9B 2X3BA 3ELAT 5FYLL 1NIBA 3AU0A 1TZIB 3HPJB 4NQQA 4F7KA 4QY8A 2XX0A 3M88A 2GB2A 1FL5A 2N1TE 4YPGB 2FEEL 4Y2OB 5F8QC 3MV9D 4UTAL 3MV7B 5EZOL 3OZ9L 4UZGA 5D7LE 2X2UA 4M6NH 2Z91A 4X5WA 1O7DE 1ODAA 4N6RB 1DP0A 4Z0XB 5H2BB 4FMKA 2HX7A 4AV0A 1JXJA 4CAGA 4FZ8H 3OKEA 5HPOA 2XA3A 4O5LH 2DDQH 2WNWA 1N5AB 4GY4A 3O2DH 1UHVA 3SDAD 5A2FA 2OLDA 2BP8B 3O6LH 3OHXB 2CO7B 2IANA 3MV8D 4J3BA 4MFHA 2JJWA 4HCFA 2HJLA 4LPYA 4DGIH 5CBEB 1NGQH 2DBJA 3VGBA 4O51B 5HDLA 2PYED 4OCWL 5C92A 2FO1A 4L4TD 2R2EB 3MNVB 4Y16C 4F5CA 4N68A 4WY7H 4TL4A 5I71B 5C0FA 4EZJA 1ASPA 3NZHL 3RDTC 3TBWA 3BZEB 1HH9B 1TVHA 5CP7B 3WFEL 1NGZB 3U4AA 2C9VA 1TQWA 2CR0A 5CZRA 2BOBB 1F3JB 1YEKL 3CHPA 2EE9A 4RSYA 3PRZA 3IYLW 5DEGA 5LG6A 4XPBL 2ZUUA 1XCQB 4PLOB 1BZOA 1U8KB 2XJLA 3PDOA 4I0KA 4OJFH 3OD3A 1IKNA 1E2ZA 1WAAA 2DQMA 3FU3A 4M3KB 4XH2B 1AOZA 4J7RA 1G94A 4KNQA 2IH8A 3RWGA 1CJYA 1HYRC 3GEWB 5J6HA 4S11A 3VYPA 1LE5B 1L9RA 3KVDD 3ARFD 1C7TA 4NP4L 3VXME 4MA1B 1RK7A 2EIEA 2VKWA 4OIAA 1S6NA 4OGZA 3D6GA 4PWFA 5LUMA 3M1BB 5J0BA 1FNEA 1PIGA 1CDGA 3GIZH 5C0BE 1ZVYA 3HN5A 4RFEB 3L7FB 5DRWA 1A4JA 5ISZA 1J5CA 3PJSB 1O6SB 2BRRL 3DI2B 4LP5A 4ZOEA 4M8VA 5L8KB 4M1CD 2P8LB 3GHPA 5I8EB 1A6VL 1XGYH 2JB5H 2HKFL 4JREB 4DK6A 3F6LA 1NCDL 2KQMA 4WHYG 2YPLA 4XMLH 2QMJA 1EAPB 1JK8B 2AXJA 4MX7A 4NUPA 4P5MA 1EERB 5L9DL 2X89D 3HBGA 3VJ6A 1Z3RA 1U6AH 4CW1A 1QTPA 2PP7A 1GY1A 5DUPL 3VGAC 3VWKA 1KYUA 5KG9A 3EJZC 1J1XL 1QPKA 1YECL 3QGVA 2DOCA 4AENA 5CJXA 2BZDA 4KJQC 1KNOA 4TLUA 1XFPA 2JWYA 2A74C 2G3XA 2HFGH 2V37A 3FO0H 3NCYP 3HAEH 4LPCA 1DVZA 4AQ1A 2CUMA 4YBHA 3VFWB 2JTDA 1JGUH 3L3JB 4LRNH 1THCA 5I76A 2XRAL 1XV8A 5JIMA 5EU7C 2EDFA 2FNWA 2IV9A 5EA0H 5IB1A 1BCIA 4X4YA 1NEZA 4LNVA 4X7CC 2R59A 4LEBA 2D3VA 3FCUB 3NPSC 1CR9H 2VXSH 3SOBL 2W0PA 2Y0SA 2W1NA 3X1NA 1TEFA 2PYEB 3GO1H 1JPSH 4A7GF 3EZJB 4NUMA 4N4YB 3FQRA 3V6FA 2VCOA 1MI5A 4Z3GA 2WQAA 2LU3A 3VCLB 5HY9A 4JPKH 3QQ4A 2IF7A 3FRUB 4QRAA 4Y8AA 3GSRA 1IGTA 5I1AB 1CFVH 3BH8B 1LM8V 5D1ZD 2CXGA 4A7UA 3MX0A 3Q6GH 3PHOB 3HMWH 1NCIA 3CLEH 4DH2A 2AHIA 4M6NL 1XR8A 1NCTA 1TTBA 2CDFB 2D3JA 2VMCA 4Z8FH 1JV5B 1WUNT 3VI4F 4MRBA 2F54B 2BERA 2XZAH 3V6OA 3Q1SH 4FZ8L 1T0NA 1G1CA 4O5LL 1NAKH 4QKTA 2DDQL 2OMTA 2Z92B 3O2DL 5KSAC 1KPRA 3O6LL 2K6YA 1SLUA 2P24A 3Q43A 2Z4QA 4DGIL 4EIGB 3ZKMD 1NGQL 3B1UA 5I66A 1T0MA 3VQMA 1CLCA 1INDL 2F15A 3S36H 1HKLH 1XF4A 5JOFA 4WY7L 1XF2A 4PWEA 4UINH 5J12C 4P4KD 5IM7A 2ZKWA 1YYMH 4FG0A 2BP5M 5JDSB 4GT7A 4CMMB 1KN2H 2Z8RA 1Z9NA 2DQIH 3MUGB 2FE0A 1LEKA 4DIXA 1QLEB 5FYLD 4WCYH 1TPXC 4JJHA 2WIIA 1QW8A 1U8MA 1NFDF 4JRXA 1JNHB 1UWGH 4KI5E 4K5OA 3QXVA 2AI0H 4OJFL 3RVXD 4HPOH 3HRZB 3N41B 3OBAA 2ZWSA 4G6KH 4J3VA 4DFHA 2GKIA 4OZHA 4Y5VB 4JZNB 1JNNH 4B41A 1C8QA 3NCFB 2YZ8A 2R56H 3HLKA 4NIYE 4JGUA 2UUDK 3BDYH 3LKSB 4NFCA 1K3IA 3SIKA 3GIZL 5FYKU 5C09B 3B9KC 5EF2A 3UCRA 4HUXA 5J8OA 3M7FB 2ZUQC 2WLZA 4YSDA 3KNBA 2XV0A 4LK4A 1XGYL 2JB5L 4XWOD 2CKNA 4XMLL 3US1A 5DC0A 1U3HA 3IPBA 1CCZA 2GSMB 3TNMA 4R0LC 4QJ5B 3UJTH 3H7BA 2DM7A 3ILDA 4YHYC 4OZGA 3VQ1C 1U6AL 4F2MB 3KLSA 5I8CA 4MZIA 5EMYA 1FV1B 1QLRA 4DGWC 4XWGH 1O9WA 4KITB 3FFCE 3VNZA 4B60A 2CHZA 2HFGL 3FO0L 1Z7JA 2X4RA 4I48B 2UZXB 2FH6A 3O0LA 4N0RA 4Q58C 4F37K 2X2IA 1JGUL 2VAAA 4LRNL 4IRSD 1KWGA 4TQEH 3V0EA 4D8PB 1FFNA 1KPVA 2FSEB 2O5NA 3SQOH 4AL8C 4UQBA 1FFOA 5DMIH 5EA0L 2RFXA 5KVGE 1BD2D 5IB3B 3BPCB 2NUPA 4C83B 1CR9L 2VXSL 4KI1A 2EACA 2WO4A 5DZVA 4E9WA 4MLSA 4Y9CA 1LHZA 5IIEA 1NGYB 3OHXC 2AJSH 4GSXA 3GO1L 1JPSL 3ZDZE 3OKKA 4Z7QB 3IXTB 3VRIB 4C56E 3NTCH 3WCYA 4JPKL 4J28A 4N26A 5AB9A 3GZKA 3X11A 4HUWB 4IBQA 3IF1B 2FX8H 4DT2A 4NQVA 5I71C 1CFVL 2X6BA 3DARA 4EN3A 2B20A 4S2SA 4ZMYA 4GRWE 4QRPD 3Q6GL 1ETB1 3HMWL 3CLEL 1ZV9A 3B9VA 3HN3A 5DA4A 4YIQB 1I9EA 2AJZA 3SBWC 3T5WA 4Z8FL 2DMBA 4CC4A 1R0AH 5K39A 3OAYH 2XZAL 3ZHKA 2I7SA 3Q1SL 4KTEL 1MZZA 1NAKL 2D31A 1R3HB 5BV7H 2JJSA 2G2NA 1V3MA 3VD9A 5IR1A 5EEWA 3NFSH 2HG5A 5EV7A 4YXHH 1T6WA 4PRAB 3QIUD 5SWSE 3VO0A 1KLGB 1PLGH 3CNKA 4G6JH 4YSQA 3S36L 1HKLL 1VKXB 5DRNA 1RK0A 3QDGB 4UINL 3KE0A 2LR4A 5DVKA 1ZIAA 3F83A 1DJGA 2BFGA 2OTPA 3D34A 4MA1C 1YYML 2BSDA 3C5XA 1N8ZB 1NGXA 4PD4J 1XBRA 5SX5K 2GBAA 1KN2L 4PV8A 4RDQF 2DQIL 2XBTA 3FU9A 3WN5A 2KKQA 4LCIH 3X3FH 5JW5A 4WCYL 3HBPA 3PWLA 1R75A 4N1EA 1M6UA 4JREC 1I1FA 4FHJA 5EU4A 4EZKA 1UWGL 2FWSA 1ZHLB 2AI0L 3E6HB 4AE1A 2K4WA 4Q4IA 4HPOL 5CM1A 2I07A 3FW6A 4AQZA 4G6KL 4P2QB 2YARA 3WY1A 1AIZA 1JGIA 1P5UB 1ID2A 1JNNL 1M6OA 1SFHA 3CFIC 4KH9A 4KNSA 2R56L 3RHWK 4F91B 3UYOD 1U93B 4W70A 3T6VA 3BDYL 3U0TB 5DZAA 2I60H 2VSCA 5F8RC 1LJMA 1FL3A 3FU7A 2WB7A 3UL4A 3MRGA 2VDOH 3L1OH 3IS1X 4G42B 1N0LA 5HVGB 5CLWA 4BSWB 2UY6A 3DJSA 4CA4A 1XCXA 2GYSA 3D25B 3EYQD 4PY7B 3WEAA 4AT6A 3EGDA 3UJTL 3KVQA 2Q6WB 4XP1H 3O6MH 5F3HB 5F9JA 3ETTA 2NX5D 2DV6A 3BUYA 4XWGL 3N6YA 2IQAB 2UX6A 3L5HA 1KC5H 3WFDH 3QDHA 1Z5YD 3AW5A 1WWWX 3UIZA 3FCSA 4TQEL 3SDXA 3DIFA 2XI9A 3DX7B 2EYTA 4V1DE 1Q0YH 5DC9B 3FZUC 4KTGA 3SQOL 5ERWA 3ZYIA 5J11B 2DL9A 3LKQA 3QUZD 1R24A 3M17A 3L95B 5DMIL 3TN0A 1SJMA 3LH9A 4WU7B 4M61B 2WLHA 3CFMA 2AW2A 3AJ7A 3T9WA 4MQXD 3BISA 5IQNA 4OH2A 3IDJA 5BZDB 2AJSL 4G3YH 1IBYA 3IK2A 3U7AA 4AX3A 4DQAA 5D93B 3ZN6A 3ARFC 3NTCL 1GAFH 2ITFA 3EH2A 5C07D 5DYFA 1AP2B 4Z7NF 5GZOD 2AK4D 5D5ME 2NY6D 2YS4A 2FX8L 4N8PA 2K7QA 1DN2A 3DGGA 5CF3A 3GXPA 4NQED 5HHMD 2OK0H 4M5ZH 4Y9GA 3DIDA 3TBVA 4PRPD 2O5XH 3RUGB 1MFMA 4MQ7A 3VXUE 2PW2A 2RR3A 4A39A 3IU3A 2QSCH 3BWUF 3AMLA 3L4YA 5DUBA 4P5TD 1CF8H 4XOBA 3SYPA 1R0AL 4LBAA 3T8VA 3BQVA 4ZFQA 5AW5B 4Q2ZA 5DD6B 5ALCH 3STLA 1A7QL 1DJHA 4NAJA 4QHUA 5BV7L 4JRLA 2JXMA 1D5ZB 1E40A 1GGYA 1VFMA 4HGWB 3ARZA 3EO9H 3OR7A 2DLEA 3NFSL 2ARJQ 3HRZC 5J3HC 3BD3A 4YXHL 3TF7C 1GGTA 4M9OA 1JZIA 1PLGL 4LLMB 3V5DB 4G6JL 3B7UX 4Y5VC 3VRJB 1DVYA 1JN6B 3JT2A 3R18A 3QEQE 2DW5A 1WFIA 3QDJB 1H6UA 1TQTA 1RJZA 3RVWD 2YGOA 1CLYH 1CG9B 2WBJB 5AB0A 3WIHA 4R97C 2LAAA 3IWVA 3QT2A 4OFYA 4NQXA 4YHZH 5E1AA 1I1AB 5ICZA 3T65B 3TO4B 4JJ5B 3VUAA 5E00A 2FYYA 4FULA 5PAZA 4LCIL 3X3FL 2ALAA 4HISA 1DUYB 1KTBA 3O3EA 2IOIA 4NZUH 1S9WB 2VRQA 3IE9A 4XZUA 1NBYB 2ZWKA 3MTRA 2R1WB 1IAMA 3NZUA 4QI3A 3KBPA 3B2UD 2ESVE 1PQZB 3TBTA 4Q9QH 1G9EA 4BZ1H 3ZT6A 4HVBA 1BXXA 2A99A 3NG5A 3F62A 3PWJB 4P9MH 4HJIA 4N8VA 3VVWA 2E86A 5LNGA 2EEXA 4JY4A 1GYVA 4K15A 2I60L 1OP3K 3DRQA 1AGDA 2PCPB 3D5OF 4IBVA 4JUTA 2J88H 1FNHA 3SJVD 3KWXA 4XO3A 3UROR 2VDMH 4IBLT 3TVMB 2FO8A 2VDOL 3L1OL 5GGRY 5HYJB 2PO6A 1OGTB 4YSCA 2WCPA 1KMGA 4LO9A 4BWUA 3ISYA 4AV4A 5I1LB 1S7UB 2Q87A 1UJ3C 4XP1L 4KKNA 1Z9OA 3SKJH 4I0CC 1M7IB 4UQIM 4MCMA 3MOAH 3O6ML 4WUUB 3ZDXE 1ONQA 1JG9A 2ZOKB 1N9PA 3M1OA 3OGOE 1Z66A 2APSA 2UY7A 3MV7E 4YFLI 1KC5L 3KPQA 1KJVB 3WFDL 4ZFGH 3O4LA 2C7UB 2XWZA 3IDNB 4JY5H 4G5AA 3VG0H 4I3SH 4HCGA 2CO2A 4BRJA 4F7EB 1TO4A 1AXSA 1Q0YL 3MRBA 3IFOA 2F74A 2Z35A 5BO1H 5KSBE 4KKRA 4M6MH 1I9IH 2PLTA 3SPCA 2BW4A 5J4MA 3U2IA 4G3YL 5KBNC 4K3GA 2ADFH 1GAFL 2BY0A 3FCTB 5DJ2A 3DHUA 1QVOB 3JV5A 3ARDD 4H1LA 3MRIB 2WXPA 2DLTA 2KC0A 4JFFA 1EHXA 3ZK0A 1WT5A 2OK0L 3U30B 4FQHB 4M5ZL 5DJXA 2WBWB 1T7YA 2O5XL 2VMFA 2ZCKH 3S3PA 1ZIBA 4P46B 1FIGH 2QSCL 1X5FA 2ZX5A 4XWOC 1CF8L 4XN9A 2ROXA 4X6DF 3RI5K 1CIDA 1DVFA 1IM9D 1XB6A 3TU6A 1BIIA 3GMLB 4GKZB 5EOQH 5ALCL 5CN2A 4R5VA 1VHPA 2NY3D 1EJ8A 1D9KA 3VB9A 4EE2A 2NW3A 5C3TA 4EUPG 3LKNA 2R2HA 4R5XA 4DZBA 1USZA 2K45A 4QXWA 4LSVH 3EO9L 1ETJA 3GMOA 1JDDA 2YR3A 1FNGA 2EDEA 1SHXA 3HG1A 5JXAH 1L9TA 2IAMB 1P5UC 1P7QB 4GW4A 3TEUA 2HRHA 3H3BC 3MJ8B 4IRSC 4KGJA 2FJSA 1CLYL 4ORGB 1OLLA 2P26A 4Z7VA 5DJ8B 4YHZL 5L8JB 2VLRA 3Q5OA 2VABB 1F11B 1KGIA 2B59B 2JKRM 2Q3XA 1M7XA 2IH1B 5J6GB 4PJXB 5G5DA 4NZUL 6FABH 1F3DH 4WFHD 2OS7A 3ZLQC 3S3SA 3H2WA 2QDVA 4Q9QL 1YEHH 1A3RH 4G8IA 4JDTH 4R7DA 4IOSA 1M42A 4BZ1L 2AQQA 4OF6A 4GBXA 2XN9A 4IKNA 2O5ZH 4IHBA 3IDGB 4P9ML 2RQEA 3L3OB 12E8H 1VEMA 3LIUA 2ADIA 1AE6H 2HT3D 2EJ1A 3PWPD 3ILQD 2YXMA 3O4OC 4WWKB 4EAEA 2XV3A 3KHQA 5GRJH 4AM0Q 2PWEA 2H6OA 5ENWB 1AD9A 1BSIA 3EYUH 3C8KA 4PR5A 4AH2A 1M71A 2J88L 4Y5YA 5LDUA 2IADB 5EF3A 5J11C 2VDML 3C60D 5JDJA 3NEEA 1E3FA 1U8IA 3BH9B 1IBZA 3B9EA 3FRPA 5BZXA 3NCCB 4PFEA 4MCZB 1ZA6A 3OSVA 3U4KA 5AW6B 1QSFD 1UQSA 4G9FD 4J1UA 2V5RA 1VZGA 3QIUC 4MXVE 4JFOA 3SKJL 1S3KH 3MOAL 2JCCA 1S7XB 2GY7B 5EU3A 5EZPA 4EMZA 4Y19A 3OHMB 3CSYB 1YMMA 4GNKB 1SUJA 2X53A 1FE8H 1RJLB 3LDBB 3VG9B 4ISVA 1SXAA 2GY5A 3AXIA 4ZFGL 1UURA 1KELH 2BVYA 3AG3B 1I8KB 4J4PD 4YEEA 3VG0L 4I3SL 2YK1H 4K9JA 1W15A 4YWGH 1HIMH 3DIVA 2R4RH 2CQVA 3DDFA 1SJEB 2IPTH 3ZE1B 2AJYH 2EILB 5BO1L 3B6SA 2H3NA 4WNQA 5E94A 2HLFC 5EBLA 4JFSA 4M6ML 4NFBA 5F9WB 3P3UA 2YD3A 1I9IL 3FAWA 3P0YH 1N3NB 3RZWA 3NIFE 5SWZD 3L5XH 2WZAA 1Z32X 1AZNA 2ADFL 4H88H 4N2IA 1U8CB 2EDWA 1W80A 5KYUB 1U8PA 2XWBB 3K2IA 3REWB 5JR1H 3N42B