5D7EA

Crystal structure of taf14 yeats domain in complex with h3k9ac
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
140
structure length
140
Chain Sequence
LGSMVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQIPLNKPLLTEELAKSGST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Association of Taf14 with acetylated histone H3 directs gene transcription and the DNA damage response.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Nuclear protein
molecule keywords Transcription initiation factor TFIID subunit 14
total genus 30
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5d7eA00
5HJDA 3QRLA 3RLSA 2NDGA 2L7EA 5IQLA 4TMPA 5IOKA 2NDFA 3FK3A 5D7EA 5HJBA
chains in the Genus database with same CATH superfamily
3QG6B 3NZHL 4QRPB 2XWXA 4HC1A 2ZWLT 4XNZB 5EU4B 3V0AC 3L08A 1TITA 3VI4A 4B97A 1H3XA 3VWKB 1Q0XL 3DOSA 1SDDA 4MTMA 4NX0A 5GGTH 3ZSSA 2YOCA 1BQRA 4MRBA 4IDLA 1ZLSH 3QDMA 2XV2A 2J8HA 1FNGA 5FHAL 3VXPB 5E4EB 4RH4A 4DOHB 1EEUA 2Q76B 5BRZA 1AMXA 4JKLA 3MU3A 4G70B 5LB1A 3ZJAA 3ZQXA 4ZO6A 1KCSH 1H9VA 4ZMVA 1JNJA 1CGSL 1XR9A 4Z0BL 4QRRB 1QWHA 3EYVB 3PWPD 5E95B 5ID1B 4I9WD 3WENA 1HQRB 1SYSB 1X5YA 2R2HA 3AMLA 4JM2C 4WDIB 3OAWA 3N3EA 1XV8A 1OAQL 4W4OC 1NWPA 2DV6A 2Z8VC 4JHUA 1BIHA 4EI5A 4LVEA 3IDXL 3WKYA 1JGUL 2FRGP 1HDMB 3VVVA 4TYUA 4LPXA 2CHZA 3EYUL 3JV6B 2GUOA 3ILPB 3QFGA 2Q7AA 3TBCA 4FNUA 3O8XA 4Z7NE 2NXZB 4Q9QH 1E27B 2JI2A 2MOVA 3PHQB 2IJ0C 3TIEA 1I8IA 4F24A 5GGUB 3GIVA 4Y5YA 4MZRA 4CADB 4LIQH 4B96A 1IAKB 2WN3A 1GY2A 4JKWA 3ZVVA 3QNXB 2JJWA 4YSQA 1RIHH 1LK2A 3MI6A 3OKDA 2VDMB 3GBLA 5KYYA 3L48A 1KENH 2NZIA 3NBNA 2GJRA 4Y1SA 5EOQH 5AENA 4FA7B 1DJXA 2OTPA 5HGAB 1TZHA 5A16B 5LNDA 4FXKA 3ULAB 4MD0B 1UC6A 1K8IA 4JFZH 1H6UA 5FDWA 2WVSA 4EIUA 4NUGL 5JOFA 4PRNA 4J3BA 3D6GA 2D9CA 1CI5A 1IBDA 3GBMH 4B9FA 4XN7A 4ODUB 1JD9A 1GHFL 2WK2A 4V33A 2IXQB 4LPTA 4OJCA 3MNMA 5DURB 4XNYL 5IY5B 2W59A 3QIUB 4JM4L 1CU4L 5T1MA 1NCAH 3ZYJA 4NDMA 5L0QB 4YHOL 5CWSB 3KVPA 1A5FH 4G8FA 3QEGH 1NKOA 2A6JB 15C8H 1AGDB 4CL7A 4M62H 5BZXA 1QRND 3QDJE 1PX3A 5HGDB 3VCLA 4BWTA 2R9HD 3WXVH 3M6DA 2NNFA 3BPNC 5E99L 3GKWH 4J28A 3E9TA 3R4RA 4K7FB 5DHDA 2GG1A 1JZHA 1KGUA 5BS0B 3QDJB 4XE0A 4A6YA 1K2DB 4GAFB 4ZFOB 1MFDL 5AKRA 3QUZA 1FF5A 1CE1L 2XG4B 3TEXA 1CXFA 2EINB 3OHXA 4P2QA 4LOVA 2GQHA 1ZDSA 3GMPB 1A6TA 2XZQH 4WNJA 4O2CA 2EVJA 4S1QH 1TTFA 5F7DA 5E24E 3EF4A 1JCVA 1RULL 2WQRA 4H44C 2DQEH 3TBWB 3V0HA 3K0WA 4XMPH 3MUY1 5M7QA 1UOKA 2NY7H 3GHEH 1EAOA 3HHRB 4PBVC 4JM0A 1SHWA 2HTKD 2F53A 4FQQB 4OD1H 3AGVA 3MJ7A 4XVUD 3OJ2C 4KXZH 5D4JA 3ZOAA 1UJ3A 2XBTA 2BK8A 5F93C 4Z5RB 4OZ4A 2D2CC 4H25B 1HXKA 4PRAB 3JUYA 3V5HB 1EEYA 3MNWB 3MACH 3OJMB 3S3PA 1YN7B 4P5KB 3DSNB 5D8JH 2JKNA 5SWZE 3APDA 3SOTA 1T0MB 4Y1AD 1AP2B 4TNVF 5T1KB 4JZNB 1D5BA 2WZ6A 3ARZA 3D25A 3WNPA 1WE5A 3EFOB 5ALCH 3GJEB 3WS6A 1A7NH 1K8DB 2D7OA 3A67H 1UWEL 4PGEB 1A2YA 2FQGA 3VRJB 5I0WA 2A5UA 2G60H 2IQ9H 3S96A 1X4YA 2UZYB 1YEIH 1G7HA 3MCYA 3UBXA 1UATA 3EJRA 2ESVB 1U93A 4XTRC 2O1AA 2XXMB 4IDJL 2CZNA 2NPLX 1HHIB 4I1PA 5IVXF 4XZUA 1MJ8H 1S7RB 3X13B 2FATH 3ZE1F 5IROD 4JQIA 4WWOA 4AW7A 4XNXL 1F8TH 4S1DC 3KPNA 1RL1A 4R2GD 2KLTA 2LU3A 3GTVA 1GRWA 1MAML 5C8JA 3BUIA 3QUXA 3PP3K 1KJMA 4UB0L 1YECL 1TTRA 1LP9E 3R1GL 1EZSA 1N64H 2QHRH 1A3LL 1NCBH 3OGCB 5IHLB 2OP4L 3M7OA 1M7XA 3UG4A 2CR3A 2CLRB 4JM2D 4POUB 3WFZA 2P24B 3T0ED 2JCCE 5AB9A 5KVMC 1DSFH 5AKVA 5EZOL 3DO7A 1EHLH 1ORQB 2JJSC 1BD2B 5I18L 1RFDL 2BS71 3E8UH 4Z7QE 1QAWA 4NERA 1T6WA 3HHMA 4KAQH 4DVRH 4AM0A 1ZT1B 2FHFA 4IGBB 4JR9L 5HI3D 2QFRA 1G84A 5FYJD 1BD2E 5EU7C 2BOBB 4PFEA 4KVNL 1TXKA 4ZFQA 4QXTB 3ZDZF 3ERXA 2H9GA 4H2AA 2TAAA 4APXA 3FYIB 4I7ZC 3SQOH 4KPHH 1MW3A 2VDRL 3L81A 3O6ML 3WJJA 2EUXA 1WHOA 3SBWC 1SXCA 3FT3A 4JJ5A 3A47A 2X1XR 1G5AA 1BHGA 5HHMB 3ZU8A 1A0QL 5C07A 3UABA 1PAZA 1WYJA 3UAEA 2F7RA 1DLFL 1K6QL 4D0CB 1E4WL 3N1FC 4LMQE 1T04A 4UT6L 4BV1A 4P04A 1SF5A 1G7MB 1OTTD 4YE4L 4PP1C 4WHYH 3BLBA 3LKPA 5GS2D 2R69H 3CSGA 1LD9A 4JFOA 4B9CA 4EIGB 1UJTA 5L2KB 1MSPA 1OCCB 2NY6B 3C87A 3OWRA 5LGHL 2AJXL 1GGIH 5FX3A 2WY3B 1E2VA 1LQBC 5A2CA 5T3XL 2CXGA 3ZHKA 5BNXD 2ADFL 1Q0YL 2FO8A 3P9MB 3VXUB 2YFNA 3RFZA 3RUGF 3MJWA 1XXDC 1CK0L 5IQMA 3H0TA 5F7EH 4JPKL 2DRUA 3ULUH 1FNLA 5D1QE 3UP6A 3KYKL 1GW0A 4KI5D 2PTTB 3ARPA 2YMXH 4X8CA 1GIGH 2NDGA 3X11B 1A64A 5TQ0L 4KRPD 3VSVA 2NUTA 5IHZA 4ZMLA 5ISZE 1S9XB 1HEZB 1EAPA 1J5CA 1MFMA 3TWYA 3KPRA 4MWFB 3V4PL 4ZPVA 1WD9A 2D03L 3IXTA 2OLDA 1CURA 2QQNL 4QKTA 4YNYB 1BZ9B 4ODXB 1SYSA 3EYFA 1E6JL 2HTLD 4AYBA 1HL9A 4HISA 4LPWA 1G0XA 1NZRA 3RWEB 1ZV2A 3GGWA 1T3FA 4WFFE 5KS9E 1U8NA 5DYOB 3EFDH 1G7PB 1Q72L 4PB9L 3E7JA 3M86A 3QZWG 2PW2B 4PS8A 2MCMA 3VTTA 4Y4FD 4PY7A 2LVCA 5JPNC 3H54A 1QLFA 3LKSB 4JRWA 3F05A 4KRPB 4HWBA 2X0UA 1CZ8H 2X2UA 4FFTA 2B15A 4H20L 5ELIA 3IDYC 1CF8H 2UZXA 4X9FA 1HHGB 3ZGIA 4F8OA 4AL8C 4H26A 3GUFA 4IEFA 2ODIA 3L6FB 2RGSA 4KK5D 1SLVA 2VM3A 3MBEC 3ZKMD 2N01B 1Q9OA 3GINA 3HFMH 4JRYA 5GGTA 4FQ2L 2EDTA 1S7UB 3HS0B 4F27A 3DV4A 3R0MA 3P3UA 3ZZQA 1TZGL 1OP3H 1XTLA 3GRWH 4DN3H 3DPBB 4HIIB 4D8PA 1U91B 4TUKH 1A7PH 3ARTA 4EUPB 4U1IB 1X5XA 2D2OA 4QNPE 5E1QA 5EBMB 4XPTL 1RZKL 4LARH 4QMEA 5DJ8B 1U92A 5I1HL 2CK0H 5HVGB 3ZL4L 1D7FA 2MPAL 4AMWA 1RPUA 5I1EH 1I7UA 3D25B 5F1NB 4P2RE 2DPKA 3SGJA 5EPMA 4NWUH 1FWXA 5I30L 4XNDA 3V52L 5BZWB 4X42A 3U46A 2IPTL 4B3EA 4WFHE 5F44A 4P9HH 4ZD3L 3SPJA 4FG6D 1RZIB 3MGOA 1R5WA 2VLLA 1QBML 1TSRA 3VD9A 2WTOA 5DJCB 2ATAA 3KBFA 4PWJA 1NC4A 5I5IA 1FBIL 1XGQA 2QSCH 4PCTA 2CKBB 5E2UH 4M43L 2J25A 3T5WA 3NEXA 2NTFA 3NSYA 4XVSH 1GZPB 1OW0A 1TYRA 1BD2D 5F6IC 2APFA 4P23D 4ZAKC 2Z4TA 1TCRB 5CJQL 4TVPD 3CPUA 1RIUH 2B7DT 5I2IA 1WC7A 1H6TA 2XWTB 4FQHA 3V4PA 4OCXH 3MUGA 2FJUB 1FGNH 1AYOA 4I0PA 1EGJL 3DSNA 4G6JH 1ZA3B 2ZOWA 3SD2A 1R0AH 3N1GC 4NLAA 4UOW0 3TEWA 1O6SA 2NY3C 2XA8H 3ESOA 3B2PA 5T33H 2HKAA 1BJMA 5LQBL 1I3GL 4H0LC 1AHWA 2V3EA 3ZTNL 4L4VE 4ZO7A 1HE8A 1ACXA 3QQ4A 1TR7A 3REVB 3RTQA 3OPZL 4F8TA 1L3NA 3WELA 3SCMC 2X6VA 4JFFB 1GGBH 1YPZF 4PG2A 4PWKA 3ZE0F 4HBCH 3POHA 4X9GA 2F8OA 4YDIL 1FFQA 2WKLA 2P49B 5CN3A 2EDKA 1A21A 2BSTB 3L4WA 2J73A 3CDZB 5A2KH 1FH5L 4RNRA 1LNUB 3KYMA 4XPBH 3P9MA 1N68A 4TV3A 4WEUD 4J23A 4P2OA 4MVBC 1V3MA 4FQXB 3KGUA 5IWLA 1NGYB 3N42B 5K1JA 2XQBH 4Q6KA 3QWOA 3VVWA 1RJLA 2R56L 4MD5B 2IADA 1Z5YD 2V6HA 4J2QA 2DQJH 4LKCB 2WLJA 4NO2A 1TU2B 4I13B 3NUKA 3SD5A 4K3DH 5TE7H 1WHPA 4GMSL 2Z7YA 2DIBA 5DEGB 1DDTA 3R0NA 1KBPA 1N19A 3AACA 1QEWB 2IPKB 3FSAA 2W9EH 3H9SE 3P0GB 4K9EH 2V3FA 4QTIL 4XXDA 5CZRA 1QW8A 4U3CA 5TE6H 1T7YA 5E8OA 1KJ3L 1KCVH 1WA0X 3SB3A 2AJVL 2DTSA 3ETTA 5L4JA 3CQFA 5FFOA 4NWTH 2EQDA 4M7KL 1PY9A 3T2NL 1BYPA 2NYKA 5FYJL 4BFFA 3LZQA 4KWUA 3BDXA 4JZJA 2IBZX 5GISL 5IB4B 5AAWA 5I17A 5SV3A 3V6OC 5IIEA 1IQDB 5L9DH 2VMFA 3MLTB 4KTEH 5JA9A 1GMEA 4OAWA 2HRHA 1F4HA 1OD7A 1VFUA 1I7TA 2H0FA 3MRMB 3OZKA 5IBUB 4N90D 4U7KA 3KLAB 2FLRT 4PR5B 4P4RA 2W88A 3HS0A 4WEMB 1MXDA 3IDJB 3F7VA 1N5YL 3JYBA 4QO1A 1NLDH 3DV6A 3HTLX 3D69B 3P0VL 3EJUA 4HS6A 1PZDA 3OVUB 2X89D 4FI6A 4Y19A 1X9UA 3QJZA 5JYLA 3MGTA 1FHNA 5C07D 3G6JB 3VW3L 1QNZH 4ZZKA 4AQ1C 4JO4L 1ZIBA 3GSWA 4QTHB 3IXAB 4WFHD 4GINA 1G7HB 4LLVA 1WFNA 4L8DB 3FU6A 2OMUA 4JO1H 3GLEA 1EO5A 3PREA 3IB4A 4HHWA 4P23C 3OKEB 4Z76B 1J5DA 3U46B 1A9VA 2ZG1A 2XSKA 3S8FB 5JNYA 1F3JA 5IQ9A 1BZ9A 5FYJU 3VQ1C 1OPOA 1CR9H 2KZBA 3RHWK 1I7UB 1KJMB 3QRLA 4BD4A 4DEUA 1Z9PA 4XPHH 1X9RA 3ILQD 4UTBL 4PJ7F 4YBHA 4WO4A 4ZXBC 5SX5H 2F1EA 2I7SA 3O3AB 1JZ2A 2I9TA 3NACL 4K8RH 2CK2A 1FZKA 3N06B 1PL3A 5E5LA 3T1FB 2AEPL 3ZE0B 2WW8A 3QPXH 5FUZL 5F3BB 4UT9H 5K1NA 1VZHA 1CLVA 4OV6F 1FORH 4HK3J 4K5OA 1BM3H 5IEHA 2WLIA 1WBXB 4UIKH 3ULVE 3BUQA 3HI1A 3QWRD 2DM2A 4M6OL 4Y9BA 1KIPA 3DUSB 5EU7E 3BX7C 4NKIL 2GIMA 5BUGA 4XMKH 1YMHB 1SUHA 1L7IH 2WP3T 5IG7B 1DVFB 4Z78B 5IW1A 3RWEA 1SEQH 4PSRA 3LZFH 5IB3B 4M1GL 4KO6A 4KNTA 5FFLA 4DP1X 1IC1A 1RUQH 3WL9A 4IBZA 5MEPB 3CLFH 1UACH 5K9QG 5INCA 2FECL 3O3BA 4Y4HD 5D1XC 2HKHH 3F12A 1F6AB 1WTGT 4R7DA 2YXVA 4Y2OA 4CN6A 3ZIYA 3GHBH 4HC1L 2WUBL 4ZQTA 4FYRA 3F58H 2VAAB 2YEZA 5GSVA 2RD0A 5DUBA 3G5YB 5DJDB 3RYMA 4P5SA 1G0DA 1MJJA 2LVEA 4TPRH 3EOTH 3NCXA 3CCHB 1DLHA 1HESA 1S7TB 2J56A 1AGDA 1BF2A 2COQA 5LGYA 4KK8D 3JWDL 2WB1A 4HULB 1MELA 1FGVH 5JXED 3C75A 1L9QA 4HLJA 4PJ6A 2QBWA 2Z8SA 1EDQA 1N8ZB 1P4LB 4IRJD 3P4NB 3N1PC 4DK6A 3LPFA 3FUIA 4OZGB 2NRDA 4QJ4B 4Z3TA 2ALWA 3DNKA 5D2NC 1K2DA 2OK0L 3FN9A 2AKRB 1ZT4B 2IFGA 5LWYH 3VSUA 1I1AB 3UAJA 2NMSA 4RFNC 3ZDYE 1FC2D 1X6NA 3HMXA 4NEHB 1EFXB 2A9BA 4YVNA 5KANG 3WNKA 2OXHA 2J2ZB 2OTWA 4WK2B 4BH7B 1YNTA 4DQAA 2ZCKH 3UH8A 3L3OA 5TF0A 4BZYA 3S5YA 2YMTA 3UTPD 2V2XB 1R33A 2H47C 4OCWH 1DVQA 5AWNL 2J6EH 3LSOB 3HMXL 2P8PB 2JB5H 3BEWA 4NGHH 4F7MB 3MOAL 3DURB 2ATKB 3VI3F 4AOFA 2ED9A 2CJTA 2QKSA 1MCHA 2VQUA 5IR1A 5AYUH 2JKWA 5D7LA 8PAZA 4K3JH 3APNA 1ICTA 3NQKA 5D2LE 2VW7A 5EC1A 3SDCC 4OZHE 2NY5L 2RQ8A 3LDBC 3FTXA 4GBXB 4MNHB 1INDH 5EO9A 1W80A 2FEDD 1KULA 4HG4J 2Q9OA 3RWFB 2EIKB 3ZGHA 3FT9A 2AV1B 2AERT 3N43F 3L2MA 1JNHB 1LEKA 3Q13A 2DLFL 3SZKC 1ZK5A 3FB8B 3G6AB 4WF7A 5IOPA 3TT1H 4HKZB 5KJ4A 2YD7A 4RA0C 3CUPB 2VJ0A 2X4OB 4WKZB 4KBPA 5C0BA 2VXSL 5HJDA 4JO3H 3UYOD 1KNOB 3K6OA 3WFDH 1OAXL 1UEYA 4N8UA 4PRBB 4HCRA 5T3ZE 2RH0A 2VDRB 1JD7A 3OQRA 4JFVA 3TBBA 5K59E 1MLCA 1P5VB 1WWBX 3RX7A 2HT2D 3ARDC 1GC1H 4NC1E 3VD5A 3U0PB 1MHCA 1JBJA 2DQHH 4P46B 4OLXL 2IDTA 4Z9KB 4YBLB 5IJVB 5C0RL 5K69A 4N0YH 1R24A 3L1EA 1I9JH 4XWGL 5IBLC 3CVHH 2UXGA 4HALA 6CGTA 4BUHA 3GT6A 5DC2A 2R0ZH 1IBZA 2I07B 3CBKB 1ZJBA 1L9SA 2BS9A 3DYOA 3NJMA 1VEPA 4PJEB 5FHBL 1EZVY 2FJSA 1IZKA 1S4IA 3VFVB 1VKXB 2YA1A 4DSYA 2Q76A 2VLLB 3ILDA 5K5YA 3AXLB 5JW5A 4Y9EA 4RMSA 4F7EA 1MDAA 4X8JB 4N0UA 1FZJA 1B0RB 4ODWB 2BSDA 4XPGH 3T1WA 4ISVA 2G5BA 2Z35A 2DKUA 4PJAE 2CHDA 1U4FA 2VXQL 4Y2DA 3T3ME 4DKTA 1CYXA 3OQ3B 1MF2H 2CDEB 1ORSA 2B0SL 4JFPB 3PWVA 3O6FC 2YPVH 4IGBD 3GJFK 1QFPA 4YR6B 4PREA 4XN8A 4ZTOL 5L7XH 1Y0LA 2I5YH 3GS0A 3FHQA 3V95A 2NYYD 3BRGC 1OK0A 2ITFA 4B9KC 1T5WB 2W60B 3O3EB 2DMHA 1WZ1H 4QRRE 4WTZG 3KMDA 4MAUH 1YJDL 1CG9B 5MEQB 5D9SA 3TEYA 4G6MH 4QHMA 4FEMA 3U7AA 4PD4J 3FO9B 4NQEB 4PBDA 5L6YL 4BGLA 3QQXA 2VABA 1H6EA 2IOMA 3TX4A 1HIML 4HSAC 4PJIE 5GZOA 1UH2A 4JGNA 3EG9B 3CGTA 5CKGA 5AEAA 1OGAD 3MRRA 3MBWB 3ME0B 4RMUA 4EXKA 1JXFA 4E68A 3QORA 2MKLC 2FO4B 4LDOB 4OF7A 3F62A 3RWGB 4IU2A 2FIKA 1H3PH 1BSIA 1WICA 1AS6A 1U8LB 2IXQA 4A63A 4P3CL 1XGPB 5C0BD 3A3YB 3NCBB 5AALA 3SOBH 4UOQA 5CMAA 1CDBA 2BZDA 4MMYB 1H3WM 5I23A 3B9DA 1Q9KB 3MZTA 2ICWI 2XTSA 4FQJH 2NY0D 4ONGH 1J88A 4WDIA 3PWJB 2W0PA 3N91A 2R29A 3T8XB 5A16A 3TTYA 2JJTC 1X9QA 3LS5H 4GO8A 1JMZA 5T5FL 3C6EA 1QEXA 5FLVA 3O45A 3KBHE 2FWOA 4OF5A 4PRNB 5LBGA 4WI4A 1S3KL 4MQTB 2QKIA 2SEBB 3VI4E 4EIBA 4DP8X 3IMBA 1ETJA 2B8OT 3GBEA 5AZEL 4ADJA 4MKTA 1RZGA 3PGDA 4NQTA 2HH0L 1E7VA 5F0LB 3FTWA 2Q20A 4HS3A 4HK0B 5C9JA 3FN0H 4AM0Q 5BQDA 1HOCA 1XFPA 2VAJA 2YSSB 2CJ3A 4IKLA 2RFXB 1T1WA 2MMXA 3KR3H 4FNPA 4N5EC 4YS4A 4AQOA 4FKEA 4AVKA 2WSDA 5EIQA 5CFAA 3AT9A 2FNBA 2OSLA 4NO0D 3DK2A 2HTLC 4UM8B 4B50A 2PLTA 3HZYA 1KGYE 2UUDK 1U2HA 4PCSA 1IUZA 1SRDA 4IKKA 4HU8A 3D48R 3QHZL 4Q4EA 1LE5A 1KTDB 4LEBA 5EF0A 2X70B 4GKZB 4NS0A 4LXFA 1GS6X 4YSOA 4NN5B 2A83A 4FL4B 2EE9A 2GIYA 4JFYA 2OJEA 1ZHBB 1I1CA 1IV8A 5I19L 1B2WL 2CLVA 3CVHA 5C0BB 3RNQB 1MEXL 4AQEB 5DSCB 1QFOA 2NY6D 3U0PA 1VFMA 3A0OA 5DVLA 5EA0H 3SIKA 1BG9A 3EYSH 2WBWB 2XPGA 3II1A 4I1RA 2Y9RT 3NGBC 4X80L 4F2MB 4MZ2A 5IP4A 2W9DL 1DN0B 1OGAB 2GSGB 4IRJB 4M5YH 5L2JB 3CSYA 1G6RB 4GH7B 5FYLD 4L18A 5EZIL 4LLDA 2WQUA 3C6SA 3SE8H 2LU5A 2YWYA 4UQ9A 1TLKA 4QRPA 2P26A 3L5WA 1RK1A 2F54D 1DUYB 4XPAL 3FCGA 2YRLA 2ILLA 4KKLD 2V9UA 3LRHA 4XNUL 1A4AA 2FTAA 5I1DB 1MFEH 1PX8A 3D30A 3CHSA 3FQXB 2VZUA 4M7ZB 1JN6B 4BSVB 3SQBB 4LEOB 2BZ7A 3QDGA 5A6LA 4KGJA 1FAKT 3ABZA 3FU9A 4NYLA 5I74B 1M05B 4P46A 3QEHB 5JPMC 4GIAA 5DD5L 4RMBA 5J3HD 1BQSA 2FEEI 1H8NA 3L95B 4JRFA 4TKWA 4F37F 4WK4B 4HJGB 1HXYB 5MEND 2DEXX 3DMMC 4HIEA 4X83A 3ARGC 2D4FA 3T0EB 1ZVYA 4HHAA 2XQYA 3O2VH 4XGZB 3T4AC 2VDNH 1SBSL 2F0CA 4G8GE 5T1DH 4ZMXA 1AI1H 1HILB 4KJQC 4MA7H 2HJLA 1T20B 3T0EE 4Z7NF 3QS2A 1AC0A 4JMXA 4OD3L 2XPZA 1XMWA 2O5ZH 4ABVA 4UQ3B 5KG9A 2EEDA 4ZMQA 1KJ2A 1ITCA 3GIZL 5DJYA 5ACZB 4O00A 1UWGH 1EDHA 2CM5A 1EXHA 1BG1A 3KDPB 3GSQB 1X3DA 3WTYA 4B9JA 5DUBB 5FKPA 3TBVA 4UF7C 5IVOA 4MA8H 3WUWB 4IIQA 3K1KC 2GIXA 3OKDB 2YC1A 2A4ZA 2FL5A 5DR5L 3RA7H 1I31A 2H3NA 3BDBA 3VFSA 1UGKA 2X40A 2HVJB 5F9JA 4F80A 3KPMB 1OM3L 3TBTB 3MJ9L 2QELA 4LAQH 4XNQA 5AOKA 3ZMRA 4M1CD 4FRWA 1U9KA 4G5ZL 5I1IL 1AXSB 3ILPA 3QUMB 1B4JH 4YHIA 2UWEE 1FO0H 1BW8A 1FNSL 1IFRA 1RJCA 2RJMA 4L3CB 3QZLA 4FFZA 4U0RB 2NY1C 4EO5A 2WP3O 5FO7A 1OCOB 4E9XA 1QSFE 2XWJB 3VYNA 4L37A 5B1CA 1DQTA 4KNUA 1TT6A 4RGOH 4LLMA 4PTUB 5HHME 1T03L 1KBGL 4RFOH 4ZQKB 4WJKB 2BW5A 2DM4A 3VCLB 3KLQA 4QHUB 3HC4H 1JE6A 4KI5C 4EIZC 2RALA 3FQRA 1YEDA 1ZLEA 2ZJSH 4FQPA 4PMFA 3TM6A 4GBXD 4MJ5B 1OEZW 2R0WH 2PPFA 3TESA 4FHJA 1IAKA 1FL6B 1XIWD 3MRDA 4GP4B 1J11A 3TFBA 1G7LB 3QJRB 4ZS6D 2QPFA 2G5BB 2Z35B 4H8VA 5ISZD 2XFXA 5D93C 3AB0B 3V9EA 1JZGA 2AJUH 2WSPA 1OB1A 1S78C 2Y7LA 2YPLE 2WOYA 3BP6A 1AYRA 4UZUA 5IMKA 4HEME 2QMJA 5GGRY 4ZNEE 5I0VA 4PLKC 3SKJL 4OCYH 5BS0D 3AQYA 5KVFH 3HCVB 3J27A 2X44D 4IJ3C 3STZA 3V5DA 5DRWB 2X4OA 3B2MA 5DUPL 4XCEA 4GXVL 4JVWA 5I71B 1NC2B 1TYEB 4YX2L 1CFTA 1MIML 1V3KA 1MG2C 2ZOKA 5LHDA 1BFSA 1HNFA 3RIAF 5IFAL 2XLLA 2W95A 3G3LA 3HUJF 1T1ZB 3UJTL 2CJUL 2B08A 3JWOL 5FO8B 2DN7A 4HS8L 1WZKA 2XPGB 5I1AB 1XR8B 5ES4B 1JPTL 1EUTA 2OMYA 2H2SC 1HYRC 4F2MA 2W0FB 4R7VA 1YNLL 1UT1A 3ZK0A 3CVHB 3RNQA 1G9ML 4G6FB 1AOHA 1FSKC 1N0LB 1R47A 2CBQA 1FC1A 1CD1A 3BAJA 3BH4A 4R5XA 1NCIA 4BK5A 3MXWH 3T8MA 4H5SB 2HLFC 1HL8A 4C4BA 5I75B 5DK3A 4MAZA 4P5TA 3IFOB 1CLOH 4GAAA 3TFKC 4FQXD 3F6IA 5DTFA 4Q9CA 2A74A 5DFVD 4F9PC 5AAMC 4ZFZA 3TCXA 1T89A 1Q9OB 4JRYB 5E7BA 4PSPA 4MWFA 2ITCA 3GPEA 1JGVL 1U36A 2B5IC 1M2VB 4LCWE 4R0LC 2RACA 3RWHA 4BFIA 2IANE 4Y7OC 4IIZA 5DZNA 2JWYA 2B39A 2OSLB 4Y4HB 5E08H 4LCIH 3VXQB 4KRLB 4ABWA 2IBGA 2BNUB 4JN2A 1MCCA 3TN0B 1C5BL 1E9PB 3TU6A 3I74A 1P5UC 5D6DA 4RA3A 4PWGA 3V4VL 3WE6B 3K1DA 3NSCA 5DD1L 1LP9F 1E4XL 1RZGB 5JHDD 2AQRA 2OS7A 5MHSE 2LE9A 4HKJA 2NYYC 3FB7A 1UB6A 1ZPLA 3CC5A 3DGGB 3P9WB 3CFJA 4CMHB 1GJIA 2WLNA 1G6RH 3VB9A 4KKNA 4MBOA 4MQXD 3OJDB 3KLHC 5CFHA 5F0MB 5IUSA 1R5IB 1G7MA 3GZKA 4TVPE 1HSBB 4HX1A 4QCIA 1MJ7L 1YEEH 5LG1A 5D7IF 1YEWA 2J44A 4JRXA 4I0KA 5JO5B 4Z5RA 4KQ4H 3MZGB 4Q2ZA 3QORB 2B59A 3U1PA 1UD6A 3FMGL 3E2HB 3QIWD 2BNRB 4X98A 3NT0A 3P9LB 5AW0B 3VXUA 5CM1A 3ZN6A 4UBDD 5E4OA 1HCYA 1UADC 5DK0A 4NM8H 3ABLB 1TJGL 1XSJA 1JHKH 4L4VD 3KWWB 4PP1D 1NINA 4KY1L 3WIHA 4NUGH 4QLRA 1G7QA 3V6ZB 1IGMH 3LPWA 3HHSB 3GBML 2Y5QA 2SODB 1IVLA 3Q2WA 3O6KL 1GHFH 1N6QH 2EH7H 3KHQA 5MENA 2ZPKL 1UZ8B 2DQTL 3ZO0A 3GC3A 1RUKH 1GJUA 2BVQA 4O9HH 4JM4H 3LNDA 3RI5K 1MH5B 4YC2B 5LKNA 4S10A 4YHOH 3C5SA 4RSVA 5ALBH 1XGUB 2WLLA 2PTTA 4ZO8A 4JY5L 5IQOA 1J05A 2P80A 5C6TL 1FL3B 1DQVA 3QO1B 4PRHE 2E7LC 4XRCA 3PGCA 3FO1B 1ASQA 5E99H 2EAEA 1IM9D 1WZLA 4XVJL 4N86A 2GPZA 1YYLL 1A7OL 4BJLA 1FPTH 1X5JA 3QI9D 4P2OB 1PMYA 5KVFE 1CD0A 4X5WA 3OG6B 4FLHA 2R0LH 2J1YA 3B37A 3QNYA 1XGTA 2VGLM 3CH1A 3KPSE 5EORL 3MV7A 4G8AC 2C4XA 4BZ1L 3LZOA 4EDWH 2KYIA 1KIUA 1BMGA 4GRMB 4A68A 3WJLA 2AXFB 5ANME 1NCJA 4W9GC 5DJ0A 1AKJD 2V8MA 3GLDA 4NNXB 1RULH 4PP2B 4PWFA 2DQEL 4DUXA 1U8QA 1B9KA 2OZNA 4XCCL 1E8WA 1P5VA 3GHEL 4J3SA 4RDBA 5E8PA 3W9EB 5CD3B 2GSIB 1H3TA 2J20A 5D2LF 1WDAA 5E00B 1PKQB 3CLEL 4GW1B 5CN2A 1J10A 4CC4C 4A39A 1OE2A 3KYOA 4IM8A 4NHCL 3LIZH 5AL0A 4MXQD 3LNIA 2A0LC 1FVDA 2M2DA 4E41E 2PP9A 1G94A 2GSGA 4IRJA 4E5XG 1DQQA 1P69B 1NOAA 1QSFA 2HSIA 3MACL 1VZIA 4AW4A 4WNQA 5D5MB 5T3XD 1SN0A 2JKXA 3S35L 3FQ2A 3DXAB 4NZ8A 3HC3L 1HCVA 3GF8A 1G7PA 4WVRA 1J12A 2PYED 2EUWA 1KJVA 2DKMA 5E8NB 3PABA 4GI8A 1DP0A 2EADA 4PVLA 4W9ZA 1A7NL 4JFDD 2XWBA 5IFHH 5IVXB 2G60L 4XP6H 1RAMA 4C4UA 1JPFA 4AEHH 2J1ZA 3AY2A 4UTAH 1QACA 5HHXH 2CE6A 1PY4A 4DT2A 4IDJH 1OAJA 1ODAA 4TSBH 4J2XA 2HAZA 4X9IA 2YAFA 3OKYA 4TUOA 3K2KA 3U9WA 4N2LA 4FA6A 2YN3A 4AQAB 4JZJB 2J88H 2IOIA 3ALPA 2ZX6A 3B56A 4BSJA 5J13C 4HIHA 2D3NA 4XTRD 2D3VA 3MV8E 4TQHA 4UB0H 5C7ZA 1R5VB 3DLQR 1N64L 1OTUD 4G7YL 2QHRL 4L8BA 4BCXA 3IGKA 1KUMA 1L5GB 4APQB 1AZNA 1XTMA 5BPPA 4C8XA 1TETH 5CEZD 4M61B 3W37A 4HJ0C 1ITBB 2YHGA 1DSFL 5EZOH 4H8HA 4WWID 4I4WA 2KT6A 4ZUVA 3PNRB 1HSBA 1Z9LA 3PAZA 4OZFH 3QR1A 5JXEC 4OKVA 2EIZA 1BFVL 3L9RB 3OR6B 4KAQL 5FS5A 1AO7E 5HYJE 4LCCA 1S7WB 2JK5A 3T65A 3CIAA 4QRTA 5HGBB 3L3KB 3KLHD 3INUH 3O6FD 2X12A 4M7LH 3QQ4B 3REVA 2Q1EA 4YXLL 5LXGL 1QWUA 1MAJA 2AXWA 4U4BA 5IFJB 3H4HA 1TVDA 2G30A 2GITB 4CA4A 5IT2L 1BBDH 2VDRH 1KPUA 1S9VA 4JG5A 3ARYA 3X14B 4Z7WE 3BO8A 4FTVA 3H56A 4MA3A 4R4BA 5DI8A 4LU5H 3V4VA 4DP6X 2BNRA 3DI2B 4LHUB 4JLRB 5FGCB 3RY6C 3IEAA 4EUPG 3U0WH 1IGFL 2B1OA 4Y4HA 1OT2A 1QBBA 1S7TA 5J8OA 5KVGE 2YXMA 4NKDB 4M03A 4QR7A 3T8VA 1IFHH 5C2UB 1OE1A 2ICWA 4KMTL 4YSUA 4HEPG 2WO2B 4PW4A 3UJIH 2HT3C 2AJXH 5F9AC 5D7JC 2DYPD 4JFDA 1AMYA 4HF5H 2OI9C 4N22A 3LRGA 5T3XH 4HOWA 1Q0YH 1PCSA 4HIJB 4P5RA 3G5YA 3BZFA 4ZMYA 2BSBA 1A9BB 5F7EL 4JPKH 1SHSA 1VA9A 3D4CA 2PYEA 2VR8A 2X0WA 1IC0A 4Y9FA 5M95B 1U3ZA 2YMXL 4LKXA 2BHZA 1GIGL 4Y19D 4EQ3A 1KXVA 3NCJL 3I6SA 3IFNL 2FWSA 4JRXB 5JO5A 2BNUA 1URZA 3TZVB 3QZBA 4BXSV 5KSBF 4YHKH 2O5YH 3FUMA 3LQAL 2OZ4H 3V4PH 5TF1L 2Y5TB 4L1SA 4UNUA 3WUWG 2A6IA 4BXVA 5C09B 5KVEE 5KYUB 2YFOA 4I88A 4N0RA 2QPDB 4PJGA 1P84J 5CIPH 3T2LA 1FNFA 2QVKA 1FNHA 4RVBA 3WAKA 3QHFL 1ONQA 3QW9A 4IOFC 4KZCA 4WENB 2ZIDA 2DQDL 3ZYOA 1FE8H 4IHOB 4LSDA 4RESB 2EIDA 2WB7A 5HBBA 4LLVB 4JZOA 1BEXA 1KPRA 2GBUA 1CF8L 3F7VB 4Q6IA 2X88A 2V7NB 4HXBL 3EBGA 2NR6C 5TD4A 2FEEL 4ICWA 3QDJD 3K6FA 4UAOB 5KSVB 1MWAA 3APCA 1E3XA 4OJFH 4L4TB 2EE2A 4WWKB 2IH3B 3FU7A 4HUWB 5ADOH 2C3GA 5EU4A 2I32A 1NCUA 5BMFH 2YXWA 2X4SA 4I2XA 4TL4A 2OCJA 2FJFA 1MCQA 5KVEL 2OMUB 3I9IA 3AS2A 4Z0XB 4KDVA 4X6FB 1MCRA 2YBGA 3QUYB 4FXKC 3F7YB 5IVXA 1SN2A 3B5TA 3QUZD 4XX1G 1NCCL 3WN5C 1IQDA 2QGBA 5I1HH 2AJZB 5T1LB 5DS8A 2WKOA 3W0WA 2YXFA 3ZQWA 3AWFA 3UPRB 5AKSA 4NJ9H 5DC4B 3ASNB 1JXJA 1DZBA 1V8HA 2ZQKA 3QZWA 4M7JL 4OKDA 4XXDB 3HC0B 5GZND 4MMZC 5C08E 5IB2A 3K71B 3RGHA 1OF0A 1YQVL 4WFGE 4L8SC 3ZE1E 4N2HA 1SXAA 4Y16C 4KZEH 2VH5L 3D2TA 3DURA 1WLHA 1QBMH 3FFCB 1QLRA 1J8HE 2UZIH 4YPGB 5IB4A 1SDDB 3PHAA 5TK2A 12E8H 1YEGH 3NRPA 3FCUB 2QSCL 3DK0A 3EYOB 5E5MB 1BVZA 2P7TA 4M43H 1AO7D 3EBIA 4I3SH 5FYKU 3APFA 4GT7A 4GQPH 4MKMA 1GZHA 1D5IH 1Q9WA 4K15A 3SJVD 3VXRB 4WQOA 2FX9H 2NYZA 2V0AA 1BAWA 5JW4N 3B1TA 3SGEI 4M3HA 5CJQH 3FW6A 3JTSB 3MOBH 3P4OA 1WK0A 1E28A 4F20A 4OCXL 2F19H 2XKNA 4KU1A 3CSBA 1SEBA 4ELME 4PJCB 1TLMA 4ZNEA 4OI9A 3S88H 4FE9A 4G80B 4RQQB 1DQML 2XA8L 3ZDZE 5T33L 3IGFA 3DX6B 5FDWB 4NHUA 5C6PB 5KTEL 4R4ND 2J55A 5I0ZA 3LH9A 4M5ZH 2B14A 4UBDC 2CSPA 2DM3A 3OMNB 4QRRD 4DPCX 4LCWD 1G1OA 3M17A 5MP6H 1RZ8A 2MH4A 4Q6YA 1PSKL 1NFDA 3ROOB 1SJHA 3F6JA 3CFEB 3SQRA 2XWJA 1D6VH 1INQA 1MIEL 3AC0A 1OCWH 2YD0A 5A3IC 5DLLA 4NRYB 1B9ZA 2EYTA 2NW2B 2XYCA 5EZLA 1E5ZA 3VWKD 1TEGA 4I18C 1NUFA 3E0GA 4FLQA 4OFPA 5FF6A 4MMYA 4PJ8D 2VE6A 5B39A 2P44B 1M7DB 4HKXB 4XI5D 5E9DB 5JHDA 2E46A 3GWJA 3VFWA 2M1KA 2R29L 3RDJA 3CZKA 2XWRA 5TGBA 4XVOA 2ALAA 1ZAGA 3NJXA 4JPQA 1NH6A 1RHHA 5C2BH 1MHEB 4LEXL 2NXYB 2JKRM 4K3DL 3VWJC 4ELDA 4Z78A 5IG7A 4GMSH 1JG9A 2ESVA 3BGMB 4ZUTB 4PV9A 4JO2L 1KTCA 3IAGC 4QTIH 3T9WA 1I4FA 5K9QI 2YK1L 4NO3B 4H1LG 1TQBC 5JQIB 3SY0B 3NIFE 3LD8B 3O8XB 3S34L 3VXNA 1ZGLA 2AJVH 4X2UA 2BRRL 3ULSA 3ULUE 1BXXA 1FVCB 1Q94A 1T0NA 2A1WH 5CLWA 4GG6B 3W39A 1CG9A 3HRZC 2ATPB 5ENWA 5LN8A 3SCMA 3T2NH 2J1XA 3TNMA 3K80A 3MMEB 5I8CB 3ECVA 3L16A 5TDPB 4DEPB 4M93C 3BIKB 4IHOA 2G9HB 5B1JA 3SDCD 1EVTC 5GISH 2H32B 4JX0A 2V9TA 1PS3A 4K3EH 4KQ3L 4RAVA 5CIPB 4YHPA 4BFNA 1FA4A 3RL2B 3VG0L 3TZVC 1N4XL 1ZLWH 3LNFA 3SO5A 4NI6A 4OZHF 4DKAA 3UCQA 1M3IA 5D6CB 1QSEB 3BAIA 4TNFA 2AV7A 3V7AG 4WWKA 2AK4A 5EEVA 1N5AB 4CSZA 3BE1L 4MX7B 3ROLA 2HRLA 1BYOA 2ZICA 2ADJB 2NNCA 5EN3A 2UV3A 3TA3B 5DFTA 3G6DL 2CGRH 3O4LE 4XMWA 2FYVA 5ICXB 1J0YA 3RLSA 2BVPA 1Q90A 2I7OA 3STLA 4OLWL 4DGYH 2PN5A 3S3CB 3D5OF 4JO4H 2IV8A 4QOKD 5DK2A 1ETZA 2A73A 2AJZA 5T1LA 4G43A 5EMYA 1I1AC 3DHPA 5CCHE 3JQOB 4GEJA 5C0AD 2HLEB 2YUXA 3NJHA 4AZ8B 3CFQA 3FKUS 4PRPE 3MX0A 4ZPVB 5EOTB 3SBRA 3NZ8A 1KTDA 3BUTA 5IQ7L 4FNQA 3MUZ1 1Z32X 4KZ0A 2KS0A 4Y5VB 1ZGLM 1CFSA 4XCYA 3HE7B 2GYSA 4UTBH 2AGJL 2HXAA 3B34A 2P8MA 3POCA 4TUOB 3PGFL 4XOAA 1A02N 2VWEE 4NO5A 4UU9A 1QLFB 4M4PA 5TE4H 5B4MC 4U33A 4YDMA 1Q1PA 3UTQA 5DS2A 4DGIH 1Y18A 2XN1A 2NUTB 1WBZB 3GRBA 3QPXL 3S2CA 1F11A 4QOKA 2C9AA 2G3ZA 3CFBB 2V4LA 3AWEA 5CAYB 3RIKA 3SO3C 5F2FA 3EW3B 4JO5A 2D73A 2WXJA 3CFUA 4JY4A 2LU7A 4X6BB 1IT9H 3OKNA 1TMQA 3BP7A 4KK9C 4PJAF 4A7GF 4ZAKD 1XXFC 4XWOD 1IEAB 3MOQA 4PJDF 3UG3A 3MNVB 3WS3B 2FQDA 2RHEA 1MAKA 1JYWA 3DROB 4OZFB 2L8AA 2WLZA 3CZGA 5DHMC 3TNNA 3LZFL 2FB4L 5LXVA 1QRNE 3SDDD 5IMMA 1KIQB 3E6FA 4LCVA 2FX8L 1F4XL 2WM0A 2XNAA 4A2DA 2MHAB 2EXYD 3U82B 3X2QB 1CYGA 3DYPA 1UM5L 1CT8A 4QRSA 2Z7UA 3EJJX 3TT3H 1JI1A 5I8OH 3U4BH 4XCFL 4J8RB 1PZAA 2D9QB 4BUGA 2WXKA 4ZO9A 4DH2A 2LABA 1KPUB 1S9VB 4NIYE 4XPFL 2H6UA 5DJAB 2C9QA 1MREH 4BZ1A 2KDGA 5JW4R 3HUJA 2VTFA 1MFCL 4KNQA 5CJ8A 1P2CA 2GW5A 3PJSB 1D9KD 3IJSB 3FUNA 3IS0X 4RQQA 1ED3A 2NX5D 4CUCA 1FGVL 2K4WA 2QDWA 1FVEB 4BSWA 4D0CA 3AQZA 4H8WH 2FD6L 2QT6A 4DJMA 4JM2A 4EN2A 1BOYA 4M93B 2WWMC 4OZHB 2EVIA 2CHWA 1LWRA 4NKOB 4TN9A 3BGMA 4K5MA 4ZUTA 1IC4L 1O7DC 3JV4A 1DL7L 4W70A 3FC8A 5SWQB 4FMKA 4YSCA 1BQHB 3I75A 4W9KC 3SDYL 3O8XC 5F7BA 2YEQA 3ZO9A 2LFEA 2PABA 2ADGA 3N41F 3NJVA 5FF6B 5C0NC 5AB2A 3DBSA 1KPVB 3VWJB 2DL2A 4OCWL 4NAQA 3X3GL 3HMXH 5ACZA 2JB5L 5AQ0A 5CD3A 4CVXA 1FIGH 5AD0B 5EWIL 4UQDA 4YHNA 5IMKB 3CFEA 4EI5C 5JHLH 1TQWA 3JTSA 3P4OB 4JKKA 5BO1H 2AI0H 2WKGA 3PV6B 2ZG3A 2NY5H 4KKAC 5EN2A 2PTUA 4P2RA 5EZJB 4F3FB 2TRYA 1N70A 2ZG2A 1T0MA 1BIIB 3OKLB 5LG6A 5T1JA 3MROB 3EDEA 1TNMA 2DIJA 3DX6A 4ZX6A 2XWCA 5GRVK 5E5UB 4NQDE 2QVTA 2H45A 3VUAA 3RNKA 4AVHA 3F65A 4J3TA 1E8YA 2JQAA 4GSDH 4PIBA 2LTQB 4ZYKB 4FTVE 5HHPB 2UY7B 1OL0A 3V10A 3RDTA 2E59A 3U30C 3WI9A 3OKOA 4HFWB 3ARED 1CI3M 3HS9A 1O9WA 4MFHA 4WU5A 4J4PD 3QJFB 3T77B 3EKCA 3W2DL 2FO1A 4B6ZA 3SKOA 1PJ9A 5FR3A 5GS0C 1Q8MA 3OHXB 2R2EA 1PFCA 3OKMA 1PDKB 4W9FC 2EKSA 5ACLA 1ND0B 4G3YH 1XDTT 3TVMC 5FB8A 5AVRB 4PVNA 1KTLA 3S4SG 1HCZA 1JXGA 1YEHH 1I9JL 4XWGH 4FQXC 1R3LA 2WVTA 3CVHL 5EBMA 1G6VK 1X5AA 1IIIA 5HYEA 3ZKXC 1DO6A 3LS4H 2A9MH 2PXYC 4N90E 5IHWA 3PDDA 2QGDA 5IIEB 4P9ML 1RHHB 1SQMA 2YAPA 3FPXA 3OAYH 2PPEA 2DH3A 2P8MB 5F1IA 2F58L 4N0CC 4D3CL 2NZ9C 4V2BA 1AD9B 4PJIB 3WBDA 1SXSA 2VDML 3WHXB 1V3JA 1LHZA 4IYKA 3ZKND 5DJYB 3T4YB 1HN1A 3NSFA 3K6SA 3MODL 3GYRA 4OZIA 3IAPA 3PYCA 1KXQE 4JRYE 3CFKA 4I3RH 5DRZB 2BIIA 4QAMB 4HFUL 1BFOA 1PZ3A 3FT0A 4WI0B 3FQWA 1K4DA 3EOBA 2HX8A 4YBQC 1JTTA 1NLBH 4W9JC 1A4BA 3WN5B 4YAQB 1AGFA 4A7SA 4FP8H 4FXGB 5JTWA 4BKLA 1PG7H 4GIOA 4BFEA 1XR8A 2ZXAA 3BZEA 2J1WA 4JDTH 3D18A 5DVNA 3T0WA 3KLLA 2YA2A 3KPQA 4JN1L 3IDGB 4R5TA 2ZUTA 1H8SA 2E86A 5IMOB 4R97C 1MCIA 1CT8B 4QRSB 4K2UL 3MV9D 5C08D 5A2LH 2LU4A 4A2EA 3PDOB 2GY7B 2IAMB 4G1EB 1L9NA 3RPIB 2VO5A 1OGTA 3SN6N 3WD5L 4KKCD 2YUVA 3O41B 1UFUA 4TVUA 3SDXB 2N56A 1A4KA 1U8KB 2X9YA 2XTJB 3K2IA 5B1KA 3V0DA 1G6RA 1QTYT 1H3VA 1WBYA 3P2TA 3LXAA 1QA9A 4PJEF 1BJ1J 3KH4A 1W72H 1UXLA 1RU9H 5DMKB 4KUCF 2WCPA 4A67A 4YHYC 3FAXA 5KVGH 5BRPA 4CBPA 4ONGL 3K2UH 5DMIL 2EH8L 5E23A 3FCSA 3REWA 5DK0B 1M9SA 5C08A 4TNGA 4APXB 4HDIA 2YD9A 4NP4H 2AMGA 4XMZA 3MXVH 2GJ6A 2X1QA 2W81C 4UYPA 3G6JA 2YC1B 3WFCH 4JGMA 5IJBC 2VW4A 2H0PA 3LEXA 3EOAB 5FGBC 3F85A 1URLA 3SGKC 1AS8A 5AOIA 3VI3E 5I76A 4LMQI 2YLKA 3FN0L 1NJ9B 5I6KA 4FJ6A 3AREC 1FFNA 3P2BA 5IBTL 5D93B 5E6IB 5LJYH 5I6XC 4IW4C 1EAQA 2PO6D 3G5XA 2IDSA 5C71A 3DRTA 4DP5X 1RLWA 2IH1B 4F5CA 4LLQB 1E4KA 4HLEA 2WQ8A 2FZ3A 4PBWD 1EZVX 4IIQB 5ECGA 3GB7A 3NPZB 3N9GL 1KEGH 2YWZA 2C1OA 3QHZH 1XF2B 2DI7A 4K71C 3N41B 4M9OA 3HKZA 3P4LA 3D85B 3JZYA 4TLTA 1BECA 3UTZA 3MCKB 3HZMA 3QCVH 2ITCB 5JIHA 4OV5A 4PJAB 4U0RC 4FI7A 2NR6D 4MDIB 5KSAA 3OKMB 2G75B 4QHUA 2PUQT 5D1ZI 4PG9A 5L2KD 5FA4A 4JPVL 4JY6A 3TC9A 3VMNA 2ZWZA 3AVEA 1GGUA 4AG4H 3BP4A 4IKJA 3H6JA 1UXWA 2GTWB 1U8CB 1GAFL 5JDSA 1R3JB 4MNGA 1HHKA 1KJ2H 4N8CH 5J56B 5T3ZH 2AJ3A 3H7BA 3U7YH 4UV7L 4KUZH 3MNZB 4HH9A 1ZLUH 4XPAH 4IRZH 4XMTA 3LKQB 1ZHLB 1E9OA 1MFEL 3Q9QA 4AEFA 1BWMA 3RWIB 5HPOA 5GSRB 2X87A 2WAHA 2Y3AA 3RX5A 3NN8B 5EZJA 4BFJA 1OT4A 2GTZB 4BWUA 2Z4QA 1V7NL 5F7DB 3WNIA 4MA1C 3U7WH 3ENEA 4OB5H 8FABB 1DJHA 5DJ6A 3T3MF 1S7SB 2DQFA 3VSQA 1EO8L 1M57B 2EABA 3MLTA 5JW3H 3FO2A 2EEAA 4M7LT 1JGIA 3A4EA 1H9DA 1KN2L 1RZJC 5DJZB 3HPLA 3D2UA 5FUOH 4U6XB 3UGEA 3WKQA 1KLUA 1SY6L 1P7HL 4PTTA 3IJHA 3RDTB 5FYLL 4RZCB 3NFPB 3HNTL 3EO9H 5K39A 1RKRA 3HI5L 1AQ8A 4R2GB 2X5PA 5I74C 4OD3H 5IEKB 1ZXQA 1QSZA 3BQUA 5GGRB 3OF6A 1WAAE 5I1JH 4ESKA 2ARWA 3HUJB 4RLDA 1R9FA 4MD4B 2V7HA 4M7ZC 5EZPA 2EYSB 1N8OE 4FF9A 4LOFA 2AEWA 4LVHC 1OY3B 5C09E 3W82A 2C7UB 2PR9A 4PN6A 5DR5H 4UCFA 2J8UB 3ARQA 3U2IA 5EEWA 5D70H 1AGFB 1U3HC 4DW2L 1RZKC 1XAKA 4OKVB 4K7PH 4PI2A 1CIDA 2FQFA 1WRFA 4GXUM 1I8MA 4GMTL 4NUPA 1QBLH 5T1KD 1MQKH 4ADIA 2VSMB 3KHOA 3SKNB 4B95C 1UB6B 4YDLB 4KVPA 1B4JL 5SWSE 1FO0L 3K6SB 3HHSA 4I0PB 1BGXH 1PEZA 3LXBA 3QWRA 4JQVA 4DN4H 3L3IB 1AKPA 3G5ZA 3ZHFA 5ITBH 5KYWB 1YJDC 3FO0L 2GJZA 4ERSH 3S8GB 1NANI 1D2PA 1ET8A 2YGPA 1LK3L 5I73C 3HVNA 1HDMA 3QFJB 4WW1A 5AW6B 3G08B 1ACCA 3KWXA 2J6WA 2XWDA 4RDQG 2XN9B 1XD0A 3LB6D 1LWHA 5HGAA 2ZJSL 2AABL 4B41A 4DGUA 4F7CA 3HAEA 4Z7UB 3MQIA 2BNRE 4S1RH 4XB3A 3D09A 3DGCR 1AHWC 1WFOA 1EPFA 3BW9B 4ZTEA 4XOEA 4LNRA 3QEQD 3TA4D 1MPAL 1FYTE 2XN9E 2MQGA 3RWFA 5LO7A 4OCLC 5ICYA 2VR7A 4LRNH 2VDOB 3LQAC 3ESVF 4XAWH 4GRMA 4GRWH 3BN3B 4DCQB 2JLLA 3D07A 1L0YA 2KQMA 4QXWA 3BVVA 4ODVH 4OCYL 5HHOD 5GZOC 5F96H 4YZFF 2PCXA 2HFGL 2F68X 3NTCL 3STLB 2ZAGA 5EIVA 2F5BL 1JGEB 1RMFL 3V6OE 1KWGA 3NIDF 4JHVA 2CO1A 2ITDB 2VXTL 5FIEA 1N2RB 1DBMH 5T5NG 1U3JA 4OY9A 2Z31D 4NCDA 4MRCA 2K7QA 2F54A 4OV5B 5IFAH 1P7KB 3AGWA 1OB0A 4TUJA 6PAZA 3LVTA 3BT2L 4MJIA 3UJTH 3JWOH 3EGXB 4LL1A 5CSZA 3RHWF 3PWNB 3WFBL 5DMJB 2BC4A 1WT5C 4PJ7A 5D1QB 1RUAL 3ZYIA 4R3SB 2YLHA 4OR1A 3EJPA 2C4FU 5L4IA 3WFEL 4PJFE 2DQIH 3RFRA 3HE6D 4ZFGH 1NCOA 3TPUA 2FDBP 4YR6A 4U1NA 5MHSD 3NSJA 1J5OH 3BXNA 4U1LB 3MXWL 1CBJA 1K5WA 1KGCE 4MLIA 1BAFH 1CLOL 3TASA 3IMVA 1H5BC 2BVOB 3TJEL 3UTQB 5G4OA 1RK0A 3JTBA 4J3VA 3SE4A 4FKHA 5IWLC 7FABH 4C47A 3ZSTA 3P73A 4R96B 4D9QE 4PS4L 4FS0A 4YNYA 5DGQA 4ALAL 2CDGB 3JYCA 3JWNH 1A6AA 4MJ4A 3MLRH 3VFUB 4AJ0A 4MXQC 3H3KA 5HGHA 4LCIL 2GC7C 3H2PA 2X6MA 4ZUSB 3L2NA 3MRHA 5GGQL 5IOPB 4P2QB 1XL4A 1BLNB 3X11A 2DS4A 3MR9A 4QRQB 4RMRA 3CMOH 2VMJA 1B88A 4RISH 5DD1H 2XIIA 3OHXC 1GGCH 3PIQA 4AGOA 4ZUWB 4WKXA 2OMTB 3EUDA 2ITEA 2IG2H 3FTGB 1AR1B 1OHZA 1KJVB 1JWMA 3FFOA 4XP5L 5LAPA 1VFBB 3O11B 3SJVE 1S6NA 4M1CC 2DLGA 3IFPA 4WIQA 3EYFB 5DVKA 3TLRA 3RJQB 4I9WE 1J8KA 4FFYA 4K8RC 2IH9A 4LK4A 4X5PA 2IAMA 1FSKB 1AQKH 3MRPB 5HDBB 3MBWA 4LSUH 2YJLA 2NY3D 3H0TB 1KBBA 4JFUA 4P23A 3T3PF 4KROD 4M8UA 3FMGH 4PJ9B 4Z6AT 3D9AH 3UJJH 3ATFA 5KYXA 3ISRA 3QUXB 3GNML 1QA9B 3AUVA 4KKCC 1K72A 4Z7WF 4JQXA 4NM8L 5MEQA 2B4CL 1SJHB 3D50A 2NY2B 4HJ0D 1JHKL 1VERA 4U1GB 5HVWA 4F7KA 5ITFB 4YHLL 2VO8A 3KPSB 5E9AA 5LCVA 1I1FA 2EH7L 2IGFL 5E03A 2DMKA 2DQTH 4QJ5B 2P5WB 4JFDE 5DJXB 4O9HL 1PZUB 4PJHE 3LPOA 4M8QB 4OIBA 3CZUB 2YQ3A 2O72A 4QXTA 3CBJB 4ISVB 4XP9H 4JKPL 4F1SA 4L5FH 2ROXA 5C6TH 3HN8A 2Z1KA 4OIIL 2WCGA 3W9DB 2C9SA 1LGVA 4WI3A 3FQ1A 1MG3C 1T5XB 1AS7A 2VKXA 2OW7A 4NRZA 4E41D 3SDAD 4D0BB 1DUZB 2GKIA 2WCSA 4XVJH 1Q0EA 4E41B 1SN5A 4J3WA 1A7OH 1TZIA 2BOBA 4F7PB 3ULVL 1O6SB 1J86A 3U25A 5D2NE 3ZKQD 3D3VA 4FD0A 2VERN 4TL5A 2OCCB 1CLZH 3WSQH 1DN0A 1OGAA 2WQVA 1OXYA 4OF0A 2R7EB 4JANA 3MRCA 1OW0C 5CJ5A 2ADIB 3KGTA 2GCYB 4WLCA 3PL6D 4QHNB 1UKSA 2P5WD 4HLZG 1KYAA 1J7VR 4PJDA 1S3RA 3TV8A 1PCXA 2PYFA 5IK3A 1OSZA 4HCRH 3QUKA 4TNVK 3P54A 4WHTB 2G2NA 3WKPA 4NRXA 4XCCH 3CVCA 1ZLWK 1UUSA 5BVPL 3RFZC 3FU3A 5DRXB 5A43C 2HA1A 2AK4B 3BESR 4JREC 1ZVSA 1NCWL 1K4CA 2YPKB 2VC2H 3B9EA 4DUVA 2H8PA 4I18A 1ZSHA 3LIZL 3PNWB 4OZGE 1XGQB 2AAAA 5FFGA 2Q8BH 2FBOJ 2M8XA 2X4SB 5I0DA 2FECI 1W8EA 2ZYRA 1TVHB 2BNQD 3KS0H 2WSKA 3M1CA 4OFYD 2VZOA 5C0GB 3F83A 3ET9F 5IHBA 1J0ZA 4I2XE 1MW1A 3F3HA 2VMEA 3OBAA 3WEOA 3C5ZB 2ZXGA 4GRLB 3S36X 5T8IA 3O4LD 2CCLA 2XACC 3L9YA 3RWDB 2BFVH 3FHAA 2OTUA 3V55A 3EO0A 3IGAB 1O6VA 3S7GA 4R4FL 2P47B 4NUQA 5F8QC 2WINA 3ABKB 5IFHL 3SY0A 3VTAA 4G7SB 4JFWA 1JF6A 3SGDH 1QBAA 3EDDA 4XO8A 1TTBA 3QIBB 3R7RA 3OTTA 5JOPD 4U49A 3PJNA 1OOAA 4PLOB 3EO1B 3G6JF 5CCKH 4WK0B 2DI8A 3FT4B 4TSBL 2X3CA 3HE7C 5HDOA 2ZCHH 4PVBA 5DLML 4ZQKA 3GXDA 5HP5A 4MJ6B 3QIBD 1IKOP 3C5ZC 2EICA 3NAAH 1MCEA 4PD4K 5C09A 2QTEA 2QQLL 3UZVB 2HFFB 3KPPA 1MVFA 5B4MD 1PLCA 4WW2A 1T80A 2ED8A 3EJSA 3JWNE 4G7YH 4OUUB 4WTWA 5C0DB 1EA9C 4L23A 3QUMA 4U4IA 4D8OA 4BA8A 1U8IA 3FHEA 5JORA 5IVZB 4NQCE 4LVOC 1G9NC 4AEEA 1AGBA 1KCBA 1JDDA 2C8NA 4PHZA 4ALAC 3RVTD 1S9YA 2E47A 4IRJC 4RGMC 5HY9B 3PAVA 1SYVB 2IGLA 5CJXA 2V2TA 4UQAA 1UZ6F 5HHQA 3CZSA 2JQMA 2WBJA 2W0FA 2BNQB 5EOCL 4DCQA 1T0PB 5KJRH 3WO4C 4YXKL 3INUL 3KYNA 2X1PA 3PPEA 4J3OD 4P9HC 1PG7W 2G4GA 1BVKA 4YXLH 2V17L 1KG0A 4JE4B 4PWHA 3FUFA 2QV2A 3C5XA 1OOWA 2O5XL 3IK2A 4XCNB 4MQSB 1WBYB 2OJZH 3RVWD 5JYMA 5IT2H 5IEHB 1BBDL 1Z1WA 3G7TA 1MNNA 2B4CC 3FDWA 4AGQA 4LU5L 1FFPB 1SVBA 4BUQA 1OAUL 4L3EB 3TA3D 2YBRB 3TIDB 2EYRA 2R39A 1IGFH 1W0WA 3H53A 3IJSA 2E74C 4DKEH 1B4LA 3ATDA 3WNOA 1NICA 4L1LA 3VXRE 1IFHL 3OM3B 2LFGA 3HG1A 4M8RA 2J5LB 4IJTA 2BVYA 2R23B 4HUMB 3H9ZA 5B39G 3BFOA 2SEBA 4HF5L 4R7NA 4B9PA 4LLYA 3AU1A 4EI5D 5JW4Q 1WBZA 2C9XA 2X6CA 3CFMA 5F1SA 3WS6C 4X6CE 2MTAA 1DN2A 3NRQA 1MJJB 3QYCA 1THCA 1R46A 4F15C 5IB1B 4RETB 1A8ZA 4RGNC 4HWBL 4OQTA 3QEUB 4N5UA 2QSVA 4Q56A 1FFTB 3WDHA 1A7BA 4U1JB 1F4YL 4OFIA 2BH0A 1NFDF 5K9OA 4WFFD 1CFNB 3RVUD 3T0DA 2R8SH 3D0VB 2X9XA 3IFNH 3KL0A 3PWPA 2G5RA 3T08A 4CKVX 1RIVH 2HJKB 4KV5E 3HW7A 4JDVB 1YMMA 1UQSB 4KJYA 4AUUA 4ZOAA 5DDHB 4AH2B 4V1DB 4HWZB 1FNGB 3RX9A 3RB5A 3A6BH 3VXPA 4ZFFB 4IBUA 4A1RA 5AFAA 3WTXA 1VLXA 1QHOA 1XCQB 3FSWA 4IOIB 2XX1A 3GMLA 3HI1B 4LSQH 3WY1A 3KVDD 4KTGA 4AYEC 2EVHA 3ECBA 4YFLF 1IC7H 1NEZB 2GCYA 4WO4D 3ZZSA 5L88L 1FE8L 1G7IA 2X7LA 1NBVH 3MCLH 2X3AA 4YO0A 5ESQB 5JDJA 5E2VH 1ASPA 4AIOA 1AFVH 5BO0D 1M6OA 1HCFX 2IALA 4HXBH 4ES9A 4N8VG 3S98A 2I9TB 4OCRH 4BKSC 5FYKH 3D33A 1N9PA 1WWWX 1XT5A 4MJIB 3PXLA 2MIZA 3ARBB 5ADOL 1HSAB 1VPOL 1Z9SA 4O51B 3S3BB 4OW6A 3TO4B 5FECB 1ETZB 1HHHA 1Z5LA 3KW8A 2VLRB 2GJJA 2EDBA 4NLHA 4WTQA 4XC3L 2X0VA 3UERA 5JHAA 2BP5M 1TTUA 5I9QC 2Z93B 3VFGH 5TK4A 1YEJH 3E1F1 4PLJD 3D39E 1ADWA 1AR1D 1ULVA 1WC7B 1N7MH 5EBLA 3GI9L 3VJ6B 1NCCH 1BIIA 3GTNA 4RAVB 5BJTA 5H35A 1JERA 4FG4A 2BIPA 1GL4B 3RDTD 1C1EL 2CG9X 4XBPA 4NJ9L 3RNKB 3VGEA 1KXQA 3BISA 4M7JH 2IAAC 1TVHA 4TVPL 4X99B 3EJYC 1G9HA 4XO5A 2VH5H 4QO1B 1ZGLB 2UZIL 1UYWL 3MJ6A 3S37L 1JZ6A 12E8L 4OIAA 4BRVA 1QFUH 1WEJH 2EO1A 4X7SL 2JXMB 1IKNA 1G1YA 1GH7A 3FCTB 4OTXL 4PCYA 2VLJB 3CIQA 2QKIC 1A6ZA 3CXDL 1JV5B 1GGYA 3GMNA 4GAJL 3VXSD 4DUWA 2GFBA 3TCLA 4UOZA 5I17B 3CFCH 2XG5A 5L4FA 3LPPA 3DBXB 3MRGA 2BCKA 2BNQA 4OFYA 4M29A 1XGTB 1B4RA 1QSFD 4C83A 3BCFA 2APVA 4ZZFA 3BD3A 1PD0A 3R4DA 2F7QA 4XT1C 3II3A 5CR8A 4WUKH 2WNWA 3BEWB 4KJPC 5TDOA 1XGUA 2WLLB 4WKZA 3W3BA 3V4UH 3EZ8A 2VN6A 3QUZB 2ZXQA 5E8EA 1YDPB 4LOEA 4O02B 4GJTB 1UJ3C 3B7TA 3CDFA 3WKNA 3O6LH 3C6LD 1NCTA 2EE0A 4M48H 1U8OA 2OL3A 5EIIB 4X4MA 3WIIL 5BS0A 2ARJA 3SGEH 4WCYH 4WWNA 4PS3A 3VRLE 2VDOL 4F8NA 4IK6A 4FNLH 2R27A 1KBVA 3OLDA 3S35X 3O41A 4CRPA 1FHGA 2A9NH 2NUPB 1D6VL 2XY2A 4PREB 1MIEH 2LAGB 5EUKA 1U8HB 4HUUA 4W9HC 3I3DA 1UZGA 5I6MA 3BWUF 1N3NA 3CDYA 4KNSA 3FZUD 5LBSL 4Y88A 2E5EA 5KBLA 3UTSE 3PJSA 4NENA 4GSQA 3KWWA 5IMMB 4QTFA 1RY7B 3OL2A 2FJHA 2DW5A 1NGQL 4N9GA 3H3PH 5CCJA 3O4OC 4HIXH 2HRPL 1CE6A 2OMXA 5LDSA 2WWOA 5DHYA 1J1XL 4WO4C 3LHPL 4WTXA 1F18A 1ZE3C 3MNVA 3WS3A 3QFJD 4LCWA 2WXRA 3MA9H 3US1A 3KWUA 3KWVA 4PIRF 3FOMA 4JRXD 3E6FB 5ESAB 1C5DB 1QOKA 4D9LH 2AQ1A 4Z3JA 4MCZA 3K5SA 4OM1L 3CFJB 3S34H 1H19A 3P77B 3IN2A 4LZKA 4A6YH 2XXFA 5GGUA 2PWHA 3AROA 3GMRA 1Q9KA 2ERJB 4MXVE 1ZDQA 4TSCL 4YSAA 1BJ8A 2L7UA 3L3GB 4ZAKA 1ZSDA 3DJTA 4Z76A 1G7IB 4HV8B 2EC8A 4X4ZA 3WKML 4WHYG 1MI5D 5ETUA 1NCNA 3VG0H 1I53A 1GMIA 2ZTBA 2BXYA 2YD6A 1HKLL 3HN3A 3GXIA 1J9TA 5D2NA 1CXIA 2DWXA 4XE5B 1QQDB 3TPUB 5MI0C 3PPSA 4ODHL 1PDKA 3C6LB 1D9KA 3EJZD 2AQQA 3QJXA 1CD1B 3BE1H 1TEYA 2AXGB 3DXAA 1HI6A 1FV1A 1WA1X 2F8IA 4M6AA 4PP2A 3BPCB 4L0ZA 3D85A 2IDFA 3MBED 3ZKMC 5CEXB 1DBBL 3BKMH 4L9DA 3VXME 3EHBD 4OCSH 4HCGA 3QUMH 5C0IA 3P73B 4FQCH 4R96A 4JG1H 2Z65C 3B6SA 2V5MA 2G75A 3K6IA 4KKZA 3H55A 5D1XB 2E56A 3DUSA 5CS7A 1HJCA 2ATKA 5BJTB 1EH9A 5A6IA 2ZUVA 3VXMB 1EJ6A 3QIUA 3QWNA 1UXWB 2GTWA 1ORSB 1BQLL 3SE6A 1I3RB 4MB4A 3CN2A 5KW9L 4LGSB 3WGVB 5AYTA 2F1BA 5DD3H 2WGXA 4PJGB 1CB4A 1HSAA 1Z9SB 4O51A 3L4CA 5L2KA 1XB3A 1JPGA 2WXOA 4JPIA 4NQSA 3BZ4A 3V79C 2BIOA 4HPYL 1KCRH 2YPLB 4PRID 4AIZB 1T4KA 3BGFC 4FABL 1BQKA 3TCTA 3FSVA 4WI2A 1ROCA 2K6ZA 4HAKA 3VDBA 5F9DC 2PKDA 2VN4A 4HIPA 3IDNB 5TE4L 4DGIL 4N0UE 1I7RA 3BGFB 4GRWB 3HZKB 3II2A 4JFEA 3DRTB 3QT2A 4I5BB 3S36L 3CJJA 3UTTD 4NJAL 5HI5C 3M7FB 3FF8A 1MHCB 4FCHA 3V7AE 3W56A 3Q9PA 7CGTA 3SDCA 5HY9A 1OLZA 2AJSH 2L0DA 4U3SB 3H1ZA 2WBJB 1F97A 1A22B 2FLMA 4NQUA 1NGWA 1NAML 1RZ7L 2PYEB 4KGLA 4KI5F 4ORGA 2QL1A 4BK8A 2ZP0T 4A2MA 1R4XA 4GPVA 1ID5I 1YQ2A 1UM5H 1A4JB 2UY6B 3TJPA 3TT3L 3U4BL 4WFGD 4XCFH 4OGYH 2MNJB 1J8RA 2G0LA 2LGNA 2R0KL 1T2XA 4XPFH 1I3UA 4XBEL 4FA8A 4WO4B 3GHPA 3KGSA 4YWGH 2WN2A 1CLYH 2DDQL 1MZYA 2Y23A 3U9UB 4D0DA 2NR6A 3GMQB 3E3QE 1A3RH 3ARGA 3LVEA 3N2JA 3SGJC 3EYQC 3WFHA 3QJVB 2DQCH 4LDCA 1X5HA 5DZLA 1LVEA 4LBAA 4ETYA 2IDUA 2WLIB 1JNNH 3OC8A 1HWGB 4PLKD 1F4WH 4ZX4A 5JLZB 4MJ2A 1DO5A 6FABL 2YKLH 4YHYB 1I9RL 2QDVA 1R5IA 2BCMA 4FQIH 2A74C 4TULH 1IC4H 4XB7A 5DRZA 1DL7H 4OUOA 5HGBA 2IBZY 2RIKA 1FZJB 4YUEH 4YK4C 3TBSA 2YEVB 3T4YA 3QS3A 3VA6A 1KGIA 3STBA 4YAQA 5E56A 3P2DA 5I1DA 3KLSA 1JHLH 1QFHA 1U93B 4HUVB 3BZEB 2CRZA 5CBAA 2CUMA 3ULUF 3LRSA 1MVYA 2CR6A 4TQEH 1IL1B 1ZV9A 1BWWA 2HX9A 1AE6L 4L1BA 4XBGB 2R1WA 3BQUC 4DK5A 2C1OB 3B2VH 3FB6B 5E8DL 4CSTA 4NUJB 1EWHA 4F7TA 1KTKE 3O6FA 4JFQB 1TSHA 4OLZH 4IOSD 5GS0L 2CJSA 4NSKB 1JWSB 2UVEA 3ZDWA 2XTJD 2J4WL 1KN4H 4HJGA 3U36A 4X4YA 1ZSDB 1U3NA 4Z23A 2AI0L 5AVUB 5JR1L 4Z18A 1JXKA 3CXHJ 4XVTH 4YDKL 3US9A 1GOHA 4BIKA 5CGBA 9CGTA 4JHAL 4YEFA 5FECA 1KV7A 1KOAA 5K59F 2NTSP 2A2QT 2WXFA 1ZTXH 4CC1A 1T1XB 5AVXB 3VFMA 2NNAB 4GNKB 1M1SA 2XDHA 3WHE0 1VACB 1JF1A 3GSVA 4W9CC 2CO3A 1CVSC 4N0FB 5DVMA 1S5IH 1KXTB 4WY7L 1Y6MR 1HHGA 1KSRA 3W0WB 1OT1A 1JI2A 3F5WB 3GIVB 3I2CL 4Y5YB 4RWHA 1P7QB 2E7LA 2XVKA 3W2DH 4KROB 5BVJB 1SVZA 1IGJB 4NZRL 1IAOB 5J1AA 1R3JA 5B38G 1OZTG 2DF3A 1KDIA 5EBLB 1TJHL 2XX0A 7PAZA 1ZANH 1CFTB 1OKEA 1T3FB 3KPRE 4L9LA 1AZVA 4JY6B 5HJ3B 3NJKA 1NPUA 4BFOA 2XZCL 5CZVL 4G42A 4RZKA 4HS3B 3VU2A 3KDMB 3TVMB 2DKSA 5EUOA 3W57A 3UGUA 1DCEA 4S0SD 4ATWA 3P40A 3CWGA 4BH8B 4O58H 2YSSA 3MV8D 5IQLA 4E9YA 4R3SA 4JFFA 5F7MC 3R7QA 4N28A 1RD6A 3GEFA 4JBSA 4TMPA 4QRFA 3UTZB 1D6EB 4HQQH 4K0OA 1X5LA 5F88A 3FU0A 4O2EA 4D3CH 1XF5A 3Q8BA 4MD5A 2WBKA 5KSVA 1CD9B 2VDMH 2EDYA 3MREB 4ONHB 4LLQA 4KTDL 4MD4A 3H9SD 3K8KA 3SPHA 5F7YC 5CWSA 3GB7B 4MJ5A 3T6XA 3ZL2A 1J0JA 4I3RL 3I02B 3O45B 4XNQB 1A65A 2QQKH 4FADA 3NEOA 4NI3A 4GW4A 4P5TC 1YNKH 2FJGB 2J72A 1NLBL 4H88L 3ZYZA 5I0XA 2IVFC 5DJZA 4AC2A 4AEIL 2G9HA 1AIZA 2Z8RA 1PG7L 1TCRA 2YJQA 3VD3A 3GSUA 3L4YA 3HNVL 4FJZA 1FCCA 3I6KB 4BRJA 5D5ME 1DVTA 3FF7A 3BH9B 5AVZB 5IKCA 1UWYA 1RZFH 2X10A 1A66A 4N25A 1UXSB 4OFKA 4WSGA 5AW5B 4N6RA 4PJ5D 1FZOB 5F9WB 1SY6A 5EF1A 2EYTB 2ZKWA 4N2EA 2UVFA 3VXTB 3DX9A 2E7MA 3E3QC 2CQVA 4HGKC 4LLWA 5BUAA 4RIRB 3MBEB 4UQIM 1W2KT 2BP3A 2DWDA 2V5TA 2IWGA 1W72B 4ZTPL 5KBMA 1KB5H 1AC6A 4U3SA 2ZWSA 3MNZA 1XCXA 4HH9B 4TSAH 4Z7NB 2OL3H 3DGGA 1F6LL 1SM3H 1N6VA 3IDYB 4JEGB 1DFBL 3DA0A 1A9EA 4NOFA 4YL4A 1NC2D 2CDGA 2ZCLH 3GK8L 3UYPA 1MFVA 1E67A 2J5LC 2QVIA 1S46A 3FXIC 2GI7A 4QLWA 1IAII 1XF1A 5CU5A 3RGVB 5HHOB 4H2CA 3BFQG 1RXLA 5FUCC 1CTOA 2CDEA 5C9KA 4M9PA 4MDRA 2JK5B 4OFDA 3IETB 3T65B 4E5XA 5JOEA 4LEOA 1MNUL 1P4IL 5DYFA 1JPSL 4M4RA 3LPGA 1MLBB 2Y7SA 1NSNL 2CUHA 2VMDA 4XMXA 5T5NF 5IFJA 1YRKA 1JZ7A 4X6EB 3L3DA 2GHZA 3C2AL 4XN1A 4IRSC 4WEBH 3WFCL 3EUUA 1B0GA 3FB7B 1S7QB 4FTVB 3L6FA 3UBFA 2VLKA 1OPGL 4G8GA 3V4VB 2Q2LA 4LKCA 1S9WA 3QYNA 4R0LA 2F5AH 4O2FB 1L0QA 4P48A 3HVDA 2ZKMX 2WXMA 3QUHA 4D9RD 3P3RA 1WUZA 2NQDA 3WJMA 4AXWB 4K3HA 3NJNA 2HT2C 4UI2A 1CIUA 3CFBA 1JFQH 1R3IL 3WE6A 1EXUB 5IEKA 2XVBA 4KV5F 2FWLB 2YAHA 2XV0A 1D9KB 4P0DA 3RP1A 1CWVA 5I8KL 5GS1B 2F8XC 2M26A 2Q6WB 1LDSA 3C6SB 3EGSA 1IBGH 3MC0A 4OI8A 2WMPB 2X4PA 4JGJA 1E5BA 3MMEA 5I8CA 1IAIL 2DD8L 1DQJA 1TKWB 4M5TA 3QARA 3RTQC 4Z77B 3SEPA 5CINH 3FU5A 1TPXB 1TQUA 3QCUL 3L3JB 3FQ4A 4FHKA 5AZ2H 2OX5A 1AHMA 4CC0A 4JFXA 1L9PA 3ARVA 4BE5A 2A3TA 4P99A 2CBMA 1P7QA 4NN7C 5DQ9A 2ZX9A 3E6HB 1KCLA 3N55A 3QIBC 3QCVL 4P5MA 1MWAH 1E3ZA 43C9A 3ULVC 2QVFB 1D2OA 1UH4A 1G9EA 4RAUB 1IC5L 2VXVH 3PHSA 1AGEA 1X4XA 1FYTB 4PJDB 2BSEA 5IHHA 5GRZA 3DMMB 2DICA 1T7WA 5ICXA 1KB3A 1U8JA 2Y2TA 4NRZB 2YSTA 5FGBA 4TOYH 3MRDB 3UMTA 2ICES 1LEGB 1REIA 1XZ0B 1NC2A 1JNLL 5HDQH 4UAHA 3HLAA 4UV7H 3Q5YA 4PUBL 4H8QA 2VDLL 4NQCA 1FZMA 1SZNA 1Q94B 3KW7A 5F0JB 4GG6A 3GSNH 3IF1A 1P7KA 2ENYA 2V5YA 4CC4A 3US0A 2ZUSA 1BM7A 4Q0XH 3EHBC 5CHNB 2AQNA 4HEMA 4OQTH 4X5QA 5TDPA 3PFUA 1E4KC 1QNIA 1V7NH 3AS0A 2K3HA 1K3IA 4G7VH 4LEEA 5F9OH 2N7SA 1NAKL 1NGYA 1OSZB 2Y22A 2ZAHA 3MROA 4Y8DC 1YNTF 4MXWH 2WZPA 1VGEH 3NQIA 1ZXKA 1WFUA 4AYGA 3CK0L 5ABDE 4X9HA 3VFPB 1KN2H 3VXMD 2VUOA 1UA6H 3QZPA 4FFVC 4PJFB 4OU3A 3L1OH 1O75A 2E9BA 3I85A 2CCWA 2BSTA 2WQAA 4MMXA 3MTRA 4W93A 3RVTC 4RNRB 5DVOA 1R17A 2V2XA 4AMKH 1KELL 2B16A 3QHTC 1NM4A 2V3DA 1INEL 1MH5A 4FL4C 4UT7L 2XN0A 2DY2A 4DTGH 3O11A 5ITFA 1OAKH 2EZ0D 2DOCA 5I1JL 3DUUB 1LP9B 1QI3A 2R59A 3B3IB 4DEPC 1L6XA 4HJEA 1VESA 2EUZA 1XVSA 1BF5A 2NCEA 4YSRA 2H7WA 3QDGE 2EDNA 2WVVA 4FYSA 5DQDH 2YQBA 3PGCB 1BLNA 4AYFA 4P59H 4NZTL 3CDGA 4ZMAT 2O61A 1KCWA 4Y2OB 2Y7QA 2CO6B 4P8QA 1V7MH 4DW2H 5ANHA 4PY7B 4J8RA 2OMTA 3ESNA 4AV4A 1RUML 4UQEA 3WE1A 1QBLL 3HE6A 2EDDA 3MLVH 3GSXB 2N59A 2WIIB 5D4HA 5JXEA 1CLCA 2G2PA 3MRHB 1SGKA 3NZSA 2BSSB 5BRZE 1WV7T 3RILA 1FDLH 5JUEH 2R2EB 3L4UA 2HT3D 1MFAL 3ZDXF 3BWUC 4DN4L 4DERA 3PIQB 3OAZH 3M1BB 5ITBL 1CL7H 5C0AA 2B2XH 2C5DC 3QUXC 4AK1A 5EEUA 4HMEA 1XSKA 1NGPH 1F6AA 4PU2A 4MCMA 1L7TL 4PJ9C 5KSUB 3OMZA 3UBXB 3BEVA 1WQVT 4CGUB 3GXTA 3LKOA 4S1RL 4F58L 4JPWL 3FRPA 3S37X 1MCNA 5E9DD 4ZX5A 3ZDZB 5L8JB 2MPVA 1KC5L 4I0PD 1JZIA 2KLRA 2Q2EB 1A14H 1MPAH 4Q2ZB 1KIQA 3ECUA 1HL5A 3ASOB 3UYRH 4DFHA 4LRNL 4PAZA 4XAWL 3F01A 5EU6B 1ZPUA 5C0EB 4X6EA 3WXWH 3BPCA 5C0GA 2QMKA 4UUJB 1S2EA 1LEIA 1ECYA 2XKSA 3RZCA 4ZUVB 1FZKB 4JHWH 1S7VA 1U21A 3WEXB 1DEEB 1X7QA 4D9QD 3NTCH 5JNYB 2Q6WA 3MJ7B 3SBWA 3LKRB 1KCUH 2A73B 4WGKA 4WUUE 3TV3H 1T1XA 3GFUA 5DHEA 2OAAA 4NB7A 3KYAA 5GJSL 43C9B 1IGJA 3WHXA 1I85C 4RWYH 5J1AB 2IFFL 2Z92A 2MTPA 4PLNC 2WJ7A 3C60C 1E27A 1ZEAL 4KTYA 3WFBH 3UROR 3ZT6A 1MFBL 4M1DH 2HJFB 2D0GA 5C08B 1JRHH 1E7UA 4ICXA 2CMRH 5DC0A 1CGWA 1MHPL 1NL0H 2DQIL 3WFEH 1H6FA 4ZFGL 3WDIA 1U0QA 1B0GB 1QW9A 4GG8B 2A6DB 3N85L 1TENA 3DO7B 1YPZA 3ATBA 4U6VH 3RZCD 1ZA6A 3SJVB 1BAFL 4KJQD 3QZOA 2Y7MA 2ARJQ 4F7PA 5HD8C 4X5LA 4X7DC 1Q0XH 4YEEA 1NIAA 1NOFA 1JWUA 4LASH 5GGTL 2OMBA 2WZ5A 1OGPA 5B1JC 5CD5D 4PR5A 3MLRL 32C2B 1IGCL 4APQD 1QFWM 4GUQA 1JDAA 2OXGA 3PDOA 3RWJA 4X7EC 3DIFB 1MWOA 3DDGA 3CU7A 3BKCL 2AKRA 2P5PA 3CH1B 4OIFA 3V6FA 1CGSH 2J8UE 2FBRA 4Z0BH 5GGQH 2FZ3B 3MAWA 2YD8A 4AT6B 1WZAA 1OCZB 3JT2A 3QP3A 3S96B 5HYQA 3CMOL 4RISL 2F2HA 4YSDA 1XGPA 2AQTA 3DVGA 1VZGA 3ARDB 3DX8B 4S1SH 4ODUA 5F3HA 1DEDA 3QUYD 4N3TA 4OJEH 5GGSA 5DMKA 4YJZL 3VQLA 3VM5A 3IDXH 4XP5H 1JGUH 2VN7A 2X2HA 4N6RB 1H5BB 4UNIA 3EYUH 4PY8I 4ZRGA 1BOGA 2YAOA 3GSRA 5LCVH 3UIZA 3UFIA 2P5WE 2EYRB 4JFDB 4Q9QL 1JGDA 2APSA 1WGOA 3C5SB 1K3ZA 1KYOK 3CFKB 1WAAF 2FYYA 4RRPG 3N6YA 1SHMA 2W94A 3D85D 3MBEA 4HCIA 4KXDA 2EE3A 4I89A 1AZUA 1UFGA 2CO7B 3GXPA 4LSUL 3UC0H 3E8VA 4HGWA 2DLEA 4AV5A 2BO0A 1XF3A 1RIHL 2GEEA 1O9ZA 3DGDA 3MV11 4N2IA 2FH6A 5JXAH 1WISA 4BCZA 2VZVA 5KOMC 3QXDB 4Y1TA 5EOQL 3MDJA 4KFZC 3GNMH 4R7LA 4XCNA 5IESL 1I8IB 4YDJB 4PCKA 1E5YA 2RCSL 5CGYC 1PJWA 3QG7H 4AM0B 3UPCA 2O61B 3P11L 4M00A 3ORJA 5GSRA 4G2AA 4EBQL 1CFBA 2AK4D 3CDCA 1XIWC 3LZNA 4WV1C 5E6ID 1U2CA 4Y4KD 3A4FA 3DUUA 1KIPB 5D7LE 5I1KL 2IGFH 2NDFA 4XNYH 2VDPB 3EO1A 4OUUA 1U8KA 1CU4H 4PRHB 2XIDA 4X8JA 4DQOH 3LQZB 3P3YA 3O2DL 5D7JB 1OAYL 1NFDB 3AXLA 4MMXB 5AVTB 1KWKA 1HFUA 2AQSA 3C5JA 2WWMD 4C4KO 3RVUC 2ZX8A 4P2OD 5AL8A 2CHNA 1U2YA 5F7UA 1PEWA 3IFLH 1XH3A 2K9FB 5AKTA 2XJLA 1DANT 1NFDE 4MMZA 2MOQA 4MNQE 5A2FA 2IH3A 3PWPE 4EDXA 1F3JB 3H9HB 2UZYA 3RGVD 4R2GC 1N0XH 4O5LH 1ZHKA 1H15B 4GB9A 3WSQL 3TP4A 4PJGE 2YRZA 1B0RA 2NNAA 3OSKA 5MENE 3THML 1C12B 2ZE0A 5E7FA 4Z3GA 1LO0L 4FQ1H 2QVMA 4KH9A 3CZLA 4OM0L 1NIBA 4YK4B 5DS8B 2VIRA 2W9LA 2Y4SA 1HWWA 1YY9D 1L5GA 2PO6A 3U6RA 2HT4C 2VERA 3MJ8B 4HETA 4K3GA 4HCRL 5IV2B 5D71L 3MV9B 4GQQA 3WEBA 1DDHB 3KPSD 3G9AB 4GRWF 3TPKA 4EZLA 5T3XE 1BYNA 4MB3A 3C6LA 1MRDH