5D7EA

Crystal structure of taf14 yeats domain in complex with h3k9ac
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
140
structure length
140
Chain Sequence
b'LGSMVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQIPLNKPLLTEELAKSGST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription initiation factor TFIID subunit 14
publication title Association of Taf14 with acetylated histone H3 directs gene transcription and the DNA damage response.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Nuclear protein
total genus 30
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5d7eA00
2NDGA 3RLSA 5HJBA 5IOKA 5IQLA 2NDFA 3FK3A 5D7EA 5HJDA 4TMPA 3QRLA 2L7EA
chains in the Genus database with same CATH superfamily
1LEKB 2D2CC 3GXNA 1FPTL 3K6IA 4WENB 3L4TA 1DE4A 2GBVA 2X4PA 4I1RA 3CDZB 5BO0D 5FFLA 3MOQA 1GW0A 4PRPA 1KPUB 3QDHA 3WXWL 3GSRB 3PHQA 5CEZE 3KWWA 2GUOA 4I0PD 3SKMB 3UBGA 2VDKL 1OWWA 2KZKA 3CHQA 3WU1A 2WLJA 1P5VB 1CFNA 4ZMXA 4WV1A 1HU8A 1PZ5A 2AGJL 2I7OA 2W9EH 2WZ5A 3FO1A 4XCNB 1KEGL 4YGAB 5GS0L 3ULSB 3EJUA 3KPSD 1SJHB 2EYSA 1XT5A 3TVMB 5KG9B 1CGWA 3PS6A 4FNQA 4NZTH 5JOPD 4Z77B 3QDJA 5F7MC 3QQDB 4ZTPH 5E24E 1HXYA 1NZRA 2HSIA 4LFHD 4CN6A 2CJTA 5CGYC 2ERJB 2XQYG 4UQEA 3FN3A 5EZLB 3B7RL 1JGIA 3II2A 5JW3H 2PYED 2DQHL 3RWGA 3KYOB 2IFFL 4JFED 1OD7A 1FORH 5F7NC 2JKXA 3QI9A 3QFDA 3V4PA 5HPOA 1I7UA 2AJXH 4OJYA 5DJ0B 4LSTH 5SWSA 3UBFA 4FFYL 1UUNA 2AFNA 3SDDD 4YFEA 1AHWB 2H3KA 3OC8A 5FM8A 3SDAD 4ZUWB 4R7NB 3AM8A 2NY6B 1LLAA 5HHPA 1KCVL 2Z31C 4PCSA 3WUZA 5FYJH 1RZFL 3X1GA 5A3IC 1NLBH 2JJWA 3T0AA 4M3JA 3STLB 1ND0A 2X41A 3GSNL 4J3WA 3EF7A 3L48A 3LKOA 4QRQA 5D5ME 2EAEA 2FL5B 3T0BA 4UQAA 3BHBB 5B7FA 2P44B 4HMDA 2UXGA 2X4RB 3T2QA 9PCYA 3DPBA 3LKNB 4JB9L 3L5IA 3MROA 4QYOA 3Q0HA 2YRBA 2H26B 4KUCF 4XPTL 3QB7C 5AUMB 1JTPA 4U3HA 2QSVA 2ZOOA 3WI9A 2G4GA 5TPWL 4CMMB 5IESL 2KMWA 4F91B 3MRNA 2IDQA 1L0QA 3KPOB 4G9FA 4KPHH 4AG4L 4AM0A 1CGXA 1FAKT 1JXJA 5DJAB 1RJYB 4KKLD 2X0WA 2FRGP 1J88A 4P06A 1P6WA 4ODHH 2CKBA 5TE4H 1IL1B 1AP2A 1KLFA 5IK3B 5C0GB 4H7VA 3AQXA 2WBWB 2G2PA 1NGPH 2C1PB 3CSYB 2FJFB 2H41A 2ITFA 5I8KL 2DH3A 1Q9OA 2WVUA 5FGCB 3U9WA 3VFSB 5IQMA 1NOLA 2VH5L 1MF2L 3RTQC 4OJCA 3QORD 1M1XA 2A0LD 4OZFA 1AZVA 4IGBC 5DZJA 1CR9H 3H8NA 1XGQB 4RGNE 3KEDA 4PLKD 4U4IA 3Q1EA 2NY2C 4G3YL 5TDNA 2Y7MA 3BUQA 4HIHB 5DRZA 2BNQB 3WIFB 5DJZA 5J0BA 2Y1YA 4HEPA 4P9MH 4WI5A 1I7RA 1GA2A 3BVTA 2NQDA 1YY8B 3BVWA 4JKPL 3WFDL 1Z9LA 1JPGA 3AT0A 4QRAA 4N3UA 4GW1B 4ABUA 1X5XA 3VXPA 5IOKA 3WEXB 3H9SE 4JFDA 3SPCA 1ZVSA 5D8JL 5AVRB 5FF6A 1MCSA 1J0HA 4KDVA 1T22A 2X9WA 4RWYH 4XBMA 4ZS6D 1E4KA 1HN1A 2I7SA 2LVEA 1UWXK 2XETA 3DXAE 5IB5A 2XVLA 5JOFA 1BAGA 1M3JA 4X6EB 5LXGL 1CFVH 4HS3B 4U1IB 2APTA 4PJDE 4WY7L 1F6LL 4EKXA 1TEYA 2XQBH 4FC3E 3VQLA 5HYJA 1CGUA 1EVTC 2P5EA 4DTGL 4WO4A 1MFDL 2R59A 2GJJA 1L0YA 2IJ0C 4Y88A 2AJUH 5KS9E 1MDTA 5IB2B 3SGDH 2AEOA 5D2NA 2IGFH 3BPLC 1SLVA 5J57B 2G2NA 1D7FA 1BBDL 4N0YL 3NA4A 4IRZH 3TNMA 5GGTH 3GSUA 3UC0H 3VQ1C 2B0SH 4PP2B 5I6KA 3CHPA 4PJ5B 3EOAA 3IF1B 4HPOL 1IQDA 4TULH 3TEZA 4BEIA 4HWUA 4UWQB 5SX5K 1OGPA 3D07A 3R8BB 4HG4K 1NCJA 2WOYA 4HIIA 4Y9EA 4BZ1L 2BP5M 3OZLA 2MCG1 3VH8G 1IKFH 2X1OA 4U6HA 4QXGH 2YQ3A 1S7TB 1V3JA 3GWJA 4WEBL 2H6OA 3MLTB 1HNFA 1YEKH 4W6XB 2QJDA 1PZCA 2E76C 4IK6A 3WN6A 4PWEA 4XNDA 1UT1A 3LNFA 3NCEB 3IMUA 5DHVB 3V7AG 3DSNB 5IQOA 1S9KC 4G8IB 4TSCL 1OF0A 2HFFA 3FCUB 1K5WA 3O2WL 1NC4A 3WKNA 4ZTOL 3GBDA 1G9EA 4OB5L 1G4MA 3E2HC 2XN9B 1R3JB 4KROB 5D93B 1QW8A 1XCTB 3EFDH 2B59B 3QUMA 4FYSA 2MKWA 4JKNA 4HUWA 4C4KO 5ETUB 3DIFA 2DQ6A 4RISL 4H44C 3L1GA 3D6GA 1G9MH 1W0YT 1A4KA 2UXVA 5CM1A 5IVZB 1MCDA 1U41A 3SD2A 1RULL 4OD1H 2R1XA 4MCYB 4WEEA 4F7MB 2R83A 4WKXA 1TR7A 4X6DE 3BD3A 4GQZA 5F97E 2WZPA 1UWFA 3ROLA 3LD8B 2IBBA 1XR9B 3F00A 3ARWA 4JREC 2N1TE 3MBXL 1D5MA 2EJ1A 1EZSA 3DJTA 2NR6D 3SJVD 3QUYC 5D6DA 4O2CA 5DJXA 5TDPB 4N6QA 2HJLA 3V0WH 4Y7MA 2J56A 2XXGA 3EGSA 5IB1A 3MUZ1 1QSFB 2B1AL 4OZIB 2X4NB 3BEVA 1W8NA 3GRWA 3IDNB 1U3HC 3NSJA 4LSRH 5E2UL 3WN5B 5CLZA 5DZLA 3DOHA 2VR5A 1EERB 2CDFA 4Y5VA 3V5DA 3OKEA 1D9KB 3EO9H 4IOIA 3QZWG 1LGVA 1TYRA 1WPCA 4NC0B 4C83A 2VL5A 4MZRA 3DBXB 4F15B 3BAXA 1NMAH 4JJ5B 4HIPA 2VR8A 3G08A 1IC0A 3KW7A 4FX5A 3RWHA 4DGWC 2HTKD 1HZKA 1CYWA 1I9IL 1A7NL 2VR3A 4Y19E 4P4KA 5H37G 3L4YA 3MRPB 3D39D 5DWUL 1LNUB 2CO6A 4XCEA 1M7IA 2FJHA 2GC4C 4P2QB 5LBSH 4YR6B 1MFAL 4WWID 1CICA 4Y1AE 3PDOB 5I73B 5CKGA 5GRJH 5I0XA 5E6SB 4EZKA 1UXMA 2FD6L 1EGJL 4KTDL 3P4NB 2P3YA 2DBLH 4X99A 4XO9A 4XAKD 4F8TA 3OMZA 4K3DH 1BQUA 2F5AL 3ZE2F 1GAFH 3UYPB 2WBJA 2HFEA 3T4AB 4UT6H 3VQ2C 4X8JB 2JJUA 2X44D 1E4XL 5DJ2B 1M05A 1IEAA 1QRKA 1HJBC 3VU2A 4ORZC 4QPEA 1KCWA 3C87A 4GO6B 2ITEA 1ZT4B 4A2LA 4FF9A 3IN0A 3I2CH 4IYKA 1MAJA 1ZTXE 3EGDA 3PWJA 4F58L 4ALAH 5B4MD 1K3ZA 1ZV2A 3HI1B 3MJ8A 1J5DA 1ZS8A 4Q0XL 3UAJA 4XGZB 1K85A 4NWUH 5AOZA 3IDMA 3JTSB 2VXQA 5GISL 3D9AH 1JI1A 1MFMA 2N0KA 4L8SA 3MJ6A 5C2BH 1N4XH 4KMTL 4BSVB 1IM3D 3L9BA 4PJGB 5ACMA 2QSTA 3HW7A 5E70A 1TZAA 3WTTA 5F7LB 4EOWH 3LPFA 3NA9L 1P7QD 2IXQB 2BCMA 3C8KA 5BUAA 4XMTA 1MRCH 3VYOA 4OD3H 4DW2H 3UJJH 4MNGA 4ORGB 3X3FL 2YZ1A 1QRNA 3O6FC 1P2CA 4PMEA 5B7MA 2FQFA 4ODVL 5JPNB 3VA6A 5I1EL 5IBLC 4O02L 4X50A 3O45B 3MRKB 1LHZA 2EIMB 3GEWB 4JKWA 4AGQA 3OJDA 1SJMA 2BVQA 1FVDB 3QIUA 2ZOKB 1WEJH 1D6EB 3V0FA 2EDQA 5BO1H 2ZUWA 2IADA 2DKMA 4NQCE 3K5SA 4GRLD 2ZWLT 2AZUA 2FJSA 1RZJC 3K72A 3NABH 4QO1B 4PG9B 4NQDE 4C4UA 1OPOA 4CBZA 1JPTH 4Z8FL 3MN8A 3FFCD 3AWFA 4JE4B 3SODB 2FB4L 3VRLE 5E1IA 3ZL4H 3N0PB 1BA9A 4UUJB 1NLDL 25C8L 3C08H 3E3QE 3AXLB 3NYKA 4NJ9H 3S9DB 1S7WA 4XNBA 1YEWA 3IAGC 1TETH 4PLJD 3T09A 1CXEA 5CLYA 4L37A 4YHKL 4WKZA 2V9UA 2Z35A 3RHWK 4A7GF 5AFAA 1U8NA 2QZ5A 1XD1A 3EJRA 3RPKA 2CHNA 3GHBH 3H42L 4AVHA 5CD5D 2X9XA 4HUUA 4XX1G 2V0AA 2EINB 3QEQD 1KJ3L 3D7PA 3MV9A 4N22A 4W6YB 3T8XB 2NCMA 4N26A 3EYVA 1GGBL 1MCFA 1HZLA 5E56A 3JWNH 1IGMH 3MOBH 2NY5L 4M4RB 4WU5A 3KM2A 3B5HA 1I4FB 2YEZA 1KN4H 4EF3A 4Z3GA 3KLHD 3K2IA 4KZEH 4NPYA 3G5XB 5L8LB 3DUHA 3FH8A 4IOFC 4PJEB 2YRPA 1S9YA 2CH8A 1TEFA 1I1FA 1W0VA 1MHEA 2YA2A 4DZBB 2EIZB 2J71A 1P69B 1SXNA 1U33A 4BSJA 2J3SA 3CFBB 3ESOA 1T89A 4PGDA 4QJ5B 2XCMC 3AG4B 3QA3A 3F62A 4OQTA 1J05A 4JHVA 1CE1L 3VNYA 2RFXA 5IR1B 4NN5B 1P6FA 4LRIA 3I74A 5C6PB 3B9VA 5E6UB 4FYRA 1DN2A 3FQWA 3P0VL 4NYLB 5IT2H 4P5MA 4LVOB 4WHTB 1KJ2H 1AGDA 1NMCB 2CXGA 5DCCA 2QADB 1T2XA 3FYIB 3WJMA 35C8H 3BSGA 4RETB 3BGAA 1LDSA 2XZCH 1BQHB 4MS8C 4Z7NE 5LUMA 1LE9B 1GGYA 2XZQH 4KOBA 4K3EL 4Y5YA 3ULUD 3WKYA 1H6UA 4LK4A 3U79A 2R4SL 2JB6A 1XF3B 3F7VB 2XA3A 4LSDA 5DTFA 1ZAGA 4FEIA 1FGNL 1ZHLA 1I7ZB 3OR7B 2GTWA 4L3FA 1JNLL 1I7TB 1XAUA 3QCUH 3BMWA 4PB9L 2WGNB 3N40P 3S5LB 3VXOB 2Q10A 4A38A 3FONA 4AKPA 2BVPB 2XZZA 3DX8A 1AGBA 1FO0H 4WEUD 4XO3A 2CA4A 5INDB 2YBGA 5DZPA 3GPEA 4U33A 3D4ZA 3QNYB 4G2AA 3THMH 4PJ6A 3PWPB 1O7VA 3MACH 3RWFA 4DGIL 2NZIA 3G3LA 2PPDA 2BVTA 3B9AA 4OZ4A 4OJAA 1UJ3C 1NAML 1QPPA 3QEUB 3N9GL 5H4YA 2ZCHL 4LVNC 3RKPA 3WENA 4U0RB 1RURL 2CDEA 3OHXA 3Q2VA 4IEFA 1XIWD 4P5TC 3V4UL 2ATKB 4ZFZB 5TGBB 3RWJA 3V4PH 1R3LA 3OM3B 3K8KA 2FCBA 4HIJA 3UMNA 4KHXH 1XXDC 4E9SA 4HWNA 4AENB 4NQED 3VXSB 2DAVA 1MY5A 1S7QA 4BSWA 4YHZH 1J1XH 4A2FA 5T1DH 3OAWA 3HNVH 2DYPA 1I1YB 1PKOA 2X1WL 4Y4FD 2C9UA 4HX1B 2BM3A 3B2MA 4R4ND 5HGBB 2YSTA 2GI7A 1EAPA 5J4MA 3FO9B 2PYFB 4OM1H 3W0WD 4Z7UE 1MN4A 4X7CC 1T66C 2G3MA 2ATPB 2CZNA 1PW3A 4FQXA 1NCAH 1SMAA 4XPFH 4R90H 4Y5XC 3RIKA 2BNRD 3VXMB 1JPFA 5FYJD 4CVXB 4LL1A 5FOJA 4CSPA 2R27A 3IRPX 3WOVA 4ZXBA 4D0BA 1PIFA 4XC3H 1FZKB 3WSQL 1D5BA 2F53D 5EB9A 3C60D 3TZVB 5EOCJ 2O72A 3QCTL 3BZ4A 3U0WH 4MJIA 2OXGB 3FO2A 5F9OL 3RZWA 4NAQA 3LPWA 4ZO6A 4ZSOA 2GUYA 2IV9A 5JIKA 1NCBH 6TAAA 3BFQG 3MNVB 2HYMA 4HKZB 2Y5TA 1BECA 2Z9TA 1HWWA 2ZX8A 3ES6A 3I6KB 5E6IA 4HJTA 4Q52A 1QSZA 3F2LA 4O9HH 4KJQC 4F92B 2OULB 1N68A 1BPLB 4XN4A 4OZFH 5HPMB 5H94B 4NZUH 4CJ0A 4NM8H 1BM3L 3NN8A 4G1MB 2X6UA 5DFAA 3TH4T 3NQIA 5FA4A 5HDWA 3B8SA 1DUYA 3H0TB 4UZUA 2WB7A 3ZO0A 2RMNA 2N7AA 4HKXB 4M3KB 2I07B 4AYMC 3QZPA 5E1GA 4NB7A 2C7UA 3TJEL 3O41B 5C7ZA 5D1QD 5FM4A 2EH8L 1AHMA 5FHAH 4Y16C 2C1OA 3TO4D 3FU7B 1QHOA 1SZNA 1TCRA 3RFZB 3VWJD 2IGTA 3O3EB 2XG4B 3QEHA 2WSPA 2QQNL 3FOMB 4QRUB 1WWBX 5KSAC 4YVUA 3GZQA 1W72H 3QC5X 3GSOB 1WIOA 5F6IC 4DOHE 2UYLB 4K5OA 1R3HB 1Z9PA 4JPSA 5J8OA 1OCCB 1T5XA 3KGSA 1O7DC 2JKIS 3EYFA 1OSEA 2GHZA 3I9GH 1YNLH 4YX2L 2FBRA 2LU7A 3EHBD 1X6LA 5BRQA 1S46A 1NM9A 1W8EA 4N8CL 4QHKI 4XMKL 3X1EA 4PGEA 1EA9C 2HKHH 4A6YH 1LO5B 3FW6A 2D31B 3BGFC 1N70A 1FFRA 1Q1JL 3P0YH 4GO8A 3O8XB 4HUKB 1G9HA 1TJXA 2WNGA 1TJIL 4PBWD 3RGVB 3JVFC 4MZ2A 4JEGB 2YARA 1DBKL 2BOBA 1SYVA 2FE0A 2WXPA 1Q72H 4U6VL 3OLGA 2B4CC 1UA3A 3PFQA 5ADOL 5LNDA 2WYHA 4HIEB 5BNXD 3GD1C 1RLBA 4PJBE 3P30L 3RIFK 2QSQA 4O51B 1ACCA 2VDOH 4PVMA 2AQ3A 1CD1A 1S7RB 3F6LA 4HS8L 2Y5QA 1HILB 2ADJB 2F61A 1SMOA 3DA0A 3IPEA 3KPRE 3QIBA 4LGPB 1NDTA 2A4ZA 3S98A 5HTSA 1SOKA 3WAKA 4HFWB 1W91A 3D1MC 4MA8L 1KPUA 3FUEA 3GSRA 5KOVC 3EJPA 2ED9A 1GPOH 4OCXH 5T3ZL 4OFIA 2F18A 3EH1A 1YZZA 3T6XA 4AI7A 3OBAA 1I8IA 3EF4A 4FMVA 1LM8V 5B1CA 1OKEA 3OPZL 1DQML 1SJHA 5EZJB 5HSFA 5E2TH 3TVMA 1SN5A 5K1JA 1EFQA 4G7QB 2GY7B 2NT1A 4PRNA 3VGEA 4S1SL 3S4SB 3ZRFC 1TZGH 4BE5A 3WUWG 3QQDA 2FAUA 3QG7H 1CFQA 2ZG3A 2HTLD 4FTDA 4NUQA 4N8UA 1YUHA 1T83A 2YPVL 4KY2A 1JK9B 4GSDL 1OTTD 5EZLA 2IBZY 4WUKH 1RVFH 4OSUH 1I53A 3BYTA 3KYOA 1OCOB 2GSGB 2VDKB 4O2FB 4X42A 2WTOA 5E00B 4PJIA 2W60B 4R4BA 5F1IA 3QQ3A 2VW6A 2NY0C 3FU5A 5I6NA 2E3VA 3LIZL 4ZUWA 3Q2WA 2OZNA 2D3NA 1ACXA 4L4VE 4EZJA 1HHIB 1EUUA 2D0FA 2YAHA 5DUPL 1N9PA 4ZODA 3GRWH 2P80A 2ZTBA 4JMNA 4PJAE 2IPTL 1C08B 4RBPH 1ZGLB 3T6VA 1E9OA 1M6OB 4M62L 4H1LA 4RGOL 1JGLH 3BHBA 4M6AA 1UGNA 4PFEA 3BLBA 3SE4A 4PUBL 4FNLL 1QFUL 1AXSB 4POUB 1AR1B 1EHLL 2ADIB 5JZ7C 1QBLL 2H26A 4YOKA 5HJDA 1HEJC 1DN0A 4X9BA 4KZDL 5AUMA 4UV7L 4OF5A 3O4OB 3LS4L 1ZSHA 3ZR6A 3HNSH 3NAAL 2EXWD 3CHOA 3W1ZA 1FBIL 3DKHA 4GS7C 5BVJB 4ZI8A 3T0EB 3BP6B 5DSCA 3FSVA 4HGKC 1REIA 5EDXA 3VRIA 2J4WH 1L9MA 5F9JB 1RJYA 5AVSB 5KZCB 5JHAA 2XTJE 4PS8A 1LWJA 3QWOA 5C0GA 4Z78B 3GJFB 4HHGA 1T1ZA 3WHE1 3VFWB 2G5BA 3U7WL 2LABA 1AG6A 3IRZA 2IWKA 3VFNA 2HX8A 1SY6H 2E8YA 2WLYA 1RFDH 4WUUB 2DWYA 5CD3B 3L5HA 4P2AA 3TNNB 2FEEI 2WC7A 1J10A 2X70B 2YUXA 4H40A 4QYAA 4QTHB 4HIHA 2ADYA 1PQZB 3PREA 4JRYE 2Z93A 4QRFA 5JHDE 5IEHA 5IW1B 4X7DC 4P9HL 1OEZW 4HXAH 1SF5A 4UQCA 3DX7B 2VDRB 2EDWA 4HIQA 3R0NA 2HUEA 2DF3A 2X3AA 1YY8A 3VTTA 5EU4B 2J1KA 4BQCA 3L3OB 4JZOA 4AITA 2D4DA 4ZUVB 2WZ0A 4GW1A 2LT9A 1A7BA 5ID1B 1UZ8B 5K93A 2VXQH 3HB3C 2K1MA 2JJTA 4B27A 4F2ME 2JIXB 1ET5A 5JMRA 1NEZG 2AKRA 3LQMA 3PGCB 2WLMA 1F00I 1Z5HA 2GJ6A 1HC1A 5F1NA 4HIXH 4BA0A 1VJSA 5I8EB 5D7IE 1D2OA 5T5FH 4Z76A 4UTBA 1IGFL 3T6QC 1PLGH 4Q74A 4G43A 4HEMA 4I85A 5F3FA 3ASNB 5IHWA 2AI0H 1SMDA 3CHXA 3SKNA 4KVNL 1UZ6E 4WGVB 3GBEA 3S5ZA 3G6JB 1UASA 4YNYB 3UG4A 4JR9L 1CI5A 3KBPA 3FU3A 5D7KD 3CN2A 4H25B 5GS1B 2X6CA 3IDGB 5I0DA 1GZPB 5L2KB 4M6NL 2JELH 2FIKB 4C4KT 2AJSH 2FHFA 1J5HA 1QASA 2R2EB 2VAAB 3NDZE 4PP2A 3KBFA 4PJ5A 3C8DA 1ZEAH 5E1HB 3VD2A 3LSOB 1KYOK 1MJUH 3U9UB 1LJMA 4U6TA 2XVKA 1R5IB 2R69A 1C7SA 4S10A 3U6XA 1S7TA 3UPCA 1NH6A 4TSAL 1FAIL 3TBWB 1XEDA 1A7QH 3ECBB 2IPUK 4JW3A 1ITCA 5BV7B 5DHVA 3VI4B 2Q9OA 3NIGB 3VXNA 1RZJH 4B50A 2PP7A 1S4IA 1MW2A 3DX6A 2KBGA 4Q6IB 3RZCB 2F6AA 1PTZA 2XN9A 4DKFH 3K6SA 5FV1L 1U91B 4AYID 4FJYA 4W68A 5ALBH 2ZT9C 4L1HA 1YN7B 4Q58C 4S2SA 1CLCA 4L1LA 5BRPA 2AJ3A 1EDQA 1YMMD 3VRJA 1D6VH 5JPMA 2MCAA 4JPVL 3B5TA 1BIHA 2UWEB 5FLVA 2OLDA 1S3KL 4L4JA 5E4OA 2AABH 2YBRB 1H3PL 3KDMB 3OL2A 2IH9A 3DXAA 3WHXB 2OMBA 4FHBD 2I25N 5ITBH 1NBVH 2HVKB 5TF1L 3U9PL 3HAEG 1XR9A 2EABA 2DIBA 4LNRA 5EBWB 4I88A 3DX2A 3HE6A 3VA2C 2TSBA 2WAQA 4ONHB 1INEL 3GNML 3DJRA 2GJPA 3G7TA 3L4CA 4OKDA 5AAMA 5KS9A 3T2LA 3FCTB 1GGCL 4FE9A 5EEUA 4ZJ9A 2VSCA 4FEMA 4PRIB 3QXAA 4JPKL 5KUKA 4XMPL 3U30C 4UM8B 1HESA 2OW7A 1G7JB 4QTIH 1ZY9A 2DLHA 5J3HC 1ZGLM 4F9PA 3BCDA 1DQJB 1PZ2A 2LAGB 4RSVA 3RX9A 3VX0A 4TMPA 5FGBA 3DBXA 3EIFA 5CCGE 1MJ8H 2ZX7A 3MODH 4IRJC 4NQTA 1YPZF 3I6LE 4YSUA 1EK3A 2PTVA 5I1AB 4GFXA 1JF1B 1U58B 2BRRH 3D0VA 1B4LA 2GFBA 5TQ2H 5E7FA 1M9SA 2BHYA 3O11B 3A5VA 5IJKA 5KYYB 1RMFH 3QUHA 1LNUA 3WJLC 3SY0B 3RKDD 1UATA 4NO3A 5SX4I 2QVMA 4P2QA 1BVLB 2O6FA 5G5DB 3TF4A 1G9NC 1TO4A 2QSCL 1AYOA 3BYYA 4G8EB 3TBVA 4K3GA 5E4EB 1F3RB 3QDGE 5HGAB 5FS5A 3GXIA 1KXVC 3T0XA 2MNWA 4KQ3H 4OAWB 3KLKA 4KO5A 5IHZB 3WY4A 5DJCB 5B1KA 2QPDB 1KTLB 3TF7C 4FMKA 4JN2A 2Q76A 4B97A 3UYPA 1FLRH 1FZMA 5I8OL 3AREB 3VXRE 5J6GB 2TSAA 4KZCA 1X5LA 5FA3B 4LVHB 5LKNA 1CD0A 4LSSL 4NZFA 5JXEA 1F4YL 1A6VL 1HKLL 1VPOL 3MRQB 4XVSH 1FUNA 1ZT4A 3DHMA 3KL0A 4O2EB 1V7NH 3C5JA 2H6PB 2EDTA 4DN4H 4LCWB 3GMNB 5DEJA 1KY6A 3WIIH 4ELDA 3QI9D 4IBQA 3ZGHA 1H19A 3GINA 3VB8A 4DHLA 3TASA 3HRPA 5J6GA 1MNUH 4MYWB 1HEZB 2ATAA 2EXYC 5T1MA 4PJGA 1T5WA 4PB0H 5CGYD 5D7LE 3TEYA 1AXTH 4POYA 3C9NB 1M2OA 4QRRB 4APQB 4MX7B 3IFLH 2AQNA 1KPRB 1UJTA 1GC1C 1WH0A 4G8GE 1PMYA 5EU3B 1O5DT 1PKQE 3A67L 2I60L 3I9IA 3OHMB 4YDIH 3H55A 2JE8A 2WYZA 4G83A 2BIQA 3SE3C 3GM8A 3I3EA 1PIGA 1WITA 2Y2TA 3OKLB 2NW3B 2FYYA 3CHRA 1IBGL 5I15L 4FQLL 2FGZA 8FABA 4FNTA 1O9VA 3O45A 5A3ID 1MZYA 1QATA 4P46D 1FNHA 2FHBA 4IDJH 4X5QA 4TSBL 3RX7A 3U1PA 4XAWL 1A2YA 1QNIA 3UGEA 4MMZA 1SUJA 2MPVA 3BVDB 3ARYA 2ZSWA 3UC2A 3W57A 1SHWA 2YXFA 4PR5A 5EZPA 2QHRL 2VNCA 2A9ML 2AXWA 4G9FD 3F6IA 2Q1EA 4QO1A 1WISA 4A7VA 4Y1AA 3MNMA 5C1MB 5IJCC 2AK4E 4NO2B 4RBPK 1TQWA 1JZHA 1GRWA 1HHHB 3D87B 1RUKL 1PY4A 1J18A 1UOWA 4O02B 2EE3A 3GBLA 2RA1A 1JWSB 4TPRL 4L8CB 3JWOL 1JCVA 1TJHH 4I77H 2NPLX 4H2AA 5KSBE 1TMCB 1MFUA 3L3GA 3IDYC 4L3EB 3WTWA 2JH2A 1WAAF 2EO7A 5B1JA 2KI6A 4W9KC 3FQTA 3C2AL 3P3RA 1DZBA 4RQQB 4LLVA 1QSEE 2F0CA 2FSEB 4XRCB 3U25A 2C3VA 4NFDA 5ALCL 1FGVH 2AQRA 1TNNA 3CN3A 2NXYC 4FTVE 4GMSL 4M4RA 3FHAA 1MUJA 2IMMA 5FYKL 2NY2D 3GSXA 1I4FA 1XB3A 1X7TA 2C8NA 3HE7C 1V05A 3FUKA 3TEXA 3R1GH 4NNYB 5T3XH 3QW9A 3EO0B 4PJEA 4JY5L 2EEXA 1KMGA 4YE4H 2DQCH 4A7QA 3NZ8B 3BVUA 3EUUA 4K7FB 1JJUA 4YHML 4DZBA 1TO5A 4JCWA 1ES0A 2EIZA 1NJ9B 2ZWSA 3HRZC 4OFKA 5HYJD 2CRYA 2X9YA 3CFBA 2P5ED 3QDAA 2OQJB 4GMTL 4WO4D 3VYNA 4LPYA 2F58H 5EU6B 1R0AL 3SYPA 2GTZB 4JO3L 5TFSL 2RALA 5IR1A 2B8OT 5DD5H 2Z8WC 3HMXL 4K71C 4BFGA 4JDEA 3E3QC 3GUFA 4QRPA 3AAZB 5AW3B 3NEXA 3D4CA 1TJGH 1GVIA 2L04A 1DLFH 2CK2A 3BD5A 4NQDA 3PJNA 5C0AB 2BS9A 2B4CH 2VR7A 3W9DB 2OJEA 3N43F 3MRJB 5KVGH 1LE9A 2A9AA 2YS4A 5D7JA 2ENYA 5JTWA 3HR5B 1XF3A 4E9WA 1FN4B 4PREB 1I1AA 1G7IB 5HY9A 2BVPA 1NC4D 3MJ7B 3O4LB 3T8MA 5EF0A 1HWHB 2VXUH 4I18B 3UEQA 4E41B 4KK9D 1LL1A 1EZVY 4M93B 5INDA 3IFNL 3TOPA 3BH8B 1NGXB 4DFHA 1FRGH 2WLIB 3DX3A 4JRLA 5HYSA 2PXYC 4UU9B 1ZE3C 5CJQL 1DVFC 3PABB 2PTTB 3EYSH 5ES4B 4ZAKC 2DQFB 2BFVH 5I17B 1KJMA 3QPKA 1EXHA 2ZXCA 3NFPB 1MELA 3Q8BA 3ULAB 4A7SA 3BW9B 5FYLH 2ATKA 5TGBA 3CC5B 1T2JA 3A6BL 3HZYA 3AY4A 1WK0A 1N5YL 1S78C 5CWSB 4D9QD 3CBRA 2G5UA 4ODXB 5MERB 1UD6A 2WZPD 1ZHKA 2O5XH 1OB0A 4P5RA 1OAZH 5ICXA 4M29A 5ABZA 1I1YA 5FUCE 4ZFQA 3C5XA 1OHZA 3HG1D 5HGBA 3LN5B 4CU8A 1TENA 4XN8A 3FO9A 3FAXA 4H1LH 3ZDXF 1EANA 4APXA 5KBKA 3WBDA 2H47C 4UIMB 3VXMA 3O2DH 3OKYA 4OLVH 3BZEA 1TTCA 2YKKA 3LOWA 4IMLA 4AVJA 5I30L 2G60L 2XJKA 3LZQA 3IM1A 3AXIA 1IC7H 4G6FB 5J11C 3ZZQA 4WW2C 5I1IL 5GGRY 2ODHA 4BWUA 3KGTA 4P2RD 2OXGA 3DK2A 1MJ7L 4W9FC 3PP3H 4U1LA 4KKPA 5H37H 5CEZH 3ZQ9A 2AXGB 2UX6A 2HVJB 5IIEA 1TZOA 1I1CA 1QSVA 5F7HA 4HHAB 4UT9A 4P4KD 3CH1B 2N1KA 2XFGB 3AS1A 1IJ9A 4ABVA 3MBWB 5LNGA 4FQIL 1UD8A 3R4DA 1KCRH 3MLWH 1RAMA 1A3RL 1NL0L 4LPTA 2AV7B 4MJ4A 4V1DD 3QWRD 1V3MA 4TVSa 4MHHI 4U1GB 2CMRH 2R0LL 2Y4SA 1MREH 2ZUQB 3WGVB 5HHMD 1C7TA 2VM4A 1B2WH 5D1ZB 2WBJD 1YVLA 4ZMQA 3FB5A 4WFFD 1ACYH 2R56H 1AQKL 3O41A 4G7RB 1WZAA 3N85H 1DJHA 2HFGH 4AH2B 2YSSB 4R84A 1N0XL 3WNIA 5DC2A 2CNYA 1J8HB 1P84J 4ZQTA 2IV8A 2QVIA 1TZIB 5CIPB 1LK2B 3UTSD 1Y07A 2XG4A 3DJSA 1IQWH 4AGNA 4HWBL 1VACB 5EORL 3GSOA 4K9EH 5AKTA 3KR3L 2UYLA 3A6CH 3DLQR 1WC7A 3VGBA 1HX0A 2A74C 4MNQD 4Z7UA 1S9XB 4JHAH 2LTQB 4NOBA 2FWOB 3RI5K 4AEHL 2YMXL 2NXZD 1MRDL 2EZ0C 5IQLA 1R4XA 4HMCA 2V9TA 3VSTA 5B8CC 5I66A 3IGLA 2XXCB 5DJYB 2ZP0T 3EDDA 1IJNA 2WTPA 3CVHH 3L13A 1JTOA 3CLWA 4AQZA 4X8XA 2ZWNA 4S1QL 3QWQB 5JO5A 4NO0B 3NCXA 1MLCB 2OPCA 5FW7A 1DO5A 2L7JA 3VMOA 4PCTA 1FHGA 1YECH 4P0DA 5D72L 2VZSA 5LHDA 1A6WH 1JFQH 2F54A 1GYWA 4E5XA 3CSGA 1O75A 2YGVA 4PRHB 3CX5K 1E27A 2HMIC 4NHCL 2ADJA 3V9EA 2YD0A 1IC5H 1C8PA 3V4VL 3V0GA 3DV6B 4LOUC 2J73A 3HUJB 3IJSA 4WTQA 5EC1B 5FHBH 1WZMA 2OXHB 1WHOA 4ZNCD 4B95C 1B0WA 4QLWA 5L0QB 2QVKA 1BBJB 1C9SA 1XD0A 5T1KB 4YLCA 4I8DA 4ZX6A 4GAGH 3I6GB 4ZOBA 4OBRA 4C56B 1AJ7H 2DM2A 4KV5F 3QFJB 1Q1PA 2AJVL 4M8VA 1MHHA 2I69A 1ZHBB 5AVYB 3S4SA 3JTTA 3BWSA 3GQFA 5CINL 4Z0BL 3MV9D 3P9MA 2QKIC 5D9SA 1JK9A 5DI8A 2WXHA 2ZCLL 4OZGB 4ERSH 4DEPC 2YD3A 3BPOB 1UXSB 2J25A 5FO8B 3ZGIA 3H54A 2GSGA 4O2FA 5E00A 4XOCA 3IPFA 4K2UH 1N10A 3KYKH 1JZGA 5F3BA 2EIJB 1QYGL 3O3UN 4G7SB 3M1BA 2RIKA 2PR4H 4M7LT 2MKLC 2JXMB 1UYWL 4OGAC 2PCFB 1JUFA 1SYSB 4WWOA 3LKRB 3BKCH 1E4KC 4HISA 4KX7A 4O4YH 4PV8A 1QI4A 3OVUB 4QF1B 5MP6H 3C6LC 2P8PB 4MKMA 1FNLA 1C08A 5F88B 5ITFB 1QP1A 1O9ZA 1WCQA 1ZA3B 2I9TA 3NG5A 1D3CA 2ZF9A 4QJ4B 3LNGA 2EDKA 4Y2DC 3UGXA 2G2RA 1AXSA 5DUBB 1NFDF 1IC4H 3GBNL 4XI5D 4PJBA 3JZ7A 3WFHA 2W9EL 4YFLI 5TQ0H 1HHKA 5IG7B 4OKVA 3DGGB 2VMFA 3KPRA 4EKJA 1VDGA 1YEGH 4D8PB 5BRZB 1DSFL 3BP6A 3VFRB 1VIWA 5C0EA 1BD2B 1IGYB 3CVIL 3QRGH 2ZZUT 4LCUA 5F9JA 4XE0A 1CFMA 5C0FB 5EO1A 3GJFA 1FL5A 1AMXA 4ANWA 4JMXA 4EEEA 2WQVA 1VRSA 3MBEB 4ZS7H 2AJZB 5ACZB 1LDPL 2A6IA 3MR9A 1FH2A 3CFDB 4E9RA 4LSTL 3PJLA 5C0BB 2KC0A 3TNNA 1JV2B 3BKML 1U2YA 2BSCA 1DJSA 1BG9A 1CGTA 2WYTA 4HC1A 3HI5H 4QTHA 3POHA 4Q9BA 5FYJL 3VQMA 1KG0A 1NLBL 3GHPA 1TQUA 3SQOH 2WD0A 2PKDA 5EOQL 3AGWA 3MO1B 3ROOA 3OV6A 5EU4A 1CLZL 1EFXB 3EJZD 5I18L 2DQUL 1VADB 4ZUVA 4GRWB 2FT7A 2WXKA 3WLBB 4YHYB 2K6YA 4PMFA 4PW4A 4KNTA 2IAMC 5JIMA 4NUJB 2JIXA 3MGTB 4DJMA 3LNEA 5C09E 1MXGA 3BZFB 2GITB 3UTPE 3BE1L 1MWAA 3BZDA 3PL6A 3RVTD 5C0JA 3TL5A 3LQAC 3LPOA 1K6QH 2DYPD 4NKOB 3X14B 1EIBA 5DK0A 5T8IA 4HZLB 3H9YA 4P5TD 3EXLA 1BJ1H 1KB5H 4HQQL 4PJAA 5I8EA 4X9HA 2OAAA 5EC2B 4KPHL 5JLZB 3HPJB 3MCKA 4GUOA 3D85B 3MPCA 2EH7H 2IGLA 4EDXB 4MMXB 2N01B 5TE4L 2JB5L 4ELME 5IW6B 4ACPA 2GSIA 5I1HH 2XXFA 1WCBA 1N2RA 2CDGA 2UVFA 2LU4A 4J3OC 4MJ5A 4YNYA 1IC1A 2OL3B 5LGHH 3TJHC 4HWEL 4OW6A 2XY2A 4EIBA 1WFNA 2AERT 3VFOA 2QEJA 3ESUF 5C0NC 2CGZA 1KBVA 2HT4D 1YCSA 1XF1A 4G8FA 5DD3H 3SN6N 4R0LC 2OM5A 1PPIA 1KYAA 3MA9H 5DMIH 1DBMH 5AEAA 1KIQA 4MJID 3V6OA 5F0LB 3ZE0B 1YQVL 3GZPA 4FP8H 1Y6KR 4IMKA 1HSAB 5E6ID 3L95A 4HWZA 3PP4L 1ILSA 1T20B 1A7OH 3ECBA 4X2UA 1PLAA 4AEFA 1BYOA 1UFGA 2ZPKL 2Y7QB 1RZGA 1AGEA 1IB5A 2CO1A 2R15A 3KG5A 2PO6B 4H88L 4AZ8B 4Q6IA 4KKRA 1OGAD 3MRIA 4WU7B 4AYFB 4LLUB 4BH7A 4Z95H 4FQQB 5FO2A 4LKCB 5A2JH 3KYMA 4DERA 1ZTXH 4W9JC 3OAUL 3PP3K 1DVXA 1F1DA 2AEWA 1IBZA 3ASWA 3MXWL 4J6RL 5DRNB 1TVDA 4BRJA 4F9LA 3HNTL 4WI2A 4LEOA 3TO2B 5CJOH 1DBJH 2AJUL 2X89A 4M7KH 4TLUA 4YXLL 3LV3A 2AVFA 1F86A 3HC2A 4C58B 4ZNEA 3VI3B 4ZUSB 2IGFL 3UCQA 5ENWA 2SODB 2OSLA 4GBXA 3EFOA 3GMMA 3ARBC 1LD9B 4M1DH 4HUVB 5D7IA 3IXAB 3Q6GL 3MRLB 3RL1A 5F9WC 5EO9A 1XGPA 1CLYH 4HJEA 5E5UB 3DRQB 2XPZA 3QHTC 3QNFA 4OLXL 5T3XD 4XBEH 4U05A 3NP3A 3ZE2E 1K2DA 1Q94B 4J3UA 1HHGA 1EMTL 5J1AB 4N4YB 1YEKL 4XMZA 1GJWA 5CGMA 3N42F 3MFGB 3SPVB 3X11B 4ZFFB 1KT2B 1F58H 2ZG2A 3AWEA 5KYXA 4HK0B 2F15A 3A24A 2CGYA 3TIEB 1PF3A 4PJFF 1H0DB 3T65B 1BVNP 4CN4A 3IFOA 1PZUB 4I3GA 2DZEA 5DD6A 3BLPX 4KY1L 3KS0H 4OCNC 1J0KA 1QPXA 4POZC 3RNQB 3VVVA 5I1AA 3GTTA 1JF1A 1O0VA 4H8WH 4HKJB 1ADQH 2IDCA 5I1LB 1JGVL 4I0PB 1MW0A 1YJDC 1G9ML 3L3IB 3QIBD 4FN0A 3QIUC 3SY0A 3SCMC 3F7LA 2GAZB 4OLYH 1XZ0B 4OCLC 2VDMH 1BVLA 2Z0BA 1E0OB 3L16A 3KPSB 3TA3D 5G55A 2V5MA 1SXCA 4N9OB 4LIQL 2OTUB 5HGAA 4WEMB 3NJIA 2I5YH 3Q3GB 4OLUH 5FR3A 3GDBA 5D1XA 3EO1A 4LPUA 3NTCL 3RB5A 5HI4D 2UZPA 1Y6NR 5EZIH 1DQDH 5I71C 3WFEH 2APFA 2ZXQA 3RJDA 5FA3A 2XWXA 4GG6B 1F4XH 1DZ0A 4JFEB 4RAUB 2CU9A 4HUXB 4QT5B 4LSPH 1BIIB 4NT6B 4RAVB 1ZE3H 1CU4L 5DT1H 3SDDB 4J1UB 4YBHA 3SDAB 3SOBH 3V0VB 2RH0A 3NMEA 5AW5B 1FC1A 4BFKA 5B39A 3HS0B 3VD0A 2WVVB 2MNJB 4B9GA 3L3DA 5DZNA 4P05A 5FYLD 2J8OA 4YAQA 3E7JA 2F7RA 3EDJA 4DP1X 4PJCF 1B6DA 1CI3M 2AAVA 1FC2D 4ZYKB 1NMAL 3GXFA 4A2GA 5ISZD 3C9NA 2WCPA 1IAII 4FQ2H 4G6KH 1I9JH 4JRFA 4MAYB 4MX7A 4NZ8A 2P49B 1RZ8B 1U92B 2KLTA 5DUJA 4BH8A 3DO3A 4G7YL 4LQFH 3WAJA 1EJOH 2P80D 1TKWB 3MV01 4OLZL 2JVUA 3BX7C 2XWDA 5BW7C 2NY0D 1R24B 3ZE1B 2DWEA 3K1DA 2WN2A 5LBSL 3BRDA 3M1OA 4YHIB 5E03A 4E9YA 3OB0H 5DJ8A 3UH8A 4Z7VA 5EEVA 3E6HA 1C1EL 4F37K 2X2UA 4PRAB 1X5YA 3TN0A 2UY6A 1O7SA 1T89C 1LO2H 3BUIA 1FCCA 5E5RB 3L7EA 4ETQB 1SBSL 4K3DL 3FT1A 4PG2A 3OKDA 4JFYB 2QZQA 4UT9H 4HALA 1T03H 1UA6L 5CSBA 4QHUB 1R3IH 4X0NA 3MUGA 1RK7A 3H9HB 4BUQA 1KN2L 2ZX9A 4MXWH 3B2VH 2ICES 3M88A 2LFGA 3QO0B 1J9QA 5BJTA 5CEZD 2ZXGA 4LCVA 1HE8A 3G5YB 5LCVA 3QORB 1S7VA 4CRPA 1NTDA 3QDGA 1XSJA 3IJHB 2XSKA 1DBBL 2VITB 3I2CL 3S34H 4ZD3H 2VCOA 4GAAA 5LBGA 2WJ5A 2E8ZA 4S1RL 4BQ8A 3W5MA 4LCCB 3MLVL 4FZ8H 2YPKA 1BZQK 4CKQA 3UFIA 4Y5YC 4OZHF 1ANUA 2JCCA 4OI7A 1UACH 1WSST 1I85A 3D9AL 4GG8A 4M5YL 1CYXA 4L8CA 7CGTA 1CQYA 2ZOLA 2PW2A 4KNQA 1B4RA 1CGSH 2E7MA 1ID5I 1TEGA 4EOWL 2KPNA 5J6HB 4F8PA 2Q8BH 1MRCL 5EZOL 4B9IA 4RQQA 1ASQA 4XNYL 4DW2L 2FSEA 3TU6A 1UM4L 3CU7A 3VW3H 5C08A 1EAJA 3CXDH 4FG2A 4A39A 2ODIA 4PJXF 2HN7A 1YN6B 3CFKA 2ZWYA 1AXIB 1R3KA 3NCFB 4Y1TA 1IILE 1YEIL 5D7LA 1F2XK 2DKSA 3C09B 4NNYA 1GGTA 4GQ9H 3T8VA 4WO0A 2B9BA 2WCGA 3FQUA 4ZDHB 4PBXA 4HSQA 4WJG3 1MFEL 1WEJL 4I3RL 4M7LH 3N41F 1L6PA 1Z1WA 1PKQA 1U95B 2YK1H 3NESA 4QRTB 2CR3A 3O9WC 3O2VH 1YEHL 3AG3B 3GTNA 2JTYA 5EWIL 1N3NB 2R29L 3GS4A 3HB3D 4JCMA 2BIPA 3S35X 2IPKB 4TNFA 2DJ4A 3VMNA 3WY2A 3GI9L 1NUGA 3ECUA 1SJEB 4MVBC 4ZZKA 1XH3B 3BP5B 3P2BA 2GTZA 4Z7OF 5I8CA 4NJ9L 5IVXB 2WQ8A 4J4PA 1QMUA 1MI5E 3FJTA 4XNXL 5IFHH 2DQGH 3AT8A 2CHDA 3AAZA 3OKNB 3MUUA 1RU9H 4H20L 1IBFA 1WWWX 5DEGB 2IVFC 2F1EA 1NCWH 3LH2L 3RWIA 2P26A 3WS6C 3MLZH 3MRJA 4R2GB 4QXTA 3VWKA 5I75C 2O6PA 3L2LA 3PPEA 3GBML 1Q0EA 1BLIA 4AV0A 5F21B 5JQ6L 1QFWM 1A3LH 2VMDA 4MD4B 1U8QB 1IAOB 4RGND 3TEUA 3W81A 1GGUA 3F84A 2YD8A 1KOAA 3BSZA 4YSDA 4I2XE 4E41A 1BV8A 3UPAA 4XP1L 3WL9B 2WWOA 3CJJA 1ORSA 1QSEA 1XCWA 5AOIA 1SRDA 2PTTA 5IFAL 3BPCB 4I5BB 1OGTA 2W80C 2Z65C 2B5IC 4FTVA 5KVFE 1CTOA 2GW5A 4LEBA 4WJ5B 3RURA 3PWLA 3H9SD 5GZNA 1B9ZA 3BW9A 4AEIH 4MWFA 4S11A 2W65A 3TX4A 4ZMLA 1KJVB 3EH2A 2J6EL 2D7TL 1LO0H 3STZB 1A5FL 2NNAB 2GT9B 2YD2A 3DXAD 5CWSA 4LF3A 1KIRB 1W0WA 2PW1B 1JZDC 5IT2L 2IQAA 4EN2A 5IV2B 5JHLH 4U1MA 2M2DA 4IU2B 4BZ2L 4Z23A 3UZEC 4M4PA 1JZ7A 2EDNA 3N1MC 4YSAA 1NIFA 3HE6D 1LQSR 4C4BA 2XC8A 4P2CG 5CHNA 4BKLB 5F3HA 2JJVA 1WA2X 35C8L 5GRUL 4BK5C 1RZKH 2EC9T 5ABDE 3QXTA 5I74C 4DP9X 4J3XA 2XZQL 5EO0B 4UIMA 3U2IA 1JV5B 3MDJA 1M7UA 1DYZA 4HF5H 1ZS2A 3AJ7A 1T4KA 4DQAA 4WF7A 5EF2A 3NCJH 3EOTH 4OGXL 1MRFL 3IJYA 4K7PH 4NIYE 1RPKA 5E2JA 5JYLA 3KJ4C 2VXVH 3MV8E 4NPKA 5DHXB 3D39B 4PQXA 2ADGA 3E8UH 4HH8A 3BPNB 1SXZA 2IQ9H 5G4MA 2J21A 4FFZL 3FRUB 5CSZA 4U2ZA 3FO0H 3ECVA 4JDZA 1KB9K 3U82B 4HHAA 2R39A 2JJSC 4YWGH 5J3HD 3FT2A 5HDBF 3EFFB 5E08H 3E9UA 2XWCA 3V4PL 4DK3A 3T6WA 1CB4A 4P3DB 4L3AA 1FL6B 2Q87A 5FECB 1UCBL 3MFFA 1E43A 2R51A 4L9LB 5TDOB 4J5VA 1T04B 4W9ZA 2EXSA 4YVNA 4IRJD 4PRBB 4YJZL 5JW5B 2VR9A 2FJGA 4WI8A 3LEYL 1T0MB 1SJXA 3HNVL 2CE6A 4V33A 1H9VA 2GY5A 2HRPH 2EYTB 4GI6A 3ZTJG 2MNUA 4WFHE 5I28A 3BQUA 3O0RL 2ZAGA 4OM1L 5FOBA 1QUNB 4PY8J 4PJ8C 5C8JB 2YSSA 1BQHG 4Z7WF 3P77B 4MA7H 3IGFA 5JXED 1KEMH 1JBJA 3T0EE 3GMQB 5CIPA 1MCCA 3NJNA 3DK0A 2VSKB 2FDBP 3HG2A 5MENE 1IM3B 3ARGD 5DO2D 1OVZA 3S5LG 1CXIA 5ID0B 4LE8A 3UTTA 3LS5H 4OFDA 5EUOF 4HCFA 2ERJC 3SGEI 1EEYA 4N25A 3PDDA 1P7QB 1J5OH 2V8MA 3O6KL 4FZEH 5C07B 2CJSA 3AU1A 2YO3A 4NCC2 8PAZA 3G6DH 4I48B 4JUSA 2CKBL 4OIAA 4W9CC 1NCBL 1QQDB 3JXAA 4Y4HC 1J1OH 1XF5B 4LRNH 2A77L 3A3YB 3AGVA 4DVBA 3DV4B 2W0PA 2AMGA 4O9HL 1AHWC 4KK6C 2EVJA 3C6SB 3IETA 3OXRA 2NY6C 4TOYL 2FGWL 5D2LF 5GJTH 2B3IA 5ILTL 1MLCA 1MVYA 1GZQB 2CLVB 4GRLB 3S35L 4P3CL 4Z18A 4AOFA 4ZFOL 2VR6A 4J3OH 2OJZH 2Y6SC 4QMEA 3N50A 2XWRA 3GT6A 1VKXA 5GZOC 3AG1B 5EBMA 5CEYB 1A4JA 4Y19D 1ROCA 3LKSB 2WTRA 3NIFB 2ZG1A 4MLSA 4PSRA 4WI4A 3FFCB 4PRHA 1VF5C 2X12A 3X13B 1PZBA 4IHOB 1PYWA 3DX0A 1K8IA 4JFQA 4Y1AD 4NNXB 3CC1A 3CMGA 3UJIH 5C0CE 1NMBH 1INDH 3HUJA 3CFTA 3UG5A 5B1BB 3MTRA 2CIIA 4XTRC 3ARUA 4PH8A 4OD2B 1MCQA 3C2SA 2B08A 2XX0A 1JHTB 3G6JE 1F4AA 3BC9A 2R7EA 5T1LB 5J5EA 1X5IA 3QEQB 4YDKH 1FZJB 3JWDC 4QRSB 4XXCA 5E2WH 2VZVA 1KGCE 3I9GL 5L2KE 3QR0A 1Z5YD 3QFJA 3LRSA 1ASPA 4JVUA 4NJAH 4JM2A 4BFIB 4QIRA 1WA1X 2CXKA 4JQXA 2WP3O 3PUUA 1B0GA 2GCYA 2VQUA 1J8SA 1P4LA 3QCVL 4DGYL 4YBLB 3SE9L 1W8OA 4N0UB 4X6CB 2EDRA 3P0YL 5TD4A 3RWCA 2CGRH 1XF2B 1A9EB 2CPCA 3D4GA 1CGVA 4RFOH 1UXSA 3RIAK 4KVCH 1DEEB 5AB9A 2PPAA 1Q72L 4K8RL 4ECNA 4LAQH 1CD8A 3EDEA 5J7CC 3VI4E 5TH2B 3VFVA 4PTTB 3MSPA 4X4XB 4X4YB 2QQKH 3FMGH 1H5BB 4ZTEA 2O26U 3W56A 5BS0B 3HCVB 1E5YA 4PEEA 2I26N 4NRZA 2PCFA 4Y8AA 1SYSA 3N04A 1R33A 4KK8C 1L3WA 5KW9H 3DUUA 4PJ7F 4QF1A 5DUML 1CDIA 3HE7D 4ODWB 2DWDB 5F88A 2N4IA 5GJSH 2X6VA 4QOKE 4Z3FA 4GXVH 1KSRA 4OCXL 5EA0H 3ZZ1A 3QUML 3O6LL 4OGZA 4QRPD 3O81A 4NQCD 4IKLA 5CP7B 3P4OB 1CD9B 4UBDC 1P0SE 2VE6B 3MXVH 4NQDD 4OUUA 4D8PA 4CUCA 3VFRA 3LQAL 1IGYA 4UQ2A 4DQOH 1HQRA 3QG7L 4Z7QB 4OM0H 1TQCB 2LLLA 3FFDB 4KITB 2R2BB 5D7JD 1MPAH 1J1PH 1U8PB 3HZ3A 4OSUL 2JKSA 2C5DC 5LBVA 4F37F 4QTFA 1YJDH 1JHLL 5ACZA 1I1AD 3B2UD 3SPIA 4KKAD 4MMYA 2N7SA 3LZRA 4FYTA 1P6AB 1OF2A 3DVIA 2CNZA 4E42B 2KT6A 3LMJH 2YPLE 1AFVH 1XIWB 4N2FA 3S3CB 4DN3H 2VDQL 3NSDA 4CA4A 3FB6A 3GRWL 5B1AB 2QPEB 5BZWB 3QULB 1S7SB 3UADA 2HT3C 3TC9A 1T6VN 4NQEB 2YZ8A 3APMA 4GXUM 3REVB 3CK0L 1JGLL 2VWEE 2Z0UA 4Y4FB 2DTSA 1R5WB 5AVWB 4NC1E 2F1AA 1TPXC 1V7MH 4B9FA 3BZFA 3CLEL 1DVFD 3FF7A 2C9XA 3CIAA 3I02A 4ZAKD 2VABB 4DK5A 3X14A 2BNRB 3BLKA 4ZMZA 3S4SG 1XGRB 1YC7A 2J4WL 3LD8C 4PN6A 5IMMB 2EDEA 5D4JA 3RILA 4EDXA 3PWNB 1S78D 3C60B 4N87A 1EJ8A 4L3CA 1ODUA 3GF8A 3FQXB 3W11D 5JW4N 2OL3A 1WAPA 3TURA 4YHOH 2PPCA 1OAYL 4OLWH 4JBSA 1OAXL 4AE1A 5IJVB 4NX0A 5DVPA 2FEEL 3EKCA 2OK0H 4NKDA 3HEIB 3EW3B 3B34A 5J56B 1TTAA 2XA8L 1DQLL 2WWKO 3WN5C 1Z0NA 5ESVA 5IMOB 1MJJA 4HXAL 1D9KC 1G6RA 4WI7A 2FX9H 3CDYA 2ZP9A 2VQ1A 3WO3B 4X6DF 5I24A 3V52L 4R7XA 4LDCA 5F71A 1BG1A 3S97C 1U2CA 2BHFA 4QRRE 3X12A 3GMLB 4M8RA 3WKML 4IIQB 2HUHA 1CFBA 2F08A 2Z6FA 3OR6B 2PO6A 1QBML 1Z2KA 2GIMA 5CUSL 4F8OA 2HRGA 4DPAX 1WZ1L 4X5XA 4Q97A 3OKOB 4X4ME 5DEZA 5D1QB 4LLUA 3MTXA 3FSAA 4HIXL 1TLKA 3TO4B 4HCGA 1D2PA 3D3VA 3KNBA 4LKCA 1M57B 1NGQH 4LMQI 4YHLL 5I73C 4HG4J 1KZQA 4F7PB 3VWJB 2X7LB 1JRHH 5E94B 2P8MB 4G42A 3HVNA 5INCB 2WXGA 4Q7DA 3ZZLA 1JRHI 2AI0L 5EU7E 1E67A 2GVYA 1WFMA 4ZQKA 1V55B 3FB7B 4X98A 5GGRA 5AYUL 3O3DA 5CLXA 3J7HA 3T4AC 3TWCH 3FT4A 3BAKA 3EHBB 3SGKA 2DIEA 3X3GH 1WBXB 3UYRH 3ARDB 4BGLA 1FNSH 5E9DE 3MRLA 4OJFL 1ZEAL 4BCZA 1MJUL 4RFNB 4XN1A 4YSEA 1QZ1A 4J3VA 1MWOA 1UWEL 5EU5A 1TUPA 4YN3A 5J1AA 1NDGB 4D94A 4YDVB 2R8SL 5EPMB 4L3EE 3V5KA 1A7QL 1KXQE 3MRBA 2CJ3A 2DH2A 4WTZG 1RUAH 1XGYL 3T77A 4UNVA 4OCYH 3HBGA 3KWXA 2NUTA 4MQXD 3TIEA 2WMPA 2HCZX 1L9TA 3LVTA 4NQXB 4J39A 2CO2A 1M7DA 4NXKA 3CFCH 3GMRB 3HMWL 3O6ML 5BUGA 5BXFA 5JDSB 5F2FA 4YGVB 3B2PA 5JPNC 1Z9OA 5CLTA 4FNPA 1BSIA 3RNQA 3KJ6L 2YAQA 2NUPB 4N6RB 3H2WA 1C5CH 4CBPA 5I1LA 1VZIA 2FR4B 2KZBA 5E7BA 1D6VL 5KSVA 1KCUL 4YIQA 2VN4A 3FU6A 5GRZA 4M6MH 4GYBA 2XBDA 1XZ0A 2BDNL 1SM3L 1TZHB 4AMXA 3X2QB 5JUEH 2F8IA 4WK4B 4GW4B 5A43C 3NSCA 1UC6A 1I8LC 3LPPA 2MQCA 4ZMYA 3DUSB 3Q3GA 1ETB1 4QRBA 1YPZB 1NBCA 4NQUA 1U8IA 5DJ6A 5KJRH 3RBSA 2E9IA 2LOEA 3QQ4A 4OQTL 5IHUH 4RNRB 5CJXC 2PYEA 2L3BA 4PS3A 1U8CA 4TLKA 4WCYH 5E9AA 4JFEA 1OXYA 4HGWB 3ZKMC 1BIIA 4NT6A 1YNKH 4RAVA 4AKQA 4FD0A 3SDAA 3K8LA 2RCSL 1RHHB 4FKKA 4FKHA 1HIML 4ZO9A 1AR2A 1BMZA 1NIDA 15C8L 1D7DA 1HZHL 2WINB 2R23A 5HI3D 1QABA 5BZDB 1MCPH 1FDLL 3ZHDA 1XSKA 4AL8C 4ONFH 4BQ9A 1HQ4A 2ZCKH 2X87A 4RH4A 5TQ2L 3SDCC 2G9KA 1RZ8A 1B2YA 5JOEA 1IVLA 2ZXBA 3LZNA 1N7ML 1WAAE 2V7HA 3L3JA 4PM1A 1KCSH 2D9CA 5EN2A 2ZUSA 4MGXA 4R26H 1QLRB 5MI0B 4YBQC 1J87A 1XF4B 2XFXA 3IDJA 2ZX5A 5HGGS 1JGDB 1K8DB 1RP8A 5EMYA 1G5AA 3BO8B 3LRHA 2VDLH 1N59A 1WT5A 3QT2A 3QH3B 1HAUA 1A6PA 2BZ7A 3ME0B 2XWTB 2HJFB 3C6LD 3NPSB 1R47A 4NN5C 5F1SA 1RZ7L 1FLRL 1UD5A 3KPRD 3K4DA 3BVXA 3DOSA 3WDHA 5HVHB 3HPLB 4Y4KA 4Y2DD 1GS7A 3FCSB 4FLOA 3NJJA 4NM4H 3WY3A 3B2DC 3GSWA 1IM9D 4FXTA 4X6BB 3ZO9A 4LVOC 4HD9A 3Q5TA 1NOAA 3SKJL 4XVSL 4LESA 1E5UI 3KLAB 2UV3A 3QORA 2QADC 5LQBH 3VXUE 1V7NL 2VITA 3NPZB 5H2BA 2XWBA 5FUOH 3DO7B 2Q7NA 3L7FB 4ZMPA 3KCPB 3CPUA 4N1EA 4AYGA 4TUUA 4WSKA 2J8UF 1H3GA 4LCCA 1XBDA 4J12A 1E4WH 3G04B 1NBYB 2UVEA 5HHQB 3T4YB 5MHSE 2JNZA 4G80B 2DLGA 2EYRB 2ITDA 4PB0L 5D1ZI 1UD4A 1CVSC 3DROB 4CC4A 4U6XB 1N0LA 3IFLL 4OBSA 4LOVA 1THAA 2KQNA 2AANA 5C0DB 2V2WA 1JWUA 1HYRC 2F1BA 2EEFA 1VGEH 4HYTB 5KYWA 3P9LB 4FQCL 4H0IA 2PWDA 3GKWL 4ODTH 1EXUA 5I0ZA 4S0SD 1EBAA 2L4OA 1ZLEA 2V5TA 4A7GA 4UM9A 4JFTA 1NSNH 5L7XH 2CRMA 4Z7NF 4ENED 4IDJL 3S3PA 4L4VD 3PL6D 1L7IL 3ECQA 5D4IA 4W93A 1F0LA 4TNWF 3G6AB 5DQDL 1U95A 4AYEC 4HAGA 4UILH 1NINA 3IK2A 5AVTB 2EVHA 3HG5A 2IAMD 4WW2F 4XPBH 2BWQA 3KPPA 5ANHA 4G72B 4HV8A 5C3TA 4IBZA 5AALA 3QUXA 2PNDA 4EDWL 5A7BA 5KVMC 4P2OD 1GJUA 3BP5A 1UB6A 3NZHH 3SQRA 5AZ2L 4DP2X 4MAUH 1JGUL 3VFGH 1F4HA 3ZTNL 4K73A 5DMGD 2ZXWB 4HH9A 4RIRA 1XB8A 2XQ0A 4G6JH 4WNSA 2MTAA 3D18B 3EG9A 1E28B 2LHAA 5KN5B 2Y7NA 1TJHL 1ETZB 1AQDA 4XNMB 4EO5A 2L0DA 4UNIA 3TZVC 5HYEA 4J3OD 3TJHD 3K74B 5HHVH 1XTLA 2XTJD 5IQ7H 2OYMA 4NGHL 1ZHNB 4UI2A 5IBTH 3LQZB 4NN6B 2WUBH 3UBHA 3CLFH 5I76B 3GLAA 3ZDXE 3ALWA 1FGVL 2AEQL 4MD0A 4UNTA 3ZYOA 1BCIA 4UTCA 4TVUA 4XXDA 5IF0B 1S9VA 5DD0L 2YC1B 2Z91A 4Q2ZB 3WTSA 4HOZA 1IAOA 4Y2LA 5EFIB 5FO9A 3RDJA 1WTLA 4MLIA 2LR4A 2OMYB 3L9EA 3DTUB 5JHDD 4JRYD 3UIYA 4BELD 2VTFA 2FLBT 4WFEE 5DDHA 4GRMB 4OJDH 4X80H 1YMMB 2D03H 2H2PD 4KH9A 3QJFA 1YYMH 3IDXL 4CADB 1JK8B 3T71A 3BPCA 3JWDH 3L4VA 1F13A 4AQAB 1KV7A 3MCLH 1GSKA 1UKSA 1F6FB 1D5IL 5HYQA 5L6YL 2Z34A 3U6RB 1YDPB 1NANH 4KI5C 2ZE0A 4XPHL 4L8BA 3JUZA 1KJVA 5IWLC 5F44A 3T9WA 3STZA 4ESKA 4RZCB 2NR6A 3BN9C 3SJVA 1U3YA 2E7LA 1KIRA 2QGEA 4UQ3B 1UM6L 2V9RA 4H5SA 5DFWH 2ADFL 5JIIA 3QHFL 1CQKA 5IV2A 4ZOAA 1UCTA 5DQ9B 4HUMB 3RFZC 2HRLA 3A47A 4MD5A 1KUMA 3FQ1A 1DLFL 3QXUA 2DY2A 4PJHB 4WSJA 1O6TA 3CZKA 1CIUA 1NKGA 4BKLA 4XBGA 1KACB 1WDAA 2ARWA 4M8QB 4ZUTB 4M7ZB 1CT8A 4GUPB 1F56A 3ARBD 4PS4H 2COQA 4LO9A 5FAAA 4GKOA 2YOAA 4Q9RL 1M2VB 3FTSA 1ESOA 5FWQA 5C0IB 1DQTA 1MI5A 2XY1A 3ZQXA 1I9RH 1DO6A 1T7ZA 4KXZH 4YLBA 5DVMA 5IGXH 1MCEA 2DJMA 2Z8SA 4IQHA 4ZUUB 1RY7B 4LCIH 1EZUA 4KXZI 4XB7A 3F12B 4FFVD 4OZGE 2NRDA 4P48A 2E4FA 1KJ2B 3HBQA 3LVEA 3O8XC 3RGVC 5T3ZE 1DE4B 2X4PB 4PRPB 4IKKA 2E6PA 3AB0B 3FRUA 2GJZB 3QZLA 1NCOA 3KWWB 2GUOB 3B37A 5FCUH 2FQGA 3FUMA 1PS3A 4DP5X 1A8ZA 2E56A 2FEDC 1CFNB 5DA0B 4P3DA 1A0QL 4WV1B 1FL6A 1FYTE 1PZ5B 5I19L 3FO1B 3QK0A 4I2XA 4RRPM 4L9LA 3ESPA 5JW5A 3TCTA 1JTTA 4EN3C 5J13B 1A7PL 1OHQA 4POZD 2K6WA 2O5XL 1FO0B 2DD8L 4QR7A 3R18A 3KHOA 1V3KA 5AW8B 3KYAA 3GO1H 1HKFA 5D1XD 2MCPH 2HKFH 2X2IA 5GGVY 2BSTA 2CD0A 3MLXL 1QUNA 1CG9B 2BXYA 3JV6A 5C8JA 2QQLH 2YR3A 4YUEH 4KTEH 1ZLSH 1E9QB 2YAPA 3PU7A 5ADPL 3NRPA 2DDQH 3QI9B 3T2NH 1I7UB 4KU1A 3PQYE 3V4PB 2YQBA 5IFJA 3VGGA 1P4IL 4KH2A 1BD2E 1AG0A 2CLZA 4FNUA 1KB3A 4WNJA 1MVUA 2Q0ZX 3E6FA 4U1JA 5HHPB 4X5WB 3VFUA 5ID0A 4Z1PA 2XV2A 3W9EA 4NSKA 2APVA 2F8OA 1N5AA 3LNDA 1B4JH 3HKZA 2EDMA 5LAXA 5CEZL 3BUDA 1MIMH 4EI0A 1ZLDA 3UP6A 3LKOB 4QRQB 1JD7A 3ULVC 4KKBC 4KV5E 3NJKA 2VUYA 1DJGA 3VO0A 3MJ9H 3DPBB 1NFIA 5GS0C 1CXHA 3P02A 4GEIA 2C9QA 3BAWA 3C6SA 3MROB 4QYOB 2KUTA 3PV6A 4XHQA 1CO1A 1T5KA 1GGIH 3SBWA 4EZMA 4P46B 3G5WA 3QJZA 3PE9A 3A4FA 2HFTA 2LAAA 4DO4A 2GSMB 1Q0YL 3MV8A 3CTTA 1RIVH 2OR7A 4GRWE 3TN0D 3ZSSA 2CWRA 4BBWA 4GRLA 4DKEH 1VERA 3NIDB 4YC2B 3I6LD 1G6RH 1MREL 4G9FB 4AM0B 1NGZB 2EE0A 1N8OE 2E7DA 1F4WL 1B2WL 5IZ7A 3LH8A 1AP2B 1KLFB 1PG7H 3X13A 4NZRL 5ERWA 5F7FA 4Z3TA 1Q9OB 2CKNA 2DB8A 3SIKA 4XMVA 4NNXA 2A9DA 3MHZA 4LHQB 4Z3IA 3RVVD 3ZDZF 1M1XB 2FATL 4OZFB 3QDGD 2X4QA 3NFSH 1OAQH 4HCRH 2V4LA 3T0EC 4K3JH 2NY3D 4K9EL 3QXDB 1OTUC 2ORBH 1JHTA 1TQTA 4GB9A 1J8KA 1NFDE 1H8NA 2J1XA 4AZUA 4JFWA 4UTBL 1MXDA 2DLEA 1I7RB 3CCHA 4YLQT 3VXRD 3NZSA 4OCWL 1XMWA 4NQVB 1JPGB 1GHFH 3RPIB 3RTLA 1NCCH 2DYSB 3CX2A 2NY1D 3VXPB 3IBEA 3W39A 1HVXA 1NIAA 2NY2B 5KBDA 4XN9A 5MENA 1MNNA 1T22B 3KLLA 3Q44A 1KGXA 2W59A 3T5WA 1CK0L 3N1GC 1W72B 5AW1B 4AXWB 1HT6A 5IB5B 1EO8H 5C2UB 1YECL 1F6AB 4L2LA 4FKEA 4UINL 4OGYL 2AJYH 2FX8H 3L3OC 5I2IA 4QXUL 5D7LD 1J86A 1A6WL 5HYJB 2R69L 4P57A 4PTTA 1DDTA 3NACH 3UX9B 4X4YA 2P5EB 3UAFA 4GAJH 4WO4B 3L1OL 4O58H 4G8GD 3GDCA 5LG1A 1B88A 3VSQA 4LLWB 3A4DA 2FVNA 4OUOA 2DQJL 5D2NB 4MS6A 4A6YB 2OX5A 1JZ5A 3VD5A 1KIUA 2CG9X 3TNMB 3GSUB 2Y36H 4YHPA 4UTAA 1EPFA 3EOAB 2LU5A 5G4NA 2AQ1A 1YEEH 1CGYA 4J4PD 3RUGB 5A2KH 1P5UA 4DH2A 2EC9U 3P11H 2XBTA 4U6HB 3DVGB 2CBPA 5E8DL 5AG8A 2M1KA 1AJ7L 1TTBA 2KPWA 2VDOB 1MFCH 5GS1C 1GOFA 3D69B 3RU8H 4WTXA 5JORA 4AVIA 5C0CA 1IE4A 2AK4D 5LWYL 4XP9L 2VXTH 1F45A 1IEBB 1TFHA 5EG6C 3WJJC 1T1WA 1KBGL 3VWKD 1NC4B 3BJLA 2IANE 5HD8D 5KSUA 4IRSA 1NPNA 3DSFH 5DLMH 1ZK5A 3KYKL 1V5JA 4JL1A 4RDQG 2FT8A 3H56A 2P28B 3KAAA 3L9YA 4B9ZA 4HUWB 3SDXF 5BV7C 2BOCB 1FL3B 2IFGA 2OTPA 1UZ6F 2PR4L 2ZKXA 2VJ8A 3IVKA 5GSVA 3AITA 1A4KB 2EIDA 1KGUA 2UZIL 5IROA 3KVQA 3WO4B 1QSED 1ZPUA 1IKOP 3CFNA 3E2HB 6PAZA 1S9WA 2DQDH 3RZCC 3QULA 3E8VA 1S7SA 4FTVD 1UH3A 4NQEA 3IPBA 3REVA 1S5IL 1IAKA 3LKQA 2Y25A 3GIZH 3PIQB 3ROLB 4A2MA 4P23A 4KQ4H 5BZZA 3P0GB 2YJQA 4XXWA 1R5WA 1D5MB 1UFUA 1U2HA 5DJXB 3MV7E 4O2CB 3W0WA 4DUXA 3HFMH 1IGJA 5K9QG 2HJLB 2R1WA 3VG0H 3RG1C 5IB1B 2HT2D 3K0WA 2VDQB 3BIBX 5D7HA 1G94A 1BJ8A 3BEVB 1FCGA 1LQBC 2AHIA 2W8CA 5EOCL 1HE7A 2F53A 2SEBB 3C60A 1QD0A 2CDFB 3QC6X 4Y5VB 3OKEB 3V5DB 1WA0X 1XWVA 4IOIB 4TQIA 4FABL 2VL5B 3GS0A 3IBOA 3CG8A 1L6XA 5IJVA 3TJPA 4Y0GA 4LZKA 2VW4A 4ZS7L 4JZJC 3G08B 3RWHB 4W81A 2EVGA 4P4KB 5LVEA 2CO6B 2WIMA 4N5UA 3GSVA 2C3HA 4HD5A 3QQNA 4XCEB 1E5BA 3WS3B 2FJHB 1OOAA 5EEZA 1XL4A 2GKIA 1URLA 4IHBA 1NAKL 5IB4A 2F5BH 3DX9A 1FA4A 4CJ1A 1PAMA 4FI7A 4FA6A 3GMLA 1ICTA 2RQEA 2X4TB 1T6BX 4Q6KA 2YGQA 5HHMB 1G7HB 4PWHA 1R17A 5GHWH 3WD5H 3QO1A 2WBJB 4DT2A 3RDTA 3OKOA 5FUZL 1IKNC 4PJFE 5CO1A 4JPWL 3QJUB 3MGAA 5IM7A 2YD4A 1M05B 4XNZB 3U4EA 4AJYV 1KYOJ 3LNIA 1TCMA 3ZL1A 4F7PA 2X7LA 5E94A 3UTSB 2XWJA 3K8MA 3L1FA 1P1VA 3IU4L 3EGDB 3PWJB 1E8ZA 3I75B 5HHXL 3MJ8B 1SEQH 1ZS8B 4WWPA 2H3XC 3DDGA 5E6RB 3KPMA 3AREC 3IDMB 4WSGA 2J6WA 2IH1B 1AZBA 4MNQB 1KV3A 5DR5H 4L8SB 5AAWA 2YD1A 1GYVA 2NY7H 3US1A 3LB6C 2J2ZA 1E30A 2NXZB 3AQYA 4J2QA 1WBXA 4CMHB 4MSWA 4J8QA 1GSMA 5DMIL 1IIKA 4PJ8D 1CL7H 1O5PA 1ZANH 1IGTB 2OP4L 5L88H 2C34A 4D0DA 1VFBA 2VSMB 4MNGB 5AQ0A 2TAAA 1JPSL 1UD3A 3FTXA 1T3FB 1W6WA 3GXDA 1QRNB 4FQJH 1ORQA 1FFNA 2H2SD 1DJXA 3B2XA 1P2CB 2UX7A 1BP3B 1A7OL 3QRBA 3FNKA 4JM4L 3ZZSA 2ITCA 4APQC 3OJDB 3MRHA 1RIHL 1KBPA 2BVQB 5GGUA 2KL6A 3ZYIA 3WFBH 5JXAL 4GKZA 4IRZA 2HWZH 2EICA 2XI9A 4MDRA 1QEWA 2BWDA 4Y4HD 4NQXA 4D0CB 3RJOA 4Z95L 4XVUD 3K72B 2XACC 3K71A 3S8WA 5JDSA 1ZTXL 5DS8B 4G7VH 4KAQH 1SLWA 3GRBA 4KK6D 4PJCE 1HL8A 1YYLL 4XCFH 4YGVA 2NY6D 1OAUL 2NUPA 1MW3A 1ZWIB 3VE0B 2EDBA 2EE9A 5K9JH 2EVIA 2FR4A 1DBJL 4DIXA 4M7KL 3RY6C 1S7WB 1Y0LA 5EU7C 1RV6X 4IBYA 4Q4IA 3PXJA 3K6DA 2VYRE 3LEXB 3LRLA 4QHMA 2Z35B 4WKZB 1TZHA 3HZMB 4X4MA 4I9XA 1U8NB 2CBTA 5GZOD 2DN7A 2H1PL 3LYRA 1Y7VA 1OP5H 2OR9L 3CGTA 1SHXA 3OMIB 2K6ZA 3SZKC 4FHJA 1FIEA 2NTFA 4LAJH 5TK2A 1X9UA 2E6QA 5FYKE 4PGZA 5J1TC 1YPZA 3DBSA 3E80A 3MV9B 5IVXE 3S36H 3EYVB 5CZVL 1WHPA 4JM2D 2DL2A 3VFTA 1CDHA 4QHKJ 4XTRD 5KEZA 4XZUA 4LSUH 2P9RA 2YEZB 3V0JA 4BWTA 4EI5A 3FQNA 4QUOA 4YHNB 1F58L 4NPYB 4Y9BA 1LEGB 1OY3B 3H2QA 1CXKA 3MLSH 5K59F 3POCA 2G9HB 1SOSA 1S3RA 4MXQD 2OBGA 2FX7H 2DTML 3LN9A 1I1FB 1YEJH 4HW6A 4XOAA 1W0VB 1MHEB 1TSRA 4YSPA 2AV1A 4ICWA 4NZDA 4JLRA 1CBVL 4OZHE 1CLOL 5DD1L 3OF6D 3QA3B 4H8WL 3SZ6A 2YGNA 32C2A 2C3XA 2RFXB 2VLRE 1K4DA 2JQZA 3NRFA 2DJSA 1QLRA 1UXWA 4OLYL 1G7PA 3Q13A 4EQ2A 5B38B 3OG4B 1SN0A 3TBCA 2CCVA 1DJIA 1KENH 2WQAA 4JG1H 1CPUA 2A6KB 4PJXE 2I5YL 3WJMB 3GI8H 4KK8D 2NY5C 3ME0A 1A6UL 4BZYA 4PPTA 1DQDL 3RP1A 2H3NA 5ANMA 2JB6B 5DTFB 2BVYA 3FCSA 4ANKA 1FIGH 3L6FA 4X6BA 3QYMA 5K9KA 2CM5A 4DUVA 1INQB 4A2DA 3N1QC 4TQHA 3FONB 3ZHKA 4LU5H 3KLAA 4P59H 3SE8H 1X5GA 5F7EL 1AQ8A 3DX8B 1AGBB 1OSPL 3SOBL 3BAIA 1G1CA 2BLFA 3BH9A 5GGSY 3TPUA 4UBDD 4Z7OE 1GXEA 3CN4A 4KUCD 1L9OA 4DPCX 5KVFH 3RAJH 3K3QA 4OZ4B 1WS7A 2W07B 3LEVH 1IAIL 1EJ6A 1SDYA 2EYRA 2APXA 2LQRA 2BNUA 3F85A 4HGMA 5CFHA 1G7QA 4F7CB 1CDUA 3DROA 3OHXB 4FQ2L 4IEFB 1I9JL 2YD5A 4MASA 3TONA 4ABQA 1G1KA 4UT6A 3RWJB 1YNTB 4AGOA 1R3LB 1B0RA 2I27N 1IVTA 4HIJB 3F65A 4I18C 1F5WA 4K7PX 4FJZA 3EZJB 4WHYG 3R7QA 5LGYA 4TQPA 5LDSA 2XV3A 1ET8A 1PSKH 3HHMA 1S7QB 3CXHK 2JLPA 4LASH 3AMKA 2DYPB 2EKJA 3TIDA 1KLGA 4P5TB 4L8DB 4HXBH 2DMGA 2X0UA 3NH7H 3UZQA 1CC3A 1EAPB 5GZNC 3DMMC 3MJGX 5DVKA 4KK5C 2EVFA 4NQQA 5AW6B 4A7UA 3QUGA 4LFHG 4UT9L 1JYXA 3BUPA 1FPTH 5G4OA 1JL8A 4CAGA 3FXIC 3QEGL 3B4NA 3B2VL 4AE0A 4D0BB 3WXWH 2QL1A 1D5BB 1TZ8A 3CMOL 4OGQC 5CBEA 3S34L 5IEKA 2XPGA 2K8MA 1HDMA 1O7DE 2OA9A 4ELKA 3BZ4B 3QE5A 2GI0A 4MJIB 2PABA 2AGJH 1C5BL 4A7TA 4BWWA 1MCOL 5IUSA 1KEGH 4FZ8L 5GS0H 2WHVA 3A21A 1X6NA 4ZSOB 4YXKL 4KC3B 2DLTA 1U3ZA 2WIIA 3PNWB 3B83A 1FNAA 5A2IH 2CBMA 5BOJA 5KN5A 3ES6B 1FP5A 5E6IB 1CGSL 1TQVA 5C9JA 1THCA 3KVPA 1W9XA 1ZPLA 4WI0A 4I87A 3VXUA 5C07E 4QHLA 4B41A 3LQZA 4EUPH 2DQHH 3ARQA 3B56A 5I76A 3U2SB 2C3WA 2IFFH 3NN8B 4QKTA 4E9TA 3VW3L 3LNHA 1OGAB 1CIDA 4U7SA 3OAZH 3V7AE 3BFOA 5FA4B 4H8UA 1DUYB 1TTFA 1BJMA 2YC1A 4Q2ZA 3M17A 3MYZA 1PJ9A 4QY8A 1OM3H 1Q90A 2A9NL 2O30A 4NN7B 4XPGL 1ECZA 3WFZA 1X9QA 2C7UB 2HPTA 1RZFH 4KJYA 3I84A 4GRMA 1NCDH 3ARXA 2C1OB 2YK1L 1YMMA 3EJYC 4U6YB 3GSNH 2CAKA 3ARFA 1I8UA 3QJHA 2DMCA 3U7YL 2CA3A 4CADA 1JK8A 3QEHB 1DFBH 4U1GC 5DVOA 3TA4D 3U46A 5AW2B 5DQJA 1TYEB 4JQVA 5D1ZC 5C09D 2VLME 3K2KA 4EJ1C 2R0KL 2Z8VC 1T5XB 3UTPD 3L5XH 4HJJL 4XPTH 3KHQA 4AUJA 3L4ZA 1HSBA 3AS2A 4UQ3A 2DQGL 4LHUA 5TPWH 3FQ4A 3Q1SL 3HG4A 3APFA 4ZT1A 4AG4H 4PGEB 3WE1A 3ARZA 4N0CC 2BZCA 3VGAB 4KXCA 1AQMA 3JVGC 2A9CA 2D3VA 3OSKA 4ZUTA 1IAMA 4GUPA 4HLZG 4HBQA 5I8KH 2LTQC 2Z4QA 3EBAA 2BOBB 4Z7WE 3NCYP 5EEXA 3GXPA 2VH5H 1MF2H 5C0IA 3VXTA 3ALXA 1Q9LA 3CDFA 4G3YH 1KLUA 5FKPA 1Y6MR 2DW5A 5MEQA 1QNZL 1KJ2A 3QIBB 2BW4A 1O6VA 4EIZC 3WFDH 1FF5A 1BEYL 1RLWA 2X6MA 4JKPH 3DGCR 3T3PB 4HJ0C 2GJZA 3BRFA 2BVOA 1OCWL 1RERA 4I9WE 5BS0E 2QR0B 3TA3B 3ABLB 4LLMA 4XMLH 3UTZA 3ULVL 1J48A 1UENA 1YA5A 1CF1A 4TUOA 1UT2A 3VCLA 3GMPB 1JAEA 4XP6H 5D2LE 1I8IB 3SKOA 4AQ1C 4Z7IA 5EIVA 4XNUH 2DWSA 1BF8A 1FO0A 4PRNB 2BZDA 5AW7B 1BF5A 2ICWB 4C54A 3E1ZA 4AVKA 1CXFA 1CFQB 1FSKB 2BMKA 3UACA 5DJDB 4DTGH 1C16B 1MFDH 1SBBA 1YUHB 2V2XA 2MQ3A 3KWTA 5L0QC 1SQ2N 3REWA 4AQOA 1CG9A 5AVZB 2E5EA 5E8PA 1MIEL 7PCYA 2BP8B 1E9QA 4PJIB 1DANT 4HF5L 3QQ3B 4R4BB 5F1IB 3U48A 1BBDH 4N0YH 3FULA 4UQDA 4J6IA 3QHZH 2PPEA 3EOTL 4U7KA 1BQ5A 5ISZB 4X5WA 3EGXA 2EECA 1OM9A 1OP5K 4JO1L 4GLRH 1JXGA 4BZ1H 1UM5H 4KRLB 4GLRI 3BPOC 4OFPA 3FPYA 1E9OB 4G6AC 3ZKMD 2C9PA 2W88A 1WAEA 2OMZA 4KXAA 2B7DT 4H1LB 1CF8L 5IHLB 2VLKE 5F0JB 1G7LA 4BGDA 4YWGL 4TSCH 4OF3A 2P8LA 2Z31A 5AZEL 4WHCA 3FUIA 5EN3A 4G8AC 3ZUCA 3O2WH 3WIHA 2J20A 4P46A 4PIRF 4ZTOH 1DN0B 3C5ZC 4MBRA 1SFDA 3K81A 4JDTL 4HC1L 2BC4A 3SDCD 1OSYA 4TV3A 5DSCB 5F93C 3KVDD 3VRIB 1NGZA 3GYRA 2VDRL 4TYUA 4DETA 3BKYH 3S3BB 2WZAA 4YBQD 1PEWA 3QWOB 4X9YA 2IOIA 2WY3B 1T1ZB 4Y4KD 2P24A 3HS8A 1FYTA 1RULH 2G5BB 1CDBA 2Y07L 4MA7L 3MLRH 3VFNB 3HBPA 1KEML 3FUJA 4UDUA 1H3UA 1KTDA 2ZD0A 3F04A 4GS7B 4PJ7E 2B1HH 1OALA 1ZXKA 2LW3A 1ZDSA 4M8UA 2ZKHH 1MWAL 1NA8A 4RDBA 1KXHA 1S6NA 2WSKA 4N9GB 3QXDA 1M4KA 4BUHA 3S48A 4RMVA 3MBXH 2Z93B 3RQ3A 5IEHB 2GG1A 4AYBA 3SB3A 2RJMA 3F6JA 1DSWA 2WLNA 3F58L 4FZEL 1EO7A 3B7TA 4EIUA 1B0IA 4KKNA 3G6DL 1Z9SA 4NQVA 4JZOB 3MBEC 2YQGA 3QIWC 4XX1E 1WVZA 3RPIA 4TRPH 3RTQA 5K9OA 3CZNA 2QADD 5D55A 3CX5J 2H32A 3ET9F 4IGBA 3VVWA 2B1AH 3PQYA 4K5PA 4CNIA 2IBZX 3LXUX 5E2UH 4JHWH 2R9HC 4FG6C 3LRGA 2AKRB 4S1DD 1E8XA 3FUNA 1QI5A 2GJ6B 2P5WE 2GEEA 4AXWA 1W72A 2FUTA 5JHMA 4ZBJA 5F1NB 3EADA 1AANA 3MU3A 3V2AR 4J3SA 4D3CL 1F6AA 2CJUL 5AWNH 1YAIA 1A4BA 2CO4A 3INUH 4MRCA 4MTMA 4TNVF 4JFFE 2H0FA 3NK4A 4UM9D 4Z76B 2FO8A 5CJBA 5LN8A 5D5MB 2D8KA 4G43B 1E40A 3HB3B 5EHFA 1I9IH 1A7NH 4PJ9D 1X5AA 4HBCL 3SKNB 3D08A 4JFZL 5DWUH 5HDLA 5BV7L 1H6EA 4LLWA 3UOAB 2UZXB 3L2MA 5IHBA 1KFAL 5I0VA 3BDBA 3MLYL 3ELQA 4A6YA 1MFAH 3SGDI 4OZIF 1W6LA 2R2HA 3UJIL 3SYAA 3QUXD 4QLRA 3WXVH 1A3QA 2YMOA 2FD6H 1EGJH 2WB1A 4KTDH 1WICA 1OQOA 4P9HC 3WG7B 2G5RA 4ZFGH 1MEXL 4KBPA 2EUXA 4BQ6A 4GSXA 2XHNA 1KPVA 5DURB 3BEWA 1MCLA 3NCBB 4MMXC 4NKMA 3RUGA 3LIUA 4YDKL 1LP9E 4Q4EA 3IGAB 3CBKB 5E2WL 5KYUA 3DVGA 1SHMA 1E4XH 3MLUH 4R9HA 2VN3A 2JKLA 2VLJE 3D69A 1JF6A 2AXFA 4HOMA 4QXWA 3VXNB 4IU3B 2JFCA 4N1CA 5JIPA 1IEBA 3SGJC 5DHEA 4RGNB 4F58H 4XP5H 3DX6B 4YXHL 5FKAB 4RGMB 2ZAIA 4Q0XH 4B3EA 1KELH 1S7XA 5A7EA 5KJ7E 3K6SB 4KVCL 3AROA 5GSRA 5GISH 3SYCA 1OE1A 1XGZA 3SOTA 2NYKA 1QPKA 2EQDA 4YMPA